data_6Q8W
# 
_entry.id   6Q8W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.332 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6Q8W         
WWPDB D_1200012674 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB 'Submitted PDB 6I0D contains the same complex with decyl-ubiquinone bound' 6I0D unspecified 
PDB 'Submitted PDB 6I1P contains the same complex with NADH bound'             6I1P unspecified 
PDB 'Submitted PDB 6Q8O contains the same complex with Piericidin A bound'     6Q8O unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6Q8W 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Gutierrez-Fernandez, J.' 1 ?                   
'Minhas, G.S.'            2 ?                   
'Sazanov, L.A.'           3 0000-0002-0977-7989 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                4135 
_citation.page_last                 4135 
_citation.title                     'Key role of quinone in the mechanism of respiratory complex I.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-020-17957-0 
_citation.pdbx_database_id_PubMed   32811817 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Gutierrez-Fernandez, J.' 1 ?                   
primary 'Kaszuba, K.'             2 ?                   
primary 'Minhas, G.S.'            3 ?                   
primary 'Baradaran, R.'           4 ?                   
primary 'Tambalo, M.'             5 ?                   
primary 'Gallagher, D.T.'         6 ?                   
primary 'Sazanov, L.A.'           7 0000-0002-0977-7989 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   100.44 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6Q8W 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     95.980 
_cell.length_a_esd                 ? 
_cell.length_b                     340.500 
_cell.length_b_esd                 ? 
_cell.length_c                     264.270 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6Q8W 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'NADH-quinone oxidoreductase subunit 1'  48693.715 2  1.6.5.11 ? ? ? 
2  polymer     nat 'NADH-quinone oxidoreductase subunit 2'  20309.162 2  1.6.5.11 ? ? ? 
3  polymer     nat 'NADH-quinone oxidoreductase subunit 3'  86656.203 2  1.6.5.11 ? ? ? 
4  polymer     nat 'NADH-quinone oxidoreductase subunit 4'  46428.027 2  1.6.5.11 ? ? ? 
5  polymer     nat 'NADH-quinone oxidoreductase subunit 5'  23893.254 2  1.6.5.11 ? ? ? 
6  polymer     nat 'NADH-quinone oxidoreductase subunit 6'  20262.564 2  1.6.5.11 ? ? ? 
7  polymer     nat 'NADH-quinone oxidoreductase subunit 9'  20106.309 2  1.6.5.11 ? ? ? 
8  polymer     nat 'NADH-quinone oxidoreductase subunit 15' 14812.074 2  1.6.5.11 ? ? ? 
9  polymer     nat 'Uncharacterized protein'                14201.612 2  ?        ? ? ? 
10 polymer     nat 'NADH-quinone oxidoreductase subunit 7'  13154.656 2  1.6.5.11 ? ? ? 
11 polymer     nat 'NADH-quinone oxidoreductase subunit 10' 18563.330 2  1.6.5.11 ? ? ? 
12 polymer     nat 'NADH-quinone oxidoreductase subunit 11' 10002.788 2  1.6.5.11 ? ? ? 
13 polymer     nat 'NADH-quinone oxidoreductase subunit 12' 65189.930 2  1.6.5.11 ? ? ? 
14 polymer     nat 'NADH-quinone oxidoreductase subunit 13' 49247.117 2  1.6.5.11 ? ? ? 
15 polymer     nat 'NADH-quinone oxidoreductase subunit 14' 44463.895 2  1.6.5.11 ? ? ? 
16 polymer     nat 'NADH-quinone oxidoreductase subunit 8'  41034.523 2  1.6.5.11 ? ? ? 
17 non-polymer syn 'IRON/SULFUR CLUSTER'                    351.640   14 ?        ? ? ? 
18 non-polymer syn 'FLAVIN MONONUCLEOTIDE'                  456.344   2  ?        ? ? ? 
19 non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER'             175.820   4  ?        ? ? ? 
20 non-polymer syn Aureothin                                397.421   2  ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'NADH dehydrogenase I chain 1,NDH-1 subunit 1'   
2  'NADH dehydrogenase I chain 2,NDH-1 subunit 2'   
3  'NADH dehydrogenase I chain 3,NDH-1 subunit 3'   
4  'NADH dehydrogenase I chain 4,NDH-1 subunit 4'   
5  'NADH dehydrogenase I chain 5,NDH-1 subunit 5'   
6  'NADH dehydrogenase I subunit 6,NDH-1 subunit 6' 
7  'NADH dehydrogenase I subunit 9,NDH-1 subunit 9' 
8  'NADH dehydrogenase I chain 15,NDH-1 subunit 15' 
10 'NADH dehydrogenase I chain 7,NDH-1 subunit 7'   
11 'NADH dehydrogenase I chain 10,NDH-1 subunit 10' 
12 'NADH dehydrogenase I chain 11,NDH-1 subunit 11' 
13 'NADH dehydrogenase I chain 12,NDH-1 subunit 12' 
14 'NADH dehydrogenase I chain 13,NDH-1 subunit 13' 
15 'NADH dehydrogenase I chain 14,NDH-1 subunit 14' 
16 'NADH dehydrogenase I subunit 8,NDH-1 subunit 8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1,B ? 
2  'polypeptide(L)' no no 
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
2,C ? 
3  'polypeptide(L)' no no 
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
3,D ? 
4  'polypeptide(L)' no no 
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
4,E ? 
5  'polypeptide(L)' no no 
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
5,F ? 
6  'polypeptide(L)' no no 
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
6,G ? 
7  'polypeptide(L)' no no 
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
9,O ? 
8  'polypeptide(L)' no no 
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
7,I ? 
9  'polypeptide(L)' no no 
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
W,X ? 
10 'polypeptide(L)' no no 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
A,P ? 
11 'polypeptide(L)' no no 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
J,R ? 
12 'polypeptide(L)' no no 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
K,S ? 
13 'polypeptide(L)' no no 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
L,T ? 
14 'polypeptide(L)' no no 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
M,U ? 
15 'polypeptide(L)' no no 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
N,V ? 
16 'polypeptide(L)' no no 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
H,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   GLY n 
1  4   PRO n 
1  5   ILE n 
1  6   LEU n 
1  7   SER n 
1  8   GLY n 
1  9   LEU n 
1  10  ASP n 
1  11  PRO n 
1  12  ARG n 
1  13  PHE n 
1  14  GLU n 
1  15  ARG n 
1  16  THR n 
1  17  LEU n 
1  18  TYR n 
1  19  ALA n 
1  20  HIS n 
1  21  VAL n 
1  22  GLY n 
1  23  LYS n 
1  24  GLU n 
1  25  GLY n 
1  26  SER n 
1  27  TRP n 
1  28  THR n 
1  29  LEU n 
1  30  ASP n 
1  31  TYR n 
1  32  TYR n 
1  33  LEU n 
1  34  ARG n 
1  35  HIS n 
1  36  GLY n 
1  37  GLY n 
1  38  TYR n 
1  39  GLU n 
1  40  THR n 
1  41  ALA n 
1  42  LYS n 
1  43  ARG n 
1  44  VAL n 
1  45  LEU n 
1  46  LYS n 
1  47  GLU n 
1  48  LYS n 
1  49  THR n 
1  50  PRO n 
1  51  ASP n 
1  52  GLU n 
1  53  VAL n 
1  54  ILE n 
1  55  GLU n 
1  56  GLU n 
1  57  VAL n 
1  58  LYS n 
1  59  ARG n 
1  60  SER n 
1  61  GLY n 
1  62  LEU n 
1  63  ARG n 
1  64  GLY n 
1  65  ARG n 
1  66  GLY n 
1  67  GLY n 
1  68  ALA n 
1  69  GLY n 
1  70  PHE n 
1  71  PRO n 
1  72  THR n 
1  73  GLY n 
1  74  LEU n 
1  75  LYS n 
1  76  TRP n 
1  77  SER n 
1  78  PHE n 
1  79  MET n 
1  80  PRO n 
1  81  LYS n 
1  82  ASP n 
1  83  ASP n 
1  84  GLY n 
1  85  LYS n 
1  86  GLN n 
1  87  HIS n 
1  88  TYR n 
1  89  LEU n 
1  90  ILE n 
1  91  CYS n 
1  92  ASN n 
1  93  ALA n 
1  94  ASP n 
1  95  GLU n 
1  96  SER n 
1  97  GLU n 
1  98  PRO n 
1  99  GLY n 
1  100 SER n 
1  101 PHE n 
1  102 LYS n 
1  103 ASP n 
1  104 ARG n 
1  105 TYR n 
1  106 ILE n 
1  107 LEU n 
1  108 GLU n 
1  109 ASP n 
1  110 VAL n 
1  111 PRO n 
1  112 HIS n 
1  113 LEU n 
1  114 LEU n 
1  115 ILE n 
1  116 GLU n 
1  117 GLY n 
1  118 MET n 
1  119 ILE n 
1  120 LEU n 
1  121 ALA n 
1  122 GLY n 
1  123 TYR n 
1  124 ALA n 
1  125 ILE n 
1  126 ARG n 
1  127 ALA n 
1  128 THR n 
1  129 VAL n 
1  130 GLY n 
1  131 TYR n 
1  132 ILE n 
1  133 TYR n 
1  134 VAL n 
1  135 ARG n 
1  136 GLY n 
1  137 GLU n 
1  138 TYR n 
1  139 ARG n 
1  140 ARG n 
1  141 ALA n 
1  142 ALA n 
1  143 ASP n 
1  144 ARG n 
1  145 LEU n 
1  146 GLU n 
1  147 GLN n 
1  148 ALA n 
1  149 ILE n 
1  150 LYS n 
1  151 GLU n 
1  152 ALA n 
1  153 ARG n 
1  154 ALA n 
1  155 ARG n 
1  156 GLY n 
1  157 TYR n 
1  158 LEU n 
1  159 GLY n 
1  160 LYS n 
1  161 ASN n 
1  162 LEU n 
1  163 PHE n 
1  164 GLY n 
1  165 THR n 
1  166 ASP n 
1  167 PHE n 
1  168 SER n 
1  169 PHE n 
1  170 ASP n 
1  171 LEU n 
1  172 HIS n 
1  173 VAL n 
1  174 HIS n 
1  175 ARG n 
1  176 GLY n 
1  177 ALA n 
1  178 GLY n 
1  179 ALA n 
1  180 TYR n 
1  181 ILE n 
1  182 CYS n 
1  183 GLY n 
1  184 GLU n 
1  185 GLU n 
1  186 THR n 
1  187 ALA n 
1  188 LEU n 
1  189 MET n 
1  190 ASN n 
1  191 SER n 
1  192 LEU n 
1  193 GLU n 
1  194 GLY n 
1  195 LEU n 
1  196 ARG n 
1  197 ALA n 
1  198 ASN n 
1  199 PRO n 
1  200 ARG n 
1  201 LEU n 
1  202 LYS n 
1  203 PRO n 
1  204 PRO n 
1  205 PHE n 
1  206 PRO n 
1  207 ALA n 
1  208 GLN n 
1  209 SER n 
1  210 GLY n 
1  211 LEU n 
1  212 TRP n 
1  213 GLY n 
1  214 LYS n 
1  215 PRO n 
1  216 THR n 
1  217 THR n 
1  218 ILE n 
1  219 ASN n 
1  220 ASN n 
1  221 VAL n 
1  222 GLU n 
1  223 THR n 
1  224 LEU n 
1  225 ALA n 
1  226 SER n 
1  227 VAL n 
1  228 VAL n 
1  229 PRO n 
1  230 ILE n 
1  231 MET n 
1  232 GLU n 
1  233 ARG n 
1  234 GLY n 
1  235 ALA n 
1  236 ASP n 
1  237 TRP n 
1  238 PHE n 
1  239 ALA n 
1  240 GLN n 
1  241 MET n 
1  242 GLY n 
1  243 THR n 
1  244 GLU n 
1  245 GLN n 
1  246 SER n 
1  247 LYS n 
1  248 GLY n 
1  249 MET n 
1  250 LYS n 
1  251 LEU n 
1  252 TYR n 
1  253 GLN n 
1  254 ILE n 
1  255 SER n 
1  256 GLY n 
1  257 PRO n 
1  258 VAL n 
1  259 LYS n 
1  260 ARG n 
1  261 PRO n 
1  262 GLY n 
1  263 VAL n 
1  264 TYR n 
1  265 GLU n 
1  266 LEU n 
1  267 PRO n 
1  268 MET n 
1  269 GLY n 
1  270 THR n 
1  271 THR n 
1  272 PHE n 
1  273 ARG n 
1  274 GLU n 
1  275 LEU n 
1  276 ILE n 
1  277 TYR n 
1  278 GLU n 
1  279 TRP n 
1  280 ALA n 
1  281 GLY n 
1  282 GLY n 
1  283 PRO n 
1  284 LEU n 
1  285 GLU n 
1  286 PRO n 
1  287 ILE n 
1  288 GLN n 
1  289 ALA n 
1  290 ILE n 
1  291 ILE n 
1  292 PRO n 
1  293 GLY n 
1  294 GLY n 
1  295 SER n 
1  296 SER n 
1  297 THR n 
1  298 PRO n 
1  299 PRO n 
1  300 LEU n 
1  301 PRO n 
1  302 PHE n 
1  303 THR n 
1  304 GLU n 
1  305 GLU n 
1  306 VAL n 
1  307 LEU n 
1  308 ASP n 
1  309 THR n 
1  310 PRO n 
1  311 MET n 
1  312 SER n 
1  313 TYR n 
1  314 GLU n 
1  315 HIS n 
1  316 LEU n 
1  317 GLN n 
1  318 ALA n 
1  319 LYS n 
1  320 GLY n 
1  321 SER n 
1  322 MET n 
1  323 LEU n 
1  324 GLY n 
1  325 THR n 
1  326 GLY n 
1  327 GLY n 
1  328 VAL n 
1  329 ILE n 
1  330 LEU n 
1  331 ILE n 
1  332 PRO n 
1  333 GLU n 
1  334 ARG n 
1  335 VAL n 
1  336 SER n 
1  337 MET n 
1  338 VAL n 
1  339 ASP n 
1  340 ALA n 
1  341 MET n 
1  342 TRP n 
1  343 ASN n 
1  344 LEU n 
1  345 THR n 
1  346 ARG n 
1  347 PHE n 
1  348 TYR n 
1  349 ALA n 
1  350 HIS n 
1  351 GLU n 
1  352 SER n 
1  353 CYS n 
1  354 GLY n 
1  355 LYS n 
1  356 CYS n 
1  357 THR n 
1  358 PRO n 
1  359 CYS n 
1  360 ARG n 
1  361 GLU n 
1  362 GLY n 
1  363 VAL n 
1  364 ALA n 
1  365 GLY n 
1  366 PHE n 
1  367 MET n 
1  368 VAL n 
1  369 ASN n 
1  370 LEU n 
1  371 PHE n 
1  372 ALA n 
1  373 LYS n 
1  374 ILE n 
1  375 GLY n 
1  376 THR n 
1  377 GLY n 
1  378 GLN n 
1  379 GLY n 
1  380 GLU n 
1  381 GLU n 
1  382 LYS n 
1  383 ASP n 
1  384 VAL n 
1  385 GLU n 
1  386 ASN n 
1  387 LEU n 
1  388 GLU n 
1  389 ALA n 
1  390 LEU n 
1  391 LEU n 
1  392 PRO n 
1  393 LEU n 
1  394 ILE n 
1  395 GLU n 
1  396 GLY n 
1  397 ARG n 
1  398 SER n 
1  399 PHE n 
1  400 CYS n 
1  401 PRO n 
1  402 LEU n 
1  403 ALA n 
1  404 ASP n 
1  405 ALA n 
1  406 ALA n 
1  407 VAL n 
1  408 TRP n 
1  409 PRO n 
1  410 VAL n 
1  411 LYS n 
1  412 GLY n 
1  413 SER n 
1  414 LEU n 
1  415 ARG n 
1  416 HIS n 
1  417 PHE n 
1  418 LYS n 
1  419 ASP n 
1  420 GLN n 
1  421 TYR n 
1  422 LEU n 
1  423 ALA n 
1  424 LEU n 
1  425 ALA n 
1  426 ARG n 
1  427 GLU n 
1  428 LYS n 
1  429 ARG n 
1  430 PRO n 
1  431 VAL n 
1  432 PRO n 
1  433 ARG n 
1  434 PRO n 
1  435 SER n 
1  436 LEU n 
1  437 TRP n 
1  438 ARG n 
2  1   MET n 
2  2   GLY n 
2  3   PHE n 
2  4   PHE n 
2  5   ASP n 
2  6   ASP n 
2  7   LYS n 
2  8   GLN n 
2  9   ASP n 
2  10  PHE n 
2  11  LEU n 
2  12  GLU n 
2  13  GLU n 
2  14  THR n 
2  15  PHE n 
2  16  ALA n 
2  17  LYS n 
2  18  TYR n 
2  19  PRO n 
2  20  PRO n 
2  21  GLU n 
2  22  GLY n 
2  23  ARG n 
2  24  ARG n 
2  25  ALA n 
2  26  ALA n 
2  27  ILE n 
2  28  MET n 
2  29  PRO n 
2  30  LEU n 
2  31  LEU n 
2  32  ARG n 
2  33  ARG n 
2  34  VAL n 
2  35  GLN n 
2  36  GLN n 
2  37  GLU n 
2  38  GLU n 
2  39  GLY n 
2  40  TRP n 
2  41  ILE n 
2  42  ARG n 
2  43  PRO n 
2  44  GLU n 
2  45  ARG n 
2  46  ILE n 
2  47  GLU n 
2  48  GLU n 
2  49  ILE n 
2  50  ALA n 
2  51  ARG n 
2  52  LEU n 
2  53  VAL n 
2  54  GLY n 
2  55  THR n 
2  56  THR n 
2  57  PRO n 
2  58  THR n 
2  59  GLU n 
2  60  VAL n 
2  61  MET n 
2  62  GLY n 
2  63  VAL n 
2  64  ALA n 
2  65  SER n 
2  66  PHE n 
2  67  TYR n 
2  68  SER n 
2  69  TYR n 
2  70  TYR n 
2  71  GLN n 
2  72  PHE n 
2  73  VAL n 
2  74  PRO n 
2  75  THR n 
2  76  GLY n 
2  77  LYS n 
2  78  TYR n 
2  79  HIS n 
2  80  LEU n 
2  81  GLN n 
2  82  VAL n 
2  83  CYS n 
2  84  ALA n 
2  85  THR n 
2  86  LEU n 
2  87  SER n 
2  88  CYS n 
2  89  LYS n 
2  90  LEU n 
2  91  ALA n 
2  92  GLY n 
2  93  ALA n 
2  94  GLU n 
2  95  GLU n 
2  96  LEU n 
2  97  TRP n 
2  98  ASP n 
2  99  TYR n 
2  100 LEU n 
2  101 THR n 
2  102 GLU n 
2  103 THR n 
2  104 LEU n 
2  105 GLY n 
2  106 ILE n 
2  107 GLY n 
2  108 PRO n 
2  109 GLY n 
2  110 GLU n 
2  111 VAL n 
2  112 THR n 
2  113 PRO n 
2  114 ASP n 
2  115 GLY n 
2  116 LEU n 
2  117 PHE n 
2  118 SER n 
2  119 VAL n 
2  120 GLN n 
2  121 LYS n 
2  122 VAL n 
2  123 GLU n 
2  124 CYS n 
2  125 LEU n 
2  126 GLY n 
2  127 SER n 
2  128 CYS n 
2  129 HIS n 
2  130 THR n 
2  131 ALA n 
2  132 PRO n 
2  133 VAL n 
2  134 ILE n 
2  135 GLN n 
2  136 VAL n 
2  137 ASN n 
2  138 ASP n 
2  139 GLU n 
2  140 PRO n 
2  141 TYR n 
2  142 VAL n 
2  143 GLU n 
2  144 CYS n 
2  145 VAL n 
2  146 THR n 
2  147 ARG n 
2  148 ALA n 
2  149 ARG n 
2  150 LEU n 
2  151 GLU n 
2  152 ALA n 
2  153 LEU n 
2  154 LEU n 
2  155 ALA n 
2  156 GLY n 
2  157 LEU n 
2  158 ARG n 
2  159 ALA n 
2  160 GLY n 
2  161 LYS n 
2  162 ARG n 
2  163 LEU n 
2  164 GLU n 
2  165 GLU n 
2  166 ILE n 
2  167 GLU n 
2  168 LEU n 
2  169 PRO n 
2  170 GLY n 
2  171 LYS n 
2  172 CYS n 
2  173 GLY n 
2  174 HIS n 
2  175 HIS n 
2  176 VAL n 
2  177 HIS n 
2  178 GLU n 
2  179 VAL n 
2  180 GLU n 
2  181 VAL n 
3  1   MET n 
3  2   VAL n 
3  3   ARG n 
3  4   VAL n 
3  5   LYS n 
3  6   VAL n 
3  7   ASN n 
3  8   ASP n 
3  9   ARG n 
3  10  ILE n 
3  11  VAL n 
3  12  GLU n 
3  13  VAL n 
3  14  PRO n 
3  15  PRO n 
3  16  GLY n 
3  17  THR n 
3  18  SER n 
3  19  VAL n 
3  20  MET n 
3  21  ASP n 
3  22  ALA n 
3  23  VAL n 
3  24  PHE n 
3  25  HIS n 
3  26  ALA n 
3  27  GLY n 
3  28  TYR n 
3  29  ASP n 
3  30  VAL n 
3  31  PRO n 
3  32  LEU n 
3  33  PHE n 
3  34  CYS n 
3  35  SER n 
3  36  GLU n 
3  37  LYS n 
3  38  HIS n 
3  39  LEU n 
3  40  SER n 
3  41  PRO n 
3  42  ILE n 
3  43  GLY n 
3  44  ALA n 
3  45  CYS n 
3  46  ARG n 
3  47  MET n 
3  48  CYS n 
3  49  LEU n 
3  50  VAL n 
3  51  ARG n 
3  52  ILE n 
3  53  GLY n 
3  54  LEU n 
3  55  PRO n 
3  56  LYS n 
3  57  LYS n 
3  58  GLY n 
3  59  PRO n 
3  60  ASP n 
3  61  GLY n 
3  62  LYS n 
3  63  PRO n 
3  64  LEU n 
3  65  LEU n 
3  66  ASN n 
3  67  GLU n 
3  68  LYS n 
3  69  GLY n 
3  70  GLU n 
3  71  PRO n 
3  72  GLU n 
3  73  ILE n 
3  74  GLN n 
3  75  TRP n 
3  76  GLN n 
3  77  PRO n 
3  78  LYS n 
3  79  LEU n 
3  80  ALA n 
3  81  ALA n 
3  82  SER n 
3  83  CYS n 
3  84  VAL n 
3  85  THR n 
3  86  ALA n 
3  87  VAL n 
3  88  ALA n 
3  89  ASP n 
3  90  GLY n 
3  91  MET n 
3  92  VAL n 
3  93  VAL n 
3  94  ASP n 
3  95  THR n 
3  96  LEU n 
3  97  SER n 
3  98  ASP n 
3  99  VAL n 
3  100 VAL n 
3  101 ARG n 
3  102 GLU n 
3  103 ALA n 
3  104 GLN n 
3  105 ALA n 
3  106 GLY n 
3  107 MET n 
3  108 VAL n 
3  109 GLU n 
3  110 PHE n 
3  111 THR n 
3  112 LEU n 
3  113 LEU n 
3  114 ASN n 
3  115 HIS n 
3  116 PRO n 
3  117 LEU n 
3  118 ASP n 
3  119 CYS n 
3  120 PRO n 
3  121 THR n 
3  122 CYS n 
3  123 ASP n 
3  124 LYS n 
3  125 GLY n 
3  126 GLY n 
3  127 ALA n 
3  128 CYS n 
3  129 GLU n 
3  130 LEU n 
3  131 GLN n 
3  132 ASP n 
3  133 ARG n 
3  134 THR n 
3  135 VAL n 
3  136 GLU n 
3  137 TYR n 
3  138 GLY n 
3  139 LEU n 
3  140 TYR n 
3  141 GLU n 
3  142 LYS n 
3  143 TYR n 
3  144 TYR n 
3  145 GLN n 
3  146 LYS n 
3  147 GLY n 
3  148 PRO n 
3  149 LEU n 
3  150 GLU n 
3  151 LEU n 
3  152 PRO n 
3  153 VAL n 
3  154 TYR n 
3  155 THR n 
3  156 ARG n 
3  157 PHE n 
3  158 GLU n 
3  159 PHE n 
3  160 THR n 
3  161 ARG n 
3  162 ARG n 
3  163 HIS n 
3  164 VAL n 
3  165 ASP n 
3  166 LYS n 
3  167 HIS n 
3  168 HIS n 
3  169 PRO n 
3  170 LEU n 
3  171 SER n 
3  172 PRO n 
3  173 PHE n 
3  174 VAL n 
3  175 ILE n 
3  176 LEU n 
3  177 ASP n 
3  178 ARG n 
3  179 GLU n 
3  180 ARG n 
3  181 CYS n 
3  182 ILE n 
3  183 HIS n 
3  184 CYS n 
3  185 LYS n 
3  186 ARG n 
3  187 CYS n 
3  188 VAL n 
3  189 ARG n 
3  190 TYR n 
3  191 PHE n 
3  192 GLU n 
3  193 GLU n 
3  194 VAL n 
3  195 PRO n 
3  196 GLY n 
3  197 ASP n 
3  198 GLU n 
3  199 VAL n 
3  200 LEU n 
3  201 ASP n 
3  202 PHE n 
3  203 ILE n 
3  204 GLU n 
3  205 ARG n 
3  206 GLY n 
3  207 VAL n 
3  208 HIS n 
3  209 THR n 
3  210 PHE n 
3  211 ILE n 
3  212 GLY n 
3  213 THR n 
3  214 MET n 
3  215 ASP n 
3  216 PHE n 
3  217 GLY n 
3  218 LEU n 
3  219 PRO n 
3  220 SER n 
3  221 GLY n 
3  222 PHE n 
3  223 SER n 
3  224 GLY n 
3  225 ASN n 
3  226 ILE n 
3  227 THR n 
3  228 ASP n 
3  229 ILE n 
3  230 CYS n 
3  231 PRO n 
3  232 VAL n 
3  233 GLY n 
3  234 ALA n 
3  235 LEU n 
3  236 LEU n 
3  237 ASP n 
3  238 LEU n 
3  239 THR n 
3  240 ALA n 
3  241 ARG n 
3  242 PHE n 
3  243 ARG n 
3  244 ALA n 
3  245 ARG n 
3  246 ASN n 
3  247 TRP n 
3  248 GLU n 
3  249 MET n 
3  250 GLU n 
3  251 GLU n 
3  252 THR n 
3  253 PRO n 
3  254 THR n 
3  255 THR n 
3  256 CYS n 
3  257 ALA n 
3  258 LEU n 
3  259 CYS n 
3  260 PRO n 
3  261 VAL n 
3  262 GLY n 
3  263 CYS n 
3  264 GLY n 
3  265 ILE n 
3  266 THR n 
3  267 ALA n 
3  268 ASP n 
3  269 THR n 
3  270 ARG n 
3  271 SER n 
3  272 GLY n 
3  273 GLU n 
3  274 LEU n 
3  275 LEU n 
3  276 ARG n 
3  277 ILE n 
3  278 ARG n 
3  279 ALA n 
3  280 ARG n 
3  281 GLU n 
3  282 VAL n 
3  283 PRO n 
3  284 GLU n 
3  285 VAL n 
3  286 ASN n 
3  287 GLU n 
3  288 ILE n 
3  289 TRP n 
3  290 ILE n 
3  291 CYS n 
3  292 ASP n 
3  293 ALA n 
3  294 GLY n 
3  295 ARG n 
3  296 PHE n 
3  297 GLY n 
3  298 HIS n 
3  299 GLU n 
3  300 TRP n 
3  301 ALA n 
3  302 ASP n 
3  303 GLN n 
3  304 ASN n 
3  305 ARG n 
3  306 LEU n 
3  307 LYS n 
3  308 THR n 
3  309 PRO n 
3  310 LEU n 
3  311 VAL n 
3  312 ARG n 
3  313 LYS n 
3  314 GLU n 
3  315 GLY n 
3  316 ARG n 
3  317 LEU n 
3  318 VAL n 
3  319 GLU n 
3  320 ALA n 
3  321 THR n 
3  322 TRP n 
3  323 GLU n 
3  324 GLU n 
3  325 ALA n 
3  326 PHE n 
3  327 LEU n 
3  328 ALA n 
3  329 LEU n 
3  330 LYS n 
3  331 GLU n 
3  332 GLY n 
3  333 LEU n 
3  334 LYS n 
3  335 GLU n 
3  336 ALA n 
3  337 ARG n 
3  338 GLY n 
3  339 GLU n 
3  340 GLU n 
3  341 VAL n 
3  342 GLY n 
3  343 LEU n 
3  344 TYR n 
3  345 LEU n 
3  346 ALA n 
3  347 HIS n 
3  348 ASP n 
3  349 ALA n 
3  350 THR n 
3  351 LEU n 
3  352 GLU n 
3  353 GLU n 
3  354 GLY n 
3  355 LEU n 
3  356 LEU n 
3  357 ALA n 
3  358 SER n 
3  359 GLU n 
3  360 LEU n 
3  361 ALA n 
3  362 LYS n 
3  363 ALA n 
3  364 LEU n 
3  365 LYS n 
3  366 THR n 
3  367 PRO n 
3  368 HIS n 
3  369 LEU n 
3  370 ASP n 
3  371 PHE n 
3  372 GLN n 
3  373 GLY n 
3  374 ARG n 
3  375 THR n 
3  376 ALA n 
3  377 ALA n 
3  378 PRO n 
3  379 ALA n 
3  380 SER n 
3  381 LEU n 
3  382 PHE n 
3  383 PRO n 
3  384 PRO n 
3  385 ALA n 
3  386 SER n 
3  387 LEU n 
3  388 GLU n 
3  389 ASP n 
3  390 LEU n 
3  391 LEU n 
3  392 GLN n 
3  393 ALA n 
3  394 ASP n 
3  395 PHE n 
3  396 ALA n 
3  397 LEU n 
3  398 VAL n 
3  399 LEU n 
3  400 GLY n 
3  401 ASP n 
3  402 PRO n 
3  403 THR n 
3  404 GLU n 
3  405 GLU n 
3  406 ALA n 
3  407 PRO n 
3  408 ILE n 
3  409 LEU n 
3  410 HIS n 
3  411 LEU n 
3  412 ARG n 
3  413 LEU n 
3  414 SER n 
3  415 GLU n 
3  416 PHE n 
3  417 VAL n 
3  418 ARG n 
3  419 ASP n 
3  420 LEU n 
3  421 LYS n 
3  422 PRO n 
3  423 PRO n 
3  424 HIS n 
3  425 ARG n 
3  426 TYR n 
3  427 ASN n 
3  428 HIS n 
3  429 GLY n 
3  430 THR n 
3  431 PRO n 
3  432 PHE n 
3  433 ALA n 
3  434 ASP n 
3  435 LEU n 
3  436 GLN n 
3  437 ILE n 
3  438 LYS n 
3  439 GLU n 
3  440 ARG n 
3  441 MET n 
3  442 PRO n 
3  443 ARG n 
3  444 ARG n 
3  445 THR n 
3  446 ASP n 
3  447 LYS n 
3  448 MET n 
3  449 ALA n 
3  450 LEU n 
3  451 PHE n 
3  452 ALA n 
3  453 PRO n 
3  454 TYR n 
3  455 ARG n 
3  456 ALA n 
3  457 PRO n 
3  458 LEU n 
3  459 MET n 
3  460 LYS n 
3  461 TRP n 
3  462 ALA n 
3  463 ALA n 
3  464 ILE n 
3  465 HIS n 
3  466 GLU n 
3  467 VAL n 
3  468 HIS n 
3  469 ARG n 
3  470 PRO n 
3  471 GLY n 
3  472 GLU n 
3  473 GLU n 
3  474 ARG n 
3  475 GLU n 
3  476 ILE n 
3  477 LEU n 
3  478 LEU n 
3  479 ALA n 
3  480 LEU n 
3  481 LEU n 
3  482 GLY n 
3  483 ASP n 
3  484 LYS n 
3  485 GLU n 
3  486 GLY n 
3  487 SER n 
3  488 GLU n 
3  489 MET n 
3  490 VAL n 
3  491 ALA n 
3  492 LYS n 
3  493 ALA n 
3  494 LYS n 
3  495 GLU n 
3  496 ALA n 
3  497 TRP n 
3  498 GLU n 
3  499 LYS n 
3  500 ALA n 
3  501 LYS n 
3  502 ASN n 
3  503 PRO n 
3  504 VAL n 
3  505 LEU n 
3  506 ILE n 
3  507 LEU n 
3  508 GLY n 
3  509 ALA n 
3  510 GLY n 
3  511 VAL n 
3  512 LEU n 
3  513 GLN n 
3  514 ASP n 
3  515 THR n 
3  516 VAL n 
3  517 ALA n 
3  518 ALA n 
3  519 GLU n 
3  520 ARG n 
3  521 ALA n 
3  522 ARG n 
3  523 LEU n 
3  524 LEU n 
3  525 ALA n 
3  526 GLU n 
3  527 ARG n 
3  528 LYS n 
3  529 GLY n 
3  530 ALA n 
3  531 LYS n 
3  532 VAL n 
3  533 LEU n 
3  534 ALA n 
3  535 MET n 
3  536 THR n 
3  537 PRO n 
3  538 ALA n 
3  539 ALA n 
3  540 ASN n 
3  541 ALA n 
3  542 ARG n 
3  543 GLY n 
3  544 LEU n 
3  545 GLU n 
3  546 ALA n 
3  547 MET n 
3  548 GLY n 
3  549 VAL n 
3  550 LEU n 
3  551 PRO n 
3  552 GLY n 
3  553 ALA n 
3  554 LYS n 
3  555 GLY n 
3  556 ALA n 
3  557 SER n 
3  558 TRP n 
3  559 ASP n 
3  560 GLU n 
3  561 PRO n 
3  562 GLY n 
3  563 ALA n 
3  564 LEU n 
3  565 TYR n 
3  566 ALA n 
3  567 TYR n 
3  568 TYR n 
3  569 GLY n 
3  570 PHE n 
3  571 VAL n 
3  572 PRO n 
3  573 PRO n 
3  574 GLU n 
3  575 GLU n 
3  576 ALA n 
3  577 LEU n 
3  578 LYS n 
3  579 GLY n 
3  580 LYS n 
3  581 ARG n 
3  582 PHE n 
3  583 VAL n 
3  584 VAL n 
3  585 MET n 
3  586 HIS n 
3  587 LEU n 
3  588 SER n 
3  589 HIS n 
3  590 LEU n 
3  591 HIS n 
3  592 PRO n 
3  593 LEU n 
3  594 ALA n 
3  595 GLU n 
3  596 ARG n 
3  597 TYR n 
3  598 ALA n 
3  599 HIS n 
3  600 VAL n 
3  601 VAL n 
3  602 LEU n 
3  603 PRO n 
3  604 ALA n 
3  605 PRO n 
3  606 THR n 
3  607 PHE n 
3  608 TYR n 
3  609 GLU n 
3  610 LYS n 
3  611 ARG n 
3  612 GLY n 
3  613 HIS n 
3  614 LEU n 
3  615 VAL n 
3  616 ASN n 
3  617 LEU n 
3  618 GLU n 
3  619 GLY n 
3  620 ARG n 
3  621 VAL n 
3  622 LEU n 
3  623 PRO n 
3  624 LEU n 
3  625 SER n 
3  626 PRO n 
3  627 ALA n 
3  628 PRO n 
3  629 ILE n 
3  630 GLU n 
3  631 ASN n 
3  632 GLY n 
3  633 GLU n 
3  634 ALA n 
3  635 GLU n 
3  636 GLY n 
3  637 ALA n 
3  638 LEU n 
3  639 GLN n 
3  640 VAL n 
3  641 LEU n 
3  642 ALA n 
3  643 LEU n 
3  644 LEU n 
3  645 ALA n 
3  646 GLU n 
3  647 ALA n 
3  648 LEU n 
3  649 GLY n 
3  650 VAL n 
3  651 ARG n 
3  652 PRO n 
3  653 PRO n 
3  654 PHE n 
3  655 ARG n 
3  656 LEU n 
3  657 HIS n 
3  658 LEU n 
3  659 GLU n 
3  660 ALA n 
3  661 GLN n 
3  662 LYS n 
3  663 ALA n 
3  664 LEU n 
3  665 LYS n 
3  666 ALA n 
3  667 ARG n 
3  668 LYS n 
3  669 VAL n 
3  670 PRO n 
3  671 GLU n 
3  672 ALA n 
3  673 MET n 
3  674 GLY n 
3  675 ARG n 
3  676 LEU n 
3  677 SER n 
3  678 PHE n 
3  679 ARG n 
3  680 LEU n 
3  681 LYS n 
3  682 GLU n 
3  683 LEU n 
3  684 ARG n 
3  685 PRO n 
3  686 LYS n 
3  687 GLU n 
3  688 ARG n 
3  689 LYS n 
3  690 GLY n 
3  691 ALA n 
3  692 PHE n 
3  693 TYR n 
3  694 LEU n 
3  695 ARG n 
3  696 PRO n 
3  697 THR n 
3  698 MET n 
3  699 TRP n 
3  700 LYS n 
3  701 ALA n 
3  702 HIS n 
3  703 GLN n 
3  704 ALA n 
3  705 VAL n 
3  706 GLY n 
3  707 LYS n 
3  708 ALA n 
3  709 GLN n 
3  710 GLU n 
3  711 ALA n 
3  712 ALA n 
3  713 ARG n 
3  714 ALA n 
3  715 GLU n 
3  716 LEU n 
3  717 TRP n 
3  718 ALA n 
3  719 HIS n 
3  720 PRO n 
3  721 GLU n 
3  722 THR n 
3  723 ALA n 
3  724 ARG n 
3  725 ALA n 
3  726 GLU n 
3  727 ALA n 
3  728 LEU n 
3  729 PRO n 
3  730 GLU n 
3  731 GLY n 
3  732 ALA n 
3  733 GLN n 
3  734 VAL n 
3  735 ALA n 
3  736 VAL n 
3  737 GLU n 
3  738 THR n 
3  739 PRO n 
3  740 PHE n 
3  741 GLY n 
3  742 ARG n 
3  743 VAL n 
3  744 GLU n 
3  745 ALA n 
3  746 ARG n 
3  747 VAL n 
3  748 VAL n 
3  749 HIS n 
3  750 ARG n 
3  751 GLU n 
3  752 ASP n 
3  753 VAL n 
3  754 PRO n 
3  755 LYS n 
3  756 GLY n 
3  757 HIS n 
3  758 LEU n 
3  759 TYR n 
3  760 LEU n 
3  761 SER n 
3  762 ALA n 
3  763 LEU n 
3  764 GLY n 
3  765 PRO n 
3  766 ALA n 
3  767 ALA n 
3  768 GLY n 
3  769 LEU n 
3  770 ARG n 
3  771 VAL n 
3  772 GLU n 
3  773 GLY n 
3  774 ARG n 
3  775 VAL n 
3  776 LEU n 
3  777 VAL n 
3  778 PRO n 
3  779 ALA n 
3  780 GLY n 
3  781 GLY n 
3  782 GLU n 
3  783 ALA n 
4  1   MET n 
4  2   ARG n 
4  3   GLU n 
4  4   GLU n 
4  5   PHE n 
4  6   LEU n 
4  7   GLU n 
4  8   GLU n 
4  9   ILE n 
4  10  PRO n 
4  11  LEU n 
4  12  ASP n 
4  13  ALA n 
4  14  PRO n 
4  15  PRO n 
4  16  GLU n 
4  17  GLU n 
4  18  ALA n 
4  19  LYS n 
4  20  GLU n 
4  21  LEU n 
4  22  ARG n 
4  23  THR n 
4  24  GLU n 
4  25  VAL n 
4  26  MET n 
4  27  THR n 
4  28  LEU n 
4  29  ASN n 
4  30  VAL n 
4  31  GLY n 
4  32  PRO n 
4  33  GLN n 
4  34  HIS n 
4  35  PRO n 
4  36  SER n 
4  37  THR n 
4  38  HIS n 
4  39  GLY n 
4  40  VAL n 
4  41  LEU n 
4  42  ARG n 
4  43  LEU n 
4  44  MET n 
4  45  VAL n 
4  46  THR n 
4  47  LEU n 
4  48  SER n 
4  49  GLY n 
4  50  GLU n 
4  51  GLU n 
4  52  VAL n 
4  53  LEU n 
4  54  GLU n 
4  55  VAL n 
4  56  VAL n 
4  57  PRO n 
4  58  HIS n 
4  59  ILE n 
4  60  GLY n 
4  61  TYR n 
4  62  LEU n 
4  63  HIS n 
4  64  THR n 
4  65  GLY n 
4  66  PHE n 
4  67  GLU n 
4  68  LYS n 
4  69  THR n 
4  70  MET n 
4  71  GLU n 
4  72  HIS n 
4  73  ARG n 
4  74  THR n 
4  75  TYR n 
4  76  LEU n 
4  77  GLN n 
4  78  ASN n 
4  79  ILE n 
4  80  THR n 
4  81  TYR n 
4  82  THR n 
4  83  PRO n 
4  84  ARG n 
4  85  MET n 
4  86  ASP n 
4  87  TYR n 
4  88  LEU n 
4  89  HIS n 
4  90  SER n 
4  91  PHE n 
4  92  ALA n 
4  93  HIS n 
4  94  ASP n 
4  95  LEU n 
4  96  ALA n 
4  97  TYR n 
4  98  ALA n 
4  99  LEU n 
4  100 ALA n 
4  101 VAL n 
4  102 GLU n 
4  103 LYS n 
4  104 LEU n 
4  105 LEU n 
4  106 GLY n 
4  107 ALA n 
4  108 VAL n 
4  109 VAL n 
4  110 PRO n 
4  111 PRO n 
4  112 ARG n 
4  113 ALA n 
4  114 GLU n 
4  115 THR n 
4  116 ILE n 
4  117 ARG n 
4  118 VAL n 
4  119 ILE n 
4  120 LEU n 
4  121 ASN n 
4  122 GLU n 
4  123 LEU n 
4  124 SER n 
4  125 ARG n 
4  126 LEU n 
4  127 ALA n 
4  128 SER n 
4  129 HIS n 
4  130 LEU n 
4  131 VAL n 
4  132 PHE n 
4  133 LEU n 
4  134 GLY n 
4  135 THR n 
4  136 GLY n 
4  137 LEU n 
4  138 LEU n 
4  139 ASP n 
4  140 LEU n 
4  141 GLY n 
4  142 ALA n 
4  143 LEU n 
4  144 THR n 
4  145 PRO n 
4  146 PHE n 
4  147 PHE n 
4  148 TYR n 
4  149 ALA n 
4  150 PHE n 
4  151 ARG n 
4  152 GLU n 
4  153 ARG n 
4  154 GLU n 
4  155 THR n 
4  156 ILE n 
4  157 LEU n 
4  158 ASP n 
4  159 LEU n 
4  160 PHE n 
4  161 GLU n 
4  162 TRP n 
4  163 VAL n 
4  164 THR n 
4  165 GLY n 
4  166 GLN n 
4  167 ARG n 
4  168 PHE n 
4  169 HIS n 
4  170 HIS n 
4  171 ASN n 
4  172 TYR n 
4  173 ILE n 
4  174 ARG n 
4  175 ILE n 
4  176 GLY n 
4  177 GLY n 
4  178 VAL n 
4  179 LYS n 
4  180 GLU n 
4  181 ASP n 
4  182 LEU n 
4  183 PRO n 
4  184 GLU n 
4  185 GLU n 
4  186 PHE n 
4  187 VAL n 
4  188 PRO n 
4  189 GLU n 
4  190 LEU n 
4  191 LYS n 
4  192 LYS n 
4  193 LEU n 
4  194 LEU n 
4  195 GLU n 
4  196 VAL n 
4  197 LEU n 
4  198 PRO n 
4  199 HIS n 
4  200 ARG n 
4  201 ILE n 
4  202 ASP n 
4  203 GLU n 
4  204 TYR n 
4  205 GLU n 
4  206 ALA n 
4  207 LEU n 
4  208 PHE n 
4  209 ALA n 
4  210 GLU n 
4  211 SER n 
4  212 PRO n 
4  213 ILE n 
4  214 PHE n 
4  215 TYR n 
4  216 GLU n 
4  217 ARG n 
4  218 ALA n 
4  219 ARG n 
4  220 GLY n 
4  221 VAL n 
4  222 GLY n 
4  223 VAL n 
4  224 ILE n 
4  225 PRO n 
4  226 PRO n 
4  227 GLU n 
4  228 VAL n 
4  229 ALA n 
4  230 ILE n 
4  231 ASP n 
4  232 LEU n 
4  233 GLY n 
4  234 LEU n 
4  235 THR n 
4  236 GLY n 
4  237 GLY n 
4  238 SER n 
4  239 LEU n 
4  240 ARG n 
4  241 ALA n 
4  242 SER n 
4  243 GLY n 
4  244 VAL n 
4  245 ASN n 
4  246 TYR n 
4  247 ASP n 
4  248 VAL n 
4  249 ARG n 
4  250 LYS n 
4  251 ALA n 
4  252 TYR n 
4  253 PRO n 
4  254 TYR n 
4  255 SER n 
4  256 GLY n 
4  257 TYR n 
4  258 GLU n 
4  259 THR n 
4  260 TYR n 
4  261 THR n 
4  262 PHE n 
4  263 ASP n 
4  264 VAL n 
4  265 PRO n 
4  266 LEU n 
4  267 GLY n 
4  268 GLU n 
4  269 ARG n 
4  270 GLY n 
4  271 ASP n 
4  272 VAL n 
4  273 PHE n 
4  274 ASP n 
4  275 ARG n 
4  276 MET n 
4  277 LEU n 
4  278 VAL n 
4  279 ARG n 
4  280 ILE n 
4  281 ARG n 
4  282 GLU n 
4  283 MET n 
4  284 ARG n 
4  285 GLU n 
4  286 SER n 
4  287 VAL n 
4  288 LYS n 
4  289 ILE n 
4  290 ILE n 
4  291 LYS n 
4  292 GLN n 
4  293 ALA n 
4  294 LEU n 
4  295 GLU n 
4  296 ARG n 
4  297 LEU n 
4  298 GLU n 
4  299 PRO n 
4  300 GLY n 
4  301 PRO n 
4  302 VAL n 
4  303 ARG n 
4  304 ASP n 
4  305 PRO n 
4  306 ASN n 
4  307 PRO n 
4  308 GLN n 
4  309 ILE n 
4  310 THR n 
4  311 PRO n 
4  312 PRO n 
4  313 PRO n 
4  314 ARG n 
4  315 HIS n 
4  316 LEU n 
4  317 LEU n 
4  318 GLU n 
4  319 THR n 
4  320 SER n 
4  321 MET n 
4  322 GLU n 
4  323 ALA n 
4  324 VAL n 
4  325 ILE n 
4  326 TYR n 
4  327 HIS n 
4  328 PHE n 
4  329 LYS n 
4  330 HIS n 
4  331 TYR n 
4  332 THR n 
4  333 GLU n 
4  334 GLY n 
4  335 PHE n 
4  336 HIS n 
4  337 PRO n 
4  338 PRO n 
4  339 LYS n 
4  340 GLY n 
4  341 GLU n 
4  342 VAL n 
4  343 TYR n 
4  344 VAL n 
4  345 PRO n 
4  346 THR n 
4  347 GLU n 
4  348 SER n 
4  349 ALA n 
4  350 ARG n 
4  351 GLY n 
4  352 GLU n 
4  353 LEU n 
4  354 GLY n 
4  355 TYR n 
4  356 TYR n 
4  357 ILE n 
4  358 VAL n 
4  359 SER n 
4  360 ASP n 
4  361 GLY n 
4  362 GLY n 
4  363 SER n 
4  364 MET n 
4  365 PRO n 
4  366 TYR n 
4  367 ARG n 
4  368 VAL n 
4  369 LYS n 
4  370 VAL n 
4  371 ARG n 
4  372 ALA n 
4  373 PRO n 
4  374 SER n 
4  375 PHE n 
4  376 VAL n 
4  377 ASN n 
4  378 LEU n 
4  379 GLN n 
4  380 SER n 
4  381 LEU n 
4  382 PRO n 
4  383 TYR n 
4  384 ALA n 
4  385 CYS n 
4  386 LYS n 
4  387 GLY n 
4  388 GLU n 
4  389 GLN n 
4  390 VAL n 
4  391 PRO n 
4  392 ASP n 
4  393 MET n 
4  394 VAL n 
4  395 ALA n 
4  396 ILE n 
4  397 ILE n 
4  398 ALA n 
4  399 SER n 
4  400 LEU n 
4  401 ASP n 
4  402 PRO n 
4  403 VAL n 
4  404 MET n 
4  405 GLY n 
4  406 ASP n 
4  407 VAL n 
4  408 ASP n 
4  409 ARG n 
5  1   MET n 
5  2   ARG n 
5  3   LEU n 
5  4   GLU n 
5  5   ARG n 
5  6   VAL n 
5  7   LEU n 
5  8   GLU n 
5  9   GLU n 
5  10  ALA n 
5  11  ARG n 
5  12  ALA n 
5  13  LYS n 
5  14  GLY n 
5  15  TYR n 
5  16  PRO n 
5  17  ILE n 
5  18  GLU n 
5  19  ASP n 
5  20  ASN n 
5  21  GLY n 
5  22  LEU n 
5  23  GLY n 
5  24  ASN n 
5  25  LEU n 
5  26  TRP n 
5  27  VAL n 
5  28  VAL n 
5  29  LEU n 
5  30  PRO n 
5  31  ARG n 
5  32  GLU n 
5  33  ARG n 
5  34  PHE n 
5  35  LYS n 
5  36  GLU n 
5  37  GLU n 
5  38  MET n 
5  39  ALA n 
5  40  HIS n 
5  41  TYR n 
5  42  LYS n 
5  43  ALA n 
5  44  MET n 
5  45  GLY n 
5  46  PHE n 
5  47  ASN n 
5  48  PHE n 
5  49  LEU n 
5  50  ALA n 
5  51  ASP n 
5  52  ILE n 
5  53  VAL n 
5  54  GLY n 
5  55  LEU n 
5  56  ASP n 
5  57  TYR n 
5  58  LEU n 
5  59  THR n 
5  60  TYR n 
5  61  PRO n 
5  62  ASP n 
5  63  PRO n 
5  64  ARG n 
5  65  PRO n 
5  66  GLU n 
5  67  ARG n 
5  68  PHE n 
5  69  ALA n 
5  70  VAL n 
5  71  VAL n 
5  72  TYR n 
5  73  GLU n 
5  74  LEU n 
5  75  VAL n 
5  76  SER n 
5  77  LEU n 
5  78  PRO n 
5  79  GLY n 
5  80  TRP n 
5  81  LYS n 
5  82  ASP n 
5  83  GLY n 
5  84  ASP n 
5  85  GLY n 
5  86  SER n 
5  87  ARG n 
5  88  PHE n 
5  89  PHE n 
5  90  VAL n 
5  91  ARG n 
5  92  VAL n 
5  93  TYR n 
5  94  VAL n 
5  95  PRO n 
5  96  GLU n 
5  97  GLU n 
5  98  ASP n 
5  99  PRO n 
5  100 ARG n 
5  101 LEU n 
5  102 PRO n 
5  103 THR n 
5  104 VAL n 
5  105 THR n 
5  106 ASP n 
5  107 LEU n 
5  108 TRP n 
5  109 GLY n 
5  110 SER n 
5  111 ALA n 
5  112 ASN n 
5  113 PHE n 
5  114 LEU n 
5  115 GLU n 
5  116 ARG n 
5  117 GLU n 
5  118 VAL n 
5  119 TYR n 
5  120 ASP n 
5  121 LEU n 
5  122 PHE n 
5  123 GLY n 
5  124 ILE n 
5  125 VAL n 
5  126 PHE n 
5  127 GLU n 
5  128 GLY n 
5  129 HIS n 
5  130 PRO n 
5  131 ASP n 
5  132 LEU n 
5  133 ARG n 
5  134 LYS n 
5  135 ILE n 
5  136 LEU n 
5  137 THR n 
5  138 PRO n 
5  139 GLU n 
5  140 ASP n 
5  141 LEU n 
5  142 GLU n 
5  143 GLY n 
5  144 HIS n 
5  145 PRO n 
5  146 LEU n 
5  147 ARG n 
5  148 LYS n 
5  149 ASP n 
5  150 TYR n 
5  151 PRO n 
5  152 LEU n 
5  153 GLY n 
5  154 GLU n 
5  155 THR n 
5  156 PRO n 
5  157 THR n 
5  158 LEU n 
5  159 PHE n 
5  160 ARG n 
5  161 GLU n 
5  162 GLY n 
5  163 ARG n 
5  164 TYR n 
5  165 ILE n 
5  166 ILE n 
5  167 PRO n 
5  168 ALA n 
5  169 GLU n 
5  170 PHE n 
5  171 ARG n 
5  172 ALA n 
5  173 ALA n 
5  174 LEU n 
5  175 THR n 
5  176 GLY n 
5  177 LYS n 
5  178 ASP n 
5  179 PRO n 
5  180 GLY n 
5  181 LEU n 
5  182 THR n 
5  183 PHE n 
5  184 TYR n 
5  185 LYS n 
5  186 GLY n 
5  187 GLY n 
5  188 SER n 
5  189 ARG n 
5  190 LYS n 
5  191 GLY n 
5  192 TYR n 
5  193 ARG n 
5  194 SER n 
5  195 LEU n 
5  196 TRP n 
5  197 ALA n 
5  198 ASP n 
5  199 LEU n 
5  200 LYS n 
5  201 LYS n 
5  202 ALA n 
5  203 ARG n 
5  204 GLU n 
5  205 VAL n 
5  206 LYS n 
5  207 GLY n 
6  1   MET n 
6  2   ALA n 
6  3   LEU n 
6  4   LYS n 
6  5   ASP n 
6  6   LEU n 
6  7   PHE n 
6  8   GLU n 
6  9   ARG n 
6  10  ASP n 
6  11  VAL n 
6  12  GLN n 
6  13  GLU n 
6  14  LEU n 
6  15  GLU n 
6  16  ARG n 
6  17  GLU n 
6  18  GLY n 
6  19  ILE n 
6  20  LEU n 
6  21  PHE n 
6  22  THR n 
6  23  THR n 
6  24  LEU n 
6  25  GLU n 
6  26  LYS n 
6  27  LEU n 
6  28  VAL n 
6  29  ALA n 
6  30  TRP n 
6  31  GLY n 
6  32  ARG n 
6  33  SER n 
6  34  ASN n 
6  35  SER n 
6  36  LEU n 
6  37  TRP n 
6  38  PRO n 
6  39  ALA n 
6  40  THR n 
6  41  PHE n 
6  42  GLY n 
6  43  LEU n 
6  44  ALA n 
6  45  CYS n 
6  46  CYS n 
6  47  ALA n 
6  48  ILE n 
6  49  GLU n 
6  50  MET n 
6  51  MET n 
6  52  ALA n 
6  53  SER n 
6  54  THR n 
6  55  ASP n 
6  56  ALA n 
6  57  ARG n 
6  58  ASN n 
6  59  ASP n 
6  60  LEU n 
6  61  ALA n 
6  62  ARG n 
6  63  PHE n 
6  64  GLY n 
6  65  SER n 
6  66  GLU n 
6  67  VAL n 
6  68  PHE n 
6  69  ARG n 
6  70  ALA n 
6  71  SER n 
6  72  PRO n 
6  73  ARG n 
6  74  GLN n 
6  75  ALA n 
6  76  ASP n 
6  77  VAL n 
6  78  MET n 
6  79  ILE n 
6  80  VAL n 
6  81  ALA n 
6  82  GLY n 
6  83  ARG n 
6  84  LEU n 
6  85  SER n 
6  86  LYS n 
6  87  LYS n 
6  88  MET n 
6  89  ALA n 
6  90  PRO n 
6  91  VAL n 
6  92  MET n 
6  93  ARG n 
6  94  ARG n 
6  95  VAL n 
6  96  TRP n 
6  97  GLU n 
6  98  GLN n 
6  99  MET n 
6  100 PRO n 
6  101 ASP n 
6  102 PRO n 
6  103 LYS n 
6  104 TRP n 
6  105 VAL n 
6  106 ILE n 
6  107 SER n 
6  108 MET n 
6  109 GLY n 
6  110 ALA n 
6  111 CYS n 
6  112 ALA n 
6  113 SER n 
6  114 SER n 
6  115 GLY n 
6  116 GLY n 
6  117 MET n 
6  118 PHE n 
6  119 ASN n 
6  120 ASN n 
6  121 TYR n 
6  122 ALA n 
6  123 ILE n 
6  124 VAL n 
6  125 GLN n 
6  126 ASN n 
6  127 VAL n 
6  128 ASP n 
6  129 SER n 
6  130 VAL n 
6  131 VAL n 
6  132 PRO n 
6  133 VAL n 
6  134 ASP n 
6  135 VAL n 
6  136 TYR n 
6  137 VAL n 
6  138 PRO n 
6  139 GLY n 
6  140 CYS n 
6  141 PRO n 
6  142 PRO n 
6  143 ARG n 
6  144 PRO n 
6  145 GLU n 
6  146 ALA n 
6  147 LEU n 
6  148 ILE n 
6  149 TYR n 
6  150 ALA n 
6  151 VAL n 
6  152 MET n 
6  153 GLN n 
6  154 LEU n 
6  155 GLN n 
6  156 LYS n 
6  157 LYS n 
6  158 VAL n 
6  159 ARG n 
6  160 GLY n 
6  161 GLN n 
6  162 ALA n 
6  163 TYR n 
6  164 ASN n 
6  165 GLU n 
6  166 ARG n 
6  167 GLY n 
6  168 GLU n 
6  169 ARG n 
6  170 LEU n 
6  171 PRO n 
6  172 PRO n 
6  173 VAL n 
6  174 ALA n 
6  175 ALA n 
6  176 TRP n 
6  177 LYS n 
6  178 ARG n 
6  179 THR n 
6  180 ARG n 
6  181 GLY n 
7  1   MET n 
7  2   THR n 
7  3   LEU n 
7  4   LYS n 
7  5   ALA n 
7  6   LEU n 
7  7   ALA n 
7  8   GLN n 
7  9   SER n 
7  10  LEU n 
7  11  GLY n 
7  12  ILE n 
7  13  THR n 
7  14  LEU n 
7  15  LYS n 
7  16  TYR n 
7  17  LEU n 
7  18  PHE n 
7  19  SER n 
7  20  LYS n 
7  21  PRO n 
7  22  VAL n 
7  23  THR n 
7  24  VAL n 
7  25  PRO n 
7  26  TYR n 
7  27  PRO n 
7  28  ASP n 
7  29  ALA n 
7  30  PRO n 
7  31  VAL n 
7  32  ALA n 
7  33  LEU n 
7  34  LYS n 
7  35  PRO n 
7  36  ARG n 
7  37  PHE n 
7  38  HIS n 
7  39  GLY n 
7  40  ARG n 
7  41  HIS n 
7  42  VAL n 
7  43  LEU n 
7  44  THR n 
7  45  ARG n 
7  46  HIS n 
7  47  PRO n 
7  48  ASN n 
7  49  GLY n 
7  50  LEU n 
7  51  GLU n 
7  52  LYS n 
7  53  CYS n 
7  54  ILE n 
7  55  GLY n 
7  56  CYS n 
7  57  SER n 
7  58  LEU n 
7  59  CYS n 
7  60  ALA n 
7  61  ALA n 
7  62  ALA n 
7  63  CYS n 
7  64  PRO n 
7  65  ALA n 
7  66  TYR n 
7  67  ALA n 
7  68  ILE n 
7  69  TYR n 
7  70  VAL n 
7  71  GLU n 
7  72  PRO n 
7  73  ALA n 
7  74  GLU n 
7  75  ASN n 
7  76  ASP n 
7  77  PRO n 
7  78  GLU n 
7  79  ASN n 
7  80  PRO n 
7  81  VAL n 
7  82  SER n 
7  83  ALA n 
7  84  GLY n 
7  85  GLU n 
7  86  ARG n 
7  87  TYR n 
7  88  ALA n 
7  89  LYS n 
7  90  VAL n 
7  91  TYR n 
7  92  GLU n 
7  93  ILE n 
7  94  ASN n 
7  95  MET n 
7  96  LEU n 
7  97  ARG n 
7  98  CYS n 
7  99  ILE n 
7  100 PHE n 
7  101 CYS n 
7  102 GLY n 
7  103 LEU n 
7  104 CYS n 
7  105 GLU n 
7  106 GLU n 
7  107 ALA n 
7  108 CYS n 
7  109 PRO n 
7  110 THR n 
7  111 GLY n 
7  112 ALA n 
7  113 ILE n 
7  114 VAL n 
7  115 LEU n 
7  116 GLY n 
7  117 TYR n 
7  118 ASP n 
7  119 PHE n 
7  120 GLU n 
7  121 MET n 
7  122 ALA n 
7  123 ASP n 
7  124 TYR n 
7  125 GLU n 
7  126 TYR n 
7  127 SER n 
7  128 ASP n 
7  129 LEU n 
7  130 VAL n 
7  131 TYR n 
7  132 GLY n 
7  133 LYS n 
7  134 GLU n 
7  135 ASP n 
7  136 MET n 
7  137 LEU n 
7  138 VAL n 
7  139 ASP n 
7  140 VAL n 
7  141 VAL n 
7  142 GLY n 
7  143 THR n 
7  144 LYS n 
7  145 PRO n 
7  146 GLN n 
7  147 ARG n 
7  148 ARG n 
7  149 GLU n 
7  150 ALA n 
7  151 LYS n 
7  152 ARG n 
7  153 THR n 
7  154 GLY n 
7  155 LYS n 
7  156 PRO n 
7  157 VAL n 
7  158 LYS n 
7  159 VAL n 
7  160 GLY n 
7  161 TYR n 
7  162 VAL n 
7  163 VAL n 
7  164 PRO n 
7  165 TYR n 
7  166 VAL n 
7  167 ARG n 
7  168 PRO n 
7  169 GLU n 
7  170 LEU n 
7  171 GLU n 
7  172 GLY n 
7  173 PHE n 
7  174 LYS n 
7  175 ALA n 
7  176 PRO n 
7  177 THR n 
7  178 GLU n 
7  179 GLY n 
7  180 GLY n 
7  181 LYS n 
7  182 ARG n 
8  1   MET n 
8  2   SER n 
8  3   ALA n 
8  4   SER n 
8  5   SER n 
8  6   GLU n 
8  7   ARG n 
8  8   GLU n 
8  9   LEU n 
8  10  TYR n 
8  11  GLU n 
8  12  ALA n 
8  13  TRP n 
8  14  VAL n 
8  15  GLU n 
8  16  LEU n 
8  17  LEU n 
8  18  SER n 
8  19  TRP n 
8  20  MET n 
8  21  ARG n 
8  22  GLU n 
8  23  TYR n 
8  24  ALA n 
8  25  GLN n 
8  26  ALA n 
8  27  LYS n 
8  28  GLY n 
8  29  VAL n 
8  30  ARG n 
8  31  PHE n 
8  32  GLU n 
8  33  LYS n 
8  34  GLU n 
8  35  ALA n 
8  36  ASP n 
8  37  PHE n 
8  38  PRO n 
8  39  ASP n 
8  40  PHE n 
8  41  ILE n 
8  42  TYR n 
8  43  ARG n 
8  44  MET n 
8  45  GLU n 
8  46  ARG n 
8  47  PRO n 
8  48  TYR n 
8  49  ASP n 
8  50  LEU n 
8  51  PRO n 
8  52  THR n 
8  53  THR n 
8  54  ILE n 
8  55  MET n 
8  56  THR n 
8  57  ALA n 
8  58  SER n 
8  59  LEU n 
8  60  SER n 
8  61  ASP n 
8  62  GLY n 
8  63  LEU n 
8  64  GLY n 
8  65  GLU n 
8  66  PRO n 
8  67  PHE n 
8  68  LEU n 
8  69  LEU n 
8  70  ALA n 
8  71  ASP n 
8  72  VAL n 
8  73  SER n 
8  74  PRO n 
8  75  ARG n 
8  76  HIS n 
8  77  ALA n 
8  78  LYS n 
8  79  LEU n 
8  80  LYS n 
8  81  ARG n 
8  82  ILE n 
8  83  GLY n 
8  84  LEU n 
8  85  ARG n 
8  86  LEU n 
8  87  PRO n 
8  88  ARG n 
8  89  ALA n 
8  90  HIS n 
8  91  ILE n 
8  92  HIS n 
8  93  LEU n 
8  94  HIS n 
8  95  ALA n 
8  96  HIS n 
8  97  TYR n 
8  98  GLU n 
8  99  PRO n 
8  100 GLY n 
8  101 LYS n 
8  102 GLY n 
8  103 LEU n 
8  104 VAL n 
8  105 THR n 
8  106 GLY n 
8  107 LYS n 
8  108 ILE n 
8  109 PRO n 
8  110 LEU n 
8  111 THR n 
8  112 LYS n 
8  113 GLU n 
8  114 ARG n 
8  115 PHE n 
8  116 PHE n 
8  117 ALA n 
8  118 LEU n 
8  119 ALA n 
8  120 ASP n 
8  121 ARG n 
8  122 ALA n 
8  123 ARG n 
8  124 GLU n 
8  125 ALA n 
8  126 LEU n 
8  127 ALA n 
8  128 PHE n 
8  129 ALA n 
9  1   MET n 
9  2   VAL n 
9  3   ARG n 
9  4   VAL n 
9  5   GLY n 
9  6   MET n 
9  7   ARG n 
9  8   ALA n 
9  9   ALA n 
9  10  PRO n 
9  11  ARG n 
9  12  VAL n 
9  13  SER n 
9  14  LEU n 
9  15  GLU n 
9  16  ALA n 
9  17  LEU n 
9  18  LYS n 
9  19  ALA n 
9  20  ALA n 
9  21  LEU n 
9  22  GLY n 
9  23  GLY n 
9  24  LEU n 
9  25  LYS n 
9  26  LEU n 
9  27  SER n 
9  28  GLU n 
9  29  ALA n 
9  30  LYS n 
9  31  VAL n 
9  32  TYR n 
9  33  LEU n 
9  34  ILE n 
9  35  THR n 
9  36  ASP n 
9  37  TRP n 
9  38  GLN n 
9  39  ASP n 
9  40  LYS n 
9  41  ARG n 
9  42  ASP n 
9  43  GLN n 
9  44  ALA n 
9  45  ARG n 
9  46  TYR n 
9  47  ALA n 
9  48  LEU n 
9  49  LEU n 
9  50  LEU n 
9  51  HIS n 
9  52  THR n 
9  53  GLY n 
9  54  LYS n 
9  55  LYS n 
9  56  ASP n 
9  57  LEU n 
9  58  LEU n 
9  59  VAL n 
9  60  PRO n 
9  61  ASP n 
9  62  ALA n 
9  63  PHE n 
9  64  GLY n 
9  65  PRO n 
9  66  ALA n 
9  67  PHE n 
9  68  PRO n 
9  69  GLY n 
9  70  GLY n 
9  71  GLU n 
9  72  GLU n 
9  73  ALA n 
9  74  LEU n 
9  75  SER n 
9  76  GLU n 
9  77  LEU n 
9  78  VAL n 
9  79  GLY n 
9  80  LEU n 
9  81  LEU n 
9  82  LEU n 
9  83  ALA n 
9  84  GLN n 
9  85  GLY n 
9  86  ALA n 
9  87  ARG n 
9  88  ARG n 
9  89  PHE n 
9  90  TYR n 
9  91  GLU n 
9  92  ALA n 
9  93  VAL n 
9  94  VAL n 
9  95  SER n 
9  96  PRO n 
9  97  GLY n 
9  98  GLU n 
9  99  MET n 
9  100 THR n 
9  101 ALA n 
9  102 LEU n 
9  103 LEU n 
9  104 ASP n 
9  105 LEU n 
9  106 PRO n 
9  107 PRO n 
9  108 GLU n 
9  109 GLU n 
9  110 LEU n 
9  111 LEU n 
9  112 LYS n 
9  113 ARG n 
9  114 VAL n 
9  115 MET n 
9  116 ALA n 
9  117 ILE n 
9  118 ALA n 
9  119 ASN n 
9  120 PRO n 
9  121 THR n 
9  122 ASP n 
9  123 PRO n 
9  124 GLY n 
9  125 ILE n 
9  126 TYR n 
9  127 LEU n 
9  128 LYS n 
9  129 ARG n 
9  130 ALA n 
9  131 ALA n 
10 1   MET n 
10 2   ALA n 
10 3   PRO n 
10 4   ILE n 
10 5   GLN n 
10 6   GLU n 
10 7   TYR n 
10 8   VAL n 
10 9   GLY n 
10 10  THR n 
10 11  LEU n 
10 12  ILE n 
10 13  TYR n 
10 14  VAL n 
10 15  GLY n 
10 16  VAL n 
10 17  ALA n 
10 18  LEU n 
10 19  PHE n 
10 20  ILE n 
10 21  GLY n 
10 22  VAL n 
10 23  ALA n 
10 24  ALA n 
10 25  LEU n 
10 26  LEU n 
10 27  VAL n 
10 28  GLY n 
10 29  ALA n 
10 30  LEU n 
10 31  LEU n 
10 32  GLY n 
10 33  PRO n 
10 34  LYS n 
10 35  LYS n 
10 36  PRO n 
10 37  GLY n 
10 38  ARG n 
10 39  ALA n 
10 40  LYS n 
10 41  LEU n 
10 42  MET n 
10 43  PRO n 
10 44  TYR n 
10 45  GLU n 
10 46  SER n 
10 47  GLY n 
10 48  ASN n 
10 49  ASP n 
10 50  PRO n 
10 51  ALA n 
10 52  GLY n 
10 53  GLU n 
10 54  VAL n 
10 55  LYS n 
10 56  ARG n 
10 57  PHE n 
10 58  PRO n 
10 59  VAL n 
10 60  HIS n 
10 61  PHE n 
10 62  TYR n 
10 63  VAL n 
10 64  VAL n 
10 65  ALA n 
10 66  MET n 
10 67  LEU n 
10 68  PHE n 
10 69  ILE n 
10 70  LEU n 
10 71  PHE n 
10 72  ASP n 
10 73  VAL n 
10 74  GLU n 
10 75  VAL n 
10 76  ALA n 
10 77  PHE n 
10 78  LEU n 
10 79  TRP n 
10 80  PRO n 
10 81  TYR n 
10 82  ALA n 
10 83  VAL n 
10 84  SER n 
10 85  ALA n 
10 86  GLY n 
10 87  GLY n 
10 88  LEU n 
10 89  GLY n 
10 90  LEU n 
10 91  TYR n 
10 92  GLY n 
10 93  PHE n 
10 94  LEU n 
10 95  GLY n 
10 96  VAL n 
10 97  LEU n 
10 98  ALA n 
10 99  PHE n 
10 100 THR n 
10 101 LEU n 
10 102 LEU n 
10 103 LEU n 
10 104 PHE n 
10 105 VAL n 
10 106 GLY n 
10 107 PHE n 
10 108 LEU n 
10 109 TYR n 
10 110 GLU n 
10 111 TRP n 
10 112 TRP n 
10 113 LYS n 
10 114 GLY n 
10 115 VAL n 
10 116 MET n 
10 117 ARG n 
10 118 TRP n 
10 119 HIS n 
11 1   MET n 
11 2   SER n 
11 3   LEU n 
11 4   LEU n 
11 5   GLU n 
11 6   GLY n 
11 7   LEU n 
11 8   ALA n 
11 9   LEU n 
11 10  PHE n 
11 11  LEU n 
11 12  LEU n 
11 13  LEU n 
11 14  LEU n 
11 15  SER n 
11 16  GLY n 
11 17  VAL n 
11 18  LEU n 
11 19  VAL n 
11 20  VAL n 
11 21  THR n 
11 22  LEU n 
11 23  ARG n 
11 24  ASN n 
11 25  ALA n 
11 26  ILE n 
11 27  HIS n 
11 28  ALA n 
11 29  ALA n 
11 30  LEU n 
11 31  ALA n 
11 32  LEU n 
11 33  ILE n 
11 34  LEU n 
11 35  ASN n 
11 36  PHE n 
11 37  LEU n 
11 38  VAL n 
11 39  LEU n 
11 40  ALA n 
11 41  GLY n 
11 42  VAL n 
11 43  TYR n 
11 44  VAL n 
11 45  ALA n 
11 46  LEU n 
11 47  ASP n 
11 48  ALA n 
11 49  ARG n 
11 50  PHE n 
11 51  LEU n 
11 52  GLY n 
11 53  PHE n 
11 54  ILE n 
11 55  GLN n 
11 56  VAL n 
11 57  ILE n 
11 58  VAL n 
11 59  TYR n 
11 60  ALA n 
11 61  GLY n 
11 62  ALA n 
11 63  ILE n 
11 64  VAL n 
11 65  VAL n 
11 66  LEU n 
11 67  PHE n 
11 68  LEU n 
11 69  PHE n 
11 70  VAL n 
11 71  ILE n 
11 72  MET n 
11 73  LEU n 
11 74  LEU n 
11 75  PHE n 
11 76  ALA n 
11 77  ALA n 
11 78  GLN n 
11 79  GLY n 
11 80  GLU n 
11 81  ILE n 
11 82  GLY n 
11 83  PHE n 
11 84  ASP n 
11 85  PRO n 
11 86  LEU n 
11 87  VAL n 
11 88  ARG n 
11 89  SER n 
11 90  ARG n 
11 91  PRO n 
11 92  LEU n 
11 93  ALA n 
11 94  ALA n 
11 95  LEU n 
11 96  LEU n 
11 97  ALA n 
11 98  LEU n 
11 99  GLY n 
11 100 VAL n 
11 101 ALA n 
11 102 GLY n 
11 103 ILE n 
11 104 LEU n 
11 105 ALA n 
11 106 ALA n 
11 107 GLY n 
11 108 LEU n 
11 109 TRP n 
11 110 GLY n 
11 111 LEU n 
11 112 ASP n 
11 113 LEU n 
11 114 ALA n 
11 115 PHE n 
11 116 THR n 
11 117 GLN n 
11 118 ASP n 
11 119 LEU n 
11 120 LYS n 
11 121 GLY n 
11 122 GLY n 
11 123 LEU n 
11 124 PRO n 
11 125 GLN n 
11 126 ALA n 
11 127 LEU n 
11 128 GLY n 
11 129 PRO n 
11 130 LEU n 
11 131 LEU n 
11 132 TYR n 
11 133 GLY n 
11 134 ASP n 
11 135 TRP n 
11 136 LEU n 
11 137 PHE n 
11 138 VAL n 
11 139 LEU n 
11 140 LEU n 
11 141 ALA n 
11 142 VAL n 
11 143 GLY n 
11 144 PHE n 
11 145 LEU n 
11 146 LEU n 
11 147 MET n 
11 148 ALA n 
11 149 ALA n 
11 150 THR n 
11 151 VAL n 
11 152 VAL n 
11 153 ALA n 
11 154 VAL n 
11 155 ALA n 
11 156 LEU n 
11 157 VAL n 
11 158 GLU n 
11 159 PRO n 
11 160 GLY n 
11 161 LYS n 
11 162 ALA n 
11 163 SER n 
11 164 ARG n 
11 165 ALA n 
11 166 LYS n 
11 167 GLU n 
11 168 ALA n 
11 169 GLU n 
11 170 LYS n 
11 171 ARG n 
11 172 GLU n 
11 173 GLU n 
11 174 VAL n 
11 175 ALA n 
11 176 ARG n 
12 1   MET n 
12 2   SER n 
12 3   TYR n 
12 4   LEU n 
12 5   LEU n 
12 6   THR n 
12 7   SER n 
12 8   ALA n 
12 9   LEU n 
12 10  LEU n 
12 11  PHE n 
12 12  ALA n 
12 13  LEU n 
12 14  GLY n 
12 15  VAL n 
12 16  TYR n 
12 17  GLY n 
12 18  VAL n 
12 19  LEU n 
12 20  THR n 
12 21  ARG n 
12 22  ARG n 
12 23  THR n 
12 24  ALA n 
12 25  ILE n 
12 26  LEU n 
12 27  VAL n 
12 28  PHE n 
12 29  LEU n 
12 30  SER n 
12 31  ILE n 
12 32  GLU n 
12 33  LEU n 
12 34  MET n 
12 35  LEU n 
12 36  ASN n 
12 37  ALA n 
12 38  ALA n 
12 39  ASN n 
12 40  LEU n 
12 41  SER n 
12 42  LEU n 
12 43  VAL n 
12 44  GLY n 
12 45  PHE n 
12 46  ALA n 
12 47  ARG n 
12 48  ALA n 
12 49  TYR n 
12 50  GLY n 
12 51  LEU n 
12 52  ASP n 
12 53  GLY n 
12 54  GLN n 
12 55  VAL n 
12 56  ALA n 
12 57  ALA n 
12 58  LEU n 
12 59  MET n 
12 60  VAL n 
12 61  ILE n 
12 62  ALA n 
12 63  VAL n 
12 64  ALA n 
12 65  ALA n 
12 66  ALA n 
12 67  GLU n 
12 68  VAL n 
12 69  ALA n 
12 70  VAL n 
12 71  GLY n 
12 72  LEU n 
12 73  GLY n 
12 74  LEU n 
12 75  ILE n 
12 76  VAL n 
12 77  ALA n 
12 78  ILE n 
12 79  PHE n 
12 80  ARG n 
12 81  HIS n 
12 82  ARG n 
12 83  GLU n 
12 84  SER n 
12 85  THR n 
12 86  ALA n 
12 87  VAL n 
12 88  ASP n 
12 89  ASP n 
12 90  LEU n 
12 91  SER n 
12 92  GLU n 
12 93  LEU n 
12 94  ARG n 
12 95  GLY n 
13 1   MET n 
13 2   ALA n 
13 3   LEU n 
13 4   LEU n 
13 5   GLY n 
13 6   THR n 
13 7   ILE n 
13 8   LEU n 
13 9   LEU n 
13 10  PRO n 
13 11  LEU n 
13 12  LEU n 
13 13  GLY n 
13 14  PHE n 
13 15  ALA n 
13 16  LEU n 
13 17  LEU n 
13 18  GLY n 
13 19  LEU n 
13 20  PHE n 
13 21  GLY n 
13 22  LYS n 
13 23  ARG n 
13 24  MET n 
13 25  ARG n 
13 26  GLU n 
13 27  PRO n 
13 28  LEU n 
13 29  PRO n 
13 30  GLY n 
13 31  VAL n 
13 32  LEU n 
13 33  ALA n 
13 34  SER n 
13 35  GLY n 
13 36  LEU n 
13 37  VAL n 
13 38  LEU n 
13 39  ALA n 
13 40  SER n 
13 41  PHE n 
13 42  LEU n 
13 43  LEU n 
13 44  GLY n 
13 45  ALA n 
13 46  GLY n 
13 47  LEU n 
13 48  LEU n 
13 49  LEU n 
13 50  SER n 
13 51  GLY n 
13 52  GLY n 
13 53  ALA n 
13 54  ARG n 
13 55  PHE n 
13 56  GLN n 
13 57  ALA n 
13 58  GLU n 
13 59  TRP n 
13 60  LEU n 
13 61  PRO n 
13 62  GLY n 
13 63  ILE n 
13 64  PRO n 
13 65  PHE n 
13 66  SER n 
13 67  LEU n 
13 68  LEU n 
13 69  LEU n 
13 70  ASP n 
13 71  ASN n 
13 72  LEU n 
13 73  SER n 
13 74  GLY n 
13 75  PHE n 
13 76  MET n 
13 77  LEU n 
13 78  LEU n 
13 79  ILE n 
13 80  VAL n 
13 81  THR n 
13 82  GLY n 
13 83  VAL n 
13 84  GLY n 
13 85  PHE n 
13 86  LEU n 
13 87  ILE n 
13 88  HIS n 
13 89  VAL n 
13 90  TYR n 
13 91  ALA n 
13 92  ILE n 
13 93  GLY n 
13 94  TYR n 
13 95  MET n 
13 96  GLY n 
13 97  GLY n 
13 98  ASP n 
13 99  PRO n 
13 100 GLY n 
13 101 TYR n 
13 102 SER n 
13 103 ARG n 
13 104 PHE n 
13 105 PHE n 
13 106 ALA n 
13 107 TYR n 
13 108 PHE n 
13 109 ASN n 
13 110 LEU n 
13 111 PHE n 
13 112 ILE n 
13 113 ALA n 
13 114 MET n 
13 115 MET n 
13 116 LEU n 
13 117 THR n 
13 118 LEU n 
13 119 VAL n 
13 120 LEU n 
13 121 ALA n 
13 122 ASP n 
13 123 SER n 
13 124 TYR n 
13 125 PRO n 
13 126 VAL n 
13 127 MET n 
13 128 PHE n 
13 129 ILE n 
13 130 GLY n 
13 131 TRP n 
13 132 GLU n 
13 133 GLY n 
13 134 VAL n 
13 135 GLY n 
13 136 LEU n 
13 137 ALA n 
13 138 SER n 
13 139 PHE n 
13 140 LEU n 
13 141 LEU n 
13 142 ILE n 
13 143 GLY n 
13 144 PHE n 
13 145 TRP n 
13 146 TYR n 
13 147 LYS n 
13 148 ASN n 
13 149 PRO n 
13 150 GLN n 
13 151 TYR n 
13 152 ALA n 
13 153 ASP n 
13 154 SER n 
13 155 ALA n 
13 156 ARG n 
13 157 LYS n 
13 158 ALA n 
13 159 PHE n 
13 160 ILE n 
13 161 VAL n 
13 162 ASN n 
13 163 ARG n 
13 164 ILE n 
13 165 GLY n 
13 166 ASP n 
13 167 LEU n 
13 168 GLY n 
13 169 PHE n 
13 170 MET n 
13 171 LEU n 
13 172 GLY n 
13 173 MET n 
13 174 ALA n 
13 175 ILE n 
13 176 LEU n 
13 177 TRP n 
13 178 ALA n 
13 179 LEU n 
13 180 TYR n 
13 181 GLY n 
13 182 THR n 
13 183 LEU n 
13 184 SER n 
13 185 ILE n 
13 186 SER n 
13 187 GLU n 
13 188 LEU n 
13 189 LYS n 
13 190 GLU n 
13 191 ALA n 
13 192 MET n 
13 193 GLU n 
13 194 GLY n 
13 195 PRO n 
13 196 LEU n 
13 197 LYS n 
13 198 ASN n 
13 199 PRO n 
13 200 ASP n 
13 201 LEU n 
13 202 LEU n 
13 203 ALA n 
13 204 LEU n 
13 205 ALA n 
13 206 GLY n 
13 207 LEU n 
13 208 LEU n 
13 209 LEU n 
13 210 PHE n 
13 211 LEU n 
13 212 GLY n 
13 213 ALA n 
13 214 VAL n 
13 215 GLY n 
13 216 LYS n 
13 217 SER n 
13 218 ALA n 
13 219 GLN n 
13 220 ILE n 
13 221 PRO n 
13 222 LEU n 
13 223 MET n 
13 224 VAL n 
13 225 TRP n 
13 226 LEU n 
13 227 PRO n 
13 228 ASP n 
13 229 ALA n 
13 230 MET n 
13 231 ALA n 
13 232 GLY n 
13 233 PRO n 
13 234 THR n 
13 235 PRO n 
13 236 VAL n 
13 237 SER n 
13 238 ALA n 
13 239 LEU n 
13 240 ILE n 
13 241 HIS n 
13 242 ALA n 
13 243 ALA n 
13 244 THR n 
13 245 MET n 
13 246 VAL n 
13 247 THR n 
13 248 ALA n 
13 249 GLY n 
13 250 VAL n 
13 251 TYR n 
13 252 LEU n 
13 253 ILE n 
13 254 ALA n 
13 255 ARG n 
13 256 SER n 
13 257 SER n 
13 258 PHE n 
13 259 LEU n 
13 260 TYR n 
13 261 SER n 
13 262 VAL n 
13 263 LEU n 
13 264 PRO n 
13 265 ASP n 
13 266 VAL n 
13 267 SER n 
13 268 TYR n 
13 269 ALA n 
13 270 ILE n 
13 271 ALA n 
13 272 VAL n 
13 273 VAL n 
13 274 GLY n 
13 275 LEU n 
13 276 LEU n 
13 277 THR n 
13 278 ALA n 
13 279 ALA n 
13 280 TYR n 
13 281 GLY n 
13 282 ALA n 
13 283 LEU n 
13 284 SER n 
13 285 ALA n 
13 286 PHE n 
13 287 GLY n 
13 288 GLN n 
13 289 THR n 
13 290 ASP n 
13 291 ILE n 
13 292 LYS n 
13 293 LYS n 
13 294 ILE n 
13 295 VAL n 
13 296 ALA n 
13 297 TYR n 
13 298 SER n 
13 299 THR n 
13 300 ILE n 
13 301 SER n 
13 302 GLN n 
13 303 LEU n 
13 304 GLY n 
13 305 TYR n 
13 306 MET n 
13 307 PHE n 
13 308 LEU n 
13 309 ALA n 
13 310 ALA n 
13 311 GLY n 
13 312 VAL n 
13 313 GLY n 
13 314 ALA n 
13 315 TYR n 
13 316 TRP n 
13 317 VAL n 
13 318 ALA n 
13 319 LEU n 
13 320 PHE n 
13 321 HIS n 
13 322 VAL n 
13 323 PHE n 
13 324 THR n 
13 325 HIS n 
13 326 ALA n 
13 327 PHE n 
13 328 PHE n 
13 329 LYS n 
13 330 ALA n 
13 331 LEU n 
13 332 LEU n 
13 333 PHE n 
13 334 LEU n 
13 335 ALA n 
13 336 SER n 
13 337 GLY n 
13 338 SER n 
13 339 VAL n 
13 340 ILE n 
13 341 HIS n 
13 342 ALA n 
13 343 LEU n 
13 344 GLY n 
13 345 GLY n 
13 346 GLU n 
13 347 GLN n 
13 348 ASP n 
13 349 VAL n 
13 350 ARG n 
13 351 LYS n 
13 352 MET n 
13 353 GLY n 
13 354 GLY n 
13 355 LEU n 
13 356 TRP n 
13 357 LYS n 
13 358 HIS n 
13 359 LEU n 
13 360 PRO n 
13 361 GLN n 
13 362 THR n 
13 363 ARG n 
13 364 TRP n 
13 365 HIS n 
13 366 ALA n 
13 367 LEU n 
13 368 ILE n 
13 369 GLY n 
13 370 ALA n 
13 371 LEU n 
13 372 ALA n 
13 373 LEU n 
13 374 GLY n 
13 375 GLY n 
13 376 LEU n 
13 377 PRO n 
13 378 LEU n 
13 379 LEU n 
13 380 SER n 
13 381 GLY n 
13 382 PHE n 
13 383 TRP n 
13 384 SER n 
13 385 LYS n 
13 386 ASP n 
13 387 ALA n 
13 388 ILE n 
13 389 LEU n 
13 390 ALA n 
13 391 ALA n 
13 392 THR n 
13 393 LEU n 
13 394 THR n 
13 395 TYR n 
13 396 PRO n 
13 397 PHE n 
13 398 GLY n 
13 399 GLY n 
13 400 VAL n 
13 401 GLY n 
13 402 PHE n 
13 403 TYR n 
13 404 VAL n 
13 405 GLY n 
13 406 ALA n 
13 407 LEU n 
13 408 LEU n 
13 409 VAL n 
13 410 ALA n 
13 411 VAL n 
13 412 LEU n 
13 413 THR n 
13 414 ALA n 
13 415 MET n 
13 416 TYR n 
13 417 ALA n 
13 418 MET n 
13 419 ARG n 
13 420 TRP n 
13 421 PHE n 
13 422 VAL n 
13 423 LEU n 
13 424 VAL n 
13 425 PHE n 
13 426 LEU n 
13 427 GLY n 
13 428 GLU n 
13 429 GLU n 
13 430 ARG n 
13 431 GLY n 
13 432 HIS n 
13 433 HIS n 
13 434 HIS n 
13 435 PRO n 
13 436 HIS n 
13 437 GLU n 
13 438 ALA n 
13 439 PRO n 
13 440 PRO n 
13 441 VAL n 
13 442 MET n 
13 443 LEU n 
13 444 TRP n 
13 445 PRO n 
13 446 ASN n 
13 447 HIS n 
13 448 LEU n 
13 449 LEU n 
13 450 ALA n 
13 451 LEU n 
13 452 GLY n 
13 453 SER n 
13 454 VAL n 
13 455 LEU n 
13 456 ALA n 
13 457 GLY n 
13 458 TYR n 
13 459 LEU n 
13 460 ALA n 
13 461 LEU n 
13 462 PRO n 
13 463 HIS n 
13 464 PRO n 
13 465 LEU n 
13 466 PRO n 
13 467 ASN n 
13 468 VAL n 
13 469 LEU n 
13 470 GLU n 
13 471 PRO n 
13 472 PHE n 
13 473 LEU n 
13 474 LYS n 
13 475 PRO n 
13 476 ALA n 
13 477 LEU n 
13 478 ALA n 
13 479 GLU n 
13 480 VAL n 
13 481 GLU n 
13 482 ALA n 
13 483 HIS n 
13 484 HIS n 
13 485 LEU n 
13 486 SER n 
13 487 LEU n 
13 488 GLY n 
13 489 ALA n 
13 490 GLU n 
13 491 TRP n 
13 492 GLY n 
13 493 LEU n 
13 494 ILE n 
13 495 ALA n 
13 496 LEU n 
13 497 SER n 
13 498 ALA n 
13 499 ALA n 
13 500 VAL n 
13 501 ALA n 
13 502 LEU n 
13 503 LEU n 
13 504 GLY n 
13 505 LEU n 
13 506 TRP n 
13 507 ALA n 
13 508 GLY n 
13 509 PHE n 
13 510 VAL n 
13 511 PHE n 
13 512 PHE n 
13 513 GLN n 
13 514 ARG n 
13 515 LYS n 
13 516 VAL n 
13 517 PHE n 
13 518 PRO n 
13 519 ALA n 
13 520 TRP n 
13 521 TYR n 
13 522 LEU n 
13 523 ALA n 
13 524 PHE n 
13 525 GLU n 
13 526 ALA n 
13 527 ALA n 
13 528 SER n 
13 529 ARG n 
13 530 GLU n 
13 531 ALA n 
13 532 PHE n 
13 533 TYR n 
13 534 VAL n 
13 535 ASP n 
13 536 ARG n 
13 537 ALA n 
13 538 TYR n 
13 539 ASN n 
13 540 ALA n 
13 541 LEU n 
13 542 ILE n 
13 543 VAL n 
13 544 ASN n 
13 545 PRO n 
13 546 LEU n 
13 547 LYS n 
13 548 ALA n 
13 549 LEU n 
13 550 ALA n 
13 551 GLU n 
13 552 ALA n 
13 553 LEU n 
13 554 PHE n 
13 555 TYR n 
13 556 GLY n 
13 557 ASP n 
13 558 ARG n 
13 559 GLY n 
13 560 LEU n 
13 561 LEU n 
13 562 SER n 
13 563 GLY n 
13 564 TYR n 
13 565 PHE n 
13 566 GLY n 
13 567 LEU n 
13 568 GLY n 
13 569 GLY n 
13 570 ALA n 
13 571 ALA n 
13 572 ARG n 
13 573 SER n 
13 574 LEU n 
13 575 GLY n 
13 576 GLN n 
13 577 GLY n 
13 578 LEU n 
13 579 ALA n 
13 580 ARG n 
13 581 LEU n 
13 582 GLN n 
13 583 THR n 
13 584 GLY n 
13 585 TYR n 
13 586 LEU n 
13 587 ARG n 
13 588 VAL n 
13 589 TYR n 
13 590 ALA n 
13 591 LEU n 
13 592 LEU n 
13 593 PHE n 
13 594 VAL n 
13 595 LEU n 
13 596 GLY n 
13 597 ALA n 
13 598 LEU n 
13 599 LEU n 
13 600 LEU n 
13 601 LEU n 
13 602 GLY n 
13 603 VAL n 
13 604 MET n 
13 605 ARG n 
13 606 TRP n 
14 1   MET n 
14 2   VAL n 
14 3   VAL n 
14 4   LEU n 
14 5   ALA n 
14 6   VAL n 
14 7   LEU n 
14 8   LEU n 
14 9   PRO n 
14 10  VAL n 
14 11  VAL n 
14 12  PHE n 
14 13  GLY n 
14 14  ALA n 
14 15  LEU n 
14 16  LEU n 
14 17  LEU n 
14 18  LEU n 
14 19  GLY n 
14 20  LEU n 
14 21  PRO n 
14 22  ARG n 
14 23  ALA n 
14 24  LEU n 
14 25  GLY n 
14 26  VAL n 
14 27  LEU n 
14 28  GLY n 
14 29  ALA n 
14 30  GLY n 
14 31  LEU n 
14 32  SER n 
14 33  PHE n 
14 34  LEU n 
14 35  LEU n 
14 36  ASN n 
14 37  LEU n 
14 38  TYR n 
14 39  LEU n 
14 40  PHE n 
14 41  LEU n 
14 42  THR n 
14 43  HIS n 
14 44  PRO n 
14 45  GLY n 
14 46  GLY n 
14 47  VAL n 
14 48  ALA n 
14 49  HIS n 
14 50  ALA n 
14 51  PHE n 
14 52  GLN n 
14 53  ALA n 
14 54  PRO n 
14 55  LEU n 
14 56  LEU n 
14 57  PRO n 
14 58  GLY n 
14 59  ALA n 
14 60  GLY n 
14 61  VAL n 
14 62  TYR n 
14 63  TRP n 
14 64  ALA n 
14 65  PHE n 
14 66  GLY n 
14 67  LEU n 
14 68  ASP n 
14 69  GLY n 
14 70  LEU n 
14 71  SER n 
14 72  ALA n 
14 73  LEU n 
14 74  PHE n 
14 75  PHE n 
14 76  LEU n 
14 77  THR n 
14 78  ILE n 
14 79  ALA n 
14 80  LEU n 
14 81  THR n 
14 82  VAL n 
14 83  PHE n 
14 84  LEU n 
14 85  GLY n 
14 86  ALA n 
14 87  LEU n 
14 88  VAL n 
14 89  ALA n 
14 90  ARG n 
14 91  VAL n 
14 92  GLU n 
14 93  GLY n 
14 94  ARG n 
14 95  PHE n 
14 96  LEU n 
14 97  GLY n 
14 98  LEU n 
14 99  ALA n 
14 100 LEU n 
14 101 LEU n 
14 102 MET n 
14 103 GLU n 
14 104 GLY n 
14 105 LEU n 
14 106 LEU n 
14 107 LEU n 
14 108 GLY n 
14 109 LEU n 
14 110 PHE n 
14 111 ALA n 
14 112 ALA n 
14 113 ARG n 
14 114 ASP n 
14 115 LEU n 
14 116 LEU n 
14 117 VAL n 
14 118 PHE n 
14 119 TYR n 
14 120 VAL n 
14 121 PHE n 
14 122 PHE n 
14 123 GLU n 
14 124 ALA n 
14 125 ALA n 
14 126 LEU n 
14 127 ILE n 
14 128 PRO n 
14 129 ALA n 
14 130 LEU n 
14 131 LEU n 
14 132 MET n 
14 133 LEU n 
14 134 TYR n 
14 135 LEU n 
14 136 TYR n 
14 137 GLY n 
14 138 GLY n 
14 139 GLU n 
14 140 GLY n 
14 141 ARG n 
14 142 THR n 
14 143 ARG n 
14 144 ALA n 
14 145 LEU n 
14 146 TYR n 
14 147 THR n 
14 148 PHE n 
14 149 VAL n 
14 150 LEU n 
14 151 PHE n 
14 152 THR n 
14 153 LEU n 
14 154 VAL n 
14 155 GLY n 
14 156 SER n 
14 157 LEU n 
14 158 PRO n 
14 159 MET n 
14 160 LEU n 
14 161 ALA n 
14 162 ALA n 
14 163 VAL n 
14 164 LEU n 
14 165 GLY n 
14 166 ALA n 
14 167 ARG n 
14 168 LEU n 
14 169 LEU n 
14 170 SER n 
14 171 GLY n 
14 172 SER n 
14 173 PRO n 
14 174 THR n 
14 175 PHE n 
14 176 LEU n 
14 177 LEU n 
14 178 GLU n 
14 179 ASP n 
14 180 LEU n 
14 181 LEU n 
14 182 ALA n 
14 183 HIS n 
14 184 PRO n 
14 185 LEU n 
14 186 GLN n 
14 187 GLU n 
14 188 GLU n 
14 189 ALA n 
14 190 ALA n 
14 191 PHE n 
14 192 TRP n 
14 193 VAL n 
14 194 PHE n 
14 195 LEU n 
14 196 GLY n 
14 197 PHE n 
14 198 ALA n 
14 199 LEU n 
14 200 ALA n 
14 201 PHE n 
14 202 ALA n 
14 203 ILE n 
14 204 LYS n 
14 205 THR n 
14 206 PRO n 
14 207 LEU n 
14 208 PHE n 
14 209 PRO n 
14 210 LEU n 
14 211 HIS n 
14 212 ALA n 
14 213 TRP n 
14 214 LEU n 
14 215 PRO n 
14 216 PRO n 
14 217 PHE n 
14 218 HIS n 
14 219 GLN n 
14 220 GLU n 
14 221 ASN n 
14 222 HIS n 
14 223 PRO n 
14 224 SER n 
14 225 GLY n 
14 226 LEU n 
14 227 ALA n 
14 228 ASP n 
14 229 ALA n 
14 230 LEU n 
14 231 GLY n 
14 232 THR n 
14 233 LEU n 
14 234 TYR n 
14 235 LYS n 
14 236 VAL n 
14 237 GLY n 
14 238 VAL n 
14 239 PHE n 
14 240 ALA n 
14 241 PHE n 
14 242 PHE n 
14 243 ARG n 
14 244 PHE n 
14 245 ALA n 
14 246 ILE n 
14 247 PRO n 
14 248 LEU n 
14 249 ALA n 
14 250 PRO n 
14 251 GLU n 
14 252 GLY n 
14 253 PHE n 
14 254 ALA n 
14 255 GLN n 
14 256 ALA n 
14 257 GLN n 
14 258 GLY n 
14 259 LEU n 
14 260 LEU n 
14 261 LEU n 
14 262 PHE n 
14 263 LEU n 
14 264 ALA n 
14 265 ALA n 
14 266 LEU n 
14 267 SER n 
14 268 ALA n 
14 269 LEU n 
14 270 TYR n 
14 271 GLY n 
14 272 ALA n 
14 273 TRP n 
14 274 VAL n 
14 275 ALA n 
14 276 PHE n 
14 277 ALA n 
14 278 ALA n 
14 279 LYS n 
14 280 ASP n 
14 281 PHE n 
14 282 LYS n 
14 283 THR n 
14 284 LEU n 
14 285 LEU n 
14 286 ALA n 
14 287 TYR n 
14 288 ALA n 
14 289 GLY n 
14 290 LEU n 
14 291 SER n 
14 292 HIS n 
14 293 MET n 
14 294 GLY n 
14 295 VAL n 
14 296 ALA n 
14 297 ALA n 
14 298 LEU n 
14 299 GLY n 
14 300 VAL n 
14 301 PHE n 
14 302 SER n 
14 303 GLY n 
14 304 THR n 
14 305 PRO n 
14 306 GLU n 
14 307 GLY n 
14 308 ALA n 
14 309 MET n 
14 310 GLY n 
14 311 GLY n 
14 312 LEU n 
14 313 TYR n 
14 314 LEU n 
14 315 LEU n 
14 316 ALA n 
14 317 ALA n 
14 318 SER n 
14 319 GLY n 
14 320 VAL n 
14 321 TYR n 
14 322 THR n 
14 323 GLY n 
14 324 GLY n 
14 325 LEU n 
14 326 PHE n 
14 327 LEU n 
14 328 LEU n 
14 329 ALA n 
14 330 GLY n 
14 331 ARG n 
14 332 LEU n 
14 333 TYR n 
14 334 GLU n 
14 335 ARG n 
14 336 THR n 
14 337 GLY n 
14 338 THR n 
14 339 LEU n 
14 340 GLU n 
14 341 ILE n 
14 342 GLY n 
14 343 ARG n 
14 344 TYR n 
14 345 ARG n 
14 346 GLY n 
14 347 LEU n 
14 348 ALA n 
14 349 GLN n 
14 350 SER n 
14 351 ALA n 
14 352 PRO n 
14 353 GLY n 
14 354 LEU n 
14 355 ALA n 
14 356 ALA n 
14 357 LEU n 
14 358 ALA n 
14 359 LEU n 
14 360 ILE n 
14 361 LEU n 
14 362 PHE n 
14 363 LEU n 
14 364 ALA n 
14 365 MET n 
14 366 VAL n 
14 367 GLY n 
14 368 LEU n 
14 369 PRO n 
14 370 GLY n 
14 371 LEU n 
14 372 SER n 
14 373 GLY n 
14 374 PHE n 
14 375 PRO n 
14 376 GLY n 
14 377 GLU n 
14 378 PHE n 
14 379 LEU n 
14 380 THR n 
14 381 LEU n 
14 382 LEU n 
14 383 GLY n 
14 384 ALA n 
14 385 TYR n 
14 386 LYS n 
14 387 ALA n 
14 388 SER n 
14 389 PRO n 
14 390 TRP n 
14 391 LEU n 
14 392 ALA n 
14 393 ALA n 
14 394 LEU n 
14 395 ALA n 
14 396 PHE n 
14 397 LEU n 
14 398 SER n 
14 399 VAL n 
14 400 ILE n 
14 401 ALA n 
14 402 SER n 
14 403 ALA n 
14 404 ALA n 
14 405 TYR n 
14 406 ALA n 
14 407 LEU n 
14 408 THR n 
14 409 ALA n 
14 410 PHE n 
14 411 GLN n 
14 412 LYS n 
14 413 THR n 
14 414 PHE n 
14 415 TRP n 
14 416 GLU n 
14 417 GLU n 
14 418 GLY n 
14 419 GLY n 
14 420 SER n 
14 421 GLY n 
14 422 VAL n 
14 423 LYS n 
14 424 ASP n 
14 425 LEU n 
14 426 ALA n 
14 427 GLY n 
14 428 ALA n 
14 429 GLU n 
14 430 TRP n 
14 431 GLY n 
14 432 PHE n 
14 433 ALA n 
14 434 LEU n 
14 435 LEU n 
14 436 SER n 
14 437 VAL n 
14 438 LEU n 
14 439 ALA n 
14 440 LEU n 
14 441 LEU n 
14 442 LEU n 
14 443 MET n 
14 444 GLY n 
14 445 VAL n 
14 446 PHE n 
14 447 PRO n 
14 448 GLY n 
14 449 TYR n 
14 450 PHE n 
14 451 ALA n 
14 452 ARG n 
14 453 GLY n 
14 454 LEU n 
14 455 HIS n 
14 456 PRO n 
14 457 LEU n 
14 458 ALA n 
14 459 GLU n 
14 460 ALA n 
14 461 PHE n 
14 462 ALA n 
14 463 LYS n 
14 464 LEU n 
14 465 LEU n 
14 466 GLY n 
14 467 GLY n 
14 468 GLY n 
14 469 ALA n 
15 1   MET n 
15 2   THR n 
15 3   LEU n 
15 4   ALA n 
15 5   ILE n 
15 6   LEU n 
15 7   ALA n 
15 8   VAL n 
15 9   PHE n 
15 10  SER n 
15 11  VAL n 
15 12  ALA n 
15 13  LEU n 
15 14  THR n 
15 15  LEU n 
15 16  LEU n 
15 17  GLY n 
15 18  PHE n 
15 19  VAL n 
15 20  LEU n 
15 21  PRO n 
15 22  PRO n 
15 23  GLN n 
15 24  GLY n 
15 25  VAL n 
15 26  LYS n 
15 27  ARG n 
15 28  ALA n 
15 29  THR n 
15 30  LEU n 
15 31  LEU n 
15 32  GLY n 
15 33  LEU n 
15 34  ALA n 
15 35  LEU n 
15 36  ALA n 
15 37  LEU n 
15 38  ALA n 
15 39  SER n 
15 40  LEU n 
15 41  LEU n 
15 42  LEU n 
15 43  THR n 
15 44  TRP n 
15 45  GLY n 
15 46  LYS n 
15 47  PRO n 
15 48  PHE n 
15 49  ALA n 
15 50  PHE n 
15 51  GLY n 
15 52  PRO n 
15 53  TYR n 
15 54  ALA n 
15 55  VAL n 
15 56  ASP n 
15 57  GLY n 
15 58  VAL n 
15 59  SER n 
15 60  GLN n 
15 61  VAL n 
15 62  PHE n 
15 63  THR n 
15 64  LEU n 
15 65  LEU n 
15 66  ALA n 
15 67  LEU n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  LEU n 
15 72  TRP n 
15 73  THR n 
15 74  VAL n 
15 75  GLY n 
15 76  LEU n 
15 77  VAL n 
15 78  ARG n 
15 79  SER n 
15 80  GLY n 
15 81  ARG n 
15 82  PHE n 
15 83  GLU n 
15 84  PHE n 
15 85  TYR n 
15 86  LEU n 
15 87  LEU n 
15 88  VAL n 
15 89  LEU n 
15 90  TYR n 
15 91  ALA n 
15 92  ALA n 
15 93  LEU n 
15 94  GLY n 
15 95  MET n 
15 96  HIS n 
15 97  LEU n 
15 98  LEU n 
15 99  ALA n 
15 100 SER n 
15 101 THR n 
15 102 ARG n 
15 103 HIS n 
15 104 LEU n 
15 105 LEU n 
15 106 LEU n 
15 107 MET n 
15 108 LEU n 
15 109 VAL n 
15 110 ALA n 
15 111 LEU n 
15 112 GLU n 
15 113 ALA n 
15 114 LEU n 
15 115 SER n 
15 116 LEU n 
15 117 PRO n 
15 118 LEU n 
15 119 TYR n 
15 120 ALA n 
15 121 LEU n 
15 122 ALA n 
15 123 THR n 
15 124 TRP n 
15 125 ARG n 
15 126 ARG n 
15 127 GLY n 
15 128 GLN n 
15 129 GLY n 
15 130 LEU n 
15 131 GLU n 
15 132 ALA n 
15 133 ALA n 
15 134 LEU n 
15 135 LYS n 
15 136 TYR n 
15 137 PHE n 
15 138 LEU n 
15 139 LEU n 
15 140 GLY n 
15 141 ALA n 
15 142 LEU n 
15 143 ALA n 
15 144 ALA n 
15 145 ALA n 
15 146 PHE n 
15 147 PHE n 
15 148 LEU n 
15 149 TYR n 
15 150 GLY n 
15 151 ALA n 
15 152 ALA n 
15 153 LEU n 
15 154 PHE n 
15 155 TYR n 
15 156 GLY n 
15 157 ALA n 
15 158 THR n 
15 159 GLY n 
15 160 SER n 
15 161 LEU n 
15 162 VAL n 
15 163 LEU n 
15 164 GLY n 
15 165 ALA n 
15 166 PRO n 
15 167 GLY n 
15 168 GLU n 
15 169 GLY n 
15 170 PRO n 
15 171 LEU n 
15 172 TYR n 
15 173 ALA n 
15 174 LEU n 
15 175 ALA n 
15 176 LEU n 
15 177 GLY n 
15 178 LEU n 
15 179 LEU n 
15 180 LEU n 
15 181 VAL n 
15 182 GLY n 
15 183 LEU n 
15 184 GLY n 
15 185 PHE n 
15 186 LYS n 
15 187 ALA n 
15 188 ALA n 
15 189 LEU n 
15 190 ALA n 
15 191 PRO n 
15 192 PHE n 
15 193 HIS n 
15 194 PHE n 
15 195 TRP n 
15 196 THR n 
15 197 PRO n 
15 198 ASP n 
15 199 VAL n 
15 200 TYR n 
15 201 GLN n 
15 202 GLY n 
15 203 SER n 
15 204 PRO n 
15 205 THR n 
15 206 PRO n 
15 207 VAL n 
15 208 VAL n 
15 209 LEU n 
15 210 PHE n 
15 211 MET n 
15 212 ALA n 
15 213 THR n 
15 214 SER n 
15 215 VAL n 
15 216 LYS n 
15 217 ALA n 
15 218 ALA n 
15 219 ALA n 
15 220 PHE n 
15 221 ALA n 
15 222 ALA n 
15 223 LEU n 
15 224 LEU n 
15 225 ARG n 
15 226 VAL n 
15 227 ALA n 
15 228 ALA n 
15 229 PRO n 
15 230 PRO n 
15 231 GLU n 
15 232 ALA n 
15 233 LEU n 
15 234 ALA n 
15 235 LEU n 
15 236 LEU n 
15 237 VAL n 
15 238 ALA n 
15 239 LEU n 
15 240 SER n 
15 241 VAL n 
15 242 VAL n 
15 243 VAL n 
15 244 GLY n 
15 245 ASN n 
15 246 LEU n 
15 247 ALA n 
15 248 ALA n 
15 249 LEU n 
15 250 ALA n 
15 251 GLN n 
15 252 LYS n 
15 253 GLU n 
15 254 ALA n 
15 255 LYS n 
15 256 ARG n 
15 257 LEU n 
15 258 LEU n 
15 259 ALA n 
15 260 TYR n 
15 261 SER n 
15 262 SER n 
15 263 ILE n 
15 264 ALA n 
15 265 HIS n 
15 266 ALA n 
15 267 GLY n 
15 268 TYR n 
15 269 MET n 
15 270 ALA n 
15 271 LEU n 
15 272 ALA n 
15 273 LEU n 
15 274 TYR n 
15 275 THR n 
15 276 GLY n 
15 277 ASN n 
15 278 ALA n 
15 279 GLN n 
15 280 ALA n 
15 281 LEU n 
15 282 GLY n 
15 283 PHE n 
15 284 TYR n 
15 285 LEU n 
15 286 LEU n 
15 287 THR n 
15 288 TYR n 
15 289 VAL n 
15 290 LEU n 
15 291 ALA n 
15 292 THR n 
15 293 GLY n 
15 294 LEU n 
15 295 ALA n 
15 296 PHE n 
15 297 ALA n 
15 298 VAL n 
15 299 LEU n 
15 300 SER n 
15 301 GLN n 
15 302 ILE n 
15 303 SER n 
15 304 PRO n 
15 305 ASP n 
15 306 ARG n 
15 307 VAL n 
15 308 PRO n 
15 309 LEU n 
15 310 GLU n 
15 311 ALA n 
15 312 LEU n 
15 313 ARG n 
15 314 GLY n 
15 315 LEU n 
15 316 TYR n 
15 317 ARG n 
15 318 LYS n 
15 319 ASP n 
15 320 PRO n 
15 321 LEU n 
15 322 LEU n 
15 323 GLY n 
15 324 LEU n 
15 325 ALA n 
15 326 PHE n 
15 327 LEU n 
15 328 VAL n 
15 329 ALA n 
15 330 MET n 
15 331 LEU n 
15 332 SER n 
15 333 LEU n 
15 334 LEU n 
15 335 GLY n 
15 336 LEU n 
15 337 PRO n 
15 338 PRO n 
15 339 LEU n 
15 340 ALA n 
15 341 GLY n 
15 342 PHE n 
15 343 TRP n 
15 344 GLY n 
15 345 LYS n 
15 346 TYR n 
15 347 LEU n 
15 348 ALA n 
15 349 PHE n 
15 350 ALA n 
15 351 GLU n 
15 352 ALA n 
15 353 ALA n 
15 354 ARG n 
15 355 ALA n 
15 356 GLY n 
15 357 ALA n 
15 358 TRP n 
15 359 GLY n 
15 360 VAL n 
15 361 LEU n 
15 362 VAL n 
15 363 LEU n 
15 364 ALA n 
15 365 LEU n 
15 366 VAL n 
15 367 THR n 
15 368 SER n 
15 369 ALA n 
15 370 VAL n 
15 371 SER n 
15 372 ALA n 
15 373 TYR n 
15 374 TYR n 
15 375 TYR n 
15 376 LEU n 
15 377 GLY n 
15 378 LEU n 
15 379 GLY n 
15 380 LEU n 
15 381 ALA n 
15 382 VAL n 
15 383 PHE n 
15 384 ALA n 
15 385 ARG n 
15 386 PRO n 
15 387 GLU n 
15 388 GLU n 
15 389 THR n 
15 390 PRO n 
15 391 PHE n 
15 392 ARG n 
15 393 PRO n 
15 394 GLY n 
15 395 PRO n 
15 396 PRO n 
15 397 TRP n 
15 398 ALA n 
15 399 ARG n 
15 400 ALA n 
15 401 ALA n 
15 402 VAL n 
15 403 VAL n 
15 404 ALA n 
15 405 ALA n 
15 406 GLY n 
15 407 VAL n 
15 408 LEU n 
15 409 LEU n 
15 410 LEU n 
15 411 ALA n 
15 412 LEU n 
15 413 GLY n 
15 414 LEU n 
15 415 LEU n 
15 416 PRO n 
15 417 GLY n 
15 418 LEU n 
15 419 VAL n 
15 420 LEU n 
15 421 PRO n 
15 422 ALA n 
15 423 LEU n 
15 424 ALA n 
15 425 ALA n 
15 426 GLY n 
15 427 GLY n 
16 1   MET n 
16 2   THR n 
16 3   TRP n 
16 4   SER n 
16 5   TYR n 
16 6   PRO n 
16 7   VAL n 
16 8   ASP n 
16 9   PRO n 
16 10  TYR n 
16 11  TRP n 
16 12  MET n 
16 13  VAL n 
16 14  ALA n 
16 15  LEU n 
16 16  LYS n 
16 17  ALA n 
16 18  LEU n 
16 19  LEU n 
16 20  VAL n 
16 21  VAL n 
16 22  VAL n 
16 23  GLY n 
16 24  LEU n 
16 25  LEU n 
16 26  THR n 
16 27  ALA n 
16 28  PHE n 
16 29  ALA n 
16 30  PHE n 
16 31  MET n 
16 32  THR n 
16 33  LEU n 
16 34  ILE n 
16 35  GLU n 
16 36  ARG n 
16 37  ARG n 
16 38  LEU n 
16 39  LEU n 
16 40  ALA n 
16 41  ARG n 
16 42  PHE n 
16 43  GLN n 
16 44  VAL n 
16 45  ARG n 
16 46  MET n 
16 47  GLY n 
16 48  PRO n 
16 49  ASN n 
16 50  ARG n 
16 51  VAL n 
16 52  GLY n 
16 53  PRO n 
16 54  PHE n 
16 55  GLY n 
16 56  LEU n 
16 57  LEU n 
16 58  GLN n 
16 59  PRO n 
16 60  LEU n 
16 61  ALA n 
16 62  ASP n 
16 63  ALA n 
16 64  ILE n 
16 65  LYS n 
16 66  SER n 
16 67  ILE n 
16 68  PHE n 
16 69  LYS n 
16 70  GLU n 
16 71  ASP n 
16 72  ILE n 
16 73  VAL n 
16 74  VAL n 
16 75  ALA n 
16 76  GLN n 
16 77  ALA n 
16 78  ASP n 
16 79  ARG n 
16 80  PHE n 
16 81  LEU n 
16 82  PHE n 
16 83  VAL n 
16 84  LEU n 
16 85  ALA n 
16 86  PRO n 
16 87  LEU n 
16 88  ILE n 
16 89  SER n 
16 90  VAL n 
16 91  VAL n 
16 92  PHE n 
16 93  ALA n 
16 94  LEU n 
16 95  LEU n 
16 96  ALA n 
16 97  PHE n 
16 98  GLY n 
16 99  LEU n 
16 100 ILE n 
16 101 PRO n 
16 102 PHE n 
16 103 GLY n 
16 104 PRO n 
16 105 PRO n 
16 106 GLY n 
16 107 SER n 
16 108 PHE n 
16 109 PHE n 
16 110 GLY n 
16 111 TYR n 
16 112 GLN n 
16 113 PRO n 
16 114 TRP n 
16 115 VAL n 
16 116 ILE n 
16 117 ASN n 
16 118 LEU n 
16 119 ASP n 
16 120 LEU n 
16 121 GLY n 
16 122 ILE n 
16 123 LEU n 
16 124 TYR n 
16 125 LEU n 
16 126 PHE n 
16 127 ALA n 
16 128 VAL n 
16 129 SER n 
16 130 GLU n 
16 131 LEU n 
16 132 ALA n 
16 133 VAL n 
16 134 TYR n 
16 135 GLY n 
16 136 ILE n 
16 137 PHE n 
16 138 LEU n 
16 139 SER n 
16 140 GLY n 
16 141 TRP n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 SER n 
16 146 LYS n 
16 147 TYR n 
16 148 SER n 
16 149 LEU n 
16 150 LEU n 
16 151 GLY n 
16 152 SER n 
16 153 LEU n 
16 154 ARG n 
16 155 SER n 
16 156 SER n 
16 157 ALA n 
16 158 SER n 
16 159 LEU n 
16 160 ILE n 
16 161 SER n 
16 162 TYR n 
16 163 GLU n 
16 164 LEU n 
16 165 GLY n 
16 166 LEU n 
16 167 GLY n 
16 168 LEU n 
16 169 ALA n 
16 170 LEU n 
16 171 LEU n 
16 172 ALA n 
16 173 PRO n 
16 174 VAL n 
16 175 LEU n 
16 176 LEU n 
16 177 VAL n 
16 178 GLY n 
16 179 SER n 
16 180 LEU n 
16 181 ASN n 
16 182 LEU n 
16 183 ASN n 
16 184 ASP n 
16 185 ILE n 
16 186 VAL n 
16 187 ASN n 
16 188 TRP n 
16 189 GLN n 
16 190 LYS n 
16 191 GLU n 
16 192 HIS n 
16 193 GLY n 
16 194 TRP n 
16 195 LEU n 
16 196 PHE n 
16 197 LEU n 
16 198 TYR n 
16 199 ALA n 
16 200 PHE n 
16 201 PRO n 
16 202 ALA n 
16 203 PHE n 
16 204 LEU n 
16 205 VAL n 
16 206 TYR n 
16 207 LEU n 
16 208 ILE n 
16 209 ALA n 
16 210 SER n 
16 211 MET n 
16 212 ALA n 
16 213 GLU n 
16 214 ALA n 
16 215 ALA n 
16 216 ARG n 
16 217 THR n 
16 218 PRO n 
16 219 PHE n 
16 220 ASP n 
16 221 LEU n 
16 222 PRO n 
16 223 GLU n 
16 224 ALA n 
16 225 GLU n 
16 226 GLN n 
16 227 GLU n 
16 228 LEU n 
16 229 VAL n 
16 230 GLY n 
16 231 GLY n 
16 232 TYR n 
16 233 HIS n 
16 234 THR n 
16 235 GLU n 
16 236 TYR n 
16 237 SER n 
16 238 SER n 
16 239 ILE n 
16 240 LYS n 
16 241 TRP n 
16 242 ALA n 
16 243 LEU n 
16 244 PHE n 
16 245 GLN n 
16 246 MET n 
16 247 ALA n 
16 248 GLU n 
16 249 TYR n 
16 250 ILE n 
16 251 HIS n 
16 252 PHE n 
16 253 ILE n 
16 254 THR n 
16 255 ALA n 
16 256 SER n 
16 257 ALA n 
16 258 LEU n 
16 259 ILE n 
16 260 PRO n 
16 261 THR n 
16 262 LEU n 
16 263 PHE n 
16 264 LEU n 
16 265 GLY n 
16 266 GLY n 
16 267 TRP n 
16 268 THR n 
16 269 MET n 
16 270 PRO n 
16 271 VAL n 
16 272 LEU n 
16 273 GLU n 
16 274 VAL n 
16 275 PRO n 
16 276 TYR n 
16 277 LEU n 
16 278 TRP n 
16 279 MET n 
16 280 PHE n 
16 281 LEU n 
16 282 LYS n 
16 283 ILE n 
16 284 ALA n 
16 285 PHE n 
16 286 PHE n 
16 287 LEU n 
16 288 PHE n 
16 289 PHE n 
16 290 PHE n 
16 291 ILE n 
16 292 TRP n 
16 293 ILE n 
16 294 ARG n 
16 295 ALA n 
16 296 THR n 
16 297 TRP n 
16 298 PHE n 
16 299 ARG n 
16 300 LEU n 
16 301 ARG n 
16 302 TYR n 
16 303 ASP n 
16 304 GLN n 
16 305 LEU n 
16 306 LEU n 
16 307 ARG n 
16 308 PHE n 
16 309 GLY n 
16 310 TRP n 
16 311 GLY n 
16 312 PHE n 
16 313 LEU n 
16 314 PHE n 
16 315 PRO n 
16 316 LEU n 
16 317 ALA n 
16 318 LEU n 
16 319 LEU n 
16 320 TRP n 
16 321 PHE n 
16 322 LEU n 
16 323 VAL n 
16 324 THR n 
16 325 ALA n 
16 326 LEU n 
16 327 VAL n 
16 328 VAL n 
16 329 ALA n 
16 330 LEU n 
16 331 ASP n 
16 332 LEU n 
16 333 PRO n 
16 334 ARG n 
16 335 THR n 
16 336 TYR n 
16 337 LEU n 
16 338 LEU n 
16 339 TYR n 
16 340 LEU n 
16 341 SER n 
16 342 ALA n 
16 343 LEU n 
16 344 SER n 
16 345 PHE n 
16 346 LEU n 
16 347 VAL n 
16 348 LEU n 
16 349 LEU n 
16 350 GLY n 
16 351 ALA n 
16 352 VAL n 
16 353 LEU n 
16 354 TYR n 
16 355 THR n 
16 356 PRO n 
16 357 LYS n 
16 358 PRO n 
16 359 ALA n 
16 360 ARG n 
16 361 LYS n 
16 362 GLY n 
16 363 GLY n 
16 364 GLY n 
16 365 ALA n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 438 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3  1 sample 1 783 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4  1 sample 1 409 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
5  1 sample 1 207 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
6  1 sample 1 181 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
7  1 sample 1 182 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
8  1 sample 1 129 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
9  1 sample 1 131 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
10 1 sample 1 119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
11 1 sample 1 176 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
12 1 sample 1 95  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
13 1 sample 1 606 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
14 1 sample 1 469 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
15 1 sample 1 427 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
16 1 sample 1 365 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP NQO1_THET8   Q56222 ? 1  
;MTGPILSGLDPRFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMP
KDDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGK
NLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQ
MGTEQSKGMKLYQISGPVKRPGVYELPMGTTFRELIYEWAGGPLEPIQAIIPGGSSTPPLPFTEEVLDTPMSYEHLQAKG
SMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFC
PLADAAVWPVKGSLRHFKDQYLALAREKRPVPRPSLWR
;
1 
2  UNP NQO2_THET8   Q56221 ? 2  
;MGFFDDKQDFLEETFAKYPPEGRRAAIMPLLRRVQQEEGWIRPERIEEIARLVGTTPTEVMGVASFYSYYQFVPTGKYHL
QVCATLSCKLAGAEELWDYLTETLGIGPGEVTPDGLFSVQKVECLGSCHTAPVIQVNDEPYVECVTRARLEALLAGLRAG
KRLEEIELPGKCGHHVHEVEV
;
1 
3  UNP NQO3_THET8   Q56223 ? 3  
;MVRVKVNDRIVEVPPGTSVMDAVFHAGYDVPLFCSEKHLSPIGACRMCLVRIGLPKKGPDGKPLLNEKGEPEIQWQPKLA
ASCVTAVADGMVVDTLSDVVREAQAGMVEFTLLNHPLDCPTCDKGGACELQDRTVEYGLYEKYYQKGPLELPVYTRFEFT
RRHVDKHHPLSPFVILDRERCIHCKRCVRYFEEVPGDEVLDFIERGVHTFIGTMDFGLPSGFSGNITDICPVGALLDLTA
RFRARNWEMEETPTTCALCPVGCGITADTRSGELLRIRAREVPEVNEIWICDAGRFGHEWADQNRLKTPLVRKEGRLVEA
TWEEAFLALKEGLKEARGEEVGLYLAHDATLEEGLLASELAKALKTPHLDFQGRTAAPASLFPPASLEDLLQADFALVLG
DPTEEAPILHLRLSEFVRDLKPPHRYNHGTPFADLQIKERMPRRTDKMALFAPYRAPLMKWAAIHEVHRPGEEREILLAL
LGDKEGSEMVAKAKEAWEKAKNPVLILGAGVLQDTVAAERARLLAERKGAKVLAMTPAANARGLEAMGVLPGAKGASWDE
PGALYAYYGFVPPEEALKGKRFVVMHLSHLHPLAERYAHVVLPAPTFYEKRGHLVNLEGRVLPLSPAPIENGEAEGALQV
LALLAEALGVRPPFRLHLEAQKALKARKVPEAMGRLSFRLKELRPKERKGAFYLRPTMWKAHQAVGKAQEAARAELWAHP
ETARAEALPEGAQVAVETPFGRVEARVVHREDVPKGHLYLSALGPAAGLRVEGRVLVPAGGEA
;
1 
4  UNP NQO4_THET8   Q56220 ? 4  
;MREEFLEEIPLDAPPEEAKELRTEVMTLNVGPQHPSTHGVLRLMVTLSGEEVLEVVPHIGYLHTGFEKTMEHRTYLQNIT
YTPRMDYLHSFAHDLAYALAVEKLLGAVVPPRAETIRVILNELSRLASHLVFLGTGLLDLGALTPFFYAFRERETILDLF
EWVTGQRFHHNYIRIGGVKEDLPEEFVPELKKLLEVLPHRIDEYEALFAESPIFYERARGVGVIPPEVAIDLGLTGGSLR
ASGVNYDVRKAYPYSGYETYTFDVPLGERGDVFDRMLVRIREMRESVKIIKQALERLEPGPVRDPNPQITPPPRHLLETS
MEAVIYHFKHYTEGFHPPKGEVYVPTESARGELGYYIVSDGGSMPYRVKVRAPSFVNLQSLPYACKGEQVPDMVAIIASL
DPVMGDVDR
;
1 
5  UNP NQO5_THET8   Q56219 ? 5  
;MRLERVLEEARAKGYPIEDNGLGNLWVVLPRERFKEEMAHYKAMGFNFLADIVGLDYLTYPDPRPERFAVVYELVSLPGW
KDGDGSRFFVRVYVPEEDPRLPTVTDLWGSANFLEREVYDLFGIVFEGHPDLRKILTPEDLEGHPLRKDYPLGETPTLFR
EGRYIIPAEFRAALTGKDPGLTFYKGGSRKGYRSLWADLKKAREVKG
;
1 
6  UNP NQO6_THET8   Q56218 ? 6  
;MALKDLFERDVQELEREGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARNDLARFGSEVFRASPRQADVMIV
AGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQNVDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVRG
QAYNERGERLPPVAAWKRTRG
;
1 
7  UNP NQO9_THET8   Q56224 ? 7  
;MTLKALAQSLGITLKYLFSKPVTVPYPDAPVALKPRFHGRHVLTRHPNGLEKCIGCSLCAAACPAYAIYVEPAENDPENP
VSAGERYAKVYEINMLRCIFCGLCEEACPTGAIVLGYDFEMADYEYSDLVYGKEDMLVDVVGTKPQRREAKRTGKPVKVG
YVVPYVRPELEGFKAPTEGGKR
;
1 
8  UNP NQO15_THET8  Q5SKZ7 ? 8  
;MSASSERELYEAWVELLSWMREYAQAKGVRFEKEADFPDFIYRMERPYDLPTTIMTASLSDGLGEPFLLADVSPRHAKLK
RIGLRLPRAHIHLHAHYEPGKGLVTGKIPLTKERFFALADRAREALAFA
;
1 
9  UNP Q5SI52_THET8 Q5SI52 ? 9  
;MVRVGMRAAPRVSLEALKAALGGLKLSEAKVYLITDWQDKRDQARYALLLHTGKKDLLVPDAFGPAFPGGEEALSELVGL
LLAQGARRFYEAVVSPGEMTALLDLPPEELLKRVMAIANPTDPGIYLKRAA
;
1 
10 UNP NQO7_THET8   Q56217 ? 10 
;MAPIQEYVGTLIYVGVALFIGVAALLVGALLGPKKPGRAKLMPYESGNDPAGEVKRFPVHFYVVAMLFILFDVEVAFLWP
YAVSAGGLGLYGFLGVLAFTLLLFVGFLYEWWKGVMRWH
;
1 
11 UNP NQO10_THET8  Q56225 ? 11 
;MSLLEGLALFLLLLSGVLVVTLRNAIHAALALILNFLVLAGVYVALDARFLGFIQVIVYAGAIVVLFLFVIMLLFAAQGE
IGFDPLVRSRPLAALLALGVAGILAAGLWGLDLAFTQDLKGGLPQALGPLLYGDWLFVLLAVGFLLMAATVVAVALVEPG
KASRAKEAEKREEVAR
;
1 
12 UNP NQO11_THET8  Q56226 ? 12 
;MSYLLTSALLFALGVYGVLTRRTAILVFLSIELMLNAANLSLVGFARAYGLDGQVAALMVIAVAAAEVAVGLGLIVAIFR
HRESTAVDDLSELRG
;
1 
13 UNP NQO12_THET8  Q56227 ? 13 
;MALLGTILLPLLGFALLGLFGKRMREPLPGVLASGLVLASFLLGAGLLLSGGARFQAEWLPGIPFSLLLDNLSGFMLLIV
TGVGFLIHVYAIGYMGGDPGYSRFFAYFNLFIAMMLTLVLADSYPVMFIGWEGVGLASFLLIGFWYKNPQYADSARKAFI
VNRIGDLGFMLGMAILWALYGTLSISELKEAMEGPLKNPDLLALAGLLLFLGAVGKSAQIPLMVWLPDAMAGPTPVSALI
HAATMVTAGVYLIARSSFLYSVLPDVSYAIAVVGLLTAAYGALSAFGQTDIKKIVAYSTISQLGYMFLAAGVGAYWVALF
HVFTHAFFKALLFLASGSVIHALGGEQDVRKMGGLWKHLPQTRWHALIGALALGGLPLLSGFWSKDAILAATLTYPFGGV
GFYVGALLVAVLTAMYAMRWFVLVFLGEERGHHHPHEAPPVMLWPNHLLALGSVLAGYLALPHPLPNVLEPFLKPALAEV
EAHHLSLGAEWGLIALSAAVALLGLWAGFVFFQRKVFPAWYLAFEAASREAFYVDRAYNALIVNPLKALAEALFYGDRGL
LSGYFGLGGAARSLGQGLARLQTGYLRVYALLFVLGALLLLGVMRW
;
1 
14 UNP NQO13_THET8  Q56228 ? 14 
;MVVLAVLLPVVFGALLLLGLPRALGVLGAGLSFLLNLYLFLTHPGGVAHAFQAPLLPGAGVYWAFGLDGLSALFFLTIAL
TVFLGALVARVEGRFLGLALLMEGLLLGLFAARDLLVFYVFFEAALIPALLMLYLYGGEGRTRALYTFVLFTLVGSLPML
AAVLGARLLSGSPTFLLEDLLAHPLQEEAAFWVFLGFALAFAIKTPLFPLHAWLPPFHQENHPSGLADALGTLYKVGVFA
FFRFAIPLAPEGFAQAQGLLLFLAALSALYGAWVAFAAKDFKTLLAYAGLSHMGVAALGVFSGTPEGAMGGLYLLAASGV
YTGGLFLLAGRLYERTGTLEIGRYRGLAQSAPGLAALALILFLAMVGLPGLSGFPGEFLTLLGAYKASPWLAALAFLSVI
ASAAYALTAFQKTFWEEGGSGVKDLAGAEWGFALLSVLALLLMGVFPGYFARGLHPLAEAFAKLLGGGA
;
1 
15 UNP NQO14_THET8  Q56229 ? 15 
;MTLAILAVFSVALTLLGFVLPPQGVKRATLLGLALALASLLLTWGKPFAFGPYAVDGVSQVFTLLALLGALWTVGLVRSG
RFEFYLLVLYAALGMHLLASTRHLLLMLVALEALSLPLYALATWRRGQGLEAALKYFLLGALAAAFFLYGAALFYGATGS
LVLGAPGEGPLYALALGLLLVGLGFKAALAPFHFWTPDVYQGSPTPVVLFMATSVKAAAFAALLRVAAPPEALALLVALS
VVVGNLAALAQKEAKRLLAYSSIAHAGYMALALYTGNAQALGFYLLTYVLATGLAFAVLSQISPDRVPLEALRGLYRKDP
LLGLAFLVAMLSLLGLPPLAGFWGKYLAFAEAARAGAWGVLVLALVTSAVSAYYYLGLGLAVFARPEETPFRPGPPWARA
AVVAAGVLLLALGLLPGLVLPALAAGG
;
1 
16 UNP NQO8_THET8   Q60019 ? 16 
;MTWSYPVDPYWMVALKALLVVVGLLTAFAFMTLIERRLLARFQVRMGPNRVGPFGLLQPLADAIKSIFKEDIVVAQADRF
LFVLAPLISVVFALLAFGLIPFGPPGSFFGYQPWVINLDLGILYLFAVSELAVYGIFLSGWASGSKYSLLGSLRSSASLI
SYELGLGLALLAPVLLVGSLNLNDIVNWQKEHGWLFLYAFPAFLVYLIASMAEAARTPFDLPEAEQELVGGYHTEYSSIK
WALFQMAEYIHFITASALIPTLFLGGWTMPVLEVPYLWMFLKIAFFLFFFIWIRATWFRLRYDQLLRFGWGFLFPLALLW
FLVTALVVALDLPRTYLLYLSALSFLVLLGAVLYTPKPARKGGGA
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6Q8W 1 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
2  2  6Q8W 2 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
3  3  6Q8W 3 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
4  4  6Q8W 4 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
5  5  6Q8W 5 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
6  6  6Q8W 6 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
7  7  6Q8W 9 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
8  8  6Q8W 7 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
9  9  6Q8W W 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
10 10 6Q8W A 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
11 11 6Q8W J 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
12 12 6Q8W K 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
13 13 6Q8W L 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
14 14 6Q8W M 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
15 15 6Q8W N 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
16 16 6Q8W H 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
17 1  6Q8W B 1 ? 438 ? Q56222 1 ? 438 ? 1 438 
18 2  6Q8W C 1 ? 181 ? Q56221 1 ? 181 ? 1 181 
19 3  6Q8W D 1 ? 783 ? Q56223 1 ? 783 ? 1 783 
20 4  6Q8W E 1 ? 409 ? Q56220 1 ? 409 ? 1 409 
21 5  6Q8W F 1 ? 207 ? Q56219 1 ? 207 ? 1 207 
22 6  6Q8W G 1 ? 181 ? Q56218 1 ? 181 ? 1 181 
23 7  6Q8W O 1 ? 182 ? Q56224 1 ? 182 ? 1 182 
24 8  6Q8W I 1 ? 129 ? Q5SKZ7 1 ? 129 ? 1 129 
25 9  6Q8W X 1 ? 131 ? Q5SI52 1 ? 131 ? 1 131 
26 10 6Q8W P 1 ? 119 ? Q56217 1 ? 119 ? 1 119 
27 11 6Q8W R 1 ? 176 ? Q56225 1 ? 176 ? 1 176 
28 12 6Q8W S 1 ? 95  ? Q56226 1 ? 95  ? 1 95  
29 13 6Q8W T 1 ? 606 ? Q56227 1 ? 606 ? 1 606 
30 14 6Q8W U 1 ? 469 ? Q56228 1 ? 469 ? 1 469 
31 15 6Q8W V 1 ? 427 ? Q56229 1 ? 427 ? 1 427 
32 16 6Q8W Q 1 ? 365 ? Q60019 1 ? 365 ? 1 365 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                      ?                          'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ?                          'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                          'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                          'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                     ?                          'C3 H7 N O2 S'    121.158 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?                          'Fe2 S2'          175.820 
FMN non-polymer         . 'FLAVIN MONONUCLEOTIDE'      'RIBOFLAVIN MONOPHOSPHATE' 'C17 H21 N4 O9 P' 456.344 
GLN 'L-peptide linking' y GLUTAMINE                    ?                          'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                          'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ?                          'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ?                          'C6 H10 N3 O2 1'  156.162 
HQW non-polymer         . Aureothin                    ?                          'C22 H23 N O6'    397.421 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                          'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ?                          'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ?                          'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ?                          'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ?                          'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ?                          'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ?                          'C3 H7 N O3'      105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER'        ?                          'Fe4 S4'          351.640 
THR 'L-peptide linking' y THREONINE                    ?                          'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                          'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                          'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                       ?                          'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6Q8W 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.95 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.89 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            296 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'100 mM Bis-Tris pH 6.0, 25% (w/v) PEG 4000, 100 mM KCl, 100 mM glutaric acid and 7.6 mM 4-cyclohexyl-1-butyl-beta-D-maltoside' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         MARRESEARCH 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-04-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.900 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.900 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-2 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6Q8W 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.40 
_reflns.d_resolution_low                 49.71 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       211093 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.3 
_reflns.pdbx_Rmerge_I_obs                0.230 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.079 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.40 
_reflns_shell.d_res_low                   3.58 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           21974 
_reflns_shell.percent_possible_all        66.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.356 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.0 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.775 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               63.8 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
;TLS refinement.

Twin refinement.
TWINNING INFORMATION:                                              
FRACTION: 0.490                                                   
OPERATOR: -h,-k,h+l 

Data cut anisotropically to limits (Angstrom) along a*, b* and c*:
3.5, 3.9, 3.4
;
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6Q8W 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.400 
_refine.ls_d_res_low                             49.71 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     191608 
_refine.ls_number_reflns_R_free                  2022 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    84.10 
_refine.ls_percent_reflns_R_free                 1.06 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2173 
_refine.ls_R_factor_R_free                       0.2342 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2126 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4HEA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.43 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        73896 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         248 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               74144 
_refine_hist.d_res_high                       3.400 
_refine_hist.d_res_low                        49.71 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007 ? 76252  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.988 ? 103998 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.798 ? 44652  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.051 ? 11642  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007 ? 13106  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.4164 3.5018  . . 32  3035  19.00 . . . 0.2268 . 0.2572 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5018 3.5964  . . 67  7357  46.00 . . . 0.3159 . 0.2405 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5964 3.7021  . . 108 10649 66.00 . . . 0.2656 . 0.2346 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7021 3.8214  . . 151 13017 81.00 . . . 0.2643 . 0.2296 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8214 3.9578  . . 143 14798 93.00 . . . 0.2444 . 0.2238 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9578 4.1160  . . 159 15150 95.00 . . . 0.2686 . 0.2186 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1160 4.3030  . . 154 15294 95.00 . . . 0.2223 . 0.2150 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3030 4.5294  . . 177 15406 96.00 . . . 0.2279 . 0.2091 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5294 4.8124  . . 159 15614 97.00 . . . 0.1996 . 0.2066 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8124 5.1828  . . 180 15628 98.00 . . . 0.2133 . 0.2053 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1828 5.7022  . . 174 15845 99.00 . . . 0.2408 . 0.2192 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7022 6.5222  . . 165 15826 99.00 . . . 0.2449 . 0.2249 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.5222 8.1983  . . 134 15898 99.00 . . . 0.2182 . 0.1993 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.1983 34.0334 . . 177 15842 98.00 . . . 0.2481 . 0.2159 . . . . . . . . . . 
# 
_struct.entry_id                     6Q8W 
_struct.title                        'Respiratory complex I from Thermus thermophilus with bound Aureothin.' 
_struct.pdbx_descriptor              
;NADH-quinone oxidoreductase subunit 1 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 2 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 3 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 4 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 5 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 6 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 9 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 15 (E.C.1.6.5.11), Uncharacterized protein, NADH-quinone oxidoreductase subunit 7 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 10 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 11 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 12 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 13 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 14 (E.C.1.6.5.11), NADH-quinone oxidoreductase subunit 8 (E.C.1.6.5.11)
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6Q8W 
_struct_keywords.text            
'Respiratory chain, complex I, NADH:ubiquinone oxidoreductase, electron transfer, proton translocation, MEMBRANE PROTEIN' 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 1  ? 
R  N N 2  ? 
S  N N 3  ? 
T  N N 4  ? 
U  N N 5  ? 
V  N N 6  ? 
W  N N 7  ? 
X  N N 8  ? 
Y  N N 9  ? 
Z  N N 10 ? 
AA N N 11 ? 
BA N N 12 ? 
CA N N 13 ? 
DA N N 14 ? 
EA N N 15 ? 
FA N N 16 ? 
GA N N 17 ? 
HA N N 18 ? 
IA N N 19 ? 
JA N N 17 ? 
KA N N 17 ? 
LA N N 17 ? 
MA N N 19 ? 
NA N N 20 ? 
OA N N 17 ? 
PA N N 17 ? 
QA N N 17 ? 
RA N N 17 ? 
SA N N 18 ? 
TA N N 19 ? 
UA N N 17 ? 
VA N N 17 ? 
WA N N 17 ? 
XA N N 19 ? 
YA N N 20 ? 
ZA N N 17 ? 
AB N N 17 ? 
BB N N 17 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 THR A  28  ? HIS A  35  ? THR 1 28  HIS 1 35  1 ? 8  
HELX_P HELX_P2   AA2 TYR A  38  ? LYS A  48  ? TYR 1 38  LYS 1 48  1 ? 11 
HELX_P HELX_P3   AA3 THR A  49  ? GLY A  61  ? THR 1 49  GLY 1 61  1 ? 13 
HELX_P HELX_P4   AA4 PRO A  71  ? PHE A  78  ? PRO 1 71  PHE 1 78  1 ? 8  
HELX_P HELX_P5   AA5 LYS A  102 ? VAL A  110 ? LYS 1 102 VAL 1 110 1 ? 9  
HELX_P HELX_P6   AA6 VAL A  110 ? ARG A  126 ? VAL 1 110 ARG 1 126 1 ? 17 
HELX_P HELX_P7   AA7 ARG A  139 ? ARG A  155 ? ARG 1 139 ARG 1 155 1 ? 17 
HELX_P HELX_P8   AA8 ASN A  161 ? THR A  165 ? ASN 1 161 THR 1 165 5 ? 5  
HELX_P HELX_P9   AA9 ALA A  179 ? GLY A  183 ? ALA 1 179 GLY 1 183 5 ? 5  
HELX_P HELX_P10  AB1 GLU A  184 ? GLY A  194 ? GLU 1 184 GLY 1 194 1 ? 11 
HELX_P HELX_P11  AB2 GLY A  210 ? LYS A  214 ? GLY 1 210 LYS 1 214 5 ? 5  
HELX_P HELX_P12  AB3 VAL A  221 ? ARG A  233 ? VAL 1 221 ARG 1 233 1 ? 13 
HELX_P HELX_P13  AB4 ALA A  235 ? GLN A  240 ? ALA 1 235 GLN 1 240 1 ? 6  
HELX_P HELX_P14  AB5 THR A  271 ? TRP A  279 ? THR 1 271 TRP 1 279 1 ? 9  
HELX_P HELX_P15  AB6 THR A  303 ? ASP A  308 ? THR 1 303 ASP 1 308 1 ? 6  
HELX_P HELX_P16  AB7 LEU A  316 ? GLY A  320 ? LEU 1 316 GLY 1 320 5 ? 5  
HELX_P HELX_P17  AB8 SER A  336 ? GLU A  351 ? SER 1 336 GLU 1 351 1 ? 16 
HELX_P HELX_P18  AB9 CYS A  356 ? PHE A  366 ? CYS 1 356 PHE 1 366 1 ? 11 
HELX_P HELX_P19  AC1 PHE A  366 ? THR A  376 ? PHE 1 366 THR 1 376 1 ? 11 
HELX_P HELX_P20  AC2 GLU A  380 ? LEU A  391 ? GLU 1 380 LEU 1 391 1 ? 12 
HELX_P HELX_P21  AC3 LEU A  391 ? GLY A  396 ? LEU 1 391 GLY 1 396 1 ? 6  
HELX_P HELX_P22  AC4 PRO A  401 ? HIS A  416 ? PRO 1 401 HIS 1 416 1 ? 16 
HELX_P HELX_P23  AC5 PHE A  417 ? GLU A  427 ? PHE 1 417 GLU 1 427 1 ? 11 
HELX_P HELX_P24  AC6 LYS B  7   ? ALA B  16  ? LYS 2 7   ALA 2 16  1 ? 10 
HELX_P HELX_P25  AC7 GLY B  22  ? ALA B  25  ? GLY 2 22  ALA 2 25  5 ? 4  
HELX_P HELX_P26  AC8 ALA B  26  ? GLY B  39  ? ALA 2 26  GLY 2 39  1 ? 14 
HELX_P HELX_P27  AC9 ARG B  42  ? GLY B  54  ? ARG 2 42  GLY 2 54  1 ? 13 
HELX_P HELX_P28  AD1 THR B  56  ? SER B  65  ? THR 2 56  SER 2 65  1 ? 10 
HELX_P HELX_P29  AD2 THR B  85  ? LEU B  90  ? THR 2 85  LEU 2 90  1 ? 6  
HELX_P HELX_P30  AD3 GLY B  92  ? GLY B  105 ? GLY 2 92  GLY 2 105 1 ? 14 
HELX_P HELX_P31  AD4 THR B  146 ? ALA B  159 ? THR 2 146 ALA 2 159 1 ? 14 
HELX_P HELX_P32  AD5 SER C  18  ? GLY C  27  ? SER 3 18  GLY 3 27  1 ? 10 
HELX_P HELX_P33  AD6 SER C  97  ? LEU C  113 ? SER 3 97  LEU 3 113 1 ? 17 
HELX_P HELX_P34  AD7 ASP C  118 ? CYS C  122 ? ASP 3 118 CYS 3 122 5 ? 5  
HELX_P HELX_P35  AD8 CYS C  128 ? GLY C  138 ? CYS 3 128 GLY 3 138 1 ? 11 
HELX_P HELX_P36  AD9 LYS C  185 ? VAL C  194 ? LYS 3 185 VAL 3 194 1 ? 10 
HELX_P HELX_P37  AE1 ARG C  205 ? THR C  209 ? ARG 3 205 THR 3 209 5 ? 5  
HELX_P HELX_P38  AE2 PHE C  222 ? GLY C  224 ? PHE 3 222 GLY 3 224 5 ? 3  
HELX_P HELX_P39  AE3 ASN C  225 ? CYS C  230 ? ASN 3 225 CYS 3 230 1 ? 6  
HELX_P HELX_P40  AE4 CYS C  291 ? PHE C  296 ? CYS 3 291 PHE 3 296 1 ? 6  
HELX_P HELX_P41  AE5 THR C  321 ? LYS C  334 ? THR 3 321 LYS 3 334 1 ? 14 
HELX_P HELX_P42  AE6 THR C  350 ? LEU C  364 ? THR 3 350 LEU 3 364 1 ? 15 
HELX_P HELX_P43  AE7 PRO C  378 ? PHE C  382 ? PRO 3 378 PHE 3 382 5 ? 5  
HELX_P HELX_P44  AE8 SER C  386 ? ALA C  393 ? SER 3 386 ALA 3 393 1 ? 8  
HELX_P HELX_P45  AE9 ASP C  401 ? ALA C  406 ? ASP 3 401 ALA 3 406 1 ? 6  
HELX_P HELX_P46  AF1 ILE C  408 ? ARG C  418 ? ILE 3 408 ARG 3 418 1 ? 11 
HELX_P HELX_P47  AF2 LEU C  458 ? ALA C  462 ? LEU 3 458 ALA 3 462 5 ? 5  
HELX_P HELX_P48  AF3 GLU C  472 ? GLY C  482 ? GLU 3 472 GLY 3 482 1 ? 11 
HELX_P HELX_P49  AF4 SER C  487 ? ALA C  500 ? SER 3 487 ALA 3 500 1 ? 14 
HELX_P HELX_P50  AF5 GLY C  508 ? GLN C  513 ? GLY 3 508 GLN 3 513 1 ? 6  
HELX_P HELX_P51  AF6 ASP C  514 ? LYS C  528 ? ASP 3 514 LYS 3 528 1 ? 15 
HELX_P HELX_P52  AF7 ASN C  540 ? MET C  547 ? ASN 3 540 MET 3 547 1 ? 8  
HELX_P HELX_P53  AF8 PRO C  573 ? LYS C  578 ? PRO 3 573 LYS 3 578 1 ? 6  
HELX_P HELX_P54  AF9 THR C  606 ? LYS C  610 ? THR 3 606 LYS 3 610 5 ? 5  
HELX_P HELX_P55  AG1 GLY C  636 ? GLU C  646 ? GLY 3 636 GLU 3 646 1 ? 11 
HELX_P HELX_P56  AG2 ALA C  647 ? GLY C  649 ? ALA 3 647 GLY 3 649 5 ? 3  
HELX_P HELX_P57  AG3 LEU C  656 ? LYS C  668 ? LEU 3 656 LYS 3 668 1 ? 13 
HELX_P HELX_P58  AG4 LYS C  700 ? ALA C  704 ? LYS 3 700 ALA 3 704 5 ? 5  
HELX_P HELX_P59  AG5 VAL C  705 ? GLN C  709 ? VAL 3 705 GLN 3 709 5 ? 5  
HELX_P HELX_P60  AG6 HIS C  719 ? ALA C  727 ? HIS 3 719 ALA 3 727 1 ? 9  
HELX_P HELX_P61  AG7 GLY D  65  ? MET D  70  ? GLY 4 65  MET 4 70  1 ? 6  
HELX_P HELX_P62  AG8 GLU D  71  ? ARG D  73  ? GLU 4 71  ARG 4 73  5 ? 3  
HELX_P HELX_P63  AG9 THR D  74  ? ILE D  79  ? THR 4 74  ILE 4 79  1 ? 6  
HELX_P HELX_P64  AH1 SER D  90  ? GLY D  106 ? SER 4 90  GLY 4 106 1 ? 17 
HELX_P HELX_P65  AH2 PRO D  110 ? LEU D  140 ? PRO 4 110 LEU 4 140 1 ? 31 
HELX_P HELX_P66  AH3 LEU D  143 ? THR D  164 ? LEU 4 143 THR 4 164 1 ? 22 
HELX_P HELX_P67  AH4 GLU D  185 ? GLU D  210 ? GLU 4 185 GLU 4 210 1 ? 26 
HELX_P HELX_P68  AH5 ILE D  213 ? ARG D  219 ? ILE 4 213 ARG 4 219 1 ? 7  
HELX_P HELX_P69  AH6 PRO D  225 ? GLY D  233 ? PRO 4 225 GLY 4 233 1 ? 9  
HELX_P HELX_P70  AH7 LEU D  239 ? GLY D  243 ? LEU 4 239 GLY 4 243 5 ? 5  
HELX_P HELX_P71  AH8 ASP D  247 ? TYR D  252 ? ASP 4 247 TYR 4 252 1 ? 6  
HELX_P HELX_P72  AH9 GLY D  256 ? TYR D  260 ? GLY 4 256 TYR 4 260 5 ? 5  
HELX_P HELX_P73  AI1 ASP D  271 ? ARG D  296 ? ASP 4 271 ARG 4 296 1 ? 26 
HELX_P HELX_P74  AI2 PRO D  313 ? THR D  319 ? PRO 4 313 THR 4 319 5 ? 7  
HELX_P HELX_P75  AI3 SER D  320 ? GLU D  333 ? SER 4 320 GLU 4 333 1 ? 14 
HELX_P HELX_P76  AI4 ALA D  372 ? ASN D  377 ? ALA 4 372 ASN 4 377 1 ? 6  
HELX_P HELX_P77  AI5 SER D  380 ? CYS D  385 ? SER 4 380 CYS 4 385 1 ? 6  
HELX_P HELX_P78  AI6 PRO D  391 ? SER D  399 ? PRO 4 391 SER 4 399 1 ? 9  
HELX_P HELX_P79  AI7 VAL D  403 ? ASP D  408 ? VAL 4 403 ASP 4 408 1 ? 6  
HELX_P HELX_P80  AI8 ARG E  2   ? LYS E  13  ? ARG 5 2   LYS 5 13  1 ? 12 
HELX_P HELX_P81  AI9 PRO E  30  ? MET E  44  ? PRO 5 30  MET 5 44  1 ? 15 
HELX_P HELX_P82  AJ1 SER E  110 ? PHE E  122 ? SER 5 110 PHE 5 122 1 ? 13 
HELX_P HELX_P83  AJ2 ILE E  166 ? ARG E  171 ? ILE 5 166 ARG 5 171 1 ? 6  
HELX_P HELX_P84  AJ3 GLY E  186 ? LYS E  190 ? GLY 5 186 LYS 5 190 5 ? 5  
HELX_P HELX_P85  AJ4 THR F  23  ? SER F  35  ? THR 6 23  SER 6 35  1 ? 13 
HELX_P HELX_P86  AJ5 ALA F  44  ? ALA F  52  ? ALA 6 44  ALA 6 52  1 ? 9  
HELX_P HELX_P87  AJ6 SER F  53  ? ASP F  55  ? SER 6 53  ASP 6 55  5 ? 3  
HELX_P HELX_P88  AJ7 SER F  71  ? ALA F  75  ? SER 6 71  ALA 6 75  5 ? 5  
HELX_P HELX_P89  AJ8 SER F  85  ? LYS F  87  ? SER 6 85  LYS 6 87  5 ? 3  
HELX_P HELX_P90  AJ9 MET F  88  ? GLN F  98  ? MET 6 88  GLN 6 98  1 ? 11 
HELX_P HELX_P91  AK1 GLY F  109 ? SER F  114 ? GLY 6 109 SER 6 114 1 ? 6  
HELX_P HELX_P92  AK2 ARG F  143 ? ARG F  159 ? ARG 6 143 ARG 6 159 1 ? 17 
HELX_P HELX_P93  AK3 LEU G  3   ? SER G  19  ? LEU 9 3   SER 9 19  1 ? 17 
HELX_P HELX_P94  AK4 SER G  57  ? ALA G  62  ? SER 9 57  ALA 9 62  1 ? 6  
HELX_P HELX_P95  AK5 GLY G  102 ? CYS G  108 ? GLY 9 102 CYS 9 108 1 ? 7  
HELX_P HELX_P96  AK6 GLU G  125 ? ASP G  128 ? GLU 9 125 ASP 9 128 5 ? 4  
HELX_P HELX_P97  AK7 GLY G  132 ? MET G  136 ? GLY 9 132 MET 9 136 5 ? 5  
HELX_P HELX_P98  AK8 THR G  143 ? GLY G  154 ? THR 9 143 GLY 9 154 1 ? 12 
HELX_P HELX_P99  AK9 ARG G  167 ? GLU G  171 ? ARG 9 167 GLU 9 171 5 ? 5  
HELX_P HELX_P100 AL1 SER H  4   ? GLY H  28  ? SER 7 4   GLY 7 28  1 ? 25 
HELX_P HELX_P101 AL2 PHE H  37  ? TYR H  42  ? PHE 7 37  TYR 7 42  1 ? 6  
HELX_P HELX_P102 AL3 THR H  111 ? LEU H  126 ? THR 7 111 LEU 7 126 1 ? 16 
HELX_P HELX_P103 AL4 ALA I  9   ? GLY I  22  ? ALA W 9   GLY W 22  1 ? 14 
HELX_P HELX_P104 AL5 GLY I  69  ? GLN I  84  ? GLY W 69  GLN W 84  1 ? 16 
HELX_P HELX_P105 AL6 SER I  95  ? LEU I  102 ? SER W 95  LEU W 102 1 ? 8  
HELX_P HELX_P106 AL7 PRO I  106 ? ILE I  117 ? PRO W 106 ILE W 117 1 ? 12 
HELX_P HELX_P107 AL8 ASP I  122 ? TYR I  126 ? ASP W 122 TYR W 126 5 ? 5  
HELX_P HELX_P108 AL9 ILE J  4   ? LEU J  31  ? ILE A 4   LEU A 31  1 ? 28 
HELX_P HELX_P109 AM1 VAL J  59  ? SER J  84  ? VAL A 59  SER A 84  1 ? 26 
HELX_P HELX_P110 AM2 ALA J  85  ? GLY J  87  ? ALA A 85  GLY A 87  5 ? 3  
HELX_P HELX_P111 AM3 LEU J  88  ? GLY J  114 ? LEU A 88  GLY A 114 1 ? 27 
HELX_P HELX_P112 AM4 SER K  2   ? LEU K  22  ? SER J 2   LEU J 22  1 ? 21 
HELX_P HELX_P113 AM5 ASN K  24  ? LEU K  46  ? ASN J 24  LEU J 46  1 ? 23 
HELX_P HELX_P114 AM6 ARG K  49  ? TYR K  59  ? ARG J 49  TYR J 59  1 ? 11 
HELX_P HELX_P115 AM7 ALA K  62  ? LEU K  74  ? ALA J 62  LEU J 74  1 ? 13 
HELX_P HELX_P116 AM8 ARG K  88  ? TRP K  109 ? ARG J 88  TRP J 109 1 ? 22 
HELX_P HELX_P117 AM9 LEU K  123 ? TYR K  132 ? LEU J 123 TYR J 132 1 ? 10 
HELX_P HELX_P118 AN1 TRP K  135 ? GLU K  158 ? TRP J 135 GLU J 158 1 ? 24 
HELX_P HELX_P119 AN2 SER L  2   ? ARG L  21  ? SER K 2   ARG K 21  1 ? 20 
HELX_P HELX_P120 AN3 THR L  23  ? GLY L  50  ? THR K 23  GLY K 50  1 ? 28 
HELX_P HELX_P121 AN4 LEU L  51  ? ARG L  80  ? LEU K 51  ARG K 80  1 ? 30 
HELX_P HELX_P122 AN5 ALA L  86  ? LEU L  90  ? ALA K 86  LEU K 90  5 ? 5  
HELX_P HELX_P123 AN6 ALA M  2   ? PHE M  20  ? ALA L 2   PHE L 20  1 ? 19 
HELX_P HELX_P124 AN7 PRO M  27  ? SER M  50  ? PRO L 27  SER L 50  1 ? 24 
HELX_P HELX_P125 AN8 ASP M  70  ? MET M  95  ? ASP L 70  MET L 95  1 ? 26 
HELX_P HELX_P126 AN9 GLY M  100 ? LEU M  120 ? GLY L 100 LEU L 120 1 ? 21 
HELX_P HELX_P127 AO1 SER M  123 ? GLY M  143 ? SER L 123 GLY L 143 1 ? 21 
HELX_P HELX_P128 AO2 PRO M  149 ? LEU M  179 ? PRO L 149 LEU L 179 1 ? 31 
HELX_P HELX_P129 AO3 SER M  184 ? GLU M  193 ? SER L 184 GLU L 193 1 ? 10 
HELX_P HELX_P130 AO4 ASN M  198 ? ALA M  218 ? ASN L 198 ALA L 218 1 ? 21 
HELX_P HELX_P131 AO5 PRO M  221 ? GLY M  232 ? PRO L 221 GLY L 232 5 ? 12 
HELX_P HELX_P132 AO6 PRO M  233 ? ALA M  242 ? PRO L 233 ALA L 242 1 ? 10 
HELX_P HELX_P133 AO7 VAL M  246 ? SER M  256 ? VAL L 246 SER L 256 1 ? 11 
HELX_P HELX_P134 AO8 SER M  256 ? SER M  261 ? SER L 256 SER L 261 1 ? 6  
HELX_P HELX_P135 AO9 LEU M  263 ? PHE M  286 ? LEU L 263 PHE L 286 1 ? 24 
HELX_P HELX_P136 AP1 ASP M  290 ? VAL M  312 ? ASP L 290 VAL L 312 1 ? 23 
HELX_P HELX_P137 AP2 ALA M  314 ? LEU M  343 ? ALA L 314 LEU L 343 1 ? 30 
HELX_P HELX_P138 AP3 THR M  362 ? GLY M  375 ? THR L 362 GLY L 375 1 ? 14 
HELX_P HELX_P139 AP4 LEU M  379 ? TYR M  395 ? LEU L 379 TYR L 395 1 ? 17 
HELX_P HELX_P140 AP5 GLY M  401 ? LEU M  426 ? GLY L 401 LEU L 426 1 ? 26 
HELX_P HELX_P141 AP6 PRO M  439 ? GLY M  457 ? PRO L 439 GLY L 457 1 ? 19 
HELX_P HELX_P142 AP7 TYR M  458 ? ALA M  460 ? TYR L 458 ALA L 460 5 ? 3  
HELX_P HELX_P143 AP8 VAL M  468 ? LYS M  474 ? VAL L 468 LYS L 474 1 ? 7  
HELX_P HELX_P144 AP9 GLY M  488 ? LYS M  515 ? GLY L 488 LYS L 515 1 ? 28 
HELX_P HELX_P145 AQ1 PRO M  518 ? GLU M  530 ? PRO L 518 GLU L 530 1 ? 13 
HELX_P HELX_P146 AQ2 TYR M  533 ? ILE M  542 ? TYR L 533 ILE L 542 1 ? 10 
HELX_P HELX_P147 AQ3 ILE M  542 ? ARG M  580 ? ILE L 542 ARG L 580 1 ? 39 
HELX_P HELX_P148 AQ4 TYR M  585 ? MET M  604 ? TYR L 585 MET L 604 1 ? 20 
HELX_P HELX_P149 AQ5 VAL N  2   ? LEU N  18  ? VAL M 2   LEU M 18  1 ? 17 
HELX_P HELX_P150 AQ6 ARG N  22  ? LEU N  41  ? ARG M 22  LEU M 41  1 ? 20 
HELX_P HELX_P151 AQ7 ASP N  68  ? VAL N  88  ? ASP M 68  VAL M 88  1 ? 21 
HELX_P HELX_P152 AQ8 PHE N  95  ? ALA N  111 ? PHE M 95  ALA M 111 1 ? 17 
HELX_P HELX_P153 AQ9 ASP N  114 ? ALA N  125 ? ASP M 114 ALA M 125 1 ? 12 
HELX_P HELX_P154 AR1 ALA N  125 ? LEU N  135 ? ALA M 125 LEU M 135 1 ? 11 
HELX_P HELX_P155 AR2 GLY N  140 ? LEU N  169 ? GLY M 140 LEU M 169 1 ? 30 
HELX_P HELX_P156 AR3 LEU N  176 ? HIS N  183 ? LEU M 176 HIS M 183 1 ? 8  
HELX_P HELX_P157 AR4 ALA N  189 ? ILE N  203 ? ALA M 189 ILE M 203 1 ? 15 
HELX_P HELX_P158 AR5 LEU N  210 ? ALA N  212 ? LEU M 210 ALA M 212 5 ? 3  
HELX_P HELX_P159 AR6 TRP N  213 ? GLU N  220 ? TRP M 213 GLU M 220 1 ? 8  
HELX_P HELX_P160 AR7 GLY N  225 ? LEU N  233 ? GLY M 225 LEU M 233 1 ? 9  
HELX_P HELX_P161 AR8 VAL N  236 ? PHE N  244 ? VAL M 236 PHE M 244 1 ? 9  
HELX_P HELX_P162 AR9 PHE N  244 ? ALA N  249 ? PHE M 244 ALA M 249 1 ? 6  
HELX_P HELX_P163 AS1 ALA N  249 ? ALA N  275 ? ALA M 249 ALA M 275 1 ? 27 
HELX_P HELX_P164 AS2 ASP N  280 ? SER N  302 ? ASP M 280 SER M 302 1 ? 23 
HELX_P HELX_P165 AS3 THR N  304 ? GLY N  337 ? THR M 304 GLY M 337 1 ? 34 
HELX_P HELX_P166 AS4 GLY N  346 ? ALA N  351 ? GLY M 346 ALA M 351 1 ? 6  
HELX_P HELX_P167 AS5 GLY N  353 ? GLY N  367 ? GLY M 353 GLY M 367 1 ? 15 
HELX_P HELX_P168 AS6 SER N  372 ? SER N  388 ? SER M 372 SER M 388 1 ? 17 
HELX_P HELX_P169 AS7 SER N  388 ? PHE N  396 ? SER M 388 PHE M 396 1 ? 9  
HELX_P HELX_P170 AS8 SER N  398 ? PHE N  414 ? SER M 398 PHE M 414 1 ? 17 
HELX_P HELX_P171 AS9 ALA N  426 ? PHE N  446 ? ALA M 426 PHE M 446 1 ? 21 
HELX_P HELX_P172 AT1 GLY N  453 ? LEU N  464 ? GLY M 453 LEU M 464 1 ? 12 
HELX_P HELX_P173 AT2 THR O  2   ? GLY O  17  ? THR N 2   GLY N 17  1 ? 16 
HELX_P HELX_P174 AT3 PRO O  21  ? THR O  43  ? PRO N 21  THR N 43  1 ? 23 
HELX_P HELX_P175 AT4 ASP O  56  ? VAL O  77  ? ASP N 56  VAL N 77  1 ? 22 
HELX_P HELX_P176 AT5 PHE O  82  ? SER O  100 ? PHE N 82  SER N 100 1 ? 19 
HELX_P HELX_P177 AT6 HIS O  103 ? ALA O  122 ? HIS N 103 ALA N 122 1 ? 20 
HELX_P HELX_P178 AT7 ARG O  126 ? THR O  158 ? ARG N 126 THR N 158 1 ? 33 
HELX_P HELX_P179 AT8 GLY O  169 ? ALA O  187 ? GLY N 169 ALA N 187 1 ? 19 
HELX_P HELX_P180 AT9 PHE O  194 ? SER O  203 ? PHE N 194 SER N 203 1 ? 10 
HELX_P HELX_P181 AU1 PRO O  204 ? LEU O  224 ? PRO N 204 LEU N 224 1 ? 21 
HELX_P HELX_P182 AU2 PRO O  229 ? ALA O  250 ? PRO N 229 ALA N 250 1 ? 22 
HELX_P HELX_P183 AU3 GLU O  253 ? ALA O  270 ? GLU N 253 ALA N 270 1 ? 18 
HELX_P HELX_P184 AU4 LEU O  271 ? THR O  275 ? LEU N 271 THR N 275 5 ? 5  
HELX_P HELX_P185 AU5 GLN O  279 ? SER O  303 ? GLN N 279 SER N 303 1 ? 25 
HELX_P HELX_P186 AU6 PRO O  308 ? ARG O  313 ? PRO N 308 ARG N 313 5 ? 6  
HELX_P HELX_P187 AU7 GLY O  314 ? ASP O  319 ? GLY N 314 ASP N 319 1 ? 6  
HELX_P HELX_P188 AU8 ASP O  319 ? GLY O  335 ? ASP N 319 GLY N 335 1 ? 17 
HELX_P HELX_P189 AU9 LEU O  339 ? ALA O  355 ? LEU N 339 ALA N 355 1 ? 17 
HELX_P HELX_P190 AV1 TRP O  358 ? SER O  371 ? TRP N 358 SER N 371 1 ? 14 
HELX_P HELX_P191 AV2 SER O  371 ? LEU O  380 ? SER N 371 LEU N 380 1 ? 10 
HELX_P HELX_P192 AV3 ALA O  381 ? ALA O  384 ? ALA N 381 ALA N 384 5 ? 4  
HELX_P HELX_P193 AV4 PRO O  395 ? LEU O  415 ? PRO N 395 LEU N 415 1 ? 21 
HELX_P HELX_P194 AV5 VAL O  419 ? LEU O  423 ? VAL N 419 LEU N 423 5 ? 5  
HELX_P HELX_P195 AV6 PRO P  9   ? GLN P  43  ? PRO H 9   GLN H 43  1 ? 35 
HELX_P HELX_P196 AV7 LEU P  57  ? ILE P  67  ? LEU H 57  ILE H 67  1 ? 11 
HELX_P HELX_P197 AV8 ASP P  78  ? LEU P  95  ? ASP H 78  LEU H 95  1 ? 18 
HELX_P HELX_P198 AV9 LEU P  120 ? SER P  143 ? LEU H 120 SER H 143 1 ? 24 
HELX_P HELX_P199 AW1 SER P  145 ? GLY P  178 ? SER H 145 GLY H 178 1 ? 34 
HELX_P HELX_P200 AW2 ASN P  181 ? HIS P  192 ? ASN H 181 HIS H 192 1 ? 12 
HELX_P HELX_P201 AW3 LEU P  195 ? GLU P  213 ? LEU H 195 GLU H 213 1 ? 19 
HELX_P HELX_P202 AW4 ILE P  239 ? PHE P  263 ? ILE H 239 PHE H 263 1 ? 25 
HELX_P HELX_P203 AW5 TYR P  276 ? TRP P  297 ? TYR H 276 TRP H 297 1 ? 22 
HELX_P HELX_P204 AW6 TYR P  302 ? PHE P  312 ? TYR H 302 PHE H 312 1 ? 11 
HELX_P HELX_P205 AW7 PHE P  312 ? ASP P  331 ? PHE H 312 ASP H 331 1 ? 20 
HELX_P HELX_P206 AW8 ARG P  334 ? ALA P  351 ? ARG H 334 ALA H 351 1 ? 18 
HELX_P HELX_P207 AW9 THR Q  28  ? HIS Q  35  ? THR B 28  HIS B 35  1 ? 8  
HELX_P HELX_P208 AX1 TYR Q  38  ? LYS Q  48  ? TYR B 38  LYS B 48  1 ? 11 
HELX_P HELX_P209 AX2 THR Q  49  ? SER Q  60  ? THR B 49  SER B 60  1 ? 12 
HELX_P HELX_P210 AX3 PRO Q  71  ? PHE Q  78  ? PRO B 71  PHE B 78  1 ? 8  
HELX_P HELX_P211 AX4 LYS Q  102 ? VAL Q  110 ? LYS B 102 VAL B 110 1 ? 9  
HELX_P HELX_P212 AX5 VAL Q  110 ? ILE Q  125 ? VAL B 110 ILE B 125 1 ? 16 
HELX_P HELX_P213 AX6 ARG Q  139 ? ARG Q  155 ? ARG B 139 ARG B 155 1 ? 17 
HELX_P HELX_P214 AX7 ASN Q  161 ? THR Q  165 ? ASN B 161 THR B 165 5 ? 5  
HELX_P HELX_P215 AX8 ALA Q  179 ? GLY Q  183 ? ALA B 179 GLY B 183 5 ? 5  
HELX_P HELX_P216 AX9 GLU Q  184 ? GLY Q  194 ? GLU B 184 GLY B 194 1 ? 11 
HELX_P HELX_P217 AY1 GLY Q  210 ? LYS Q  214 ? GLY B 210 LYS B 214 5 ? 5  
HELX_P HELX_P218 AY2 VAL Q  221 ? ARG Q  233 ? VAL B 221 ARG B 233 1 ? 13 
HELX_P HELX_P219 AY3 ALA Q  235 ? GLN Q  240 ? ALA B 235 GLN B 240 1 ? 6  
HELX_P HELX_P220 AY4 THR Q  271 ? GLU Q  278 ? THR B 271 GLU B 278 1 ? 8  
HELX_P HELX_P221 AY5 THR Q  303 ? ASP Q  308 ? THR B 303 ASP B 308 1 ? 6  
HELX_P HELX_P222 AY6 LEU Q  316 ? GLY Q  320 ? LEU B 316 GLY B 320 5 ? 5  
HELX_P HELX_P223 AY7 SER Q  336 ? GLU Q  351 ? SER B 336 GLU B 351 1 ? 16 
HELX_P HELX_P224 AY8 CYS Q  356 ? PHE Q  366 ? CYS B 356 PHE B 366 1 ? 11 
HELX_P HELX_P225 AY9 PHE Q  366 ? THR Q  376 ? PHE B 366 THR B 376 1 ? 11 
HELX_P HELX_P226 AZ1 GLU Q  380 ? GLY Q  396 ? GLU B 380 GLY B 396 1 ? 17 
HELX_P HELX_P227 AZ2 PRO Q  401 ? GLU Q  427 ? PRO B 401 GLU B 427 1 ? 27 
HELX_P HELX_P228 AZ3 GLN R  8   ? ALA R  16  ? GLN C 8   ALA C 16  1 ? 9  
HELX_P HELX_P229 AZ4 GLY R  22  ? ALA R  25  ? GLY C 22  ALA C 25  5 ? 4  
HELX_P HELX_P230 AZ5 ALA R  26  ? GLY R  39  ? ALA C 26  GLY C 39  1 ? 14 
HELX_P HELX_P231 AZ6 ARG R  42  ? GLY R  54  ? ARG C 42  GLY C 54  1 ? 13 
HELX_P HELX_P232 AZ7 THR R  56  ? SER R  65  ? THR C 56  SER C 65  1 ? 10 
HELX_P HELX_P233 AZ8 THR R  85  ? ALA R  91  ? THR C 85  ALA C 91  1 ? 7  
HELX_P HELX_P234 AZ9 GLY R  92  ? GLY R  105 ? GLY C 92  GLY C 105 1 ? 14 
HELX_P HELX_P235 BA1 THR R  146 ? ALA R  159 ? THR C 146 ALA C 159 1 ? 14 
HELX_P HELX_P236 BA2 SER S  18  ? GLY S  27  ? SER D 18  GLY D 27  1 ? 10 
HELX_P HELX_P237 BA3 SER S  97  ? LEU S  113 ? SER D 97  LEU D 113 1 ? 17 
HELX_P HELX_P238 BA4 ASP S  118 ? CYS S  122 ? ASP D 118 CYS D 122 5 ? 5  
HELX_P HELX_P239 BA5 CYS S  128 ? GLY S  138 ? CYS D 128 GLY D 138 1 ? 11 
HELX_P HELX_P240 BA6 LYS S  185 ? VAL S  194 ? LYS D 185 VAL D 194 1 ? 10 
HELX_P HELX_P241 BA7 ARG S  205 ? THR S  209 ? ARG D 205 THR D 209 5 ? 5  
HELX_P HELX_P242 BA8 GLY S  224 ? CYS S  230 ? GLY D 224 CYS D 230 1 ? 7  
HELX_P HELX_P243 BA9 THR S  239 ? ARG S  241 ? THR D 239 ARG D 241 5 ? 3  
HELX_P HELX_P244 BB1 CYS S  291 ? PHE S  296 ? CYS D 291 PHE D 296 1 ? 6  
HELX_P HELX_P245 BB2 THR S  321 ? LYS S  334 ? THR D 321 LYS D 334 1 ? 14 
HELX_P HELX_P246 BB3 ARG S  337 ? GLU S  339 ? ARG D 337 GLU D 339 5 ? 3  
HELX_P HELX_P247 BB4 THR S  350 ? LEU S  364 ? THR D 350 LEU D 364 1 ? 15 
HELX_P HELX_P248 BB5 PRO S  378 ? PHE S  382 ? PRO D 378 PHE D 382 5 ? 5  
HELX_P HELX_P249 BB6 SER S  386 ? ALA S  393 ? SER D 386 ALA D 393 1 ? 8  
HELX_P HELX_P250 BB7 ASP S  401 ? ALA S  406 ? ASP D 401 ALA D 406 1 ? 6  
HELX_P HELX_P251 BB8 ALA S  406 ? ARG S  418 ? ALA D 406 ARG D 418 1 ? 13 
HELX_P HELX_P252 BB9 ALA S  456 ? TRP S  461 ? ALA D 456 TRP D 461 5 ? 6  
HELX_P HELX_P253 BC1 GLU S  472 ? GLY S  482 ? GLU D 472 GLY D 482 1 ? 11 
HELX_P HELX_P254 BC2 SER S  487 ? ALA S  500 ? SER D 487 ALA D 500 1 ? 14 
HELX_P HELX_P255 BC3 GLY S  508 ? GLN S  513 ? GLY D 508 GLN D 513 1 ? 6  
HELX_P HELX_P256 BC4 ASP S  514 ? LYS S  528 ? ASP D 514 LYS D 528 1 ? 15 
HELX_P HELX_P257 BC5 ASN S  540 ? MET S  547 ? ASN D 540 MET D 547 1 ? 8  
HELX_P HELX_P258 BC6 PRO S  573 ? LYS S  578 ? PRO D 573 LYS D 578 1 ? 6  
HELX_P HELX_P259 BC7 HIS S  591 ? TYR S  597 ? HIS D 591 TYR D 597 1 ? 7  
HELX_P HELX_P260 BC8 THR S  606 ? LYS S  610 ? THR D 606 LYS D 610 5 ? 5  
HELX_P HELX_P261 BC9 GLY S  636 ? ALA S  647 ? GLY D 636 ALA D 647 1 ? 12 
HELX_P HELX_P262 BD1 LEU S  656 ? ARG S  667 ? LEU D 656 ARG D 667 1 ? 12 
HELX_P HELX_P263 BD2 LYS S  700 ? ALA S  704 ? LYS D 700 ALA D 704 5 ? 5  
HELX_P HELX_P264 BD3 VAL S  705 ? GLN S  709 ? VAL D 705 GLN D 709 5 ? 5  
HELX_P HELX_P265 BD4 HIS S  719 ? ALA S  727 ? HIS D 719 ALA D 727 1 ? 9  
HELX_P HELX_P266 BD5 GLY T  65  ? MET T  70  ? GLY E 65  MET E 70  1 ? 6  
HELX_P HELX_P267 BD6 GLU T  71  ? ARG T  73  ? GLU E 71  ARG E 73  5 ? 3  
HELX_P HELX_P268 BD7 THR T  74  ? THR T  82  ? THR E 74  THR E 82  1 ? 9  
HELX_P HELX_P269 BD8 SER T  90  ? GLY T  106 ? SER E 90  GLY E 106 1 ? 17 
HELX_P HELX_P270 BD9 PRO T  110 ? LEU T  140 ? PRO E 110 LEU E 140 1 ? 31 
HELX_P HELX_P271 BE1 THR T  144 ? THR T  164 ? THR E 144 THR E 164 1 ? 21 
HELX_P HELX_P272 BE2 GLU T  185 ? ALA T  209 ? GLU E 185 ALA E 209 1 ? 25 
HELX_P HELX_P273 BE3 ILE T  213 ? ARG T  219 ? ILE E 213 ARG E 219 1 ? 7  
HELX_P HELX_P274 BE4 PRO T  225 ? GLY T  233 ? PRO E 225 GLY E 233 1 ? 9  
HELX_P HELX_P275 BE5 LEU T  239 ? GLY T  243 ? LEU E 239 GLY E 243 5 ? 5  
HELX_P HELX_P276 BE6 ASP T  247 ? TYR T  252 ? ASP E 247 TYR E 252 1 ? 6  
HELX_P HELX_P277 BE7 GLY T  256 ? TYR T  260 ? GLY E 256 TYR E 260 5 ? 5  
HELX_P HELX_P278 BE8 ASP T  271 ? ARG T  296 ? ASP E 271 ARG E 296 1 ? 26 
HELX_P HELX_P279 BE9 PRO T  313 ? THR T  319 ? PRO E 313 THR E 319 5 ? 7  
HELX_P HELX_P280 BF1 SER T  320 ? GLU T  333 ? SER E 320 GLU E 333 1 ? 14 
HELX_P HELX_P281 BF2 ALA T  372 ? LEU T  378 ? ALA E 372 LEU E 378 1 ? 7  
HELX_P HELX_P282 BF3 SER T  380 ? CYS T  385 ? SER E 380 CYS E 385 1 ? 6  
HELX_P HELX_P283 BF4 PRO T  391 ? SER T  399 ? PRO E 391 SER E 399 1 ? 9  
HELX_P HELX_P284 BF5 VAL T  403 ? ARG T  409 ? VAL E 403 ARG E 409 1 ? 7  
HELX_P HELX_P285 BF6 ARG U  2   ? LYS U  13  ? ARG F 2   LYS F 13  1 ? 12 
HELX_P HELX_P286 BF7 PRO U  30  ? MET U  44  ? PRO F 30  MET F 44  1 ? 15 
HELX_P HELX_P287 BF8 SER U  110 ? PHE U  122 ? SER F 110 PHE F 122 1 ? 13 
HELX_P HELX_P288 BF9 ILE U  166 ? ARG U  171 ? ILE F 166 ARG F 171 1 ? 6  
HELX_P HELX_P289 BG1 GLY U  186 ? GLY U  191 ? GLY F 186 GLY F 191 5 ? 6  
HELX_P HELX_P290 BG2 THR V  23  ? SER V  35  ? THR G 23  SER G 35  1 ? 13 
HELX_P HELX_P291 BG3 ALA V  44  ? ALA V  52  ? ALA G 44  ALA G 52  1 ? 9  
HELX_P HELX_P292 BG4 SER V  53  ? ASP V  55  ? SER G 53  ASP G 55  5 ? 3  
HELX_P HELX_P293 BG5 SER V  71  ? ALA V  75  ? SER G 71  ALA G 75  5 ? 5  
HELX_P HELX_P294 BG6 SER V  85  ? LYS V  87  ? SER G 85  LYS G 87  5 ? 3  
HELX_P HELX_P295 BG7 MET V  88  ? GLN V  98  ? MET G 88  GLN G 98  1 ? 11 
HELX_P HELX_P296 BG8 GLY V  109 ? SER V  114 ? GLY G 109 SER G 114 1 ? 6  
HELX_P HELX_P297 BG9 ASN V  126 ? VAL V  130 ? ASN G 126 VAL G 130 5 ? 5  
HELX_P HELX_P298 BH1 ARG V  143 ? ARG V  159 ? ARG G 143 ARG G 159 1 ? 17 
HELX_P HELX_P299 BH2 LEU W  3   ? SER W  19  ? LEU O 3   SER O 19  1 ? 17 
HELX_P HELX_P300 BH3 SER W  57  ? ALA W  62  ? SER O 57  ALA O 62  1 ? 6  
HELX_P HELX_P301 BH4 GLY W  102 ? CYS W  108 ? GLY O 102 CYS O 108 1 ? 7  
HELX_P HELX_P302 BH5 GLU W  125 ? ASP W  128 ? GLU O 125 ASP O 128 5 ? 4  
HELX_P HELX_P303 BH6 GLY W  132 ? MET W  136 ? GLY O 132 MET O 136 5 ? 5  
HELX_P HELX_P304 BH7 THR W  143 ? GLY W  154 ? THR O 143 GLY O 154 1 ? 12 
HELX_P HELX_P305 BH8 ARG W  167 ? GLU W  171 ? ARG O 167 GLU O 171 5 ? 5  
HELX_P HELX_P306 BH9 SER X  4   ? GLY X  28  ? SER I 4   GLY I 28  1 ? 25 
HELX_P HELX_P307 BI1 PHE X  37  ? TYR X  42  ? PHE I 37  TYR I 42  1 ? 6  
HELX_P HELX_P308 BI2 THR X  111 ? LEU X  126 ? THR I 111 LEU I 126 1 ? 16 
HELX_P HELX_P309 BI3 ALA Y  9   ? GLY Y  22  ? ALA X 9   GLY X 22  1 ? 14 
HELX_P HELX_P310 BI4 GLY Y  69  ? GLN Y  84  ? GLY X 69  GLN X 84  1 ? 16 
HELX_P HELX_P311 BI5 GLY Y  97  ? LEU Y  102 ? GLY X 97  LEU X 102 1 ? 6  
HELX_P HELX_P312 BI6 PRO Y  106 ? ALA Y  118 ? PRO X 106 ALA X 118 1 ? 13 
HELX_P HELX_P313 BI7 ASP Y  122 ? LEU Y  127 ? ASP X 122 LEU X 127 5 ? 6  
HELX_P HELX_P314 BI8 ILE Z  4   ? LEU Z  31  ? ILE P 4   LEU P 31  1 ? 28 
HELX_P HELX_P315 BI9 VAL Z  59  ? SER Z  84  ? VAL P 59  SER P 84  1 ? 26 
HELX_P HELX_P316 BJ1 LEU Z  88  ? GLY Z  114 ? LEU P 88  GLY P 114 1 ? 27 
HELX_P HELX_P317 BJ2 SER AA 2   ? LEU AA 22  ? SER R 2   LEU R 22  1 ? 21 
HELX_P HELX_P318 BJ3 ASN AA 24  ? LEU AA 46  ? ASN R 24  LEU R 46  1 ? 23 
HELX_P HELX_P319 BJ4 ARG AA 49  ? TYR AA 59  ? ARG R 49  TYR R 59  1 ? 11 
HELX_P HELX_P320 BJ5 ALA AA 62  ? LEU AA 74  ? ALA R 62  LEU R 74  1 ? 13 
HELX_P HELX_P321 BJ6 ARG AA 88  ? TRP AA 109 ? ARG R 88  TRP R 109 1 ? 22 
HELX_P HELX_P322 BJ7 LEU AA 123 ? TYR AA 132 ? LEU R 123 TYR R 132 1 ? 10 
HELX_P HELX_P323 BJ8 TRP AA 135 ? GLU AA 158 ? TRP R 135 GLU R 158 1 ? 24 
HELX_P HELX_P324 BJ9 SER BA 2   ? ARG BA 21  ? SER S 2   ARG S 21  1 ? 20 
HELX_P HELX_P325 BK1 THR BA 23  ? GLY BA 50  ? THR S 23  GLY S 50  1 ? 28 
HELX_P HELX_P326 BK2 LEU BA 51  ? PHE BA 79  ? LEU S 51  PHE S 79  1 ? 29 
HELX_P HELX_P327 BK3 ALA BA 86  ? LEU BA 90  ? ALA S 86  LEU S 90  5 ? 5  
HELX_P HELX_P328 BK4 ALA CA 2   ? PHE CA 20  ? ALA T 2   PHE T 20  1 ? 19 
HELX_P HELX_P329 BK5 PRO CA 27  ? SER CA 50  ? PRO T 27  SER T 50  1 ? 24 
HELX_P HELX_P330 BK6 ASP CA 70  ? MET CA 95  ? ASP T 70  MET T 95  1 ? 26 
HELX_P HELX_P331 BK7 GLY CA 100 ? LEU CA 120 ? GLY T 100 LEU T 120 1 ? 21 
HELX_P HELX_P332 BK8 SER CA 123 ? GLY CA 143 ? SER T 123 GLY T 143 1 ? 21 
HELX_P HELX_P333 BK9 PRO CA 149 ? LEU CA 179 ? PRO T 149 LEU T 179 1 ? 31 
HELX_P HELX_P334 BL1 SER CA 184 ? GLU CA 193 ? SER T 184 GLU T 193 1 ? 10 
HELX_P HELX_P335 BL2 ASN CA 198 ? ALA CA 218 ? ASN T 198 ALA T 218 1 ? 21 
HELX_P HELX_P336 BL3 PRO CA 221 ? GLY CA 232 ? PRO T 221 GLY T 232 5 ? 12 
HELX_P HELX_P337 BL4 PRO CA 233 ? ALA CA 242 ? PRO T 233 ALA T 242 1 ? 10 
HELX_P HELX_P338 BL5 VAL CA 246 ? SER CA 256 ? VAL T 246 SER T 256 1 ? 11 
HELX_P HELX_P339 BL6 SER CA 256 ? SER CA 261 ? SER T 256 SER T 261 1 ? 6  
HELX_P HELX_P340 BL7 LEU CA 263 ? GLN CA 288 ? LEU T 263 GLN T 288 1 ? 26 
HELX_P HELX_P341 BL8 ASP CA 290 ? VAL CA 312 ? ASP T 290 VAL T 312 1 ? 23 
HELX_P HELX_P342 BL9 ALA CA 314 ? LEU CA 343 ? ALA T 314 LEU T 343 1 ? 30 
HELX_P HELX_P343 BM1 THR CA 362 ? GLY CA 375 ? THR T 362 GLY T 375 1 ? 14 
HELX_P HELX_P344 BM2 LEU CA 379 ? TYR CA 395 ? LEU T 379 TYR T 395 1 ? 17 
HELX_P HELX_P345 BM3 GLY CA 399 ? LEU CA 426 ? GLY T 399 LEU T 426 1 ? 28 
HELX_P HELX_P346 BM4 PRO CA 439 ? GLY CA 457 ? PRO T 439 GLY T 457 1 ? 19 
HELX_P HELX_P347 BM5 TYR CA 458 ? ALA CA 460 ? TYR T 458 ALA T 460 5 ? 3  
HELX_P HELX_P348 BM6 VAL CA 468 ? LYS CA 474 ? VAL T 468 LYS T 474 1 ? 7  
HELX_P HELX_P349 BM7 GLY CA 488 ? LYS CA 515 ? GLY T 488 LYS T 515 1 ? 28 
HELX_P HELX_P350 BM8 PRO CA 518 ? GLU CA 530 ? PRO T 518 GLU T 530 1 ? 13 
HELX_P HELX_P351 BM9 TYR CA 533 ? ILE CA 542 ? TYR T 533 ILE T 542 1 ? 10 
HELX_P HELX_P352 BN1 ILE CA 542 ? ARG CA 580 ? ILE T 542 ARG T 580 1 ? 39 
HELX_P HELX_P353 BN2 TYR CA 585 ? MET CA 604 ? TYR T 585 MET T 604 1 ? 20 
HELX_P HELX_P354 BN3 VAL DA 2   ? LEU DA 18  ? VAL U 2   LEU U 18  1 ? 17 
HELX_P HELX_P355 BN4 ARG DA 22  ? LEU DA 41  ? ARG U 22  LEU U 41  1 ? 20 
HELX_P HELX_P356 BN5 ASP DA 68  ? VAL DA 88  ? ASP U 68  VAL U 88  1 ? 21 
HELX_P HELX_P357 BN6 PHE DA 95  ? ALA DA 112 ? PHE U 95  ALA U 112 1 ? 18 
HELX_P HELX_P358 BN7 ASP DA 114 ? ALA DA 125 ? ASP U 114 ALA U 125 1 ? 12 
HELX_P HELX_P359 BN8 ALA DA 125 ? LEU DA 135 ? ALA U 125 LEU U 135 1 ? 11 
HELX_P HELX_P360 BN9 GLY DA 140 ? LEU DA 169 ? GLY U 140 LEU U 169 1 ? 30 
HELX_P HELX_P361 BO1 LEU DA 176 ? HIS DA 183 ? LEU U 176 HIS U 183 1 ? 8  
HELX_P HELX_P362 BO2 ALA DA 189 ? LYS DA 204 ? ALA U 189 LYS U 204 1 ? 16 
HELX_P HELX_P363 BO3 LEU DA 210 ? ALA DA 212 ? LEU U 210 ALA U 212 5 ? 3  
HELX_P HELX_P364 BO4 TRP DA 213 ? ASN DA 221 ? TRP U 213 ASN U 221 1 ? 9  
HELX_P HELX_P365 BO5 GLY DA 225 ? TYR DA 234 ? GLY U 225 TYR U 234 1 ? 10 
HELX_P HELX_P366 BO6 VAL DA 236 ? PHE DA 244 ? VAL U 236 PHE U 244 1 ? 9  
HELX_P HELX_P367 BO7 PHE DA 244 ? ALA DA 249 ? PHE U 244 ALA U 249 1 ? 6  
HELX_P HELX_P368 BO8 ALA DA 249 ? ALA DA 278 ? ALA U 249 ALA U 278 1 ? 30 
HELX_P HELX_P369 BO9 ASP DA 280 ? SER DA 302 ? ASP U 280 SER U 302 1 ? 23 
HELX_P HELX_P370 BP1 THR DA 304 ? GLY DA 337 ? THR U 304 GLY U 337 1 ? 34 
HELX_P HELX_P371 BP2 GLY DA 346 ? ALA DA 351 ? GLY U 346 ALA U 351 1 ? 6  
HELX_P HELX_P372 BP3 GLY DA 353 ? GLY DA 367 ? GLY U 353 GLY U 367 1 ? 15 
HELX_P HELX_P373 BP4 SER DA 372 ? SER DA 388 ? SER U 372 SER U 388 1 ? 17 
HELX_P HELX_P374 BP5 SER DA 388 ? PHE DA 396 ? SER U 388 PHE U 396 1 ? 9  
HELX_P HELX_P375 BP6 SER DA 398 ? PHE DA 414 ? SER U 398 PHE U 414 1 ? 17 
HELX_P HELX_P376 BP7 ALA DA 426 ? PHE DA 446 ? ALA U 426 PHE U 446 1 ? 21 
HELX_P HELX_P377 BP8 GLY DA 453 ? LEU DA 464 ? GLY U 453 LEU U 464 1 ? 12 
HELX_P HELX_P378 BP9 THR EA 2   ? GLY EA 17  ? THR V 2   GLY V 17  1 ? 16 
HELX_P HELX_P379 BQ1 PRO EA 21  ? THR EA 43  ? PRO V 21  THR V 43  1 ? 23 
HELX_P HELX_P380 BQ2 ASP EA 56  ? VAL EA 77  ? ASP V 56  VAL V 77  1 ? 22 
HELX_P HELX_P381 BQ3 PHE EA 82  ? SER EA 100 ? PHE V 82  SER V 100 1 ? 19 
HELX_P HELX_P382 BQ4 HIS EA 103 ? ALA EA 122 ? HIS V 103 ALA V 122 1 ? 20 
HELX_P HELX_P383 BQ5 ARG EA 126 ? THR EA 158 ? ARG V 126 THR V 158 1 ? 33 
HELX_P HELX_P384 BQ6 GLY EA 169 ? ALA EA 187 ? GLY V 169 ALA V 187 1 ? 19 
HELX_P HELX_P385 BQ7 PHE EA 194 ? SER EA 203 ? PHE V 194 SER V 203 1 ? 10 
HELX_P HELX_P386 BQ8 PRO EA 204 ? VAL EA 226 ? PRO V 204 VAL V 226 1 ? 23 
HELX_P HELX_P387 BQ9 PRO EA 229 ? ALA EA 250 ? PRO V 229 ALA V 250 1 ? 22 
HELX_P HELX_P388 BR1 GLU EA 253 ? ALA EA 270 ? GLU V 253 ALA V 270 1 ? 18 
HELX_P HELX_P389 BR2 LEU EA 271 ? THR EA 275 ? LEU V 271 THR V 275 5 ? 5  
HELX_P HELX_P390 BR3 GLN EA 279 ? SER EA 303 ? GLN V 279 SER V 303 1 ? 25 
HELX_P HELX_P391 BR4 PRO EA 308 ? ARG EA 313 ? PRO V 308 ARG V 313 5 ? 6  
HELX_P HELX_P392 BR5 GLY EA 314 ? ASP EA 319 ? GLY V 314 ASP V 319 1 ? 6  
HELX_P HELX_P393 BR6 ASP EA 319 ? GLY EA 335 ? ASP V 319 GLY V 335 1 ? 17 
HELX_P HELX_P394 BR7 LEU EA 339 ? ALA EA 355 ? LEU V 339 ALA V 355 1 ? 17 
HELX_P HELX_P395 BR8 TRP EA 358 ? LEU EA 380 ? TRP V 358 LEU V 380 1 ? 23 
HELX_P HELX_P396 BR9 ALA EA 381 ? ALA EA 384 ? ALA V 381 ALA V 384 5 ? 4  
HELX_P HELX_P397 BS1 PRO EA 395 ? LEU EA 415 ? PRO V 395 LEU V 415 1 ? 21 
HELX_P HELX_P398 BS2 VAL EA 419 ? LEU EA 423 ? VAL V 419 LEU V 423 5 ? 5  
HELX_P HELX_P399 BS3 PRO FA 9   ? GLN FA 43  ? PRO Q 9   GLN Q 43  1 ? 35 
HELX_P HELX_P400 BS4 LEU FA 57  ? ILE FA 67  ? LEU Q 57  ILE Q 67  1 ? 11 
HELX_P HELX_P401 BS5 ASP FA 78  ? LEU FA 95  ? ASP Q 78  LEU Q 95  1 ? 18 
HELX_P HELX_P402 BS6 LEU FA 120 ? SER FA 143 ? LEU Q 120 SER Q 143 1 ? 24 
HELX_P HELX_P403 BS7 SER FA 145 ? GLY FA 178 ? SER Q 145 GLY Q 178 1 ? 34 
HELX_P HELX_P404 BS8 ASN FA 181 ? HIS FA 192 ? ASN Q 181 HIS Q 192 1 ? 12 
HELX_P HELX_P405 BS9 TRP FA 194 ? GLU FA 213 ? TRP Q 194 GLU Q 213 1 ? 20 
HELX_P HELX_P406 BT1 ILE FA 239 ? PHE FA 263 ? ILE Q 239 PHE Q 263 1 ? 25 
HELX_P HELX_P407 BT2 TYR FA 276 ? TRP FA 297 ? TYR Q 276 TRP Q 297 1 ? 22 
HELX_P HELX_P408 BT3 TYR FA 302 ? PHE FA 312 ? TYR Q 302 PHE Q 312 1 ? 11 
HELX_P HELX_P409 BT4 PHE FA 312 ? ASP FA 331 ? PHE Q 312 ASP Q 331 1 ? 20 
HELX_P HELX_P410 BT5 ARG FA 334 ? ALA FA 351 ? ARG Q 334 ALA Q 351 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? B CYS 144 SG  ? ? ? 1_555 B  CYS 172 SG  ? ? 2 CYS 144 2 CYS 172 1_555 ? ? ? ? ? ? ? 2.095 ? ? 
disulf2  disulf ? ? R CYS 144 SG  ? ? ? 1_555 R  CYS 172 SG  ? ? C CYS 144 C CYS 172 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc1  metalc ? ? A CYS 353 SG  ? ? ? 1_555 GA SF4 .   FE4 ? ? 1 CYS 353 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc2  metalc ? ? A CYS 356 SG  ? ? ? 1_555 GA SF4 .   FE1 ? ? 1 CYS 356 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc3  metalc ? ? A CYS 359 SG  ? ? ? 1_555 GA SF4 .   FE2 ? ? 1 CYS 359 1 SF4 501 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc4  metalc ? ? B CYS 83  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 83  2 FES 201 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc5  metalc ? ? B CYS 88  SG  ? ? ? 1_555 IA FES .   FE1 ? ? 2 CYS 88  2 FES 201 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc6  metalc ? ? B CYS 124 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 124 2 FES 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc7  metalc ? ? B CYS 128 SG  ? ? ? 1_555 IA FES .   FE2 ? ? 2 CYS 128 2 FES 201 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc8  metalc ? ? C CYS 45  SG  ? ? ? 1_555 MA FES .   FE1 ? ? 3 CYS 45  3 FES 804 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc9  metalc ? ? C CYS 48  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 48  3 FES 804 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc10 metalc ? ? C CYS 83  SG  ? ? ? 1_555 MA FES .   FE2 ? ? 3 CYS 83  3 FES 804 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc11 metalc ? ? C HIS 115 NE2 ? ? ? 1_555 JA SF4 .   FE3 ? ? 3 HIS 115 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.070 ? ? 
metalc12 metalc ? ? C CYS 119 SG  ? ? ? 1_555 JA SF4 .   FE2 ? ? 3 CYS 119 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc13 metalc ? ? C CYS 122 SG  ? ? ? 1_555 JA SF4 .   FE4 ? ? 3 CYS 122 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc14 metalc ? ? C CYS 128 SG  ? ? ? 1_555 JA SF4 .   FE1 ? ? 3 CYS 128 3 SF4 801 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc15 metalc ? ? C CYS 181 SG  ? ? ? 1_555 KA SF4 .   FE2 ? ? 3 CYS 181 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.306 ? ? 
metalc16 metalc ? ? C CYS 184 SG  ? ? ? 1_555 KA SF4 .   FE1 ? ? 3 CYS 184 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.344 ? ? 
metalc17 metalc ? ? C CYS 187 SG  ? ? ? 1_555 KA SF4 .   FE3 ? ? 3 CYS 187 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.341 ? ? 
metalc18 metalc ? ? C CYS 230 SG  ? ? ? 1_555 KA SF4 .   FE4 ? ? 3 CYS 230 3 SF4 802 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc19 metalc ? ? C CYS 256 SG  ? ? ? 1_555 LA SF4 .   FE1 ? ? 3 CYS 256 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc20 metalc ? ? C CYS 259 SG  ? ? ? 1_555 LA SF4 .   FE4 ? ? 3 CYS 259 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.274 ? ? 
metalc21 metalc ? ? C CYS 263 SG  ? ? ? 1_555 LA SF4 .   FE3 ? ? 3 CYS 263 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.292 ? ? 
metalc22 metalc ? ? C CYS 291 SG  ? ? ? 1_555 LA SF4 .   FE2 ? ? 3 CYS 291 3 SF4 803 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc23 metalc ? ? F CYS 45  SG  ? ? ? 1_555 OA SF4 .   FE3 ? ? 6 CYS 45  6 SF4 201 1_555 ? ? ? ? ? ? ? 1.968 ? ? 
metalc24 metalc ? ? F CYS 46  SG  ? ? ? 1_555 OA SF4 .   FE2 ? ? 6 CYS 46  6 SF4 201 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc25 metalc ? ? F CYS 111 SG  ? ? ? 1_555 OA SF4 .   FE1 ? ? 6 CYS 111 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.307 ? ? 
metalc26 metalc ? ? F CYS 140 SG  ? ? ? 1_555 OA SF4 .   FE4 ? ? 6 CYS 140 6 SF4 201 1_555 ? ? ? ? ? ? ? 2.320 ? ? 
metalc27 metalc ? ? G CYS 53  SG  ? ? ? 1_555 QA SF4 .   FE3 ? ? 9 CYS 53  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc28 metalc ? ? G CYS 56  SG  ? ? ? 1_555 QA SF4 .   FE4 ? ? 9 CYS 56  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.304 ? ? 
metalc29 metalc ? ? G CYS 59  SG  ? ? ? 1_555 QA SF4 .   FE2 ? ? 9 CYS 59  9 SF4 202 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc30 metalc ? ? G CYS 63  SG  ? ? ? 1_555 PA SF4 .   FE4 ? ? 9 CYS 63  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.294 ? ? 
metalc31 metalc ? ? G CYS 98  SG  ? ? ? 1_555 PA SF4 .   FE2 ? ? 9 CYS 98  9 SF4 201 1_555 ? ? ? ? ? ? ? 2.328 ? ? 
metalc32 metalc ? ? G CYS 101 SG  ? ? ? 1_555 PA SF4 .   FE1 ? ? 9 CYS 101 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.333 ? ? 
metalc33 metalc ? ? G CYS 104 SG  ? ? ? 1_555 PA SF4 .   FE3 ? ? 9 CYS 104 9 SF4 201 1_555 ? ? ? ? ? ? ? 2.303 ? ? 
metalc34 metalc ? ? G CYS 108 SG  ? ? ? 1_555 QA SF4 .   FE1 ? ? 9 CYS 108 9 SF4 202 1_555 ? ? ? ? ? ? ? 2.331 ? ? 
metalc35 metalc ? ? Q CYS 353 SG  ? ? ? 1_555 RA SF4 .   FE4 ? ? B CYS 353 B SF4 501 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc36 metalc ? ? Q CYS 356 SG  ? ? ? 1_555 RA SF4 .   FE1 ? ? B CYS 356 B SF4 501 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc37 metalc ? ? Q CYS 359 SG  ? ? ? 1_555 RA SF4 .   FE2 ? ? B CYS 359 B SF4 501 1_555 ? ? ? ? ? ? ? 2.299 ? ? 
metalc38 metalc ? ? R CYS 83  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 83  C FES 201 1_555 ? ? ? ? ? ? ? 2.329 ? ? 
metalc39 metalc ? ? R CYS 88  SG  ? ? ? 1_555 TA FES .   FE1 ? ? C CYS 88  C FES 201 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc40 metalc ? ? R CYS 124 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 124 C FES 201 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc41 metalc ? ? R CYS 128 SG  ? ? ? 1_555 TA FES .   FE2 ? ? C CYS 128 C FES 201 1_555 ? ? ? ? ? ? ? 2.324 ? ? 
metalc42 metalc ? ? S CYS 34  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 34  D FES 804 1_555 ? ? ? ? ? ? ? 2.325 ? ? 
metalc43 metalc ? ? S CYS 45  SG  ? ? ? 1_555 XA FES .   FE1 ? ? D CYS 45  D FES 804 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc44 metalc ? ? S CYS 48  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 48  D FES 804 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc45 metalc ? ? S CYS 83  SG  ? ? ? 1_555 XA FES .   FE2 ? ? D CYS 83  D FES 804 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc46 metalc ? ? S HIS 115 NE2 ? ? ? 1_555 UA SF4 .   FE3 ? ? D HIS 115 D SF4 801 1_555 ? ? ? ? ? ? ? 2.017 ? ? 
metalc47 metalc ? ? S CYS 119 SG  ? ? ? 1_555 UA SF4 .   FE2 ? ? D CYS 119 D SF4 801 1_555 ? ? ? ? ? ? ? 2.323 ? ? 
metalc48 metalc ? ? S CYS 122 SG  ? ? ? 1_555 UA SF4 .   FE4 ? ? D CYS 122 D SF4 801 1_555 ? ? ? ? ? ? ? 2.280 ? ? 
metalc49 metalc ? ? S CYS 128 SG  ? ? ? 1_555 UA SF4 .   FE1 ? ? D CYS 128 D SF4 801 1_555 ? ? ? ? ? ? ? 2.321 ? ? 
metalc50 metalc ? ? S CYS 181 SG  ? ? ? 1_555 VA SF4 .   FE2 ? ? D CYS 181 D SF4 802 1_555 ? ? ? ? ? ? ? 2.318 ? ? 
metalc51 metalc ? ? S CYS 184 SG  ? ? ? 1_555 VA SF4 .   FE1 ? ? D CYS 184 D SF4 802 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc52 metalc ? ? S CYS 187 SG  ? ? ? 1_555 VA SF4 .   FE3 ? ? D CYS 187 D SF4 802 1_555 ? ? ? ? ? ? ? 2.335 ? ? 
metalc53 metalc ? ? S CYS 230 SG  ? ? ? 1_555 VA SF4 .   FE4 ? ? D CYS 230 D SF4 802 1_555 ? ? ? ? ? ? ? 2.332 ? ? 
metalc54 metalc ? ? S CYS 256 SG  ? ? ? 1_555 WA SF4 .   FE1 ? ? D CYS 256 D SF4 803 1_555 ? ? ? ? ? ? ? 2.322 ? ? 
metalc55 metalc ? ? S CYS 259 SG  ? ? ? 1_555 WA SF4 .   FE4 ? ? D CYS 259 D SF4 803 1_555 ? ? ? ? ? ? ? 2.296 ? ? 
metalc56 metalc ? ? S CYS 263 SG  ? ? ? 1_555 WA SF4 .   FE3 ? ? D CYS 263 D SF4 803 1_555 ? ? ? ? ? ? ? 2.267 ? ? 
metalc57 metalc ? ? S CYS 291 SG  ? ? ? 1_555 WA SF4 .   FE2 ? ? D CYS 291 D SF4 803 1_555 ? ? ? ? ? ? ? 2.313 ? ? 
metalc58 metalc ? ? V CYS 45  SG  ? ? ? 1_555 ZA SF4 .   FE3 ? ? G CYS 45  G SF4 201 1_555 ? ? ? ? ? ? ? 2.035 ? ? 
metalc59 metalc ? ? V CYS 46  SG  ? ? ? 1_555 ZA SF4 .   FE2 ? ? G CYS 46  G SF4 201 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc60 metalc ? ? V CYS 111 SG  ? ? ? 1_555 ZA SF4 .   FE1 ? ? G CYS 111 G SF4 201 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc61 metalc ? ? V CYS 140 SG  ? ? ? 1_555 ZA SF4 .   FE4 ? ? G CYS 140 G SF4 201 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc62 metalc ? ? W CYS 53  SG  ? ? ? 1_555 BB SF4 .   FE3 ? ? O CYS 53  O SF4 202 1_555 ? ? ? ? ? ? ? 2.311 ? ? 
metalc63 metalc ? ? W CYS 56  SG  ? ? ? 1_555 BB SF4 .   FE4 ? ? O CYS 56  O SF4 202 1_555 ? ? ? ? ? ? ? 2.314 ? ? 
metalc64 metalc ? ? W CYS 59  SG  ? ? ? 1_555 BB SF4 .   FE2 ? ? O CYS 59  O SF4 202 1_555 ? ? ? ? ? ? ? 2.310 ? ? 
metalc65 metalc ? ? W CYS 63  SG  ? ? ? 1_555 AB SF4 .   FE4 ? ? O CYS 63  O SF4 201 1_555 ? ? ? ? ? ? ? 2.339 ? ? 
metalc66 metalc ? ? W CYS 98  SG  ? ? ? 1_555 AB SF4 .   FE2 ? ? O CYS 98  O SF4 201 1_555 ? ? ? ? ? ? ? 2.336 ? ? 
metalc67 metalc ? ? W CYS 101 SG  ? ? ? 1_555 AB SF4 .   FE1 ? ? O CYS 101 O SF4 201 1_555 ? ? ? ? ? ? ? 2.346 ? ? 
metalc68 metalc ? ? W CYS 104 SG  ? ? ? 1_555 AB SF4 .   FE3 ? ? O CYS 104 O SF4 201 1_555 ? ? ? ? ? ? ? 2.309 ? ? 
metalc69 metalc ? ? W CYS 108 SG  ? ? ? 1_555 BB SF4 .   FE1 ? ? O CYS 108 O SF4 202 1_555 ? ? ? ? ? ? ? 2.289 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ALA 131 B  . ? ALA 131 2 PRO 132 B  ? PRO 132 2 1 -6.84  
2  HIS 34  D  . ? HIS 34  4 PRO 35  D  ? PRO 35  4 1 -5.17  
3  CYS 140 F  . ? CYS 140 6 PRO 141 F  ? PRO 141 6 1 -10.43 
4  TYR 26  G  . ? TYR 26  9 PRO 27  G  ? PRO 27  9 1 -1.17  
5  ILE 220 M  . ? ILE 220 L PRO 221 M  ? PRO 221 L 1 -3.11  
6  LEU 20  N  . ? LEU 20  M PRO 21  N  ? PRO 21  M 1 -3.34  
7  THR 205 N  . ? THR 205 M PRO 206 N  ? PRO 206 M 1 -5.70  
8  ALA 190 O  . ? ALA 190 N PRO 191 O  ? PRO 191 N 1 -0.24  
9  PRO 337 O  . ? PRO 337 N PRO 338 O  ? PRO 338 N 1 -0.66  
10 GLY 52  P  . ? GLY 52  H PRO 53  P  ? PRO 53  H 1 27.56  
11 LEU 221 P  . ? LEU 221 H PRO 222 P  ? PRO 222 H 1 -6.78  
12 ALA 131 R  . ? ALA 131 C PRO 132 R  ? PRO 132 C 1 -5.75  
13 HIS 34  T  . ? HIS 34  E PRO 35  T  ? PRO 35  E 1 -4.19  
14 CYS 140 V  . ? CYS 140 G PRO 141 V  ? PRO 141 G 1 -7.39  
15 TYR 26  W  . ? TYR 26  O PRO 27  W  ? PRO 27  O 1 1.52   
16 ILE 220 CA . ? ILE 220 T PRO 221 CA ? PRO 221 T 1 -5.23  
17 LEU 20  DA . ? LEU 20  U PRO 21  DA ? PRO 21  U 1 -4.47  
18 THR 205 DA . ? THR 205 U PRO 206 DA ? PRO 206 U 1 -7.41  
19 ALA 190 EA . ? ALA 190 V PRO 191 EA ? PRO 191 V 1 -1.14  
20 PRO 337 EA . ? PRO 337 V PRO 338 EA ? PRO 338 V 1 -0.17  
21 GLY 52  FA . ? GLY 52  Q PRO 53  FA ? PRO 53  Q 1 28.99  
22 LEU 221 FA . ? LEU 221 Q PRO 222 FA ? PRO 222 Q 1 -4.49  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 7 ? 
AA9 ? 5 ? 
AB1 ? 2 ? 
AB2 ? 7 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 5 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 4 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 7 ? 
AC4 ? 6 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 4 ? 
AC8 ? 5 ? 
AC9 ? 3 ? 
AD1 ? 5 ? 
AD2 ? 3 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 2 ? 
AD6 ? 5 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 7 ? 
AE1 ? 3 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 4 ? 
AE8 ? 2 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 3 ? 
AF3 ? 7 ? 
AF4 ? 6 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA8 5 6 ? parallel      
AA8 6 7 ? parallel      
AA9 1 2 ? parallel      
AA9 2 3 ? parallel      
AA9 3 4 ? parallel      
AA9 4 5 ? parallel      
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB2 5 6 ? anti-parallel 
AB2 6 7 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB6 1 2 ? parallel      
AB7 1 2 ? anti-parallel 
AB8 1 2 ? parallel      
AB8 2 3 ? parallel      
AB8 3 4 ? parallel      
AB9 1 2 ? parallel      
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC3 5 6 ? anti-parallel 
AC3 6 7 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? parallel      
AC4 5 6 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? parallel      
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? parallel      
AD6 2 3 ? parallel      
AD6 3 4 ? parallel      
AD6 4 5 ? parallel      
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? parallel      
AD9 3 4 ? anti-parallel 
AD9 4 5 ? parallel      
AD9 5 6 ? anti-parallel 
AD9 6 7 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? parallel      
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE8 1 2 ? anti-parallel 
AE9 1 2 ? parallel      
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF3 4 5 ? anti-parallel 
AF3 5 6 ? anti-parallel 
AF3 6 7 ? anti-parallel 
AF4 1 2 ? parallel      
AF4 2 3 ? anti-parallel 
AF4 3 4 ? anti-parallel 
AF4 4 5 ? parallel      
AF4 5 6 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A  171 ? ARG A  175 ? LEU 1 171 ARG 1 175 
AA1 2 ALA A  127 ? VAL A  134 ? ALA 1 127 VAL 1 134 
AA1 3 HIS A  87  ? ALA A  93  ? HIS 1 87  ALA 1 93  
AA1 4 THR A  216 ? ASN A  220 ? THR 1 216 ASN 1 220 
AA2 1 GLY A  262 ? PRO A  267 ? GLY 1 262 PRO 1 267 
AA2 2 MET A  249 ? SER A  255 ? MET 1 249 SER 1 255 
AA2 3 GLY A  327 ? PRO A  332 ? GLY 1 327 PRO 1 332 
AA2 4 ILE A  287 ? ILE A  291 ? ILE 1 287 ILE 1 291 
AA2 5 LEU A  300 ? PRO A  301 ? LEU 1 300 PRO 1 301 
AA3 1 PHE B  117 ? VAL B  122 ? PHE 2 117 VAL 2 122 
AA3 2 TYR B  78  ? CYS B  83  ? TYR 2 78  CYS 2 83  
AA3 3 ILE B  134 ? VAL B  136 ? ILE 2 134 VAL 2 136 
AA4 1 ARG C  9   ? VAL C  13  ? ARG 3 9   VAL 3 13  
AA4 2 VAL C  2   ? VAL C  6   ? VAL 3 2   VAL 3 6   
AA4 3 MET C  91  ? ASP C  94  ? MET 3 91  ASP 3 94  
AA4 4 LEU C  49  ? GLY C  53  ? LEU 3 49  GLY 3 53  
AA4 5 ALA C  80  ? ALA C  81  ? ALA 3 80  ALA 3 81  
AA5 1 HIS C  168 ? SER C  171 ? HIS 3 168 SER 3 171 
AA5 2 VAL C  174 ? LEU C  176 ? VAL 3 174 LEU 3 176 
AA5 3 LEU C  235 ? ASP C  237 ? LEU 3 235 ASP 3 237 
AA6 1 ASP C  201 ? PHE C  202 ? ASP 3 201 PHE 3 202 
AA6 2 ILE C  211 ? GLY C  212 ? ILE 3 211 GLY 3 212 
AA7 1 GLU C  250 ? THR C  255 ? GLU 3 250 THR 3 255 
AA7 2 GLY C  264 ? ARG C  270 ? GLY 3 264 ARG 3 270 
AA7 3 GLU C  273 ? ALA C  279 ? GLU 3 273 ALA 3 279 
AA8 1 LEU C  317 ? GLU C  319 ? LEU 3 317 GLU 3 319 
AA8 2 LEU C  310 ? ARG C  312 ? LEU 3 310 ARG 3 312 
AA8 3 VAL C  600 ? PRO C  603 ? VAL 3 600 PRO 3 603 
AA8 4 PHE C  582 ? LEU C  587 ? PHE 3 582 LEU 3 587 
AA8 5 TYR C  565 ? TYR C  568 ? TYR 3 565 TYR 3 568 
AA8 6 VAL C  341 ? LEU C  345 ? VAL 3 341 LEU 3 345 
AA8 7 LEU C  369 ? PHE C  371 ? LEU 3 369 PHE 3 371 
AA9 1 ILE C  464 ? VAL C  467 ? ILE 3 464 VAL 3 467 
AA9 2 ALA C  449 ? ALA C  452 ? ALA 3 449 ALA 3 452 
AA9 3 ALA C  396 ? LEU C  399 ? ALA 3 396 LEU 3 399 
AA9 4 VAL C  504 ? LEU C  507 ? VAL 3 504 LEU 3 507 
AA9 5 LYS C  531 ? ALA C  534 ? LYS 3 531 ALA 3 534 
AB1 1 GLY C  612 ? VAL C  615 ? GLY 3 612 VAL 3 615 
AB1 2 VAL C  621 ? LEU C  624 ? VAL 3 621 LEU 3 624 
AB2 1 ARG C  770 ? VAL C  771 ? ARG 3 770 VAL 3 771 
AB2 2 PHE C  692 ? PRO C  696 ? PHE 3 692 PRO 3 696 
AB2 3 LEU C  758 ? ALA C  762 ? LEU 3 758 ALA 3 762 
AB2 4 GLU C  715 ? ALA C  718 ? GLU 3 715 ALA 3 718 
AB2 5 GLY C  741 ? HIS C  749 ? GLY 3 741 HIS 3 749 
AB2 6 GLN C  733 ? THR C  738 ? GLN 3 733 THR 3 738 
AB2 7 ARG C  774 ? LEU C  776 ? ARG 3 774 LEU 3 776 
AB3 1 THR D  27  ? VAL D  30  ? THR 4 27  VAL 4 30  
AB3 2 ARG D  42  ? THR D  46  ? ARG 4 42  THR 4 46  
AB3 3 GLU D  54  ? HIS D  58  ? GLU 4 54  HIS 4 58  
AB4 1 LYS D  339 ? SER D  348 ? LYS 4 339 SER 4 348 
AB4 2 GLY D  351 ? ASP D  360 ? GLY 4 351 ASP 4 360 
AB4 3 ARG D  367 ? ARG D  371 ? ARG 4 367 ARG 4 371 
AB5 1 ILE E  17  ? ASP E  19  ? ILE 5 17  ASP 5 19  
AB5 2 LEU E  25  ? VAL E  28  ? LEU 5 25  VAL 5 28  
AB5 3 ARG E  87  ? VAL E  94  ? ARG 5 87  VAL 5 94  
AB5 4 PHE E  68  ? VAL E  75  ? PHE 5 68  VAL 5 75  
AB5 5 PHE E  48  ? ASP E  56  ? PHE 5 48  ASP 5 56  
AB6 1 ARG E  100 ? PRO E  102 ? ARG 5 100 PRO 5 102 
AB6 2 VAL E  125 ? GLU E  127 ? VAL 5 125 GLU 5 127 
AB7 1 THR E  157 ? LEU E  158 ? THR 5 157 LEU 5 158 
AB7 2 TYR E  164 ? ILE E  165 ? TYR 5 164 ILE 5 165 
AB8 1 PRO F  38  ? GLY F  42  ? PRO 6 38  GLY 6 42  
AB8 2 VAL F  77  ? ALA F  81  ? VAL 6 77  ALA 6 81  
AB8 3 TRP F  104 ? MET F  108 ? TRP 6 104 MET 6 108 
AB8 4 VAL F  135 ? VAL F  137 ? VAL 6 135 VAL 6 137 
AB9 1 VAL G  31  ? ALA G  32  ? VAL 9 31  ALA 9 32  
AB9 2 TYR G  161 ? VAL G  162 ? TYR 9 161 VAL 9 162 
AC1 1 HIS G  41  ? LEU G  43  ? HIS 9 41  LEU 9 43  
AC1 2 ILE G  113 ? LEU G  115 ? ILE 9 113 LEU 9 115 
AC2 1 ILE G  68  ? GLU G  74  ? ILE 9 68  GLU 9 74  
AC2 2 ARG G  86  ? ASN G  94  ? ARG 9 86  ASN 9 94  
AC2 3 VAL G  130 ? TYR G  131 ? VAL 9 130 TYR 9 131 
AC3 1 PHE H  31  ? ASP H  36  ? PHE 7 31  ASP 7 36  
AC3 2 ILE H  54  ? SER H  60  ? ILE 7 54  SER 7 60  
AC3 3 PRO H  66  ? VAL H  72  ? PRO 7 66  VAL 7 72  
AC3 4 ILE H  82  ? LEU H  86  ? ILE 7 82  LEU 7 86  
AC3 5 ILE H  91  ? GLU H  98  ? ILE 7 91  GLU 7 98  
AC3 6 GLY H  102 ? THR H  105 ? GLY 7 102 THR 7 105 
AC3 7 ILE H  108 ? PRO H  109 ? ILE 7 108 PRO 7 109 
AC4 1 VAL I  2   ? ARG I  3   ? VAL W 2   ARG W 3   
AC4 2 ASP I  56  ? PHE I  63  ? ASP W 56  PHE W 63  
AC4 3 TYR I  46  ? HIS I  51  ? TYR W 46  HIS W 51  
AC4 4 LYS I  30  ? THR I  35  ? LYS W 30  THR W 35  
AC4 5 PHE I  89  ? VAL I  93  ? PHE W 89  VAL W 93  
AC4 6 ALA I  118 ? PRO I  120 ? ALA W 118 PRO W 120 
AC5 1 ALA M  53  ? ALA M  57  ? ALA L 53  ALA L 57  
AC5 2 PHE M  65  ? LEU M  69  ? PHE L 65  LEU L 69  
AC6 1 PHE N  51  ? LEU N  56  ? PHE M 51  LEU M 56  
AC6 2 VAL N  61  ? PHE N  65  ? VAL M 61  PHE M 65  
AC7 1 LEU Q  171 ? ARG Q  175 ? LEU B 171 ARG B 175 
AC7 2 VAL Q  129 ? VAL Q  134 ? VAL B 129 VAL B 134 
AC7 3 TYR Q  88  ? ALA Q  93  ? TYR B 88  ALA B 93  
AC7 4 THR Q  217 ? ASN Q  220 ? THR B 217 ASN B 220 
AC8 1 GLY Q  262 ? PRO Q  267 ? GLY B 262 PRO B 267 
AC8 2 MET Q  249 ? SER Q  255 ? MET B 249 SER B 255 
AC8 3 GLY Q  327 ? PRO Q  332 ? GLY B 327 PRO B 332 
AC8 4 ILE Q  287 ? ILE Q  291 ? ILE B 287 ILE B 291 
AC8 5 LEU Q  300 ? PRO Q  301 ? LEU B 300 PRO B 301 
AC9 1 PHE R  117 ? VAL R  122 ? PHE C 117 VAL C 122 
AC9 2 TYR R  78  ? CYS R  83  ? TYR C 78  CYS C 83  
AC9 3 ILE R  134 ? VAL R  136 ? ILE C 134 VAL C 136 
AD1 1 ARG S  9   ? VAL S  13  ? ARG D 9   VAL D 13  
AD1 2 VAL S  2   ? VAL S  6   ? VAL D 2   VAL D 6   
AD1 3 MET S  91  ? ASP S  94  ? MET D 91  ASP D 94  
AD1 4 LEU S  49  ? GLY S  53  ? LEU D 49  GLY D 53  
AD1 5 ALA S  80  ? ALA S  81  ? ALA D 80  ALA D 81  
AD2 1 HIS S  168 ? SER S  171 ? HIS D 168 SER D 171 
AD2 2 VAL S  174 ? LEU S  176 ? VAL D 174 LEU D 176 
AD2 3 LEU S  235 ? ASP S  237 ? LEU D 235 ASP D 237 
AD3 1 ASP S  201 ? PHE S  202 ? ASP D 201 PHE D 202 
AD3 2 ILE S  211 ? GLY S  212 ? ILE D 211 GLY D 212 
AD4 1 GLU S  250 ? THR S  255 ? GLU D 250 THR D 255 
AD4 2 GLY S  264 ? ARG S  270 ? GLY D 264 ARG D 270 
AD4 3 GLU S  273 ? ALA S  279 ? GLU D 273 ALA D 279 
AD5 1 LEU S  310 ? ARG S  312 ? LEU D 310 ARG D 312 
AD5 2 LEU S  317 ? GLU S  319 ? LEU D 317 GLU D 319 
AD6 1 LEU S  369 ? PHE S  371 ? LEU D 369 PHE D 371 
AD6 2 VAL S  341 ? LEU S  345 ? VAL D 341 LEU D 345 
AD6 3 TYR S  565 ? TYR S  568 ? TYR D 565 TYR D 568 
AD6 4 PHE S  582 ? LEU S  587 ? PHE D 582 LEU D 587 
AD6 5 VAL S  600 ? PRO S  603 ? VAL D 600 PRO D 603 
AD7 1 ILE S  464 ? VAL S  467 ? ILE D 464 VAL D 467 
AD7 2 MET S  448 ? ALA S  452 ? MET D 448 ALA D 452 
AD7 3 ALA S  396 ? LEU S  399 ? ALA D 396 LEU D 399 
AD7 4 VAL S  504 ? LEU S  507 ? VAL D 504 LEU D 507 
AD7 5 LYS S  531 ? ALA S  534 ? LYS D 531 ALA D 534 
AD8 1 GLY S  612 ? VAL S  615 ? GLY D 612 VAL D 615 
AD8 2 VAL S  621 ? LEU S  624 ? VAL D 621 LEU D 624 
AD9 1 ARG S  770 ? VAL S  771 ? ARG D 770 VAL D 771 
AD9 2 PHE S  692 ? PRO S  696 ? PHE D 692 PRO D 696 
AD9 3 TYR S  759 ? ALA S  762 ? TYR D 759 ALA D 762 
AD9 4 GLU S  715 ? ALA S  718 ? GLU D 715 ALA D 718 
AD9 5 GLY S  741 ? HIS S  749 ? GLY D 741 HIS D 749 
AD9 6 GLN S  733 ? THR S  738 ? GLN D 733 THR D 738 
AD9 7 ARG S  774 ? VAL S  775 ? ARG D 774 VAL D 775 
AE1 1 THR T  27  ? VAL T  30  ? THR E 27  VAL E 30  
AE1 2 ARG T  42  ? THR T  46  ? ARG E 42  THR E 46  
AE1 3 GLU T  54  ? HIS T  58  ? GLU E 54  HIS E 58  
AE2 1 GLY T  340 ? SER T  348 ? GLY E 340 SER E 348 
AE2 2 GLY T  351 ? SER T  359 ? GLY E 351 SER E 359 
AE2 3 ARG T  367 ? ARG T  371 ? ARG E 367 ARG E 371 
AE3 1 ILE U  17  ? ASP U  19  ? ILE F 17  ASP F 19  
AE3 2 LEU U  25  ? VAL U  27  ? LEU F 25  VAL F 27  
AE4 1 PHE U  48  ? ASP U  56  ? PHE F 48  ASP F 56  
AE4 2 PHE U  68  ? VAL U  75  ? PHE F 68  VAL F 75  
AE4 3 ARG U  87  ? VAL U  94  ? ARG F 87  VAL F 94  
AE5 1 ARG U  100 ? PRO U  102 ? ARG F 100 PRO F 102 
AE5 2 VAL U  125 ? GLU U  127 ? VAL F 125 GLU F 127 
AE6 1 THR U  157 ? LEU U  158 ? THR F 157 LEU F 158 
AE6 2 TYR U  164 ? ILE U  165 ? TYR F 164 ILE F 165 
AE7 1 PRO V  38  ? GLY V  42  ? PRO G 38  GLY G 42  
AE7 2 VAL V  77  ? ALA V  81  ? VAL G 77  ALA G 81  
AE7 3 TRP V  104 ? MET V  108 ? TRP G 104 MET G 108 
AE7 4 VAL V  135 ? VAL V  137 ? VAL G 135 VAL G 137 
AE8 1 ALA V  162 ? TYR V  163 ? ALA G 162 TYR G 163 
AE8 2 ARG V  169 ? LEU V  170 ? ARG G 169 LEU G 170 
AE9 1 VAL W  31  ? ALA W  32  ? VAL O 31  ALA O 32  
AE9 2 TYR W  161 ? VAL W  162 ? TYR O 161 VAL O 162 
AF1 1 HIS W  41  ? LEU W  43  ? HIS O 41  LEU O 43  
AF1 2 ILE W  113 ? LEU W  115 ? ILE O 113 LEU O 115 
AF2 1 ILE W  68  ? GLU W  74  ? ILE O 68  GLU O 74  
AF2 2 ARG W  86  ? ASN W  94  ? ARG O 86  ASN O 94  
AF2 3 VAL W  130 ? TYR W  131 ? VAL O 130 TYR O 131 
AF3 1 ARG X  30  ? ASP X  36  ? ARG I 30  ASP I 36  
AF3 2 ILE X  54  ? SER X  60  ? ILE I 54  SER I 60  
AF3 3 PRO X  66  ? VAL X  72  ? PRO I 66  VAL I 72  
AF3 4 ILE X  82  ? LEU X  86  ? ILE I 82  LEU I 86  
AF3 5 ILE X  91  ? GLU X  98  ? ILE I 91  GLU I 98  
AF3 6 GLY X  102 ? THR X  105 ? GLY I 102 THR I 105 
AF3 7 ILE X  108 ? PRO X  109 ? ILE I 108 PRO I 109 
AF4 1 VAL Y  2   ? ARG Y  3   ? VAL X 2   ARG X 3   
AF4 2 ASP Y  56  ? PHE Y  63  ? ASP X 56  PHE X 63  
AF4 3 TYR Y  46  ? HIS Y  51  ? TYR X 46  HIS X 51  
AF4 4 LYS Y  30  ? THR Y  35  ? LYS X 30  THR X 35  
AF4 5 PHE Y  89  ? VAL Y  93  ? PHE X 89  VAL X 93  
AF4 6 ASN Y  119 ? PRO Y  120 ? ASN X 119 PRO X 120 
AF5 1 ALA CA 53  ? ALA CA 57  ? ALA T 53  ALA T 57  
AF5 2 PHE CA 65  ? LEU CA 69  ? PHE T 65  LEU T 69  
AF6 1 PHE DA 51  ? LEU DA 56  ? PHE U 51  LEU U 56  
AF6 2 VAL DA 61  ? PHE DA 65  ? VAL U 61  PHE U 65  
AF7 1 PHE EA 48  ? ALA EA 49  ? PHE V 48  ALA V 49  
AF7 2 ALA EA 54  ? VAL EA 55  ? ALA V 54  VAL V 55  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O HIS A  172 ? O HIS 1 172 N ILE A  132 ? N ILE 1 132 
AA1 2 3 O TYR A  131 ? O TYR 1 131 N CYS A  91  ? N CYS 1 91  
AA1 3 4 N ILE A  90  ? N ILE 1 90  O THR A  217 ? O THR 1 217 
AA2 1 2 O TYR A  264 ? O TYR 1 264 N TYR A  252 ? N TYR 1 252 
AA2 2 3 N GLN A  253 ? N GLN 1 253 O VAL A  328 ? O VAL 1 328 
AA2 3 4 O ILE A  331 ? O ILE 1 331 N GLN A  288 ? N GLN 1 288 
AA2 4 5 N ILE A  290 ? N ILE 1 290 O LEU A  300 ? O LEU 1 300 
AA3 1 2 O VAL B  122 ? O VAL 2 122 N VAL B  82  ? N VAL 2 82  
AA3 2 3 N GLN B  81  ? N GLN 2 81  O GLN B  135 ? O GLN 2 135 
AA4 1 2 O ARG C  9   ? O ARG 3 9   N VAL C  6   ? N VAL 3 6   
AA4 2 3 N LYS C  5   ? N LYS 3 5   O VAL C  93  ? O VAL 3 93  
AA4 3 4 O VAL C  92  ? O VAL 3 92  N GLY C  53  ? N GLY 3 53  
AA4 4 5 N VAL C  50  ? N VAL 3 50  O ALA C  80  ? O ALA 3 80  
AA5 1 2 N HIS C  168 ? N HIS 3 168 O LEU C  176 ? O LEU 3 176 
AA5 2 3 N ILE C  175 ? N ILE 3 175 O LEU C  236 ? O LEU 3 236 
AA6 1 2 N ASP C  201 ? N ASP 3 201 O GLY C  212 ? O GLY 3 212 
AA7 1 2 N THR C  252 ? N THR 3 252 O ALA C  267 ? O ALA 3 267 
AA7 2 3 N ASP C  268 ? N ASP 3 268 O ARG C  276 ? O ARG 3 276 
AA8 1 2 O VAL C  318 ? O VAL 3 318 N VAL C  311 ? N VAL 3 311 
AA8 2 3 N LEU C  310 ? N LEU 3 310 O VAL C  601 ? O VAL 3 601 
AA8 3 4 O VAL C  600 ? O VAL 3 600 N MET C  585 ? N MET 3 585 
AA8 4 5 O HIS C  586 ? O HIS 3 586 N TYR C  568 ? N TYR 3 568 
AA8 5 6 O TYR C  567 ? O TYR 3 567 N TYR C  344 ? N TYR 3 344 
AA8 6 7 N LEU C  343 ? N LEU 3 343 O ASP C  370 ? O ASP 3 370 
AA9 1 2 O ILE C  464 ? O ILE 3 464 N LEU C  450 ? N LEU 3 450 
AA9 2 3 O ALA C  449 ? O ALA 3 449 N VAL C  398 ? N VAL 3 398 
AA9 3 4 N LEU C  397 ? N LEU 3 397 O ILE C  506 ? O ILE 3 506 
AA9 4 5 N LEU C  505 ? N LEU 3 505 O LYS C  531 ? O LYS 3 531 
AB1 1 2 N GLY C  612 ? N GLY 3 612 O LEU C  624 ? O LEU 3 624 
AB2 1 2 O VAL C  771 ? O VAL 3 771 N PHE C  692 ? N PHE 3 692 
AB2 2 3 N TYR C  693 ? N TYR 3 693 O LEU C  760 ? O LEU 3 760 
AB2 3 4 O SER C  761 ? O SER 3 761 N GLU C  715 ? N GLU 3 715 
AB2 4 5 N LEU C  716 ? N LEU 3 716 O VAL C  748 ? O VAL 3 748 
AB2 5 6 O VAL C  743 ? O VAL 3 743 N VAL C  736 ? N VAL 3 736 
AB2 6 7 N GLU C  737 ? N GLU 3 737 O ARG C  774 ? O ARG 3 774 
AB3 1 2 N LEU D  28  ? N LEU 4 28  O VAL D  45  ? O VAL 4 45  
AB3 2 3 N MET D  44  ? N MET 4 44  O VAL D  56  ? O VAL 4 56  
AB4 1 2 N SER D  348 ? N SER 4 348 O GLY D  351 ? O GLY 4 351 
AB4 2 3 N TYR D  356 ? N TYR 4 356 O LYS D  369 ? O LYS 4 369 
AB5 1 2 N GLU E  18  ? N GLU 5 18  O TRP E  26  ? O TRP 5 26  
AB5 2 3 N VAL E  27  ? N VAL 5 27  O ARG E  91  ? O ARG 5 91  
AB5 3 4 O VAL E  94  ? O VAL 5 94  N PHE E  68  ? N PHE 5 68  
AB5 4 5 O VAL E  75  ? O VAL 5 75  N PHE E  48  ? N PHE 5 48  
AB6 1 2 N LEU E  101 ? N LEU 5 101 O GLU E  127 ? O GLU 5 127 
AB7 1 2 N THR E  157 ? N THR 5 157 O ILE E  165 ? O ILE 5 165 
AB8 1 2 N ALA F  39  ? N ALA 6 39  O VAL F  77  ? O VAL 6 77  
AB8 2 3 N VAL F  80  ? N VAL 6 80  O ILE F  106 ? O ILE 6 106 
AB8 3 4 N SER F  107 ? N SER 6 107 O VAL F  135 ? O VAL 6 135 
AB9 1 2 N VAL G  31  ? N VAL 9 31  O VAL G  162 ? O VAL 9 162 
AC1 1 2 N VAL G  42  ? N VAL 9 42  O VAL G  114 ? O VAL 9 114 
AC2 1 2 N TYR G  69  ? N TYR 9 69  O GLU G  92  ? O GLU 9 92  
AC2 2 3 N ILE G  93  ? N ILE 9 93  O TYR G  131 ? O TYR 9 131 
AC3 1 2 N ALA H  35  ? N ALA 7 35  O THR H  56  ? O THR 7 56  
AC3 2 3 N LEU H  59  ? N LEU 7 59  O PHE H  67  ? O PHE 7 67  
AC3 3 4 N LEU H  69  ? N LEU 7 69  O ARG H  85  ? O ARG 7 85  
AC3 4 5 N ILE H  82  ? N ILE 7 82  O ALA H  95  ? O ALA 7 95  
AC3 5 6 N HIS H  96  ? N HIS 7 96  O VAL H  104 ? O VAL 7 104 
AC3 6 7 N THR H  105 ? N THR 7 105 O ILE H  108 ? O ILE 7 108 
AC4 1 2 N VAL I  2   ? N VAL W 2   O ASP I  56  ? O ASP W 56  
AC4 2 3 O LEU I  57  ? O LEU W 57  N LEU I  50  ? N LEU W 50  
AC4 3 4 O LEU I  49  ? O LEU W 49  N TYR I  32  ? N TYR W 32  
AC4 4 5 N THR I  35  ? N THR W 35  O ALA I  92  ? O ALA W 92  
AC4 5 6 N GLU I  91  ? N GLU W 91  O ASN I  119 ? O ASN W 119 
AC5 1 2 N PHE M  55  ? N PHE L 55  O LEU M  67  ? O LEU L 67  
AC6 1 2 N LEU N  55  ? N LEU M 55  O VAL N  61  ? O VAL M 61  
AC7 1 2 O HIS Q  174 ? O HIS B 174 N VAL Q  134 ? N VAL B 134 
AC7 2 3 O TYR Q  131 ? O TYR B 131 N CYS Q  91  ? N CYS B 91  
AC7 3 4 N ILE Q  90  ? N ILE B 90  O THR Q  217 ? O THR B 217 
AC8 1 2 O TYR Q  264 ? O TYR B 264 N TYR Q  252 ? N TYR B 252 
AC8 2 3 N GLN Q  253 ? N GLN B 253 O VAL Q  328 ? O VAL B 328 
AC8 3 4 O ILE Q  331 ? O ILE B 331 N ALA Q  289 ? N ALA B 289 
AC8 4 5 N ILE Q  290 ? N ILE B 290 O LEU Q  300 ? O LEU B 300 
AC9 1 2 O VAL R  122 ? O VAL C 122 N VAL R  82  ? N VAL C 82  
AC9 2 3 N GLN R  81  ? N GLN C 81  O GLN R  135 ? O GLN C 135 
AD1 1 2 O VAL S  13  ? O VAL D 13  N VAL S  2   ? N VAL D 2   
AD1 2 3 N LYS S  5   ? N LYS D 5   O VAL S  93  ? O VAL D 93  
AD1 3 4 O VAL S  92  ? O VAL D 92  N GLY S  53  ? N GLY D 53  
AD1 4 5 N VAL S  50  ? N VAL D 50  O ALA S  80  ? O ALA D 80  
AD2 1 2 N HIS S  168 ? N HIS D 168 O LEU S  176 ? O LEU D 176 
AD2 2 3 N ILE S  175 ? N ILE D 175 O LEU S  236 ? O LEU D 236 
AD3 1 2 N ASP S  201 ? N ASP D 201 O GLY S  212 ? O GLY D 212 
AD4 1 2 N THR S  252 ? N THR D 252 O ALA S  267 ? O ALA D 267 
AD4 2 3 N ASP S  268 ? N ASP D 268 O ARG S  276 ? O ARG D 276 
AD5 1 2 N VAL S  311 ? N VAL D 311 O VAL S  318 ? O VAL D 318 
AD6 1 2 O ASP S  370 ? O ASP D 370 N LEU S  345 ? N LEU D 345 
AD6 2 3 N TYR S  344 ? N TYR D 344 O TYR S  567 ? O TYR D 567 
AD6 3 4 N TYR S  568 ? N TYR D 568 O HIS S  586 ? O HIS D 586 
AD6 4 5 N MET S  585 ? N MET D 585 O VAL S  600 ? O VAL D 600 
AD7 1 2 O GLU S  466 ? O GLU D 466 N LEU S  450 ? N LEU D 450 
AD7 2 3 O ALA S  449 ? O ALA D 449 N VAL S  398 ? N VAL D 398 
AD7 3 4 N LEU S  397 ? N LEU D 397 O ILE S  506 ? O ILE D 506 
AD7 4 5 N LEU S  505 ? N LEU D 505 O LEU S  533 ? O LEU D 533 
AD8 1 2 N GLY S  612 ? N GLY D 612 O LEU S  624 ? O LEU D 624 
AD9 1 2 O VAL S  771 ? O VAL D 771 N PHE S  692 ? N PHE D 692 
AD9 2 3 N TYR S  693 ? N TYR D 693 O LEU S  760 ? O LEU D 760 
AD9 3 4 O TYR S  759 ? O TYR D 759 N TRP S  717 ? N TRP D 717 
AD9 4 5 N LEU S  716 ? N LEU D 716 O VAL S  748 ? O VAL D 748 
AD9 5 6 O VAL S  743 ? O VAL D 743 N VAL S  736 ? N VAL D 736 
AD9 6 7 N GLU S  737 ? N GLU D 737 O ARG S  774 ? O ARG D 774 
AE1 1 2 N LEU T  28  ? N LEU E 28  O VAL T  45  ? O VAL E 45  
AE1 2 3 N ARG T  42  ? N ARG E 42  O HIS T  58  ? O HIS E 58  
AE2 1 2 N SER T  348 ? N SER E 348 O GLY T  351 ? O GLY E 351 
AE2 2 3 N TYR T  356 ? N TYR E 356 O LYS T  369 ? O LYS E 369 
AE3 1 2 N GLU U  18  ? N GLU F 18  O TRP U  26  ? O TRP F 26  
AE4 1 2 N VAL U  53  ? N VAL F 53  O VAL U  71  ? O VAL F 71  
AE4 2 3 N PHE U  68  ? N PHE F 68  O VAL U  94  ? O VAL F 94  
AE5 1 2 N LEU U  101 ? N LEU F 101 O GLU U  127 ? O GLU F 127 
AE6 1 2 N THR U  157 ? N THR F 157 O ILE U  165 ? O ILE F 165 
AE7 1 2 N ALA V  39  ? N ALA G 39  O VAL V  77  ? O VAL G 77  
AE7 2 3 N MET V  78  ? N MET G 78  O ILE V  106 ? O ILE G 106 
AE7 3 4 N SER V  107 ? N SER G 107 O VAL V  135 ? O VAL G 135 
AE8 1 2 N ALA V  162 ? N ALA G 162 O LEU V  170 ? O LEU G 170 
AE9 1 2 N VAL W  31  ? N VAL O 31  O VAL W  162 ? O VAL O 162 
AF1 1 2 N VAL W  42  ? N VAL O 42  O VAL W  114 ? O VAL O 114 
AF2 1 2 N GLU W  71  ? N GLU O 71  O VAL W  90  ? O VAL O 90  
AF2 2 3 N ILE W  93  ? N ILE O 93  O TYR W  131 ? O TYR O 131 
AF3 1 2 N GLU X  32  ? N GLU I 32  O SER X  58  ? O SER I 58  
AF3 2 3 N ALA X  57  ? N ALA I 57  O ALA X  70  ? O ALA I 70  
AF3 3 4 N ASP X  71  ? N ASP I 71  O GLY X  83  ? O GLY I 83  
AF3 4 5 N ILE X  82  ? N ILE I 82  O ALA X  95  ? O ALA I 95  
AF3 5 6 N GLU X  98  ? N GLU I 98  O GLY X  102 ? O GLY I 102 
AF3 6 7 N THR X  105 ? N THR I 105 O ILE X  108 ? O ILE I 108 
AF4 1 2 N VAL Y  2   ? N VAL X 2   O ASP Y  56  ? O ASP X 56  
AF4 2 3 O PHE Y  63  ? O PHE X 63  N TYR Y  46  ? N TYR X 46  
AF4 3 4 O HIS Y  51  ? O HIS X 51  N LYS Y  30  ? N LYS X 30  
AF4 4 5 N THR Y  35  ? N THR X 35  O ALA Y  92  ? O ALA X 92  
AF4 5 6 N GLU Y  91  ? N GLU X 91  O ASN Y  119 ? O ASN X 119 
AF5 1 2 N ALA CA 53  ? N ALA T 53  O LEU CA 69  ? O LEU T 69  
AF6 1 2 N PHE DA 51  ? N PHE U 51  O PHE DA 65  ? O PHE U 65  
AF7 1 2 N PHE EA 48  ? N PHE V 48  O VAL EA 55  ? O VAL V 55  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software 1 SF4 501 ? 5  'binding site for residue SF4 1 501' 
AC2 Software 1 FMN 502 ? 13 'binding site for residue FMN 1 502' 
AC3 Software 2 FES 201 ? 9  'binding site for residue FES 2 201' 
AC4 Software 3 SF4 801 ? 7  'binding site for residue SF4 3 801' 
AC5 Software 3 SF4 802 ? 5  'binding site for residue SF4 3 802' 
AC6 Software 3 SF4 803 ? 9  'binding site for residue SF4 3 803' 
AC7 Software 3 FES 804 ? 7  'binding site for residue FES 3 804' 
AC8 Software 4 HQW 501 ? 10 'binding site for residue HQW 4 501' 
AC9 Software 6 SF4 201 ? 9  'binding site for residue SF4 6 201' 
AD1 Software 9 SF4 201 ? 9  'binding site for residue SF4 9 201' 
AD2 Software 9 SF4 202 ? 9  'binding site for residue SF4 9 202' 
AD3 Software B SF4 501 ? 9  'binding site for residue SF4 B 501' 
AD4 Software B FMN 502 ? 13 'binding site for residue FMN B 502' 
AD5 Software C FES 201 ? 9  'binding site for residue FES C 201' 
AD6 Software D SF4 801 ? 8  'binding site for residue SF4 D 801' 
AD7 Software D SF4 802 ? 8  'binding site for residue SF4 D 802' 
AD8 Software D SF4 803 ? 9  'binding site for residue SF4 D 803' 
AD9 Software D FES 804 ? 7  'binding site for residue FES D 804' 
AE1 Software E HQW 501 ? 12 'binding site for residue HQW E 501' 
AE2 Software G SF4 201 ? 10 'binding site for residue SF4 G 201' 
AE3 Software O SF4 201 ? 11 'binding site for residue SF4 O 201' 
AE4 Software O SF4 202 ? 9  'binding site for residue SF4 O 202' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  PRO A  199 ? PRO 1 199 . ? 1_555 ? 
2   AC1 5  CYS A  353 ? CYS 1 353 . ? 1_555 ? 
3   AC1 5  CYS A  356 ? CYS 1 356 . ? 1_555 ? 
4   AC1 5  CYS A  359 ? CYS 1 359 . ? 1_555 ? 
5   AC1 5  CYS A  400 ? CYS 1 400 . ? 1_555 ? 
6   AC2 13 GLY A  64  ? GLY 1 64  . ? 1_555 ? 
7   AC2 13 ARG A  65  ? ARG 1 65  . ? 1_555 ? 
8   AC2 13 GLY A  66  ? GLY 1 66  . ? 1_555 ? 
9   AC2 13 ALA A  68  ? ALA 1 68  . ? 1_555 ? 
10  AC2 13 LYS A  75  ? LYS 1 75  . ? 1_555 ? 
11  AC2 13 ASN A  92  ? ASN 1 92  . ? 1_555 ? 
12  AC2 13 ASP A  94  ? ASP 1 94  . ? 1_555 ? 
13  AC2 13 GLY A  183 ? GLY 1 183 . ? 1_555 ? 
14  AC2 13 GLU A  184 ? GLU 1 184 . ? 1_555 ? 
15  AC2 13 ASN A  219 ? ASN 1 219 . ? 1_555 ? 
16  AC2 13 ASN A  220 ? ASN 1 220 . ? 1_555 ? 
17  AC2 13 THR A  223 ? THR 1 223 . ? 1_555 ? 
18  AC2 13 PRO A  401 ? PRO 1 401 . ? 1_555 ? 
19  AC3 9  CYS B  83  ? CYS 2 83  . ? 1_555 ? 
20  AC3 9  THR B  85  ? THR 2 85  . ? 1_555 ? 
21  AC3 9  SER B  87  ? SER 2 87  . ? 1_555 ? 
22  AC3 9  CYS B  88  ? CYS 2 88  . ? 1_555 ? 
23  AC3 9  CYS B  124 ? CYS 2 124 . ? 1_555 ? 
24  AC3 9  LEU B  125 ? LEU 2 125 . ? 1_555 ? 
25  AC3 9  GLY B  126 ? GLY 2 126 . ? 1_555 ? 
26  AC3 9  SER B  127 ? SER 2 127 . ? 1_555 ? 
27  AC3 9  CYS B  128 ? CYS 2 128 . ? 1_555 ? 
28  AC4 7  HIS C  115 ? HIS 3 115 . ? 1_555 ? 
29  AC4 7  ASP C  118 ? ASP 3 118 . ? 1_555 ? 
30  AC4 7  CYS C  119 ? CYS 3 119 . ? 1_555 ? 
31  AC4 7  CYS C  122 ? CYS 3 122 . ? 1_555 ? 
32  AC4 7  CYS C  128 ? CYS 3 128 . ? 1_555 ? 
33  AC4 7  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
34  AC4 7  GLY C  233 ? GLY 3 233 . ? 1_555 ? 
35  AC5 5  CYS C  181 ? CYS 3 181 . ? 1_555 ? 
36  AC5 5  CYS C  184 ? CYS 3 184 . ? 1_555 ? 
37  AC5 5  CYS C  187 ? CYS 3 187 . ? 1_555 ? 
38  AC5 5  CYS C  230 ? CYS 3 230 . ? 1_555 ? 
39  AC5 5  VAL C  232 ? VAL 3 232 . ? 1_555 ? 
40  AC6 9  CYS C  256 ? CYS 3 256 . ? 1_555 ? 
41  AC6 9  LEU C  258 ? LEU 3 258 . ? 1_555 ? 
42  AC6 9  CYS C  259 ? CYS 3 259 . ? 1_555 ? 
43  AC6 9  VAL C  261 ? VAL 3 261 . ? 1_555 ? 
44  AC6 9  GLY C  262 ? GLY 3 262 . ? 1_555 ? 
45  AC6 9  CYS C  263 ? CYS 3 263 . ? 1_555 ? 
46  AC6 9  ILE C  290 ? ILE 3 290 . ? 1_555 ? 
47  AC6 9  CYS C  291 ? CYS 3 291 . ? 1_555 ? 
48  AC6 9  PRO C  407 ? PRO 3 407 . ? 1_555 ? 
49  AC7 7  LEU C  32  ? LEU 3 32  . ? 1_555 ? 
50  AC7 7  CYS C  34  ? CYS 3 34  . ? 1_555 ? 
51  AC7 7  SER C  35  ? SER 3 35  . ? 1_555 ? 
52  AC7 7  CYS C  45  ? CYS 3 45  . ? 1_555 ? 
53  AC7 7  ARG C  46  ? ARG 3 46  . ? 1_555 ? 
54  AC7 7  CYS C  48  ? CYS 3 48  . ? 1_555 ? 
55  AC7 7  CYS C  83  ? CYS 3 83  . ? 1_555 ? 
56  AC8 10 GLN D  33  ? GLN 4 33  . ? 1_555 ? 
57  AC8 10 HIS D  38  ? HIS 4 38  . ? 1_555 ? 
58  AC8 10 GLY D  39  ? GLY 4 39  . ? 1_555 ? 
59  AC8 10 TYR D  87  ? TYR 4 87  . ? 1_555 ? 
60  AC8 10 THR D  135 ? THR 4 135 . ? 1_555 ? 
61  AC8 10 GLY F  42  ? GLY 6 42  . ? 1_555 ? 
62  AC8 10 LEU F  43  ? LEU 6 43  . ? 1_555 ? 
63  AC8 10 ALA F  47  ? ALA 6 47  . ? 1_555 ? 
64  AC8 10 MET F  51  ? MET 6 51  . ? 1_555 ? 
65  AC8 10 PHE F  68  ? PHE 6 68  . ? 1_555 ? 
66  AC9 9  HIS D  169 ? HIS 4 169 . ? 1_555 ? 
67  AC9 9  CYS F  45  ? CYS 6 45  . ? 1_555 ? 
68  AC9 9  CYS F  46  ? CYS 6 46  . ? 1_555 ? 
69  AC9 9  GLY F  82  ? GLY 6 82  . ? 1_555 ? 
70  AC9 9  ARG F  83  ? ARG 6 83  . ? 1_555 ? 
71  AC9 9  ALA F  110 ? ALA 6 110 . ? 1_555 ? 
72  AC9 9  CYS F  111 ? CYS 6 111 . ? 1_555 ? 
73  AC9 9  CYS F  140 ? CYS 6 140 . ? 1_555 ? 
74  AC9 9  PRO F  141 ? PRO 6 141 . ? 1_555 ? 
75  AD1 9  CYS G  63  ? CYS 9 63  . ? 1_555 ? 
76  AD1 9  ILE G  68  ? ILE 9 68  . ? 1_555 ? 
77  AD1 9  CYS G  98  ? CYS 9 98  . ? 1_555 ? 
78  AD1 9  ILE G  99  ? ILE 9 99  . ? 1_555 ? 
79  AD1 9  PHE G  100 ? PHE 9 100 . ? 1_555 ? 
80  AD1 9  CYS G  101 ? CYS 9 101 . ? 1_555 ? 
81  AD1 9  GLY G  102 ? GLY 9 102 . ? 1_555 ? 
82  AD1 9  LEU G  103 ? LEU 9 103 . ? 1_555 ? 
83  AD1 9  CYS G  104 ? CYS 9 104 . ? 1_555 ? 
84  AD2 9  CYS G  53  ? CYS 9 53  . ? 1_555 ? 
85  AD2 9  ILE G  54  ? ILE 9 54  . ? 1_555 ? 
86  AD2 9  GLY G  55  ? GLY 9 55  . ? 1_555 ? 
87  AD2 9  CYS G  56  ? CYS 9 56  . ? 1_555 ? 
88  AD2 9  SER G  57  ? SER 9 57  . ? 1_555 ? 
89  AD2 9  CYS G  59  ? CYS 9 59  . ? 1_555 ? 
90  AD2 9  CYS G  108 ? CYS 9 108 . ? 1_555 ? 
91  AD2 9  THR G  110 ? THR 9 110 . ? 1_555 ? 
92  AD2 9  ILE G  113 ? ILE 9 113 . ? 1_555 ? 
93  AD3 9  PRO Q  199 ? PRO B 199 . ? 1_555 ? 
94  AD3 9  SER Q  352 ? SER B 352 . ? 1_555 ? 
95  AD3 9  CYS Q  353 ? CYS B 353 . ? 1_555 ? 
96  AD3 9  GLY Q  354 ? GLY B 354 . ? 1_555 ? 
97  AD3 9  LYS Q  355 ? LYS B 355 . ? 1_555 ? 
98  AD3 9  CYS Q  356 ? CYS B 356 . ? 1_555 ? 
99  AD3 9  CYS Q  359 ? CYS B 359 . ? 1_555 ? 
100 AD3 9  PHE Q  399 ? PHE B 399 . ? 1_555 ? 
101 AD3 9  CYS Q  400 ? CYS B 400 . ? 1_555 ? 
102 AD4 13 GLY Q  64  ? GLY B 64  . ? 1_555 ? 
103 AD4 13 ARG Q  65  ? ARG B 65  . ? 1_555 ? 
104 AD4 13 GLY Q  66  ? GLY B 66  . ? 1_555 ? 
105 AD4 13 ALA Q  68  ? ALA B 68  . ? 1_555 ? 
106 AD4 13 LYS Q  75  ? LYS B 75  . ? 1_555 ? 
107 AD4 13 ASN Q  92  ? ASN B 92  . ? 1_555 ? 
108 AD4 13 ASP Q  94  ? ASP B 94  . ? 1_555 ? 
109 AD4 13 TYR Q  180 ? TYR B 180 . ? 1_555 ? 
110 AD4 13 GLY Q  183 ? GLY B 183 . ? 1_555 ? 
111 AD4 13 ASN Q  219 ? ASN B 219 . ? 1_555 ? 
112 AD4 13 ASN Q  220 ? ASN B 220 . ? 1_555 ? 
113 AD4 13 THR Q  223 ? THR B 223 . ? 1_555 ? 
114 AD4 13 LEU Q  402 ? LEU B 402 . ? 1_555 ? 
115 AD5 9  CYS R  83  ? CYS C 83  . ? 1_555 ? 
116 AD5 9  THR R  85  ? THR C 85  . ? 1_555 ? 
117 AD5 9  SER R  87  ? SER C 87  . ? 1_555 ? 
118 AD5 9  CYS R  88  ? CYS C 88  . ? 1_555 ? 
119 AD5 9  CYS R  124 ? CYS C 124 . ? 1_555 ? 
120 AD5 9  LEU R  125 ? LEU C 125 . ? 1_555 ? 
121 AD5 9  GLY R  126 ? GLY C 126 . ? 1_555 ? 
122 AD5 9  SER R  127 ? SER C 127 . ? 1_555 ? 
123 AD5 9  CYS R  128 ? CYS C 128 . ? 1_555 ? 
124 AD6 8  HIS S  115 ? HIS D 115 . ? 1_555 ? 
125 AD6 8  ASP S  118 ? ASP D 118 . ? 1_555 ? 
126 AD6 8  CYS S  119 ? CYS D 119 . ? 1_555 ? 
127 AD6 8  CYS S  122 ? CYS D 122 . ? 1_555 ? 
128 AD6 8  CYS S  128 ? CYS D 128 . ? 1_555 ? 
129 AD6 8  GLN S  131 ? GLN D 131 . ? 1_555 ? 
130 AD6 8  VAL S  232 ? VAL D 232 . ? 1_555 ? 
131 AD6 8  GLY S  233 ? GLY D 233 . ? 1_555 ? 
132 AD7 8  CYS S  181 ? CYS D 181 . ? 1_555 ? 
133 AD7 8  ILE S  182 ? ILE D 182 . ? 1_555 ? 
134 AD7 8  CYS S  184 ? CYS D 184 . ? 1_555 ? 
135 AD7 8  CYS S  187 ? CYS D 187 . ? 1_555 ? 
136 AD7 8  CYS S  230 ? CYS D 230 . ? 1_555 ? 
137 AD7 8  VAL S  232 ? VAL D 232 . ? 1_555 ? 
138 AD7 8  ALA S  234 ? ALA D 234 . ? 1_555 ? 
139 AD7 8  LEU S  235 ? LEU D 235 . ? 1_555 ? 
140 AD8 9  CYS S  256 ? CYS D 256 . ? 1_555 ? 
141 AD8 9  LEU S  258 ? LEU D 258 . ? 1_555 ? 
142 AD8 9  CYS S  259 ? CYS D 259 . ? 1_555 ? 
143 AD8 9  VAL S  261 ? VAL D 261 . ? 1_555 ? 
144 AD8 9  GLY S  262 ? GLY D 262 . ? 1_555 ? 
145 AD8 9  CYS S  263 ? CYS D 263 . ? 1_555 ? 
146 AD8 9  ILE S  290 ? ILE D 290 . ? 1_555 ? 
147 AD8 9  CYS S  291 ? CYS D 291 . ? 1_555 ? 
148 AD8 9  PRO S  407 ? PRO D 407 . ? 1_555 ? 
149 AD9 7  CYS S  34  ? CYS D 34  . ? 1_555 ? 
150 AD9 7  GLY S  43  ? GLY D 43  . ? 1_555 ? 
151 AD9 7  ALA S  44  ? ALA D 44  . ? 1_555 ? 
152 AD9 7  CYS S  45  ? CYS D 45  . ? 1_555 ? 
153 AD9 7  ARG S  46  ? ARG D 46  . ? 1_555 ? 
154 AD9 7  CYS S  48  ? CYS D 48  . ? 1_555 ? 
155 AD9 7  CYS S  83  ? CYS D 83  . ? 1_555 ? 
156 AE1 12 GLN T  33  ? GLN E 33  . ? 1_555 ? 
157 AE1 12 HIS T  38  ? HIS E 38  . ? 1_555 ? 
158 AE1 12 GLY T  39  ? GLY E 39  . ? 1_555 ? 
159 AE1 12 TYR T  87  ? TYR E 87  . ? 1_555 ? 
160 AE1 12 THR T  135 ? THR E 135 . ? 1_555 ? 
161 AE1 12 PHE T  146 ? PHE E 146 . ? 1_555 ? 
162 AE1 12 PHE T  147 ? PHE E 147 . ? 1_555 ? 
163 AE1 12 LEU V  43  ? LEU G 43  . ? 1_555 ? 
164 AE1 12 ALA V  47  ? ALA G 47  . ? 1_555 ? 
165 AE1 12 MET V  51  ? MET G 51  . ? 1_555 ? 
166 AE1 12 THR V  54  ? THR G 54  . ? 1_555 ? 
167 AE1 12 GLN FA 226 ? GLN Q 226 . ? 1_555 ? 
168 AE2 10 ARG T  84  ? ARG E 84  . ? 1_555 ? 
169 AE2 10 HIS T  169 ? HIS E 169 . ? 1_555 ? 
170 AE2 10 CYS V  45  ? CYS G 45  . ? 1_555 ? 
171 AE2 10 CYS V  46  ? CYS G 46  . ? 1_555 ? 
172 AE2 10 GLY V  82  ? GLY G 82  . ? 1_555 ? 
173 AE2 10 ARG V  83  ? ARG G 83  . ? 1_555 ? 
174 AE2 10 ALA V  110 ? ALA G 110 . ? 1_555 ? 
175 AE2 10 CYS V  111 ? CYS G 111 . ? 1_555 ? 
176 AE2 10 CYS V  140 ? CYS G 140 . ? 1_555 ? 
177 AE2 10 PRO V  141 ? PRO G 141 . ? 1_555 ? 
178 AE3 11 HIS W  41  ? HIS O 41  . ? 1_555 ? 
179 AE3 11 ALA W  62  ? ALA O 62  . ? 1_555 ? 
180 AE3 11 CYS W  63  ? CYS O 63  . ? 1_555 ? 
181 AE3 11 PRO W  64  ? PRO O 64  . ? 1_555 ? 
182 AE3 11 ILE W  68  ? ILE O 68  . ? 1_555 ? 
183 AE3 11 CYS W  98  ? CYS O 98  . ? 1_555 ? 
184 AE3 11 ILE W  99  ? ILE O 99  . ? 1_555 ? 
185 AE3 11 PHE W  100 ? PHE O 100 . ? 1_555 ? 
186 AE3 11 CYS W  101 ? CYS O 101 . ? 1_555 ? 
187 AE3 11 GLY W  102 ? GLY O 102 . ? 1_555 ? 
188 AE3 11 CYS W  104 ? CYS O 104 . ? 1_555 ? 
189 AE4 9  CYS W  53  ? CYS O 53  . ? 1_555 ? 
190 AE4 9  ILE W  54  ? ILE O 54  . ? 1_555 ? 
191 AE4 9  CYS W  56  ? CYS O 56  . ? 1_555 ? 
192 AE4 9  SER W  57  ? SER O 57  . ? 1_555 ? 
193 AE4 9  CYS W  59  ? CYS O 59  . ? 1_555 ? 
194 AE4 9  TYR W  91  ? TYR O 91  . ? 1_555 ? 
195 AE4 9  CYS W  108 ? CYS O 108 . ? 1_555 ? 
196 AE4 9  THR W  110 ? THR O 110 . ? 1_555 ? 
197 AE4 9  ILE W  113 ? ILE O 113 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6Q8W 
_atom_sites.fract_transf_matrix[1][1]   0.010419 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001920 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002937 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003848 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . THR A  1  2   ? -17.134  1.167    410.248 1.00 217.36 ? 2   THR 1 N     1 
ATOM   2     C  CA    . THR A  1  2   ? -17.135  1.665    408.876 1.00 217.79 ? 2   THR 1 CA    1 
ATOM   3     C  C     . THR A  1  2   ? -18.139  0.869    408.041 1.00 218.50 ? 2   THR 1 C     1 
ATOM   4     O  O     . THR A  1  2   ? -18.432  -0.285   408.358 1.00 218.38 ? 2   THR 1 O     1 
ATOM   5     C  CB    . THR A  1  2   ? -15.728  1.575    408.238 1.00 217.42 ? 2   THR 1 CB    1 
ATOM   6     O  OG1   . THR A  1  2   ? -14.738  1.969    409.196 1.00 217.32 ? 2   THR 1 OG1   1 
ATOM   7     C  CG2   . THR A  1  2   ? -15.623  2.497    407.028 1.00 217.26 ? 2   THR 1 CG2   1 
ATOM   8     N  N     . GLY A  1  3   ? -18.667  1.495    406.987 1.00 219.50 ? 3   GLY 1 N     1 
ATOM   9     C  CA    . GLY A  1  3   ? -19.608  0.858    406.093 1.00 219.84 ? 3   GLY 1 CA    1 
ATOM   10    C  C     . GLY A  1  3   ? -19.075  -0.454   405.558 1.00 220.74 ? 3   GLY 1 C     1 
ATOM   11    O  O     . GLY A  1  3   ? -17.880  -0.587   405.270 1.00 220.09 ? 3   GLY 1 O     1 
ATOM   12    N  N     . PRO A  1  4   ? -19.948  -1.462   405.419 1.00 219.61 ? 4   PRO 1 N     1 
ATOM   13    C  CA    . PRO A  1  4   ? -19.444  -2.815   405.155 1.00 220.45 ? 4   PRO 1 CA    1 
ATOM   14    C  C     . PRO A  1  4   ? -18.856  -2.975   403.762 1.00 215.99 ? 4   PRO 1 C     1 
ATOM   15    O  O     . PRO A  1  4   ? -19.578  -3.174   402.781 1.00 217.39 ? 4   PRO 1 O     1 
ATOM   16    C  CB    . PRO A  1  4   ? -20.695  -3.690   405.335 1.00 220.48 ? 4   PRO 1 CB    1 
ATOM   17    C  CG    . PRO A  1  4   ? -21.612  -2.868   406.203 1.00 221.14 ? 4   PRO 1 CG    1 
ATOM   18    C  CD    . PRO A  1  4   ? -21.388  -1.465   405.725 1.00 221.13 ? 4   PRO 1 CD    1 
ATOM   19    N  N     . ILE A  1  5   ? -17.524  -2.919   403.704 1.00 212.57 ? 5   ILE 1 N     1 
ATOM   20    C  CA    . ILE A  1  5   ? -16.685  -3.252   402.555 1.00 206.82 ? 5   ILE 1 CA    1 
ATOM   21    C  C     . ILE A  1  5   ? -15.291  -3.510   403.114 1.00 199.42 ? 5   ILE 1 C     1 
ATOM   22    O  O     . ILE A  1  5   ? -14.776  -2.711   403.903 1.00 199.70 ? 5   ILE 1 O     1 
ATOM   23    C  CB    . ILE A  1  5   ? -16.667  -2.142   401.483 1.00 208.18 ? 5   ILE 1 CB    1 
ATOM   24    C  CG1   . ILE A  1  5   ? -17.842  -2.292   400.512 1.00 209.05 ? 5   ILE 1 CG1   1 
ATOM   25    C  CG2   . ILE A  1  5   ? -15.363  -2.155   400.702 1.00 208.52 ? 5   ILE 1 CG2   1 
ATOM   26    C  CD1   . ILE A  1  5   ? -17.960  -1.159   399.512 1.00 209.14 ? 5   ILE 1 CD1   1 
ATOM   27    N  N     . LEU A  1  6   ? -14.665  -4.617   402.718 1.00 191.26 ? 6   LEU 1 N     1 
ATOM   28    C  CA    . LEU A  1  6   ? -13.339  -4.977   403.209 1.00 182.35 ? 6   LEU 1 CA    1 
ATOM   29    C  C     . LEU A  1  6   ? -12.318  -4.742   402.104 1.00 173.67 ? 6   LEU 1 C     1 
ATOM   30    O  O     . LEU A  1  6   ? -12.327  -5.433   401.078 1.00 173.59 ? 6   LEU 1 O     1 
ATOM   31    C  CB    . LEU A  1  6   ? -13.308  -6.419   403.706 1.00 182.50 ? 6   LEU 1 CB    1 
ATOM   32    C  CG    . LEU A  1  6   ? -14.083  -6.583   405.015 1.00 183.48 ? 6   LEU 1 CG    1 
ATOM   33    C  CD1   . LEU A  1  6   ? -14.175  -8.028   405.452 1.00 184.30 ? 6   LEU 1 CD1   1 
ATOM   34    C  CD2   . LEU A  1  6   ? -13.435  -5.752   406.090 1.00 183.88 ? 6   LEU 1 CD2   1 
ATOM   35    N  N     . SER A  1  7   ? -11.440  -3.756   402.322 1.00 164.92 ? 7   SER 1 N     1 
ATOM   36    C  CA    . SER A  1  7   ? -10.417  -3.401   401.347 1.00 157.01 ? 7   SER 1 CA    1 
ATOM   37    C  C     . SER A  1  7   ? -9.052   -3.173   401.995 1.00 151.40 ? 7   SER 1 C     1 
ATOM   38    O  O     . SER A  1  7   ? -8.173   -2.572   401.366 1.00 151.45 ? 7   SER 1 O     1 
ATOM   39    C  CB    . SER A  1  7   ? -10.836  -2.153   400.557 1.00 155.42 ? 7   SER 1 CB    1 
ATOM   40    O  OG    . SER A  1  7   ? -12.132  -2.307   400.001 1.00 154.32 ? 7   SER 1 OG    1 
ATOM   41    N  N     . GLY A  1  8   ? -8.845   -3.639   403.227 1.00 146.16 ? 8   GLY 1 N     1 
ATOM   42    C  CA    . GLY A  1  8   ? -7.591   -3.383   403.914 1.00 141.05 ? 8   GLY 1 CA    1 
ATOM   43    C  C     . GLY A  1  8   ? -7.497   -3.938   405.322 1.00 135.93 ? 8   GLY 1 C     1 
ATOM   44    O  O     . GLY A  1  8   ? -7.821   -5.105   405.565 1.00 135.58 ? 8   GLY 1 O     1 
ATOM   45    N  N     . LEU A  1  9   ? -7.049   -3.105   406.262 1.00 130.75 ? 9   LEU 1 N     1 
ATOM   46    C  CA    . LEU A  1  9   ? -6.765   -3.517   407.630 1.00 125.15 ? 9   LEU 1 CA    1 
ATOM   47    C  C     . LEU A  1  9   ? -7.995   -3.471   408.540 1.00 122.15 ? 9   LEU 1 C     1 
ATOM   48    O  O     . LEU A  1  9   ? -7.846   -3.385   409.765 1.00 120.70 ? 9   LEU 1 O     1 
ATOM   49    C  CB    . LEU A  1  9   ? -5.637   -2.649   408.204 1.00 122.79 ? 9   LEU 1 CB    1 
ATOM   50    C  CG    . LEU A  1  9   ? -4.872   -3.132   409.442 1.00 121.45 ? 9   LEU 1 CG    1 
ATOM   51    C  CD1   . LEU A  1  9   ? -4.710   -4.637   409.413 1.00 122.49 ? 9   LEU 1 CD1   1 
ATOM   52    C  CD2   . LEU A  1  9   ? -3.515   -2.447   409.552 1.00 120.34 ? 9   LEU 1 CD2   1 
ATOM   53    N  N     . ASP A  1  10  ? -9.196   -3.529   407.975 1.00 121.22 ? 10  ASP 1 N     1 
ATOM   54    C  CA    . ASP A  1  10  ? -10.397  -3.542   408.799 1.00 118.74 ? 10  ASP 1 CA    1 
ATOM   55    C  C     . ASP A  1  10  ? -10.398  -4.782   409.695 1.00 117.60 ? 10  ASP 1 C     1 
ATOM   56    O  O     . ASP A  1  10  ? -10.070  -5.883   409.235 1.00 115.24 ? 10  ASP 1 O     1 
ATOM   57    C  CB    . ASP A  1  10  ? -11.646  -3.509   407.920 1.00 116.75 ? 10  ASP 1 CB    1 
ATOM   58    C  CG    . ASP A  1  10  ? -12.788  -2.739   408.556 1.00 114.92 ? 10  ASP 1 CG    1 
ATOM   59    O  OD1   . ASP A  1  10  ? -12.547  -1.612   409.038 1.00 114.42 ? 10  ASP 1 OD1   1 
ATOM   60    O  OD2   . ASP A  1  10  ? -13.926  -3.252   408.571 1.00 113.80 ? 10  ASP 1 OD2   1 
ATOM   61    N  N     . PRO A  1  11  ? -10.768  -4.644   410.973 1.00 118.79 ? 11  PRO 1 N     1 
ATOM   62    C  CA    . PRO A  1  11  ? -10.531  -5.732   411.939 1.00 119.46 ? 11  PRO 1 CA    1 
ATOM   63    C  C     . PRO A  1  11  ? -11.382  -6.971   411.724 1.00 121.23 ? 11  PRO 1 C     1 
ATOM   64    O  O     . PRO A  1  11  ? -11.070  -8.014   412.314 1.00 121.92 ? 11  PRO 1 O     1 
ATOM   65    C  CB    . PRO A  1  11  ? -10.859  -5.080   413.286 1.00 119.03 ? 11  PRO 1 CB    1 
ATOM   66    C  CG    . PRO A  1  11  ? -11.809  -3.982   412.943 1.00 119.41 ? 11  PRO 1 CG    1 
ATOM   67    C  CD    . PRO A  1  11  ? -11.403  -3.472   411.597 1.00 119.68 ? 11  PRO 1 CD    1 
ATOM   68    N  N     . ARG A  1  12  ? -12.420  -6.903   410.897 1.00 123.33 ? 12  ARG 1 N     1 
ATOM   69    C  CA    . ARG A  1  12  ? -13.308  -8.034   410.662 1.00 123.56 ? 12  ARG 1 CA    1 
ATOM   70    C  C     . ARG A  1  12  ? -12.782  -8.990   409.601 1.00 120.00 ? 12  ARG 1 C     1 
ATOM   71    O  O     . ARG A  1  12  ? -13.479  -9.950   409.249 1.00 118.89 ? 12  ARG 1 O     1 
ATOM   72    C  CB    . ARG A  1  12  ? -14.696  -7.529   410.260 1.00 125.68 ? 12  ARG 1 CB    1 
ATOM   73    C  CG    . ARG A  1  12  ? -14.651  -6.153   409.633 1.00 128.29 ? 12  ARG 1 CG    1 
ATOM   74    C  CD    . ARG A  1  12  ? -16.018  -5.666   409.218 1.00 131.29 ? 12  ARG 1 CD    1 
ATOM   75    N  NE    . ARG A  1  12  ? -15.915  -4.439   408.436 1.00 134.04 ? 12  ARG 1 NE    1 
ATOM   76    C  CZ    . ARG A  1  12  ? -16.901  -3.932   407.706 1.00 135.63 ? 12  ARG 1 CZ    1 
ATOM   77    N  NH1   . ARG A  1  12  ? -18.073  -4.550   407.650 1.00 136.08 ? 12  ARG 1 NH1   1 
ATOM   78    N  NH2   . ARG A  1  12  ? -16.713  -2.805   407.031 1.00 135.79 ? 12  ARG 1 NH2   1 
ATOM   79    N  N     . PHE A  1  13  ? -11.574  -8.759   409.095 1.00 116.31 ? 13  PHE 1 N     1 
ATOM   80    C  CA    . PHE A  1  13  ? -10.931  -9.708   408.200 1.00 111.58 ? 13  PHE 1 CA    1 
ATOM   81    C  C     . PHE A  1  13  ? -10.360  -10.873  408.999 1.00 105.43 ? 13  PHE 1 C     1 
ATOM   82    O  O     . PHE A  1  13  ? -9.725   -10.683  410.042 1.00 105.43 ? 13  PHE 1 O     1 
ATOM   83    C  CB    . PHE A  1  13  ? -9.823   -9.026   407.393 1.00 112.87 ? 13  PHE 1 CB    1 
ATOM   84    C  CG    . PHE A  1  13  ? -8.958   -9.987   406.627 1.00 114.70 ? 13  PHE 1 CG    1 
ATOM   85    C  CD1   . PHE A  1  13  ? -9.510   -10.818  405.666 1.00 115.96 ? 13  PHE 1 CD1   1 
ATOM   86    C  CD2   . PHE A  1  13  ? -7.599   -10.068  406.868 1.00 114.31 ? 13  PHE 1 CD2   1 
ATOM   87    C  CE1   . PHE A  1  13  ? -8.726   -11.710  404.960 1.00 115.53 ? 13  PHE 1 CE1   1 
ATOM   88    C  CE2   . PHE A  1  13  ? -6.815   -10.958  406.162 1.00 114.28 ? 13  PHE 1 CE2   1 
ATOM   89    C  CZ    . PHE A  1  13  ? -7.379   -11.779  405.210 1.00 114.92 ? 13  PHE 1 CZ    1 
ATOM   90    N  N     . GLU A  1  14  ? -10.593  -12.085  408.501 1.00 100.40 ? 14  GLU 1 N     1 
ATOM   91    C  CA    . GLU A  1  14  ? -10.264  -13.314  409.215 1.00 94.49  ? 14  GLU 1 CA    1 
ATOM   92    C  C     . GLU A  1  14  ? -9.221   -14.079  408.406 1.00 96.64  ? 14  GLU 1 C     1 
ATOM   93    O  O     . GLU A  1  14  ? -9.515   -14.567  407.308 1.00 93.21  ? 14  GLU 1 O     1 
ATOM   94    C  CB    . GLU A  1  14  ? -11.524  -14.151  409.441 1.00 85.87  ? 14  GLU 1 CB    1 
ATOM   95    C  CG    . GLU A  1  14  ? -12.409  -13.614  410.565 1.00 82.51  ? 14  GLU 1 CG    1 
ATOM   96    C  CD    . GLU A  1  14  ? -13.671  -14.429  410.799 1.00 82.99  ? 14  GLU 1 CD    1 
ATOM   97    O  OE1   . GLU A  1  14  ? -14.556  -14.428  409.921 1.00 70.62  ? 14  GLU 1 OE1   1 
ATOM   98    O  OE2   . GLU A  1  14  ? -13.791  -15.046  411.877 1.00 70.75  ? 14  GLU 1 OE2   1 
ATOM   99    N  N     . ARG A  1  15  ? -8.009   -14.184  408.949 1.00 101.05 ? 15  ARG 1 N     1 
ATOM   100   C  CA    . ARG A  1  15  ? -6.964   -14.970  408.305 1.00 102.99 ? 15  ARG 1 CA    1 
ATOM   101   C  C     . ARG A  1  15  ? -7.362   -16.439  408.313 1.00 102.43 ? 15  ARG 1 C     1 
ATOM   102   O  O     . ARG A  1  15  ? -7.522   -17.039  409.381 1.00 102.73 ? 15  ARG 1 O     1 
ATOM   103   C  CB    . ARG A  1  15  ? -5.627   -14.776  409.018 1.00 105.71 ? 15  ARG 1 CB    1 
ATOM   104   C  CG    . ARG A  1  15  ? -5.296   -13.344  409.403 1.00 107.68 ? 15  ARG 1 CG    1 
ATOM   105   C  CD    . ARG A  1  15  ? -4.604   -12.638  408.255 1.00 110.89 ? 15  ARG 1 CD    1 
ATOM   106   N  NE    . ARG A  1  15  ? -4.742   -11.188  408.333 1.00 114.58 ? 15  ARG 1 NE    1 
ATOM   107   C  CZ    . ARG A  1  15  ? -3.887   -10.324  407.790 1.00 116.64 ? 15  ARG 1 CZ    1 
ATOM   108   N  NH1   . ARG A  1  15  ? -2.827   -10.763  407.121 1.00 116.89 ? 15  ARG 1 NH1   1 
ATOM   109   N  NH2   . ARG A  1  15  ? -4.095   -9.016   407.909 1.00 116.26 ? 15  ARG 1 NH2   1 
ATOM   110   N  N     . THR A  1  16  ? -7.534   -17.014  407.124 1.00 99.45  ? 16  THR 1 N     1 
ATOM   111   C  CA    . THR A  1  16  ? -7.960   -18.402  406.994 1.00 96.76  ? 16  THR 1 CA    1 
ATOM   112   C  C     . THR A  1  16  ? -6.916   -19.273  406.316 1.00 90.96  ? 16  THR 1 C     1 
ATOM   113   O  O     . THR A  1  16  ? -6.508   -20.293  406.881 1.00 90.32  ? 16  THR 1 O     1 
ATOM   114   C  CB    . THR A  1  16  ? -9.293   -18.473  406.224 1.00 96.98  ? 16  THR 1 CB    1 
ATOM   115   O  OG1   . THR A  1  16  ? -10.223  -17.534  406.781 1.00 98.12  ? 16  THR 1 OG1   1 
ATOM   116   C  CG2   . THR A  1  16  ? -9.887   -19.874  406.300 1.00 97.60  ? 16  THR 1 CG2   1 
ATOM   117   N  N     . LEU A  1  17  ? -6.434   -18.872  405.138 1.00 90.20  ? 17  LEU 1 N     1 
ATOM   118   C  CA    . LEU A  1  17  ? -5.560   -19.732  404.343 1.00 91.63  ? 17  LEU 1 CA    1 
ATOM   119   C  C     . LEU A  1  17  ? -4.116   -19.675  404.834 1.00 91.94  ? 17  LEU 1 C     1 
ATOM   120   O  O     . LEU A  1  17  ? -3.560   -20.684  405.285 1.00 90.84  ? 17  LEU 1 O     1 
ATOM   121   C  CB    . LEU A  1  17  ? -5.643   -19.326  402.867 1.00 94.63  ? 17  LEU 1 CB    1 
ATOM   122   C  CG    . LEU A  1  17  ? -7.035   -19.314  402.224 1.00 97.02  ? 17  LEU 1 CG    1 
ATOM   123   C  CD1   . LEU A  1  17  ? -6.931   -19.079  400.729 1.00 97.45  ? 17  LEU 1 CD1   1 
ATOM   124   C  CD2   . LEU A  1  17  ? -7.782   -20.613  402.503 1.00 98.64  ? 17  LEU 1 CD2   1 
ATOM   125   N  N     . TYR A  1  18  ? -3.490   -18.496  404.751 1.00 93.19  ? 18  TYR 1 N     1 
ATOM   126   C  CA    . TYR A  1  18  ? -2.099   -18.304  405.153 1.00 94.86  ? 18  TYR 1 CA    1 
ATOM   127   C  C     . TYR A  1  18  ? -1.934   -18.080  406.649 1.00 96.23  ? 18  TYR 1 C     1 
ATOM   128   O  O     . TYR A  1  18  ? -0.822   -17.764  407.092 1.00 94.24  ? 18  TYR 1 O     1 
ATOM   129   C  CB    . TYR A  1  18  ? -1.471   -17.131  404.385 1.00 96.41  ? 18  TYR 1 CB    1 
ATOM   130   C  CG    . TYR A  1  18  ? -0.479   -17.569  403.325 1.00 101.33 ? 18  TYR 1 CG    1 
ATOM   131   C  CD1   . TYR A  1  18  ? -0.900   -18.248  402.192 1.00 105.21 ? 18  TYR 1 CD1   1 
ATOM   132   C  CD2   . TYR A  1  18  ? 0.883    -17.321  403.465 1.00 102.78 ? 18  TYR 1 CD2   1 
ATOM   133   C  CE1   . TYR A  1  18  ? 0.005    -18.667  401.219 1.00 107.46 ? 18  TYR 1 CE1   1 
ATOM   134   C  CE2   . TYR A  1  18  ? 1.797    -17.738  402.497 1.00 105.38 ? 18  TYR 1 CE2   1 
ATOM   135   C  CZ    . TYR A  1  18  ? 1.349    -18.410  401.375 1.00 106.51 ? 18  TYR 1 CZ    1 
ATOM   136   O  OH    . TYR A  1  18  ? 2.242    -18.825  400.408 1.00 104.89 ? 18  TYR 1 OH    1 
ATOM   137   N  N     . ALA A  1  19  ? -3.004   -18.228  407.432 1.00 100.67 ? 19  ALA 1 N     1 
ATOM   138   C  CA    . ALA A  1  19  ? -2.903   -18.029  408.874 1.00 103.76 ? 19  ALA 1 CA    1 
ATOM   139   C  C     . ALA A  1  19  ? -1.956   -19.047  409.504 1.00 106.06 ? 19  ALA 1 C     1 
ATOM   140   O  O     . ALA A  1  19  ? -0.904   -18.690  410.045 1.00 105.36 ? 19  ALA 1 O     1 
ATOM   141   C  CB    . ALA A  1  19  ? -4.294   -18.117  409.508 1.00 104.06 ? 19  ALA 1 CB    1 
ATOM   142   N  N     . HIS A  1  20  ? -2.315   -20.326  409.435 1.00 106.20 ? 20  HIS 1 N     1 
ATOM   143   C  CA    . HIS A  1  20  ? -1.548   -21.385  410.073 1.00 106.60 ? 20  HIS 1 CA    1 
ATOM   144   C  C     . HIS A  1  20  ? -0.425   -21.934  409.191 1.00 103.06 ? 20  HIS 1 C     1 
ATOM   145   O  O     . HIS A  1  20  ? 0.126    -22.996  409.501 1.00 101.83 ? 20  HIS 1 O     1 
ATOM   146   C  CB    . HIS A  1  20  ? -2.494   -22.508  410.505 1.00 108.57 ? 20  HIS 1 CB    1 
ATOM   147   C  CG    . HIS A  1  20  ? -3.622   -22.032  411.370 1.00 112.74 ? 20  HIS 1 CG    1 
ATOM   148   N  ND1   . HIS A  1  20  ? -4.908   -22.515  411.254 1.00 112.57 ? 20  HIS 1 ND1   1 
ATOM   149   C  CD2   . HIS A  1  20  ? -3.666   -21.078  412.333 1.00 110.40 ? 20  HIS 1 CD2   1 
ATOM   150   C  CE1   . HIS A  1  20  ? -5.689   -21.900  412.124 1.00 113.00 ? 20  HIS 1 CE1   1 
ATOM   151   N  NE2   . HIS A  1  20  ? -4.961   -21.022  412.789 1.00 110.60 ? 20  HIS 1 NE2   1 
ATOM   152   N  N     . VAL A  1  21  ? -0.082   -21.245  408.107 1.00 102.56 ? 21  VAL 1 N     1 
ATOM   153   C  CA    . VAL A  1  21  ? 1.000    -21.679  407.229 1.00 102.45 ? 21  VAL 1 CA    1 
ATOM   154   C  C     . VAL A  1  21  ? 2.330    -21.298  407.868 1.00 106.19 ? 21  VAL 1 C     1 
ATOM   155   O  O     . VAL A  1  21  ? 2.490    -20.181  408.378 1.00 108.12 ? 21  VAL 1 O     1 
ATOM   156   C  CB    . VAL A  1  21  ? 0.853    -21.062  405.827 1.00 98.78  ? 21  VAL 1 CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? 2.137    -21.229  405.021 1.00 98.29  ? 21  VAL 1 CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? -0.330   -21.675  405.092 1.00 95.98  ? 21  VAL 1 CG2   1 
ATOM   159   N  N     . GLY A  1  22  ? 3.285    -22.230  407.863 1.00 107.08 ? 22  GLY 1 N     1 
ATOM   160   C  CA    . GLY A  1  22  ? 4.612    -21.993  408.377 1.00 108.40 ? 22  GLY 1 CA    1 
ATOM   161   C  C     . GLY A  1  22  ? 4.855    -22.550  409.767 1.00 109.77 ? 22  GLY 1 C     1 
ATOM   162   O  O     . GLY A  1  22  ? 5.998    -22.882  410.096 1.00 109.01 ? 22  GLY 1 O     1 
ATOM   163   N  N     . LYS A  1  23  ? 3.811    -22.649  410.588 1.00 111.31 ? 23  LYS 1 N     1 
ATOM   164   C  CA    . LYS A  1  23  ? 3.972    -23.169  411.940 1.00 111.04 ? 23  LYS 1 CA    1 
ATOM   165   C  C     . LYS A  1  23  ? 4.483    -24.603  411.884 1.00 111.25 ? 23  LYS 1 C     1 
ATOM   166   O  O     . LYS A  1  23  ? 3.956    -25.431  411.136 1.00 109.79 ? 23  LYS 1 O     1 
ATOM   167   C  CB    . LYS A  1  23  ? 2.640    -23.112  412.690 1.00 109.03 ? 23  LYS 1 CB    1 
ATOM   168   C  CG    . LYS A  1  23  ? 2.029    -21.722  412.814 1.00 105.80 ? 23  LYS 1 CG    1 
ATOM   169   C  CD    . LYS A  1  23  ? 2.982    -20.754  413.491 1.00 103.62 ? 23  LYS 1 CD    1 
ATOM   170   C  CE    . LYS A  1  23  ? 2.241    -19.538  414.030 1.00 102.71 ? 23  LYS 1 CE    1 
ATOM   171   N  NZ    . LYS A  1  23  ? 2.975    -18.859  415.141 1.00 101.31 ? 23  LYS 1 NZ    1 
ATOM   172   N  N     . GLU A  1  24  ? 5.544    -24.887  412.633 1.00 112.03 ? 24  GLU 1 N     1 
ATOM   173   C  CA    . GLU A  1  24  ? 6.104    -26.230  412.609 1.00 112.30 ? 24  GLU 1 CA    1 
ATOM   174   C  C     . GLU A  1  24  ? 5.100    -27.205  413.211 1.00 107.85 ? 24  GLU 1 C     1 
ATOM   175   O  O     . GLU A  1  24  ? 4.455    -26.917  414.222 1.00 108.75 ? 24  GLU 1 O     1 
ATOM   176   C  CB    . GLU A  1  24  ? 7.432    -26.278  413.362 1.00 115.16 ? 24  GLU 1 CB    1 
ATOM   177   C  CG    . GLU A  1  24  ? 8.191    -27.577  413.171 1.00 118.85 ? 24  GLU 1 CG    1 
ATOM   178   C  CD    . GLU A  1  24  ? 9.392    -27.683  414.081 1.00 122.22 ? 24  GLU 1 CD    1 
ATOM   179   O  OE1   . GLU A  1  24  ? 9.412    -26.989  415.118 1.00 124.03 ? 24  GLU 1 OE1   1 
ATOM   180   O  OE2   . GLU A  1  24  ? 10.320   -28.452  413.757 1.00 123.59 ? 24  GLU 1 OE2   1 
ATOM   181   N  N     . GLY A  1  25  ? 4.970    -28.364  412.581 1.00 103.09 ? 25  GLY 1 N     1 
ATOM   182   C  CA    . GLY A  1  25  ? 3.930    -29.292  412.952 1.00 98.04  ? 25  GLY 1 CA    1 
ATOM   183   C  C     . GLY A  1  25  ? 2.565    -28.941  412.409 1.00 94.83  ? 25  GLY 1 C     1 
ATOM   184   O  O     . GLY A  1  25  ? 1.582    -29.585  412.789 1.00 94.74  ? 25  GLY 1 O     1 
ATOM   185   N  N     . SER A  1  26  ? 2.469    -27.931  411.535 1.00 91.74  ? 26  SER 1 N     1 
ATOM   186   C  CA    . SER A  1  26  ? 1.187    -27.593  410.925 1.00 88.48  ? 26  SER 1 CA    1 
ATOM   187   C  C     . SER A  1  26  ? 0.772    -28.619  409.882 1.00 84.73  ? 26  SER 1 C     1 
ATOM   188   O  O     . SER A  1  26  ? -0.407   -28.670  409.520 1.00 83.17  ? 26  SER 1 O     1 
ATOM   189   C  CB    . SER A  1  26  ? 1.225    -26.195  410.294 1.00 87.26  ? 26  SER 1 CB    1 
ATOM   190   O  OG    . SER A  1  26  ? 2.450    -25.961  409.614 1.00 86.10  ? 26  SER 1 OG    1 
ATOM   191   N  N     . TRP A  1  27  ? 1.714    -29.437  409.406 1.00 85.32  ? 27  TRP 1 N     1 
ATOM   192   C  CA    . TRP A  1  27  ? 1.447    -30.531  408.479 1.00 85.67  ? 27  TRP 1 CA    1 
ATOM   193   C  C     . TRP A  1  27  ? 1.000    -31.796  409.193 1.00 90.00  ? 27  TRP 1 C     1 
ATOM   194   O  O     . TRP A  1  27  ? 0.734    -32.805  408.529 1.00 89.35  ? 27  TRP 1 O     1 
ATOM   195   C  CB    . TRP A  1  27  ? 2.695    -30.825  407.638 1.00 82.70  ? 27  TRP 1 CB    1 
ATOM   196   C  CG    . TRP A  1  27  ? 3.910    -31.075  408.483 1.00 79.42  ? 27  TRP 1 CG    1 
ATOM   197   C  CD1   . TRP A  1  27  ? 4.327    -32.267  408.993 1.00 78.09  ? 27  TRP 1 CD1   1 
ATOM   198   C  CD2   . TRP A  1  27  ? 4.846    -30.090  408.945 1.00 79.28  ? 27  TRP 1 CD2   1 
ATOM   199   N  NE1   . TRP A  1  27  ? 5.475    -32.090  409.732 1.00 77.06  ? 27  TRP 1 NE1   1 
ATOM   200   C  CE2   . TRP A  1  27  ? 5.812    -30.762  409.718 1.00 77.08  ? 27  TRP 1 CE2   1 
ATOM   201   C  CE3   . TRP A  1  27  ? 4.965    -28.705  408.771 1.00 79.02  ? 27  TRP 1 CE3   1 
ATOM   202   C  CZ2   . TRP A  1  27  ? 6.880    -30.099  410.318 1.00 77.82  ? 27  TRP 1 CZ2   1 
ATOM   203   C  CZ3   . TRP A  1  27  ? 6.028    -28.047  409.367 1.00 78.23  ? 27  TRP 1 CZ3   1 
ATOM   204   C  CH2   . TRP A  1  27  ? 6.972    -28.744  410.130 1.00 78.01  ? 27  TRP 1 CH2   1 
ATOM   205   N  N     . THR A  1  28  ? 0.932    -31.776  410.520 1.00 94.54  ? 28  THR 1 N     1 
ATOM   206   C  CA    . THR A  1  28  ? 0.352    -32.885  411.257 1.00 98.02  ? 28  THR 1 CA    1 
ATOM   207   C  C     . THR A  1  28  ? -1.163   -32.794  411.150 1.00 99.61  ? 28  THR 1 C     1 
ATOM   208   O  O     . THR A  1  28  ? -1.741   -31.703  411.197 1.00 97.00  ? 28  THR 1 O     1 
ATOM   209   C  CB    . THR A  1  28  ? 0.766    -32.862  412.730 1.00 100.49 ? 28  THR 1 CB    1 
ATOM   210   O  OG1   . THR A  1  28  ? 0.397    -31.608  413.315 1.00 102.02 ? 28  THR 1 OG1   1 
ATOM   211   C  CG2   . THR A  1  28  ? 2.268    -33.051  412.876 1.00 100.70 ? 28  THR 1 CG2   1 
ATOM   212   N  N     . LEU A  1  29  ? -1.803   -33.949  410.986 1.00 102.90 ? 29  LEU 1 N     1 
ATOM   213   C  CA    . LEU A  1  29  ? -3.260   -33.985  410.975 1.00 106.22 ? 29  LEU 1 CA    1 
ATOM   214   C  C     . LEU A  1  29  ? -3.830   -33.372  412.251 1.00 109.35 ? 29  LEU 1 C     1 
ATOM   215   O  O     . LEU A  1  29  ? -4.858   -32.682  412.218 1.00 109.93 ? 29  LEU 1 O     1 
ATOM   216   C  CB    . LEU A  1  29  ? -3.732   -35.432  410.798 1.00 104.48 ? 29  LEU 1 CB    1 
ATOM   217   C  CG    . LEU A  1  29  ? -5.217   -35.714  411.019 1.00 104.01 ? 29  LEU 1 CG    1 
ATOM   218   C  CD1   . LEU A  1  29  ? -6.080   -34.904  410.060 1.00 103.71 ? 29  LEU 1 CD1   1 
ATOM   219   C  CD2   . LEU A  1  29  ? -5.514   -37.208  410.914 1.00 103.68 ? 29  LEU 1 CD2   1 
ATOM   220   N  N     . ASP A  1  30  ? -3.144   -33.582  413.379 1.00 110.24 ? 30  ASP 1 N     1 
ATOM   221   C  CA    . ASP A  1  30  ? -3.627   -33.109  414.672 1.00 109.18 ? 30  ASP 1 CA    1 
ATOM   222   C  C     . ASP A  1  30  ? -3.646   -31.586  414.741 1.00 104.40 ? 30  ASP 1 C     1 
ATOM   223   O  O     . ASP A  1  30  ? -4.531   -31.000  415.379 1.00 105.44 ? 30  ASP 1 O     1 
ATOM   224   C  CB    . ASP A  1  30  ? -2.759   -33.695  415.785 1.00 112.62 ? 30  ASP 1 CB    1 
ATOM   225   C  CG    . ASP A  1  30  ? -2.731   -35.214  415.757 1.00 116.86 ? 30  ASP 1 CG    1 
ATOM   226   O  OD1   . ASP A  1  30  ? -2.150   -35.784  414.809 1.00 118.31 ? 30  ASP 1 OD1   1 
ATOM   227   O  OD2   . ASP A  1  30  ? -3.300   -35.841  416.675 1.00 118.29 ? 30  ASP 1 OD2   1 
ATOM   228   N  N     . TYR A  1  31  ? -2.670   -30.928  414.110 1.00 98.92  ? 31  TYR 1 N     1 
ATOM   229   C  CA    . TYR A  1  31  ? -2.697   -29.471  414.041 1.00 94.81  ? 31  TYR 1 CA    1 
ATOM   230   C  C     . TYR A  1  31  ? -3.967   -28.994  413.352 1.00 92.53  ? 31  TYR 1 C     1 
ATOM   231   O  O     . TYR A  1  31  ? -4.697   -28.146  413.879 1.00 93.09  ? 31  TYR 1 O     1 
ATOM   232   C  CB    . TYR A  1  31  ? -1.459   -28.955  413.302 1.00 95.49  ? 31  TYR 1 CB    1 
ATOM   233   C  CG    . TYR A  1  31  ? -1.307   -27.445  413.313 1.00 94.12  ? 31  TYR 1 CG    1 
ATOM   234   C  CD1   . TYR A  1  31  ? -2.029   -26.642  412.437 1.00 91.09  ? 31  TYR 1 CD1   1 
ATOM   235   C  CD2   . TYR A  1  31  ? -0.432   -26.824  414.191 1.00 92.29  ? 31  TYR 1 CD2   1 
ATOM   236   C  CE1   . TYR A  1  31  ? -1.891   -25.272  412.450 1.00 84.95  ? 31  TYR 1 CE1   1 
ATOM   237   C  CE2   . TYR A  1  31  ? -0.288   -25.452  414.206 1.00 86.87  ? 31  TYR 1 CE2   1 
ATOM   238   C  CZ    . TYR A  1  31  ? -1.018   -24.685  413.335 1.00 85.20  ? 31  TYR 1 CZ    1 
ATOM   239   O  OH    . TYR A  1  31  ? -0.867   -23.321  413.358 1.00 87.62  ? 31  TYR 1 OH    1 
ATOM   240   N  N     . TYR A  1  32  ? -4.253   -29.545  412.169 1.00 90.18  ? 32  TYR 1 N     1 
ATOM   241   C  CA    . TYR A  1  32  ? -5.466   -29.172  411.451 1.00 89.77  ? 32  TYR 1 CA    1 
ATOM   242   C  C     . TYR A  1  32  ? -6.711   -29.488  412.274 1.00 91.29  ? 32  TYR 1 C     1 
ATOM   243   O  O     . TYR A  1  32  ? -7.710   -28.763  412.199 1.00 92.42  ? 32  TYR 1 O     1 
ATOM   244   C  CB    . TYR A  1  32  ? -5.506   -29.876  410.089 1.00 86.46  ? 32  TYR 1 CB    1 
ATOM   245   C  CG    . TYR A  1  32  ? -6.638   -29.423  409.184 1.00 83.35  ? 32  TYR 1 CG    1 
ATOM   246   C  CD1   . TYR A  1  32  ? -6.704   -28.116  408.718 1.00 83.26  ? 32  TYR 1 CD1   1 
ATOM   247   C  CD2   . TYR A  1  32  ? -7.622   -30.307  408.774 1.00 80.42  ? 32  TYR 1 CD2   1 
ATOM   248   C  CE1   . TYR A  1  32  ? -7.734   -27.699  407.889 1.00 85.11  ? 32  TYR 1 CE1   1 
ATOM   249   C  CE2   . TYR A  1  32  ? -8.651   -29.897  407.940 1.00 82.58  ? 32  TYR 1 CE2   1 
ATOM   250   C  CZ    . TYR A  1  32  ? -8.703   -28.596  407.504 1.00 98.06  ? 32  TYR 1 CZ    1 
ATOM   251   O  OH    . TYR A  1  32  ? -9.727   -28.194  406.680 1.00 115.42 ? 32  TYR 1 OH    1 
ATOM   252   N  N     . LEU A  1  33  ? -6.656   -30.549  413.082 1.00 91.29  ? 33  LEU 1 N     1 
ATOM   253   C  CA    . LEU A  1  33  ? -7.797   -30.919  413.916 1.00 88.72  ? 33  LEU 1 CA    1 
ATOM   254   C  C     . LEU A  1  33  ? -8.065   -29.875  414.996 1.00 86.90  ? 33  LEU 1 C     1 
ATOM   255   O  O     . LEU A  1  33  ? -9.195   -29.394  415.141 1.00 84.55  ? 33  LEU 1 O     1 
ATOM   256   C  CB    . LEU A  1  33  ? -7.547   -32.285  414.555 1.00 85.65  ? 33  LEU 1 CB    1 
ATOM   257   C  CG    . LEU A  1  33  ? -7.606   -33.500  413.634 1.00 80.77  ? 33  LEU 1 CG    1 
ATOM   258   C  CD1   . LEU A  1  33  ? -7.424   -34.762  414.453 1.00 80.90  ? 33  LEU 1 CD1   1 
ATOM   259   C  CD2   . LEU A  1  33  ? -8.919   -33.525  412.877 1.00 79.02  ? 33  LEU 1 CD2   1 
ATOM   260   N  N     . ARG A  1  34  ? -7.036   -29.518  415.770 1.00 86.28  ? 34  ARG 1 N     1 
ATOM   261   C  CA    . ARG A  1  34  ? -7.225   -28.644  416.927 1.00 86.59  ? 34  ARG 1 CA    1 
ATOM   262   C  C     . ARG A  1  34  ? -7.717   -27.249  416.561 1.00 86.93  ? 34  ARG 1 C     1 
ATOM   263   O  O     . ARG A  1  34  ? -8.113   -26.500  417.464 1.00 86.92  ? 34  ARG 1 O     1 
ATOM   264   C  CB    . ARG A  1  34  ? -5.928   -28.517  417.732 1.00 85.53  ? 34  ARG 1 CB    1 
ATOM   265   C  CG    . ARG A  1  34  ? -5.779   -29.547  418.846 1.00 84.37  ? 34  ARG 1 CG    1 
ATOM   266   C  CD    . ARG A  1  34  ? -4.359   -30.080  418.915 1.00 84.01  ? 34  ARG 1 CD    1 
ATOM   267   N  NE    . ARG A  1  34  ? -3.393   -28.990  419.002 1.00 84.91  ? 34  ARG 1 NE    1 
ATOM   268   C  CZ    . ARG A  1  34  ? -2.079   -29.138  418.866 1.00 86.73  ? 34  ARG 1 CZ    1 
ATOM   269   N  NH1   . ARG A  1  34  ? -1.562   -30.336  418.638 1.00 87.26  ? 34  ARG 1 NH1   1 
ATOM   270   N  NH2   . ARG A  1  34  ? -1.281   -28.083  418.964 1.00 88.12  ? 34  ARG 1 NH2   1 
ATOM   271   N  N     . HIS A  1  35  ? -7.685   -26.873  415.285 1.00 87.69  ? 35  HIS 1 N     1 
ATOM   272   C  CA    . HIS A  1  35  ? -8.054   -25.528  414.867 1.00 85.17  ? 35  HIS 1 CA    1 
ATOM   273   C  C     . HIS A  1  35  ? -9.417   -25.477  414.175 1.00 86.64  ? 35  HIS 1 C     1 
ATOM   274   O  O     . HIS A  1  35  ? -9.794   -24.427  413.644 1.00 86.11  ? 35  HIS 1 O     1 
ATOM   275   C  CB    . HIS A  1  35  ? -6.960   -24.965  413.956 1.00 84.36  ? 35  HIS 1 CB    1 
ATOM   276   C  CG    . HIS A  1  35  ? -5.656   -24.734  414.661 1.00 76.82  ? 35  HIS 1 CG    1 
ATOM   277   N  ND1   . HIS A  1  35  ? -4.754   -25.748  414.903 1.00 82.23  ? 35  HIS 1 ND1   1 
ATOM   278   C  CD2   . HIS A  1  35  ? -5.131   -23.623  415.229 1.00 82.97  ? 35  HIS 1 CD2   1 
ATOM   279   C  CE1   . HIS A  1  35  ? -3.712   -25.264  415.555 1.00 78.22  ? 35  HIS 1 CE1   1 
ATOM   280   N  NE2   . HIS A  1  35  ? -3.918   -23.979  415.771 1.00 82.25  ? 35  HIS 1 NE2   1 
ATOM   281   N  N     . GLY A  1  36  ? -10.169  -26.574  414.183 1.00 85.09  ? 36  GLY 1 N     1 
ATOM   282   C  CA    . GLY A  1  36  ? -11.465  -26.630  413.536 1.00 83.19  ? 36  GLY 1 CA    1 
ATOM   283   C  C     . GLY A  1  36  ? -11.478  -27.275  412.166 1.00 82.07  ? 36  GLY 1 C     1 
ATOM   284   O  O     . GLY A  1  36  ? -12.378  -26.981  411.371 1.00 81.57  ? 36  GLY 1 O     1 
ATOM   285   N  N     . GLY A  1  37  ? -10.501  -28.124  411.860 1.00 81.77  ? 37  GLY 1 N     1 
ATOM   286   C  CA    . GLY A  1  37  ? -10.436  -28.736  410.548 1.00 82.21  ? 37  GLY 1 CA    1 
ATOM   287   C  C     . GLY A  1  37  ? -11.378  -29.915  410.393 1.00 85.01  ? 37  GLY 1 C     1 
ATOM   288   O  O     . GLY A  1  37  ? -11.762  -30.571  411.360 1.00 83.81  ? 37  GLY 1 O     1 
ATOM   289   N  N     . TYR A  1  38  ? -11.750  -30.174  409.138 1.00 86.35  ? 38  TYR 1 N     1 
ATOM   290   C  CA    . TYR A  1  38  ? -12.539  -31.312  408.666 1.00 88.02  ? 38  TYR 1 CA    1 
ATOM   291   C  C     . TYR A  1  38  ? -13.981  -31.329  409.172 1.00 88.78  ? 38  TYR 1 C     1 
ATOM   292   O  O     . TYR A  1  38  ? -14.699  -32.297  408.893 1.00 87.50  ? 38  TYR 1 O     1 
ATOM   293   C  CB    . TYR A  1  38  ? -11.879  -32.659  408.996 1.00 85.39  ? 38  TYR 1 CB    1 
ATOM   294   C  CG    . TYR A  1  38  ? -10.916  -33.093  407.914 1.00 87.65  ? 38  TYR 1 CG    1 
ATOM   295   C  CD1   . TYR A  1  38  ? -11.381  -33.472  406.660 1.00 87.77  ? 38  TYR 1 CD1   1 
ATOM   296   C  CD2   . TYR A  1  38  ? -9.546   -33.114  408.134 1.00 85.27  ? 38  TYR 1 CD2   1 
ATOM   297   C  CE1   . TYR A  1  38  ? -10.513  -33.857  405.656 1.00 86.14  ? 38  TYR 1 CE1   1 
ATOM   298   C  CE2   . TYR A  1  38  ? -8.670   -33.499  407.135 1.00 84.65  ? 38  TYR 1 CE2   1 
ATOM   299   C  CZ    . TYR A  1  38  ? -9.162   -33.868  405.899 1.00 84.64  ? 38  TYR 1 CZ    1 
ATOM   300   O  OH    . TYR A  1  38  ? -8.304   -34.253  404.899 1.00 85.38  ? 38  TYR 1 OH    1 
ATOM   301   N  N     . GLU A  1  39  ? -14.430  -30.306  409.907 1.00 75.10  ? 39  GLU 1 N     1 
ATOM   302   C  CA    . GLU A  1  39  ? -15.836  -30.225  410.306 1.00 74.54  ? 39  GLU 1 CA    1 
ATOM   303   C  C     . GLU A  1  39  ? -16.737  -29.992  409.099 1.00 73.32  ? 39  GLU 1 C     1 
ATOM   304   O  O     . GLU A  1  39  ? -17.845  -30.546  409.007 1.00 72.48  ? 39  GLU 1 O     1 
ATOM   305   C  CB    . GLU A  1  39  ? -16.030  -29.094  411.315 1.00 77.33  ? 39  GLU 1 CB    1 
ATOM   306   C  CG    . GLU A  1  39  ? -16.252  -29.535  412.747 1.00 78.02  ? 39  GLU 1 CG    1 
ATOM   307   C  CD    . GLU A  1  39  ? -16.723  -28.388  413.624 1.00 78.34  ? 39  GLU 1 CD    1 
ATOM   308   O  OE1   . GLU A  1  39  ? -16.283  -27.239  413.392 1.00 77.82  ? 39  GLU 1 OE1   1 
ATOM   309   O  OE2   . GLU A  1  39  ? -17.555  -28.631  414.524 1.00 77.99  ? 39  GLU 1 OE2   1 
ATOM   310   N  N     . THR A  1  40  ? -16.266  -29.161  408.172 1.00 68.99  ? 40  THR 1 N     1 
ATOM   311   C  CA    . THR A  1  40  ? -17.094  -28.684  407.075 1.00 65.63  ? 40  THR 1 CA    1 
ATOM   312   C  C     . THR A  1  40  ? -17.459  -29.801  406.108 1.00 69.30  ? 40  THR 1 C     1 
ATOM   313   O  O     . THR A  1  40  ? -18.616  -29.925  405.695 1.00 72.03  ? 40  THR 1 O     1 
ATOM   314   C  CB    . THR A  1  40  ? -16.347  -27.586  406.346 1.00 57.60  ? 40  THR 1 CB    1 
ATOM   315   O  OG1   . THR A  1  40  ? -15.817  -26.677  407.313 1.00 54.21  ? 40  THR 1 OG1   1 
ATOM   316   C  CG2   . THR A  1  40  ? -17.288  -26.870  405.452 1.00 57.09  ? 40  THR 1 CG2   1 
ATOM   317   N  N     . ALA A  1  41  ? -16.479  -30.604  405.705 1.00 69.28  ? 41  ALA 1 N     1 
ATOM   318   C  CA    . ALA A  1  41  ? -16.797  -31.733  404.845 1.00 65.92  ? 41  ALA 1 CA    1 
ATOM   319   C  C     . ALA A  1  41  ? -17.763  -32.673  405.545 1.00 64.51  ? 41  ALA 1 C     1 
ATOM   320   O  O     . ALA A  1  41  ? -18.733  -33.147  404.943 1.00 64.08  ? 41  ALA 1 O     1 
ATOM   321   C  CB    . ALA A  1  41  ? -15.517  -32.462  404.436 1.00 65.61  ? 41  ALA 1 CB    1 
ATOM   322   N  N     . LYS A  1  42  ? -17.530  -32.924  406.832 1.00 65.69  ? 42  LYS 1 N     1 
ATOM   323   C  CA    . LYS A  1  42  ? -18.354  -33.873  407.572 1.00 68.36  ? 42  LYS 1 CA    1 
ATOM   324   C  C     . LYS A  1  42  ? -19.813  -33.440  407.590 1.00 64.72  ? 42  LYS 1 C     1 
ATOM   325   O  O     . LYS A  1  42  ? -20.716  -34.268  407.420 1.00 64.11  ? 42  LYS 1 O     1 
ATOM   326   C  CB    . LYS A  1  42  ? -17.810  -34.028  408.991 1.00 73.41  ? 42  LYS 1 CB    1 
ATOM   327   C  CG    . LYS A  1  42  ? -18.544  -35.038  409.848 1.00 77.79  ? 42  LYS 1 CG    1 
ATOM   328   C  CD    . LYS A  1  42  ? -17.896  -35.119  411.218 1.00 81.20  ? 42  LYS 1 CD    1 
ATOM   329   C  CE    . LYS A  1  42  ? -16.641  -35.980  411.154 1.00 83.92  ? 42  LYS 1 CE    1 
ATOM   330   N  NZ    . LYS A  1  42  ? -16.185  -36.458  412.487 1.00 85.11  ? 42  LYS 1 NZ    1 
ATOM   331   N  N     . ARG A  1  43  ? -20.069  -32.149  407.787 1.00 64.16  ? 43  ARG 1 N     1 
ATOM   332   C  CA    . ARG A  1  43  ? -21.451  -31.685  407.729 1.00 66.22  ? 43  ARG 1 CA    1 
ATOM   333   C  C     . ARG A  1  43  ? -21.996  -31.717  406.296 1.00 64.89  ? 43  ARG 1 C     1 
ATOM   334   O  O     . ARG A  1  43  ? -23.077  -32.271  406.047 1.00 63.75  ? 43  ARG 1 O     1 
ATOM   335   C  CB    . ARG A  1  43  ? -21.558  -30.285  408.350 1.00 68.94  ? 43  ARG 1 CB    1 
ATOM   336   C  CG    . ARG A  1  43  ? -20.564  -29.279  407.807 1.00 70.34  ? 43  ARG 1 CG    1 
ATOM   337   C  CD    . ARG A  1  43  ? -20.745  -27.909  408.391 1.00 73.73  ? 43  ARG 1 CD    1 
ATOM   338   N  NE    . ARG A  1  43  ? -21.963  -27.274  407.910 1.00 79.87  ? 43  ARG 1 NE    1 
ATOM   339   C  CZ    . ARG A  1  43  ? -22.364  -26.064  408.288 1.00 87.12  ? 43  ARG 1 CZ    1 
ATOM   340   N  NH1   . ARG A  1  43  ? -21.636  -25.363  409.153 1.00 89.70  ? 43  ARG 1 NH1   1 
ATOM   341   N  NH2   . ARG A  1  43  ? -23.489  -25.554  407.807 1.00 88.53  ? 43  ARG 1 NH2   1 
ATOM   342   N  N     . VAL A  1  44  ? -21.243  -31.168  405.328 1.00 63.16  ? 44  VAL 1 N     1 
ATOM   343   C  CA    . VAL A  1  44  ? -21.784  -30.952  403.984 1.00 58.55  ? 44  VAL 1 CA    1 
ATOM   344   C  C     . VAL A  1  44  ? -22.093  -32.270  403.284 1.00 55.91  ? 44  VAL 1 C     1 
ATOM   345   O  O     . VAL A  1  44  ? -23.121  -32.394  402.609 1.00 53.95  ? 44  VAL 1 O     1 
ATOM   346   C  CB    . VAL A  1  44  ? -20.823  -30.079  403.150 1.00 58.55  ? 44  VAL 1 CB    1 
ATOM   347   C  CG1   . VAL A  1  44  ? -21.346  -29.905  401.727 1.00 58.36  ? 44  VAL 1 CG1   1 
ATOM   348   C  CG2   . VAL A  1  44  ? -20.654  -28.704  403.793 1.00 57.88  ? 44  VAL 1 CG2   1 
ATOM   349   N  N     . LEU A  1  45  ? -21.219  -33.274  403.423 1.00 57.74  ? 45  LEU 1 N     1 
ATOM   350   C  CA    . LEU A  1  45  ? -21.409  -34.533  402.697 1.00 61.28  ? 45  LEU 1 CA    1 
ATOM   351   C  C     . LEU A  1  45  ? -22.738  -35.199  403.039 1.00 67.31  ? 45  LEU 1 C     1 
ATOM   352   O  O     . LEU A  1  45  ? -23.305  -35.919  402.207 1.00 68.54  ? 45  LEU 1 O     1 
ATOM   353   C  CB    . LEU A  1  45  ? -20.252  -35.501  402.967 1.00 59.42  ? 45  LEU 1 CB    1 
ATOM   354   C  CG    . LEU A  1  45  ? -18.994  -35.324  402.112 1.00 57.62  ? 45  LEU 1 CG    1 
ATOM   355   C  CD1   . LEU A  1  45  ? -17.906  -36.327  402.478 1.00 55.85  ? 45  LEU 1 CD1   1 
ATOM   356   C  CD2   . LEU A  1  45  ? -19.342  -35.432  400.643 1.00 58.61  ? 45  LEU 1 CD2   1 
ATOM   357   N  N     . LYS A  1  46  ? -23.242  -34.988  404.252 1.00 70.77  ? 46  LYS 1 N     1 
ATOM   358   C  CA    . LYS A  1  46  ? -24.487  -35.613  404.673 1.00 73.69  ? 46  LYS 1 CA    1 
ATOM   359   C  C     . LYS A  1  46  ? -25.678  -34.671  404.623 1.00 78.83  ? 46  LYS 1 C     1 
ATOM   360   O  O     . LYS A  1  46  ? -26.818  -35.147  404.571 1.00 76.69  ? 46  LYS 1 O     1 
ATOM   361   C  CB    . LYS A  1  46  ? -24.341  -36.150  406.098 1.00 73.75  ? 46  LYS 1 CB    1 
ATOM   362   C  CG    . LYS A  1  46  ? -22.901  -36.479  406.451 1.00 76.29  ? 46  LYS 1 CG    1 
ATOM   363   C  CD    . LYS A  1  46  ? -22.824  -37.526  407.545 1.00 78.99  ? 46  LYS 1 CD    1 
ATOM   364   C  CE    . LYS A  1  46  ? -21.446  -37.562  408.181 1.00 78.64  ? 46  LYS 1 CE    1 
ATOM   365   N  NZ    . LYS A  1  46  ? -21.489  -38.173  409.537 1.00 77.85  ? 46  LYS 1 NZ    1 
ATOM   366   N  N     . GLU A  1  47  ? -25.442  -33.355  404.619 1.00 85.82  ? 47  GLU 1 N     1 
ATOM   367   C  CA    . GLU A  1  47  ? -26.529  -32.378  404.629 1.00 89.34  ? 47  GLU 1 CA    1 
ATOM   368   C  C     . GLU A  1  47  ? -26.925  -31.913  403.229 1.00 89.87  ? 47  GLU 1 C     1 
ATOM   369   O  O     . GLU A  1  47  ? -28.069  -32.103  402.804 1.00 89.82  ? 47  GLU 1 O     1 
ATOM   370   C  CB    . GLU A  1  47  ? -26.140  -31.173  405.490 1.00 91.87  ? 47  GLU 1 CB    1 
ATOM   371   C  CG    . GLU A  1  47  ? -25.880  -31.521  406.937 1.00 94.91  ? 47  GLU 1 CG    1 
ATOM   372   C  CD    . GLU A  1  47  ? -25.231  -30.387  407.693 1.00 98.81  ? 47  GLU 1 CD    1 
ATOM   373   O  OE1   . GLU A  1  47  ? -24.822  -29.394  407.051 1.00 100.61 ? 47  GLU 1 OE1   1 
ATOM   374   O  OE2   . GLU A  1  47  ? -25.109  -30.499  408.930 1.00 100.39 ? 47  GLU 1 OE2   1 
ATOM   375   N  N     . LYS A  1  48  ? -25.996  -31.299  402.505 1.00 89.78  ? 48  LYS 1 N     1 
ATOM   376   C  CA    . LYS A  1  48  ? -26.337  -30.606  401.272 1.00 90.94  ? 48  LYS 1 CA    1 
ATOM   377   C  C     . LYS A  1  48  ? -26.246  -31.535  400.067 1.00 93.92  ? 48  LYS 1 C     1 
ATOM   378   O  O     . LYS A  1  48  ? -25.501  -32.517  400.071 1.00 95.93  ? 48  LYS 1 O     1 
ATOM   379   C  CB    . LYS A  1  48  ? -25.415  -29.404  401.067 1.00 89.44  ? 48  LYS 1 CB    1 
ATOM   380   C  CG    . LYS A  1  48  ? -25.633  -28.297  402.083 1.00 88.23  ? 48  LYS 1 CG    1 
ATOM   381   C  CD    . LYS A  1  48  ? -24.706  -27.121  401.835 1.00 86.08  ? 48  LYS 1 CD    1 
ATOM   382   C  CE    . LYS A  1  48  ? -24.946  -26.043  402.864 1.00 82.70  ? 48  LYS 1 CE    1 
ATOM   383   N  NZ    . LYS A  1  48  ? -26.317  -25.514  402.727 1.00 81.55  ? 48  LYS 1 NZ    1 
ATOM   384   N  N     . THR A  1  49  ? -27.042  -31.220  399.029 1.00 92.59  ? 49  THR 1 N     1 
ATOM   385   C  CA    . THR A  1  49  ? -26.967  -31.909  397.749 1.00 90.04  ? 49  THR 1 CA    1 
ATOM   386   C  C     . THR A  1  49  ? -25.928  -31.233  396.856 1.00 83.76  ? 49  THR 1 C     1 
ATOM   387   O  O     . THR A  1  49  ? -25.509  -30.101  397.124 1.00 82.16  ? 49  THR 1 O     1 
ATOM   388   C  CB    . THR A  1  49  ? -28.350  -31.934  397.078 1.00 90.81  ? 49  THR 1 CB    1 
ATOM   389   O  OG1   . THR A  1  49  ? -28.838  -30.603  396.886 1.00 91.99  ? 49  THR 1 OG1   1 
ATOM   390   C  CG2   . THR A  1  49  ? -29.350  -32.700  397.937 1.00 91.07  ? 49  THR 1 CG2   1 
ATOM   391   N  N     . PRO A  1  50  ? -25.448  -31.914  395.805 1.00 80.39  ? 50  PRO 1 N     1 
ATOM   392   C  CA    . PRO A  1  50  ? -24.423  -31.283  394.946 1.00 75.50  ? 50  PRO 1 CA    1 
ATOM   393   C  C     . PRO A  1  50  ? -24.873  -29.963  394.334 1.00 71.08  ? 50  PRO 1 C     1 
ATOM   394   O  O     . PRO A  1  50  ? -24.077  -29.019  394.232 1.00 70.79  ? 50  PRO 1 O     1 
ATOM   395   C  CB    . PRO A  1  50  ? -24.161  -32.356  393.877 1.00 75.52  ? 50  PRO 1 CB    1 
ATOM   396   C  CG    . PRO A  1  50  ? -24.544  -33.647  394.536 1.00 74.75  ? 50  PRO 1 CG    1 
ATOM   397   C  CD    . PRO A  1  50  ? -25.697  -33.321  395.430 1.00 76.40  ? 50  PRO 1 CD    1 
ATOM   398   N  N     . ASP A  1  51  ? -26.134  -29.872  393.914 1.00 67.03  ? 51  ASP 1 N     1 
ATOM   399   C  CA    . ASP A  1  51  ? -26.652  -28.595  393.443 1.00 67.58  ? 51  ASP 1 CA    1 
ATOM   400   C  C     . ASP A  1  51  ? -26.549  -27.525  394.519 1.00 64.33  ? 51  ASP 1 C     1 
ATOM   401   O  O     . ASP A  1  51  ? -26.312  -26.358  394.205 1.00 64.22  ? 51  ASP 1 O     1 
ATOM   402   C  CB    . ASP A  1  51  ? -28.096  -28.743  392.962 1.00 73.54  ? 51  ASP 1 CB    1 
ATOM   403   C  CG    . ASP A  1  51  ? -28.187  -29.356  391.573 1.00 76.44  ? 51  ASP 1 CG    1 
ATOM   404   O  OD1   . ASP A  1  51  ? -27.606  -28.772  390.630 1.00 77.10  ? 51  ASP 1 OD1   1 
ATOM   405   O  OD2   . ASP A  1  51  ? -28.848  -30.405  391.419 1.00 76.84  ? 51  ASP 1 OD2   1 
ATOM   406   N  N     . GLU A  1  52  ? -26.713  -27.897  395.788 1.00 64.44  ? 52  GLU 1 N     1 
ATOM   407   C  CA    . GLU A  1  52  ? -26.644  -26.906  396.855 1.00 69.55  ? 52  GLU 1 CA    1 
ATOM   408   C  C     . GLU A  1  52  ? -25.225  -26.371  397.013 1.00 72.71  ? 52  GLU 1 C     1 
ATOM   409   O  O     . GLU A  1  52  ? -25.017  -25.155  397.099 1.00 72.66  ? 52  GLU 1 O     1 
ATOM   410   C  CB    . GLU A  1  52  ? -27.135  -27.515  398.165 1.00 70.15  ? 52  GLU 1 CB    1 
ATOM   411   C  CG    . GLU A  1  52  ? -28.598  -27.839  398.173 1.00 72.00  ? 52  GLU 1 CG    1 
ATOM   412   C  CD    . GLU A  1  52  ? -29.053  -28.266  399.537 1.00 75.68  ? 52  GLU 1 CD    1 
ATOM   413   O  OE1   . GLU A  1  52  ? -28.604  -27.644  400.522 1.00 74.12  ? 52  GLU 1 OE1   1 
ATOM   414   O  OE2   . GLU A  1  52  ? -29.827  -29.242  399.627 1.00 80.72  ? 52  GLU 1 OE2   1 
ATOM   415   N  N     . VAL A  1  53  ? -24.230  -27.264  397.035 1.00 75.08  ? 53  VAL 1 N     1 
ATOM   416   C  CA    . VAL A  1  53  ? -22.847  -26.816  397.171 1.00 75.10  ? 53  VAL 1 CA    1 
ATOM   417   C  C     . VAL A  1  53  ? -22.378  -26.067  395.929 1.00 67.72  ? 53  VAL 1 C     1 
ATOM   418   O  O     . VAL A  1  53  ? -21.493  -25.213  396.030 1.00 63.02  ? 53  VAL 1 O     1 
ATOM   419   C  CB    . VAL A  1  53  ? -21.910  -28.005  397.508 1.00 79.41  ? 53  VAL 1 CB    1 
ATOM   420   C  CG1   . VAL A  1  53  ? -22.003  -29.114  396.473 1.00 78.83  ? 53  VAL 1 CG1   1 
ATOM   421   C  CG2   . VAL A  1  53  ? -20.452  -27.541  397.650 1.00 81.92  ? 53  VAL 1 CG2   1 
ATOM   422   N  N     . ILE A  1  54  ? -22.991  -26.313  394.768 1.00 68.86  ? 54  ILE 1 N     1 
ATOM   423   C  CA    . ILE A  1  54  ? -22.607  -25.592  393.554 1.00 68.98  ? 54  ILE 1 CA    1 
ATOM   424   C  C     . ILE A  1  54  ? -23.257  -24.211  393.511 1.00 68.97  ? 54  ILE 1 C     1 
ATOM   425   O  O     . ILE A  1  54  ? -22.609  -23.213  393.174 1.00 67.40  ? 54  ILE 1 O     1 
ATOM   426   C  CB    . ILE A  1  54  ? -22.954  -26.430  392.309 1.00 69.68  ? 54  ILE 1 CB    1 
ATOM   427   C  CG1   . ILE A  1  54  ? -21.986  -27.606  392.197 1.00 67.87  ? 54  ILE 1 CG1   1 
ATOM   428   C  CG2   . ILE A  1  54  ? -22.916  -25.574  391.042 1.00 70.42  ? 54  ILE 1 CG2   1 
ATOM   429   C  CD1   . ILE A  1  54  ? -22.314  -28.572  391.093 1.00 69.44  ? 54  ILE 1 CD1   1 
ATOM   430   N  N     . GLU A  1  55  ? -24.553  -24.133  393.827 1.00 68.47  ? 55  GLU 1 N     1 
ATOM   431   C  CA    . GLU A  1  55  ? -25.201  -22.836  393.957 1.00 69.92  ? 55  GLU 1 CA    1 
ATOM   432   C  C     . GLU A  1  55  ? -24.530  -22.009  395.044 1.00 70.67  ? 55  GLU 1 C     1 
ATOM   433   O  O     . GLU A  1  55  ? -24.484  -20.777  394.948 1.00 71.98  ? 55  GLU 1 O     1 
ATOM   434   C  CB    . GLU A  1  55  ? -26.691  -23.010  394.267 1.00 69.53  ? 55  GLU 1 CB    1 
ATOM   435   C  CG    . GLU A  1  55  ? -27.626  -23.068  393.054 1.00 70.12  ? 55  GLU 1 CG    1 
ATOM   436   C  CD    . GLU A  1  55  ? -27.722  -21.752  392.295 1.00 70.22  ? 55  GLU 1 CD    1 
ATOM   437   O  OE1   . GLU A  1  55  ? -27.128  -21.647  391.201 1.00 69.10  ? 55  GLU 1 OE1   1 
ATOM   438   O  OE2   . GLU A  1  55  ? -28.383  -20.818  392.798 1.00 70.61  ? 55  GLU 1 OE2   1 
ATOM   439   N  N     . GLU A  1  56  ? -23.993  -22.667  396.075 1.00 71.90  ? 56  GLU 1 N     1 
ATOM   440   C  CA    . GLU A  1  56  ? -23.256  -21.956  397.114 1.00 73.41  ? 56  GLU 1 CA    1 
ATOM   441   C  C     . GLU A  1  56  ? -22.041  -21.242  396.535 1.00 68.77  ? 56  GLU 1 C     1 
ATOM   442   O  O     . GLU A  1  56  ? -21.821  -20.055  396.798 1.00 66.53  ? 56  GLU 1 O     1 
ATOM   443   C  CB    . GLU A  1  56  ? -22.837  -22.924  398.226 1.00 79.20  ? 56  GLU 1 CB    1 
ATOM   444   C  CG    . GLU A  1  56  ? -22.357  -22.230  399.504 1.00 84.50  ? 56  GLU 1 CG    1 
ATOM   445   C  CD    . GLU A  1  56  ? -23.494  -21.781  400.408 1.00 90.13  ? 56  GLU 1 CD    1 
ATOM   446   O  OE1   . GLU A  1  56  ? -24.522  -22.485  400.463 1.00 92.46  ? 56  GLU 1 OE1   1 
ATOM   447   O  OE2   . GLU A  1  56  ? -23.364  -20.716  401.055 1.00 91.45  ? 56  GLU 1 OE2   1 
ATOM   448   N  N     . VAL A  1  57  ? -21.238  -21.953  395.741 1.00 64.72  ? 57  VAL 1 N     1 
ATOM   449   C  CA    . VAL A  1  57  ? -20.048  -21.331  395.175 1.00 63.27  ? 57  VAL 1 CA    1 
ATOM   450   C  C     . VAL A  1  57  ? -20.443  -20.301  394.122 1.00 71.92  ? 57  VAL 1 C     1 
ATOM   451   O  O     . VAL A  1  57  ? -19.753  -19.289  393.940 1.00 75.85  ? 57  VAL 1 O     1 
ATOM   452   C  CB    . VAL A  1  57  ? -19.092  -22.404  394.618 1.00 57.41  ? 57  VAL 1 CB    1 
ATOM   453   C  CG1   . VAL A  1  57  ? -17.754  -21.801  394.289 1.00 57.00  ? 57  VAL 1 CG1   1 
ATOM   454   C  CG2   . VAL A  1  57  ? -18.883  -23.495  395.642 1.00 55.65  ? 57  VAL 1 CG2   1 
ATOM   455   N  N     . LYS A  1  58  ? -21.566  -20.518  393.430 1.00 76.24  ? 58  LYS 1 N     1 
ATOM   456   C  CA    . LYS A  1  58  ? -22.053  -19.507  392.494 1.00 78.58  ? 58  LYS 1 CA    1 
ATOM   457   C  C     . LYS A  1  58  ? -22.396  -18.218  393.231 1.00 81.06  ? 58  LYS 1 C     1 
ATOM   458   O  O     . LYS A  1  58  ? -22.072  -17.118  392.767 1.00 82.71  ? 58  LYS 1 O     1 
ATOM   459   C  CB    . LYS A  1  58  ? -23.270  -20.031  391.728 1.00 77.95  ? 58  LYS 1 CB    1 
ATOM   460   C  CG    . LYS A  1  58  ? -23.577  -19.281  390.442 1.00 76.53  ? 58  LYS 1 CG    1 
ATOM   461   C  CD    . LYS A  1  58  ? -24.808  -19.865  389.755 1.00 77.71  ? 58  LYS 1 CD    1 
ATOM   462   C  CE    . LYS A  1  58  ? -24.574  -21.309  389.292 1.00 77.69  ? 58  LYS 1 CE    1 
ATOM   463   N  NZ    . LYS A  1  58  ? -25.643  -21.825  388.381 1.00 76.88  ? 58  LYS 1 NZ    1 
ATOM   464   N  N     . ARG A  1  59  ? -23.021  -18.341  394.404 1.00 81.82  ? 59  ARG 1 N     1 
ATOM   465   C  CA    . ARG A  1  59  ? -23.358  -17.182  395.220 1.00 84.07  ? 59  ARG 1 CA    1 
ATOM   466   C  C     . ARG A  1  59  ? -22.131  -16.578  395.891 1.00 81.74  ? 59  ARG 1 C     1 
ATOM   467   O  O     . ARG A  1  59  ? -22.153  -15.395  396.245 1.00 80.52  ? 59  ARG 1 O     1 
ATOM   468   C  CB    . ARG A  1  59  ? -24.388  -17.578  396.280 1.00 90.20  ? 59  ARG 1 CB    1 
ATOM   469   C  CG    . ARG A  1  59  ? -25.805  -17.715  395.742 1.00 95.17  ? 59  ARG 1 CG    1 
ATOM   470   C  CD    . ARG A  1  59  ? -26.776  -18.131  396.831 1.00 98.18  ? 59  ARG 1 CD    1 
ATOM   471   N  NE    . ARG A  1  59  ? -27.720  -19.134  396.347 1.00 100.56 ? 59  ARG 1 NE    1 
ATOM   472   C  CZ    . ARG A  1  59  ? -28.993  -19.205  396.724 1.00 102.27 ? 59  ARG 1 CZ    1 
ATOM   473   N  NH1   . ARG A  1  59  ? -29.480  -18.324  397.592 1.00 103.51 ? 59  ARG 1 NH1   1 
ATOM   474   N  NH2   . ARG A  1  59  ? -29.781  -20.155  396.234 1.00 101.16 ? 59  ARG 1 NH2   1 
ATOM   475   N  N     . SER A  1  60  ? -21.068  -17.366  396.077 1.00 78.46  ? 60  SER 1 N     1 
ATOM   476   C  CA    . SER A  1  60  ? -19.848  -16.854  396.692 1.00 78.77  ? 60  SER 1 CA    1 
ATOM   477   C  C     . SER A  1  60  ? -19.197  -15.763  395.860 1.00 85.66  ? 60  SER 1 C     1 
ATOM   478   O  O     . SER A  1  60  ? -18.372  -15.008  396.386 1.00 88.82  ? 60  SER 1 O     1 
ATOM   479   C  CB    . SER A  1  60  ? -18.828  -17.972  396.879 1.00 69.60  ? 60  SER 1 CB    1 
ATOM   480   O  OG    . SER A  1  60  ? -18.335  -18.399  395.621 1.00 69.62  ? 60  SER 1 OG    1 
ATOM   481   N  N     . GLY A  1  61  ? -19.523  -15.681  394.572 1.00 81.94  ? 61  GLY 1 N     1 
ATOM   482   C  CA    . GLY A  1  61  ? -18.840  -14.741  393.711 1.00 82.86  ? 61  GLY 1 CA    1 
ATOM   483   C  C     . GLY A  1  61  ? -17.389  -15.090  393.515 1.00 82.45  ? 61  GLY 1 C     1 
ATOM   484   O  O     . GLY A  1  61  ? -16.599  -14.238  393.103 1.00 81.44  ? 61  GLY 1 O     1 
ATOM   485   N  N     . LEU A  1  62  ? -17.019  -16.332  393.801 1.00 83.12  ? 62  LEU 1 N     1 
ATOM   486   C  CA    . LEU A  1  62  ? -15.630  -16.748  393.702 1.00 86.96  ? 62  LEU 1 CA    1 
ATOM   487   C  C     . LEU A  1  62  ? -15.254  -16.933  392.240 1.00 89.28  ? 62  LEU 1 C     1 
ATOM   488   O  O     . LEU A  1  62  ? -15.779  -17.824  391.560 1.00 90.92  ? 62  LEU 1 O     1 
ATOM   489   C  CB    . LEU A  1  62  ? -15.413  -18.037  394.488 1.00 88.37  ? 62  LEU 1 CB    1 
ATOM   490   C  CG    . LEU A  1  62  ? -14.039  -18.690  394.357 1.00 87.58  ? 62  LEU 1 CG    1 
ATOM   491   C  CD1   . LEU A  1  62  ? -12.932  -17.713  394.717 1.00 86.15  ? 62  LEU 1 CD1   1 
ATOM   492   C  CD2   . LEU A  1  62  ? -13.962  -19.940  395.226 1.00 87.54  ? 62  LEU 1 CD2   1 
ATOM   493   N  N     . ARG A  1  63  ? -14.334  -16.104  391.765 1.00 87.57  ? 63  ARG 1 N     1 
ATOM   494   C  CA    . ARG A  1  63  ? -13.832  -16.184  390.405 1.00 87.34  ? 63  ARG 1 CA    1 
ATOM   495   C  C     . ARG A  1  63  ? -12.503  -16.930  390.380 1.00 85.33  ? 63  ARG 1 C     1 
ATOM   496   O  O     . ARG A  1  63  ? -11.854  -17.133  391.410 1.00 84.66  ? 63  ARG 1 O     1 
ATOM   497   C  CB    . ARG A  1  63  ? -13.688  -14.787  389.792 1.00 87.31  ? 63  ARG 1 CB    1 
ATOM   498   C  CG    . ARG A  1  63  ? -15.023  -14.167  389.407 1.00 90.22  ? 63  ARG 1 CG    1 
ATOM   499   C  CD    . ARG A  1  63  ? -14.862  -12.763  388.846 1.00 94.98  ? 63  ARG 1 CD    1 
ATOM   500   N  NE    . ARG A  1  63  ? -14.644  -12.782  387.401 1.00 98.46  ? 63  ARG 1 NE    1 
ATOM   501   C  CZ    . ARG A  1  63  ? -14.496  -11.696  386.646 1.00 100.72 ? 63  ARG 1 CZ    1 
ATOM   502   N  NH1   . ARG A  1  63  ? -14.565  -10.486  387.187 1.00 100.18 ? 63  ARG 1 NH1   1 
ATOM   503   N  NH2   . ARG A  1  63  ? -14.290  -11.820  385.341 1.00 102.38 ? 63  ARG 1 NH2   1 
ATOM   504   N  N     . GLY A  1  64  ? -12.126  -17.372  389.184 1.00 84.77  ? 64  GLY 1 N     1 
ATOM   505   C  CA    . GLY A  1  64  ? -10.915  -18.145  389.010 1.00 83.94  ? 64  GLY 1 CA    1 
ATOM   506   C  C     . GLY A  1  64  ? -9.684   -17.521  389.626 1.00 85.19  ? 64  GLY 1 C     1 
ATOM   507   O  O     . GLY A  1  64  ? -9.372   -16.354  389.374 1.00 86.29  ? 64  GLY 1 O     1 
ATOM   508   N  N     . ARG A  1  65  ? -8.976   -18.301  390.436 1.00 87.35  ? 65  ARG 1 N     1 
ATOM   509   C  CA    . ARG A  1  65  ? -7.756   -17.859  391.094 1.00 90.61  ? 65  ARG 1 CA    1 
ATOM   510   C  C     . ARG A  1  65  ? -6.492   -18.269  390.351 1.00 90.77  ? 65  ARG 1 C     1 
ATOM   511   O  O     . ARG A  1  65  ? -5.391   -17.947  390.812 1.00 90.15  ? 65  ARG 1 O     1 
ATOM   512   C  CB    . ARG A  1  65  ? -7.716   -18.384  392.536 1.00 93.79  ? 65  ARG 1 CB    1 
ATOM   513   C  CG    . ARG A  1  65  ? -8.828   -17.825  393.404 1.00 96.24  ? 65  ARG 1 CG    1 
ATOM   514   C  CD    . ARG A  1  65  ? -8.603   -16.337  393.593 1.00 99.94  ? 65  ARG 1 CD    1 
ATOM   515   N  NE    . ARG A  1  65  ? -9.846   -15.575  393.581 1.00 104.84 ? 65  ARG 1 NE    1 
ATOM   516   C  CZ    . ARG A  1  65  ? -10.534  -15.253  394.671 1.00 109.57 ? 65  ARG 1 CZ    1 
ATOM   517   N  NH1   . ARG A  1  65  ? -10.110  -15.641  395.867 1.00 111.23 ? 65  ARG 1 NH1   1 
ATOM   518   N  NH2   . ARG A  1  65  ? -11.654  -14.549  394.561 1.00 111.11 ? 65  ARG 1 NH2   1 
ATOM   519   N  N     . GLY A  1  66  ? -6.622   -18.959  389.212 1.00 91.25  ? 66  GLY 1 N     1 
ATOM   520   C  CA    . GLY A  1  66  ? -5.468   -19.316  388.404 1.00 89.98  ? 66  GLY 1 CA    1 
ATOM   521   C  C     . GLY A  1  66  ? -4.978   -18.239  387.461 1.00 87.66  ? 66  GLY 1 C     1 
ATOM   522   O  O     . GLY A  1  66  ? -3.919   -18.403  386.849 1.00 85.46  ? 66  GLY 1 O     1 
ATOM   523   N  N     . GLY A  1  67  ? -5.707   -17.134  387.346 1.00 87.49  ? 67  GLY 1 N     1 
ATOM   524   C  CA    . GLY A  1  67  ? -5.409   -16.082  386.394 1.00 86.76  ? 67  GLY 1 CA    1 
ATOM   525   C  C     . GLY A  1  67  ? -6.523   -15.819  385.403 1.00 87.87  ? 67  GLY 1 C     1 
ATOM   526   O  O     . GLY A  1  67  ? -6.559   -14.736  384.803 1.00 89.49  ? 67  GLY 1 O     1 
ATOM   527   N  N     . ALA A  1  68  ? -7.429   -16.778  385.201 1.00 89.33  ? 68  ALA 1 N     1 
ATOM   528   C  CA    . ALA A  1  68  ? -8.555   -16.567  384.296 1.00 90.32  ? 68  ALA 1 CA    1 
ATOM   529   C  C     . ALA A  1  68  ? -9.611   -15.673  384.936 1.00 95.66  ? 68  ALA 1 C     1 
ATOM   530   O  O     . ALA A  1  68  ? -9.914   -14.584  384.433 1.00 98.03  ? 68  ALA 1 O     1 
ATOM   531   C  CB    . ALA A  1  68  ? -9.162   -17.908  383.883 1.00 88.90  ? 68  ALA 1 CB    1 
ATOM   532   N  N     . GLY A  1  69  ? -10.182  -16.114  386.050 1.00 94.63  ? 69  GLY 1 N     1 
ATOM   533   C  CA    . GLY A  1  69  ? -11.254  -15.384  386.688 1.00 92.78  ? 69  GLY 1 CA    1 
ATOM   534   C  C     . GLY A  1  69  ? -12.644  -15.896  386.395 1.00 88.78  ? 69  GLY 1 C     1 
ATOM   535   O  O     . GLY A  1  69  ? -13.616  -15.172  386.640 1.00 88.43  ? 69  GLY 1 O     1 
ATOM   536   N  N     . PHE A  1  70  ? -12.771  -17.103  385.864 1.00 86.82  ? 70  PHE 1 N     1 
ATOM   537   C  CA    . PHE A  1  70  ? -14.089  -17.634  385.569 1.00 87.07  ? 70  PHE 1 CA    1 
ATOM   538   C  C     . PHE A  1  70  ? -14.782  -18.062  386.862 1.00 81.92  ? 70  PHE 1 C     1 
ATOM   539   O  O     . PHE A  1  70  ? -14.144  -18.645  387.746 1.00 81.09  ? 70  PHE 1 O     1 
ATOM   540   C  CB    . PHE A  1  70  ? -13.987  -18.817  384.600 1.00 91.89  ? 70  PHE 1 CB    1 
ATOM   541   C  CG    . PHE A  1  70  ? -15.254  -19.081  383.825 1.00 93.76  ? 70  PHE 1 CG    1 
ATOM   542   C  CD1   . PHE A  1  70  ? -16.210  -19.962  384.305 1.00 93.91  ? 70  PHE 1 CD1   1 
ATOM   543   C  CD2   . PHE A  1  70  ? -15.498  -18.432  382.625 1.00 94.35  ? 70  PHE 1 CD2   1 
ATOM   544   C  CE1   . PHE A  1  70  ? -17.376  -20.201  383.597 1.00 93.81  ? 70  PHE 1 CE1   1 
ATOM   545   C  CE2   . PHE A  1  70  ? -16.669  -18.668  381.917 1.00 94.89  ? 70  PHE 1 CE2   1 
ATOM   546   C  CZ    . PHE A  1  70  ? -17.604  -19.552  382.405 1.00 94.14  ? 70  PHE 1 CZ    1 
ATOM   547   N  N     . PRO A  1  71  ? -16.082  -17.768  387.014 1.00 79.46  ? 71  PRO 1 N     1 
ATOM   548   C  CA    . PRO A  1  71  ? -16.802  -18.201  388.221 1.00 79.25  ? 71  PRO 1 CA    1 
ATOM   549   C  C     . PRO A  1  71  ? -16.861  -19.716  388.334 1.00 78.37  ? 71  PRO 1 C     1 
ATOM   550   O  O     . PRO A  1  71  ? -17.481  -20.389  387.502 1.00 79.52  ? 71  PRO 1 O     1 
ATOM   551   C  CB    . PRO A  1  71  ? -18.196  -17.590  388.033 1.00 80.34  ? 71  PRO 1 CB    1 
ATOM   552   C  CG    . PRO A  1  71  ? -17.950  -16.384  387.165 1.00 80.41  ? 71  PRO 1 CG    1 
ATOM   553   C  CD    . PRO A  1  71  ? -16.885  -16.836  386.199 1.00 79.50  ? 71  PRO 1 CD    1 
ATOM   554   N  N     . THR A  1  72  ? -16.191  -20.258  389.355 1.00 75.71  ? 72  THR 1 N     1 
ATOM   555   C  CA    . THR A  1  72  ? -16.095  -21.705  389.509 1.00 73.89  ? 72  THR 1 CA    1 
ATOM   556   C  C     . THR A  1  72  ? -17.455  -22.356  389.724 1.00 66.67  ? 72  THR 1 C     1 
ATOM   557   O  O     . THR A  1  72  ? -17.625  -23.533  389.392 1.00 66.76  ? 72  THR 1 O     1 
ATOM   558   C  CB    . THR A  1  72  ? -15.152  -22.037  390.665 1.00 76.22  ? 72  THR 1 CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? -15.889  -22.044  391.889 1.00 79.92  ? 72  THR 1 OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? -14.062  -20.984  390.758 1.00 74.64  ? 72  THR 1 CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? -18.430  -21.611  390.244 1.00 60.62  ? 73  GLY 1 N     1 
ATOM   562   C  CA    . GLY A  1  73  ? -19.778  -22.144  390.335 1.00 56.74  ? 73  GLY 1 CA    1 
ATOM   563   C  C     . GLY A  1  73  ? -20.364  -22.429  388.966 1.00 55.25  ? 73  GLY 1 C     1 
ATOM   564   O  O     . GLY A  1  73  ? -20.903  -23.508  388.716 1.00 58.31  ? 73  GLY 1 O     1 
ATOM   565   N  N     . LEU A  1  74  ? -20.273  -21.456  388.056 1.00 51.76  ? 74  LEU 1 N     1 
ATOM   566   C  CA    . LEU A  1  74  ? -20.733  -21.677  386.688 1.00 48.69  ? 74  LEU 1 CA    1 
ATOM   567   C  C     . LEU A  1  74  ? -19.863  -22.703  385.978 1.00 50.30  ? 74  LEU 1 C     1 
ATOM   568   O  O     . LEU A  1  74  ? -20.349  -23.457  385.123 1.00 51.30  ? 74  LEU 1 O     1 
ATOM   569   C  CB    . LEU A  1  74  ? -20.751  -20.356  385.922 1.00 46.34  ? 74  LEU 1 CB    1 
ATOM   570   C  CG    . LEU A  1  74  ? -21.166  -20.421  384.454 1.00 44.84  ? 74  LEU 1 CG    1 
ATOM   571   C  CD1   . LEU A  1  74  ? -22.644  -20.744  384.308 1.00 41.70  ? 74  LEU 1 CD1   1 
ATOM   572   C  CD2   . LEU A  1  74  ? -20.833  -19.102  383.783 1.00 46.58  ? 74  LEU 1 CD2   1 
ATOM   573   N  N     . LYS A  1  75  ? -18.576  -22.737  386.320 1.00 49.23  ? 75  LYS 1 N     1 
ATOM   574   C  CA    . LYS A  1  75  ? -17.682  -23.753  385.777 1.00 52.19  ? 75  LYS 1 CA    1 
ATOM   575   C  C     . LYS A  1  75  ? -18.168  -25.157  386.121 1.00 44.82  ? 75  LYS 1 C     1 
ATOM   576   O  O     . LYS A  1  75  ? -18.138  -26.063  385.278 1.00 44.27  ? 75  LYS 1 O     1 
ATOM   577   C  CB    . LYS A  1  75  ? -16.270  -23.525  386.308 1.00 55.30  ? 75  LYS 1 CB    1 
ATOM   578   C  CG    . LYS A  1  75  ? -15.252  -24.396  385.639 1.00 59.92  ? 75  LYS 1 CG    1 
ATOM   579   C  CD    . LYS A  1  75  ? -13.883  -24.193  386.240 1.00 63.19  ? 75  LYS 1 CD    1 
ATOM   580   C  CE    . LYS A  1  75  ? -12.814  -24.651  385.262 1.00 66.14  ? 75  LYS 1 CE    1 
ATOM   581   N  NZ    . LYS A  1  75  ? -11.457  -24.571  385.861 1.00 63.71  ? 75  LYS 1 NZ    1 
ATOM   582   N  N     . TRP A  1  76  ? -18.591  -25.362  387.367 1.00 41.83  ? 76  TRP 1 N     1 
ATOM   583   C  CA    . TRP A  1  76  ? -19.191  -26.633  387.755 1.00 41.82  ? 76  TRP 1 CA    1 
ATOM   584   C  C     . TRP A  1  76  ? -20.567  -26.813  387.137 1.00 45.83  ? 76  TRP 1 C     1 
ATOM   585   O  O     . TRP A  1  76  ? -20.988  -27.944  386.874 1.00 49.40  ? 76  TRP 1 O     1 
ATOM   586   C  CB    . TRP A  1  76  ? -19.276  -26.724  389.275 1.00 41.93  ? 76  TRP 1 CB    1 
ATOM   587   C  CG    . TRP A  1  76  ? -17.955  -26.635  389.952 1.00 43.33  ? 76  TRP 1 CG    1 
ATOM   588   C  CD1   . TRP A  1  76  ? -16.741  -26.482  389.359 1.00 43.84  ? 76  TRP 1 CD1   1 
ATOM   589   C  CD2   . TRP A  1  76  ? -17.709  -26.714  391.357 1.00 46.49  ? 76  TRP 1 CD2   1 
ATOM   590   N  NE1   . TRP A  1  76  ? -15.750  -26.458  390.307 1.00 44.54  ? 76  TRP 1 NE1   1 
ATOM   591   C  CE2   . TRP A  1  76  ? -16.321  -26.600  391.543 1.00 45.65  ? 76  TRP 1 CE2   1 
ATOM   592   C  CE3   . TRP A  1  76  ? -18.528  -26.871  392.477 1.00 44.80  ? 76  TRP 1 CE3   1 
ATOM   593   C  CZ2   . TRP A  1  76  ? -15.735  -26.636  392.801 1.00 49.46  ? 76  TRP 1 CZ2   1 
ATOM   594   C  CZ3   . TRP A  1  76  ? -17.941  -26.907  393.726 1.00 46.82  ? 76  TRP 1 CZ3   1 
ATOM   595   C  CH2   . TRP A  1  76  ? -16.562  -26.791  393.878 1.00 48.82  ? 76  TRP 1 CH2   1 
ATOM   596   N  N     . SER A  1  77  ? -21.276  -25.717  386.894 1.00 43.03  ? 77  SER 1 N     1 
ATOM   597   C  CA    . SER A  1  77  ? -22.576  -25.810  386.250 1.00 44.62  ? 77  SER 1 CA    1 
ATOM   598   C  C     . SER A  1  77  ? -22.462  -26.219  384.786 1.00 42.67  ? 77  SER 1 C     1 
ATOM   599   O  O     . SER A  1  77  ? -23.456  -26.661  384.200 1.00 42.29  ? 77  SER 1 O     1 
ATOM   600   C  CB    . SER A  1  77  ? -23.310  -24.474  386.375 1.00 49.75  ? 77  SER 1 CB    1 
ATOM   601   O  OG    . SER A  1  77  ? -23.000  -23.630  385.280 1.00 57.52  ? 77  SER 1 OG    1 
ATOM   602   N  N     . PHE A  1  78  ? -21.277  -26.087  384.184 1.00 45.74  ? 78  PHE 1 N     1 
ATOM   603   C  CA    . PHE A  1  78  ? -21.099  -26.544  382.813 1.00 44.97  ? 78  PHE 1 CA    1 
ATOM   604   C  C     . PHE A  1  78  ? -20.809  -28.034  382.715 1.00 41.43  ? 78  PHE 1 C     1 
ATOM   605   O  O     . PHE A  1  78  ? -20.839  -28.576  381.606 1.00 41.33  ? 78  PHE 1 O     1 
ATOM   606   C  CB    . PHE A  1  78  ? -19.966  -25.777  382.122 1.00 49.63  ? 78  PHE 1 CB    1 
ATOM   607   C  CG    . PHE A  1  78  ? -20.336  -24.383  381.732 1.00 54.04  ? 78  PHE 1 CG    1 
ATOM   608   C  CD1   . PHE A  1  78  ? -21.635  -24.083  381.359 1.00 58.34  ? 78  PHE 1 CD1   1 
ATOM   609   C  CD2   . PHE A  1  78  ? -19.392  -23.373  381.719 1.00 54.43  ? 78  PHE 1 CD2   1 
ATOM   610   C  CE1   . PHE A  1  78  ? -21.993  -22.794  380.998 1.00 58.76  ? 78  PHE 1 CE1   1 
ATOM   611   C  CE2   . PHE A  1  78  ? -19.747  -22.082  381.353 1.00 55.88  ? 78  PHE 1 CE2   1 
ATOM   612   C  CZ    . PHE A  1  78  ? -21.048  -21.795  380.992 1.00 56.96  ? 78  PHE 1 CZ    1 
ATOM   613   N  N     . MET A  1  79  ? -20.555  -28.703  383.835 1.00 42.58  ? 79  MET 1 N     1 
ATOM   614   C  CA    . MET A  1  79  ? -20.262  -30.121  383.812 1.00 46.54  ? 79  MET 1 CA    1 
ATOM   615   C  C     . MET A  1  79  ? -21.491  -30.917  383.386 1.00 47.73  ? 79  MET 1 C     1 
ATOM   616   O  O     . MET A  1  79  ? -22.622  -30.434  383.491 1.00 49.02  ? 79  MET 1 O     1 
ATOM   617   C  CB    . MET A  1  79  ? -19.792  -30.590  385.186 1.00 50.15  ? 79  MET 1 CB    1 
ATOM   618   C  CG    . MET A  1  79  ? -18.420  -30.110  385.575 1.00 56.41  ? 79  MET 1 CG    1 
ATOM   619   S  SD    . MET A  1  79  ? -17.191  -31.264  384.914 1.00 64.27  ? 79  MET 1 SD    1 
ATOM   620   C  CE    . MET A  1  79  ? -17.722  -32.845  385.578 1.00 64.49  ? 79  MET 1 CE    1 
ATOM   621   N  N     . PRO A  1  80  ? -21.293  -32.142  382.886 1.00 46.27  ? 80  PRO 1 N     1 
ATOM   622   C  CA    . PRO A  1  80  ? -22.459  -32.958  382.516 1.00 49.83  ? 80  PRO 1 CA    1 
ATOM   623   C  C     . PRO A  1  80  ? -23.368  -33.205  383.707 1.00 55.75  ? 80  PRO 1 C     1 
ATOM   624   O  O     . PRO A  1  80  ? -24.594  -33.274  383.547 1.00 59.49  ? 80  PRO 1 O     1 
ATOM   625   C  CB    . PRO A  1  80  ? -21.819  -34.238  381.972 1.00 47.00  ? 80  PRO 1 CB    1 
ATOM   626   C  CG    . PRO A  1  80  ? -20.510  -33.761  381.425 1.00 44.30  ? 80  PRO 1 CG    1 
ATOM   627   C  CD    . PRO A  1  80  ? -20.036  -32.773  382.448 1.00 44.28  ? 80  PRO 1 CD    1 
ATOM   628   N  N     . LYS A  1  81  ? -22.779  -33.393  384.891 1.00 57.02  ? 81  LYS 1 N     1 
ATOM   629   C  CA    . LYS A  1  81  ? -23.466  -33.355  386.180 1.00 60.20  ? 81  LYS 1 CA    1 
ATOM   630   C  C     . LYS A  1  81  ? -24.349  -34.572  386.418 1.00 58.65  ? 81  LYS 1 C     1 
ATOM   631   O  O     . LYS A  1  81  ? -24.782  -34.813  387.547 1.00 58.55  ? 81  LYS 1 O     1 
ATOM   632   C  CB    . LYS A  1  81  ? -24.308  -32.067  386.273 1.00 64.19  ? 81  LYS 1 CB    1 
ATOM   633   C  CG    . LYS A  1  81  ? -24.819  -31.671  387.663 1.00 67.24  ? 81  LYS 1 CG    1 
ATOM   634   C  CD    . LYS A  1  81  ? -25.322  -30.220  387.685 1.00 66.93  ? 81  LYS 1 CD    1 
ATOM   635   C  CE    . LYS A  1  81  ? -24.268  -29.259  388.212 1.00 64.27  ? 81  LYS 1 CE    1 
ATOM   636   N  NZ    . LYS A  1  81  ? -23.076  -29.195  387.329 1.00 62.28  ? 81  LYS 1 NZ    1 
ATOM   637   N  N     . ASP A  1  82  ? -24.596  -35.364  385.380 1.00 58.82  ? 82  ASP 1 N     1 
ATOM   638   C  CA    . ASP A  1  82  ? -25.232  -36.667  385.553 1.00 60.05  ? 82  ASP 1 CA    1 
ATOM   639   C  C     . ASP A  1  82  ? -25.011  -37.454  384.270 1.00 61.79  ? 82  ASP 1 C     1 
ATOM   640   O  O     . ASP A  1  82  ? -25.597  -37.119  383.234 1.00 61.57  ? 82  ASP 1 O     1 
ATOM   641   C  CB    . ASP A  1  82  ? -26.714  -36.523  385.869 1.00 58.08  ? 82  ASP 1 CB    1 
ATOM   642   C  CG    . ASP A  1  82  ? -27.212  -37.619  386.771 1.00 57.02  ? 82  ASP 1 CG    1 
ATOM   643   O  OD1   . ASP A  1  82  ? -26.981  -38.796  386.439 1.00 57.34  ? 82  ASP 1 OD1   1 
ATOM   644   O  OD2   . ASP A  1  82  ? -27.824  -37.311  387.810 1.00 57.09  ? 82  ASP 1 OD2   1 
ATOM   645   N  N     . ASP A  1  83  ? -24.154  -38.473  384.329 1.00 62.22  ? 83  ASP 1 N     1 
ATOM   646   C  CA    . ASP A  1  83  ? -23.984  -39.368  383.189 1.00 58.41  ? 83  ASP 1 CA    1 
ATOM   647   C  C     . ASP A  1  83  ? -23.837  -40.839  383.546 1.00 60.40  ? 83  ASP 1 C     1 
ATOM   648   O  O     . ASP A  1  83  ? -24.034  -41.683  382.665 1.00 58.84  ? 83  ASP 1 O     1 
ATOM   649   C  CB    . ASP A  1  83  ? -22.771  -38.932  382.357 1.00 53.49  ? 83  ASP 1 CB    1 
ATOM   650   C  CG    . ASP A  1  83  ? -21.498  -38.843  383.176 1.00 48.19  ? 83  ASP 1 CG    1 
ATOM   651   O  OD1   . ASP A  1  83  ? -21.552  -38.944  384.420 1.00 47.17  ? 83  ASP 1 OD1   1 
ATOM   652   O  OD2   . ASP A  1  83  ? -20.433  -38.616  382.571 1.00 48.63  ? 83  ASP 1 OD2   1 
ATOM   653   N  N     . GLY A  1  84  ? -23.516  -41.190  384.787 1.00 61.53  ? 84  GLY 1 N     1 
ATOM   654   C  CA    . GLY A  1  84  ? -23.148  -42.543  385.122 1.00 62.05  ? 84  GLY 1 CA    1 
ATOM   655   C  C     . GLY A  1  84  ? -21.680  -42.851  384.914 1.00 60.77  ? 84  GLY 1 C     1 
ATOM   656   O  O     . GLY A  1  84  ? -21.178  -43.832  385.473 1.00 59.11  ? 84  GLY 1 O     1 
ATOM   657   N  N     . LYS A  1  85  ? -20.983  -42.047  384.115 1.00 62.27  ? 85  LYS 1 N     1 
ATOM   658   C  CA    . LYS A  1  85  ? -19.575  -42.284  383.858 1.00 62.50  ? 85  LYS 1 CA    1 
ATOM   659   C  C     . LYS A  1  85  ? -18.710  -41.666  384.956 1.00 58.31  ? 85  LYS 1 C     1 
ATOM   660   O  O     . LYS A  1  85  ? -19.083  -40.686  385.614 1.00 54.31  ? 85  LYS 1 O     1 
ATOM   661   C  CB    . LYS A  1  85  ? -19.172  -41.711  382.498 1.00 68.78  ? 85  LYS 1 CB    1 
ATOM   662   C  CG    . LYS A  1  85  ? -19.806  -42.422  381.324 1.00 74.41  ? 85  LYS 1 CG    1 
ATOM   663   C  CD    . LYS A  1  85  ? -19.235  -41.938  379.993 1.00 79.42  ? 85  LYS 1 CD    1 
ATOM   664   C  CE    . LYS A  1  85  ? -19.076  -43.103  379.010 1.00 81.31  ? 85  LYS 1 CE    1 
ATOM   665   N  NZ    . LYS A  1  85  ? -18.895  -42.664  377.593 1.00 80.47  ? 85  LYS 1 NZ    1 
ATOM   666   N  N     . GLN A  1  86  ? -17.511  -42.222  385.098 1.00 54.27  ? 86  GLN 1 N     1 
ATOM   667   C  CA    . GLN A  1  86  ? -16.543  -41.711  386.053 1.00 48.27  ? 86  GLN 1 CA    1 
ATOM   668   C  C     . GLN A  1  86  ? -16.096  -40.312  385.658 1.00 41.37  ? 86  GLN 1 C     1 
ATOM   669   O  O     . GLN A  1  86  ? -15.831  -40.043  384.484 1.00 41.29  ? 86  GLN 1 O     1 
ATOM   670   C  CB    . GLN A  1  86  ? -15.333  -42.648  386.107 1.00 48.82  ? 86  GLN 1 CB    1 
ATOM   671   C  CG    . GLN A  1  86  ? -14.062  -42.017  386.642 1.00 46.78  ? 86  GLN 1 CG    1 
ATOM   672   C  CD    . GLN A  1  86  ? -14.019  -42.029  388.151 1.00 46.16  ? 86  GLN 1 CD    1 
ATOM   673   O  OE1   . GLN A  1  86  ? -14.826  -41.371  388.809 1.00 46.22  ? 86  GLN 1 OE1   1 
ATOM   674   N  NE2   . GLN A  1  86  ? -13.067  -42.767  388.714 1.00 45.66  ? 86  GLN 1 NE2   1 
ATOM   675   N  N     . HIS A  1  87  ? -16.019  -39.414  386.641 1.00 33.64  ? 87  HIS 1 N     1 
ATOM   676   C  CA    . HIS A  1  87  ? -15.451  -38.083  386.438 1.00 31.80  ? 87  HIS 1 CA    1 
ATOM   677   C  C     . HIS A  1  87  ? -14.148  -37.935  387.210 1.00 32.67  ? 87  HIS 1 C     1 
ATOM   678   O  O     . HIS A  1  87  ? -13.819  -38.728  388.097 1.00 30.90  ? 87  HIS 1 O     1 
ATOM   679   C  CB    . HIS A  1  87  ? -16.384  -36.921  386.840 1.00 42.23  ? 87  HIS 1 CB    1 
ATOM   680   C  CG    . HIS A  1  87  ? -17.719  -36.929  386.163 1.00 46.29  ? 87  HIS 1 CG    1 
ATOM   681   N  ND1   . HIS A  1  87  ? -18.773  -36.147  386.594 1.00 46.48  ? 87  HIS 1 ND1   1 
ATOM   682   C  CD2   . HIS A  1  87  ? -18.185  -37.653  385.117 1.00 47.72  ? 87  HIS 1 CD2   1 
ATOM   683   C  CE1   . HIS A  1  87  ? -19.816  -36.353  385.811 1.00 45.98  ? 87  HIS 1 CE1   1 
ATOM   684   N  NE2   . HIS A  1  87  ? -19.488  -37.270  384.914 1.00 47.16  ? 87  HIS 1 NE2   1 
ATOM   685   N  N     . TYR A  1  88  ? -13.398  -36.898  386.847 1.00 35.12  ? 88  TYR 1 N     1 
ATOM   686   C  CA    . TYR A  1  88  ? -12.093  -36.652  387.435 1.00 37.19  ? 88  TYR 1 CA    1 
ATOM   687   C  C     . TYR A  1  88  ? -11.996  -35.192  387.845 1.00 34.12  ? 88  TYR 1 C     1 
ATOM   688   O  O     . TYR A  1  88  ? -12.382  -34.293  387.091 1.00 28.77  ? 88  TYR 1 O     1 
ATOM   689   C  CB    . TYR A  1  88  ? -10.954  -36.985  386.446 1.00 34.73  ? 88  TYR 1 CB    1 
ATOM   690   C  CG    . TYR A  1  88  ? -10.765  -38.470  386.152 1.00 27.15  ? 88  TYR 1 CG    1 
ATOM   691   C  CD1   . TYR A  1  88  ? -10.049  -39.296  387.006 1.00 27.21  ? 88  TYR 1 CD1   1 
ATOM   692   C  CD2   . TYR A  1  88  ? -11.292  -39.030  385.005 1.00 28.02  ? 88  TYR 1 CD2   1 
ATOM   693   C  CE1   . TYR A  1  88  ? -9.877   -40.639  386.718 1.00 24.66  ? 88  TYR 1 CE1   1 
ATOM   694   C  CE2   . TYR A  1  88  ? -11.126  -40.363  384.717 1.00 26.15  ? 88  TYR 1 CE2   1 
ATOM   695   C  CZ    . TYR A  1  88  ? -10.424  -41.166  385.568 1.00 23.91  ? 88  TYR 1 CZ    1 
ATOM   696   O  OH    . TYR A  1  88  ? -10.283  -42.500  385.243 1.00 26.12  ? 88  TYR 1 OH    1 
ATOM   697   N  N     . LEU A  1  89  ? -11.439  -34.966  389.027 1.00 39.35  ? 89  LEU 1 N     1 
ATOM   698   C  CA    . LEU A  1  89  ? -11.134  -33.631  389.513 1.00 42.06  ? 89  LEU 1 CA    1 
ATOM   699   C  C     . LEU A  1  89  ? -9.625   -33.462  389.510 1.00 51.35  ? 89  LEU 1 C     1 
ATOM   700   O  O     . LEU A  1  89  ? -8.895   -34.340  389.987 1.00 49.24  ? 89  LEU 1 O     1 
ATOM   701   C  CB    . LEU A  1  89  ? -11.698  -33.397  390.913 1.00 38.09  ? 89  LEU 1 CB    1 
ATOM   702   C  CG    . LEU A  1  89  ? -11.391  -32.006  391.478 1.00 36.23  ? 89  LEU 1 CG    1 
ATOM   703   C  CD1   . LEU A  1  89  ? -11.831  -30.894  390.542 1.00 32.42  ? 89  LEU 1 CD1   1 
ATOM   704   C  CD2   . LEU A  1  89  ? -11.994  -31.833  392.862 1.00 41.28  ? 89  LEU 1 CD2   1 
ATOM   705   N  N     . ILE A  1  90  ? -9.162   -32.338  388.964 1.00 59.13  ? 90  ILE 1 N     1 
ATOM   706   C  CA    . ILE A  1  90  ? -7.743   -32.071  388.774 1.00 62.98  ? 90  ILE 1 CA    1 
ATOM   707   C  C     . ILE A  1  90  ? -7.350   -30.881  389.628 1.00 61.71  ? 90  ILE 1 C     1 
ATOM   708   O  O     . ILE A  1  90  ? -7.946   -29.803  389.514 1.00 54.12  ? 90  ILE 1 O     1 
ATOM   709   C  CB    . ILE A  1  90  ? -7.399   -31.824  387.294 1.00 63.21  ? 90  ILE 1 CB    1 
ATOM   710   C  CG1   . ILE A  1  90  ? -7.574   -33.109  386.480 1.00 63.25  ? 90  ILE 1 CG1   1 
ATOM   711   C  CG2   . ILE A  1  90  ? -5.988   -31.275  387.142 1.00 65.32  ? 90  ILE 1 CG2   1 
ATOM   712   C  CD1   . ILE A  1  90  ? -7.018   -33.032  385.070 1.00 62.86  ? 90  ILE 1 CD1   1 
ATOM   713   N  N     . CYS A  1  91  ? -6.357   -31.087  390.489 1.00 74.44  ? 91  CYS 1 N     1 
ATOM   714   C  CA    . CYS A  1  91  ? -5.686   -30.009  391.196 1.00 84.77  ? 91  CYS 1 CA    1 
ATOM   715   C  C     . CYS A  1  91  ? -4.550   -29.526  390.308 1.00 80.93  ? 91  CYS 1 C     1 
ATOM   716   O  O     . CYS A  1  91  ? -3.661   -30.306  389.950 1.00 79.82  ? 91  CYS 1 O     1 
ATOM   717   C  CB    . CYS A  1  91  ? -5.144   -30.481  392.543 1.00 105.84 ? 91  CYS 1 CB    1 
ATOM   718   S  SG    . CYS A  1  91  ? -4.407   -29.178  393.558 1.00 126.32 ? 91  CYS 1 SG    1 
ATOM   719   N  N     . ASN A  1  92  ? -4.586   -28.249  389.951 1.00 74.00  ? 92  ASN 1 N     1 
ATOM   720   C  CA    . ASN A  1  92  ? -3.636   -27.661  389.012 1.00 69.03  ? 92  ASN 1 CA    1 
ATOM   721   C  C     . ASN A  1  92  ? -2.512   -27.048  389.838 1.00 64.11  ? 92  ASN 1 C     1 
ATOM   722   O  O     . ASN A  1  92  ? -2.527   -25.864  390.178 1.00 64.53  ? 92  ASN 1 O     1 
ATOM   723   C  CB    . ASN A  1  92  ? -4.359   -26.660  388.113 1.00 69.23  ? 92  ASN 1 CB    1 
ATOM   724   C  CG    . ASN A  1  92  ? -3.476   -26.078  387.016 1.00 67.36  ? 92  ASN 1 CG    1 
ATOM   725   O  OD1   . ASN A  1  92  ? -2.362   -26.545  386.772 1.00 67.89  ? 92  ASN 1 OD1   1 
ATOM   726   N  ND2   . ASN A  1  92  ? -4.023   -25.112  386.283 1.00 64.64  ? 92  ASN 1 ND2   1 
ATOM   727   N  N     . ALA A  1  93  ? -1.534   -27.883  390.192 1.00 57.55  ? 93  ALA 1 N     1 
ATOM   728   C  CA    . ALA A  1  93  ? -0.455   -27.499  391.090 1.00 55.77  ? 93  ALA 1 CA    1 
ATOM   729   C  C     . ALA A  1  93  ? 0.844    -27.172  390.351 1.00 59.44  ? 93  ALA 1 C     1 
ATOM   730   O  O     . ALA A  1  93  ? 1.913    -27.136  390.967 1.00 63.30  ? 93  ALA 1 O     1 
ATOM   731   C  CB    . ALA A  1  93  ? -0.225   -28.596  392.130 1.00 51.62  ? 93  ALA 1 CB    1 
ATOM   732   N  N     . ASP A  1  94  ? 0.779    -26.930  389.047 1.00 58.93  ? 94  ASP 1 N     1 
ATOM   733   C  CA    . ASP A  1  94  ? 1.941    -26.441  388.310 1.00 54.57  ? 94  ASP 1 CA    1 
ATOM   734   C  C     . ASP A  1  94  ? 2.031    -24.939  388.557 1.00 47.41  ? 94  ASP 1 C     1 
ATOM   735   O  O     . ASP A  1  94  ? 1.211    -24.172  388.042 1.00 43.30  ? 94  ASP 1 O     1 
ATOM   736   C  CB    . ASP A  1  94  ? 1.798    -26.755  386.822 1.00 54.40  ? 94  ASP 1 CB    1 
ATOM   737   C  CG    . ASP A  1  94  ? 3.014    -26.342  386.013 1.00 53.14  ? 94  ASP 1 CG    1 
ATOM   738   O  OD1   . ASP A  1  94  ? 3.935    -27.172  385.861 1.00 52.24  ? 94  ASP 1 OD1   1 
ATOM   739   O  OD2   . ASP A  1  94  ? 3.062    -25.189  385.543 1.00 53.42  ? 94  ASP 1 OD2   1 
ATOM   740   N  N     . GLU A  1  95  ? 2.982    -24.517  389.391 1.00 46.14  ? 95  GLU 1 N     1 
ATOM   741   C  CA    . GLU A  1  95  ? 3.175    -23.108  389.767 1.00 44.70  ? 95  GLU 1 CA    1 
ATOM   742   C  C     . GLU A  1  95  ? 4.472    -22.606  389.130 1.00 38.68  ? 95  GLU 1 C     1 
ATOM   743   O  O     . GLU A  1  95  ? 5.552    -22.716  389.712 1.00 36.81  ? 95  GLU 1 O     1 
ATOM   744   C  CB    . GLU A  1  95  ? 3.198    -22.956  391.293 1.00 42.09  ? 95  GLU 1 CB    1 
ATOM   745   C  CG    . GLU A  1  95  ? 3.563    -21.573  391.810 1.00 37.65  ? 95  GLU 1 CG    1 
ATOM   746   C  CD    . GLU A  1  95  ? 3.587    -21.514  393.328 1.00 37.00  ? 95  GLU 1 CD    1 
ATOM   747   O  OE1   . GLU A  1  95  ? 4.305    -22.310  393.964 1.00 37.55  ? 95  GLU 1 OE1   1 
ATOM   748   O  OE2   . GLU A  1  95  ? 2.855    -20.680  393.893 1.00 37.47  ? 95  GLU 1 OE2   1 
ATOM   749   N  N     . SER A  1  96  ? 4.351    -22.004  387.942 1.00 36.58  ? 96  SER 1 N     1 
ATOM   750   C  CA    . SER A  1  96  ? 5.523    -21.645  387.154 1.00 33.54  ? 96  SER 1 CA    1 
ATOM   751   C  C     . SER A  1  96  ? 5.608    -20.178  386.727 1.00 29.10  ? 96  SER 1 C     1 
ATOM   752   O  O     . SER A  1  96  ? 6.676    -19.761  386.259 1.00 25.02  ? 96  SER 1 O     1 
ATOM   753   C  CB    . SER A  1  96  ? 5.597    -22.536  385.899 1.00 33.91  ? 96  SER 1 CB    1 
ATOM   754   O  OG    . SER A  1  96  ? 5.658    -23.915  386.249 1.00 32.88  ? 96  SER 1 OG    1 
ATOM   755   N  N     . GLU A  1  97  ? 4.562    -19.377  386.909 1.00 31.98  ? 97  GLU 1 N     1 
ATOM   756   C  CA    . GLU A  1  97  ? 4.627    -17.980  386.480 1.00 34.14  ? 97  GLU 1 CA    1 
ATOM   757   C  C     . GLU A  1  97  ? 5.529    -17.188  387.421 1.00 35.78  ? 97  GLU 1 C     1 
ATOM   758   O  O     . GLU A  1  97  ? 5.411    -17.323  388.649 1.00 33.30  ? 97  GLU 1 O     1 
ATOM   759   C  CB    . GLU A  1  97  ? 3.235    -17.345  386.435 1.00 33.03  ? 97  GLU 1 CB    1 
ATOM   760   C  CG    . GLU A  1  97  ? 3.212    -15.892  385.972 1.00 33.21  ? 97  GLU 1 CG    1 
ATOM   761   C  CD    . GLU A  1  97  ? 1.919    -15.518  385.269 1.00 38.59  ? 97  GLU 1 CD    1 
ATOM   762   O  OE1   . GLU A  1  97  ? 1.004    -16.361  385.228 1.00 42.99  ? 97  GLU 1 OE1   1 
ATOM   763   O  OE2   . GLU A  1  97  ? 1.821    -14.399  384.724 1.00 40.55  ? 97  GLU 1 OE2   1 
ATOM   764   N  N     . PRO A  1  98  ? 6.465    -16.397  386.889 1.00 38.01  ? 98  PRO 1 N     1 
ATOM   765   C  CA    . PRO A  1  98  ? 7.359    -15.605  387.746 1.00 31.91  ? 98  PRO 1 CA    1 
ATOM   766   C  C     . PRO A  1  98  ? 6.614    -14.520  388.511 1.00 25.55  ? 98  PRO 1 C     1 
ATOM   767   O  O     . PRO A  1  98  ? 5.616    -13.963  388.046 1.00 25.46  ? 98  PRO 1 O     1 
ATOM   768   C  CB    . PRO A  1  98  ? 8.350    -14.996  386.750 1.00 32.21  ? 98  PRO 1 CB    1 
ATOM   769   C  CG    . PRO A  1  98  ? 8.302    -15.917  385.568 1.00 32.92  ? 98  PRO 1 CG    1 
ATOM   770   C  CD    . PRO A  1  98  ? 6.889    -16.386  385.478 1.00 36.38  ? 98  PRO 1 CD    1 
ATOM   771   N  N     . GLY A  1  99  ? 7.161    -14.163  389.670 1.00 27.07  ? 99  GLY 1 N     1 
ATOM   772   C  CA    . GLY A  1  99  ? 6.513    -13.217  390.555 1.00 31.31  ? 99  GLY 1 CA    1 
ATOM   773   C  C     . GLY A  1  99  ? 5.353    -13.783  391.342 1.00 36.03  ? 99  GLY 1 C     1 
ATOM   774   O  O     . GLY A  1  99  ? 4.825    -13.085  392.218 1.00 31.75  ? 99  GLY 1 O     1 
ATOM   775   N  N     . SER A  1  100 ? 4.946    -15.025  391.059 1.00 41.77  ? 100 SER 1 N     1 
ATOM   776   C  CA    . SER A  1  100 ? 3.854    -15.723  391.739 1.00 40.38  ? 100 SER 1 CA    1 
ATOM   777   C  C     . SER A  1  100 ? 4.426    -16.986  392.377 1.00 33.80  ? 100 SER 1 C     1 
ATOM   778   O  O     . SER A  1  100 ? 4.887    -17.888  391.668 1.00 30.28  ? 100 SER 1 O     1 
ATOM   779   C  CB    . SER A  1  100 ? 2.729    -16.052  390.759 1.00 45.10  ? 100 SER 1 CB    1 
ATOM   780   O  OG    . SER A  1  100 ? 1.784    -16.941  391.323 1.00 51.57  ? 100 SER 1 OG    1 
ATOM   781   N  N     . PHE A  1  101 ? 4.439    -17.024  393.717 1.00 35.83  ? 101 PHE 1 N     1 
ATOM   782   C  CA    . PHE A  1  101 ? 4.973    -18.134  394.501 1.00 40.70  ? 101 PHE 1 CA    1 
ATOM   783   C  C     . PHE A  1  101 ? 4.046    -18.483  395.664 1.00 41.67  ? 101 PHE 1 C     1 
ATOM   784   O  O     . PHE A  1  101 ? 4.520    -18.847  396.751 1.00 38.08  ? 101 PHE 1 O     1 
ATOM   785   C  CB    . PHE A  1  101 ? 6.356    -17.804  395.071 1.00 48.73  ? 101 PHE 1 CB    1 
ATOM   786   C  CG    . PHE A  1  101 ? 6.485    -16.383  395.577 1.00 55.30  ? 101 PHE 1 CG    1 
ATOM   787   C  CD1   . PHE A  1  101 ? 6.096    -16.057  396.867 1.00 56.55  ? 101 PHE 1 CD1   1 
ATOM   788   C  CD2   . PHE A  1  101 ? 7.009    -15.379  394.777 1.00 57.62  ? 101 PHE 1 CD2   1 
ATOM   789   C  CE1   . PHE A  1  101 ? 6.203    -14.754  397.338 1.00 55.32  ? 101 PHE 1 CE1   1 
ATOM   790   C  CE2   . PHE A  1  101 ? 7.121    -14.073  395.254 1.00 57.14  ? 101 PHE 1 CE2   1 
ATOM   791   C  CZ    . PHE A  1  101 ? 6.717    -13.768  396.534 1.00 55.29  ? 101 PHE 1 CZ    1 
ATOM   792   N  N     . LYS A  1  102 ? 2.730    -18.367  395.464 1.00 41.97  ? 102 LYS 1 N     1 
ATOM   793   C  CA    . LYS A  1  102 ? 1.794    -18.386  396.585 1.00 39.88  ? 102 LYS 1 CA    1 
ATOM   794   C  C     . LYS A  1  102 ? 1.351    -19.796  396.985 1.00 40.85  ? 102 LYS 1 C     1 
ATOM   795   O  O     . LYS A  1  102 ? 1.285    -20.094  398.185 1.00 45.41  ? 102 LYS 1 O     1 
ATOM   796   C  CB    . LYS A  1  102 ? 0.571    -17.521  396.266 1.00 31.74  ? 102 LYS 1 CB    1 
ATOM   797   C  CG    . LYS A  1  102 ? -0.100   -17.871  394.967 1.00 28.48  ? 102 LYS 1 CG    1 
ATOM   798   C  CD    . LYS A  1  102 ? -1.546   -17.416  394.984 1.00 30.09  ? 102 LYS 1 CD    1 
ATOM   799   C  CE    . LYS A  1  102 ? -2.247   -17.748  393.675 1.00 28.72  ? 102 LYS 1 CE    1 
ATOM   800   N  NZ    . LYS A  1  102 ? -2.254   -19.214  393.372 1.00 23.88  ? 102 LYS 1 NZ    1 
ATOM   801   N  N     . ASP A  1  103 ? 1.042    -20.680  396.024 1.00 37.58  ? 103 ASP 1 N     1 
ATOM   802   C  CA    . ASP A  1  103 ? 0.515    -22.002  396.380 1.00 34.23  ? 103 ASP 1 CA    1 
ATOM   803   C  C     . ASP A  1  103 ? 1.571    -22.936  396.941 1.00 31.08  ? 103 ASP 1 C     1 
ATOM   804   O  O     . ASP A  1  103 ? 1.210    -23.954  397.541 1.00 32.60  ? 103 ASP 1 O     1 
ATOM   805   C  CB    . ASP A  1  103 ? -0.137   -22.682  395.167 1.00 37.55  ? 103 ASP 1 CB    1 
ATOM   806   C  CG    . ASP A  1  103 ? -1.282   -21.872  394.573 1.00 42.86  ? 103 ASP 1 CG    1 
ATOM   807   O  OD1   . ASP A  1  103 ? -1.854   -21.030  395.299 1.00 46.10  ? 103 ASP 1 OD1   1 
ATOM   808   O  OD2   . ASP A  1  103 ? -1.621   -22.064  393.386 1.00 43.84  ? 103 ASP 1 OD2   1 
ATOM   809   N  N     . ARG A  1  104 ? 2.849    -22.600  396.783 1.00 29.34  ? 104 ARG 1 N     1 
ATOM   810   C  CA    . ARG A  1  104 ? 3.928    -23.462  397.252 1.00 34.80  ? 104 ARG 1 CA    1 
ATOM   811   C  C     . ARG A  1  104 ? 3.750    -23.836  398.722 1.00 37.63  ? 104 ARG 1 C     1 
ATOM   812   O  O     . ARG A  1  104 ? 3.786    -25.016  399.094 1.00 40.26  ? 104 ARG 1 O     1 
ATOM   813   C  CB    . ARG A  1  104 ? 5.266    -22.753  397.035 1.00 39.74  ? 104 ARG 1 CB    1 
ATOM   814   C  CG    . ARG A  1  104 ? 6.481    -23.543  397.481 1.00 42.77  ? 104 ARG 1 CG    1 
ATOM   815   C  CD    . ARG A  1  104 ? 7.710    -23.102  396.685 1.00 44.87  ? 104 ARG 1 CD    1 
ATOM   816   N  NE    . ARG A  1  104 ? 8.592    -22.201  397.415 1.00 45.34  ? 104 ARG 1 NE    1 
ATOM   817   C  CZ    . ARG A  1  104 ? 9.722    -22.597  397.998 1.00 47.35  ? 104 ARG 1 CZ    1 
ATOM   818   N  NH1   . ARG A  1  104 ? 10.098   -23.875  397.926 1.00 48.10  ? 104 ARG 1 NH1   1 
ATOM   819   N  NH2   . ARG A  1  104 ? 10.486   -21.722  398.642 1.00 46.90  ? 104 ARG 1 NH2   1 
ATOM   820   N  N     . TYR A  1  105 ? 3.539    -22.845  399.575 1.00 38.45  ? 105 TYR 1 N     1 
ATOM   821   C  CA    . TYR A  1  105 ? 3.473    -23.131  401.001 1.00 41.64  ? 105 TYR 1 CA    1 
ATOM   822   C  C     . TYR A  1  105 ? 2.104    -23.614  401.439 1.00 39.79  ? 105 TYR 1 C     1 
ATOM   823   O  O     . TYR A  1  105 ? 2.013    -24.252  402.491 1.00 41.91  ? 105 TYR 1 O     1 
ATOM   824   C  CB    . TYR A  1  105 ? 3.919    -21.910  401.801 1.00 49.45  ? 105 TYR 1 CB    1 
ATOM   825   C  CG    . TYR A  1  105 ? 5.337    -21.547  401.435 1.00 52.17  ? 105 TYR 1 CG    1 
ATOM   826   C  CD1   . TYR A  1  105 ? 6.389    -22.395  401.751 1.00 49.77  ? 105 TYR 1 CD1   1 
ATOM   827   C  CD2   . TYR A  1  105 ? 5.615    -20.409  400.700 1.00 54.16  ? 105 TYR 1 CD2   1 
ATOM   828   C  CE1   . TYR A  1  105 ? 7.680    -22.095  401.386 1.00 49.52  ? 105 TYR 1 CE1   1 
ATOM   829   C  CE2   . TYR A  1  105 ? 6.903    -20.105  400.331 1.00 55.06  ? 105 TYR 1 CE2   1 
ATOM   830   C  CZ    . TYR A  1  105 ? 7.933    -20.953  400.671 1.00 51.82  ? 105 TYR 1 CZ    1 
ATOM   831   O  OH    . TYR A  1  105 ? 9.226    -20.646  400.310 1.00 52.08  ? 105 TYR 1 OH    1 
ATOM   832   N  N     . ILE A  1  106 ? 1.046    -23.306  400.680 1.00 35.88  ? 106 ILE 1 N     1 
ATOM   833   C  CA    . ILE A  1  106 ? -0.226   -24.010  400.862 1.00 36.97  ? 106 ILE 1 CA    1 
ATOM   834   C  C     . ILE A  1  106 ? -0.018   -25.514  400.717 1.00 26.79  ? 106 ILE 1 C     1 
ATOM   835   O  O     . ILE A  1  106 ? -0.509   -26.315  401.526 1.00 23.06  ? 106 ILE 1 O     1 
ATOM   836   C  CB    . ILE A  1  106 ? -1.285   -23.488  399.868 1.00 33.17  ? 106 ILE 1 CB    1 
ATOM   837   C  CG1   . ILE A  1  106 ? -1.745   -22.074  400.244 1.00 41.46  ? 106 ILE 1 CG1   1 
ATOM   838   C  CG2   . ILE A  1  106 ? -2.474   -24.424  399.805 1.00 26.75  ? 106 ILE 1 CG2   1 
ATOM   839   C  CD1   . ILE A  1  106 ? -2.918   -21.581  399.405 1.00 42.95  ? 106 ILE 1 CD1   1 
ATOM   840   N  N     . LEU A  1  107 ? 0.764    -25.913  399.714 1.00 30.81  ? 107 LEU 1 N     1 
ATOM   841   C  CA    . LEU A  1  107 ? 1.083    -27.326  399.551 1.00 25.01  ? 107 LEU 1 CA    1 
ATOM   842   C  C     . LEU A  1  107 ? 1.968    -27.814  400.690 1.00 35.87  ? 107 LEU 1 C     1 
ATOM   843   O  O     . LEU A  1  107 ? 1.732    -28.887  401.248 1.00 39.21  ? 107 LEU 1 O     1 
ATOM   844   C  CB    . LEU A  1  107 ? 1.785    -27.558  398.208 1.00 23.28  ? 107 LEU 1 CB    1 
ATOM   845   C  CG    . LEU A  1  107 ? 1.042    -27.124  396.939 1.00 23.22  ? 107 LEU 1 CG    1 
ATOM   846   C  CD1   . LEU A  1  107 ? 1.721    -27.634  395.660 1.00 23.28  ? 107 LEU 1 CD1   1 
ATOM   847   C  CD2   . LEU A  1  107 ? -0.421   -27.528  396.991 1.00 22.97  ? 107 LEU 1 CD2   1 
ATOM   848   N  N     . GLU A  1  108 ? 2.959    -27.018  401.087 1.00 37.88  ? 108 GLU 1 N     1 
ATOM   849   C  CA    . GLU A  1  108 ? 3.962    -27.524  402.023 1.00 43.60  ? 108 GLU 1 CA    1 
ATOM   850   C  C     . GLU A  1  108 ? 3.417    -27.674  403.439 1.00 46.32  ? 108 GLU 1 C     1 
ATOM   851   O  O     . GLU A  1  108 ? 3.822    -28.594  404.160 1.00 50.17  ? 108 GLU 1 O     1 
ATOM   852   C  CB    . GLU A  1  108 ? 5.195    -26.628  402.045 1.00 43.97  ? 108 GLU 1 CB    1 
ATOM   853   C  CG    . GLU A  1  108 ? 6.029    -26.693  400.795 1.00 43.56  ? 108 GLU 1 CG    1 
ATOM   854   C  CD    . GLU A  1  108 ? 7.392    -26.078  401.001 1.00 41.01  ? 108 GLU 1 CD    1 
ATOM   855   O  OE1   . GLU A  1  108 ? 7.718    -25.712  402.152 1.00 37.12  ? 108 GLU 1 OE1   1 
ATOM   856   O  OE2   . GLU A  1  108 ? 8.142    -25.972  400.010 1.00 40.83  ? 108 GLU 1 OE2   1 
ATOM   857   N  N     . ASP A  1  109 ? 2.555    -26.752  403.888 1.00 43.94  ? 109 ASP 1 N     1 
ATOM   858   C  CA    . ASP A  1  109 ? 2.184    -26.685  405.299 1.00 42.24  ? 109 ASP 1 CA    1 
ATOM   859   C  C     . ASP A  1  109 ? 0.708    -26.881  405.603 1.00 30.60  ? 109 ASP 1 C     1 
ATOM   860   O  O     . ASP A  1  109 ? 0.375    -27.074  406.774 1.00 30.97  ? 109 ASP 1 O     1 
ATOM   861   C  CB    . ASP A  1  109 ? 2.615    -25.343  405.907 1.00 48.87  ? 109 ASP 1 CB    1 
ATOM   862   C  CG    . ASP A  1  109 ? 4.021    -24.956  405.513 1.00 50.91  ? 109 ASP 1 CG    1 
ATOM   863   O  OD1   . ASP A  1  109 ? 4.891    -25.857  405.418 1.00 49.54  ? 109 ASP 1 OD1   1 
ATOM   864   O  OD2   . ASP A  1  109 ? 4.241    -23.749  405.269 1.00 47.69  ? 109 ASP 1 OD2   1 
ATOM   865   N  N     . VAL A  1  110 ? -0.183   -26.769  404.621 1.00 32.23  ? 110 VAL 1 N     1 
ATOM   866   C  CA    . VAL A  1  110 ? -1.604   -26.995  404.886 1.00 27.45  ? 110 VAL 1 CA    1 
ATOM   867   C  C     . VAL A  1  110 ? -2.214   -27.863  403.788 1.00 35.43  ? 110 VAL 1 C     1 
ATOM   868   O  O     . VAL A  1  110 ? -3.070   -27.384  403.025 1.00 40.14  ? 110 VAL 1 O     1 
ATOM   869   C  CB    . VAL A  1  110 ? -2.373   -25.672  405.027 1.00 22.90  ? 110 VAL 1 CB    1 
ATOM   870   C  CG1   . VAL A  1  110 ? -2.179   -25.099  406.404 1.00 23.04  ? 110 VAL 1 CG1   1 
ATOM   871   C  CG2   . VAL A  1  110 ? -1.940   -24.684  403.976 1.00 23.03  ? 110 VAL 1 CG2   1 
ATOM   872   N  N     . PRO A  1  111 ? -1.835   -29.162  403.686 1.00 35.02  ? 111 PRO 1 N     1 
ATOM   873   C  CA    . PRO A  1  111 ? -2.350   -29.992  402.592 1.00 34.28  ? 111 PRO 1 CA    1 
ATOM   874   C  C     . PRO A  1  111 ? -3.791   -30.409  402.831 1.00 41.44  ? 111 PRO 1 C     1 
ATOM   875   O  O     . PRO A  1  111 ? -4.609   -30.413  401.904 1.00 43.23  ? 111 PRO 1 O     1 
ATOM   876   C  CB    . PRO A  1  111 ? -1.412   -31.206  402.602 1.00 32.14  ? 111 PRO 1 CB    1 
ATOM   877   C  CG    . PRO A  1  111 ? -0.248   -30.830  403.513 1.00 31.22  ? 111 PRO 1 CG    1 
ATOM   878   C  CD    . PRO A  1  111 ? -0.862   -29.902  404.510 1.00 32.34  ? 111 PRO 1 CD    1 
ATOM   879   N  N     . HIS A  1  112 ? -4.115   -30.758  404.085 1.00 47.71  ? 112 HIS 1 N     1 
ATOM   880   C  CA    . HIS A  1  112 ? -5.442   -31.293  404.394 1.00 53.33  ? 112 HIS 1 CA    1 
ATOM   881   C  C     . HIS A  1  112 ? -6.544   -30.267  404.140 1.00 56.23  ? 112 HIS 1 C     1 
ATOM   882   O  O     . HIS A  1  112 ? -7.674   -30.644  403.812 1.00 54.94  ? 112 HIS 1 O     1 
ATOM   883   C  CB    . HIS A  1  112 ? -5.478   -31.795  405.840 1.00 59.68  ? 112 HIS 1 CB    1 
ATOM   884   C  CG    . HIS A  1  112 ? -4.607   -32.996  406.085 1.00 65.11  ? 112 HIS 1 CG    1 
ATOM   885   N  ND1   . HIS A  1  112 ? -4.885   -34.241  405.556 1.00 66.62  ? 112 HIS 1 ND1   1 
ATOM   886   C  CD2   . HIS A  1  112 ? -3.468   -33.143  406.807 1.00 68.15  ? 112 HIS 1 CD2   1 
ATOM   887   C  CE1   . HIS A  1  112 ? -3.956   -35.100  405.936 1.00 66.14  ? 112 HIS 1 CE1   1 
ATOM   888   N  NE2   . HIS A  1  112 ? -3.084   -34.460  406.696 1.00 68.07  ? 112 HIS 1 NE2   1 
ATOM   889   N  N     . LEU A  1  113 ? -6.227   -28.972  404.246 1.00 56.96  ? 113 LEU 1 N     1 
ATOM   890   C  CA    . LEU A  1  113 ? -7.144   -27.925  403.797 1.00 55.78  ? 113 LEU 1 CA    1 
ATOM   891   C  C     . LEU A  1  113 ? -7.511   -28.117  402.333 1.00 61.09  ? 113 LEU 1 C     1 
ATOM   892   O  O     . LEU A  1  113 ? -8.693   -28.126  401.960 1.00 61.97  ? 113 LEU 1 O     1 
ATOM   893   C  CB    . LEU A  1  113 ? -6.488   -26.558  403.992 1.00 51.27  ? 113 LEU 1 CB    1 
ATOM   894   C  CG    . LEU A  1  113 ? -7.139   -25.392  403.243 1.00 50.77  ? 113 LEU 1 CG    1 
ATOM   895   C  CD1   . LEU A  1  113 ? -8.454   -24.997  403.861 1.00 51.90  ? 113 LEU 1 CD1   1 
ATOM   896   C  CD2   . LEU A  1  113 ? -6.206   -24.199  403.160 1.00 51.41  ? 113 LEU 1 CD2   1 
ATOM   897   N  N     . LEU A  1  114 ? -6.490   -28.268  401.489 1.00 63.43  ? 114 LEU 1 N     1 
ATOM   898   C  CA    . LEU A  1  114 ? -6.696   -28.478  400.060 1.00 62.75  ? 114 LEU 1 CA    1 
ATOM   899   C  C     . LEU A  1  114 ? -7.469   -29.769  399.792 1.00 54.16  ? 114 LEU 1 C     1 
ATOM   900   O  O     . LEU A  1  114 ? -8.334   -29.818  398.907 1.00 50.57  ? 114 LEU 1 O     1 
ATOM   901   C  CB    . LEU A  1  114 ? -5.329   -28.506  399.368 1.00 65.60  ? 114 LEU 1 CB    1 
ATOM   902   C  CG    . LEU A  1  114 ? -5.231   -28.763  397.867 1.00 67.91  ? 114 LEU 1 CG    1 
ATOM   903   C  CD1   . LEU A  1  114 ? -5.825   -27.587  397.108 1.00 67.71  ? 114 LEU 1 CD1   1 
ATOM   904   C  CD2   . LEU A  1  114 ? -3.786   -29.054  397.444 1.00 68.49  ? 114 LEU 1 CD2   1 
ATOM   905   N  N     . ILE A  1  115 ? -7.169   -30.826  400.551 1.00 47.98  ? 115 ILE 1 N     1 
ATOM   906   C  CA    . ILE A  1  115 ? -7.849   -32.103  400.358 1.00 46.80  ? 115 ILE 1 CA    1 
ATOM   907   C  C     . ILE A  1  115 ? -9.328   -31.989  400.738 1.00 46.82  ? 115 ILE 1 C     1 
ATOM   908   O  O     . ILE A  1  115 ? -10.195  -32.612  400.115 1.00 42.03  ? 115 ILE 1 O     1 
ATOM   909   C  CB    . ILE A  1  115 ? -7.119   -33.210  401.142 1.00 46.01  ? 115 ILE 1 CB    1 
ATOM   910   C  CG1   . ILE A  1  115 ? -5.741   -33.470  400.504 1.00 41.59  ? 115 ILE 1 CG1   1 
ATOM   911   C  CG2   . ILE A  1  115 ? -7.953   -34.496  401.153 1.00 50.34  ? 115 ILE 1 CG2   1 
ATOM   912   C  CD1   . ILE A  1  115 ? -4.786   -34.387  401.288 1.00 38.04  ? 115 ILE 1 CD1   1 
ATOM   913   N  N     . GLU A  1  116 ? -9.639   -31.194  401.769 1.00 51.74  ? 116 GLU 1 N     1 
ATOM   914   C  CA    . GLU A  1  116 ? -11.032  -30.908  402.122 1.00 52.55  ? 116 GLU 1 CA    1 
ATOM   915   C  C     . GLU A  1  116 ? -11.734  -30.097  401.031 1.00 48.12  ? 116 GLU 1 C     1 
ATOM   916   O  O     . GLU A  1  116 ? -12.903  -30.356  400.703 1.00 47.18  ? 116 GLU 1 O     1 
ATOM   917   C  CB    . GLU A  1  116 ? -11.094  -30.189  403.476 1.00 54.50  ? 116 GLU 1 CB    1 
ATOM   918   C  CG    . GLU A  1  116 ? -12.500  -30.078  404.055 1.00 52.47  ? 116 GLU 1 CG    1 
ATOM   919   C  CD    . GLU A  1  116 ? -12.492  -29.668  405.512 1.00 51.94  ? 116 GLU 1 CD    1 
ATOM   920   O  OE1   . GLU A  1  116 ? -11.389  -29.493  406.072 1.00 51.84  ? 116 GLU 1 OE1   1 
ATOM   921   O  OE2   . GLU A  1  116 ? -13.583  -29.528  406.101 1.00 51.10  ? 116 GLU 1 OE2   1 
ATOM   922   N  N     . GLY A  1  117 ? -11.047  -29.099  400.471 1.00 40.49  ? 117 GLY 1 N     1 
ATOM   923   C  CA    . GLY A  1  117 ? -11.636  -28.349  399.371 1.00 35.03  ? 117 GLY 1 CA    1 
ATOM   924   C  C     . GLY A  1  117 ? -11.940  -29.222  398.167 1.00 32.27  ? 117 GLY 1 C     1 
ATOM   925   O  O     . GLY A  1  117 ? -12.967  -29.045  397.500 1.00 27.82  ? 117 GLY 1 O     1 
ATOM   926   N  N     . MET A  1  118 ? -11.037  -30.172  397.867 1.00 33.59  ? 118 MET 1 N     1 
ATOM   927   C  CA    . MET A  1  118 ? -11.220  -31.135  396.771 1.00 34.85  ? 118 MET 1 CA    1 
ATOM   928   C  C     . MET A  1  118 ? -12.293  -32.179  397.079 1.00 29.47  ? 118 MET 1 C     1 
ATOM   929   O  O     . MET A  1  118 ? -12.924  -32.704  396.158 1.00 20.80  ? 118 MET 1 O     1 
ATOM   930   C  CB    . MET A  1  118 ? -9.907   -31.847  396.438 1.00 31.41  ? 118 MET 1 CB    1 
ATOM   931   C  CG    . MET A  1  118 ? -8.805   -30.936  395.919 1.00 27.26  ? 118 MET 1 CG    1 
ATOM   932   S  SD    . MET A  1  118 ? -7.260   -31.798  395.556 1.00 21.63  ? 118 MET 1 SD    1 
ATOM   933   C  CE    . MET A  1  118 ? -7.724   -32.601  394.029 1.00 21.50  ? 118 MET 1 CE    1 
ATOM   934   N  N     . ILE A  1  119 ? -12.463  -32.543  398.351 1.00 33.10  ? 119 ILE 1 N     1 
ATOM   935   C  CA    . ILE A  1  119 ? -13.600  -33.370  398.743 1.00 37.80  ? 119 ILE 1 CA    1 
ATOM   936   C  C     . ILE A  1  119 ? -14.910  -32.646  398.448 1.00 40.31  ? 119 ILE 1 C     1 
ATOM   937   O  O     . ILE A  1  119 ? -15.866  -33.238  397.928 1.00 34.94  ? 119 ILE 1 O     1 
ATOM   938   C  CB    . ILE A  1  119 ? -13.491  -33.742  400.235 1.00 51.18  ? 119 ILE 1 CB    1 
ATOM   939   C  CG1   . ILE A  1  119 ? -12.321  -34.702  400.469 1.00 56.91  ? 119 ILE 1 CG1   1 
ATOM   940   C  CG2   . ILE A  1  119 ? -14.809  -34.344  400.730 1.00 50.34  ? 119 ILE 1 CG2   1 
ATOM   941   C  CD1   . ILE A  1  119 ? -12.057  -35.004  401.929 1.00 61.77  ? 119 ILE 1 CD1   1 
ATOM   942   N  N     . LEU A  1  120 ? -14.974  -31.351  398.794 1.00 42.88  ? 120 LEU 1 N     1 
ATOM   943   C  CA    . LEU A  1  120 ? -16.170  -30.539  398.536 1.00 51.21  ? 120 LEU 1 CA    1 
ATOM   944   C  C     . LEU A  1  120 ? -16.472  -30.429  397.043 1.00 54.27  ? 120 LEU 1 C     1 
ATOM   945   O  O     . LEU A  1  120 ? -17.618  -30.617  396.601 1.00 56.31  ? 120 LEU 1 O     1 
ATOM   946   C  CB    . LEU A  1  120 ? -16.004  -29.155  399.171 1.00 52.99  ? 120 LEU 1 CB    1 
ATOM   947   C  CG    . LEU A  1  120 ? -15.847  -29.253  400.698 1.00 59.23  ? 120 LEU 1 CG    1 
ATOM   948   C  CD1   . LEU A  1  120 ? -15.380  -27.958  401.379 1.00 57.61  ? 120 LEU 1 CD1   1 
ATOM   949   C  CD2   . LEU A  1  120 ? -17.148  -29.789  401.333 1.00 60.77  ? 120 LEU 1 CD2   1 
ATOM   950   N  N     . ALA A  1  121 ? -15.452  -30.099  396.251 1.00 54.95  ? 121 ALA 1 N     1 
ATOM   951   C  CA    . ALA A  1  121 ? -15.639  -30.021  394.808 1.00 47.08  ? 121 ALA 1 CA    1 
ATOM   952   C  C     . ALA A  1  121 ? -16.011  -31.391  394.218 1.00 40.72  ? 121 ALA 1 C     1 
ATOM   953   O  O     . ALA A  1  121 ? -16.897  -31.481  393.355 1.00 45.78  ? 121 ALA 1 O     1 
ATOM   954   C  CB    . ALA A  1  121 ? -14.377  -29.445  394.162 1.00 42.90  ? 121 ALA 1 CB    1 
ATOM   955   N  N     . GLY A  1  122 ? -15.373  -32.473  394.685 1.00 26.79  ? 122 GLY 1 N     1 
ATOM   956   C  CA    . GLY A  1  122 ? -15.712  -33.788  394.178 1.00 20.35  ? 122 GLY 1 CA    1 
ATOM   957   C  C     . GLY A  1  122 ? -17.135  -34.199  394.499 1.00 24.29  ? 122 GLY 1 C     1 
ATOM   958   O  O     . GLY A  1  122 ? -17.821  -34.785  393.661 1.00 23.01  ? 122 GLY 1 O     1 
ATOM   959   N  N     . TYR A  1  123 ? -17.600  -33.907  395.717 1.00 22.24  ? 123 TYR 1 N     1 
ATOM   960   C  CA    . TYR A  1  123 ? -19.010  -34.123  396.030 1.00 26.19  ? 123 TYR 1 CA    1 
ATOM   961   C  C     . TYR A  1  123 ? -19.898  -33.313  395.095 1.00 34.21  ? 123 TYR 1 C     1 
ATOM   962   O  O     . TYR A  1  123 ? -20.953  -33.789  394.656 1.00 39.26  ? 123 TYR 1 O     1 
ATOM   963   C  CB    . TYR A  1  123 ? -19.302  -33.782  397.496 1.00 24.77  ? 123 TYR 1 CB    1 
ATOM   964   C  CG    . TYR A  1  123 ? -20.771  -33.944  397.877 1.00 20.98  ? 123 TYR 1 CG    1 
ATOM   965   C  CD1   . TYR A  1  123 ? -21.389  -35.177  397.827 1.00 19.69  ? 123 TYR 1 CD1   1 
ATOM   966   C  CD2   . TYR A  1  123 ? -21.540  -32.847  398.262 1.00 20.21  ? 123 TYR 1 CD2   1 
ATOM   967   C  CE1   . TYR A  1  123 ? -22.729  -35.320  398.155 1.00 21.69  ? 123 TYR 1 CE1   1 
ATOM   968   C  CE2   . TYR A  1  123 ? -22.881  -32.990  398.596 1.00 21.71  ? 123 TYR 1 CE2   1 
ATOM   969   C  CZ    . TYR A  1  123 ? -23.470  -34.233  398.541 1.00 19.40  ? 123 TYR 1 CZ    1 
ATOM   970   O  OH    . TYR A  1  123 ? -24.803  -34.426  398.862 1.00 19.24  ? 123 TYR 1 OH    1 
ATOM   971   N  N     . ALA A  1  124 ? -19.480  -32.087  394.771 1.00 29.41  ? 124 ALA 1 N     1 
ATOM   972   C  CA    . ALA A  1  124 ? -20.291  -31.238  393.905 1.00 29.58  ? 124 ALA 1 CA    1 
ATOM   973   C  C     . ALA A  1  124 ? -20.428  -31.821  392.502 1.00 30.38  ? 124 ALA 1 C     1 
ATOM   974   O  O     . ALA A  1  124 ? -21.523  -31.809  391.925 1.00 31.15  ? 124 ALA 1 O     1 
ATOM   975   C  CB    . ALA A  1  124 ? -19.678  -29.845  393.831 1.00 29.33  ? 124 ALA 1 CB    1 
ATOM   976   N  N     . ILE A  1  125 ? -19.326  -32.320  391.936 1.00 34.73  ? 125 ILE 1 N     1 
ATOM   977   C  CA    . ILE A  1  125 ? -19.253  -32.753  390.537 1.00 36.83  ? 125 ILE 1 CA    1 
ATOM   978   C  C     . ILE A  1  125 ? -19.133  -34.282  390.400 1.00 27.98  ? 125 ILE 1 C     1 
ATOM   979   O  O     . ILE A  1  125 ? -18.736  -34.788  389.344 1.00 19.87  ? 125 ILE 1 O     1 
ATOM   980   C  CB    . ILE A  1  125 ? -18.103  -32.039  389.803 1.00 34.29  ? 125 ILE 1 CB    1 
ATOM   981   C  CG1   . ILE A  1  125 ? -16.741  -32.542  390.313 1.00 39.62  ? 125 ILE 1 CG1   1 
ATOM   982   C  CG2   . ILE A  1  125 ? -18.248  -30.539  389.956 1.00 28.71  ? 125 ILE 1 CG2   1 
ATOM   983   C  CD1   . ILE A  1  125 ? -15.509  -31.884  389.678 1.00 39.06  ? 125 ILE 1 CD1   1 
ATOM   984   N  N     . ARG A  1  126 ? -19.463  -35.032  391.446 1.00 37.59  ? 126 ARG 1 N     1 
ATOM   985   C  CA    . ARG A  1  126 ? -19.448  -36.495  391.391 1.00 46.92  ? 126 ARG 1 CA    1 
ATOM   986   C  C     . ARG A  1  126 ? -18.078  -37.034  390.969 1.00 54.92  ? 126 ARG 1 C     1 
ATOM   987   O  O     . ARG A  1  126 ? -17.974  -38.015  390.220 1.00 54.15  ? 126 ARG 1 O     1 
ATOM   988   C  CB    . ARG A  1  126 ? -20.533  -37.029  390.451 1.00 51.84  ? 126 ARG 1 CB    1 
ATOM   989   C  CG    . ARG A  1  126 ? -21.959  -36.792  390.915 1.00 50.04  ? 126 ARG 1 CG    1 
ATOM   990   C  CD    . ARG A  1  126 ? -22.486  -35.456  390.410 1.00 46.26  ? 126 ARG 1 CD    1 
ATOM   991   N  NE    . ARG A  1  126 ? -23.935  -35.382  390.542 1.00 43.62  ? 126 ARG 1 NE    1 
ATOM   992   C  CZ    . ARG A  1  126 ? -24.617  -34.245  390.550 1.00 41.85  ? 126 ARG 1 CZ    1 
ATOM   993   N  NH1   . ARG A  1  126 ? -23.975  -33.094  390.424 1.00 40.77  ? 126 ARG 1 NH1   1 
ATOM   994   N  NH2   . ARG A  1  126 ? -25.939  -34.261  390.676 1.00 41.31  ? 126 ARG 1 NH2   1 
ATOM   995   N  N     . ALA A  1  127 ? -17.016  -36.419  391.478 1.00 48.54  ? 127 ALA 1 N     1 
ATOM   996   C  CA    . ALA A  1  127 ? -15.659  -36.880  391.212 1.00 40.72  ? 127 ALA 1 CA    1 
ATOM   997   C  C     . ALA A  1  127 ? -15.318  -37.970  392.226 1.00 30.20  ? 127 ALA 1 C     1 
ATOM   998   O  O     . ALA A  1  127 ? -15.187  -37.698  393.424 1.00 24.02  ? 127 ALA 1 O     1 
ATOM   999   C  CB    . ALA A  1  127 ? -14.677  -35.714  391.286 1.00 38.78  ? 127 ALA 1 CB    1 
ATOM   1000  N  N     . THR A  1  128 ? -15.213  -39.212  391.749 1.00 33.43  ? 128 THR 1 N     1 
ATOM   1001  C  CA    . THR A  1  128 ? -14.913  -40.337  392.625 1.00 35.01  ? 128 THR 1 CA    1 
ATOM   1002  C  C     . THR A  1  128 ? -13.415  -40.560  392.793 1.00 41.53  ? 128 THR 1 C     1 
ATOM   1003  O  O     . THR A  1  128 ? -12.994  -41.185  393.779 1.00 44.16  ? 128 THR 1 O     1 
ATOM   1004  C  CB    . THR A  1  128 ? -15.553  -41.617  392.083 1.00 31.23  ? 128 THR 1 CB    1 
ATOM   1005  O  OG1   . THR A  1  128 ? -14.666  -42.231  391.143 1.00 26.88  ? 128 THR 1 OG1   1 
ATOM   1006  C  CG2   . THR A  1  128 ? -16.844  -41.261  391.350 1.00 31.46  ? 128 THR 1 CG2   1 
ATOM   1007  N  N     . VAL A  1  129 ? -12.611  -40.055  391.856 1.00 38.68  ? 129 VAL 1 N     1 
ATOM   1008  C  CA    . VAL A  1  129 ? -11.157  -40.075  391.937 1.00 35.84  ? 129 VAL 1 CA    1 
ATOM   1009  C  C     . VAL A  1  129 ? -10.664  -38.725  391.436 1.00 36.88  ? 129 VAL 1 C     1 
ATOM   1010  O  O     . VAL A  1  129 ? -11.286  -38.099  390.569 1.00 33.83  ? 129 VAL 1 O     1 
ATOM   1011  C  CB    . VAL A  1  129 ? -10.520  -41.219  391.113 1.00 30.99  ? 129 VAL 1 CB    1 
ATOM   1012  C  CG1   . VAL A  1  129 ? -9.009   -41.222  391.286 1.00 29.01  ? 129 VAL 1 CG1   1 
ATOM   1013  C  CG2   . VAL A  1  129 ? -11.112  -42.574  391.498 1.00 32.50  ? 129 VAL 1 CG2   1 
ATOM   1014  N  N     . GLY A  1  130 ? -9.543   -38.280  391.992 1.00 41.18  ? 130 GLY 1 N     1 
ATOM   1015  C  CA    . GLY A  1  130 ? -8.968   -36.999  391.627 1.00 35.11  ? 130 GLY 1 CA    1 
ATOM   1016  C  C     . GLY A  1  130 ? -7.459   -37.084  391.540 1.00 28.36  ? 130 GLY 1 C     1 
ATOM   1017  O  O     . GLY A  1  130 ? -6.815   -37.890  392.220 1.00 31.64  ? 130 GLY 1 O     1 
ATOM   1018  N  N     . TYR A  1  131 ? -6.898   -36.226  390.690 1.00 30.55  ? 131 TYR 1 N     1 
ATOM   1019  C  CA    . TYR A  1  131 ? -5.463   -36.158  390.458 1.00 32.51  ? 131 TYR 1 CA    1 
ATOM   1020  C  C     . TYR A  1  131 ? -4.928   -34.774  390.804 1.00 31.08  ? 131 TYR 1 C     1 
ATOM   1021  O  O     . TYR A  1  131 ? -5.622   -33.761  390.660 1.00 23.47  ? 131 TYR 1 O     1 
ATOM   1022  C  CB    . TYR A  1  131 ? -5.113   -36.492  389.001 1.00 31.99  ? 131 TYR 1 CB    1 
ATOM   1023  C  CG    . TYR A  1  131 ? -5.125   -37.972  388.687 1.00 27.76  ? 131 TYR 1 CG    1 
ATOM   1024  C  CD1   . TYR A  1  131 ? -6.306   -38.633  388.403 1.00 27.03  ? 131 TYR 1 CD1   1 
ATOM   1025  C  CD2   . TYR A  1  131 ? -3.951   -38.703  388.661 1.00 27.56  ? 131 TYR 1 CD2   1 
ATOM   1026  C  CE1   . TYR A  1  131 ? -6.316   -39.976  388.110 1.00 25.24  ? 131 TYR 1 CE1   1 
ATOM   1027  C  CE2   . TYR A  1  131 ? -3.954   -40.048  388.368 1.00 25.57  ? 131 TYR 1 CE2   1 
ATOM   1028  C  CZ    . TYR A  1  131 ? -5.139   -40.677  388.094 1.00 28.01  ? 131 TYR 1 CZ    1 
ATOM   1029  O  OH    . TYR A  1  131 ? -5.155   -42.018  387.798 1.00 32.12  ? 131 TYR 1 OH    1 
ATOM   1030  N  N     . ILE A  1  132 ? -3.687   -34.757  391.285 1.00 36.92  ? 132 ILE 1 N     1 
ATOM   1031  C  CA    . ILE A  1  132 ? -2.960   -33.545  391.641 1.00 37.38  ? 132 ILE 1 CA    1 
ATOM   1032  C  C     . ILE A  1  132 ? -1.681   -33.540  390.820 1.00 35.90  ? 132 ILE 1 C     1 
ATOM   1033  O  O     . ILE A  1  132 ? -0.797   -34.382  391.029 1.00 38.88  ? 132 ILE 1 O     1 
ATOM   1034  C  CB    . ILE A  1  132 ? -2.636   -33.495  393.137 1.00 38.46  ? 132 ILE 1 CB    1 
ATOM   1035  C  CG1   . ILE A  1  132 ? -3.912   -33.702  393.960 1.00 41.86  ? 132 ILE 1 CG1   1 
ATOM   1036  C  CG2   . ILE A  1  132 ? -1.945   -32.190  393.474 1.00 40.92  ? 132 ILE 1 CG2   1 
ATOM   1037  C  CD1   . ILE A  1  132 ? -3.734   -33.539  395.460 1.00 44.54  ? 132 ILE 1 CD1   1 
ATOM   1038  N  N     . TYR A  1  133 ? -1.549   -32.580  389.930 1.00 35.08  ? 133 TYR 1 N     1 
ATOM   1039  C  CA    . TYR A  1  133 ? -0.380   -32.505  389.067 1.00 40.39  ? 133 TYR 1 CA    1 
ATOM   1040  C  C     . TYR A  1  133 ? 0.526    -31.403  389.599 1.00 47.72  ? 133 TYR 1 C     1 
ATOM   1041  O  O     . TYR A  1  133 ? 0.262    -30.212  389.404 1.00 49.44  ? 133 TYR 1 O     1 
ATOM   1042  C  CB    . TYR A  1  133 ? -0.808   -32.269  387.622 1.00 41.05  ? 133 TYR 1 CB    1 
ATOM   1043  C  CG    . TYR A  1  133 ? 0.341    -32.219  386.648 1.00 43.52  ? 133 TYR 1 CG    1 
ATOM   1044  C  CD1   . TYR A  1  133 ? 1.010    -31.029  386.396 1.00 46.83  ? 133 TYR 1 CD1   1 
ATOM   1045  C  CD2   . TYR A  1  133 ? 0.788    -33.362  386.011 1.00 40.83  ? 133 TYR 1 CD2   1 
ATOM   1046  C  CE1   . TYR A  1  133 ? 2.069    -30.976  385.515 1.00 45.49  ? 133 TYR 1 CE1   1 
ATOM   1047  C  CE2   . TYR A  1  133 ? 1.853    -33.316  385.130 1.00 41.39  ? 133 TYR 1 CE2   1 
ATOM   1048  C  CZ    . TYR A  1  133 ? 2.487    -32.125  384.887 1.00 44.45  ? 133 TYR 1 CZ    1 
ATOM   1049  O  OH    . TYR A  1  133 ? 3.544    -32.097  384.012 1.00 47.69  ? 133 TYR 1 OH    1 
ATOM   1050  N  N     . VAL A  1  134 ? 1.614    -31.805  390.265 1.00 52.20  ? 134 VAL 1 N     1 
ATOM   1051  C  CA    . VAL A  1  134 ? 2.580    -30.852  390.798 1.00 58.24  ? 134 VAL 1 CA    1 
ATOM   1052  C  C     . VAL A  1  134 ? 3.803    -30.833  389.893 1.00 53.15  ? 134 VAL 1 C     1 
ATOM   1053  O  O     . VAL A  1  134 ? 4.176    -31.842  389.275 1.00 49.72  ? 134 VAL 1 O     1 
ATOM   1054  C  CB    . VAL A  1  134 ? 2.972    -31.182  392.258 1.00 64.70  ? 134 VAL 1 CB    1 
ATOM   1055  C  CG1   . VAL A  1  134 ? 1.732    -31.479  393.110 1.00 66.62  ? 134 VAL 1 CG1   1 
ATOM   1056  C  CG2   . VAL A  1  134 ? 3.972    -32.340  392.317 1.00 68.20  ? 134 VAL 1 CG2   1 
ATOM   1057  N  N     . ARG A  1  135 ? 4.444    -29.668  389.829 1.00 52.27  ? 135 ARG 1 N     1 
ATOM   1058  C  CA    . ARG A  1  135 ? 5.622    -29.496  388.993 1.00 46.02  ? 135 ARG 1 CA    1 
ATOM   1059  C  C     . ARG A  1  135 ? 6.829    -30.198  389.611 1.00 51.66  ? 135 ARG 1 C     1 
ATOM   1060  O  O     . ARG A  1  135 ? 6.912    -30.386  390.829 1.00 53.33  ? 135 ARG 1 O     1 
ATOM   1061  C  CB    . ARG A  1  135 ? 5.921    -28.011  388.819 1.00 37.21  ? 135 ARG 1 CB    1 
ATOM   1062  C  CG    . ARG A  1  135 ? 6.030    -27.265  390.134 1.00 33.29  ? 135 ARG 1 CG    1 
ATOM   1063  C  CD    . ARG A  1  135 ? 6.411    -25.829  389.871 1.00 39.29  ? 135 ARG 1 CD    1 
ATOM   1064  N  NE    . ARG A  1  135 ? 7.730    -25.718  389.253 1.00 43.99  ? 135 ARG 1 NE    1 
ATOM   1065  C  CZ    . ARG A  1  135 ? 8.297    -24.568  388.886 1.00 44.26  ? 135 ARG 1 CZ    1 
ATOM   1066  N  NH1   . ARG A  1  135 ? 7.661    -23.415  389.063 1.00 43.34  ? 135 ARG 1 NH1   1 
ATOM   1067  N  NH2   . ARG A  1  135 ? 9.499    -24.570  388.328 1.00 43.55  ? 135 ARG 1 NH2   1 
ATOM   1068  N  N     . GLY A  1  136 ? 7.775    -30.586  388.751 1.00 47.31  ? 136 GLY 1 N     1 
ATOM   1069  C  CA    . GLY A  1  136 ? 8.963    -31.300  389.172 1.00 40.39  ? 136 GLY 1 CA    1 
ATOM   1070  C  C     . GLY A  1  136 ? 10.024   -30.483  389.871 1.00 34.82  ? 136 GLY 1 C     1 
ATOM   1071  O  O     . GLY A  1  136 ? 11.102   -31.010  390.152 1.00 29.70  ? 136 GLY 1 O     1 
ATOM   1072  N  N     . GLU A  1  137 ? 9.758    -29.204  390.139 1.00 42.08  ? 137 GLU 1 N     1 
ATOM   1073  C  CA    . GLU A  1  137 ? 10.652   -28.339  390.899 1.00 54.09  ? 137 GLU 1 CA    1 
ATOM   1074  C  C     . GLU A  1  137 ? 10.256   -28.217  392.367 1.00 56.70  ? 137 GLU 1 C     1 
ATOM   1075  O  O     . GLU A  1  137 ? 10.946   -27.517  393.125 1.00 56.77  ? 137 GLU 1 O     1 
ATOM   1076  C  CB    . GLU A  1  137 ? 10.703   -26.940  390.271 1.00 58.87  ? 137 GLU 1 CB    1 
ATOM   1077  C  CG    . GLU A  1  137 ? 11.696   -26.804  389.132 1.00 60.85  ? 137 GLU 1 CG    1 
ATOM   1078  C  CD    . GLU A  1  137 ? 11.167   -27.388  387.841 1.00 64.38  ? 137 GLU 1 CD    1 
ATOM   1079  O  OE1   . GLU A  1  137 ? 9.931    -27.419  387.677 1.00 65.93  ? 137 GLU 1 OE1   1 
ATOM   1080  O  OE2   . GLU A  1  137 ? 11.974   -27.833  387.001 1.00 66.34  ? 137 GLU 1 OE2   1 
ATOM   1081  N  N     . TYR A  1  138 ? 9.146    -28.841  392.768 1.00 52.27  ? 138 TYR 1 N     1 
ATOM   1082  C  CA    . TYR A  1  138 ? 8.653    -28.829  394.148 1.00 42.79  ? 138 TYR 1 CA    1 
ATOM   1083  C  C     . TYR A  1  138 ? 8.830    -30.229  394.716 1.00 45.97  ? 138 TYR 1 C     1 
ATOM   1084  O  O     . TYR A  1  138 ? 7.998    -31.110  394.475 1.00 50.32  ? 138 TYR 1 O     1 
ATOM   1085  C  CB    . TYR A  1  138 ? 7.195    -28.391  394.207 1.00 31.34  ? 138 TYR 1 CB    1 
ATOM   1086  C  CG    . TYR A  1  138 ? 7.012    -26.911  394.024 1.00 25.85  ? 138 TYR 1 CG    1 
ATOM   1087  C  CD1   . TYR A  1  138 ? 8.085    -26.105  393.704 1.00 26.11  ? 138 TYR 1 CD1   1 
ATOM   1088  C  CD2   . TYR A  1  138 ? 5.773    -26.320  394.165 1.00 24.03  ? 138 TYR 1 CD2   1 
ATOM   1089  C  CE1   . TYR A  1  138 ? 7.939    -24.747  393.534 1.00 32.03  ? 138 TYR 1 CE1   1 
ATOM   1090  C  CE2   . TYR A  1  138 ? 5.611    -24.957  393.998 1.00 26.70  ? 138 TYR 1 CE2   1 
ATOM   1091  C  CZ    . TYR A  1  138 ? 6.706    -24.168  393.678 1.00 32.73  ? 138 TYR 1 CZ    1 
ATOM   1092  O  OH    . TYR A  1  138 ? 6.595    -22.797  393.505 1.00 36.58  ? 138 TYR 1 OH    1 
ATOM   1093  N  N     . ARG A  1  139 ? 9.900    -30.429  395.487 1.00 42.52  ? 139 ARG 1 N     1 
ATOM   1094  C  CA    . ARG A  1  139 ? 10.080   -31.739  396.088 1.00 43.22  ? 139 ARG 1 CA    1 
ATOM   1095  C  C     . ARG A  1  139 ? 9.523    -31.814  397.501 1.00 38.95  ? 139 ARG 1 C     1 
ATOM   1096  O  O     . ARG A  1  139 ? 8.825    -32.775  397.835 1.00 41.72  ? 139 ARG 1 O     1 
ATOM   1097  C  CB    . ARG A  1  139 ? 11.564   -32.122  396.104 1.00 49.55  ? 139 ARG 1 CB    1 
ATOM   1098  C  CG    . ARG A  1  139 ? 11.765   -33.561  396.586 1.00 56.06  ? 139 ARG 1 CG    1 
ATOM   1099  C  CD    . ARG A  1  139 ? 13.215   -33.995  396.734 1.00 56.53  ? 139 ARG 1 CD    1 
ATOM   1100  N  NE    . ARG A  1  139 ? 13.289   -35.401  397.122 1.00 55.53  ? 139 ARG 1 NE    1 
ATOM   1101  C  CZ    . ARG A  1  139 ? 13.135   -35.832  398.370 1.00 57.08  ? 139 ARG 1 CZ    1 
ATOM   1102  N  NH1   . ARG A  1  139 ? 12.897   -34.964  399.345 1.00 57.19  ? 139 ARG 1 NH1   1 
ATOM   1103  N  NH2   . ARG A  1  139 ? 13.219   -37.128  398.646 1.00 58.61  ? 139 ARG 1 NH2   1 
ATOM   1104  N  N     . ARG A  1  140 ? 9.771    -30.805  398.328 1.00 35.72  ? 140 ARG 1 N     1 
ATOM   1105  C  CA    . ARG A  1  140 ? 9.282    -30.861  399.700 1.00 40.18  ? 140 ARG 1 CA    1 
ATOM   1106  C  C     . ARG A  1  140 ? 7.762    -30.861  399.733 1.00 42.50  ? 140 ARG 1 C     1 
ATOM   1107  O  O     . ARG A  1  140 ? 7.149    -31.604  400.510 1.00 45.73  ? 140 ARG 1 O     1 
ATOM   1108  C  CB    . ARG A  1  140 ? 9.834    -29.690  400.507 1.00 45.28  ? 140 ARG 1 CB    1 
ATOM   1109  C  CG    . ARG A  1  140 ? 9.313    -29.599  401.929 1.00 51.45  ? 140 ARG 1 CG    1 
ATOM   1110  C  CD    . ARG A  1  140 ? 10.362   -28.919  402.805 1.00 57.98  ? 140 ARG 1 CD    1 
ATOM   1111  N  NE    . ARG A  1  140 ? 11.515   -29.773  403.081 1.00 62.03  ? 140 ARG 1 NE    1 
ATOM   1112  C  CZ    . ARG A  1  140 ? 12.676   -29.329  403.562 1.00 62.27  ? 140 ARG 1 CZ    1 
ATOM   1113  N  NH1   . ARG A  1  140 ? 12.849   -28.035  403.811 1.00 60.20  ? 140 ARG 1 NH1   1 
ATOM   1114  N  NH2   . ARG A  1  140 ? 13.674   -30.177  403.783 1.00 62.79  ? 140 ARG 1 NH2   1 
ATOM   1115  N  N     . ALA A  1  141 ? 7.137    -30.007  398.916 1.00 40.85  ? 141 ALA 1 N     1 
ATOM   1116  C  CA    . ALA A  1  141 ? 5.679    -29.969  398.851 1.00 38.46  ? 141 ALA 1 CA    1 
ATOM   1117  C  C     . ALA A  1  141 ? 5.116    -31.299  398.355 1.00 33.88  ? 141 ALA 1 C     1 
ATOM   1118  O  O     . ALA A  1  141 ? 4.086    -31.770  398.849 1.00 33.55  ? 141 ALA 1 O     1 
ATOM   1119  C  CB    . ALA A  1  141 ? 5.225    -28.809  397.962 1.00 36.00  ? 141 ALA 1 CB    1 
ATOM   1120  N  N     . ALA A  1  142 ? 5.797    -31.939  397.407 1.00 32.40  ? 142 ALA 1 N     1 
ATOM   1121  C  CA    . ALA A  1  142 ? 5.341    -33.243  396.939 1.00 34.89  ? 142 ALA 1 CA    1 
ATOM   1122  C  C     . ALA A  1  142 ? 5.450    -34.293  398.042 1.00 39.83  ? 142 ALA 1 C     1 
ATOM   1123  O  O     . ALA A  1  142 ? 4.559    -35.140  398.196 1.00 41.41  ? 142 ALA 1 O     1 
ATOM   1124  C  CB    . ALA A  1  142 ? 6.149    -33.673  395.711 1.00 36.46  ? 142 ALA 1 CB    1 
ATOM   1125  N  N     . ASP A  1  143 ? 6.541    -34.266  398.811 1.00 40.43  ? 143 ASP 1 N     1 
ATOM   1126  C  CA    . ASP A  1  143 ? 6.696    -35.233  399.891 1.00 44.67  ? 143 ASP 1 CA    1 
ATOM   1127  C  C     . ASP A  1  143 ? 5.638    -35.032  400.971 1.00 46.58  ? 143 ASP 1 C     1 
ATOM   1128  O  O     . ASP A  1  143 ? 5.025    -36.003  401.437 1.00 51.87  ? 143 ASP 1 O     1 
ATOM   1129  C  CB    . ASP A  1  143 ? 8.108    -35.151  400.478 1.00 45.24  ? 143 ASP 1 CB    1 
ATOM   1130  C  CG    . ASP A  1  143 ? 9.180    -35.674  399.515 1.00 48.45  ? 143 ASP 1 CG    1 
ATOM   1131  O  OD1   . ASP A  1  143 ? 8.837    -36.425  398.571 1.00 49.60  ? 143 ASP 1 OD1   1 
ATOM   1132  O  OD2   . ASP A  1  143 ? 10.373   -35.371  399.723 1.00 48.44  ? 143 ASP 1 OD2   1 
ATOM   1133  N  N     . ARG A  1  144 ? 5.384    -33.783  401.362 1.00 45.89  ? 144 ARG 1 N     1 
ATOM   1134  C  CA    . ARG A  1  144 ? 4.340    -33.522  402.351 1.00 49.23  ? 144 ARG 1 CA    1 
ATOM   1135  C  C     . ARG A  1  144 ? 2.947    -33.840  401.811 1.00 52.07  ? 144 ARG 1 C     1 
ATOM   1136  O  O     . ARG A  1  144 ? 2.066    -34.253  402.574 1.00 54.56  ? 144 ARG 1 O     1 
ATOM   1137  C  CB    . ARG A  1  144 ? 4.440    -32.083  402.852 1.00 54.52  ? 144 ARG 1 CB    1 
ATOM   1138  C  CG    . ARG A  1  144 ? 5.807    -31.824  403.473 1.00 57.52  ? 144 ARG 1 CG    1 
ATOM   1139  C  CD    . ARG A  1  144 ? 5.784    -32.063  404.976 1.00 56.22  ? 144 ARG 1 CD    1 
ATOM   1140  N  NE    . ARG A  1  144 ? 6.833    -31.330  405.671 1.00 53.13  ? 144 ARG 1 NE    1 
ATOM   1141  C  CZ    . ARG A  1  144 ? 7.987    -31.870  406.051 1.00 49.00  ? 144 ARG 1 CZ    1 
ATOM   1142  N  NH1   . ARG A  1  144 ? 8.230    -33.150  405.803 1.00 51.40  ? 144 ARG 1 NH1   1 
ATOM   1143  N  NH2   . ARG A  1  144 ? 8.891    -31.141  406.684 1.00 46.11  ? 144 ARG 1 NH2   1 
ATOM   1144  N  N     . LEU A  1  145 ? 2.729    -33.664  400.506 1.00 45.12  ? 145 LEU 1 N     1 
ATOM   1145  C  CA    . LEU A  1  145 ? 1.446    -34.018  399.908 1.00 37.39  ? 145 LEU 1 CA    1 
ATOM   1146  C  C     . LEU A  1  145 ? 1.220    -35.533  399.935 1.00 29.47  ? 145 LEU 1 C     1 
ATOM   1147  O  O     . LEU A  1  145 ? 0.124    -35.999  400.262 1.00 28.08  ? 145 LEU 1 O     1 
ATOM   1148  C  CB    . LEU A  1  145 ? 1.379    -33.482  398.480 1.00 32.50  ? 145 LEU 1 CB    1 
ATOM   1149  C  CG    . LEU A  1  145 ? 0.879    -32.049  398.309 1.00 26.27  ? 145 LEU 1 CG    1 
ATOM   1150  C  CD1   . LEU A  1  145 ? 0.786    -31.734  396.821 1.00 24.65  ? 145 LEU 1 CD1   1 
ATOM   1151  C  CD2   . LEU A  1  145 ? -0.435   -31.826  399.021 1.00 28.44  ? 145 LEU 1 CD2   1 
ATOM   1152  N  N     . GLU A  1  146 ? 2.237    -36.315  399.548 1.00 28.42  ? 146 GLU 1 N     1 
ATOM   1153  C  CA    . GLU A  1  146 ? 2.149    -37.770  399.678 1.00 30.60  ? 146 GLU 1 CA    1 
ATOM   1154  C  C     . GLU A  1  146 ? 1.931    -38.186  401.126 1.00 37.77  ? 146 GLU 1 C     1 
ATOM   1155  O  O     . GLU A  1  146 ? 1.190    -39.142  401.404 1.00 39.49  ? 146 GLU 1 O     1 
ATOM   1156  C  CB    . GLU A  1  146 ? 3.410    -38.438  399.132 1.00 29.29  ? 146 GLU 1 CB    1 
ATOM   1157  C  CG    . GLU A  1  146 ? 3.238    -39.923  398.828 1.00 28.09  ? 146 GLU 1 CG    1 
ATOM   1158  C  CD    . GLU A  1  146 ? 2.696    -40.187  397.445 1.00 29.26  ? 146 GLU 1 CD    1 
ATOM   1159  O  OE1   . GLU A  1  146 ? 1.522    -40.607  397.331 1.00 28.42  ? 146 GLU 1 OE1   1 
ATOM   1160  O  OE2   . GLU A  1  146 ? 3.436    -39.954  396.470 1.00 29.19  ? 146 GLU 1 OE2   1 
ATOM   1161  N  N     . GLN A  1  147 ? 2.583    -37.487  402.060 1.00 36.89  ? 147 GLN 1 N     1 
ATOM   1162  C  CA    . GLN A  1  147 ? 2.357    -37.730  403.481 1.00 41.44  ? 147 GLN 1 CA    1 
ATOM   1163  C  C     . GLN A  1  147 ? 0.891    -37.526  403.843 1.00 43.64  ? 147 GLN 1 C     1 
ATOM   1164  O  O     . GLN A  1  147 ? 0.259    -38.400  404.452 1.00 45.57  ? 147 GLN 1 O     1 
ATOM   1165  C  CB    . GLN A  1  147 ? 3.259    -36.806  404.308 1.00 45.20  ? 147 GLN 1 CB    1 
ATOM   1166  C  CG    . GLN A  1  147 ? 3.203    -37.018  405.826 1.00 47.45  ? 147 GLN 1 CG    1 
ATOM   1167  C  CD    . GLN A  1  147 ? 4.229    -36.178  406.584 1.00 48.57  ? 147 GLN 1 CD    1 
ATOM   1168  O  OE1   . GLN A  1  147 ? 5.060    -35.495  405.986 1.00 48.18  ? 147 GLN 1 OE1   1 
ATOM   1169  N  NE2   . GLN A  1  147 ? 4.172    -36.230  407.906 1.00 50.33  ? 147 GLN 1 NE2   1 
ATOM   1170  N  N     . ALA A  1  148 ? 0.328    -36.379  403.451 1.00 39.07  ? 148 ALA 1 N     1 
ATOM   1171  C  CA    . ALA A  1  148 ? -1.056   -36.074  403.796 1.00 38.18  ? 148 ALA 1 CA    1 
ATOM   1172  C  C     . ALA A  1  148 ? -2.013   -37.086  403.183 1.00 44.74  ? 148 ALA 1 C     1 
ATOM   1173  O  O     . ALA A  1  148 ? -2.967   -37.532  403.839 1.00 48.73  ? 148 ALA 1 O     1 
ATOM   1174  C  CB    . ALA A  1  148 ? -1.416   -34.666  403.331 1.00 27.73  ? 148 ALA 1 CB    1 
ATOM   1175  N  N     . ILE A  1  149 ? -1.765   -37.472  401.929 1.00 45.64  ? 149 ILE 1 N     1 
ATOM   1176  C  CA    . ILE A  1  149 ? -2.649   -38.424  401.266 1.00 43.61  ? 149 ILE 1 CA    1 
ATOM   1177  C  C     . ILE A  1  149 ? -2.598   -39.755  401.991 1.00 48.30  ? 149 ILE 1 C     1 
ATOM   1178  O  O     . ILE A  1  149 ? -3.640   -40.359  402.274 1.00 51.10  ? 149 ILE 1 O     1 
ATOM   1179  C  CB    . ILE A  1  149 ? -2.268   -38.575  399.778 1.00 43.51  ? 149 ILE 1 CB    1 
ATOM   1180  C  CG1   . ILE A  1  149 ? -2.440   -37.236  399.043 1.00 48.76  ? 149 ILE 1 CG1   1 
ATOM   1181  C  CG2   . ILE A  1  149 ? -3.107   -39.667  399.104 1.00 38.77  ? 149 ILE 1 CG2   1 
ATOM   1182  C  CD1   . ILE A  1  149 ? -2.319   -37.297  397.530 1.00 49.81  ? 149 ILE 1 CD1   1 
ATOM   1183  N  N     . LYS A  1  150 ? -1.390   -40.212  402.346 1.00 49.17  ? 150 LYS 1 N     1 
ATOM   1184  C  CA    . LYS A  1  150 ? -1.268   -41.466  403.085 1.00 51.41  ? 150 LYS 1 CA    1 
ATOM   1185  C  C     . LYS A  1  150 ? -2.000   -41.403  404.420 1.00 49.90  ? 150 LYS 1 C     1 
ATOM   1186  O  O     . LYS A  1  150 ? -2.660   -42.372  404.820 1.00 50.85  ? 150 LYS 1 O     1 
ATOM   1187  C  CB    . LYS A  1  150 ? 0.202    -41.831  403.300 1.00 52.06  ? 150 LYS 1 CB    1 
ATOM   1188  C  CG    . LYS A  1  150 ? 0.910    -42.355  402.055 1.00 53.39  ? 150 LYS 1 CG    1 
ATOM   1189  C  CD    . LYS A  1  150 ? 2.185    -43.097  402.449 1.00 55.18  ? 150 LYS 1 CD    1 
ATOM   1190  C  CE    . LYS A  1  150 ? 2.948    -43.646  401.251 1.00 55.47  ? 150 LYS 1 CE    1 
ATOM   1191  N  NZ    . LYS A  1  150 ? 3.944    -42.669  400.734 1.00 55.17  ? 150 LYS 1 NZ    1 
ATOM   1192  N  N     . GLU A  1  151 ? -1.884   -40.274  405.128 1.00 45.71  ? 151 GLU 1 N     1 
ATOM   1193  C  CA    . GLU A  1  151 ? -2.523   -40.140  406.437 1.00 43.42  ? 151 GLU 1 CA    1 
ATOM   1194  C  C     . GLU A  1  151 ? -4.041   -40.211  406.317 1.00 43.33  ? 151 GLU 1 C     1 
ATOM   1195  O  O     . GLU A  1  151 ? -4.710   -40.967  407.039 1.00 42.27  ? 151 GLU 1 O     1 
ATOM   1196  C  CB    . GLU A  1  151 ? -2.095   -38.827  407.092 1.00 39.42  ? 151 GLU 1 CB    1 
ATOM   1197  C  CG    . GLU A  1  151 ? -0.664   -38.810  407.615 1.00 38.70  ? 151 GLU 1 CG    1 
ATOM   1198  C  CD    . GLU A  1  151 ? -0.352   -37.512  408.328 1.00 41.34  ? 151 GLU 1 CD    1 
ATOM   1199  O  OE1   . GLU A  1  151 ? -0.446   -37.472  409.574 1.00 41.89  ? 151 GLU 1 OE1   1 
ATOM   1200  O  OE2   . GLU A  1  151 ? -0.041   -36.517  407.638 1.00 42.03  ? 151 GLU 1 OE2   1 
ATOM   1201  N  N     . ALA A  1  152 ? -4.608   -39.404  405.418 1.00 45.40  ? 152 ALA 1 N     1 
ATOM   1202  C  CA    . ALA A  1  152 ? -6.055   -39.415  405.235 1.00 42.41  ? 152 ALA 1 CA    1 
ATOM   1203  C  C     . ALA A  1  152 ? -6.541   -40.772  404.729 1.00 37.06  ? 152 ALA 1 C     1 
ATOM   1204  O  O     . ALA A  1  152 ? -7.674   -41.170  405.017 1.00 34.12  ? 152 ALA 1 O     1 
ATOM   1205  C  CB    . ALA A  1  152 ? -6.480   -38.291  404.284 1.00 44.24  ? 152 ALA 1 CB    1 
ATOM   1206  N  N     . ARG A  1  153 ? -5.705   -41.493  403.970 1.00 32.48  ? 153 ARG 1 N     1 
ATOM   1207  C  CA    . ARG A  1  153 ? -6.079   -42.833  403.525 1.00 37.65  ? 153 ARG 1 CA    1 
ATOM   1208  C  C     . ARG A  1  153 ? -6.099   -43.831  404.683 1.00 35.30  ? 153 ARG 1 C     1 
ATOM   1209  O  O     . ARG A  1  153 ? -6.978   -44.700  404.756 1.00 34.68  ? 153 ARG 1 O     1 
ATOM   1210  C  CB    . ARG A  1  153 ? -5.113   -43.324  402.446 1.00 39.11  ? 153 ARG 1 CB    1 
ATOM   1211  C  CG    . ARG A  1  153 ? -5.589   -43.175  401.007 1.00 39.44  ? 153 ARG 1 CG    1 
ATOM   1212  C  CD    . ARG A  1  153 ? -4.626   -43.921  400.086 1.00 37.27  ? 153 ARG 1 CD    1 
ATOM   1213  N  NE    . ARG A  1  153 ? -3.695   -43.054  399.387 1.00 36.21  ? 153 ARG 1 NE    1 
ATOM   1214  C  CZ    . ARG A  1  153 ? -2.879   -43.468  398.421 1.00 38.27  ? 153 ARG 1 CZ    1 
ATOM   1215  N  NH1   . ARG A  1  153 ? -2.876   -44.739  398.039 1.00 34.82  ? 153 ARG 1 NH1   1 
ATOM   1216  N  NH2   . ARG A  1  153 ? -2.055   -42.605  397.838 1.00 43.62  ? 153 ARG 1 NH2   1 
ATOM   1217  N  N     . ALA A  1  154 ? -5.116   -43.742  405.578 1.00 38.80  ? 154 ALA 1 N     1 
ATOM   1218  C  CA    . ALA A  1  154 ? -5.036   -44.681  406.692 1.00 41.27  ? 154 ALA 1 CA    1 
ATOM   1219  C  C     . ALA A  1  154 ? -6.178   -44.461  407.679 1.00 46.65  ? 154 ALA 1 C     1 
ATOM   1220  O  O     . ALA A  1  154 ? -6.847   -45.416  408.097 1.00 42.88  ? 154 ALA 1 O     1 
ATOM   1221  C  CB    . ALA A  1  154 ? -3.682   -44.543  407.391 1.00 40.99  ? 154 ALA 1 CB    1 
ATOM   1222  N  N     . ARG A  1  155 ? -6.415   -43.206  408.061 1.00 54.85  ? 155 ARG 1 N     1 
ATOM   1223  C  CA    . ARG A  1  155 ? -7.403   -42.871  409.084 1.00 59.41  ? 155 ARG 1 CA    1 
ATOM   1224  C  C     . ARG A  1  155 ? -8.828   -42.673  408.550 1.00 59.89  ? 155 ARG 1 C     1 
ATOM   1225  O  O     . ARG A  1  155 ? -9.686   -42.178  409.292 1.00 55.50  ? 155 ARG 1 O     1 
ATOM   1226  C  CB    . ARG A  1  155 ? -6.956   -41.627  409.850 1.00 64.80  ? 155 ARG 1 CB    1 
ATOM   1227  C  CG    . ARG A  1  155 ? -5.836   -41.919  410.831 1.00 66.24  ? 155 ARG 1 CG    1 
ATOM   1228  C  CD    . ARG A  1  155 ? -5.610   -40.760  411.774 1.00 66.95  ? 155 ARG 1 CD    1 
ATOM   1229  N  NE    . ARG A  1  155 ? -4.542   -41.055  412.718 1.00 68.52  ? 155 ARG 1 NE    1 
ATOM   1230  C  CZ    . ARG A  1  155 ? -4.107   -40.203  413.637 1.00 71.47  ? 155 ARG 1 CZ    1 
ATOM   1231  N  NH1   . ARG A  1  155 ? -4.653   -38.997  413.732 1.00 75.42  ? 155 ARG 1 NH1   1 
ATOM   1232  N  NH2   . ARG A  1  155 ? -3.133   -40.558  414.464 1.00 70.19  ? 155 ARG 1 NH2   1 
ATOM   1233  N  N     . GLY A  1  156 ? -9.095   -43.012  407.290 1.00 52.59  ? 156 GLY 1 N     1 
ATOM   1234  C  CA    . GLY A  1  156 ? -10.468  -43.045  406.816 1.00 52.05  ? 156 GLY 1 CA    1 
ATOM   1235  C  C     . GLY A  1  156 ? -11.061  -41.737  406.340 1.00 51.10  ? 156 GLY 1 C     1 
ATOM   1236  O  O     . GLY A  1  156 ? -12.289  -41.623  406.247 1.00 50.47  ? 156 GLY 1 O     1 
ATOM   1237  N  N     . TYR A  1  157 ? -10.238  -40.735  406.037 1.00 50.70  ? 157 TYR 1 N     1 
ATOM   1238  C  CA    . TYR A  1  157 ? -10.772  -39.515  405.445 1.00 50.32  ? 157 TYR 1 CA    1 
ATOM   1239  C  C     . TYR A  1  157 ? -10.927  -39.615  403.932 1.00 50.97  ? 157 TYR 1 C     1 
ATOM   1240  O  O     . TYR A  1  157 ? -11.730  -38.872  403.355 1.00 50.18  ? 157 TYR 1 O     1 
ATOM   1241  C  CB    . TYR A  1  157 ? -9.893   -38.316  405.806 1.00 49.75  ? 157 TYR 1 CB    1 
ATOM   1242  C  CG    . TYR A  1  157 ? -10.117  -37.787  407.210 1.00 48.04  ? 157 TYR 1 CG    1 
ATOM   1243  C  CD1   . TYR A  1  157 ? -11.082  -36.818  407.451 1.00 46.71  ? 157 TYR 1 CD1   1 
ATOM   1244  C  CD2   . TYR A  1  157 ? -9.375   -38.248  408.288 1.00 45.53  ? 157 TYR 1 CD2   1 
ATOM   1245  C  CE1   . TYR A  1  157 ? -11.305  -36.314  408.724 1.00 44.89  ? 157 TYR 1 CE1   1 
ATOM   1246  C  CE2   . TYR A  1  157 ? -9.597   -37.745  409.577 1.00 44.78  ? 157 TYR 1 CE2   1 
ATOM   1247  C  CZ    . TYR A  1  157 ? -10.566  -36.777  409.784 1.00 43.33  ? 157 TYR 1 CZ    1 
ATOM   1248  O  OH    . TYR A  1  157 ? -10.809  -36.261  411.041 1.00 40.78  ? 157 TYR 1 OH    1 
ATOM   1249  N  N     . LEU A  1  158 ? -10.187  -40.516  403.286 1.00 51.68  ? 158 LEU 1 N     1 
ATOM   1250  C  CA    . LEU A  1  158 ? -10.334  -40.810  401.862 1.00 50.57  ? 158 LEU 1 CA    1 
ATOM   1251  C  C     . LEU A  1  158 ? -10.470  -42.320  401.728 1.00 52.11  ? 158 LEU 1 C     1 
ATOM   1252  O  O     . LEU A  1  158 ? -9.507   -43.053  401.973 1.00 48.68  ? 158 LEU 1 O     1 
ATOM   1253  C  CB    . LEU A  1  158 ? -9.144   -40.279  401.059 1.00 47.53  ? 158 LEU 1 CB    1 
ATOM   1254  C  CG    . LEU A  1  158 ? -8.787   -38.784  401.184 1.00 45.10  ? 158 LEU 1 CG    1 
ATOM   1255  C  CD1   . LEU A  1  158 ? -7.696   -38.387  400.200 1.00 45.75  ? 158 LEU 1 CD1   1 
ATOM   1256  C  CD2   . LEU A  1  158 ? -10.003  -37.889  400.978 1.00 41.63  ? 158 LEU 1 CD2   1 
ATOM   1257  N  N     . GLY A  1  159 ? -11.655  -42.788  401.350 1.00 58.45  ? 159 GLY 1 N     1 
ATOM   1258  C  CA    . GLY A  1  159 ? -11.909  -44.211  401.370 1.00 63.42  ? 159 GLY 1 CA    1 
ATOM   1259  C  C     . GLY A  1  159 ? -13.085  -44.617  400.508 1.00 63.49  ? 159 GLY 1 C     1 
ATOM   1260  O  O     . GLY A  1  159 ? -13.617  -43.825  399.728 1.00 64.93  ? 159 GLY 1 O     1 
ATOM   1261  N  N     . LYS A  1  160 ? -13.470  -45.886  400.663 1.00 62.76  ? 160 LYS 1 N     1 
ATOM   1262  C  CA    . LYS A  1  160 ? -14.593  -46.451  399.922 1.00 61.32  ? 160 LYS 1 CA    1 
ATOM   1263  C  C     . LYS A  1  160 ? -15.845  -45.597  400.084 1.00 58.89  ? 160 LYS 1 C     1 
ATOM   1264  O  O     . LYS A  1  160 ? -16.409  -45.100  399.103 1.00 54.94  ? 160 LYS 1 O     1 
ATOM   1265  C  CB    . LYS A  1  160 ? -14.863  -47.884  400.403 1.00 65.27  ? 160 LYS 1 CB    1 
ATOM   1266  C  CG    . LYS A  1  160 ? -13.663  -48.819  400.395 1.00 67.18  ? 160 LYS 1 CG    1 
ATOM   1267  C  CD    . LYS A  1  160 ? -13.201  -49.145  398.980 1.00 68.82  ? 160 LYS 1 CD    1 
ATOM   1268  C  CE    . LYS A  1  160 ? -11.979  -50.057  398.989 1.00 68.72  ? 160 LYS 1 CE    1 
ATOM   1269  N  NZ    . LYS A  1  160 ? -12.255  -51.385  399.601 1.00 67.96  ? 160 LYS 1 NZ    1 
ATOM   1270  N  N     . ASN A  1  161 ? -16.289  -45.413  401.327 1.00 57.65  ? 161 ASN 1 N     1 
ATOM   1271  C  CA    . ASN A  1  161 ? -17.486  -44.641  401.637 1.00 55.30  ? 161 ASN 1 CA    1 
ATOM   1272  C  C     . ASN A  1  161 ? -17.097  -43.599  402.675 1.00 49.94  ? 161 ASN 1 C     1 
ATOM   1273  O  O     . ASN A  1  161 ? -16.632  -43.960  403.760 1.00 50.95  ? 161 ASN 1 O     1 
ATOM   1274  C  CB    . ASN A  1  161 ? -18.597  -45.555  402.184 1.00 56.38  ? 161 ASN 1 CB    1 
ATOM   1275  C  CG    . ASN A  1  161 ? -19.087  -46.606  401.161 1.00 55.37  ? 161 ASN 1 CG    1 
ATOM   1276  O  OD1   . ASN A  1  161 ? -20.154  -46.468  400.557 1.00 55.61  ? 161 ASN 1 OD1   1 
ATOM   1277  N  ND2   . ASN A  1  161 ? -18.319  -47.679  401.007 1.00 52.31  ? 161 ASN 1 ND2   1 
ATOM   1278  N  N     . LEU A  1  162 ? -17.285  -42.317  402.353 1.00 50.58  ? 162 LEU 1 N     1 
ATOM   1279  C  CA    . LEU A  1  162 ? -16.835  -41.217  403.209 1.00 50.75  ? 162 LEU 1 CA    1 
ATOM   1280  C  C     . LEU A  1  162 ? -17.914  -40.902  404.241 1.00 48.30  ? 162 LEU 1 C     1 
ATOM   1281  O  O     . LEU A  1  162 ? -19.018  -40.485  403.879 1.00 51.21  ? 162 LEU 1 O     1 
ATOM   1282  C  CB    . LEU A  1  162 ? -16.525  -39.972  402.376 1.00 51.44  ? 162 LEU 1 CB    1 
ATOM   1283  C  CG    . LEU A  1  162 ? -15.367  -40.043  401.379 1.00 52.28  ? 162 LEU 1 CG    1 
ATOM   1284  C  CD1   . LEU A  1  162 ? -15.094  -38.656  400.789 1.00 54.57  ? 162 LEU 1 CD1   1 
ATOM   1285  C  CD2   . LEU A  1  162 ? -14.113  -40.649  402.015 1.00 49.85  ? 162 LEU 1 CD2   1 
ATOM   1286  N  N     . PHE A  1  163 ? -17.586  -41.077  405.524 1.00 41.42  ? 163 PHE 1 N     1 
ATOM   1287  C  CA    . PHE A  1  163 ? -18.473  -40.721  406.633 1.00 36.32  ? 163 PHE 1 CA    1 
ATOM   1288  C  C     . PHE A  1  163 ? -19.776  -41.520  406.575 1.00 39.59  ? 163 PHE 1 C     1 
ATOM   1289  O  O     . PHE A  1  163 ? -20.841  -41.030  406.966 1.00 40.66  ? 163 PHE 1 O     1 
ATOM   1290  C  CB    . PHE A  1  163 ? -18.759  -39.210  406.697 1.00 28.83  ? 163 PHE 1 CB    1 
ATOM   1291  C  CG    . PHE A  1  163 ? -17.533  -38.331  406.524 1.00 24.97  ? 163 PHE 1 CG    1 
ATOM   1292  C  CD1   . PHE A  1  163 ? -16.333  -38.647  407.139 1.00 25.23  ? 163 PHE 1 CD1   1 
ATOM   1293  C  CD2   . PHE A  1  163 ? -17.596  -37.154  405.792 1.00 20.38  ? 163 PHE 1 CD2   1 
ATOM   1294  C  CE1   . PHE A  1  163 ? -15.212  -37.833  406.986 1.00 21.73  ? 163 PHE 1 CE1   1 
ATOM   1295  C  CE2   . PHE A  1  163 ? -16.472  -36.342  405.646 1.00 16.02  ? 163 PHE 1 CE2   1 
ATOM   1296  C  CZ    . PHE A  1  163 ? -15.290  -36.682  406.240 1.00 16.66  ? 163 PHE 1 CZ    1 
ATOM   1297  N  N     . GLY A  1  164 ? -19.706  -42.751  406.060 1.00 40.13  ? 164 GLY 1 N     1 
ATOM   1298  C  CA    . GLY A  1  164 ? -20.856  -43.618  405.945 1.00 39.88  ? 164 GLY 1 CA    1 
ATOM   1299  C  C     . GLY A  1  164 ? -21.667  -43.424  404.676 1.00 40.28  ? 164 GLY 1 C     1 
ATOM   1300  O  O     . GLY A  1  164 ? -22.305  -44.379  404.211 1.00 43.23  ? 164 GLY 1 O     1 
ATOM   1301  N  N     . THR A  1  165 ? -21.657  -42.212  404.106 1.00 35.34  ? 165 THR 1 N     1 
ATOM   1302  C  CA    . THR A  1  165 ? -22.426  -41.932  402.901 1.00 34.81  ? 165 THR 1 CA    1 
ATOM   1303  C  C     . THR A  1  165 ? -21.803  -42.686  401.722 1.00 37.95  ? 165 THR 1 C     1 
ATOM   1304  O  O     . THR A  1  165 ? -20.650  -43.130  401.775 1.00 12.90  ? 165 THR 1 O     1 
ATOM   1305  C  CB    . THR A  1  165 ? -22.513  -40.403  402.650 1.00 36.63  ? 165 THR 1 CB    1 
ATOM   1306  O  OG1   . THR A  1  165 ? -23.663  -40.098  401.851 1.00 40.24  ? 165 THR 1 OG1   1 
ATOM   1307  C  CG2   . THR A  1  165 ? -21.292  -39.836  401.927 1.00 35.52  ? 165 THR 1 CG2   1 
ATOM   1308  N  N     . ASP A  1  166 ? -22.591  -42.816  400.643 1.00 32.46  ? 166 ASP 1 N     1 
ATOM   1309  C  CA    . ASP A  1  166 ? -22.266  -43.631  399.475 1.00 32.99  ? 166 ASP 1 CA    1 
ATOM   1310  C  C     . ASP A  1  166 ? -21.365  -42.909  398.468 1.00 26.80  ? 166 ASP 1 C     1 
ATOM   1311  O  O     . ASP A  1  166 ? -21.321  -43.281  397.291 1.00 25.55  ? 166 ASP 1 O     1 
ATOM   1312  C  CB    . ASP A  1  166 ? -23.557  -44.120  398.797 1.00 42.89  ? 166 ASP 1 CB    1 
ATOM   1313  C  CG    . ASP A  1  166 ? -24.453  -42.979  398.332 1.00 50.62  ? 166 ASP 1 CG    1 
ATOM   1314  O  OD1   . ASP A  1  166 ? -24.502  -41.927  399.007 1.00 54.38  ? 166 ASP 1 OD1   1 
ATOM   1315  O  OD2   . ASP A  1  166 ? -25.135  -43.148  397.296 1.00 54.16  ? 166 ASP 1 OD2   1 
ATOM   1316  N  N     . PHE A  1  167 ? -20.660  -41.875  398.887 1.00 24.43  ? 167 PHE 1 N     1 
ATOM   1317  C  CA    . PHE A  1  167 ? -19.749  -41.168  398.002 1.00 28.16  ? 167 PHE 1 CA    1 
ATOM   1318  C  C     . PHE A  1  167 ? -18.349  -41.734  398.219 1.00 29.76  ? 167 PHE 1 C     1 
ATOM   1319  O  O     . PHE A  1  167 ? -18.043  -42.288  399.278 1.00 28.88  ? 167 PHE 1 O     1 
ATOM   1320  C  CB    . PHE A  1  167 ? -19.788  -39.643  398.262 1.00 29.80  ? 167 PHE 1 CB    1 
ATOM   1321  C  CG    . PHE A  1  167 ? -19.031  -38.820  397.239 1.00 26.36  ? 167 PHE 1 CG    1 
ATOM   1322  C  CD1   . PHE A  1  167 ? -19.594  -38.509  396.007 1.00 25.40  ? 167 PHE 1 CD1   1 
ATOM   1323  C  CD2   . PHE A  1  167 ? -17.749  -38.374  397.504 1.00 25.34  ? 167 PHE 1 CD2   1 
ATOM   1324  C  CE1   . PHE A  1  167 ? -18.891  -37.762  395.064 1.00 23.19  ? 167 PHE 1 CE1   1 
ATOM   1325  C  CE2   . PHE A  1  167 ? -17.043  -37.628  396.559 1.00 24.49  ? 167 PHE 1 CE2   1 
ATOM   1326  C  CZ    . PHE A  1  167 ? -17.616  -37.330  395.346 1.00 23.78  ? 167 PHE 1 CZ    1 
ATOM   1327  N  N     . SER A  1  168 ? -17.518  -41.650  397.185 1.00 32.46  ? 168 SER 1 N     1 
ATOM   1328  C  CA    . SER A  1  168 ? -16.153  -42.151  397.257 1.00 35.86  ? 168 SER 1 CA    1 
ATOM   1329  C  C     . SER A  1  168 ? -15.185  -41.106  396.722 1.00 34.63  ? 168 SER 1 C     1 
ATOM   1330  O  O     . SER A  1  168 ? -15.543  -40.286  395.875 1.00 38.84  ? 168 SER 1 O     1 
ATOM   1331  C  CB    . SER A  1  168 ? -15.973  -43.472  396.491 1.00 43.30  ? 168 SER 1 CB    1 
ATOM   1332  O  OG    . SER A  1  168 ? -16.763  -44.507  397.060 1.00 49.70  ? 168 SER 1 OG    1 
ATOM   1333  N  N     . PHE A  1  169 ? -13.946  -41.153  397.209 1.00 28.05  ? 169 PHE 1 N     1 
ATOM   1334  C  CA    . PHE A  1  169 ? -12.953  -40.171  396.790 1.00 24.40  ? 169 PHE 1 CA    1 
ATOM   1335  C  C     . PHE A  1  169 ? -11.552  -40.703  397.052 1.00 19.80  ? 169 PHE 1 C     1 
ATOM   1336  O  O     . PHE A  1  169 ? -11.321  -41.442  398.015 1.00 19.45  ? 169 PHE 1 O     1 
ATOM   1337  C  CB    . PHE A  1  169 ? -13.156  -38.820  397.501 1.00 23.73  ? 169 PHE 1 CB    1 
ATOM   1338  C  CG    . PHE A  1  169 ? -12.566  -37.670  396.752 1.00 23.11  ? 169 PHE 1 CG    1 
ATOM   1339  C  CD1   . PHE A  1  169 ? -13.232  -37.124  395.677 1.00 24.60  ? 169 PHE 1 CD1   1 
ATOM   1340  C  CD2   . PHE A  1  169 ? -11.340  -37.141  397.109 1.00 23.00  ? 169 PHE 1 CD2   1 
ATOM   1341  C  CE1   . PHE A  1  169 ? -12.683  -36.069  394.956 1.00 25.85  ? 169 PHE 1 CE1   1 
ATOM   1342  C  CE2   . PHE A  1  169 ? -10.793  -36.078  396.394 1.00 24.56  ? 169 PHE 1 CE2   1 
ATOM   1343  C  CZ    . PHE A  1  169 ? -11.470  -35.545  395.318 1.00 24.45  ? 169 PHE 1 CZ    1 
ATOM   1344  N  N     . ASP A  1  170 ? -10.618  -40.296  396.192 1.00 17.89  ? 170 ASP 1 N     1 
ATOM   1345  C  CA    . ASP A  1  170 ? -9.213   -40.636  396.361 1.00 22.97  ? 170 ASP 1 CA    1 
ATOM   1346  C  C     . ASP A  1  170 ? -8.370   -39.694  395.521 1.00 20.41  ? 170 ASP 1 C     1 
ATOM   1347  O  O     . ASP A  1  170 ? -8.825   -39.166  394.506 1.00 20.56  ? 170 ASP 1 O     1 
ATOM   1348  C  CB    . ASP A  1  170 ? -8.914   -42.079  395.949 1.00 31.72  ? 170 ASP 1 CB    1 
ATOM   1349  C  CG    . ASP A  1  170 ? -7.557   -42.566  396.453 1.00 35.70  ? 170 ASP 1 CG    1 
ATOM   1350  O  OD1   . ASP A  1  170 ? -6.705   -41.720  396.820 1.00 31.96  ? 170 ASP 1 OD1   1 
ATOM   1351  O  OD2   . ASP A  1  170 ? -7.341   -43.802  396.464 1.00 37.62  ? 170 ASP 1 OD2   1 
ATOM   1352  N  N     . LEU A  1  171 ? -7.117   -39.529  395.934 1.00 22.76  ? 171 LEU 1 N     1 
ATOM   1353  C  CA    . LEU A  1  171 ? -6.186   -38.639  395.258 1.00 27.28  ? 171 LEU 1 CA    1 
ATOM   1354  C  C     . LEU A  1  171 ? -4.976   -39.419  394.759 1.00 32.47  ? 171 LEU 1 C     1 
ATOM   1355  O  O     . LEU A  1  171 ? -4.642   -40.488  395.285 1.00 31.67  ? 171 LEU 1 O     1 
ATOM   1356  C  CB    . LEU A  1  171 ? -5.733   -37.492  396.179 1.00 23.50  ? 171 LEU 1 CB    1 
ATOM   1357  C  CG    . LEU A  1  171 ? -6.833   -36.511  396.573 1.00 20.38  ? 171 LEU 1 CG    1 
ATOM   1358  C  CD1   . LEU A  1  171 ? -6.263   -35.423  397.444 1.00 13.32  ? 171 LEU 1 CD1   1 
ATOM   1359  C  CD2   . LEU A  1  171 ? -7.479   -35.940  395.328 1.00 13.18  ? 171 LEU 1 CD2   1 
ATOM   1360  N  N     . HIS A  1  172 ? -4.335   -38.883  393.715 1.00 31.42  ? 172 HIS 1 N     1 
ATOM   1361  C  CA    . HIS A  1  172 ? -3.145   -39.502  393.155 1.00 33.83  ? 172 HIS 1 CA    1 
ATOM   1362  C  C     . HIS A  1  172 ? -2.146   -38.430  392.758 1.00 26.12  ? 172 HIS 1 C     1 
ATOM   1363  O  O     . HIS A  1  172 ? -2.522   -37.407  392.180 1.00 15.41  ? 172 HIS 1 O     1 
ATOM   1364  C  CB    . HIS A  1  172 ? -3.490   -40.355  391.936 1.00 38.41  ? 172 HIS 1 CB    1 
ATOM   1365  C  CG    . HIS A  1  172 ? -4.495   -41.414  392.236 1.00 47.40  ? 172 HIS 1 CG    1 
ATOM   1366  N  ND1   . HIS A  1  172 ? -4.291   -42.375  393.205 1.00 48.31  ? 172 HIS 1 ND1   1 
ATOM   1367  C  CD2   . HIS A  1  172 ? -5.715   -41.659  391.707 1.00 44.92  ? 172 HIS 1 CD2   1 
ATOM   1368  C  CE1   . HIS A  1  172 ? -5.347   -43.167  393.259 1.00 50.75  ? 172 HIS 1 CE1   1 
ATOM   1369  N  NE2   . HIS A  1  172 ? -6.223   -42.756  392.358 1.00 47.87  ? 172 HIS 1 NE2   1 
ATOM   1370  N  N     . VAL A  1  173 ? -0.866   -38.701  393.031 1.00 37.40  ? 173 VAL 1 N     1 
ATOM   1371  C  CA    . VAL A  1  173 ? 0.222    -37.749  392.833 1.00 42.97  ? 173 VAL 1 CA    1 
ATOM   1372  C  C     . VAL A  1  173 ? 0.910    -38.035  391.505 1.00 46.88  ? 173 VAL 1 C     1 
ATOM   1373  O  O     . VAL A  1  173 ? 1.127    -39.197  391.132 1.00 48.43  ? 173 VAL 1 O     1 
ATOM   1374  C  CB    . VAL A  1  173 ? 1.227    -37.811  394.003 1.00 43.80  ? 173 VAL 1 CB    1 
ATOM   1375  C  CG1   . VAL A  1  173 ? 2.175    -36.620  393.975 1.00 44.01  ? 173 VAL 1 CG1   1 
ATOM   1376  C  CG2   . VAL A  1  173 ? 0.487    -37.846  395.333 1.00 45.27  ? 173 VAL 1 CG2   1 
ATOM   1377  N  N     . HIS A  1  174 ? 1.271    -36.967  390.798 1.00 51.12  ? 174 HIS 1 N     1 
ATOM   1378  C  CA    . HIS A  1  174 ? 1.986    -37.056  389.531 1.00 54.17  ? 174 HIS 1 CA    1 
ATOM   1379  C  C     . HIS A  1  174 ? 3.041    -35.961  389.525 1.00 55.93  ? 174 HIS 1 C     1 
ATOM   1380  O  O     . HIS A  1  174 ? 2.704    -34.777  389.654 1.00 55.33  ? 174 HIS 1 O     1 
ATOM   1381  C  CB    . HIS A  1  174 ? 1.023    -36.905  388.345 1.00 61.55  ? 174 HIS 1 CB    1 
ATOM   1382  C  CG    . HIS A  1  174 ? 1.629    -37.250  387.019 1.00 55.62  ? 174 HIS 1 CG    1 
ATOM   1383  N  ND1   . HIS A  1  174 ? 1.599    -38.527  386.492 1.00 61.89  ? 174 HIS 1 ND1   1 
ATOM   1384  C  CD2   . HIS A  1  174 ? 2.259    -36.478  386.102 1.00 60.78  ? 174 HIS 1 CD2   1 
ATOM   1385  C  CE1   . HIS A  1  174 ? 2.199    -38.529  385.315 1.00 56.49  ? 174 HIS 1 CE1   1 
ATOM   1386  N  NE2   . HIS A  1  174 ? 2.606    -37.298  385.055 1.00 59.28  ? 174 HIS 1 NE2   1 
ATOM   1387  N  N     . ARG A  1  175 ? 4.312    -36.346  389.407 1.00 50.82  ? 175 ARG 1 N     1 
ATOM   1388  C  CA    . ARG A  1  175 ? 5.404    -35.385  389.438 1.00 50.85  ? 175 ARG 1 CA    1 
ATOM   1389  C  C     . ARG A  1  175 ? 5.836    -35.022  388.023 1.00 49.76  ? 175 ARG 1 C     1 
ATOM   1390  O  O     . ARG A  1  175 ? 6.063    -35.906  387.187 1.00 49.98  ? 175 ARG 1 O     1 
ATOM   1391  C  CB    . ARG A  1  175 ? 6.587    -35.934  390.235 1.00 51.28  ? 175 ARG 1 CB    1 
ATOM   1392  C  CG    . ARG A  1  175 ? 6.324    -35.989  391.738 1.00 51.70  ? 175 ARG 1 CG    1 
ATOM   1393  C  CD    . ARG A  1  175 ? 7.572    -36.355  392.525 1.00 51.85  ? 175 ARG 1 CD    1 
ATOM   1394  N  NE    . ARG A  1  175 ? 8.564    -35.283  392.499 1.00 53.34  ? 175 ARG 1 NE    1 
ATOM   1395  C  CZ    . ARG A  1  175 ? 9.851    -35.449  392.790 1.00 56.16  ? 175 ARG 1 CZ    1 
ATOM   1396  N  NH1   . ARG A  1  175 ? 10.314   -36.642  393.133 1.00 57.09  ? 175 ARG 1 NH1   1 
ATOM   1397  N  NH2   . ARG A  1  175 ? 10.679   -34.418  392.742 1.00 58.00  ? 175 ARG 1 NH2   1 
ATOM   1398  N  N     . GLY A  1  176 ? 5.983    -33.713  387.780 1.00 47.81  ? 176 GLY 1 N     1 
ATOM   1399  C  CA    . GLY A  1  176 ? 6.289    -33.170  386.470 1.00 45.96  ? 176 GLY 1 CA    1 
ATOM   1400  C  C     . GLY A  1  176 ? 7.775    -33.086  386.176 1.00 44.72  ? 176 GLY 1 C     1 
ATOM   1401  O  O     . GLY A  1  176 ? 8.600    -33.744  386.811 1.00 45.79  ? 176 GLY 1 O     1 
ATOM   1402  N  N     . ALA A  1  177 ? 8.115    -32.276  385.160 1.00 41.23  ? 177 ALA 1 N     1 
ATOM   1403  C  CA    . ALA A  1  177 ? 9.505    -32.104  384.746 1.00 35.02  ? 177 ALA 1 CA    1 
ATOM   1404  C  C     . ALA A  1  177 ? 9.820    -30.676  384.317 1.00 30.86  ? 177 ALA 1 C     1 
ATOM   1405  O  O     . ALA A  1  177 ? 10.726   -30.457  383.501 1.00 27.57  ? 177 ALA 1 O     1 
ATOM   1406  C  CB    . ALA A  1  177 ? 9.859    -33.052  383.606 1.00 33.43  ? 177 ALA 1 CB    1 
ATOM   1407  N  N     . GLY A  1  178 ? 9.072    -29.700  384.819 1.00 32.51  ? 178 GLY 1 N     1 
ATOM   1408  C  CA    . GLY A  1  178 ? 9.427    -28.307  384.613 1.00 33.18  ? 178 GLY 1 CA    1 
ATOM   1409  C  C     . GLY A  1  178 ? 9.154    -27.752  383.225 1.00 31.31  ? 178 GLY 1 C     1 
ATOM   1410  O  O     . GLY A  1  178 ? 10.089   -27.369  382.511 1.00 29.13  ? 178 GLY 1 O     1 
ATOM   1411  N  N     . ALA A  1  179 ? 7.884    -27.651  382.839 1.00 28.27  ? 179 ALA 1 N     1 
ATOM   1412  C  CA    . ALA A  1  179 ? 7.529    -27.012  381.577 1.00 26.09  ? 179 ALA 1 CA    1 
ATOM   1413  C  C     . ALA A  1  179 ? 6.278    -26.174  381.790 1.00 21.66  ? 179 ALA 1 C     1 
ATOM   1414  O  O     . ALA A  1  179 ? 5.209    -26.694  382.137 1.00 13.75  ? 179 ALA 1 O     1 
ATOM   1415  C  CB    . ALA A  1  179 ? 7.317    -28.032  380.458 1.00 19.91  ? 179 ALA 1 CB    1 
ATOM   1416  N  N     . TYR A  1  180 ? 6.444    -24.868  381.572 1.00 23.30  ? 180 TYR 1 N     1 
ATOM   1417  C  CA    . TYR A  1  180 ? 5.405    -23.892  381.861 1.00 18.05  ? 180 TYR 1 CA    1 
ATOM   1418  C  C     . TYR A  1  180 ? 4.129    -24.190  381.082 1.00 16.19  ? 180 TYR 1 C     1 
ATOM   1419  O  O     . TYR A  1  180 ? 3.027    -24.087  381.626 1.00 17.99  ? 180 TYR 1 O     1 
ATOM   1420  C  CB    . TYR A  1  180 ? 5.957    -22.491  381.556 1.00 15.67  ? 180 TYR 1 CB    1 
ATOM   1421  C  CG    . TYR A  1  180 ? 4.977    -21.336  381.625 1.00 15.45  ? 180 TYR 1 CG    1 
ATOM   1422  C  CD1   . TYR A  1  180 ? 3.965    -21.309  382.568 1.00 17.72  ? 180 TYR 1 CD1   1 
ATOM   1423  C  CD2   . TYR A  1  180 ? 5.097    -20.252  380.769 1.00 14.13  ? 180 TYR 1 CD2   1 
ATOM   1424  C  CE1   . TYR A  1  180 ? 3.075    -20.252  382.631 1.00 21.95  ? 180 TYR 1 CE1   1 
ATOM   1425  C  CE2   . TYR A  1  180 ? 4.216    -19.184  380.831 1.00 24.09  ? 180 TYR 1 CE2   1 
ATOM   1426  C  CZ    . TYR A  1  180 ? 3.204    -19.188  381.764 1.00 24.11  ? 180 TYR 1 CZ    1 
ATOM   1427  O  OH    . TYR A  1  180 ? 2.316    -18.128  381.840 1.00 24.92  ? 180 TYR 1 OH    1 
ATOM   1428  N  N     . ILE A  1  181 ? 4.251    -24.598  379.817 1.00 13.79  ? 181 ILE 1 N     1 
ATOM   1429  C  CA    . ILE A  1  181 ? 3.040    -24.846  379.034 1.00 24.09  ? 181 ILE 1 CA    1 
ATOM   1430  C  C     . ILE A  1  181 ? 2.236    -25.991  379.642 1.00 21.62  ? 181 ILE 1 C     1 
ATOM   1431  O  O     . ILE A  1  181 ? 1.000    -26.017  379.546 1.00 16.67  ? 181 ILE 1 O     1 
ATOM   1432  C  CB    . ILE A  1  181 ? 3.385    -25.110  377.549 1.00 20.70  ? 181 ILE 1 CB    1 
ATOM   1433  C  CG1   . ILE A  1  181 ? 2.124    -25.458  376.743 1.00 19.56  ? 181 ILE 1 CG1   1 
ATOM   1434  C  CG2   . ILE A  1  181 ? 4.431    -26.219  377.403 1.00 17.90  ? 181 ILE 1 CG2   1 
ATOM   1435  C  CD1   . ILE A  1  181 ? 1.108    -24.335  376.700 1.00 20.92  ? 181 ILE 1 CD1   1 
ATOM   1436  N  N     . CYS A  1  182 ? 2.911    -26.938  380.306 1.00 23.86  ? 182 CYS 1 N     1 
ATOM   1437  C  CA    . CYS A  1  182 ? 2.201    -28.039  380.959 1.00 26.70  ? 182 CYS 1 CA    1 
ATOM   1438  C  C     . CYS A  1  182 ? 1.270    -27.562  382.053 1.00 29.56  ? 182 CYS 1 C     1 
ATOM   1439  O  O     . CYS A  1  182 ? 0.474    -28.360  382.562 1.00 30.58  ? 182 CYS 1 O     1 
ATOM   1440  C  CB    . CYS A  1  182 ? 3.177    -29.039  381.563 1.00 25.37  ? 182 CYS 1 CB    1 
ATOM   1441  S  SG    . CYS A  1  182 ? 4.229    -29.757  380.360 1.00 25.48  ? 182 CYS 1 SG    1 
ATOM   1442  N  N     . GLY A  1  183 ? 1.368    -26.293  382.439 1.00 29.43  ? 183 GLY 1 N     1 
ATOM   1443  C  CA    . GLY A  1  183 ? 0.404    -25.739  383.354 1.00 29.00  ? 183 GLY 1 CA    1 
ATOM   1444  C  C     . GLY A  1  183 ? -0.913   -25.417  382.704 1.00 30.13  ? 183 GLY 1 C     1 
ATOM   1445  O  O     . GLY A  1  183 ? -1.937   -25.392  383.392 1.00 31.67  ? 183 GLY 1 O     1 
ATOM   1446  N  N     . GLU A  1  184 ? -0.919   -25.201  381.389 1.00 31.75  ? 184 GLU 1 N     1 
ATOM   1447  C  CA    . GLU A  1  184 ? -2.177   -24.982  380.692 1.00 36.82  ? 184 GLU 1 CA    1 
ATOM   1448  C  C     . GLU A  1  184 ? -3.031   -26.226  380.868 1.00 39.61  ? 184 GLU 1 C     1 
ATOM   1449  O  O     . GLU A  1  184 ? -2.543   -27.349  380.700 1.00 42.13  ? 184 GLU 1 O     1 
ATOM   1450  C  CB    . GLU A  1  184 ? -1.937   -24.695  379.202 1.00 38.69  ? 184 GLU 1 CB    1 
ATOM   1451  C  CG    . GLU A  1  184 ? -2.934   -23.691  378.579 1.00 40.09  ? 184 GLU 1 CG    1 
ATOM   1452  C  CD    . GLU A  1  184 ? -4.248   -24.340  378.167 1.00 36.94  ? 184 GLU 1 CD    1 
ATOM   1453  O  OE1   . GLU A  1  184 ? -4.264   -25.573  378.047 1.00 33.52  ? 184 GLU 1 OE1   1 
ATOM   1454  O  OE2   . GLU A  1  184 ? -5.267   -23.627  377.989 1.00 33.67  ? 184 GLU 1 OE2   1 
ATOM   1455  N  N     . GLU A  1  185 ? -4.303   -26.031  381.233 1.00 37.89  ? 185 GLU 1 N     1 
ATOM   1456  C  CA    . GLU A  1  185 ? -5.113   -27.172  381.652 1.00 31.64  ? 185 GLU 1 CA    1 
ATOM   1457  C  C     . GLU A  1  185 ? -5.256   -28.210  380.547 1.00 28.20  ? 185 GLU 1 C     1 
ATOM   1458  O  O     . GLU A  1  185 ? -5.316   -29.406  380.842 1.00 21.42  ? 185 GLU 1 O     1 
ATOM   1459  C  CB    . GLU A  1  185 ? -6.494   -26.726  382.154 1.00 28.74  ? 185 GLU 1 CB    1 
ATOM   1460  C  CG    . GLU A  1  185 ? -7.373   -25.959  381.183 1.00 25.72  ? 185 GLU 1 CG    1 
ATOM   1461  C  CD    . GLU A  1  185 ? -8.762   -25.728  381.758 1.00 20.74  ? 185 GLU 1 CD    1 
ATOM   1462  O  OE1   . GLU A  1  185 ? -9.361   -26.716  382.227 1.00 18.50  ? 185 GLU 1 OE1   1 
ATOM   1463  O  OE2   . GLU A  1  185 ? -9.254   -24.582  381.765 1.00 13.46  ? 185 GLU 1 OE2   1 
ATOM   1464  N  N     . THR A  1  186 ? -5.297   -27.777  379.281 1.00 29.22  ? 186 THR 1 N     1 
ATOM   1465  C  CA    . THR A  1  186 ? -5.372   -28.693  378.149 1.00 29.96  ? 186 THR 1 CA    1 
ATOM   1466  C  C     . THR A  1  186 ? -4.015   -29.287  377.797 1.00 24.92  ? 186 THR 1 C     1 
ATOM   1467  O  O     . THR A  1  186 ? -3.961   -30.348  377.171 1.00 29.14  ? 186 THR 1 O     1 
ATOM   1468  C  CB    . THR A  1  186 ? -5.949   -27.986  376.920 1.00 30.82  ? 186 THR 1 CB    1 
ATOM   1469  O  OG1   . THR A  1  186 ? -5.135   -26.853  376.602 1.00 34.57  ? 186 THR 1 OG1   1 
ATOM   1470  C  CG2   . THR A  1  186 ? -7.360   -27.483  377.213 1.00 29.98  ? 186 THR 1 CG2   1 
ATOM   1471  N  N     . ALA A  1  187 ? -2.921   -28.617  378.141 1.00 20.35  ? 187 ALA 1 N     1 
ATOM   1472  C  CA    . ALA A  1  187 ? -1.616   -29.240  377.981 1.00 22.39  ? 187 ALA 1 CA    1 
ATOM   1473  C  C     . ALA A  1  187 ? -1.285   -30.107  379.175 1.00 23.85  ? 187 ALA 1 C     1 
ATOM   1474  O  O     . ALA A  1  187 ? -0.524   -31.066  379.046 1.00 24.75  ? 187 ALA 1 O     1 
ATOM   1475  C  CB    . ALA A  1  187 ? -0.530   -28.181  377.791 1.00 27.58  ? 187 ALA 1 CB    1 
ATOM   1476  N  N     . LEU A  1  188 ? -1.808   -29.746  380.352 1.00 28.69  ? 188 LEU 1 N     1 
ATOM   1477  C  CA    . LEU A  1  188 ? -1.614   -30.557  381.553 1.00 31.51  ? 188 LEU 1 CA    1 
ATOM   1478  C  C     . LEU A  1  188 ? -2.245   -31.933  381.378 1.00 29.69  ? 188 LEU 1 C     1 
ATOM   1479  O  O     . LEU A  1  188 ? -1.676   -32.954  381.788 1.00 27.42  ? 188 LEU 1 O     1 
ATOM   1480  C  CB    . LEU A  1  188 ? -2.209   -29.834  382.769 1.00 34.33  ? 188 LEU 1 CB    1 
ATOM   1481  C  CG    . LEU A  1  188 ? -1.811   -30.296  384.182 1.00 39.77  ? 188 LEU 1 CG    1 
ATOM   1482  C  CD1   . LEU A  1  188 ? -1.973   -29.141  385.156 1.00 41.93  ? 188 LEU 1 CD1   1 
ATOM   1483  C  CD2   . LEU A  1  188 ? -2.597   -31.513  384.688 1.00 40.70  ? 188 LEU 1 CD2   1 
ATOM   1484  N  N     . MET A  1  189 ? -3.420   -31.979  380.757 1.00 27.42  ? 189 MET 1 N     1 
ATOM   1485  C  CA    . MET A  1  189 ? -4.071   -33.257  380.524 1.00 28.79  ? 189 MET 1 CA    1 
ATOM   1486  C  C     . MET A  1  189 ? -3.256   -34.110  379.564 1.00 27.80  ? 189 MET 1 C     1 
ATOM   1487  O  O     . MET A  1  189 ? -3.071   -35.308  379.801 1.00 37.97  ? 189 MET 1 O     1 
ATOM   1488  C  CB    . MET A  1  189 ? -5.488   -33.026  380.002 1.00 23.24  ? 189 MET 1 CB    1 
ATOM   1489  C  CG    . MET A  1  189 ? -6.367   -32.257  380.977 1.00 24.82  ? 189 MET 1 CG    1 
ATOM   1490  S  SD    . MET A  1  189 ? -8.145   -32.432  380.650 1.00 30.38  ? 189 MET 1 SD    1 
ATOM   1491  C  CE    . MET A  1  189 ? -8.353   -31.390  379.210 1.00 25.56  ? 189 MET 1 CE    1 
ATOM   1492  N  N     . ASN A  1  190 ? -2.702   -33.514  378.509 1.00 19.94  ? 190 ASN 1 N     1 
ATOM   1493  C  CA    . ASN A  1  190 ? -1.858   -34.305  377.622 1.00 26.60  ? 190 ASN 1 CA    1 
ATOM   1494  C  C     . ASN A  1  190 ? -0.597   -34.782  378.341 1.00 12.90  ? 190 ASN 1 C     1 
ATOM   1495  O  O     . ASN A  1  190 ? -0.251   -35.967  378.287 1.00 16.24  ? 190 ASN 1 O     1 
ATOM   1496  C  CB    . ASN A  1  190 ? -1.501   -33.517  376.358 1.00 12.90  ? 190 ASN 1 CB    1 
ATOM   1497  C  CG    . ASN A  1  190 ? -2.664   -33.404  375.391 1.00 12.85  ? 190 ASN 1 CG    1 
ATOM   1498  O  OD1   . ASN A  1  190 ? -3.604   -34.186  375.437 1.00 12.77  ? 190 ASN 1 OD1   1 
ATOM   1499  N  ND2   . ASN A  1  190 ? -2.572   -32.462  374.471 1.00 13.63  ? 190 ASN 1 ND2   1 
ATOM   1500  N  N     . SER A  1  191 ? 0.088    -33.880  379.041 1.00 13.00  ? 191 SER 1 N     1 
ATOM   1501  C  CA    . SER A  1  191 ? 1.340    -34.247  379.698 1.00 20.66  ? 191 SER 1 CA    1 
ATOM   1502  C  C     . SER A  1  191 ? 1.116    -35.338  380.746 1.00 24.93  ? 191 SER 1 C     1 
ATOM   1503  O  O     . SER A  1  191 ? 1.874    -36.317  380.808 1.00 25.79  ? 191 SER 1 O     1 
ATOM   1504  C  CB    . SER A  1  191 ? 1.996    -33.008  380.311 1.00 20.33  ? 191 SER 1 CB    1 
ATOM   1505  O  OG    . SER A  1  191 ? 3.287    -33.301  380.819 1.00 13.21  ? 191 SER 1 OG    1 
ATOM   1506  N  N     . LEU A  1  192 ? 0.065    -35.205  381.564 1.00 22.89  ? 192 LEU 1 N     1 
ATOM   1507  C  CA    . LEU A  1  192 ? -0.276   -36.273  382.500 1.00 26.06  ? 192 LEU 1 CA    1 
ATOM   1508  C  C     . LEU A  1  192 ? -0.546   -37.563  381.740 1.00 26.57  ? 192 LEU 1 C     1 
ATOM   1509  O  O     . LEU A  1  192 ? 0.006    -38.619  382.064 1.00 29.72  ? 192 LEU 1 O     1 
ATOM   1510  C  CB    . LEU A  1  192 ? -1.495   -35.884  383.348 1.00 25.01  ? 192 LEU 1 CB    1 
ATOM   1511  C  CG    . LEU A  1  192 ? -1.842   -36.912  384.446 1.00 28.73  ? 192 LEU 1 CG    1 
ATOM   1512  C  CD1   . LEU A  1  192 ? -2.303   -36.229  385.733 1.00 27.99  ? 192 LEU 1 CD1   1 
ATOM   1513  C  CD2   . LEU A  1  192 ? -2.889   -37.960  383.982 1.00 29.06  ? 192 LEU 1 CD2   1 
ATOM   1514  N  N     . GLU A  1  193 ? -1.369   -37.478  380.693 1.00 25.68  ? 193 GLU 1 N     1 
ATOM   1515  C  CA    . GLU A  1  193 ? -1.786   -38.651  379.949 1.00 19.40  ? 193 GLU 1 CA    1 
ATOM   1516  C  C     . GLU A  1  193 ? -0.590   -39.401  379.382 1.00 19.41  ? 193 GLU 1 C     1 
ATOM   1517  O  O     . GLU A  1  193 ? -0.660   -40.626  379.205 1.00 21.01  ? 193 GLU 1 O     1 
ATOM   1518  C  CB    . GLU A  1  193 ? -2.747   -38.186  378.850 1.00 12.61  ? 193 GLU 1 CB    1 
ATOM   1519  C  CG    . GLU A  1  193 ? -3.862   -39.133  378.539 1.00 12.51  ? 193 GLU 1 CG    1 
ATOM   1520  C  CD    . GLU A  1  193 ? -4.842   -38.562  377.540 1.00 12.49  ? 193 GLU 1 CD    1 
ATOM   1521  O  OE1   . GLU A  1  193 ? -5.457   -37.517  377.845 1.00 12.55  ? 193 GLU 1 OE1   1 
ATOM   1522  O  OE2   . GLU A  1  193 ? -4.991   -39.146  376.448 1.00 14.84  ? 193 GLU 1 OE2   1 
ATOM   1523  N  N     . GLY A  1  194 ? 0.531    -38.715  379.204 1.00 13.62  ? 194 GLY 1 N     1 
ATOM   1524  C  CA    . GLY A  1  194 ? 1.735    -39.291  378.662 1.00 15.93  ? 194 GLY 1 CA    1 
ATOM   1525  C  C     . GLY A  1  194 ? 2.084    -38.868  377.263 1.00 18.25  ? 194 GLY 1 C     1 
ATOM   1526  O  O     . GLY A  1  194 ? 2.922    -39.522  376.634 1.00 12.68  ? 194 GLY 1 O     1 
ATOM   1527  N  N     . LEU A  1  195 ? 1.487    -37.796  376.763 1.00 28.50  ? 195 LEU 1 N     1 
ATOM   1528  C  CA    . LEU A  1  195 ? 1.750    -37.269  375.437 1.00 28.30  ? 195 LEU 1 CA    1 
ATOM   1529  C  C     . LEU A  1  195 ? 2.642    -36.050  375.576 1.00 36.09  ? 195 LEU 1 C     1 
ATOM   1530  O  O     . LEU A  1  195 ? 2.944    -35.588  376.679 1.00 39.47  ? 195 LEU 1 O     1 
ATOM   1531  C  CB    . LEU A  1  195 ? 0.442    -36.872  374.742 1.00 25.69  ? 195 LEU 1 CB    1 
ATOM   1532  C  CG    . LEU A  1  195 ? -0.816   -37.708  375.001 1.00 24.47  ? 195 LEU 1 CG    1 
ATOM   1533  C  CD1   . LEU A  1  195 ? -2.068   -37.045  374.438 1.00 22.55  ? 195 LEU 1 CD1   1 
ATOM   1534  C  CD2   . LEU A  1  195 ? -0.650   -39.087  374.414 1.00 27.57  ? 195 LEU 1 CD2   1 
ATOM   1535  N  N     . ARG A  1  196 ? 3.038    -35.489  374.446 1.00 38.51  ? 196 ARG 1 N     1 
ATOM   1536  C  CA    . ARG A  1  196 ? 3.654    -34.180  374.513 1.00 43.91  ? 196 ARG 1 CA    1 
ATOM   1537  C  C     . ARG A  1  196 ? 2.584    -33.166  374.902 1.00 42.21  ? 196 ARG 1 C     1 
ATOM   1538  O  O     . ARG A  1  196 ? 1.413    -33.291  374.535 1.00 45.29  ? 196 ARG 1 O     1 
ATOM   1539  C  CB    . ARG A  1  196 ? 4.314    -33.822  373.179 1.00 41.31  ? 196 ARG 1 CB    1 
ATOM   1540  C  CG    . ARG A  1  196 ? 5.597    -34.607  372.910 1.00 39.86  ? 196 ARG 1 CG    1 
ATOM   1541  C  CD    . ARG A  1  196 ? 6.086    -34.436  371.479 1.00 36.03  ? 196 ARG 1 CD    1 
ATOM   1542  N  NE    . ARG A  1  196 ? 7.362    -33.724  371.437 1.00 31.94  ? 196 ARG 1 NE    1 
ATOM   1543  C  CZ    . ARG A  1  196 ? 7.503    -32.441  371.108 1.00 18.01  ? 196 ARG 1 CZ    1 
ATOM   1544  N  NH1   . ARG A  1  196 ? 6.454    -31.705  370.770 1.00 19.33  ? 196 ARG 1 NH1   1 
ATOM   1545  N  NH2   . ARG A  1  196 ? 8.706    -31.895  371.111 1.00 13.33  ? 196 ARG 1 NH2   1 
ATOM   1546  N  N     . ALA A  1  197 ? 2.988    -32.170  375.684 1.00 40.16  ? 197 ALA 1 N     1 
ATOM   1547  C  CA    . ALA A  1  197 ? 2.045    -31.199  376.232 1.00 37.83  ? 197 ALA 1 CA    1 
ATOM   1548  C  C     . ALA A  1  197 ? 1.618    -30.211  375.150 1.00 40.91  ? 197 ALA 1 C     1 
ATOM   1549  O  O     . ALA A  1  197 ? 1.873    -29.010  375.221 1.00 47.82  ? 197 ALA 1 O     1 
ATOM   1550  C  CB    . ALA A  1  197 ? 2.654    -30.469  377.419 1.00 37.57  ? 197 ALA 1 CB    1 
ATOM   1551  N  N     . ASN A  1  198 ? 0.947    -30.735  374.133 1.00 35.49  ? 198 ASN 1 N     1 
ATOM   1552  C  CA    . ASN A  1  198 ? 0.384    -29.867  373.126 1.00 26.55  ? 198 ASN 1 CA    1 
ATOM   1553  C  C     . ASN A  1  198 ? -1.097   -29.672  373.416 1.00 25.51  ? 198 ASN 1 C     1 
ATOM   1554  O  O     . ASN A  1  198 ? -1.840   -30.665  373.491 1.00 16.88  ? 198 ASN 1 O     1 
ATOM   1555  C  CB    . ASN A  1  198 ? 0.597    -30.456  371.735 1.00 25.37  ? 198 ASN 1 CB    1 
ATOM   1556  C  CG    . ASN A  1  198 ? 2.084    -30.660  371.397 1.00 22.16  ? 198 ASN 1 CG    1 
ATOM   1557  O  OD1   . ASN A  1  198 ? 2.960    -30.126  372.071 1.00 18.52  ? 198 ASN 1 OD1   1 
ATOM   1558  N  ND2   . ASN A  1  198 ? 2.359    -31.344  370.287 1.00 26.18  ? 198 ASN 1 ND2   1 
ATOM   1559  N  N     . PRO A  1  199 ? -1.562   -28.432  373.604 1.00 26.59  ? 199 PRO 1 N     1 
ATOM   1560  C  CA    . PRO A  1  199 ? -2.952   -28.210  374.035 1.00 34.24  ? 199 PRO 1 CA    1 
ATOM   1561  C  C     . PRO A  1  199 ? -3.967   -28.780  373.055 1.00 38.96  ? 199 PRO 1 C     1 
ATOM   1562  O  O     . PRO A  1  199 ? -3.674   -29.055  371.888 1.00 43.37  ? 199 PRO 1 O     1 
ATOM   1563  C  CB    . PRO A  1  199 ? -3.073   -26.679  374.122 1.00 28.63  ? 199 PRO 1 CB    1 
ATOM   1564  C  CG    . PRO A  1  199 ? -1.800   -26.131  373.613 1.00 25.90  ? 199 PRO 1 CG    1 
ATOM   1565  C  CD    . PRO A  1  199 ? -0.761   -27.196  373.645 1.00 26.17  ? 199 PRO 1 CD    1 
ATOM   1566  N  N     . ARG A  1  200 ? -5.179   -28.977  373.560 1.00 42.46  ? 200 ARG 1 N     1 
ATOM   1567  C  CA    . ARG A  1  200 ? -6.265   -29.525  372.766 1.00 41.05  ? 200 ARG 1 CA    1 
ATOM   1568  C  C     . ARG A  1  200 ? -7.103   -28.397  372.145 1.00 38.75  ? 200 ARG 1 C     1 
ATOM   1569  O  O     . ARG A  1  200 ? -6.899   -27.208  372.408 1.00 34.46  ? 200 ARG 1 O     1 
ATOM   1570  C  CB    . ARG A  1  200 ? -7.116   -30.454  373.640 1.00 41.64  ? 200 ARG 1 CB    1 
ATOM   1571  C  CG    . ARG A  1  200 ? -6.281   -31.453  374.421 1.00 41.46  ? 200 ARG 1 CG    1 
ATOM   1572  C  CD    . ARG A  1  200 ? -7.145   -32.520  375.061 1.00 47.34  ? 200 ARG 1 CD    1 
ATOM   1573  N  NE    . ARG A  1  200 ? -6.376   -33.726  375.368 1.00 56.57  ? 200 ARG 1 NE    1 
ATOM   1574  C  CZ    . ARG A  1  200 ? -6.869   -34.788  376.008 1.00 63.58  ? 200 ARG 1 CZ    1 
ATOM   1575  N  NH1   . ARG A  1  200 ? -8.134   -34.796  376.413 1.00 68.06  ? 200 ARG 1 NH1   1 
ATOM   1576  N  NH2   . ARG A  1  200 ? -6.107   -35.854  376.228 1.00 63.41  ? 200 ARG 1 NH2   1 
ATOM   1577  N  N     . LEU A  1  201 ? -8.064   -28.795  371.310 1.00 37.32  ? 201 LEU 1 N     1 
ATOM   1578  C  CA    . LEU A  1  201 ? -8.967   -27.870  370.634 1.00 31.24  ? 201 LEU 1 CA    1 
ATOM   1579  C  C     . LEU A  1  201 ? -10.070  -27.433  371.595 1.00 28.08  ? 201 LEU 1 C     1 
ATOM   1580  O  O     . LEU A  1  201 ? -10.633  -28.255  372.327 1.00 21.21  ? 201 LEU 1 O     1 
ATOM   1581  C  CB    . LEU A  1  201 ? -9.582   -28.541  369.409 1.00 28.46  ? 201 LEU 1 CB    1 
ATOM   1582  C  CG    . LEU A  1  201 ? -10.112  -27.678  368.276 1.00 24.63  ? 201 LEU 1 CG    1 
ATOM   1583  C  CD1   . LEU A  1  201 ? -8.918   -27.088  367.600 1.00 20.93  ? 201 LEU 1 CD1   1 
ATOM   1584  C  CD2   . LEU A  1  201 ? -10.930  -28.505  367.297 1.00 25.84  ? 201 LEU 1 CD2   1 
ATOM   1585  N  N     . LYS A  1  202 ? -10.354  -26.130  371.614 1.00 34.08  ? 202 LYS 1 N     1 
ATOM   1586  C  CA    . LYS A  1  202 ? -11.326  -25.533  372.538 1.00 31.55  ? 202 LYS 1 CA    1 
ATOM   1587  C  C     . LYS A  1  202 ? -12.790  -25.840  372.192 1.00 29.48  ? 202 LYS 1 C     1 
ATOM   1588  O  O     . LYS A  1  202 ? -13.594  -26.086  373.108 1.00 17.85  ? 202 LYS 1 O     1 
ATOM   1589  C  CB    . LYS A  1  202 ? -11.117  -24.009  372.591 1.00 27.06  ? 202 LYS 1 CB    1 
ATOM   1590  C  CG    . LYS A  1  202 ? -10.935  -23.415  373.964 1.00 22.71  ? 202 LYS 1 CG    1 
ATOM   1591  C  CD    . LYS A  1  202 ? -10.160  -22.109  373.824 1.00 23.60  ? 202 LYS 1 CD    1 
ATOM   1592  C  CE    . LYS A  1  202 ? -9.910   -21.429  375.170 1.00 21.98  ? 202 LYS 1 CE    1 
ATOM   1593  N  NZ    . LYS A  1  202 ? -9.103   -20.173  375.051 1.00 16.42  ? 202 LYS 1 NZ    1 
ATOM   1594  N  N     . PRO A  1  203 ? -13.187  -25.805  370.915 1.00 29.17  ? 203 PRO 1 N     1 
ATOM   1595  C  CA    . PRO A  1  203 ? -14.569  -26.142  370.564 1.00 21.87  ? 203 PRO 1 CA    1 
ATOM   1596  C  C     . PRO A  1  203 ? -15.025  -27.479  371.136 1.00 23.34  ? 203 PRO 1 C     1 
ATOM   1597  O  O     . PRO A  1  203 ? -16.211  -27.611  371.487 1.00 18.96  ? 203 PRO 1 O     1 
ATOM   1598  C  CB    . PRO A  1  203 ? -14.542  -26.157  369.031 1.00 17.86  ? 203 PRO 1 CB    1 
ATOM   1599  C  CG    . PRO A  1  203 ? -13.511  -25.142  368.677 1.00 19.80  ? 203 PRO 1 CG    1 
ATOM   1600  C  CD    . PRO A  1  203 ? -12.548  -25.035  369.821 1.00 13.07  ? 203 PRO 1 CD    1 
ATOM   1601  N  N     . PRO A  1  204 ? -14.123  -28.531  371.244 1.00 38.02  ? 204 PRO 1 N     1 
ATOM   1602  C  CA    . PRO A  1  204 ? -14.393  -29.635  372.189 1.00 44.01  ? 204 PRO 1 CA    1 
ATOM   1603  C  C     . PRO A  1  204 ? -13.961  -29.256  373.598 1.00 53.71  ? 204 PRO 1 C     1 
ATOM   1604  O  O     . PRO A  1  204 ? -12.765  -29.196  373.903 1.00 57.44  ? 204 PRO 1 O     1 
ATOM   1605  C  CB    . PRO A  1  204 ? -13.556  -30.797  371.630 1.00 38.12  ? 204 PRO 1 CB    1 
ATOM   1606  C  CG    . PRO A  1  204 ? -13.058  -30.369  370.296 1.00 36.09  ? 204 PRO 1 CG    1 
ATOM   1607  C  CD    . PRO A  1  204 ? -13.021  -28.874  370.322 1.00 35.55  ? 204 PRO 1 CD    1 
ATOM   1608  N  N     . PHE A  1  205 ? -14.984  -29.014  374.512 1.00 53.33  ? 205 PHE 1 N     1 
ATOM   1609  C  CA    . PHE A  1  205 ? -14.544  -28.470  375.792 1.00 45.35  ? 205 PHE 1 CA    1 
ATOM   1610  C  C     . PHE A  1  205 ? -14.211  -29.602  376.772 1.00 33.49  ? 205 PHE 1 C     1 
ATOM   1611  O  O     . PHE A  1  205 ? -14.745  -30.715  376.661 1.00 28.29  ? 205 PHE 1 O     1 
ATOM   1612  C  CB    . PHE A  1  205 ? -15.618  -27.534  376.383 1.00 45.02  ? 205 PHE 1 CB    1 
ATOM   1613  C  CG    . PHE A  1  205 ? -15.590  -26.123  375.819 1.00 45.36  ? 205 PHE 1 CG    1 
ATOM   1614  C  CD1   . PHE A  1  205 ? -14.604  -25.227  376.198 1.00 45.20  ? 205 PHE 1 CD1   1 
ATOM   1615  C  CD2   . PHE A  1  205 ? -16.547  -25.695  374.907 1.00 50.68  ? 205 PHE 1 CD2   1 
ATOM   1616  C  CE1   . PHE A  1  205 ? -14.575  -23.925  375.685 1.00 48.68  ? 205 PHE 1 CE1   1 
ATOM   1617  C  CE2   . PHE A  1  205 ? -16.515  -24.385  374.387 1.00 52.85  ? 205 PHE 1 CE2   1 
ATOM   1618  C  CZ    . PHE A  1  205 ? -15.528  -23.510  374.781 1.00 50.94  ? 205 PHE 1 CZ    1 
ATOM   1619  N  N     . PRO A  1  206 ? -13.293  -29.355  377.709 1.00 23.78  ? 206 PRO 1 N     1 
ATOM   1620  C  CA    . PRO A  1  206 ? -12.880  -30.435  378.606 1.00 23.11  ? 206 PRO 1 CA    1 
ATOM   1621  C  C     . PRO A  1  206 ? -13.970  -30.857  379.562 1.00 31.97  ? 206 PRO 1 C     1 
ATOM   1622  O  O     . PRO A  1  206 ? -14.037  -32.044  379.921 1.00 39.36  ? 206 PRO 1 O     1 
ATOM   1623  C  CB    . PRO A  1  206 ? -11.677  -29.840  379.346 1.00 20.00  ? 206 PRO 1 CB    1 
ATOM   1624  C  CG    . PRO A  1  206 ? -11.858  -28.387  379.267 1.00 20.28  ? 206 PRO 1 CG    1 
ATOM   1625  C  CD    . PRO A  1  206 ? -12.609  -28.087  378.013 1.00 22.21  ? 206 PRO 1 CD    1 
ATOM   1626  N  N     . ALA A  1  207 ? -14.859  -29.934  379.936 1.00 30.24  ? 207 ALA 1 N     1 
ATOM   1627  C  CA    . ALA A  1  207 ? -15.922  -30.255  380.882 1.00 28.50  ? 207 ALA 1 CA    1 
ATOM   1628  C  C     . ALA A  1  207 ? -16.742  -31.465  380.424 1.00 28.94  ? 207 ALA 1 C     1 
ATOM   1629  O  O     . ALA A  1  207 ? -17.186  -32.268  381.257 1.00 20.35  ? 207 ALA 1 O     1 
ATOM   1630  C  CB    . ALA A  1  207 ? -16.804  -29.014  381.089 1.00 24.41  ? 207 ALA 1 CB    1 
ATOM   1631  N  N     . GLN A  1  208 ? -16.885  -31.641  379.103 1.00 31.73  ? 208 GLN 1 N     1 
ATOM   1632  C  CA    . GLN A  1  208 ? -17.553  -32.775  378.461 1.00 24.09  ? 208 GLN 1 CA    1 
ATOM   1633  C  C     . GLN A  1  208 ? -16.581  -33.845  377.966 1.00 16.57  ? 208 GLN 1 C     1 
ATOM   1634  O  O     . GLN A  1  208 ? -17.012  -34.967  377.701 1.00 17.15  ? 208 GLN 1 O     1 
ATOM   1635  C  CB    . GLN A  1  208 ? -18.407  -32.283  377.275 1.00 21.58  ? 208 GLN 1 CB    1 
ATOM   1636  C  CG    . GLN A  1  208 ? -19.301  -31.081  377.626 1.00 21.06  ? 208 GLN 1 CG    1 
ATOM   1637  C  CD    . GLN A  1  208 ? -18.767  -29.744  377.121 1.00 17.78  ? 208 GLN 1 CD    1 
ATOM   1638  O  OE1   . GLN A  1  208 ? -18.039  -29.673  376.127 1.00 21.45  ? 208 GLN 1 OE1   1 
ATOM   1639  N  NE2   . GLN A  1  208 ? -19.108  -28.679  377.829 1.00 12.99  ? 208 GLN 1 NE2   1 
ATOM   1640  N  N     . SER A  1  209 ? -15.290  -33.525  377.829 1.00 14.82  ? 209 SER 1 N     1 
ATOM   1641  C  CA    . SER A  1  209 ? -14.287  -34.511  377.422 1.00 17.53  ? 209 SER 1 CA    1 
ATOM   1642  C  C     . SER A  1  209 ? -12.922  -34.045  377.923 1.00 15.03  ? 209 SER 1 C     1 
ATOM   1643  O  O     . SER A  1  209 ? -12.321  -33.155  377.323 1.00 25.08  ? 209 SER 1 O     1 
ATOM   1644  C  CB    . SER A  1  209 ? -14.276  -34.686  375.911 1.00 24.55  ? 209 SER 1 CB    1 
ATOM   1645  O  OG    . SER A  1  209 ? -13.764  -35.943  375.514 1.00 13.67  ? 209 SER 1 OG    1 
ATOM   1646  N  N     . GLY A  1  210 ? -12.438  -34.651  378.997 1.00 12.65  ? 210 GLY 1 N     1 
ATOM   1647  C  CA    . GLY A  1  210 ? -11.120  -34.291  379.495 1.00 16.14  ? 210 GLY 1 CA    1 
ATOM   1648  C  C     . GLY A  1  210 ? -10.129  -35.441  379.500 1.00 17.43  ? 210 GLY 1 C     1 
ATOM   1649  O  O     . GLY A  1  210 ? -9.941   -36.119  378.485 1.00 21.11  ? 210 GLY 1 O     1 
ATOM   1650  N  N     . LEU A  1  211 ? -9.475   -35.653  380.643 1.00 14.42  ? 211 LEU 1 N     1 
ATOM   1651  C  CA    . LEU A  1  211 ? -8.574   -36.788  380.837 1.00 12.62  ? 211 LEU 1 CA    1 
ATOM   1652  C  C     . LEU A  1  211 ? -9.224   -38.102  380.452 1.00 19.60  ? 211 LEU 1 C     1 
ATOM   1653  O  O     . LEU A  1  211 ? -10.257  -38.485  381.009 1.00 25.49  ? 211 LEU 1 O     1 
ATOM   1654  C  CB    . LEU A  1  211 ? -8.135   -36.853  382.297 1.00 12.67  ? 211 LEU 1 CB    1 
ATOM   1655  C  CG    . LEU A  1  211 ? -6.678   -37.163  382.582 1.00 12.69  ? 211 LEU 1 CG    1 
ATOM   1656  C  CD1   . LEU A  1  211 ? -5.754   -36.476  381.609 1.00 13.84  ? 211 LEU 1 CD1   1 
ATOM   1657  C  CD2   . LEU A  1  211 ? -6.376   -36.754  384.016 1.00 14.16  ? 211 LEU 1 CD2   1 
ATOM   1658  N  N     . TRP A  1  212 ? -8.591   -38.797  379.511 1.00 18.41  ? 212 TRP 1 N     1 
ATOM   1659  C  CA    . TRP A  1  212 ? -9.063   -40.087  379.021 1.00 15.75  ? 212 TRP 1 CA    1 
ATOM   1660  C  C     . TRP A  1  212 ? -10.530  -39.994  378.629 1.00 22.60  ? 212 TRP 1 C     1 
ATOM   1661  O  O     . TRP A  1  212 ? -11.306  -40.931  378.826 1.00 34.29  ? 212 TRP 1 O     1 
ATOM   1662  C  CB    . TRP A  1  212 ? -8.844   -41.201  380.046 1.00 12.29  ? 212 TRP 1 CB    1 
ATOM   1663  C  CG    . TRP A  1  212 ? -7.410   -41.524  380.214 1.00 12.30  ? 212 TRP 1 CG    1 
ATOM   1664  C  CD1   . TRP A  1  212 ? -6.615   -42.162  379.311 1.00 13.52  ? 212 TRP 1 CD1   1 
ATOM   1665  C  CD2   . TRP A  1  212 ? -6.601   -41.316  381.384 1.00 12.37  ? 212 TRP 1 CD2   1 
ATOM   1666  N  NE1   . TRP A  1  212 ? -5.344   -42.302  379.813 1.00 12.29  ? 212 TRP 1 NE1   1 
ATOM   1667  C  CE2   . TRP A  1  212 ? -5.314   -41.804  381.089 1.00 12.36  ? 212 TRP 1 CE2   1 
ATOM   1668  C  CE3   . TRP A  1  212 ? -6.833   -40.744  382.639 1.00 12.44  ? 212 TRP 1 CE3   1 
ATOM   1669  C  CZ2   . TRP A  1  212 ? -4.266   -41.739  382.002 1.00 12.42  ? 212 TRP 1 CZ2   1 
ATOM   1670  C  CZ3   . TRP A  1  212 ? -5.785   -40.680  383.542 1.00 12.50  ? 212 TRP 1 CZ3   1 
ATOM   1671  C  CH2   . TRP A  1  212 ? -4.522   -41.173  383.220 1.00 12.49  ? 212 TRP 1 CH2   1 
ATOM   1672  N  N     . GLY A  1  213 ? -10.916  -38.844  378.074 1.00 20.11  ? 213 GLY 1 N     1 
ATOM   1673  C  CA    . GLY A  1  213 ? -12.268  -38.669  377.604 1.00 19.61  ? 213 GLY 1 CA    1 
ATOM   1674  C  C     . GLY A  1  213 ? -13.319  -38.503  378.678 1.00 12.37  ? 213 GLY 1 C     1 
ATOM   1675  O  O     . GLY A  1  213 ? -14.502  -38.382  378.344 1.00 12.36  ? 213 GLY 1 O     1 
ATOM   1676  N  N     . LYS A  1  214 ? -12.957  -38.570  379.934 1.00 12.41  ? 214 LYS 1 N     1 
ATOM   1677  C  CA    . LYS A  1  214 ? -13.988  -38.433  380.948 1.00 21.31  ? 214 LYS 1 CA    1 
ATOM   1678  C  C     . LYS A  1  214 ? -14.161  -36.969  381.330 1.00 37.91  ? 214 LYS 1 C     1 
ATOM   1679  O  O     . LYS A  1  214 ? -13.243  -36.155  381.162 1.00 47.25  ? 214 LYS 1 O     1 
ATOM   1680  C  CB    . LYS A  1  214 ? -13.640  -39.289  382.156 1.00 24.65  ? 214 LYS 1 CB    1 
ATOM   1681  C  CG    . LYS A  1  214 ? -13.565  -40.774  381.786 1.00 23.92  ? 214 LYS 1 CG    1 
ATOM   1682  C  CD    . LYS A  1  214 ? -14.789  -41.251  380.991 1.00 16.97  ? 214 LYS 1 CD    1 
ATOM   1683  C  CE    . LYS A  1  214 ? -14.764  -42.749  380.881 1.00 12.58  ? 214 LYS 1 CE    1 
ATOM   1684  N  NZ    . LYS A  1  214 ? -13.349  -43.159  380.662 1.00 12.11  ? 214 LYS 1 NZ    1 
ATOM   1685  N  N     . PRO A  1  215 ? -15.348  -36.587  381.831 1.00 35.12  ? 215 PRO 1 N     1 
ATOM   1686  C  CA    . PRO A  1  215 ? -15.652  -35.154  382.005 1.00 35.03  ? 215 PRO 1 CA    1 
ATOM   1687  C  C     . PRO A  1  215 ? -14.884  -34.526  383.161 1.00 29.43  ? 215 PRO 1 C     1 
ATOM   1688  O  O     . PRO A  1  215 ? -15.377  -34.466  384.291 1.00 28.94  ? 215 PRO 1 O     1 
ATOM   1689  C  CB    . PRO A  1  215 ? -17.166  -35.153  382.262 1.00 35.09  ? 215 PRO 1 CB    1 
ATOM   1690  C  CG    . PRO A  1  215 ? -17.662  -36.490  381.730 1.00 31.78  ? 215 PRO 1 CG    1 
ATOM   1691  C  CD    . PRO A  1  215 ? -16.544  -37.438  381.994 1.00 33.00  ? 215 PRO 1 CD    1 
ATOM   1692  N  N     . THR A  1  216 ? -13.659  -34.082  382.903 1.00 25.30  ? 216 THR 1 N     1 
ATOM   1693  C  CA    . THR A  1  216 ? -12.807  -33.608  383.986 1.00 28.08  ? 216 THR 1 CA    1 
ATOM   1694  C  C     . THR A  1  216 ? -13.004  -32.112  384.240 1.00 28.31  ? 216 THR 1 C     1 
ATOM   1695  O  O     . THR A  1  216 ? -13.418  -31.357  383.355 1.00 29.21  ? 216 THR 1 O     1 
ATOM   1696  C  CB    . THR A  1  216 ? -11.329  -33.918  383.699 1.00 25.69  ? 216 THR 1 CB    1 
ATOM   1697  O  OG1   . THR A  1  216 ? -10.841  -33.099  382.628 1.00 26.84  ? 216 THR 1 OG1   1 
ATOM   1698  C  CG2   . THR A  1  216 ? -11.155  -35.370  383.350 1.00 25.70  ? 216 THR 1 CG2   1 
ATOM   1699  N  N     . THR A  1  217 ? -12.736  -31.698  385.483 1.00 28.23  ? 217 THR 1 N     1 
ATOM   1700  C  CA    . THR A  1  217 ? -12.798  -30.296  385.880 1.00 29.67  ? 217 THR 1 CA    1 
ATOM   1701  C  C     . THR A  1  217 ? -11.508  -29.945  386.600 1.00 23.05  ? 217 THR 1 C     1 
ATOM   1702  O  O     . THR A  1  217 ? -11.058  -30.683  387.482 1.00 14.87  ? 217 THR 1 O     1 
ATOM   1703  C  CB    . THR A  1  217 ? -14.009  -30.009  386.783 1.00 33.33  ? 217 THR 1 CB    1 
ATOM   1704  O  OG1   . THR A  1  217 ? -15.212  -30.169  386.027 1.00 33.50  ? 217 THR 1 OG1   1 
ATOM   1705  C  CG2   . THR A  1  217 ? -13.963  -28.566  387.313 1.00 35.95  ? 217 THR 1 CG2   1 
ATOM   1706  N  N     . ILE A  1  218 ? -10.927  -28.811  386.228 1.00 28.44  ? 218 ILE 1 N     1 
ATOM   1707  C  CA    . ILE A  1  218 ? -9.627   -28.374  386.717 1.00 28.67  ? 218 ILE 1 CA    1 
ATOM   1708  C  C     . ILE A  1  218 ? -9.799   -27.056  387.457 1.00 26.90  ? 218 ILE 1 C     1 
ATOM   1709  O  O     . ILE A  1  218 ? -10.438  -26.132  386.945 1.00 28.79  ? 218 ILE 1 O     1 
ATOM   1710  C  CB    . ILE A  1  218 ? -8.630   -28.247  385.550 1.00 31.88  ? 218 ILE 1 CB    1 
ATOM   1711  C  CG1   . ILE A  1  218 ? -8.549   -29.593  384.813 1.00 25.76  ? 218 ILE 1 CG1   1 
ATOM   1712  C  CG2   . ILE A  1  218 ? -7.273   -27.731  386.043 1.00 33.85  ? 218 ILE 1 CG2   1 
ATOM   1713  C  CD1   . ILE A  1  218 ? -8.256   -29.509  383.335 1.00 24.46  ? 218 ILE 1 CD1   1 
ATOM   1714  N  N     . ASN A  1  219 ? -9.218   -26.967  388.652 1.00 23.39  ? 219 ASN 1 N     1 
ATOM   1715  C  CA    . ASN A  1  219 ? -9.351   -25.794  389.496 1.00 22.23  ? 219 ASN 1 CA    1 
ATOM   1716  C  C     . ASN A  1  219 ? -7.994   -25.347  390.010 1.00 20.01  ? 219 ASN 1 C     1 
ATOM   1717  O  O     . ASN A  1  219 ? -7.095   -26.153  390.246 1.00 13.66  ? 219 ASN 1 O     1 
ATOM   1718  C  CB    . ASN A  1  219 ? -10.274  -26.055  390.714 1.00 21.39  ? 219 ASN 1 CB    1 
ATOM   1719  C  CG    . ASN A  1  219 ? -11.746  -25.769  390.427 1.00 22.87  ? 219 ASN 1 CG    1 
ATOM   1720  O  OD1   . ASN A  1  219 ? -12.610  -26.617  390.640 1.00 23.50  ? 219 ASN 1 OD1   1 
ATOM   1721  N  ND2   . ASN A  1  219 ? -12.033  -24.565  389.952 1.00 23.55  ? 219 ASN 1 ND2   1 
ATOM   1722  N  N     . ASN A  1  220 ? -7.877   -24.044  390.221 1.00 24.23  ? 220 ASN 1 N     1 
ATOM   1723  C  CA    . ASN A  1  220 ? -6.699   -23.490  390.857 1.00 20.87  ? 220 ASN 1 CA    1 
ATOM   1724  C  C     . ASN A  1  220 ? -6.630   -23.981  392.297 1.00 25.96  ? 220 ASN 1 C     1 
ATOM   1725  O  O     . ASN A  1  220 ? -7.653   -24.223  392.943 1.00 28.38  ? 220 ASN 1 O     1 
ATOM   1726  C  CB    . ASN A  1  220 ? -6.758   -21.961  390.816 1.00 17.47  ? 220 ASN 1 CB    1 
ATOM   1727  C  CG    . ASN A  1  220 ? -5.480   -21.312  391.271 1.00 14.04  ? 220 ASN 1 CG    1 
ATOM   1728  O  OD1   . ASN A  1  220 ? -5.456   -20.646  392.300 1.00 14.12  ? 220 ASN 1 OD1   1 
ATOM   1729  N  ND2   . ASN A  1  220 ? -4.417   -21.468  390.493 1.00 14.03  ? 220 ASN 1 ND2   1 
ATOM   1730  N  N     . VAL A  1  221 ? -5.402   -24.132  392.791 1.00 26.10  ? 221 VAL 1 N     1 
ATOM   1731  C  CA    . VAL A  1  221 ? -5.191   -24.619  394.152 1.00 25.92  ? 221 VAL 1 CA    1 
ATOM   1732  C  C     . VAL A  1  221 ? -5.801   -23.654  395.159 1.00 29.74  ? 221 VAL 1 C     1 
ATOM   1733  O  O     . VAL A  1  221 ? -6.511   -24.059  396.089 1.00 34.88  ? 221 VAL 1 O     1 
ATOM   1734  C  CB    . VAL A  1  221 ? -3.690   -24.811  394.413 1.00 22.14  ? 221 VAL 1 CB    1 
ATOM   1735  C  CG1   . VAL A  1  221 ? -3.447   -25.246  395.845 1.00 22.09  ? 221 VAL 1 CG1   1 
ATOM   1736  C  CG2   . VAL A  1  221 ? -3.123   -25.792  393.430 1.00 23.49  ? 221 VAL 1 CG2   1 
ATOM   1737  N  N     . GLU A  1  222 ? -5.550   -22.358  394.972 1.00 25.00  ? 222 GLU 1 N     1 
ATOM   1738  C  CA    . GLU A  1  222 ? -6.100   -21.365  395.882 1.00 25.67  ? 222 GLU 1 CA    1 
ATOM   1739  C  C     . GLU A  1  222 ? -7.618   -21.458  395.928 1.00 23.06  ? 222 GLU 1 C     1 
ATOM   1740  O  O     . GLU A  1  222 ? -8.214   -21.293  396.996 1.00 18.11  ? 222 GLU 1 O     1 
ATOM   1741  C  CB    . GLU A  1  222 ? -5.641   -19.961  395.463 1.00 31.45  ? 222 GLU 1 CB    1 
ATOM   1742  C  CG    . GLU A  1  222 ? -5.974   -18.850  396.493 1.00 29.87  ? 222 GLU 1 CG    1 
ATOM   1743  C  CD    . GLU A  1  222 ? -6.026   -17.445  395.899 1.00 19.46  ? 222 GLU 1 CD    1 
ATOM   1744  O  OE1   . GLU A  1  222 ? -5.225   -17.129  395.000 1.00 18.84  ? 222 GLU 1 OE1   1 
ATOM   1745  O  OE2   . GLU A  1  222 ? -6.925   -16.680  396.289 1.00 20.03  ? 222 GLU 1 OE2   1 
ATOM   1746  N  N     . THR A  1  223 ? -8.253   -21.787  394.790 1.00 31.52  ? 223 THR 1 N     1 
ATOM   1747  C  CA    . THR A  1  223 ? -9.714   -21.931  394.724 1.00 34.95  ? 223 THR 1 CA    1 
ATOM   1748  C  C     . THR A  1  223 ? -10.195  -23.137  395.530 1.00 36.73  ? 223 THR 1 C     1 
ATOM   1749  O  O     . THR A  1  223 ? -11.158  -23.045  396.309 1.00 37.55  ? 223 THR 1 O     1 
ATOM   1750  C  CB    . THR A  1  223 ? -10.179  -22.057  393.265 1.00 40.21  ? 223 THR 1 CB    1 
ATOM   1751  O  OG1   . THR A  1  223 ? -9.492   -21.114  392.435 1.00 38.34  ? 223 THR 1 OG1   1 
ATOM   1752  C  CG2   . THR A  1  223 ? -11.669  -21.806  393.155 1.00 40.98  ? 223 THR 1 CG2   1 
ATOM   1753  N  N     . LEU A  1  224 ? -9.541   -24.283  395.340 1.00 27.38  ? 224 LEU 1 N     1 
ATOM   1754  C  CA    . LEU A  1  224 ? -9.886   -25.455  396.125 1.00 28.68  ? 224 LEU 1 CA    1 
ATOM   1755  C  C     . LEU A  1  224 ? -9.771   -25.154  397.615 1.00 26.02  ? 224 LEU 1 C     1 
ATOM   1756  O  O     . LEU A  1  224 ? -10.699  -25.425  398.386 1.00 24.05  ? 224 LEU 1 O     1 
ATOM   1757  C  CB    . LEU A  1  224 ? -8.968   -26.613  395.725 1.00 31.03  ? 224 LEU 1 CB    1 
ATOM   1758  C  CG    . LEU A  1  224 ? -9.128   -27.113  394.286 1.00 39.32  ? 224 LEU 1 CG    1 
ATOM   1759  C  CD1   . LEU A  1  224 ? -8.100   -28.189  393.953 1.00 39.48  ? 224 LEU 1 CD1   1 
ATOM   1760  C  CD2   . LEU A  1  224 ? -10.546  -27.642  394.065 1.00 44.36  ? 224 LEU 1 CD2   1 
ATOM   1761  N  N     . ALA A  1  225 ? -8.698   -24.473  398.015 1.00 33.21  ? 225 ALA 1 N     1 
ATOM   1762  C  CA    . ALA A  1  225 ? -8.529   -24.137  399.425 1.00 36.36  ? 225 ALA 1 CA    1 
ATOM   1763  C  C     . ALA A  1  225 ? -9.645   -23.211  399.902 1.00 40.55  ? 225 ALA 1 C     1 
ATOM   1764  O  O     . ALA A  1  225 ? -10.325  -23.502  400.892 1.00 45.21  ? 225 ALA 1 O     1 
ATOM   1765  C  CB    . ALA A  1  225 ? -7.155   -23.498  399.649 1.00 40.98  ? 225 ALA 1 CB    1 
ATOM   1766  N  N     . SER A  1  226 ? -9.903   -22.132  399.150 1.00 31.31  ? 226 SER 1 N     1 
ATOM   1767  C  CA    . SER A  1  226 ? -10.887  -21.103  399.480 1.00 25.30  ? 226 SER 1 CA    1 
ATOM   1768  C  C     . SER A  1  226 ? -12.307  -21.635  399.514 1.00 23.08  ? 226 SER 1 C     1 
ATOM   1769  O  O     . SER A  1  226 ? -13.215  -20.887  399.898 1.00 14.27  ? 226 SER 1 O     1 
ATOM   1770  C  CB    . SER A  1  226 ? -10.840  -19.980  398.462 1.00 15.08  ? 226 SER 1 CB    1 
ATOM   1771  O  OG    . SER A  1  226 ? -9.637   -19.260  398.549 1.00 14.36  ? 226 SER 1 OG    1 
ATOM   1772  N  N     . VAL A  1  227 ? -12.527  -22.850  398.997 1.00 24.10  ? 227 VAL 1 N     1 
ATOM   1773  C  CA    . VAL A  1  227 ? -13.818  -23.518  399.176 1.00 17.21  ? 227 VAL 1 CA    1 
ATOM   1774  C  C     . VAL A  1  227 ? -14.112  -23.743  400.657 1.00 14.82  ? 227 VAL 1 C     1 
ATOM   1775  O  O     . VAL A  1  227 ? -15.268  -23.681  401.091 1.00 14.12  ? 227 VAL 1 O     1 
ATOM   1776  C  CB    . VAL A  1  227 ? -13.860  -24.844  398.398 1.00 18.38  ? 227 VAL 1 CB    1 
ATOM   1777  C  CG1   . VAL A  1  227 ? -15.143  -25.596  398.718 1.00 13.91  ? 227 VAL 1 CG1   1 
ATOM   1778  C  CG2   . VAL A  1  227 ? -13.749  -24.591  396.904 1.00 19.15  ? 227 VAL 1 CG2   1 
ATOM   1779  N  N     . VAL A  1  228 ? -13.084  -24.033  401.456 1.00 19.88  ? 228 VAL 1 N     1 
ATOM   1780  C  CA    . VAL A  1  228 ? -13.328  -24.417  402.846 1.00 24.49  ? 228 VAL 1 CA    1 
ATOM   1781  C  C     . VAL A  1  228 ? -13.939  -23.279  403.653 1.00 21.03  ? 228 VAL 1 C     1 
ATOM   1782  O  O     . VAL A  1  228 ? -14.973  -23.504  404.302 1.00 14.26  ? 228 VAL 1 O     1 
ATOM   1783  C  CB    . VAL A  1  228 ? -12.039  -24.965  403.481 1.00 21.93  ? 228 VAL 1 CB    1 
ATOM   1784  C  CG1   . VAL A  1  228 ? -12.299  -25.394  404.906 1.00 24.92  ? 228 VAL 1 CG1   1 
ATOM   1785  C  CG2   . VAL A  1  228 ? -11.484  -26.117  402.654 1.00 33.56  ? 228 VAL 1 CG2   1 
ATOM   1786  N  N     . PRO A  1  229 ? -13.378  -22.052  403.660 1.00 31.68  ? 229 PRO 1 N     1 
ATOM   1787  C  CA    . PRO A  1  229 ? -14.042  -20.939  404.383 1.00 32.03  ? 229 PRO 1 CA    1 
ATOM   1788  C  C     . PRO A  1  229 ? -15.420  -20.586  403.860 1.00 36.98  ? 229 PRO 1 C     1 
ATOM   1789  O  O     . PRO A  1  229 ? -16.233  -20.010  404.600 1.00 36.96  ? 229 PRO 1 O     1 
ATOM   1790  C  CB    . PRO A  1  229 ? -13.074  -19.763  404.206 1.00 26.71  ? 229 PRO 1 CB    1 
ATOM   1791  C  CG    . PRO A  1  229 ? -12.076  -20.193  403.208 1.00 26.00  ? 229 PRO 1 CG    1 
ATOM   1792  C  CD    . PRO A  1  229 ? -12.029  -21.664  403.208 1.00 28.93  ? 229 PRO 1 CD    1 
ATOM   1793  N  N     . ILE A  1  230 ? -15.649  -20.808  402.564 1.00 39.45  ? 230 ILE 1 N     1 
ATOM   1794  C  CA    . ILE A  1  230 ? -16.963  -20.610  401.961 1.00 37.40  ? 230 ILE 1 CA    1 
ATOM   1795  C  C     . ILE A  1  230 ? -17.994  -21.514  402.622 1.00 30.12  ? 230 ILE 1 C     1 
ATOM   1796  O  O     . ILE A  1  230 ? -19.032  -21.054  403.110 1.00 29.96  ? 230 ILE 1 O     1 
ATOM   1797  C  CB    . ILE A  1  230 ? -16.884  -20.886  400.446 1.00 38.31  ? 230 ILE 1 CB    1 
ATOM   1798  C  CG1   . ILE A  1  230 ? -16.083  -19.771  399.742 1.00 43.77  ? 230 ILE 1 CG1   1 
ATOM   1799  C  CG2   . ILE A  1  230 ? -18.290  -21.144  399.869 1.00 33.41  ? 230 ILE 1 CG2   1 
ATOM   1800  C  CD1   . ILE A  1  230 ? -15.905  -19.943  398.239 1.00 44.96  ? 230 ILE 1 CD1   1 
ATOM   1801  N  N     . MET A  1  231 ? -17.716  -22.822  402.654 1.00 24.81  ? 231 MET 1 N     1 
ATOM   1802  C  CA    . MET A  1  231 ? -18.692  -23.754  403.210 1.00 19.29  ? 231 MET 1 CA    1 
ATOM   1803  C  C     . MET A  1  231 ? -18.733  -23.687  404.730 1.00 18.33  ? 231 MET 1 C     1 
ATOM   1804  O  O     . MET A  1  231 ? -19.820  -23.748  405.318 1.00 15.31  ? 231 MET 1 O     1 
ATOM   1805  C  CB    . MET A  1  231 ? -18.404  -25.204  402.777 1.00 18.09  ? 231 MET 1 CB    1 
ATOM   1806  C  CG    . MET A  1  231 ? -18.402  -25.565  401.292 1.00 17.90  ? 231 MET 1 CG    1 
ATOM   1807  S  SD    . MET A  1  231 ? -19.808  -24.934  400.352 1.00 22.48  ? 231 MET 1 SD    1 
ATOM   1808  C  CE    . MET A  1  231 ? -21.202  -25.751  401.126 1.00 21.28  ? 231 MET 1 CE    1 
ATOM   1809  N  N     . GLU A  1  232 ? -17.590  -23.459  405.379 1.00 18.88  ? 232 GLU 1 N     1 
ATOM   1810  C  CA    . GLU A  1  232 ? -17.513  -23.599  406.828 1.00 20.97  ? 232 GLU 1 CA    1 
ATOM   1811  C  C     . GLU A  1  232 ? -18.314  -22.529  407.540 1.00 26.60  ? 232 GLU 1 C     1 
ATOM   1812  O  O     . GLU A  1  232 ? -19.343  -22.842  408.152 1.00 30.03  ? 232 GLU 1 O     1 
ATOM   1813  C  CB    . GLU A  1  232 ? -16.048  -23.563  407.287 1.00 14.38  ? 232 GLU 1 CB    1 
ATOM   1814  C  CG    . GLU A  1  232 ? -15.866  -23.584  408.801 1.00 14.44  ? 232 GLU 1 CG    1 
ATOM   1815  C  CD    . GLU A  1  232 ? -14.408  -23.514  409.230 1.00 14.47  ? 232 GLU 1 CD    1 
ATOM   1816  O  OE1   . GLU A  1  232 ? -13.646  -22.713  408.658 1.00 14.50  ? 232 GLU 1 OE1   1 
ATOM   1817  O  OE2   . GLU A  1  232 ? -14.051  -24.159  410.232 1.00 14.47  ? 232 GLU 1 OE2   1 
ATOM   1818  N  N     . ARG A  1  233 ? -17.901  -21.268  407.409 1.00 37.14  ? 233 ARG 1 N     1 
ATOM   1819  C  CA    . ARG A  1  233 ? -18.582  -20.145  408.048 1.00 30.88  ? 233 ARG 1 CA    1 
ATOM   1820  C  C     . ARG A  1  233 ? -18.992  -19.193  406.936 1.00 31.68  ? 233 ARG 1 C     1 
ATOM   1821  O  O     . ARG A  1  233 ? -18.297  -18.222  406.639 1.00 30.15  ? 233 ARG 1 O     1 
ATOM   1822  C  CB    . ARG A  1  233 ? -17.688  -19.479  409.092 1.00 28.86  ? 233 ARG 1 CB    1 
ATOM   1823  C  CG    . ARG A  1  233 ? -16.262  -19.189  408.658 1.00 28.91  ? 233 ARG 1 CG    1 
ATOM   1824  C  CD    . ARG A  1  233 ? -15.413  -19.012  409.890 1.00 29.05  ? 233 ARG 1 CD    1 
ATOM   1825  N  NE    . ARG A  1  233 ? -14.004  -19.148  409.584 1.00 29.03  ? 233 ARG 1 NE    1 
ATOM   1826  C  CZ    . ARG A  1  233 ? -13.036  -18.622  410.320 1.00 29.21  ? 233 ARG 1 CZ    1 
ATOM   1827  N  NH1   . ARG A  1  233 ? -13.329  -17.941  411.418 1.00 29.41  ? 233 ARG 1 NH1   1 
ATOM   1828  N  NH2   . ARG A  1  233 ? -11.772  -18.787  409.963 1.00 29.18  ? 233 ARG 1 NH2   1 
ATOM   1829  N  N     . GLY A  1  234 ? -20.131  -19.490  406.313 1.00 37.12  ? 234 GLY 1 N     1 
ATOM   1830  C  CA    . GLY A  1  234 ? -20.752  -18.583  405.365 1.00 44.50  ? 234 GLY 1 CA    1 
ATOM   1831  C  C     . GLY A  1  234 ? -20.073  -18.470  404.012 1.00 48.11  ? 234 GLY 1 C     1 
ATOM   1832  O  O     . GLY A  1  234 ? -18.841  -18.510  403.911 1.00 48.38  ? 234 GLY 1 O     1 
ATOM   1833  N  N     . ALA A  1  235 ? -20.875  -18.333  402.958 1.00 51.31  ? 235 ALA 1 N     1 
ATOM   1834  C  CA    . ALA A  1  235 ? -20.361  -17.868  401.676 1.00 53.20  ? 235 ALA 1 CA    1 
ATOM   1835  C  C     . ALA A  1  235 ? -20.385  -16.348  401.577 1.00 60.49  ? 235 ALA 1 C     1 
ATOM   1836  O  O     . ALA A  1  235 ? -19.486  -15.752  400.975 1.00 63.75  ? 235 ALA 1 O     1 
ATOM   1837  C  CB    . ALA A  1  235 ? -21.167  -18.476  400.525 1.00 52.33  ? 235 ALA 1 CB    1 
ATOM   1838  N  N     . ASP A  1  236 ? -21.404  -15.704  402.157 1.00 61.49  ? 236 ASP 1 N     1 
ATOM   1839  C  CA    . ASP A  1  236 ? -21.410  -14.245  402.224 1.00 60.87  ? 236 ASP 1 CA    1 
ATOM   1840  C  C     . ASP A  1  236 ? -20.199  -13.737  402.983 1.00 56.59  ? 236 ASP 1 C     1 
ATOM   1841  O  O     . ASP A  1  236 ? -19.674  -12.664  402.666 1.00 57.45  ? 236 ASP 1 O     1 
ATOM   1842  C  CB    . ASP A  1  236 ? -22.699  -13.741  402.877 1.00 64.87  ? 236 ASP 1 CB    1 
ATOM   1843  C  CG    . ASP A  1  236 ? -23.897  -13.818  401.942 1.00 69.44  ? 236 ASP 1 CG    1 
ATOM   1844  O  OD1   . ASP A  1  236 ? -23.906  -13.078  400.934 1.00 71.50  ? 236 ASP 1 OD1   1 
ATOM   1845  O  OD2   . ASP A  1  236 ? -24.830  -14.607  402.211 1.00 70.01  ? 236 ASP 1 OD2   1 
ATOM   1846  N  N     . TRP A  1  237 ? -19.739  -14.506  403.976 1.00 52.43  ? 237 TRP 1 N     1 
ATOM   1847  C  CA    . TRP A  1  237 ? -18.488  -14.186  404.651 1.00 51.69  ? 237 TRP 1 CA    1 
ATOM   1848  C  C     . TRP A  1  237 ? -17.366  -14.053  403.632 1.00 61.69  ? 237 TRP 1 C     1 
ATOM   1849  O  O     . TRP A  1  237 ? -16.505  -13.175  403.751 1.00 67.65  ? 237 TRP 1 O     1 
ATOM   1850  C  CB    . TRP A  1  237 ? -18.146  -15.269  405.677 1.00 40.02  ? 237 TRP 1 CB    1 
ATOM   1851  C  CG    . TRP A  1  237 ? -16.837  -15.041  406.372 1.00 35.64  ? 237 TRP 1 CG    1 
ATOM   1852  C  CD1   . TRP A  1  237 ? -16.639  -14.414  407.571 1.00 32.17  ? 237 TRP 1 CD1   1 
ATOM   1853  C  CD2   . TRP A  1  237 ? -15.535  -15.352  405.865 1.00 32.59  ? 237 TRP 1 CD2   1 
ATOM   1854  N  NE1   . TRP A  1  237 ? -15.295  -14.366  407.863 1.00 29.86  ? 237 TRP 1 NE1   1 
ATOM   1855  C  CE2   . TRP A  1  237 ? -14.597  -14.929  406.828 1.00 30.90  ? 237 TRP 1 CE2   1 
ATOM   1856  C  CE3   . TRP A  1  237 ? -15.071  -15.966  404.699 1.00 33.22  ? 237 TRP 1 CE3   1 
ATOM   1857  C  CZ2   . TRP A  1  237 ? -13.225  -15.102  406.656 1.00 30.99  ? 237 TRP 1 CZ2   1 
ATOM   1858  C  CZ3   . TRP A  1  237 ? -13.705  -16.133  404.533 1.00 32.90  ? 237 TRP 1 CZ3   1 
ATOM   1859  C  CH2   . TRP A  1  237 ? -12.801  -15.706  405.506 1.00 31.84  ? 237 TRP 1 CH2   1 
ATOM   1860  N  N     . PHE A  1  238 ? -17.345  -14.933  402.631 1.00 67.87  ? 238 PHE 1 N     1 
ATOM   1861  C  CA    . PHE A  1  238 ? -16.398  -14.764  401.534 1.00 77.36  ? 238 PHE 1 CA    1 
ATOM   1862  C  C     . PHE A  1  238 ? -16.723  -13.511  400.723 1.00 87.50  ? 238 PHE 1 C     1 
ATOM   1863  O  O     . PHE A  1  238 ? -15.844  -12.686  400.454 1.00 90.84  ? 238 PHE 1 O     1 
ATOM   1864  C  CB    . PHE A  1  238 ? -16.383  -16.008  400.639 1.00 76.81  ? 238 PHE 1 CB    1 
ATOM   1865  C  CG    . PHE A  1  238 ? -15.324  -15.963  399.577 1.00 78.04  ? 238 PHE 1 CG    1 
ATOM   1866  C  CD1   . PHE A  1  238 ? -14.043  -16.413  399.839 1.00 77.77  ? 238 PHE 1 CD1   1 
ATOM   1867  C  CD2   . PHE A  1  238 ? -15.603  -15.456  398.319 1.00 79.55  ? 238 PHE 1 CD2   1 
ATOM   1868  C  CE1   . PHE A  1  238 ? -13.063  -16.362  398.866 1.00 76.95  ? 238 PHE 1 CE1   1 
ATOM   1869  C  CE2   . PHE A  1  238 ? -14.623  -15.403  397.345 1.00 78.86  ? 238 PHE 1 CE2   1 
ATOM   1870  C  CZ    . PHE A  1  238 ? -13.354  -15.857  397.622 1.00 77.44  ? 238 PHE 1 CZ    1 
ATOM   1871  N  N     . ALA A  1  239 ? -17.993  -13.337  400.353 1.00 93.31  ? 239 ALA 1 N     1 
ATOM   1872  C  CA    . ALA A  1  239 ? -18.431  -12.170  399.591 1.00 99.48  ? 239 ALA 1 CA    1 
ATOM   1873  C  C     . ALA A  1  239 ? -18.297  -10.864  400.367 1.00 105.61 ? 239 ALA 1 C     1 
ATOM   1874  O  O     . ALA A  1  239 ? -18.451  -9.790   399.773 1.00 106.66 ? 239 ALA 1 O     1 
ATOM   1875  C  CB    . ALA A  1  239 ? -19.883  -12.361  399.139 1.00 100.09 ? 239 ALA 1 CB    1 
ATOM   1876  N  N     . GLN A  1  240 ? -17.997  -10.929  401.664 1.00 108.23 ? 240 GLN 1 N     1 
ATOM   1877  C  CA    . GLN A  1  240 ? -17.832  -9.748   402.499 1.00 112.09 ? 240 GLN 1 CA    1 
ATOM   1878  C  C     . GLN A  1  240 ? -16.576  -8.951   402.154 1.00 109.30 ? 240 GLN 1 C     1 
ATOM   1879  O  O     . GLN A  1  240 ? -16.427  -7.818   402.628 1.00 112.26 ? 240 GLN 1 O     1 
ATOM   1880  C  CB    . GLN A  1  240 ? -17.807  -10.213  403.962 1.00 116.71 ? 240 GLN 1 CB    1 
ATOM   1881  C  CG    . GLN A  1  240 ? -17.610  -9.162   405.032 1.00 123.65 ? 240 GLN 1 CG    1 
ATOM   1882  C  CD    . GLN A  1  240 ? -17.563  -9.776   406.418 1.00 127.56 ? 240 GLN 1 CD    1 
ATOM   1883  O  OE1   . GLN A  1  240 ? -18.526  -10.399  406.866 1.00 128.02 ? 240 GLN 1 OE1   1 
ATOM   1884  N  NE2   . GLN A  1  240 ? -16.443  -9.600   407.108 1.00 129.84 ? 240 GLN 1 NE2   1 
ATOM   1885  N  N     . MET A  1  241 ? -15.707  -9.482   401.295 1.00 106.08 ? 241 MET 1 N     1 
ATOM   1886  C  CA    . MET A  1  241 ? -14.434  -8.860   400.947 1.00 101.69 ? 241 MET 1 CA    1 
ATOM   1887  C  C     . MET A  1  241 ? -14.409  -8.478   399.472 1.00 98.29  ? 241 MET 1 C     1 
ATOM   1888  O  O     . MET A  1  241 ? -14.802  -9.275   398.614 1.00 97.55  ? 241 MET 1 O     1 
ATOM   1889  C  CB    . MET A  1  241 ? -13.280  -9.817   401.278 1.00 100.59 ? 241 MET 1 CB    1 
ATOM   1890  C  CG    . MET A  1  241 ? -12.914  -9.865   402.757 1.00 96.43  ? 241 MET 1 CG    1 
ATOM   1891  S  SD    . MET A  1  241 ? -11.822  -11.224  403.246 1.00 89.19  ? 241 MET 1 SD    1 
ATOM   1892  C  CE    . MET A  1  241 ? -13.043  -12.477  403.585 1.00 85.82  ? 241 MET 1 CE    1 
ATOM   1893  N  N     . GLY A  1  242 ? -13.945  -7.261   399.180 1.00 94.01  ? 242 GLY 1 N     1 
ATOM   1894  C  CA    . GLY A  1  242 ? -13.685  -6.855   397.812 1.00 91.39  ? 242 GLY 1 CA    1 
ATOM   1895  C  C     . GLY A  1  242 ? -14.831  -6.115   397.147 1.00 89.87  ? 242 GLY 1 C     1 
ATOM   1896  O  O     . GLY A  1  242 ? -15.899  -5.878   397.721 1.00 86.65  ? 242 GLY 1 O     1 
ATOM   1897  N  N     . THR A  1  243 ? -14.594  -5.753   395.885 1.00 91.59  ? 243 THR 1 N     1 
ATOM   1898  C  CA    . THR A  1  243 ? -15.537  -4.952   395.112 1.00 93.53  ? 243 THR 1 CA    1 
ATOM   1899  C  C     . THR A  1  243 ? -16.600  -5.884   394.520 1.00 92.51  ? 243 THR 1 C     1 
ATOM   1900  O  O     . THR A  1  243 ? -16.636  -7.081   394.812 1.00 93.97  ? 243 THR 1 O     1 
ATOM   1901  C  CB    . THR A  1  243 ? -14.787  -4.141   394.052 1.00 95.72  ? 243 THR 1 CB    1 
ATOM   1902  O  OG1   . THR A  1  243 ? -13.539  -3.694   394.593 1.00 96.92  ? 243 THR 1 OG1   1 
ATOM   1903  C  CG2   . THR A  1  243 ? -15.581  -2.891   393.653 1.00 96.14  ? 243 THR 1 CG2   1 
ATOM   1904  N  N     . GLU A  1  244 ? -17.480  -5.348   393.666 1.00 90.40  ? 244 GLU 1 N     1 
ATOM   1905  C  CA    . GLU A  1  244 ? -18.619  -6.113   393.165 1.00 87.91  ? 244 GLU 1 CA    1 
ATOM   1906  C  C     . GLU A  1  244 ? -18.221  -7.213   392.191 1.00 80.61  ? 244 GLU 1 C     1 
ATOM   1907  O  O     . GLU A  1  244 ? -18.981  -8.171   392.025 1.00 81.56  ? 244 GLU 1 O     1 
ATOM   1908  C  CB    . GLU A  1  244 ? -19.628  -5.191   392.480 1.00 93.03  ? 244 GLU 1 CB    1 
ATOM   1909  C  CG    . GLU A  1  244 ? -21.050  -5.742   392.433 1.00 95.88  ? 244 GLU 1 CG    1 
ATOM   1910  C  CD    . GLU A  1  244 ? -21.892  -5.061   391.372 1.00 98.75  ? 244 GLU 1 CD    1 
ATOM   1911  O  OE1   . GLU A  1  244 ? -21.825  -3.817   391.266 1.00 100.55 ? 244 GLU 1 OE1   1 
ATOM   1912  O  OE2   . GLU A  1  244 ? -22.620  -5.766   390.644 1.00 98.80  ? 244 GLU 1 OE2   1 
ATOM   1913  N  N     . GLN A  1  245 ? -17.067  -7.097   391.530 1.00 73.30  ? 245 GLN 1 N     1 
ATOM   1914  C  CA    . GLN A  1  245 ? -16.596  -8.159   390.653 1.00 67.84  ? 245 GLN 1 CA    1 
ATOM   1915  C  C     . GLN A  1  245 ? -15.419  -8.932   391.225 1.00 64.08  ? 245 GLN 1 C     1 
ATOM   1916  O  O     . GLN A  1  245 ? -15.171  -10.064  390.793 1.00 55.81  ? 245 GLN 1 O     1 
ATOM   1917  C  CB    . GLN A  1  245 ? -16.196  -7.593   389.282 1.00 63.96  ? 245 GLN 1 CB    1 
ATOM   1918  C  CG    . GLN A  1  245 ? -17.350  -7.440   388.310 1.00 60.17  ? 245 GLN 1 CG    1 
ATOM   1919  C  CD    . GLN A  1  245 ? -16.893  -7.505   386.869 1.00 56.99  ? 245 GLN 1 CD    1 
ATOM   1920  O  OE1   . GLN A  1  245 ? -16.149  -6.644   386.406 1.00 59.15  ? 245 GLN 1 OE1   1 
ATOM   1921  N  NE2   . GLN A  1  245 ? -17.331  -8.528   386.154 1.00 52.97  ? 245 GLN 1 NE2   1 
ATOM   1922  N  N     . SER A  1  246 ? -14.739  -8.380   392.221 1.00 70.27  ? 246 SER 1 N     1 
ATOM   1923  C  CA    . SER A  1  246 ? -13.601  -9.018   392.873 1.00 71.37  ? 246 SER 1 CA    1 
ATOM   1924  C  C     . SER A  1  246 ? -14.045  -9.324   394.304 1.00 68.64  ? 246 SER 1 C     1 
ATOM   1925  O  O     . SER A  1  246 ? -13.817  -8.539   395.227 1.00 66.52  ? 246 SER 1 O     1 
ATOM   1926  C  CB    . SER A  1  246 ? -12.359  -8.105   392.834 1.00 72.34  ? 246 SER 1 CB    1 
ATOM   1927  O  OG    . SER A  1  246 ? -11.877  -7.901   391.513 1.00 71.77  ? 246 SER 1 OG    1 
ATOM   1928  N  N     . LYS A  1  247 ? -14.696  -10.474  394.477 1.00 65.14  ? 247 LYS 1 N     1 
ATOM   1929  C  CA    . LYS A  1  247 ? -15.202  -10.901  395.774 1.00 59.62  ? 247 LYS 1 CA    1 
ATOM   1930  C  C     . LYS A  1  247 ? -14.147  -11.700  396.533 1.00 57.85  ? 247 LYS 1 C     1 
ATOM   1931  O  O     . LYS A  1  247 ? -13.313  -12.391  395.939 1.00 58.72  ? 247 LYS 1 O     1 
ATOM   1932  C  CB    . LYS A  1  247 ? -16.473  -11.737  395.610 1.00 54.71  ? 247 LYS 1 CB    1 
ATOM   1933  C  CG    . LYS A  1  247 ? -17.637  -10.969  395.012 1.00 49.15  ? 247 LYS 1 CG    1 
ATOM   1934  C  CD    . LYS A  1  247 ? -18.123  -9.912   395.995 1.00 45.62  ? 247 LYS 1 CD    1 
ATOM   1935  C  CE    . LYS A  1  247 ? -19.340  -9.170   395.462 1.00 44.33  ? 247 LYS 1 CE    1 
ATOM   1936  N  NZ    . LYS A  1  247 ? -19.788  -8.025   396.315 1.00 42.78  ? 247 LYS 1 NZ    1 
ATOM   1937  N  N     . GLY A  1  248 ? -14.195  -11.591  397.862 1.00 53.00  ? 248 GLY 1 N     1 
ATOM   1938  C  CA    . GLY A  1  248 ? -13.351  -12.378  398.725 1.00 46.33  ? 248 GLY 1 CA    1 
ATOM   1939  C  C     . GLY A  1  248 ? -11.955  -11.810  398.876 1.00 41.81  ? 248 GLY 1 C     1 
ATOM   1940  O  O     . GLY A  1  248 ? -11.598  -10.754  398.352 1.00 40.48  ? 248 GLY 1 O     1 
ATOM   1941  N  N     . MET A  1  249 ? -11.141  -12.582  399.574 1.00 41.35  ? 249 MET 1 N     1 
ATOM   1942  C  CA    . MET A  1  249 ? -9.749   -12.273  399.851 1.00 42.52  ? 249 MET 1 CA    1 
ATOM   1943  C  C     . MET A  1  249 ? -8.837   -12.903  398.796 1.00 38.77  ? 249 MET 1 C     1 
ATOM   1944  O  O     . MET A  1  249 ? -9.278   -13.645  397.919 1.00 40.52  ? 249 MET 1 O     1 
ATOM   1945  C  CB    . MET A  1  249 ? -9.411   -12.757  401.265 1.00 42.33  ? 249 MET 1 CB    1 
ATOM   1946  C  CG    . MET A  1  249 ? -9.472   -14.290  401.460 1.00 45.85  ? 249 MET 1 CG    1 
ATOM   1947  S  SD    . MET A  1  249 ? -11.123  -15.107  401.272 1.00 46.73  ? 249 MET 1 SD    1 
ATOM   1948  C  CE    . MET A  1  249 ? -10.817  -16.784  401.807 1.00 42.79  ? 249 MET 1 CE    1 
ATOM   1949  N  N     . LYS A  1  250 ? -7.553   -12.564  398.862 1.00 29.90  ? 250 LYS 1 N     1 
ATOM   1950  C  CA    . LYS A  1  250 ? -6.577   -13.069  397.913 1.00 29.78  ? 250 LYS 1 CA    1 
ATOM   1951  C  C     . LYS A  1  250 ? -5.230   -13.115  398.621 1.00 29.85  ? 250 LYS 1 C     1 
ATOM   1952  O  O     . LYS A  1  250 ? -4.944   -12.280  399.480 1.00 30.08  ? 250 LYS 1 O     1 
ATOM   1953  C  CB    . LYS A  1  250 ? -6.515   -12.202  396.646 1.00 29.89  ? 250 LYS 1 CB    1 
ATOM   1954  C  CG    . LYS A  1  250 ? -5.387   -12.582  395.706 1.00 29.80  ? 250 LYS 1 CG    1 
ATOM   1955  C  CD    . LYS A  1  250 ? -5.572   -13.981  395.147 1.00 29.47  ? 250 LYS 1 CD    1 
ATOM   1956  C  CE    . LYS A  1  250 ? -4.473   -14.346  394.150 1.00 33.33  ? 250 LYS 1 CE    1 
ATOM   1957  N  NZ    . LYS A  1  250 ? -3.120   -14.322  394.773 1.00 29.47  ? 250 LYS 1 NZ    1 
ATOM   1958  N  N     . LEU A  1  251 ? -4.430   -14.126  398.290 1.00 29.65  ? 251 LEU 1 N     1 
ATOM   1959  C  CA    . LEU A  1  251 ? -3.075   -14.272  398.815 1.00 29.69  ? 251 LEU 1 CA    1 
ATOM   1960  C  C     . LEU A  1  251 ? -2.159   -13.502  397.880 1.00 40.51  ? 251 LEU 1 C     1 
ATOM   1961  O  O     . LEU A  1  251 ? -1.614   -14.055  396.923 1.00 44.80  ? 251 LEU 1 O     1 
ATOM   1962  C  CB    . LEU A  1  251 ? -2.680   -15.740  398.890 1.00 36.24  ? 251 LEU 1 CB    1 
ATOM   1963  C  CG    . LEU A  1  251 ? -3.181   -16.682  399.990 1.00 39.50  ? 251 LEU 1 CG    1 
ATOM   1964  C  CD1   . LEU A  1  251 ? -4.627   -16.441  400.345 1.00 39.47  ? 251 LEU 1 CD1   1 
ATOM   1965  C  CD2   . LEU A  1  251 ? -3.012   -18.111  399.522 1.00 38.50  ? 251 LEU 1 CD2   1 
ATOM   1966  N  N     . TYR A  1  252 ? -1.986   -12.208  398.149 1.00 43.65  ? 252 TYR 1 N     1 
ATOM   1967  C  CA    . TYR A  1  252 ? -1.102   -11.401  397.323 1.00 41.02  ? 252 TYR 1 CA    1 
ATOM   1968  C  C     . TYR A  1  252 ? 0.344    -11.775  397.606 1.00 39.38  ? 252 TYR 1 C     1 
ATOM   1969  O  O     . TYR A  1  252 ? 0.690    -12.202  398.707 1.00 36.98  ? 252 TYR 1 O     1 
ATOM   1970  C  CB    . TYR A  1  252 ? -1.291   -9.912   397.607 1.00 43.84  ? 252 TYR 1 CB    1 
ATOM   1971  C  CG    . TYR A  1  252 ? -2.576   -9.318   397.089 1.00 49.21  ? 252 TYR 1 CG    1 
ATOM   1972  C  CD1   . TYR A  1  252 ? -3.764   -9.455   397.786 1.00 50.57  ? 252 TYR 1 CD1   1 
ATOM   1973  C  CD2   . TYR A  1  252 ? -2.602   -8.629   395.889 1.00 52.37  ? 252 TYR 1 CD2   1 
ATOM   1974  C  CE1   . TYR A  1  252 ? -4.941   -8.904   397.304 1.00 51.08  ? 252 TYR 1 CE1   1 
ATOM   1975  C  CE2   . TYR A  1  252 ? -3.771   -8.085   395.400 1.00 51.98  ? 252 TYR 1 CE2   1 
ATOM   1976  C  CZ    . TYR A  1  252 ? -4.937   -8.223   396.109 1.00 51.71  ? 252 TYR 1 CZ    1 
ATOM   1977  O  OH    . TYR A  1  252 ? -6.106   -7.679   395.625 1.00 52.56  ? 252 TYR 1 OH    1 
ATOM   1978  N  N     . GLN A  1  253 ? 1.199    -11.588  396.612 1.00 45.81  ? 253 GLN 1 N     1 
ATOM   1979  C  CA    . GLN A  1  253 ? 2.626    -11.774  396.823 1.00 54.86  ? 253 GLN 1 CA    1 
ATOM   1980  C  C     . GLN A  1  253 ? 3.376    -10.659  396.113 1.00 55.21  ? 253 GLN 1 C     1 
ATOM   1981  O  O     . GLN A  1  253 ? 2.910    -10.110  395.115 1.00 53.56  ? 253 GLN 1 O     1 
ATOM   1982  C  CB    . GLN A  1  253 ? 3.128    -13.166  396.360 1.00 59.29  ? 253 GLN 1 CB    1 
ATOM   1983  C  CG    . GLN A  1  253 ? 2.929    -13.488  394.885 1.00 63.03  ? 253 GLN 1 CG    1 
ATOM   1984  C  CD    . GLN A  1  253 ? 1.527    -13.961  394.574 1.00 67.19  ? 253 GLN 1 CD    1 
ATOM   1985  O  OE1   . GLN A  1  253 ? 0.678    -14.022  395.459 1.00 69.48  ? 253 GLN 1 OE1   1 
ATOM   1986  N  NE2   . GLN A  1  253 ? 1.268    -14.267  393.306 1.00 67.63  ? 253 GLN 1 NE2   1 
ATOM   1987  N  N     . ILE A  1  254 ? 4.534    -10.310  396.658 1.00 57.36  ? 254 ILE 1 N     1 
ATOM   1988  C  CA    . ILE A  1  254 ? 5.337    -9.224   396.115 1.00 61.17  ? 254 ILE 1 CA    1 
ATOM   1989  C  C     . ILE A  1  254 ? 6.796    -9.659   396.094 1.00 65.83  ? 254 ILE 1 C     1 
ATOM   1990  O  O     . ILE A  1  254 ? 7.253    -10.402  396.976 1.00 67.80  ? 254 ILE 1 O     1 
ATOM   1991  C  CB    . ILE A  1  254 ? 5.149    -7.914   396.917 1.00 63.74  ? 254 ILE 1 CB    1 
ATOM   1992  C  CG1   . ILE A  1  254 ? 5.862    -6.744   396.224 1.00 63.42  ? 254 ILE 1 CG1   1 
ATOM   1993  C  CG2   . ILE A  1  254 ? 5.606    -8.086   398.367 1.00 63.03  ? 254 ILE 1 CG2   1 
ATOM   1994  C  CD1   . ILE A  1  254 ? 5.800    -5.434   396.982 1.00 62.75  ? 254 ILE 1 CD1   1 
ATOM   1995  N  N     . SER A  1  255 ? 7.513    -9.215   395.060 1.00 66.97  ? 255 SER 1 N     1 
ATOM   1996  C  CA    . SER A  1  255 ? 8.937    -9.471   394.899 1.00 67.71  ? 255 SER 1 CA    1 
ATOM   1997  C  C     . SER A  1  255 ? 9.599    -8.231   394.296 1.00 68.15  ? 255 SER 1 C     1 
ATOM   1998  O  O     . SER A  1  255 ? 8.944    -7.369   393.692 1.00 67.75  ? 255 SER 1 O     1 
ATOM   1999  C  CB    . SER A  1  255 ? 9.195    -10.703  394.018 1.00 65.96  ? 255 SER 1 CB    1 
ATOM   2000  O  OG    . SER A  1  255 ? 8.332    -10.708  392.890 1.00 66.63  ? 255 SER 1 OG    1 
ATOM   2001  N  N     . GLY A  1  256 ? 10.914   -8.134   394.488 1.00 68.40  ? 256 GLY 1 N     1 
ATOM   2002  C  CA    . GLY A  1  256 ? 11.659   -7.008   393.980 1.00 71.74  ? 256 GLY 1 CA    1 
ATOM   2003  C  C     . GLY A  1  256 ? 12.517   -6.350   395.045 1.00 74.11  ? 256 GLY 1 C     1 
ATOM   2004  O  O     . GLY A  1  256 ? 12.757   -6.915   396.121 1.00 75.74  ? 256 GLY 1 O     1 
ATOM   2005  N  N     . PRO A  1  257 ? 13.018   -5.122   394.749 1.00 73.64  ? 257 PRO 1 N     1 
ATOM   2006  C  CA    . PRO A  1  257 ? 13.787   -4.365   395.747 1.00 69.80  ? 257 PRO 1 CA    1 
ATOM   2007  C  C     . PRO A  1  257 ? 12.895   -3.788   396.834 1.00 70.15  ? 257 PRO 1 C     1 
ATOM   2008  O  O     . PRO A  1  257 ? 12.751   -2.567   396.936 1.00 69.28  ? 257 PRO 1 O     1 
ATOM   2009  C  CB    . PRO A  1  257 ? 14.435   -3.240   394.920 1.00 70.82  ? 257 PRO 1 CB    1 
ATOM   2010  C  CG    . PRO A  1  257 ? 14.223   -3.619   393.471 1.00 71.02  ? 257 PRO 1 CG    1 
ATOM   2011  C  CD    . PRO A  1  257 ? 12.962   -4.415   393.458 1.00 71.74  ? 257 PRO 1 CD    1 
ATOM   2012  N  N     . VAL A  1  258 ? 12.263   -4.650   397.628 1.00 71.22  ? 258 VAL 1 N     1 
ATOM   2013  C  CA    . VAL A  1  258 ? 11.436   -4.223   398.749 1.00 73.68  ? 258 VAL 1 CA    1 
ATOM   2014  C  C     . VAL A  1  258 ? 12.066   -4.774   400.022 1.00 79.19  ? 258 VAL 1 C     1 
ATOM   2015  O  O     . VAL A  1  258 ? 12.832   -5.741   399.997 1.00 83.58  ? 258 VAL 1 O     1 
ATOM   2016  C  CB    . VAL A  1  258 ? 9.962    -4.681   398.604 1.00 69.37  ? 258 VAL 1 CB    1 
ATOM   2017  C  CG1   . VAL A  1  258 ? 9.792    -6.134   399.025 1.00 67.32  ? 258 VAL 1 CG1   1 
ATOM   2018  C  CG2   . VAL A  1  258 ? 9.030    -3.765   399.386 1.00 68.69  ? 258 VAL 1 CG2   1 
ATOM   2019  N  N     . LYS A  1  259 ? 11.740   -4.138   401.150 1.00 80.32  ? 259 LYS 1 N     1 
ATOM   2020  C  CA    . LYS A  1  259 ? 12.418   -4.473   402.399 1.00 78.86  ? 259 LYS 1 CA    1 
ATOM   2021  C  C     . LYS A  1  259 ? 12.015   -5.857   402.899 1.00 75.93  ? 259 LYS 1 C     1 
ATOM   2022  O  O     . LYS A  1  259 ? 12.850   -6.590   403.439 1.00 74.73  ? 259 LYS 1 O     1 
ATOM   2023  C  CB    . LYS A  1  259 ? 12.150   -3.406   403.458 1.00 79.10  ? 259 LYS 1 CB    1 
ATOM   2024  C  CG    . LYS A  1  259 ? 12.888   -3.659   404.763 1.00 77.27  ? 259 LYS 1 CG    1 
ATOM   2025  C  CD    . LYS A  1  259 ? 12.915   -2.422   405.640 1.00 74.83  ? 259 LYS 1 CD    1 
ATOM   2026  C  CE    . LYS A  1  259 ? 13.661   -2.697   406.931 1.00 73.97  ? 259 LYS 1 CE    1 
ATOM   2027  N  NZ    . LYS A  1  259 ? 14.911   -3.451   406.670 1.00 74.75  ? 259 LYS 1 NZ    1 
ATOM   2028  N  N     . ARG A  1  260 ? 10.745   -6.229   402.754 1.00 73.72  ? 260 ARG 1 N     1 
ATOM   2029  C  CA    . ARG A  1  260 ? 10.316   -7.592   403.058 1.00 74.60  ? 260 ARG 1 CA    1 
ATOM   2030  C  C     . ARG A  1  260 ? 9.312    -8.093   402.023 1.00 73.15  ? 260 ARG 1 C     1 
ATOM   2031  O  O     . ARG A  1  260 ? 8.108    -7.811   402.105 1.00 75.19  ? 260 ARG 1 O     1 
ATOM   2032  C  CB    . ARG A  1  260 ? 9.787    -7.706   404.492 1.00 74.35  ? 260 ARG 1 CB    1 
ATOM   2033  C  CG    . ARG A  1  260 ? 8.715    -6.731   404.929 1.00 71.75  ? 260 ARG 1 CG    1 
ATOM   2034  C  CD    . ARG A  1  260 ? 8.476    -6.890   406.419 1.00 68.40  ? 260 ARG 1 CD    1 
ATOM   2035  N  NE    . ARG A  1  260 ? 9.441    -6.113   407.189 1.00 64.00  ? 260 ARG 1 NE    1 
ATOM   2036  C  CZ    . ARG A  1  260 ? 9.225    -4.869   407.600 1.00 59.47  ? 260 ARG 1 CZ    1 
ATOM   2037  N  NH1   . ARG A  1  260 ? 8.074    -4.271   407.324 1.00 57.82  ? 260 ARG 1 NH1   1 
ATOM   2038  N  NH2   . ARG A  1  260 ? 10.154   -4.224   408.291 1.00 57.88  ? 260 ARG 1 NH2   1 
ATOM   2039  N  N     . PRO A  1  261 ? 9.787    -8.811   401.003 1.00 65.45  ? 261 PRO 1 N     1 
ATOM   2040  C  CA    . PRO A  1  261 ? 8.881    -9.429   400.028 1.00 59.21  ? 261 PRO 1 CA    1 
ATOM   2041  C  C     . PRO A  1  261 ? 8.219    -10.671  400.611 1.00 53.54  ? 261 PRO 1 C     1 
ATOM   2042  O  O     . PRO A  1  261 ? 8.570    -11.147  401.692 1.00 51.40  ? 261 PRO 1 O     1 
ATOM   2043  C  CB    . PRO A  1  261 ? 9.810    -9.797   398.866 1.00 57.54  ? 261 PRO 1 CB    1 
ATOM   2044  C  CG    . PRO A  1  261 ? 11.118   -10.018  399.509 1.00 58.70  ? 261 PRO 1 CG    1 
ATOM   2045  C  CD    . PRO A  1  261 ? 11.200   -9.059   400.666 1.00 61.99  ? 261 PRO 1 CD    1 
ATOM   2046  N  N     . GLY A  1  262 ? 7.218    -11.177  399.881 1.00 50.62  ? 262 GLY 1 N     1 
ATOM   2047  C  CA    . GLY A  1  262 ? 6.573    -12.416  400.266 1.00 47.47  ? 262 GLY 1 CA    1 
ATOM   2048  C  C     . GLY A  1  262 ? 5.071    -12.349  400.077 1.00 46.12  ? 262 GLY 1 C     1 
ATOM   2049  O  O     . GLY A  1  262 ? 4.569    -11.514  399.325 1.00 46.66  ? 262 GLY 1 O     1 
ATOM   2050  N  N     . VAL A  1  263 ? 4.367    -13.226  400.810 1.00 43.99  ? 263 VAL 1 N     1 
ATOM   2051  C  CA    . VAL A  1  263 ? 2.928    -13.459  400.659 1.00 43.97  ? 263 VAL 1 CA    1 
ATOM   2052  C  C     . VAL A  1  263 ? 2.174    -12.856  401.843 1.00 39.94  ? 263 VAL 1 C     1 
ATOM   2053  O  O     . VAL A  1  263 ? 2.609    -12.970  402.997 1.00 43.80  ? 263 VAL 1 O     1 
ATOM   2054  C  CB    . VAL A  1  263 ? 2.633    -14.970  400.533 1.00 29.85  ? 263 VAL 1 CB    1 
ATOM   2055  C  CG1   . VAL A  1  263 ? 1.184    -15.228  400.167 1.00 29.72  ? 263 VAL 1 CG1   1 
ATOM   2056  C  CG2   . VAL A  1  263 ? 3.555    -15.602  399.512 1.00 29.70  ? 263 VAL 1 CG2   1 
ATOM   2057  N  N     . TYR A  1  264 ? 1.005    -12.274  401.554 1.00 37.69  ? 264 TYR 1 N     1 
ATOM   2058  C  CA    . TYR A  1  264 ? 0.094    -11.686  402.534 1.00 35.95  ? 264 TYR 1 CA    1 
ATOM   2059  C  C     . TYR A  1  264 ? -1.341   -11.958  402.114 1.00 30.42  ? 264 TYR 1 C     1 
ATOM   2060  O  O     . TYR A  1  264 ? -1.728   -11.634  400.987 1.00 30.62  ? 264 TYR 1 O     1 
ATOM   2061  C  CB    . TYR A  1  264 ? 0.318    -10.166  402.665 1.00 38.82  ? 264 TYR 1 CB    1 
ATOM   2062  C  CG    . TYR A  1  264 ? 1.700    -9.804   403.162 1.00 37.38  ? 264 TYR 1 CG    1 
ATOM   2063  C  CD1   . TYR A  1  264 ? 1.983    -9.792   404.522 1.00 37.00  ? 264 TYR 1 CD1   1 
ATOM   2064  C  CD2   . TYR A  1  264 ? 2.736    -9.542   402.279 1.00 36.10  ? 264 TYR 1 CD2   1 
ATOM   2065  C  CE1   . TYR A  1  264 ? 3.248    -9.492   404.990 1.00 38.10  ? 264 TYR 1 CE1   1 
ATOM   2066  C  CE2   . TYR A  1  264 ? 4.010    -9.245   402.739 1.00 38.09  ? 264 TYR 1 CE2   1 
ATOM   2067  C  CZ    . TYR A  1  264 ? 4.261    -9.223   404.097 1.00 40.22  ? 264 TYR 1 CZ    1 
ATOM   2068  O  OH    . TYR A  1  264 ? 5.524    -8.925   404.568 1.00 42.07  ? 264 TYR 1 OH    1 
ATOM   2069  N  N     . GLU A  1  265 ? -2.125   -12.544  403.018 1.00 30.32  ? 265 GLU 1 N     1 
ATOM   2070  C  CA    . GLU A  1  265 ? -3.543   -12.819  402.774 1.00 35.45  ? 265 GLU 1 CA    1 
ATOM   2071  C  C     . GLU A  1  265 ? -4.343   -11.552  403.057 1.00 39.53  ? 265 GLU 1 C     1 
ATOM   2072  O  O     . GLU A  1  265 ? -4.600   -11.217  404.216 1.00 40.87  ? 265 GLU 1 O     1 
ATOM   2073  C  CB    . GLU A  1  265 ? -4.037   -13.950  403.663 1.00 30.00  ? 265 GLU 1 CB    1 
ATOM   2074  C  CG    . GLU A  1  265 ? -5.462   -14.389  403.384 1.00 29.85  ? 265 GLU 1 CG    1 
ATOM   2075  C  CD    . GLU A  1  265 ? -5.947   -15.374  404.421 1.00 35.26  ? 265 GLU 1 CD    1 
ATOM   2076  O  OE1   . GLU A  1  265 ? -5.087   -15.997  405.073 1.00 36.98  ? 265 GLU 1 OE1   1 
ATOM   2077  O  OE2   . GLU A  1  265 ? -7.175   -15.521  404.602 1.00 35.50  ? 265 GLU 1 OE2   1 
ATOM   2078  N  N     . LEU A  1  266 ? -4.754   -10.850  402.006 1.00 36.94  ? 266 LEU 1 N     1 
ATOM   2079  C  CA    . LEU A  1  266 ? -5.412   -9.558   402.124 1.00 35.67  ? 266 LEU 1 CA    1 
ATOM   2080  C  C     . LEU A  1  266 ? -6.615   -9.527   401.190 1.00 39.06  ? 266 LEU 1 C     1 
ATOM   2081  O  O     . LEU A  1  266 ? -6.621   -10.214  400.163 1.00 41.01  ? 266 LEU 1 O     1 
ATOM   2082  C  CB    . LEU A  1  266 ? -4.435   -8.423   401.777 1.00 31.03  ? 266 LEU 1 CB    1 
ATOM   2083  C  CG    . LEU A  1  266 ? -3.137   -8.407   402.592 1.00 31.13  ? 266 LEU 1 CG    1 
ATOM   2084  C  CD1   . LEU A  1  266 ? -2.092   -7.569   401.895 1.00 32.91  ? 266 LEU 1 CD1   1 
ATOM   2085  C  CD2   . LEU A  1  266 ? -3.384   -7.875   404.009 1.00 31.31  ? 266 LEU 1 CD2   1 
ATOM   2086  N  N     . PRO A  1  267 ? -7.647   -8.749   401.518 1.00 40.18  ? 267 PRO 1 N     1 
ATOM   2087  C  CA    . PRO A  1  267 ? -8.816   -8.665   400.632 1.00 38.07  ? 267 PRO 1 CA    1 
ATOM   2088  C  C     . PRO A  1  267 ? -8.448   -8.067   399.279 1.00 44.62  ? 267 PRO 1 C     1 
ATOM   2089  O  O     . PRO A  1  267 ? -7.393   -7.455   399.100 1.00 45.90  ? 267 PRO 1 O     1 
ATOM   2090  C  CB    . PRO A  1  267 ? -9.788   -7.765   401.407 1.00 36.65  ? 267 PRO 1 CB    1 
ATOM   2091  C  CG    . PRO A  1  267 ? -8.910   -6.979   402.337 1.00 37.99  ? 267 PRO 1 CG    1 
ATOM   2092  C  CD    . PRO A  1  267 ? -7.802   -7.908   402.718 1.00 38.96  ? 267 PRO 1 CD    1 
ATOM   2093  N  N     . MET A  1  268 ? -9.321   -8.293   398.299 1.00 50.99  ? 268 MET 1 N     1 
ATOM   2094  C  CA    . MET A  1  268 ? -9.100   -7.768   396.956 1.00 58.96  ? 268 MET 1 CA    1 
ATOM   2095  C  C     . MET A  1  268 ? -9.450   -6.287   396.914 1.00 62.23  ? 268 MET 1 C     1 
ATOM   2096  O  O     . MET A  1  268 ? -10.568  -5.900   397.267 1.00 61.23  ? 268 MET 1 O     1 
ATOM   2097  C  CB    . MET A  1  268 ? -9.946   -8.532   395.940 1.00 65.79  ? 268 MET 1 CB    1 
ATOM   2098  C  CG    . MET A  1  268 ? -9.322   -8.648   394.566 1.00 71.85  ? 268 MET 1 CG    1 
ATOM   2099  S  SD    . MET A  1  268 ? -8.283   -10.127  394.517 1.00 77.28  ? 268 MET 1 SD    1 
ATOM   2100  C  CE    . MET A  1  268 ? -9.482   -11.402  394.096 1.00 77.48  ? 268 MET 1 CE    1 
ATOM   2101  N  N     . GLY A  1  269 ? -8.510   -5.463   396.458 1.00 67.23  ? 269 GLY 1 N     1 
ATOM   2102  C  CA    . GLY A  1  269 ? -8.732   -4.026   396.388 1.00 73.11  ? 269 GLY 1 CA    1 
ATOM   2103  C  C     . GLY A  1  269 ? -7.743   -3.184   397.166 1.00 76.71  ? 269 GLY 1 C     1 
ATOM   2104  O  O     . GLY A  1  269 ? -7.887   -1.951   397.174 1.00 76.69  ? 269 GLY 1 O     1 
ATOM   2105  N  N     . THR A  1  270 ? -6.777   -3.786   397.860 1.00 79.35  ? 270 THR 1 N     1 
ATOM   2106  C  CA    . THR A  1  270 ? -5.772   -3.001   398.564 1.00 82.89  ? 270 THR 1 CA    1 
ATOM   2107  C  C     . THR A  1  270 ? -4.996   -2.147   397.573 1.00 82.61  ? 270 THR 1 C     1 
ATOM   2108  O  O     . THR A  1  270 ? -4.513   -2.646   396.552 1.00 79.79  ? 270 THR 1 O     1 
ATOM   2109  C  CB    . THR A  1  270 ? -4.801   -3.910   399.329 1.00 83.98  ? 270 THR 1 CB    1 
ATOM   2110  O  OG1   . THR A  1  270 ? -3.948   -4.589   398.400 1.00 85.35  ? 270 THR 1 OG1   1 
ATOM   2111  C  CG2   . THR A  1  270 ? -5.551   -4.937   400.177 1.00 82.52  ? 270 THR 1 CG2   1 
ATOM   2112  N  N     . THR A  1  271 ? -4.871   -0.859   397.871 1.00 87.00  ? 271 THR 1 N     1 
ATOM   2113  C  CA    . THR A  1  271 ? -4.109   -0.005   396.981 1.00 91.41  ? 271 THR 1 CA    1 
ATOM   2114  C  C     . THR A  1  271 ? -2.641   -0.410   397.051 1.00 90.19  ? 271 THR 1 C     1 
ATOM   2115  O  O     . THR A  1  271 ? -2.180   -0.998   398.034 1.00 88.69  ? 271 THR 1 O     1 
ATOM   2116  C  CB    . THR A  1  271 ? -4.292   1.473    397.348 1.00 96.30  ? 271 THR 1 CB    1 
ATOM   2117  O  OG1   . THR A  1  271 ? -3.836   1.696    398.688 1.00 99.95  ? 271 THR 1 OG1   1 
ATOM   2118  C  CG2   . THR A  1  271 ? -5.757   1.880    397.247 1.00 95.11  ? 271 THR 1 CG2   1 
ATOM   2119  N  N     . PHE A  1  272 ? -1.912   -0.129   395.971 1.00 91.54  ? 272 PHE 1 N     1 
ATOM   2120  C  CA    . PHE A  1  272 ? -0.508   -0.526   395.916 1.00 94.03  ? 272 PHE 1 CA    1 
ATOM   2121  C  C     . PHE A  1  272 ? 0.282    0.126    397.041 1.00 92.50  ? 272 PHE 1 C     1 
ATOM   2122  O  O     . PHE A  1  272 ? 1.193    -0.486   397.611 1.00 95.23  ? 272 PHE 1 O     1 
ATOM   2123  C  CB    . PHE A  1  272 ? 0.084    -0.171   394.550 1.00 98.91  ? 272 PHE 1 CB    1 
ATOM   2124  C  CG    . PHE A  1  272 ? -0.608   -0.851   393.399 1.00 104.24 ? 272 PHE 1 CG    1 
ATOM   2125  C  CD1   . PHE A  1  272 ? -1.813   -0.372   392.913 1.00 106.40 ? 272 PHE 1 CD1   1 
ATOM   2126  C  CD2   . PHE A  1  272 ? -0.066   -1.987   392.821 1.00 106.29 ? 272 PHE 1 CD2   1 
ATOM   2127  C  CE1   . PHE A  1  272 ? -2.458   -1.005   391.865 1.00 106.82 ? 272 PHE 1 CE1   1 
ATOM   2128  C  CE2   . PHE A  1  272 ? -0.708   -2.623   391.771 1.00 106.90 ? 272 PHE 1 CE2   1 
ATOM   2129  C  CZ    . PHE A  1  272 ? -1.905   -2.129   391.295 1.00 106.93 ? 272 PHE 1 CZ    1 
ATOM   2130  N  N     . ARG A  1  273 ? -0.072   1.365    397.387 1.00 86.59  ? 273 ARG 1 N     1 
ATOM   2131  C  CA    . ARG A  1  273 ? 0.603    2.067    398.471 1.00 82.06  ? 273 ARG 1 CA    1 
ATOM   2132  C  C     . ARG A  1  273 ? 0.496    1.300    399.781 1.00 76.62  ? 273 ARG 1 C     1 
ATOM   2133  O  O     . ARG A  1  273 ? 1.488    1.136    400.498 1.00 76.73  ? 273 ARG 1 O     1 
ATOM   2134  C  CB    . ARG A  1  273 ? 0.029    3.471    398.626 1.00 83.87  ? 273 ARG 1 CB    1 
ATOM   2135  C  CG    . ARG A  1  273 ? 0.651    4.249    399.770 1.00 85.42  ? 273 ARG 1 CG    1 
ATOM   2136  C  CD    . ARG A  1  273 ? -0.038   5.579    399.934 1.00 87.22  ? 273 ARG 1 CD    1 
ATOM   2137  N  NE    . ARG A  1  273 ? -0.026   6.295    398.665 1.00 87.70  ? 273 ARG 1 NE    1 
ATOM   2138  C  CZ    . ARG A  1  273 ? 1.033    6.925    398.170 1.00 87.85  ? 273 ARG 1 CZ    1 
ATOM   2139  N  NH1   . ARG A  1  273 ? 2.182    6.944    398.836 1.00 87.11  ? 273 ARG 1 NH1   1 
ATOM   2140  N  NH2   . ARG A  1  273 ? 0.942    7.536    397.000 1.00 88.87  ? 273 ARG 1 NH2   1 
ATOM   2141  N  N     . GLU A  1  274 ? -0.708   0.831    400.116 1.00 71.59  ? 274 GLU 1 N     1 
ATOM   2142  C  CA    . GLU A  1  274 ? -0.889   0.078    401.354 1.00 66.52  ? 274 GLU 1 CA    1 
ATOM   2143  C  C     . GLU A  1  274 ? -0.077   -1.216   401.331 1.00 60.97  ? 274 GLU 1 C     1 
ATOM   2144  O  O     . GLU A  1  274 ? 0.707    -1.485   402.247 1.00 61.48  ? 274 GLU 1 O     1 
ATOM   2145  C  CB    . GLU A  1  274 ? -2.374   -0.226   401.577 1.00 63.82  ? 274 GLU 1 CB    1 
ATOM   2146  C  CG    . GLU A  1  274 ? -2.608   -1.293   402.631 1.00 60.53  ? 274 GLU 1 CG    1 
ATOM   2147  C  CD    . GLU A  1  274 ? -4.071   -1.526   402.949 1.00 56.61  ? 274 GLU 1 CD    1 
ATOM   2148  O  OE1   . GLU A  1  274 ? -4.916   -0.665   402.631 1.00 54.66  ? 274 GLU 1 OE1   1 
ATOM   2149  O  OE2   . GLU A  1  274 ? -4.375   -2.585   403.531 1.00 55.72  ? 274 GLU 1 OE2   1 
ATOM   2150  N  N     . LEU A  1  275 ? -0.227   -2.012   400.263 1.00 53.49  ? 275 LEU 1 N     1 
ATOM   2151  C  CA    . LEU A  1  275 ? 0.418    -3.321   400.204 1.00 48.01  ? 275 LEU 1 CA    1 
ATOM   2152  C  C     . LEU A  1  275 ? 1.933    -3.190   400.274 1.00 52.95  ? 275 LEU 1 C     1 
ATOM   2153  O  O     . LEU A  1  275 ? 2.583    -3.801   401.129 1.00 53.56  ? 275 LEU 1 O     1 
ATOM   2154  C  CB    . LEU A  1  275 ? 0.006    -4.054   398.918 1.00 42.96  ? 275 LEU 1 CB    1 
ATOM   2155  C  CG    . LEU A  1  275 ? -0.037   -5.601   398.848 1.00 38.19  ? 275 LEU 1 CG    1 
ATOM   2156  C  CD1   . LEU A  1  275 ? -0.684   -6.109   397.551 1.00 32.83  ? 275 LEU 1 CD1   1 
ATOM   2157  C  CD2   . LEU A  1  275 ? 1.338    -6.264   399.033 1.00 37.07  ? 275 LEU 1 CD2   1 
ATOM   2158  N  N     . ILE A  1  276 ? 2.512    -2.373   399.394 1.00 59.77  ? 276 ILE 1 N     1 
ATOM   2159  C  CA    . ILE A  1  276 ? 3.967    -2.275   399.313 1.00 69.07  ? 276 ILE 1 CA    1 
ATOM   2160  C  C     . ILE A  1  276 ? 4.533    -1.509   400.508 1.00 74.98  ? 276 ILE 1 C     1 
ATOM   2161  O  O     . ILE A  1  276 ? 5.596    -1.857   401.040 1.00 72.38  ? 276 ILE 1 O     1 
ATOM   2162  C  CB    . ILE A  1  276 ? 4.372    -1.638   397.970 1.00 74.13  ? 276 ILE 1 CB    1 
ATOM   2163  C  CG1   . ILE A  1  276 ? 3.716    -2.403   396.817 1.00 76.14  ? 276 ILE 1 CG1   1 
ATOM   2164  C  CG2   . ILE A  1  276 ? 5.892    -1.625   397.805 1.00 74.26  ? 276 ILE 1 CG2   1 
ATOM   2165  C  CD1   . ILE A  1  276 ? 3.442    -1.558   395.578 1.00 77.54  ? 276 ILE 1 CD1   1 
ATOM   2166  N  N     . TYR A  1  277 ? 3.827    -0.473   400.964 1.00 80.20  ? 277 TYR 1 N     1 
ATOM   2167  C  CA    . TYR A  1  277 ? 4.353    0.456    401.961 1.00 84.37  ? 277 TYR 1 CA    1 
ATOM   2168  C  C     . TYR A  1  277 ? 4.041    -0.008   403.384 1.00 78.68  ? 277 TYR 1 C     1 
ATOM   2169  O  O     . TYR A  1  277 ? 4.956    -0.243   404.180 1.00 79.32  ? 277 TYR 1 O     1 
ATOM   2170  C  CB    . TYR A  1  277 ? 3.781    1.860    401.716 1.00 90.44  ? 277 TYR 1 CB    1 
ATOM   2171  C  CG    . TYR A  1  277 ? 4.492    2.631    400.624 1.00 95.38  ? 277 TYR 1 CG    1 
ATOM   2172  C  CD1   . TYR A  1  277 ? 5.795    3.073    400.789 1.00 96.76  ? 277 TYR 1 CD1   1 
ATOM   2173  C  CD2   . TYR A  1  277 ? 3.855    2.918    399.424 1.00 97.32  ? 277 TYR 1 CD2   1 
ATOM   2174  C  CE1   . TYR A  1  277 ? 6.448    3.777    399.784 1.00 98.33  ? 277 TYR 1 CE1   1 
ATOM   2175  C  CE2   . TYR A  1  277 ? 4.498    3.623    398.417 1.00 98.53  ? 277 TYR 1 CE2   1 
ATOM   2176  C  CZ    . TYR A  1  277 ? 5.793    4.048    398.602 1.00 98.40  ? 277 TYR 1 CZ    1 
ATOM   2177  O  OH    . TYR A  1  277 ? 6.437    4.745    397.605 1.00 97.97  ? 277 TYR 1 OH    1 
ATOM   2178  N  N     . GLU A  1  278 ? 2.755    -0.159   403.713 1.00 73.56  ? 278 GLU 1 N     1 
ATOM   2179  C  CA    . GLU A  1  278 ? 2.386    -0.589   405.057 1.00 70.38  ? 278 GLU 1 CA    1 
ATOM   2180  C  C     . GLU A  1  278 ? 2.945    -1.972   405.366 1.00 70.89  ? 278 GLU 1 C     1 
ATOM   2181  O  O     . GLU A  1  278 ? 3.528    -2.192   406.434 1.00 73.88  ? 278 GLU 1 O     1 
ATOM   2182  C  CB    . GLU A  1  278 ? 0.862    -0.591   405.219 1.00 70.58  ? 278 GLU 1 CB    1 
ATOM   2183  C  CG    . GLU A  1  278 ? 0.172    0.746    405.061 1.00 73.54  ? 278 GLU 1 CG    1 
ATOM   2184  C  CD    . GLU A  1  278 ? 0.140    1.524    406.366 1.00 77.86  ? 278 GLU 1 CD    1 
ATOM   2185  O  OE1   . GLU A  1  278 ? 1.216    1.748    406.960 1.00 80.22  ? 278 GLU 1 OE1   1 
ATOM   2186  O  OE2   . GLU A  1  278 ? -0.965   1.899    406.812 1.00 78.43  ? 278 GLU 1 OE2   1 
ATOM   2187  N  N     . TRP A  1  279 ? 2.787    -2.914   404.434 1.00 64.54  ? 279 TRP 1 N     1 
ATOM   2188  C  CA    . TRP A  1  279 ? 3.055    -4.326   404.692 1.00 56.94  ? 279 TRP 1 CA    1 
ATOM   2189  C  C     . TRP A  1  279 ? 4.467    -4.761   404.297 1.00 57.13  ? 279 TRP 1 C     1 
ATOM   2190  O  O     . TRP A  1  279 ? 5.249    -5.202   405.148 1.00 57.81  ? 279 TRP 1 O     1 
ATOM   2191  C  CB    . TRP A  1  279 ? 2.008    -5.170   403.963 1.00 51.93  ? 279 TRP 1 CB    1 
ATOM   2192  C  CG    . TRP A  1  279 ? 0.637    -4.742   404.325 1.00 51.87  ? 279 TRP 1 CG    1 
ATOM   2193  C  CD1   . TRP A  1  279 ? -0.215   -3.980   403.582 1.00 49.09  ? 279 TRP 1 CD1   1 
ATOM   2194  C  CD2   . TRP A  1  279 ? 0.001    -4.936   405.585 1.00 55.38  ? 279 TRP 1 CD2   1 
ATOM   2195  N  NE1   . TRP A  1  279 ? -1.378   -3.758   404.275 1.00 47.50  ? 279 TRP 1 NE1   1 
ATOM   2196  C  CE2   . TRP A  1  279 ? -1.264   -4.325   405.516 1.00 51.70  ? 279 TRP 1 CE2   1 
ATOM   2197  C  CE3   . TRP A  1  279 ? 0.366    -5.600   406.759 1.00 60.18  ? 279 TRP 1 CE3   1 
ATOM   2198  C  CZ2   . TRP A  1  279 ? -2.163   -4.354   406.575 1.00 55.62  ? 279 TRP 1 CZ2   1 
ATOM   2199  C  CZ3   . TRP A  1  279 ? -0.527   -5.630   407.807 1.00 62.03  ? 279 TRP 1 CZ3   1 
ATOM   2200  C  CH2   . TRP A  1  279 ? -1.776   -5.011   407.711 1.00 59.63  ? 279 TRP 1 CH2   1 
ATOM   2201  N  N     . ALA A  1  280 ? 4.807    -4.636   403.014 1.00 57.74  ? 280 ALA 1 N     1 
ATOM   2202  C  CA    . ALA A  1  280 ? 6.061    -5.169   402.486 1.00 58.09  ? 280 ALA 1 CA    1 
ATOM   2203  C  C     . ALA A  1  280 ? 7.304    -4.416   402.974 1.00 55.11  ? 280 ALA 1 C     1 
ATOM   2204  O  O     . ALA A  1  280 ? 8.420    -4.806   402.595 1.00 51.60  ? 280 ALA 1 O     1 
ATOM   2205  C  CB    . ALA A  1  280 ? 6.010    -5.175   400.956 1.00 61.51  ? 280 ALA 1 CB    1 
ATOM   2206  N  N     . GLY A  1  281 ? 7.145    -3.369   403.788 1.00 53.07  ? 281 GLY 1 N     1 
ATOM   2207  C  CA    . GLY A  1  281 ? 8.275    -2.664   404.357 1.00 52.12  ? 281 GLY 1 CA    1 
ATOM   2208  C  C     . GLY A  1  281 ? 8.882    -1.593   403.483 1.00 51.59  ? 281 GLY 1 C     1 
ATOM   2209  O  O     . GLY A  1  281 ? 9.983    -1.111   403.786 1.00 47.28  ? 281 GLY 1 O     1 
ATOM   2210  N  N     . GLY A  1  282 ? 8.202    -1.202   402.411 1.00 55.40  ? 282 GLY 1 N     1 
ATOM   2211  C  CA    . GLY A  1  282 ? 8.657    -0.116   401.579 1.00 58.94  ? 282 GLY 1 CA    1 
ATOM   2212  C  C     . GLY A  1  282 ? 9.808    -0.476   400.657 1.00 58.00  ? 282 GLY 1 C     1 
ATOM   2213  O  O     . GLY A  1  282 ? 10.595   -1.397   400.911 1.00 54.79  ? 282 GLY 1 O     1 
ATOM   2214  N  N     . PRO A  1  283 ? 9.921    0.272    399.561 1.00 59.38  ? 283 PRO 1 N     1 
ATOM   2215  C  CA    . PRO A  1  283 ? 10.978   0.006    398.578 1.00 60.17  ? 283 PRO 1 CA    1 
ATOM   2216  C  C     . PRO A  1  283 ? 12.366   0.246    399.154 1.00 62.26  ? 283 PRO 1 C     1 
ATOM   2217  O  O     . PRO A  1  283 ? 12.558   1.010    400.102 1.00 64.00  ? 283 PRO 1 O     1 
ATOM   2218  C  CB    . PRO A  1  283 ? 10.682   1.015    397.459 1.00 59.07  ? 283 PRO 1 CB    1 
ATOM   2219  C  CG    . PRO A  1  283 ? 9.242    1.436    397.680 1.00 58.26  ? 283 PRO 1 CG    1 
ATOM   2220  C  CD    . PRO A  1  283 ? 9.036    1.378    399.152 1.00 57.99  ? 283 PRO 1 CD    1 
ATOM   2221  N  N     . LEU A  1  284 ? 13.351   -0.407   398.538 1.00 62.77  ? 284 LEU 1 N     1 
ATOM   2222  C  CA    . LEU A  1  284 ? 14.749   -0.171   398.873 1.00 62.72  ? 284 LEU 1 CA    1 
ATOM   2223  C  C     . LEU A  1  284 ? 15.430   0.746    397.874 1.00 68.37  ? 284 LEU 1 C     1 
ATOM   2224  O  O     . LEU A  1  284 ? 16.448   1.362    398.210 1.00 70.13  ? 284 LEU 1 O     1 
ATOM   2225  C  CB    . LEU A  1  284 ? 15.526   -1.490   398.927 1.00 58.32  ? 284 LEU 1 CB    1 
ATOM   2226  C  CG    . LEU A  1  284 ? 14.838   -2.617   399.684 1.00 56.71  ? 284 LEU 1 CG    1 
ATOM   2227  C  CD1   . LEU A  1  284 ? 15.439   -3.936   399.266 1.00 56.17  ? 284 LEU 1 CD1   1 
ATOM   2228  C  CD2   . LEU A  1  284 ? 14.988   -2.396   401.171 1.00 58.52  ? 284 LEU 1 CD2   1 
ATOM   2229  N  N     . GLU A  1  285 ? 14.891   0.846    396.664 1.00 71.17  ? 285 GLU 1 N     1 
ATOM   2230  C  CA    . GLU A  1  285 ? 15.450   1.679    395.613 1.00 74.99  ? 285 GLU 1 CA    1 
ATOM   2231  C  C     . GLU A  1  285 ? 14.280   2.348    394.899 1.00 74.21  ? 285 GLU 1 C     1 
ATOM   2232  O  O     . GLU A  1  285 ? 13.128   1.939    395.100 1.00 70.42  ? 285 GLU 1 O     1 
ATOM   2233  C  CB    . GLU A  1  285 ? 16.290   0.832    394.651 1.00 77.89  ? 285 GLU 1 CB    1 
ATOM   2234  C  CG    . GLU A  1  285 ? 17.434   0.073    395.317 1.00 80.24  ? 285 GLU 1 CG    1 
ATOM   2235  C  CD    . GLU A  1  285 ? 18.690   0.902    395.465 1.00 82.46  ? 285 GLU 1 CD    1 
ATOM   2236  O  OE1   . GLU A  1  285 ? 19.023   1.656    394.530 1.00 84.38  ? 285 GLU 1 OE1   1 
ATOM   2237  O  OE2   . GLU A  1  285 ? 19.345   0.801    396.524 1.00 83.15  ? 285 GLU 1 OE2   1 
ATOM   2238  N  N     . PRO A  1  286 ? 14.512   3.367    394.069 1.00 78.92  ? 286 PRO 1 N     1 
ATOM   2239  C  CA    . PRO A  1  286 ? 13.393   3.939    393.307 1.00 79.07  ? 286 PRO 1 CA    1 
ATOM   2240  C  C     . PRO A  1  286 ? 12.883   2.928    392.291 1.00 76.57  ? 286 PRO 1 C     1 
ATOM   2241  O  O     . PRO A  1  286 ? 13.662   2.318    391.556 1.00 76.29  ? 286 PRO 1 O     1 
ATOM   2242  C  CB    . PRO A  1  286 ? 14.004   5.176    392.632 1.00 80.59  ? 286 PRO 1 CB    1 
ATOM   2243  C  CG    . PRO A  1  286 ? 15.254   5.463    393.417 1.00 80.46  ? 286 PRO 1 CG    1 
ATOM   2244  C  CD    . PRO A  1  286 ? 15.757   4.133    393.867 1.00 79.42  ? 286 PRO 1 CD    1 
ATOM   2245  N  N     . ILE A  1  287 ? 11.573   2.745    392.257 1.00 73.32  ? 287 ILE 1 N     1 
ATOM   2246  C  CA    . ILE A  1  287 ? 10.957   1.772    391.368 1.00 73.41  ? 287 ILE 1 CA    1 
ATOM   2247  C  C     . ILE A  1  287 ? 10.508   2.533    390.133 1.00 69.43  ? 287 ILE 1 C     1 
ATOM   2248  O  O     . ILE A  1  287 ? 9.947    3.632    390.240 1.00 68.74  ? 287 ILE 1 O     1 
ATOM   2249  C  CB    . ILE A  1  287 ? 9.777    1.043    392.048 1.00 77.38  ? 287 ILE 1 CB    1 
ATOM   2250  C  CG1   . ILE A  1  287 ? 10.231   -0.284   392.665 1.00 80.29  ? 287 ILE 1 CG1   1 
ATOM   2251  C  CG2   . ILE A  1  287 ? 8.652    0.745    391.061 1.00 76.97  ? 287 ILE 1 CG2   1 
ATOM   2252  C  CD1   . ILE A  1  287 ? 11.215   -0.154   393.814 1.00 82.15  ? 287 ILE 1 CD1   1 
ATOM   2253  N  N     . GLN A  1  288 ? 10.782   1.969    388.954 1.00 67.09  ? 288 GLN 1 N     1 
ATOM   2254  C  CA    . GLN A  1  288 ? 10.303   2.586    387.724 1.00 64.42  ? 288 GLN 1 CA    1 
ATOM   2255  C  C     . GLN A  1  288 ? 8.940    2.053    387.312 1.00 62.76  ? 288 GLN 1 C     1 
ATOM   2256  O  O     . GLN A  1  288 ? 8.125    2.824    386.782 1.00 60.70  ? 288 GLN 1 O     1 
ATOM   2257  C  CB    . GLN A  1  288 ? 11.295   2.380    386.571 1.00 63.13  ? 288 GLN 1 CB    1 
ATOM   2258  C  CG    . GLN A  1  288 ? 11.414   0.946    386.066 1.00 62.23  ? 288 GLN 1 CG    1 
ATOM   2259  C  CD    . GLN A  1  288 ? 12.382   0.818    384.905 1.00 61.79  ? 288 GLN 1 CD    1 
ATOM   2260  O  OE1   . GLN A  1  288 ? 12.489   1.721    384.073 1.00 58.49  ? 288 GLN 1 OE1   1 
ATOM   2261  N  NE2   . GLN A  1  288 ? 13.073   -0.315   384.828 1.00 63.66  ? 288 GLN 1 NE2   1 
ATOM   2262  N  N     . ALA A  1  289 ? 8.648    0.780    387.612 1.00 59.43  ? 289 ALA 1 N     1 
ATOM   2263  C  CA    . ALA A  1  289 ? 7.397    0.154    387.185 1.00 50.17  ? 289 ALA 1 CA    1 
ATOM   2264  C  C     . ALA A  1  289 ? 7.064    -1.013   388.104 1.00 44.09  ? 289 ALA 1 C     1 
ATOM   2265  O  O     . ALA A  1  289 ? 7.865    -1.413   388.952 1.00 36.05  ? 289 ALA 1 O     1 
ATOM   2266  C  CB    . ALA A  1  289 ? 7.472    -0.340   385.734 1.00 45.65  ? 289 ALA 1 CB    1 
ATOM   2267  N  N     . ILE A  1  290 ? 5.842    -1.535   387.930 1.00 45.17  ? 290 ILE 1 N     1 
ATOM   2268  C  CA    . ILE A  1  290 ? 5.330    -2.698   388.657 1.00 45.15  ? 290 ILE 1 CA    1 
ATOM   2269  C  C     . ILE A  1  290 ? 4.641    -3.620   387.661 1.00 35.00  ? 290 ILE 1 C     1 
ATOM   2270  O  O     . ILE A  1  290 ? 3.972    -3.155   386.733 1.00 31.70  ? 290 ILE 1 O     1 
ATOM   2271  C  CB    . ILE A  1  290 ? 4.337    -2.329   389.787 1.00 49.04  ? 290 ILE 1 CB    1 
ATOM   2272  C  CG1   . ILE A  1  290 ? 3.165    -1.487   389.255 1.00 53.32  ? 290 ILE 1 CG1   1 
ATOM   2273  C  CG2   . ILE A  1  290 ? 5.047    -1.617   390.922 1.00 53.32  ? 290 ILE 1 CG2   1 
ATOM   2274  C  CD1   . ILE A  1  290 ? 1.863    -2.266   389.041 1.00 52.57  ? 290 ILE 1 CD1   1 
ATOM   2275  N  N     . ILE A  1  291 ? 4.794    -4.927   387.871 1.00 39.66  ? 291 ILE 1 N     1 
ATOM   2276  C  CA    . ILE A  1  291 ? 4.104    -5.964   387.097 1.00 40.26  ? 291 ILE 1 CA    1 
ATOM   2277  C  C     . ILE A  1  291 ? 3.139    -6.656   388.055 1.00 31.03  ? 291 ILE 1 C     1 
ATOM   2278  O  O     . ILE A  1  291 ? 3.574    -7.479   388.879 1.00 30.87  ? 291 ILE 1 O     1 
ATOM   2279  C  CB    . ILE A  1  291 ? 5.096    -6.955   386.467 1.00 37.56  ? 291 ILE 1 CB    1 
ATOM   2280  C  CG1   . ILE A  1  291 ? 6.114    -6.205   385.627 1.00 36.41  ? 291 ILE 1 CG1   1 
ATOM   2281  C  CG2   . ILE A  1  291 ? 4.391    -7.845   385.512 1.00 30.68  ? 291 ILE 1 CG2   1 
ATOM   2282  C  CD1   . ILE A  1  291 ? 7.179    -7.084   385.065 1.00 34.40  ? 291 ILE 1 CD1   1 
ATOM   2283  N  N     . PRO A  1  292 ? 1.837    -6.289   388.025 1.00 32.55  ? 292 PRO 1 N     1 
ATOM   2284  C  CA    . PRO A  1  292 ? 0.906    -6.669   389.101 1.00 36.20  ? 292 PRO 1 CA    1 
ATOM   2285  C  C     . PRO A  1  292 ? 0.568    -8.150   389.175 1.00 41.23  ? 292 PRO 1 C     1 
ATOM   2286  O  O     . PRO A  1  292 ? 0.731    -8.780   390.226 1.00 43.47  ? 292 PRO 1 O     1 
ATOM   2287  C  CB    . PRO A  1  292 ? -0.350   -5.839   388.783 1.00 33.71  ? 292 PRO 1 CB    1 
ATOM   2288  C  CG    . PRO A  1  292 ? -0.225   -5.507   387.346 1.00 31.05  ? 292 PRO 1 CG    1 
ATOM   2289  C  CD    . PRO A  1  292 ? 1.222    -5.355   387.071 1.00 31.13  ? 292 PRO 1 CD    1 
ATOM   2290  N  N     . GLY A  1  293 ? 0.065    -8.719   388.080 1.00 40.34  ? 293 GLY 1 N     1 
ATOM   2291  C  CA    . GLY A  1  293 ? -0.501   -10.048  388.175 1.00 35.61  ? 293 GLY 1 CA    1 
ATOM   2292  C  C     . GLY A  1  293 ? 0.576    -11.098  388.305 1.00 34.32  ? 293 GLY 1 C     1 
ATOM   2293  O  O     . GLY A  1  293 ? 0.777    -11.641  389.391 1.00 32.33  ? 293 GLY 1 O     1 
ATOM   2294  N  N     . GLY A  1  294 ? 1.338    -11.313  387.236 1.00 39.42  ? 294 GLY 1 N     1 
ATOM   2295  C  CA    . GLY A  1  294 ? 2.448    -12.247  387.231 1.00 43.63  ? 294 GLY 1 CA    1 
ATOM   2296  C  C     . GLY A  1  294 ? 3.582    -11.664  386.419 1.00 45.09  ? 294 GLY 1 C     1 
ATOM   2297  O  O     . GLY A  1  294 ? 3.881    -10.480  386.564 1.00 47.19  ? 294 GLY 1 O     1 
ATOM   2298  N  N     . SER A  1  295 ? 4.234    -12.470  385.586 1.00 40.29  ? 295 SER 1 N     1 
ATOM   2299  C  CA    . SER A  1  295 ? 5.128    -11.926  384.573 1.00 40.35  ? 295 SER 1 CA    1 
ATOM   2300  C  C     . SER A  1  295 ? 4.402    -11.582  383.280 1.00 44.56  ? 295 SER 1 C     1 
ATOM   2301  O  O     . SER A  1  295 ? 4.798    -10.640  382.581 1.00 48.18  ? 295 SER 1 O     1 
ATOM   2302  C  CB    . SER A  1  295 ? 6.255    -12.916  384.271 1.00 39.70  ? 295 SER 1 CB    1 
ATOM   2303  O  OG    . SER A  1  295 ? 7.089    -12.427  383.234 1.00 43.10  ? 295 SER 1 OG    1 
ATOM   2304  N  N     . SER A  1  296 ? 3.339    -12.315  382.959 1.00 46.12  ? 296 SER 1 N     1 
ATOM   2305  C  CA    . SER A  1  296 ? 2.556    -12.112  381.747 1.00 46.19  ? 296 SER 1 CA    1 
ATOM   2306  C  C     . SER A  1  296 ? 1.755    -10.816  381.773 1.00 47.85  ? 296 SER 1 C     1 
ATOM   2307  O  O     . SER A  1  296 ? 1.120    -10.467  380.773 1.00 47.75  ? 296 SER 1 O     1 
ATOM   2308  C  CB    . SER A  1  296 ? 1.610    -13.309  381.559 1.00 43.35  ? 296 SER 1 CB    1 
ATOM   2309  O  OG    . SER A  1  296 ? 2.318    -14.544  381.544 1.00 39.82  ? 296 SER 1 OG    1 
ATOM   2310  N  N     . THR A  1  297 ? 1.810    -10.109  382.803 1.00 48.35  ? 297 THR 1 N     1 
ATOM   2311  C  CA    . THR A  1  297 ? 0.884    -9.005   382.908 1.00 53.15  ? 297 THR 1 CA    1 
ATOM   2312  C  C     . THR A  1  297 ? 1.552    -7.693   382.504 1.00 52.98  ? 297 THR 1 C     1 
ATOM   2313  O  O     . THR A  1  297 ? 2.751    -7.496   382.732 1.00 54.30  ? 297 THR 1 O     1 
ATOM   2314  C  CB    . THR A  1  297 ? 0.350    -8.912   384.340 1.00 59.51  ? 297 THR 1 CB    1 
ATOM   2315  O  OG1   . THR A  1  297 ? 1.449    -8.897   385.263 1.00 62.16  ? 297 THR 1 OG1   1 
ATOM   2316  C  CG2   . THR A  1  297 ? -0.552   -10.108  384.642 1.00 60.14  ? 297 THR 1 CG2   1 
ATOM   2317  N  N     . PRO A  1  298 ? 0.801    -6.786   381.885 1.00 51.19  ? 298 PRO 1 N     1 
ATOM   2318  C  CA    . PRO A  1  298 ? 1.388    -5.533   381.424 1.00 46.74  ? 298 PRO 1 CA    1 
ATOM   2319  C  C     . PRO A  1  298 ? 1.893    -4.711   382.596 1.00 43.17  ? 298 PRO 1 C     1 
ATOM   2320  O  O     . PRO A  1  298 ? 1.235    -4.635   383.645 1.00 40.03  ? 298 PRO 1 O     1 
ATOM   2321  C  CB    . PRO A  1  298 ? 0.213    -4.834   380.723 1.00 47.30  ? 298 PRO 1 CB    1 
ATOM   2322  C  CG    . PRO A  1  298 ? -0.699   -5.942   380.321 1.00 48.84  ? 298 PRO 1 CG    1 
ATOM   2323  C  CD    . PRO A  1  298 ? -0.597   -6.933   381.440 1.00 51.95  ? 298 PRO 1 CD    1 
ATOM   2324  N  N     . PRO A  1  299 ? 3.078    -4.116   382.468 1.00 45.26  ? 299 PRO 1 N     1 
ATOM   2325  C  CA    . PRO A  1  299 ? 3.574    -3.205   383.506 1.00 47.44  ? 299 PRO 1 CA    1 
ATOM   2326  C  C     . PRO A  1  299 ? 2.861    -1.856   383.501 1.00 51.57  ? 299 PRO 1 C     1 
ATOM   2327  O  O     . PRO A  1  299 ? 2.349    -1.389   382.478 1.00 50.57  ? 299 PRO 1 O     1 
ATOM   2328  C  CB    . PRO A  1  299 ? 5.057    -3.041   383.149 1.00 46.70  ? 299 PRO 1 CB    1 
ATOM   2329  C  CG    . PRO A  1  299 ? 5.113    -3.308   381.677 1.00 45.77  ? 299 PRO 1 CG    1 
ATOM   2330  C  CD    . PRO A  1  299 ? 4.098    -4.392   381.443 1.00 46.48  ? 299 PRO 1 CD    1 
ATOM   2331  N  N     . LEU A  1  300 ? 2.856    -1.218   384.673 1.00 54.71  ? 300 LEU 1 N     1 
ATOM   2332  C  CA    . LEU A  1  300 ? 2.314    0.115    384.847 1.00 56.38  ? 300 LEU 1 CA    1 
ATOM   2333  C  C     . LEU A  1  300 ? 3.357    1.032    385.481 1.00 63.49  ? 300 LEU 1 C     1 
ATOM   2334  O  O     . LEU A  1  300 ? 4.205    0.578    386.259 1.00 61.65  ? 300 LEU 1 O     1 
ATOM   2335  C  CB    . LEU A  1  300 ? 1.059    0.082    385.724 1.00 51.32  ? 300 LEU 1 CB    1 
ATOM   2336  C  CG    . LEU A  1  300 ? -0.122   -0.677   385.125 1.00 48.42  ? 300 LEU 1 CG    1 
ATOM   2337  C  CD1   . LEU A  1  300 ? -1.261   -0.727   386.122 1.00 47.67  ? 300 LEU 1 CD1   1 
ATOM   2338  C  CD2   . LEU A  1  300 ? -0.565   -0.023   383.821 1.00 50.77  ? 300 LEU 1 CD2   1 
ATOM   2339  N  N     . PRO A  1  301 ? 3.325    2.324    385.158 1.00 71.15  ? 301 PRO 1 N     1 
ATOM   2340  C  CA    . PRO A  1  301 ? 4.278    3.263    385.757 1.00 74.56  ? 301 PRO 1 CA    1 
ATOM   2341  C  C     . PRO A  1  301 ? 4.050    3.395    387.256 1.00 81.26  ? 301 PRO 1 C     1 
ATOM   2342  O  O     . PRO A  1  301 ? 3.059    2.925    387.819 1.00 81.58  ? 301 PRO 1 O     1 
ATOM   2343  C  CB    . PRO A  1  301 ? 3.997    4.581    385.025 1.00 72.54  ? 301 PRO 1 CB    1 
ATOM   2344  C  CG    . PRO A  1  301 ? 3.270    4.180    383.776 1.00 72.78  ? 301 PRO 1 CG    1 
ATOM   2345  C  CD    . PRO A  1  301 ? 2.467    2.979    384.156 1.00 72.73  ? 301 PRO 1 CD    1 
ATOM   2346  N  N     . PHE A  1  302 ? 5.019    4.032    387.909 1.00 88.42  ? 302 PHE 1 N     1 
ATOM   2347  C  CA    . PHE A  1  302 ? 4.988    4.261    389.353 1.00 93.92  ? 302 PHE 1 CA    1 
ATOM   2348  C  C     . PHE A  1  302 ? 4.437    5.669    389.591 1.00 95.20  ? 302 PHE 1 C     1 
ATOM   2349  O  O     . PHE A  1  302 ? 5.184    6.645    389.669 1.00 93.99  ? 302 PHE 1 O     1 
ATOM   2350  C  CB    . PHE A  1  302 ? 6.383    4.063    389.941 1.00 96.77  ? 302 PHE 1 CB    1 
ATOM   2351  C  CG    . PHE A  1  302 ? 6.384    3.512    391.337 1.00 97.16  ? 302 PHE 1 CG    1 
ATOM   2352  C  CD1   . PHE A  1  302 ? 5.680    2.359    391.640 1.00 96.36  ? 302 PHE 1 CD1   1 
ATOM   2353  C  CD2   . PHE A  1  302 ? 7.109    4.129    392.342 1.00 97.16  ? 302 PHE 1 CD2   1 
ATOM   2354  C  CE1   . PHE A  1  302 ? 5.682    1.848    392.922 1.00 96.78  ? 302 PHE 1 CE1   1 
ATOM   2355  C  CE2   . PHE A  1  302 ? 7.113    3.617    393.628 1.00 96.65  ? 302 PHE 1 CE2   1 
ATOM   2356  C  CZ    . PHE A  1  302 ? 6.399    2.477    393.915 1.00 97.03  ? 302 PHE 1 CZ    1 
ATOM   2357  N  N     . THR A  1  303 ? 3.112    5.767    389.718 1.00 95.44  ? 303 THR 1 N     1 
ATOM   2358  C  CA    . THR A  1  303 ? 2.414    7.043    389.806 1.00 98.37  ? 303 THR 1 CA    1 
ATOM   2359  C  C     . THR A  1  303 ? 1.442    7.010    390.982 1.00 99.10  ? 303 THR 1 C     1 
ATOM   2360  O  O     . THR A  1  303 ? 1.025    5.942    391.439 1.00 100.18 ? 303 THR 1 O     1 
ATOM   2361  C  CB    . THR A  1  303 ? 1.673    7.362    388.487 1.00 95.93  ? 303 THR 1 CB    1 
ATOM   2362  O  OG1   . THR A  1  303 ? 2.589    7.259    387.390 1.00 96.00  ? 303 THR 1 OG1   1 
ATOM   2363  C  CG2   . THR A  1  303 ? 1.092    8.768    388.491 1.00 97.10  ? 303 THR 1 CG2   1 
ATOM   2364  N  N     . GLU A  1  304 ? 1.114    8.200    391.495 1.00 101.13 ? 304 GLU 1 N     1 
ATOM   2365  C  CA    . GLU A  1  304 ? 0.100    8.315    392.538 1.00 101.74 ? 304 GLU 1 CA    1 
ATOM   2366  C  C     . GLU A  1  304 ? -1.236   7.753    392.071 1.00 99.92  ? 304 GLU 1 C     1 
ATOM   2367  O  O     . GLU A  1  304 ? -1.863   6.951    392.772 1.00 100.86 ? 304 GLU 1 O     1 
ATOM   2368  C  CB    . GLU A  1  304 ? -0.052   9.775    392.964 1.00 105.94 ? 304 GLU 1 CB    1 
ATOM   2369  C  CG    . GLU A  1  304 ? 1.176    10.353   393.647 1.00 108.54 ? 304 GLU 1 CG    1 
ATOM   2370  C  CD    . GLU A  1  304 ? 1.360    9.821    395.053 1.00 110.36 ? 304 GLU 1 CD    1 
ATOM   2371  O  OE1   . GLU A  1  304 ? 0.518    10.122   395.926 1.00 110.78 ? 304 GLU 1 OE1   1 
ATOM   2372  O  OE2   . GLU A  1  304 ? 2.344    9.089    395.286 1.00 110.63 ? 304 GLU 1 OE2   1 
ATOM   2373  N  N     . GLU A  1  305 ? -1.695   8.172    390.890 1.00 97.92  ? 305 GLU 1 N     1 
ATOM   2374  C  CA    . GLU A  1  305 ? -2.929   7.618    390.348 1.00 99.66  ? 305 GLU 1 CA    1 
ATOM   2375  C  C     . GLU A  1  305 ? -2.818   6.121    390.079 1.00 102.90 ? 305 GLU 1 C     1 
ATOM   2376  O  O     . GLU A  1  305 ? -3.847   5.446    389.962 1.00 102.77 ? 305 GLU 1 O     1 
ATOM   2377  C  CB    . GLU A  1  305 ? -3.328   8.358    389.070 1.00 98.81  ? 305 GLU 1 CB    1 
ATOM   2378  C  CG    . GLU A  1  305 ? -4.820   8.276    388.769 1.00 97.48  ? 305 GLU 1 CG    1 
ATOM   2379  C  CD    . GLU A  1  305 ? -5.216   9.041    387.523 1.00 97.02  ? 305 GLU 1 CD    1 
ATOM   2380  O  OE1   . GLU A  1  305 ? -5.058   8.496    386.410 1.00 97.05  ? 305 GLU 1 OE1   1 
ATOM   2381  O  OE2   . GLU A  1  305 ? -5.677   10.194   387.656 1.00 96.88  ? 305 GLU 1 OE2   1 
ATOM   2382  N  N     . VAL A  1  306 ? -1.601   5.587    389.991 1.00 106.28 ? 306 VAL 1 N     1 
ATOM   2383  C  CA    . VAL A  1  306 ? -1.386   4.143    389.882 1.00 108.14 ? 306 VAL 1 CA    1 
ATOM   2384  C  C     . VAL A  1  306 ? -1.316   3.495    391.258 1.00 110.54 ? 306 VAL 1 C     1 
ATOM   2385  O  O     . VAL A  1  306 ? -1.982   2.490    391.519 1.00 109.12 ? 306 VAL 1 O     1 
ATOM   2386  C  CB    . VAL A  1  306 ? -0.109   3.844    389.060 1.00 106.79 ? 306 VAL 1 CB    1 
ATOM   2387  C  CG1   . VAL A  1  306 ? 0.271    2.370    389.179 1.00 105.17 ? 306 VAL 1 CG1   1 
ATOM   2388  C  CG2   . VAL A  1  306 ? -0.302   4.226    387.596 1.00 106.77 ? 306 VAL 1 CG2   1 
ATOM   2389  N  N     . LEU A  1  307 ? -0.502   4.061    392.156 1.00 114.48 ? 307 LEU 1 N     1 
ATOM   2390  C  CA    . LEU A  1  307 ? -0.327   3.482    393.486 1.00 117.07 ? 307 LEU 1 CA    1 
ATOM   2391  C  C     . LEU A  1  307 ? -1.642   3.409    394.251 1.00 119.29 ? 307 LEU 1 C     1 
ATOM   2392  O  O     . LEU A  1  307 ? -1.852   2.479    395.039 1.00 119.72 ? 307 LEU 1 O     1 
ATOM   2393  C  CB    . LEU A  1  307 ? 0.697    4.297    394.279 1.00 116.93 ? 307 LEU 1 CB    1 
ATOM   2394  C  CG    . LEU A  1  307 ? 2.171    3.964    394.035 1.00 115.66 ? 307 LEU 1 CG    1 
ATOM   2395  C  CD1   . LEU A  1  307 ? 3.067    5.081    394.552 1.00 114.73 ? 307 LEU 1 CD1   1 
ATOM   2396  C  CD2   . LEU A  1  307 ? 2.532    2.628    394.680 1.00 114.93 ? 307 LEU 1 CD2   1 
ATOM   2397  N  N     . ASP A  1  308 ? -2.538   4.368    394.034 1.00 120.78 ? 308 ASP 1 N     1 
ATOM   2398  C  CA    . ASP A  1  308 ? -3.824   4.396    394.715 1.00 122.22 ? 308 ASP 1 CA    1 
ATOM   2399  C  C     . ASP A  1  308 ? -4.855   3.480    394.068 1.00 118.93 ? 308 ASP 1 C     1 
ATOM   2400  O  O     . ASP A  1  308 ? -6.024   3.508    394.470 1.00 120.04 ? 308 ASP 1 O     1 
ATOM   2401  C  CB    . ASP A  1  308 ? -4.370   5.824    394.749 1.00 127.00 ? 308 ASP 1 CB    1 
ATOM   2402  C  CG    . ASP A  1  308 ? -3.594   6.724    395.687 1.00 131.02 ? 308 ASP 1 CG    1 
ATOM   2403  O  OD1   . ASP A  1  308 ? -3.588   6.444    396.905 1.00 132.41 ? 308 ASP 1 OD1   1 
ATOM   2404  O  OD2   . ASP A  1  308 ? -3.007   7.721    395.212 1.00 132.07 ? 308 ASP 1 OD2   1 
ATOM   2405  N  N     . THR A  1  309 ? -4.458   2.669    393.092 1.00 113.49 ? 309 THR 1 N     1 
ATOM   2406  C  CA    . THR A  1  309 ? -5.424   1.841    392.381 1.00 107.65 ? 309 THR 1 CA    1 
ATOM   2407  C  C     . THR A  1  309 ? -5.744   0.597    393.198 1.00 100.35 ? 309 THR 1 C     1 
ATOM   2408  O  O     . THR A  1  309 ? -4.827   -0.092   393.654 1.00 99.41  ? 309 THR 1 O     1 
ATOM   2409  C  CB    . THR A  1  309 ? -4.889   1.444    391.006 1.00 109.50 ? 309 THR 1 CB    1 
ATOM   2410  O  OG1   . THR A  1  309 ? -4.594   2.626    390.249 1.00 110.89 ? 309 THR 1 OG1   1 
ATOM   2411  C  CG2   . THR A  1  309 ? -5.905   0.597    390.244 1.00 109.38 ? 309 THR 1 CG2   1 
ATOM   2412  N  N     . PRO A  1  310 ? -7.022   0.286    393.410 1.00 95.09  ? 310 PRO 1 N     1 
ATOM   2413  C  CA    . PRO A  1  310 ? -7.384   -0.954   394.112 1.00 90.91  ? 310 PRO 1 CA    1 
ATOM   2414  C  C     . PRO A  1  310 ? -7.175   -2.148   393.192 1.00 84.81  ? 310 PRO 1 C     1 
ATOM   2415  O  O     . PRO A  1  310 ? -7.724   -2.200   392.090 1.00 84.15  ? 310 PRO 1 O     1 
ATOM   2416  C  CB    . PRO A  1  310 ? -8.866   -0.755   394.457 1.00 91.64  ? 310 PRO 1 CB    1 
ATOM   2417  C  CG    . PRO A  1  310 ? -9.169   0.690    394.145 1.00 94.03  ? 310 PRO 1 CG    1 
ATOM   2418  C  CD    . PRO A  1  310 ? -8.192   1.124    393.114 1.00 94.77  ? 310 PRO 1 CD    1 
ATOM   2419  N  N     . MET A  1  311 ? -6.378   -3.111   393.652 1.00 77.79  ? 311 MET 1 N     1 
ATOM   2420  C  CA    . MET A  1  311 ? -6.101   -4.324   392.885 1.00 69.45  ? 311 MET 1 CA    1 
ATOM   2421  C  C     . MET A  1  311 ? -7.353   -5.187   392.863 1.00 59.93  ? 311 MET 1 C     1 
ATOM   2422  O  O     . MET A  1  311 ? -7.679   -5.864   393.839 1.00 54.20  ? 311 MET 1 O     1 
ATOM   2423  C  CB    . MET A  1  311 ? -4.910   -5.065   393.478 1.00 70.43  ? 311 MET 1 CB    1 
ATOM   2424  C  CG    . MET A  1  311 ? -3.779   -4.140   393.908 1.00 71.82  ? 311 MET 1 CG    1 
ATOM   2425  S  SD    . MET A  1  311 ? -2.423   -5.005   394.722 1.00 72.98  ? 311 MET 1 SD    1 
ATOM   2426  C  CE    . MET A  1  311 ? -1.623   -5.762   393.311 1.00 73.74  ? 311 MET 1 CE    1 
ATOM   2427  N  N     . SER A  1  312 ? -8.057   -5.158   391.734 1.00 62.38  ? 312 SER 1 N     1 
ATOM   2428  C  CA    . SER A  1  312 ? -9.294   -5.904   391.536 1.00 64.55  ? 312 SER 1 CA    1 
ATOM   2429  C  C     . SER A  1  312 ? -9.452   -6.181   390.047 1.00 62.98  ? 312 SER 1 C     1 
ATOM   2430  O  O     . SER A  1  312 ? -8.644   -5.741   389.219 1.00 61.30  ? 312 SER 1 O     1 
ATOM   2431  C  CB    . SER A  1  312 ? -10.509  -5.144   392.088 1.00 67.56  ? 312 SER 1 CB    1 
ATOM   2432  O  OG    . SER A  1  312 ? -10.878  -4.065   391.241 1.00 67.98  ? 312 SER 1 OG    1 
ATOM   2433  N  N     . TYR A  1  313 ? -10.515  -6.912   389.705 1.00 59.99  ? 313 TYR 1 N     1 
ATOM   2434  C  CA    . TYR A  1  313 ? -10.745  -7.287   388.315 1.00 58.23  ? 313 TYR 1 CA    1 
ATOM   2435  C  C     . TYR A  1  313 ? -11.272  -6.143   387.453 1.00 61.93  ? 313 TYR 1 C     1 
ATOM   2436  O  O     . TYR A  1  313 ? -11.386  -6.310   386.233 1.00 62.32  ? 313 TYR 1 O     1 
ATOM   2437  C  CB    . TYR A  1  313 ? -11.716  -8.477   388.240 1.00 52.25  ? 313 TYR 1 CB    1 
ATOM   2438  C  CG    . TYR A  1  313 ? -11.116  -9.823   388.616 1.00 47.86  ? 313 TYR 1 CG    1 
ATOM   2439  C  CD1   . TYR A  1  313 ? -9.780   -9.946   388.969 1.00 44.80  ? 313 TYR 1 CD1   1 
ATOM   2440  C  CD2   . TYR A  1  313 ? -11.882  -10.977  388.592 1.00 44.28  ? 313 TYR 1 CD2   1 
ATOM   2441  C  CE1   . TYR A  1  313 ? -9.236   -11.192  389.306 1.00 46.06  ? 313 TYR 1 CE1   1 
ATOM   2442  C  CE2   . TYR A  1  313 ? -11.345  -12.225  388.926 1.00 42.93  ? 313 TYR 1 CE2   1 
ATOM   2443  C  CZ    . TYR A  1  313 ? -10.025  -12.328  389.280 1.00 37.76  ? 313 TYR 1 CZ    1 
ATOM   2444  O  OH    . TYR A  1  313 ? -9.500   -13.562  389.607 1.00 29.16  ? 313 TYR 1 OH    1 
ATOM   2445  N  N     . GLU A  1  314 ? -11.566  -4.986   388.029 1.00 65.88  ? 314 GLU 1 N     1 
ATOM   2446  C  CA    . GLU A  1  314 ? -12.108  -3.881   387.246 1.00 71.74  ? 314 GLU 1 CA    1 
ATOM   2447  C  C     . GLU A  1  314 ? -11.210  -2.653   387.231 1.00 72.00  ? 314 GLU 1 C     1 
ATOM   2448  O  O     . GLU A  1  314 ? -11.056  -2.022   386.180 1.00 70.86  ? 314 GLU 1 O     1 
ATOM   2449  C  CB    . GLU A  1  314 ? -13.497  -3.490   387.770 1.00 77.53  ? 314 GLU 1 CB    1 
ATOM   2450  C  CG    . GLU A  1  314 ? -13.596  -3.495   389.283 1.00 82.34  ? 314 GLU 1 CG    1 
ATOM   2451  C  CD    . GLU A  1  314 ? -15.015  -3.714   389.763 1.00 85.94  ? 314 GLU 1 CD    1 
ATOM   2452  O  OE1   . GLU A  1  314 ? -15.954  -3.290   389.055 1.00 87.07  ? 314 GLU 1 OE1   1 
ATOM   2453  O  OE2   . GLU A  1  314 ? -15.196  -4.324   390.835 1.00 87.40  ? 314 GLU 1 OE2   1 
ATOM   2454  N  N     . HIS A  1  315 ? -10.609  -2.295   388.372 1.00 73.46  ? 315 HIS 1 N     1 
ATOM   2455  C  CA    . HIS A  1  315 ? -9.773   -1.100   388.427 1.00 71.97  ? 315 HIS 1 CA    1 
ATOM   2456  C  C     . HIS A  1  315 ? -8.529   -1.249   387.560 1.00 71.43  ? 315 HIS 1 C     1 
ATOM   2457  O  O     . HIS A  1  315 ? -8.066   -0.271   386.962 1.00 69.13  ? 315 HIS 1 O     1 
ATOM   2458  C  CB    . HIS A  1  315 ? -9.378   -0.796   389.872 1.00 79.65  ? 315 HIS 1 CB    1 
ATOM   2459  C  CG    . HIS A  1  315 ? -10.540  -0.720   390.815 1.00 78.43  ? 315 HIS 1 CG    1 
ATOM   2460  N  ND1   . HIS A  1  315 ? -11.190  -1.841   391.287 1.00 85.07  ? 315 HIS 1 ND1   1 
ATOM   2461  C  CD2   . HIS A  1  315 ? -11.180  0.344    391.357 1.00 85.64  ? 315 HIS 1 CD2   1 
ATOM   2462  C  CE1   . HIS A  1  315 ? -12.171  -1.471   392.091 1.00 82.85  ? 315 HIS 1 CE1   1 
ATOM   2463  N  NE2   . HIS A  1  315 ? -12.188  -0.150   392.149 1.00 86.61  ? 315 HIS 1 NE2   1 
ATOM   2464  N  N     . LEU A  1  316 ? -7.976   -2.461   387.483 1.00 69.95  ? 316 LEU 1 N     1 
ATOM   2465  C  CA    . LEU A  1  316 ? -6.795   -2.700   386.662 1.00 67.83  ? 316 LEU 1 CA    1 
ATOM   2466  C  C     . LEU A  1  316 ? -7.175   -2.906   385.203 1.00 66.35  ? 316 LEU 1 C     1 
ATOM   2467  O  O     . LEU A  1  316 ? -6.478   -2.427   384.301 1.00 63.24  ? 316 LEU 1 O     1 
ATOM   2468  C  CB    . LEU A  1  316 ? -6.037   -3.928   387.182 1.00 62.84  ? 316 LEU 1 CB    1 
ATOM   2469  C  CG    . LEU A  1  316 ? -5.183   -3.781   388.442 1.00 57.21  ? 316 LEU 1 CG    1 
ATOM   2470  C  CD1   . LEU A  1  316 ? -5.189   -5.084   389.221 1.00 53.10  ? 316 LEU 1 CD1   1 
ATOM   2471  C  CD2   . LEU A  1  316 ? -3.755   -3.372   388.075 1.00 54.54  ? 316 LEU 1 CD2   1 
ATOM   2472  N  N     . GLN A  1  317 ? -8.280   -3.617   384.966 1.00 67.72  ? 317 GLN 1 N     1 
ATOM   2473  C  CA    . GLN A  1  317 ? -8.687   -3.954   383.605 1.00 68.55  ? 317 GLN 1 CA    1 
ATOM   2474  C  C     . GLN A  1  317 ? -8.872   -2.701   382.754 1.00 66.04  ? 317 GLN 1 C     1 
ATOM   2475  O  O     . GLN A  1  317 ? -8.250   -2.555   381.694 1.00 64.88  ? 317 GLN 1 O     1 
ATOM   2476  C  CB    . GLN A  1  317 ? -9.967   -4.803   383.654 1.00 68.66  ? 317 GLN 1 CB    1 
ATOM   2477  C  CG    . GLN A  1  317 ? -10.823  -4.768   382.401 1.00 68.13  ? 317 GLN 1 CG    1 
ATOM   2478  C  CD    . GLN A  1  317 ? -10.284  -5.672   381.318 1.00 66.67  ? 317 GLN 1 CD    1 
ATOM   2479  O  OE1   . GLN A  1  317 ? -9.612   -6.669   381.597 1.00 66.69  ? 317 GLN 1 OE1   1 
ATOM   2480  N  NE2   . GLN A  1  317 ? -10.563  -5.323   380.066 1.00 66.55  ? 317 GLN 1 NE2   1 
ATOM   2481  N  N     . ALA A  1  318 ? -9.688   -1.761   383.224 1.00 65.22  ? 318 ALA 1 N     1 
ATOM   2482  C  CA    . ALA A  1  318 ? -9.924   -0.545   382.459 1.00 67.16  ? 318 ALA 1 CA    1 
ATOM   2483  C  C     . ALA A  1  318 ? -8.713   0.385    382.446 1.00 74.86  ? 318 ALA 1 C     1 
ATOM   2484  O  O     . ALA A  1  318 ? -8.725   1.378    381.710 1.00 78.07  ? 318 ALA 1 O     1 
ATOM   2485  C  CB    . ALA A  1  318 ? -11.160  0.173    383.009 1.00 65.33  ? 318 ALA 1 CB    1 
ATOM   2486  N  N     . LYS A  1  319 ? -7.667   0.086    383.217 1.00 77.81  ? 319 LYS 1 N     1 
ATOM   2487  C  CA    . LYS A  1  319 ? -6.440   0.874    383.229 1.00 81.01  ? 319 LYS 1 CA    1 
ATOM   2488  C  C     . LYS A  1  319 ? -5.339   0.259    382.365 1.00 82.92  ? 319 LYS 1 C     1 
ATOM   2489  O  O     . LYS A  1  319 ? -4.188   0.702    382.424 1.00 83.00  ? 319 LYS 1 O     1 
ATOM   2490  C  CB    . LYS A  1  319 ? -5.948   1.052    384.669 1.00 82.46  ? 319 LYS 1 CB    1 
ATOM   2491  C  CG    . LYS A  1  319 ? -5.195   2.359    384.949 1.00 83.67  ? 319 LYS 1 CG    1 
ATOM   2492  C  CD    . LYS A  1  319 ? -6.156   3.550    385.043 1.00 83.16  ? 319 LYS 1 CD    1 
ATOM   2493  C  CE    . LYS A  1  319 ? -5.412   4.890    385.066 1.00 82.41  ? 319 LYS 1 CE    1 
ATOM   2494  N  NZ    . LYS A  1  319 ? -6.200   6.027    384.492 1.00 81.45  ? 319 LYS 1 NZ    1 
ATOM   2495  N  N     . GLY A  1  320 ? -5.665   -0.755   381.571 1.00 83.40  ? 320 GLY 1 N     1 
ATOM   2496  C  CA    . GLY A  1  320 ? -4.707   -1.370   380.673 1.00 82.38  ? 320 GLY 1 CA    1 
ATOM   2497  C  C     . GLY A  1  320 ? -4.065   -2.655   381.161 1.00 81.25  ? 320 GLY 1 C     1 
ATOM   2498  O  O     . GLY A  1  320 ? -3.899   -3.585   380.368 1.00 83.85  ? 320 GLY 1 O     1 
ATOM   2499  N  N     . SER A  1  321 ? -3.756   -2.765   382.453 1.00 76.37  ? 321 SER 1 N     1 
ATOM   2500  C  CA    . SER A  1  321 ? -3.101   -3.961   382.968 1.00 69.93  ? 321 SER 1 CA    1 
ATOM   2501  C  C     . SER A  1  321 ? -4.155   -4.987   383.379 1.00 66.95  ? 321 SER 1 C     1 
ATOM   2502  O  O     . SER A  1  321 ? -5.332   -4.871   383.029 1.00 71.15  ? 321 SER 1 O     1 
ATOM   2503  C  CB    . SER A  1  321 ? -2.171   -3.615   384.128 1.00 67.67  ? 321 SER 1 CB    1 
ATOM   2504  O  OG    . SER A  1  321 ? -1.245   -4.663   384.365 1.00 64.31  ? 321 SER 1 OG    1 
ATOM   2505  N  N     . MET A  1  322 ? -3.740   -6.018   384.111 1.00 57.38  ? 322 MET 1 N     1 
ATOM   2506  C  CA    . MET A  1  322 ? -4.663   -7.055   384.554 1.00 47.15  ? 322 MET 1 CA    1 
ATOM   2507  C  C     . MET A  1  322 ? -4.109   -7.723   385.805 1.00 35.71  ? 322 MET 1 C     1 
ATOM   2508  O  O     . MET A  1  322 ? -2.922   -7.611   386.124 1.00 35.56  ? 322 MET 1 O     1 
ATOM   2509  C  CB    . MET A  1  322 ? -4.893   -8.100   383.463 1.00 43.19  ? 322 MET 1 CB    1 
ATOM   2510  C  CG    . MET A  1  322 ? -3.596   -8.652   382.903 1.00 45.51  ? 322 MET 1 CG    1 
ATOM   2511  S  SD    . MET A  1  322 ? -3.840   -9.665   381.432 1.00 47.75  ? 322 MET 1 SD    1 
ATOM   2512  C  CE    . MET A  1  322 ? -4.292   -8.419   380.232 1.00 51.53  ? 322 MET 1 CE    1 
ATOM   2513  N  N     . LEU A  1  323 ? -4.979   -8.456   386.486 1.00 33.32  ? 323 LEU 1 N     1 
ATOM   2514  C  CA    . LEU A  1  323 ? -4.633   -9.112   387.740 1.00 33.19  ? 323 LEU 1 CA    1 
ATOM   2515  C  C     . LEU A  1  323 ? -4.538   -10.613  387.476 1.00 45.54  ? 323 LEU 1 C     1 
ATOM   2516  O  O     . LEU A  1  323 ? -5.534   -11.340  387.549 1.00 48.55  ? 323 LEU 1 O     1 
ATOM   2517  C  CB    . LEU A  1  323 ? -5.667   -8.811   388.802 1.00 32.29  ? 323 LEU 1 CB    1 
ATOM   2518  C  CG    . LEU A  1  323 ? -5.442   -9.502   390.139 1.00 31.05  ? 323 LEU 1 CG    1 
ATOM   2519  C  CD1   . LEU A  1  323 ? -4.210   -8.916   390.831 1.00 33.27  ? 323 LEU 1 CD1   1 
ATOM   2520  C  CD2   . LEU A  1  323 ? -6.687   -9.420   390.996 1.00 30.17  ? 323 LEU 1 CD2   1 
ATOM   2521  N  N     . GLY A  1  324 ? -3.336   -11.073  387.136 1.00 43.99  ? 324 GLY 1 N     1 
ATOM   2522  C  CA    . GLY A  1  324 ? -3.157   -12.487  386.908 1.00 41.09  ? 324 GLY 1 CA    1 
ATOM   2523  C  C     . GLY A  1  324 ? -3.090   -13.288  388.192 1.00 40.79  ? 324 GLY 1 C     1 
ATOM   2524  O  O     . GLY A  1  324 ? -4.048   -13.995  388.515 1.00 42.90  ? 324 GLY 1 O     1 
ATOM   2525  N  N     . THR A  1  325 ? -2.007   -13.143  388.968 1.00 41.87  ? 325 THR 1 N     1 
ATOM   2526  C  CA    . THR A  1  325 ? -1.803   -13.945  390.173 1.00 42.37  ? 325 THR 1 CA    1 
ATOM   2527  C  C     . THR A  1  325 ? -1.646   -13.112  391.440 1.00 47.09  ? 325 THR 1 C     1 
ATOM   2528  O  O     . THR A  1  325 ? -1.367   -13.682  392.503 1.00 45.13  ? 325 THR 1 O     1 
ATOM   2529  C  CB    . THR A  1  325 ? -0.570   -14.870  390.026 1.00 41.26  ? 325 THR 1 CB    1 
ATOM   2530  O  OG1   . THR A  1  325 ? 0.521    -14.169  389.419 1.00 45.52  ? 325 THR 1 OG1   1 
ATOM   2531  C  CG2   . THR A  1  325 ? -0.888   -16.071  389.152 1.00 34.34  ? 325 THR 1 CG2   1 
ATOM   2532  N  N     . GLY A  1  326 ? -1.811   -11.789  391.367 1.00 51.77  ? 326 GLY 1 N     1 
ATOM   2533  C  CA    . GLY A  1  326 ? -1.488   -10.937  392.500 1.00 55.92  ? 326 GLY 1 CA    1 
ATOM   2534  C  C     . GLY A  1  326 ? -0.011   -10.861  392.799 1.00 56.91  ? 326 GLY 1 C     1 
ATOM   2535  O  O     . GLY A  1  326 ? 0.379    -10.280  393.818 1.00 56.62  ? 326 GLY 1 O     1 
ATOM   2536  N  N     . GLY A  1  327 ? 0.819    -11.462  391.949 1.00 56.91  ? 327 GLY 1 N     1 
ATOM   2537  C  CA    . GLY A  1  327 ? 2.250    -11.465  392.134 1.00 57.43  ? 327 GLY 1 CA    1 
ATOM   2538  C  C     . GLY A  1  327 ? 2.889    -10.240  391.532 1.00 59.15  ? 327 GLY 1 C     1 
ATOM   2539  O  O     . GLY A  1  327 ? 3.134    -10.189  390.321 1.00 61.83  ? 327 GLY 1 O     1 
ATOM   2540  N  N     . VAL A  1  328 ? 3.189    -9.259   392.379 1.00 54.04  ? 328 VAL 1 N     1 
ATOM   2541  C  CA    . VAL A  1  328 ? 3.726    -7.981   391.939 1.00 43.81  ? 328 VAL 1 CA    1 
ATOM   2542  C  C     . VAL A  1  328 ? 5.235    -8.122   391.859 1.00 39.62  ? 328 VAL 1 C     1 
ATOM   2543  O  O     . VAL A  1  328 ? 5.865    -8.796   392.683 1.00 34.80  ? 328 VAL 1 O     1 
ATOM   2544  C  CB    . VAL A  1  328 ? 3.317    -6.839   392.896 1.00 40.54  ? 328 VAL 1 CB    1 
ATOM   2545  C  CG1   . VAL A  1  328 ? 3.536    -5.473   392.237 1.00 42.00  ? 328 VAL 1 CG1   1 
ATOM   2546  C  CG2   . VAL A  1  328 ? 1.875    -6.986   393.369 1.00 37.60  ? 328 VAL 1 CG2   1 
ATOM   2547  N  N     . ILE A  1  329 ? 5.809    -7.533   390.822 1.00 42.69  ? 329 ILE 1 N     1 
ATOM   2548  C  CA    . ILE A  1  329 ? 7.255    -7.399   390.697 1.00 43.56  ? 329 ILE 1 CA    1 
ATOM   2549  C  C     . ILE A  1  329 ? 7.581    -5.917   390.585 1.00 45.14  ? 329 ILE 1 C     1 
ATOM   2550  O  O     . ILE A  1  329 ? 7.020    -5.216   389.733 1.00 40.67  ? 329 ILE 1 O     1 
ATOM   2551  C  CB    . ILE A  1  329 ? 7.806    -8.170   389.486 1.00 43.65  ? 329 ILE 1 CB    1 
ATOM   2552  C  CG1   . ILE A  1  329 ? 7.421    -9.639   389.541 1.00 34.23  ? 329 ILE 1 CG1   1 
ATOM   2553  C  CG2   . ILE A  1  329 ? 9.319    -8.075   389.434 1.00 50.32  ? 329 ILE 1 CG2   1 
ATOM   2554  C  CD1   . ILE A  1  329 ? 7.940    -10.414  388.348 1.00 33.06  ? 329 ILE 1 CD1   1 
ATOM   2555  N  N     . LEU A  1  330 ? 8.472    -5.441   391.446 1.00 48.67  ? 330 LEU 1 N     1 
ATOM   2556  C  CA    . LEU A  1  330 ? 8.889    -4.046   391.415 1.00 56.53  ? 330 LEU 1 CA    1 
ATOM   2557  C  C     . LEU A  1  330 ? 10.178   -3.931   390.613 1.00 51.98  ? 330 LEU 1 C     1 
ATOM   2558  O  O     . LEU A  1  330 ? 11.174   -4.582   390.938 1.00 47.22  ? 330 LEU 1 O     1 
ATOM   2559  C  CB    . LEU A  1  330 ? 9.066    -3.497   392.830 1.00 65.62  ? 330 LEU 1 CB    1 
ATOM   2560  C  CG    . LEU A  1  330 ? 8.002    -3.854   393.872 1.00 72.92  ? 330 LEU 1 CG    1 
ATOM   2561  C  CD1   . LEU A  1  330 ? 8.290    -3.122   395.184 1.00 75.87  ? 330 LEU 1 CD1   1 
ATOM   2562  C  CD2   . LEU A  1  330 ? 6.595    -3.544   393.363 1.00 72.91  ? 330 LEU 1 CD2   1 
ATOM   2563  N  N     . ILE A  1  331 ? 10.150   -3.134   389.554 1.00 56.10  ? 331 ILE 1 N     1 
ATOM   2564  C  CA    . ILE A  1  331 ? 11.289   -2.946   388.663 1.00 57.16  ? 331 ILE 1 CA    1 
ATOM   2565  C  C     . ILE A  1  331 ? 11.834   -1.540   388.895 1.00 59.85  ? 331 ILE 1 C     1 
ATOM   2566  O  O     . ILE A  1  331 ? 11.083   -0.560   388.760 1.00 61.81  ? 331 ILE 1 O     1 
ATOM   2567  C  CB    . ILE A  1  331 ? 10.908   -3.156   387.187 1.00 52.13  ? 331 ILE 1 CB    1 
ATOM   2568  C  CG1   . ILE A  1  331 ? 10.098   -4.448   387.023 1.00 49.04  ? 331 ILE 1 CG1   1 
ATOM   2569  C  CG2   . ILE A  1  331 ? 12.160   -3.177   386.310 1.00 48.49  ? 331 ILE 1 CG2   1 
ATOM   2570  C  CD1   . ILE A  1  331 ? 9.944    -4.908   385.590 1.00 47.20  ? 331 ILE 1 CD1   1 
ATOM   2571  N  N     . PRO A  1  332 ? 13.100   -1.401   389.275 1.00 58.65  ? 332 PRO 1 N     1 
ATOM   2572  C  CA    . PRO A  1  332 ? 13.702   -0.084   389.480 1.00 58.26  ? 332 PRO 1 CA    1 
ATOM   2573  C  C     . PRO A  1  332 ? 14.238   0.494    388.173 1.00 59.37  ? 332 PRO 1 C     1 
ATOM   2574  O  O     . PRO A  1  332 ? 14.398   -0.203   387.170 1.00 57.13  ? 332 PRO 1 O     1 
ATOM   2575  C  CB    . PRO A  1  332 ? 14.848   -0.396   390.452 1.00 58.16  ? 332 PRO 1 CB    1 
ATOM   2576  C  CG    . PRO A  1  332 ? 15.273   -1.769   390.044 1.00 56.51  ? 332 PRO 1 CG    1 
ATOM   2577  C  CD    . PRO A  1  332 ? 13.993   -2.487   389.718 1.00 56.45  ? 332 PRO 1 CD    1 
ATOM   2578  N  N     . GLU A  1  333 ? 14.526   1.798    388.211 1.00 62.17  ? 333 GLU 1 N     1 
ATOM   2579  C  CA    . GLU A  1  333 ? 15.108   2.467    387.049 1.00 62.75  ? 333 GLU 1 CA    1 
ATOM   2580  C  C     . GLU A  1  333 ? 16.506   1.960    386.723 1.00 59.45  ? 333 GLU 1 C     1 
ATOM   2581  O  O     . GLU A  1  333 ? 16.956   2.112    385.583 1.00 59.05  ? 333 GLU 1 O     1 
ATOM   2582  C  CB    . GLU A  1  333 ? 15.163   3.980    387.275 1.00 63.90  ? 333 GLU 1 CB    1 
ATOM   2583  C  CG    . GLU A  1  333 ? 13.814   4.630    387.484 1.00 67.50  ? 333 GLU 1 CG    1 
ATOM   2584  C  CD    . GLU A  1  333 ? 13.940   6.037    388.011 1.00 73.67  ? 333 GLU 1 CD    1 
ATOM   2585  O  OE1   . GLU A  1  333 ? 14.974   6.329    388.645 1.00 76.68  ? 333 GLU 1 OE1   1 
ATOM   2586  O  OE2   . GLU A  1  333 ? 13.006   6.842    387.815 1.00 76.05  ? 333 GLU 1 OE2   1 
ATOM   2587  N  N     . ARG A  1  334 ? 17.189   1.341    387.686 1.00 58.59  ? 334 ARG 1 N     1 
ATOM   2588  C  CA    . ARG A  1  334 ? 18.582   0.969    387.485 1.00 60.72  ? 334 ARG 1 CA    1 
ATOM   2589  C  C     . ARG A  1  334 ? 18.761   -0.067   386.387 1.00 64.62  ? 334 ARG 1 C     1 
ATOM   2590  O  O     . ARG A  1  334 ? 19.870   -0.201   385.857 1.00 61.66  ? 334 ARG 1 O     1 
ATOM   2591  C  CB    . ARG A  1  334 ? 19.172   0.467    388.803 1.00 62.03  ? 334 ARG 1 CB    1 
ATOM   2592  C  CG    . ARG A  1  334 ? 20.675   0.619    388.883 1.00 65.66  ? 334 ARG 1 CG    1 
ATOM   2593  C  CD    . ARG A  1  334 ? 21.114   0.869    390.310 1.00 69.44  ? 334 ARG 1 CD    1 
ATOM   2594  N  NE    . ARG A  1  334 ? 20.611   -0.124   391.248 1.00 70.27  ? 334 ARG 1 NE    1 
ATOM   2595  C  CZ    . ARG A  1  334 ? 21.365   -1.078   391.786 1.00 71.22  ? 334 ARG 1 CZ    1 
ATOM   2596  N  NH1   . ARG A  1  334 ? 22.657   -1.159   391.484 1.00 70.93  ? 334 ARG 1 NH1   1 
ATOM   2597  N  NH2   . ARG A  1  334 ? 20.831   -1.944   392.637 1.00 71.60  ? 334 ARG 1 NH2   1 
ATOM   2598  N  N     . VAL A  1  335 ? 17.693   -0.770   386.010 1.00 67.65  ? 335 VAL 1 N     1 
ATOM   2599  C  CA    . VAL A  1  335 ? 17.714   -1.746   384.926 1.00 66.16  ? 335 VAL 1 CA    1 
ATOM   2600  C  C     . VAL A  1  335 ? 16.742   -1.279   383.852 1.00 66.39  ? 335 VAL 1 C     1 
ATOM   2601  O  O     . VAL A  1  335 ? 15.584   -0.963   384.152 1.00 67.49  ? 335 VAL 1 O     1 
ATOM   2602  C  CB    . VAL A  1  335 ? 17.342   -3.154   385.421 1.00 56.20  ? 335 VAL 1 CB    1 
ATOM   2603  C  CG1   . VAL A  1  335 ? 17.373   -4.127   384.272 1.00 57.22  ? 335 VAL 1 CG1   1 
ATOM   2604  C  CG2   . VAL A  1  335 ? 18.282   -3.594   386.537 1.00 53.74  ? 335 VAL 1 CG2   1 
ATOM   2605  N  N     . SER A  1  336 ? 17.214   -1.229   382.609 1.00 68.73  ? 336 SER 1 N     1 
ATOM   2606  C  CA    . SER A  1  336 ? 16.399   -0.704   381.522 1.00 66.97  ? 336 SER 1 CA    1 
ATOM   2607  C  C     . SER A  1  336 ? 15.285   -1.679   381.159 1.00 59.17  ? 336 SER 1 C     1 
ATOM   2608  O  O     . SER A  1  336 ? 15.459   -2.900   381.204 1.00 51.78  ? 336 SER 1 O     1 
ATOM   2609  C  CB    . SER A  1  336 ? 17.258   -0.409   380.291 1.00 70.29  ? 336 SER 1 CB    1 
ATOM   2610  O  OG    . SER A  1  336 ? 16.474   0.123    379.233 1.00 70.67  ? 336 SER 1 OG    1 
ATOM   2611  N  N     . MET A  1  337 ? 14.124   -1.115   380.822 1.00 59.65  ? 337 MET 1 N     1 
ATOM   2612  C  CA    . MET A  1  337 ? 12.973   -1.912   380.421 1.00 56.02  ? 337 MET 1 CA    1 
ATOM   2613  C  C     . MET A  1  337 ? 13.310   -2.809   379.243 1.00 50.73  ? 337 MET 1 C     1 
ATOM   2614  O  O     . MET A  1  337 ? 12.737   -3.891   379.109 1.00 49.04  ? 337 MET 1 O     1 
ATOM   2615  C  CB    . MET A  1  337 ? 11.810   -0.985   380.080 1.00 60.78  ? 337 MET 1 CB    1 
ATOM   2616  C  CG    . MET A  1  337 ? 10.782   -0.856   381.179 1.00 62.87  ? 337 MET 1 CG    1 
ATOM   2617  S  SD    . MET A  1  337 ? 9.648    -2.233   381.133 1.00 67.71  ? 337 MET 1 SD    1 
ATOM   2618  C  CE    . MET A  1  337 ? 9.211    -2.370   382.862 1.00 70.06  ? 337 MET 1 CE    1 
ATOM   2619  N  N     . VAL A  1  338 ? 14.207   -2.362   378.363 1.00 48.81  ? 338 VAL 1 N     1 
ATOM   2620  C  CA    . VAL A  1  338 ? 14.705   -3.228   377.297 1.00 52.23  ? 338 VAL 1 CA    1 
ATOM   2621  C  C     . VAL A  1  338 ? 15.271   -4.521   377.884 1.00 56.56  ? 338 VAL 1 C     1 
ATOM   2622  O  O     . VAL A  1  338 ? 14.984   -5.616   377.395 1.00 54.13  ? 338 VAL 1 O     1 
ATOM   2623  C  CB    . VAL A  1  338 ? 15.758   -2.484   376.447 1.00 53.48  ? 338 VAL 1 CB    1 
ATOM   2624  C  CG1   . VAL A  1  338 ? 16.472   -3.452   375.505 1.00 55.76  ? 338 VAL 1 CG1   1 
ATOM   2625  C  CG2   . VAL A  1  338 ? 15.120   -1.363   375.649 1.00 53.73  ? 338 VAL 1 CG2   1 
ATOM   2626  N  N     . ASP A  1  339 ? 16.047   -4.417   378.974 1.00 56.65  ? 339 ASP 1 N     1 
ATOM   2627  C  CA    . ASP A  1  339 ? 16.657   -5.604   379.583 1.00 45.65  ? 339 ASP 1 CA    1 
ATOM   2628  C  C     . ASP A  1  339 ? 15.603   -6.499   380.237 1.00 37.25  ? 339 ASP 1 C     1 
ATOM   2629  O  O     . ASP A  1  339 ? 15.625   -7.725   380.073 1.00 34.08  ? 339 ASP 1 O     1 
ATOM   2630  C  CB    . ASP A  1  339 ? 17.707   -5.169   380.616 1.00 39.28  ? 339 ASP 1 CB    1 
ATOM   2631  C  CG    . ASP A  1  339 ? 18.639   -6.301   381.035 1.00 45.09  ? 339 ASP 1 CG    1 
ATOM   2632  O  OD1   . ASP A  1  339 ? 19.415   -6.787   380.191 1.00 31.45  ? 339 ASP 1 OD1   1 
ATOM   2633  O  OD2   . ASP A  1  339 ? 18.584   -6.727   382.204 1.00 31.49  ? 339 ASP 1 OD2   1 
ATOM   2634  N  N     . ALA A  1  340 ? 14.652   -5.901   380.953 1.00 34.31  ? 340 ALA 1 N     1 
ATOM   2635  C  CA    . ALA A  1  340 ? 13.610   -6.693   381.593 1.00 33.29  ? 340 ALA 1 CA    1 
ATOM   2636  C  C     . ALA A  1  340 ? 12.797   -7.447   380.558 1.00 39.07  ? 340 ALA 1 C     1 
ATOM   2637  O  O     . ALA A  1  340 ? 12.612   -8.663   380.668 1.00 46.84  ? 340 ALA 1 O     1 
ATOM   2638  C  CB    . ALA A  1  340 ? 12.698   -5.812   382.443 1.00 32.39  ? 340 ALA 1 CB    1 
ATOM   2639  N  N     . MET A  1  341 ? 12.291   -6.742   379.542 1.00 38.16  ? 341 MET 1 N     1 
ATOM   2640  C  CA    . MET A  1  341 ? 11.463   -7.421   378.550 1.00 36.59  ? 341 MET 1 CA    1 
ATOM   2641  C  C     . MET A  1  341 ? 12.301   -8.327   377.656 1.00 37.01  ? 341 MET 1 C     1 
ATOM   2642  O  O     . MET A  1  341 ? 11.786   -9.312   377.124 1.00 37.15  ? 341 MET 1 O     1 
ATOM   2643  C  CB    . MET A  1  341 ? 10.662   -6.408   377.727 1.00 36.52  ? 341 MET 1 CB    1 
ATOM   2644  C  CG    . MET A  1  341 ? 10.208   -5.180   378.509 1.00 38.67  ? 341 MET 1 CG    1 
ATOM   2645  S  SD    . MET A  1  341 ? 9.502    -5.566   380.121 1.00 31.17  ? 341 MET 1 SD    1 
ATOM   2646  C  CE    . MET A  1  341 ? 7.916    -6.239   379.616 1.00 30.93  ? 341 MET 1 CE    1 
ATOM   2647  N  N     . TRP A  1  342 ? 13.591   -8.016   377.500 1.00 37.20  ? 342 TRP 1 N     1 
ATOM   2648  C  CA    . TRP A  1  342 ? 14.580   -8.932   376.944 1.00 44.11  ? 342 TRP 1 CA    1 
ATOM   2649  C  C     . TRP A  1  342 ? 14.486   -10.303  377.610 1.00 43.65  ? 342 TRP 1 C     1 
ATOM   2650  O  O     . TRP A  1  342 ? 14.244   -11.334  376.960 1.00 37.00  ? 342 TRP 1 O     1 
ATOM   2651  C  CB    . TRP A  1  342 ? 15.966   -8.309   377.171 1.00 47.60  ? 342 TRP 1 CB    1 
ATOM   2652  C  CG    . TRP A  1  342 ? 17.012   -8.593   376.178 1.00 52.39  ? 342 TRP 1 CG    1 
ATOM   2653  C  CD1   . TRP A  1  342 ? 17.523   -7.720   375.274 1.00 55.02  ? 342 TRP 1 CD1   1 
ATOM   2654  C  CD2   . TRP A  1  342 ? 17.735   -9.819   376.010 1.00 54.56  ? 342 TRP 1 CD2   1 
ATOM   2655  N  NE1   . TRP A  1  342 ? 18.507   -8.328   374.532 1.00 56.66  ? 342 TRP 1 NE1   1 
ATOM   2656  C  CE2   . TRP A  1  342 ? 18.654   -9.620   374.962 1.00 55.24  ? 342 TRP 1 CE2   1 
ATOM   2657  C  CE3   . TRP A  1  342 ? 17.683   -11.071  376.631 1.00 55.16  ? 342 TRP 1 CE3   1 
ATOM   2658  C  CZ2   . TRP A  1  342 ? 19.517   -10.624  374.524 1.00 55.24  ? 342 TRP 1 CZ2   1 
ATOM   2659  C  CZ3   . TRP A  1  342 ? 18.543   -12.066  376.191 1.00 54.98  ? 342 TRP 1 CZ3   1 
ATOM   2660  C  CH2   . TRP A  1  342 ? 19.444   -11.836  375.149 1.00 54.98  ? 342 TRP 1 CH2   1 
ATOM   2661  N  N     . ASN A  1  343 ? 14.671   -10.318  378.931 1.00 46.97  ? 343 ASN 1 N     1 
ATOM   2662  C  CA    . ASN A  1  343 ? 14.619   -11.580  379.661 1.00 45.34  ? 343 ASN 1 CA    1 
ATOM   2663  C  C     . ASN A  1  343 ? 13.218   -12.170  379.625 1.00 42.47  ? 343 ASN 1 C     1 
ATOM   2664  O  O     . ASN A  1  343 ? 13.060   -13.389  379.531 1.00 46.95  ? 343 ASN 1 O     1 
ATOM   2665  C  CB    . ASN A  1  343 ? 15.098   -11.413  381.105 1.00 51.96  ? 343 ASN 1 CB    1 
ATOM   2666  C  CG    . ASN A  1  343 ? 15.292   -12.755  381.806 1.00 59.25  ? 343 ASN 1 CG    1 
ATOM   2667  O  OD1   . ASN A  1  343 ? 14.328   -13.380  382.255 1.00 63.46  ? 343 ASN 1 OD1   1 
ATOM   2668  N  ND2   . ASN A  1  343 ? 16.530   -13.229  381.849 1.00 61.16  ? 343 ASN 1 ND2   1 
ATOM   2669  N  N     . LEU A  1  344 ? 12.188   -11.326  379.691 1.00 35.06  ? 344 LEU 1 N     1 
ATOM   2670  C  CA    . LEU A  1  344 ? 10.824   -11.845  379.676 1.00 36.14  ? 344 LEU 1 CA    1 
ATOM   2671  C  C     . LEU A  1  344 ? 10.537   -12.605  378.380 1.00 37.71  ? 344 LEU 1 C     1 
ATOM   2672  O  O     . LEU A  1  344 ? 10.023   -13.733  378.402 1.00 29.42  ? 344 LEU 1 O     1 
ATOM   2673  C  CB    . LEU A  1  344 ? 9.817    -10.712  379.867 1.00 30.10  ? 344 LEU 1 CB    1 
ATOM   2674  C  CG    . LEU A  1  344 ? 9.732    -10.110  381.272 1.00 30.27  ? 344 LEU 1 CG    1 
ATOM   2675  C  CD1   . LEU A  1  344 ? 8.423    -9.357   381.411 1.00 35.91  ? 344 LEU 1 CD1   1 
ATOM   2676  C  CD2   . LEU A  1  344 ? 9.882    -11.147  382.371 1.00 30.11  ? 344 LEU 1 CD2   1 
ATOM   2677  N  N     . THR A  1  345 ? 10.873   -12.001  377.239 1.00 35.41  ? 345 THR 1 N     1 
ATOM   2678  C  CA    . THR A  1  345 ? 10.636   -12.633  375.948 1.00 34.28  ? 345 THR 1 CA    1 
ATOM   2679  C  C     . THR A  1  345 ? 11.531   -13.850  375.736 1.00 37.26  ? 345 THR 1 C     1 
ATOM   2680  O  O     . THR A  1  345 ? 11.096   -14.825  375.119 1.00 34.39  ? 345 THR 1 O     1 
ATOM   2681  C  CB    . THR A  1  345 ? 10.826   -11.622  374.817 1.00 32.89  ? 345 THR 1 CB    1 
ATOM   2682  O  OG1   . THR A  1  345 ? 12.156   -11.084  374.866 1.00 35.47  ? 345 THR 1 OG1   1 
ATOM   2683  C  CG2   . THR A  1  345 ? 9.803    -10.522  374.911 1.00 29.96  ? 345 THR 1 CG2   1 
ATOM   2684  N  N     . ARG A  1  346 ? 12.774   -13.829  376.234 1.00 44.71  ? 346 ARG 1 N     1 
ATOM   2685  C  CA    . ARG A  1  346 ? 13.593   -15.033  376.098 1.00 50.15  ? 346 ARG 1 CA    1 
ATOM   2686  C  C     . ARG A  1  346 ? 13.070   -16.151  376.995 1.00 47.43  ? 346 ARG 1 C     1 
ATOM   2687  O  O     . ARG A  1  346 ? 13.235   -17.335  376.678 1.00 46.32  ? 346 ARG 1 O     1 
ATOM   2688  C  CB    . ARG A  1  346 ? 15.066   -14.731  376.407 1.00 57.06  ? 346 ARG 1 CB    1 
ATOM   2689  C  CG    . ARG A  1  346 ? 15.420   -14.630  377.883 1.00 61.06  ? 346 ARG 1 CG    1 
ATOM   2690  C  CD    . ARG A  1  346 ? 16.921   -14.401  378.099 1.00 63.13  ? 346 ARG 1 CD    1 
ATOM   2691  N  NE    . ARG A  1  346 ? 17.755   -15.233  377.224 1.00 65.34  ? 346 ARG 1 NE    1 
ATOM   2692  C  CZ    . ARG A  1  346 ? 18.181   -16.468  377.514 1.00 67.09  ? 346 ARG 1 CZ    1 
ATOM   2693  N  NH1   . ARG A  1  346 ? 17.845   -17.060  378.657 1.00 69.97  ? 346 ARG 1 NH1   1 
ATOM   2694  N  NH2   . ARG A  1  346 ? 18.941   -17.125  376.643 1.00 64.49  ? 346 ARG 1 NH2   1 
ATOM   2695  N  N     . PHE A  1  347 ? 12.412   -15.788  378.100 1.00 46.97  ? 347 PHE 1 N     1 
ATOM   2696  C  CA    . PHE A  1  347 ? 11.778   -16.771  378.970 1.00 49.48  ? 347 PHE 1 CA    1 
ATOM   2697  C  C     . PHE A  1  347 ? 10.563   -17.398  378.289 1.00 51.15  ? 347 PHE 1 C     1 
ATOM   2698  O  O     . PHE A  1  347 ? 10.416   -18.628  378.266 1.00 52.24  ? 347 PHE 1 O     1 
ATOM   2699  C  CB    . PHE A  1  347 ? 11.412   -16.110  380.310 1.00 46.17  ? 347 PHE 1 CB    1 
ATOM   2700  C  CG    . PHE A  1  347 ? 10.255   -16.766  381.034 1.00 43.62  ? 347 PHE 1 CG    1 
ATOM   2701  C  CD1   . PHE A  1  347 ? 9.013    -16.151  381.094 1.00 40.13  ? 347 PHE 1 CD1   1 
ATOM   2702  C  CD2   . PHE A  1  347 ? 10.405   -18.013  381.631 1.00 39.43  ? 347 PHE 1 CD2   1 
ATOM   2703  C  CE1   . PHE A  1  347 ? 7.949    -16.762  381.758 1.00 38.58  ? 347 PHE 1 CE1   1 
ATOM   2704  C  CE2   . PHE A  1  347 ? 9.342    -18.624  382.283 1.00 36.46  ? 347 PHE 1 CE2   1 
ATOM   2705  C  CZ    . PHE A  1  347 ? 8.118    -17.998  382.347 1.00 36.49  ? 347 PHE 1 CZ    1 
ATOM   2706  N  N     . TYR A  1  348 ? 9.679    -16.566  377.723 1.00 50.52  ? 348 TYR 1 N     1 
ATOM   2707  C  CA    . TYR A  1  348 ? 8.531    -17.103  376.986 1.00 50.72  ? 348 TYR 1 CA    1 
ATOM   2708  C  C     . TYR A  1  348 ? 8.962    -17.855  375.731 1.00 51.17  ? 348 TYR 1 C     1 
ATOM   2709  O  O     . TYR A  1  348 ? 8.299    -18.817  375.324 1.00 51.85  ? 348 TYR 1 O     1 
ATOM   2710  C  CB    . TYR A  1  348 ? 7.549    -15.984  376.629 1.00 54.11  ? 348 TYR 1 CB    1 
ATOM   2711  C  CG    . TYR A  1  348 ? 6.749    -15.542  377.827 1.00 60.04  ? 348 TYR 1 CG    1 
ATOM   2712  C  CD1   . TYR A  1  348 ? 5.676    -16.292  378.281 1.00 61.76  ? 348 TYR 1 CD1   1 
ATOM   2713  C  CD2   . TYR A  1  348 ? 7.083    -14.395  378.530 1.00 65.06  ? 348 TYR 1 CD2   1 
ATOM   2714  C  CE1   . TYR A  1  348 ? 4.953    -15.909  379.395 1.00 63.14  ? 348 TYR 1 CE1   1 
ATOM   2715  C  CE2   . TYR A  1  348 ? 6.360    -14.000  379.649 1.00 66.85  ? 348 TYR 1 CE2   1 
ATOM   2716  C  CZ    . TYR A  1  348 ? 5.295    -14.764  380.072 1.00 66.57  ? 348 TYR 1 CZ    1 
ATOM   2717  O  OH    . TYR A  1  348 ? 4.566    -14.397  381.177 1.00 68.53  ? 348 TYR 1 OH    1 
ATOM   2718  N  N     . ALA A  1  349 ? 10.091   -17.464  375.141 1.00 47.81  ? 349 ALA 1 N     1 
ATOM   2719  C  CA    . ALA A  1  349 ? 10.645   -18.193  374.010 1.00 42.87  ? 349 ALA 1 CA    1 
ATOM   2720  C  C     . ALA A  1  349 ? 11.143   -19.565  374.443 1.00 38.73  ? 349 ALA 1 C     1 
ATOM   2721  O  O     . ALA A  1  349 ? 10.998   -20.547  373.705 1.00 38.99  ? 349 ALA 1 O     1 
ATOM   2722  C  CB    . ALA A  1  349 ? 11.779   -17.378  373.390 1.00 43.75  ? 349 ALA 1 CB    1 
ATOM   2723  N  N     . HIS A  1  350 ? 11.739   -19.645  375.638 1.00 34.47  ? 350 HIS 1 N     1 
ATOM   2724  C  CA    . HIS A  1  350 ? 12.170   -20.930  376.176 1.00 31.70  ? 350 HIS 1 CA    1 
ATOM   2725  C  C     . HIS A  1  350 ? 10.987   -21.874  376.302 1.00 32.03  ? 350 HIS 1 C     1 
ATOM   2726  O  O     . HIS A  1  350 ? 11.136   -23.085  376.123 1.00 32.05  ? 350 HIS 1 O     1 
ATOM   2727  C  CB    . HIS A  1  350 ? 12.864   -20.725  377.528 1.00 30.09  ? 350 HIS 1 CB    1 
ATOM   2728  C  CG    . HIS A  1  350 ? 13.454   -21.972  378.129 1.00 32.22  ? 350 HIS 1 CG    1 
ATOM   2729  N  ND1   . HIS A  1  350 ? 14.645   -22.514  377.687 1.00 27.78  ? 350 HIS 1 ND1   1 
ATOM   2730  C  CD2   . HIS A  1  350 ? 13.084   -22.708  379.205 1.00 27.71  ? 350 HIS 1 CD2   1 
ATOM   2731  C  CE1   . HIS A  1  350 ? 14.948   -23.565  378.422 1.00 27.59  ? 350 HIS 1 CE1   1 
ATOM   2732  N  NE2   . HIS A  1  350 ? 14.021   -23.702  379.353 1.00 27.55  ? 350 HIS 1 NE2   1 
ATOM   2733  N  N     . GLU A  1  351 ? 9.800    -21.327  376.550 1.00 36.57  ? 351 GLU 1 N     1 
ATOM   2734  C  CA    . GLU A  1  351 ? 8.644    -22.090  376.991 1.00 37.67  ? 351 GLU 1 CA    1 
ATOM   2735  C  C     . GLU A  1  351 ? 7.639    -22.360  375.871 1.00 41.65  ? 351 GLU 1 C     1 
ATOM   2736  O  O     . GLU A  1  351 ? 6.452    -22.550  376.152 1.00 40.23  ? 351 GLU 1 O     1 
ATOM   2737  C  CB    . GLU A  1  351 ? 7.956    -21.360  378.147 1.00 37.34  ? 351 GLU 1 CB    1 
ATOM   2738  C  CG    . GLU A  1  351 ? 8.785    -21.262  379.427 1.00 33.79  ? 351 GLU 1 CG    1 
ATOM   2739  C  CD    . GLU A  1  351 ? 9.019    -22.603  380.074 1.00 29.17  ? 351 GLU 1 CD    1 
ATOM   2740  O  OE1   . GLU A  1  351 ? 8.290    -23.555  379.742 1.00 27.33  ? 351 GLU 1 OE1   1 
ATOM   2741  O  OE2   . GLU A  1  351 ? 9.921    -22.702  380.928 1.00 27.62  ? 351 GLU 1 OE2   1 
ATOM   2742  N  N     . SER A  1  352 ? 8.069    -22.329  374.611 1.00 43.01  ? 352 SER 1 N     1 
ATOM   2743  C  CA    . SER A  1  352 ? 7.171    -22.724  373.530 1.00 42.49  ? 352 SER 1 CA    1 
ATOM   2744  C  C     . SER A  1  352 ? 6.961    -24.236  373.535 1.00 44.53  ? 352 SER 1 C     1 
ATOM   2745  O  O     . SER A  1  352 ? 7.884    -25.010  373.808 1.00 43.67  ? 352 SER 1 O     1 
ATOM   2746  C  CB    . SER A  1  352 ? 7.725    -22.298  372.168 1.00 35.41  ? 352 SER 1 CB    1 
ATOM   2747  O  OG    . SER A  1  352 ? 6.912    -22.786  371.112 1.00 29.46  ? 352 SER 1 OG    1 
ATOM   2748  N  N     . CYS A  1  353 ? 5.738    -24.660  373.218 1.00 44.23  ? 353 CYS 1 N     1 
ATOM   2749  C  CA    . CYS A  1  353 ? 5.413    -26.081  373.198 1.00 39.24  ? 353 CYS 1 CA    1 
ATOM   2750  C  C     . CYS A  1  353 ? 5.709    -26.730  371.852 1.00 43.46  ? 353 CYS 1 C     1 
ATOM   2751  O  O     . CYS A  1  353 ? 6.097    -27.904  371.815 1.00 45.47  ? 353 CYS 1 O     1 
ATOM   2752  C  CB    . CYS A  1  353 ? 3.943    -26.283  373.595 1.00 28.88  ? 353 CYS 1 CB    1 
ATOM   2753  S  SG    . CYS A  1  353 ? 2.735    -26.267  372.264 1.00 26.29  ? 353 CYS 1 SG    1 
ATOM   2754  N  N     . GLY A  1  354 ? 5.611    -25.981  370.753 1.00 46.09  ? 354 GLY 1 N     1 
ATOM   2755  C  CA    . GLY A  1  354 ? 6.013    -26.473  369.448 1.00 45.41  ? 354 GLY 1 CA    1 
ATOM   2756  C  C     . GLY A  1  354 ? 4.880    -26.766  368.488 1.00 42.91  ? 354 GLY 1 C     1 
ATOM   2757  O  O     . GLY A  1  354 ? 5.143    -27.203  367.359 1.00 41.17  ? 354 GLY 1 O     1 
ATOM   2758  N  N     . LYS A  1  355 ? 3.627    -26.579  368.898 1.00 41.86  ? 355 LYS 1 N     1 
ATOM   2759  C  CA    . LYS A  1  355 ? 2.526    -26.867  367.987 1.00 42.20  ? 355 LYS 1 CA    1 
ATOM   2760  C  C     . LYS A  1  355 ? 2.390    -25.778  366.926 1.00 43.43  ? 355 LYS 1 C     1 
ATOM   2761  O  O     . LYS A  1  355 ? 2.519    -26.045  365.725 1.00 44.44  ? 355 LYS 1 O     1 
ATOM   2762  C  CB    . LYS A  1  355 ? 1.227    -27.049  368.778 1.00 39.06  ? 355 LYS 1 CB    1 
ATOM   2763  C  CG    . LYS A  1  355 ? 0.398    -28.230  368.302 1.00 34.44  ? 355 LYS 1 CG    1 
ATOM   2764  C  CD    . LYS A  1  355 ? -0.830   -28.435  369.172 1.00 32.34  ? 355 LYS 1 CD    1 
ATOM   2765  C  CE    . LYS A  1  355 ? -2.081   -27.871  368.525 1.00 31.94  ? 355 LYS 1 CE    1 
ATOM   2766  N  NZ    . LYS A  1  355 ? -3.338   -28.335  369.181 1.00 30.40  ? 355 LYS 1 NZ    1 
ATOM   2767  N  N     . CYS A  1  356 ? 2.183    -24.531  367.349 1.00 43.99  ? 356 CYS 1 N     1 
ATOM   2768  C  CA    . CYS A  1  356 ? 1.875    -23.463  366.405 1.00 41.80  ? 356 CYS 1 CA    1 
ATOM   2769  C  C     . CYS A  1  356 ? 3.156    -22.917  365.800 1.00 42.30  ? 356 CYS 1 C     1 
ATOM   2770  O  O     . CYS A  1  356 ? 4.133    -22.677  366.514 1.00 43.86  ? 356 CYS 1 O     1 
ATOM   2771  C  CB    . CYS A  1  356 ? 1.131    -22.324  367.086 1.00 41.43  ? 356 CYS 1 CB    1 
ATOM   2772  S  SG    . CYS A  1  356 ? -0.243   -22.830  368.044 1.00 44.66  ? 356 CYS 1 SG    1 
ATOM   2773  N  N     . THR A  1  357 ? 3.141    -22.723  364.482 1.00 40.02  ? 357 THR 1 N     1 
ATOM   2774  C  CA    . THR A  1  357 ? 4.198    -21.965  363.812 1.00 40.55  ? 357 THR 1 CA    1 
ATOM   2775  C  C     . THR A  1  357 ? 4.309    -20.511  364.291 1.00 39.12  ? 357 THR 1 C     1 
ATOM   2776  O  O     . THR A  1  357 ? 5.439    -20.064  364.564 1.00 41.20  ? 357 THR 1 O     1 
ATOM   2777  C  CB    . THR A  1  357 ? 3.980    -22.063  362.295 1.00 36.92  ? 357 THR 1 CB    1 
ATOM   2778  O  OG1   . THR A  1  357 ? 3.725    -23.427  361.957 1.00 38.52  ? 357 THR 1 OG1   1 
ATOM   2779  C  CG2   . THR A  1  357 ? 5.229    -21.630  361.524 1.00 33.40  ? 357 THR 1 CG2   1 
ATOM   2780  N  N     . PRO A  1  358 ? 3.195    -19.720  364.453 1.00 39.84  ? 358 PRO 1 N     1 
ATOM   2781  C  CA    . PRO A  1  358 ? 3.345    -18.294  364.789 1.00 42.69  ? 358 PRO 1 CA    1 
ATOM   2782  C  C     . PRO A  1  358 ? 4.101    -18.025  366.082 1.00 54.49  ? 358 PRO 1 C     1 
ATOM   2783  O  O     . PRO A  1  358 ? 5.098    -17.296  366.078 1.00 54.64  ? 358 PRO 1 O     1 
ATOM   2784  C  CB    . PRO A  1  358 ? 1.891    -17.810  364.883 1.00 41.04  ? 358 PRO 1 CB    1 
ATOM   2785  C  CG    . PRO A  1  358 ? 1.101    -19.025  365.213 1.00 38.58  ? 358 PRO 1 CG    1 
ATOM   2786  C  CD    . PRO A  1  358 ? 1.766    -20.090  364.393 1.00 38.18  ? 358 PRO 1 CD    1 
ATOM   2787  N  N     . CYS A  1  359 ? 3.619    -18.592  367.191 1.00 62.45  ? 359 CYS 1 N     1 
ATOM   2788  C  CA    . CYS A  1  359 ? 4.282    -18.436  368.483 1.00 66.33  ? 359 CYS 1 CA    1 
ATOM   2789  C  C     . CYS A  1  359 ? 5.725    -18.922  368.418 1.00 59.72  ? 359 CYS 1 C     1 
ATOM   2790  O  O     . CYS A  1  359 ? 6.658    -18.145  368.644 1.00 69.17  ? 359 CYS 1 O     1 
ATOM   2791  C  CB    . CYS A  1  359 ? 3.482    -19.172  369.565 1.00 70.61  ? 359 CYS 1 CB    1 
ATOM   2792  S  SG    . CYS A  1  359 ? 4.324    -19.727  371.084 1.00 73.35  ? 359 CYS 1 SG    1 
ATOM   2793  N  N     . ARG A  1  360 ? 5.925    -20.202  368.086 1.00 45.22  ? 360 ARG 1 N     1 
ATOM   2794  C  CA    . ARG A  1  360 ? 7.265    -20.784  368.073 1.00 37.91  ? 360 ARG 1 CA    1 
ATOM   2795  C  C     . ARG A  1  360 ? 8.236    -19.903  367.294 1.00 31.16  ? 360 ARG 1 C     1 
ATOM   2796  O  O     . ARG A  1  360 ? 9.190    -19.365  367.861 1.00 27.88  ? 360 ARG 1 O     1 
ATOM   2797  C  CB    . ARG A  1  360 ? 7.207    -22.202  367.489 1.00 44.40  ? 360 ARG 1 CB    1 
ATOM   2798  C  CG    . ARG A  1  360 ? 8.562    -22.870  367.166 1.00 41.78  ? 360 ARG 1 CG    1 
ATOM   2799  C  CD    . ARG A  1  360 ? 8.335    -24.220  366.524 1.00 29.85  ? 360 ARG 1 CD    1 
ATOM   2800  N  NE    . ARG A  1  360 ? 8.161    -23.973  365.105 1.00 26.82  ? 360 ARG 1 NE    1 
ATOM   2801  C  CZ    . ARG A  1  360 ? 6.978    -23.924  364.522 1.00 26.76  ? 360 ARG 1 CZ    1 
ATOM   2802  N  NH1   . ARG A  1  360 ? 5.894    -24.106  365.256 1.00 26.69  ? 360 ARG 1 NH1   1 
ATOM   2803  N  NH2   . ARG A  1  360 ? 6.883    -23.675  363.224 1.00 26.78  ? 360 ARG 1 NH2   1 
ATOM   2804  N  N     . GLU A  1  361 ? 7.975    -19.719  365.996 1.00 27.70  ? 361 GLU 1 N     1 
ATOM   2805  C  CA    . GLU A  1  361 ? 8.906    -19.020  365.107 1.00 36.64  ? 361 GLU 1 CA    1 
ATOM   2806  C  C     . GLU A  1  361 ? 9.002    -17.518  365.413 1.00 38.43  ? 361 GLU 1 C     1 
ATOM   2807  O  O     . GLU A  1  361 ? 10.101   -16.984  365.622 1.00 28.36  ? 361 GLU 1 O     1 
ATOM   2808  C  CB    . GLU A  1  361 ? 8.512    -19.252  363.649 1.00 36.67  ? 361 GLU 1 CB    1 
ATOM   2809  C  CG    . GLU A  1  361 ? 8.553    -20.713  363.239 1.00 38.47  ? 361 GLU 1 CG    1 
ATOM   2810  C  CD    . GLU A  1  361 ? 9.948    -21.310  363.287 1.00 39.63  ? 361 GLU 1 CD    1 
ATOM   2811  O  OE1   . GLU A  1  361 ? 10.921   -20.542  363.225 1.00 39.19  ? 361 GLU 1 OE1   1 
ATOM   2812  O  OE2   . GLU A  1  361 ? 10.081   -22.551  363.356 1.00 39.01  ? 361 GLU 1 OE2   1 
ATOM   2813  N  N     . GLY A  1  362 ? 7.881    -16.800  365.383 1.00 28.28  ? 362 GLY 1 N     1 
ATOM   2814  C  CA    . GLY A  1  362 ? 7.973    -15.390  365.638 1.00 28.58  ? 362 GLY 1 CA    1 
ATOM   2815  C  C     . GLY A  1  362 ? 8.595    -15.127  366.990 1.00 28.70  ? 362 GLY 1 C     1 
ATOM   2816  O  O     . GLY A  1  362 ? 9.645    -14.492  367.026 1.00 30.46  ? 362 GLY 1 O     1 
ATOM   2817  N  N     . VAL A  1  363 ? 8.076    -15.668  368.092 1.00 28.59  ? 363 VAL 1 N     1 
ATOM   2818  C  CA    . VAL A  1  363 ? 8.626    -15.295  369.391 1.00 28.73  ? 363 VAL 1 CA    1 
ATOM   2819  C  C     . VAL A  1  363 ? 10.060   -15.793  369.538 1.00 28.70  ? 363 VAL 1 C     1 
ATOM   2820  O  O     . VAL A  1  363 ? 10.988   -14.991  369.678 1.00 28.92  ? 363 VAL 1 O     1 
ATOM   2821  C  CB    . VAL A  1  363 ? 7.730    -15.807  370.530 1.00 28.62  ? 363 VAL 1 CB    1 
ATOM   2822  C  CG1   . VAL A  1  363 ? 8.265    -15.342  371.895 1.00 28.78  ? 363 VAL 1 CG1   1 
ATOM   2823  C  CG2   . VAL A  1  363 ? 6.311    -15.345  370.313 1.00 28.64  ? 363 VAL 1 CG2   1 
ATOM   2824  N  N     . ALA A  1  364 ? 10.275   -17.113  369.506 1.00 28.44  ? 364 ALA 1 N     1 
ATOM   2825  C  CA    . ALA A  1  364 ? 11.596   -17.619  369.853 1.00 28.41  ? 364 ALA 1 CA    1 
ATOM   2826  C  C     . ALA A  1  364 ? 12.628   -17.463  368.742 1.00 28.46  ? 364 ALA 1 C     1 
ATOM   2827  O  O     . ALA A  1  364 ? 13.819   -17.659  369.002 1.00 28.49  ? 364 ALA 1 O     1 
ATOM   2828  C  CB    . ALA A  1  364 ? 11.497   -19.085  370.273 1.00 30.44  ? 364 ALA 1 CB    1 
ATOM   2829  N  N     . GLY A  1  365 ? 12.212   -17.161  367.516 1.00 28.47  ? 365 GLY 1 N     1 
ATOM   2830  C  CA    . GLY A  1  365 ? 13.146   -16.959  366.435 1.00 36.67  ? 365 GLY 1 CA    1 
ATOM   2831  C  C     . GLY A  1  365 ? 13.339   -15.484  366.174 1.00 41.34  ? 365 GLY 1 C     1 
ATOM   2832  O  O     . GLY A  1  365 ? 14.473   -15.008  366.070 1.00 47.42  ? 365 GLY 1 O     1 
ATOM   2833  N  N     . PHE A  1  366 ? 12.234   -14.741  366.097 1.00 36.65  ? 366 PHE 1 N     1 
ATOM   2834  C  CA    . PHE A  1  366 ? 12.296   -13.338  365.693 1.00 32.69  ? 366 PHE 1 CA    1 
ATOM   2835  C  C     . PHE A  1  366 ? 12.380   -12.413  366.904 1.00 29.45  ? 366 PHE 1 C     1 
ATOM   2836  O  O     . PHE A  1  366 ? 13.403   -11.762  367.112 1.00 29.64  ? 366 PHE 1 O     1 
ATOM   2837  C  CB    . PHE A  1  366 ? 11.063   -12.986  364.849 1.00 33.81  ? 366 PHE 1 CB    1 
ATOM   2838  C  CG    . PHE A  1  366 ? 11.297   -11.935  363.820 1.00 34.50  ? 366 PHE 1 CG    1 
ATOM   2839  C  CD1   . PHE A  1  366 ? 12.503   -11.266  363.750 1.00 35.27  ? 366 PHE 1 CD1   1 
ATOM   2840  C  CD2   . PHE A  1  366 ? 10.283   -11.570  362.953 1.00 29.41  ? 366 PHE 1 CD2   1 
ATOM   2841  C  CE1   . PHE A  1  366 ? 12.710   -10.273  362.795 1.00 35.05  ? 366 PHE 1 CE1   1 
ATOM   2842  C  CE2   . PHE A  1  366 ? 10.482   -10.580  362.013 1.00 40.18  ? 366 PHE 1 CE2   1 
ATOM   2843  C  CZ    . PHE A  1  366 ? 11.702   -9.927   361.938 1.00 38.97  ? 366 PHE 1 CZ    1 
ATOM   2844  N  N     . MET A  1  367 ? 11.350   -12.427  367.756 1.00 25.61  ? 367 MET 1 N     1 
ATOM   2845  C  CA    . MET A  1  367 ? 11.190   -11.396  368.786 1.00 32.18  ? 367 MET 1 CA    1 
ATOM   2846  C  C     . MET A  1  367 ? 12.331   -11.387  369.798 1.00 47.16  ? 367 MET 1 C     1 
ATOM   2847  O  O     . MET A  1  367 ? 12.871   -10.319  370.127 1.00 56.15  ? 367 MET 1 O     1 
ATOM   2848  C  CB    . MET A  1  367 ? 9.836    -11.549  369.474 1.00 28.03  ? 367 MET 1 CB    1 
ATOM   2849  C  CG    . MET A  1  367 ? 8.676    -11.072  368.632 1.00 23.52  ? 367 MET 1 CG    1 
ATOM   2850  S  SD    . MET A  1  367 ? 7.179    -11.110  369.622 1.00 23.45  ? 367 MET 1 SD    1 
ATOM   2851  C  CE    . MET A  1  367 ? 7.708    -10.318  371.139 1.00 23.39  ? 367 MET 1 CE    1 
ATOM   2852  N  N     . VAL A  1  368 ? 12.700   -12.554  370.328 1.00 45.33  ? 368 VAL 1 N     1 
ATOM   2853  C  CA    . VAL A  1  368 ? 13.842   -12.570  371.237 1.00 49.15  ? 368 VAL 1 CA    1 
ATOM   2854  C  C     . VAL A  1  368 ? 15.091   -12.079  370.505 1.00 47.31  ? 368 VAL 1 C     1 
ATOM   2855  O  O     . VAL A  1  368 ? 15.933   -11.383  371.087 1.00 44.55  ? 368 VAL 1 O     1 
ATOM   2856  C  CB    . VAL A  1  368 ? 14.036   -13.981  371.839 1.00 55.12  ? 368 VAL 1 CB    1 
ATOM   2857  C  CG1   . VAL A  1  368 ? 14.104   -15.027  370.743 1.00 58.65  ? 368 VAL 1 CG1   1 
ATOM   2858  C  CG2   . VAL A  1  368 ? 15.288   -14.047  372.722 1.00 56.14  ? 368 VAL 1 CG2   1 
ATOM   2859  N  N     . ASN A  1  369 ? 15.199   -12.374  369.204 1.00 45.29  ? 369 ASN 1 N     1 
ATOM   2860  C  CA    . ASN A  1  369 ? 16.369   -11.947  368.439 1.00 46.06  ? 369 ASN 1 CA    1 
ATOM   2861  C  C     . ASN A  1  369 ? 16.358   -10.431  368.226 1.00 37.59  ? 369 ASN 1 C     1 
ATOM   2862  O  O     . ASN A  1  369 ? 17.416   -9.789   368.243 1.00 36.84  ? 369 ASN 1 O     1 
ATOM   2863  C  CB    . ASN A  1  369 ? 16.408   -12.709  367.102 1.00 48.16  ? 369 ASN 1 CB    1 
ATOM   2864  C  CG    . ASN A  1  369 ? 17.084   -14.105  367.216 1.00 45.84  ? 369 ASN 1 CG    1 
ATOM   2865  O  OD1   . ASN A  1  369 ? 17.932   -14.338  368.077 1.00 48.16  ? 369 ASN 1 OD1   1 
ATOM   2866  N  ND2   . ASN A  1  369 ? 16.713   -15.017  366.319 1.00 44.74  ? 369 ASN 1 ND2   1 
ATOM   2867  N  N     . LEU A  1  370 ? 15.166   -9.850   368.034 1.00 38.56  ? 370 LEU 1 N     1 
ATOM   2868  C  CA    . LEU A  1  370 ? 14.988   -8.397   368.009 1.00 23.38  ? 370 LEU 1 CA    1 
ATOM   2869  C  C     . LEU A  1  370 ? 15.476   -7.762   369.300 1.00 23.34  ? 370 LEU 1 C     1 
ATOM   2870  O  O     . LEU A  1  370 ? 16.263   -6.804   369.283 1.00 23.28  ? 370 LEU 1 O     1 
ATOM   2871  C  CB    . LEU A  1  370 ? 13.511   -8.069   367.784 1.00 23.32  ? 370 LEU 1 CB    1 
ATOM   2872  C  CG    . LEU A  1  370 ? 13.124   -7.713   366.356 1.00 23.27  ? 370 LEU 1 CG    1 
ATOM   2873  C  CD1   . LEU A  1  370 ? 13.549   -6.303   366.079 1.00 34.59  ? 370 LEU 1 CD1   1 
ATOM   2874  C  CD2   . LEU A  1  370 ? 13.869   -8.591   365.418 1.00 23.36  ? 370 LEU 1 CD2   1 
ATOM   2875  N  N     . PHE A  1  371 ? 15.019   -8.291   370.438 1.00 23.39  ? 371 PHE 1 N     1 
ATOM   2876  C  CA    . PHE A  1  371 ? 15.449   -7.754   371.725 1.00 32.76  ? 371 PHE 1 CA    1 
ATOM   2877  C  C     . PHE A  1  371 ? 16.954   -7.904   371.905 1.00 38.54  ? 371 PHE 1 C     1 
ATOM   2878  O  O     . PHE A  1  371 ? 17.611   -7.014   372.450 1.00 39.26  ? 371 PHE 1 O     1 
ATOM   2879  C  CB    . PHE A  1  371 ? 14.692   -8.449   372.859 1.00 25.33  ? 371 PHE 1 CB    1 
ATOM   2880  C  CG    . PHE A  1  371 ? 13.325   -7.898   373.087 1.00 23.32  ? 371 PHE 1 CG    1 
ATOM   2881  C  CD1   . PHE A  1  371 ? 12.223   -8.455   372.476 1.00 23.34  ? 371 PHE 1 CD1   1 
ATOM   2882  C  CD2   . PHE A  1  371 ? 13.144   -6.792   373.897 1.00 32.09  ? 371 PHE 1 CD2   1 
ATOM   2883  C  CE1   . PHE A  1  371 ? 10.960   -7.918   372.673 1.00 23.26  ? 371 PHE 1 CE1   1 
ATOM   2884  C  CE2   . PHE A  1  371 ? 11.877   -6.253   374.099 1.00 31.07  ? 371 PHE 1 CE2   1 
ATOM   2885  C  CZ    . PHE A  1  371 ? 10.792   -6.818   373.490 1.00 23.17  ? 371 PHE 1 CZ    1 
ATOM   2886  N  N     . ALA A  1  372 ? 17.518   -9.026   371.445 1.00 42.03  ? 372 ALA 1 N     1 
ATOM   2887  C  CA    . ALA A  1  372 ? 18.958   -9.231   371.530 1.00 43.80  ? 372 ALA 1 CA    1 
ATOM   2888  C  C     . ALA A  1  372 ? 19.716   -8.177   370.734 1.00 52.51  ? 372 ALA 1 C     1 
ATOM   2889  O  O     . ALA A  1  372 ? 20.649   -7.547   371.244 1.00 54.90  ? 372 ALA 1 O     1 
ATOM   2890  C  CB    . ALA A  1  372 ? 19.305   -10.636  371.047 1.00 40.91  ? 372 ALA 1 CB    1 
ATOM   2891  N  N     . LYS A  1  373 ? 19.313   -7.960   369.481 1.00 57.21  ? 373 LYS 1 N     1 
ATOM   2892  C  CA    . LYS A  1  373 ? 19.940   -6.917   368.676 1.00 62.39  ? 373 LYS 1 CA    1 
ATOM   2893  C  C     . LYS A  1  373 ? 19.846   -5.558   369.361 1.00 60.66  ? 373 LYS 1 C     1 
ATOM   2894  O  O     . LYS A  1  373 ? 20.827   -4.804   369.384 1.00 63.59  ? 373 LYS 1 O     1 
ATOM   2895  C  CB    . LYS A  1  373 ? 19.317   -6.853   367.285 1.00 66.31  ? 373 LYS 1 CB    1 
ATOM   2896  C  CG    . LYS A  1  373 ? 20.134   -6.003   366.320 1.00 69.74  ? 373 LYS 1 CG    1 
ATOM   2897  C  CD    . LYS A  1  373 ? 19.442   -5.835   364.979 1.00 73.61  ? 373 LYS 1 CD    1 
ATOM   2898  C  CE    . LYS A  1  373 ? 20.373   -5.173   363.971 1.00 77.92  ? 373 LYS 1 CE    1 
ATOM   2899  N  NZ    . LYS A  1  373 ? 19.754   -5.059   362.618 1.00 80.61  ? 373 LYS 1 NZ    1 
ATOM   2900  N  N     . ILE A  1  374 ? 18.674   -5.218   369.913 1.00 60.71  ? 374 ILE 1 N     1 
ATOM   2901  C  CA    . ILE A  1  374 ? 18.528   -3.920   370.582 1.00 59.67  ? 374 ILE 1 CA    1 
ATOM   2902  C  C     . ILE A  1  374 ? 19.471   -3.834   371.779 1.00 62.70  ? 374 ILE 1 C     1 
ATOM   2903  O  O     . ILE A  1  374 ? 20.361   -2.977   371.836 1.00 63.56  ? 374 ILE 1 O     1 
ATOM   2904  C  CB    . ILE A  1  374 ? 17.064   -3.662   370.998 1.00 61.85  ? 374 ILE 1 CB    1 
ATOM   2905  C  CG1   . ILE A  1  374 ? 16.138   -3.549   369.778 1.00 58.11  ? 374 ILE 1 CG1   1 
ATOM   2906  C  CG2   . ILE A  1  374 ? 16.952   -2.391   371.849 1.00 58.69  ? 374 ILE 1 CG2   1 
ATOM   2907  C  CD1   . ILE A  1  374 ? 14.644   -3.512   370.123 1.00 56.42  ? 374 ILE 1 CD1   1 
ATOM   2908  N  N     . GLY A  1  375 ? 19.308   -4.742   372.737 1.00 56.35  ? 375 GLY 1 N     1 
ATOM   2909  C  CA    . GLY A  1  375 ? 20.049   -4.689   373.976 1.00 57.51  ? 375 GLY 1 CA    1 
ATOM   2910  C  C     . GLY A  1  375 ? 21.518   -5.032   373.867 1.00 59.71  ? 375 GLY 1 C     1 
ATOM   2911  O  O     . GLY A  1  375 ? 22.226   -4.956   374.875 1.00 63.74  ? 375 GLY 1 O     1 
ATOM   2912  N  N     . THR A  1  376 ? 22.012   -5.381   372.678 1.00 58.41  ? 376 THR 1 N     1 
ATOM   2913  C  CA    . THR A  1  376 ? 23.436   -5.624   372.478 1.00 59.01  ? 376 THR 1 CA    1 
ATOM   2914  C  C     . THR A  1  376 ? 24.163   -4.391   371.941 1.00 56.04  ? 376 THR 1 C     1 
ATOM   2915  O  O     . THR A  1  376 ? 25.332   -4.493   371.557 1.00 55.72  ? 376 THR 1 O     1 
ATOM   2916  C  CB    . THR A  1  376 ? 23.650   -6.826   371.536 1.00 59.16  ? 376 THR 1 CB    1 
ATOM   2917  O  OG1   . THR A  1  376 ? 22.623   -7.801   371.747 1.00 58.91  ? 376 THR 1 OG1   1 
ATOM   2918  C  CG2   . THR A  1  376 ? 24.995   -7.509   371.791 1.00 57.57  ? 376 THR 1 CG2   1 
ATOM   2919  N  N     . GLY A  1  377 ? 23.498   -3.236   371.886 1.00 54.69  ? 377 GLY 1 N     1 
ATOM   2920  C  CA    . GLY A  1  377 ? 24.144   -2.027   371.403 1.00 56.50  ? 377 GLY 1 CA    1 
ATOM   2921  C  C     . GLY A  1  377 ? 24.314   -1.964   369.904 1.00 57.39  ? 377 GLY 1 C     1 
ATOM   2922  O  O     . GLY A  1  377 ? 25.177   -1.226   369.411 1.00 52.82  ? 377 GLY 1 O     1 
ATOM   2923  N  N     . GLN A  1  378 ? 23.490   -2.703   369.161 1.00 62.25  ? 378 GLN 1 N     1 
ATOM   2924  C  CA    . GLN A  1  378 ? 23.590   -2.802   367.714 1.00 68.08  ? 378 GLN 1 CA    1 
ATOM   2925  C  C     . GLN A  1  378 ? 22.371   -2.257   366.996 1.00 66.56  ? 378 GLN 1 C     1 
ATOM   2926  O  O     . GLN A  1  378 ? 22.368   -2.206   365.759 1.00 66.66  ? 378 GLN 1 O     1 
ATOM   2927  C  CB    . GLN A  1  378 ? 23.780   -4.272   367.292 1.00 74.96  ? 378 GLN 1 CB    1 
ATOM   2928  C  CG    . GLN A  1  378 ? 24.592   -5.135   368.259 1.00 79.53  ? 378 GLN 1 CG    1 
ATOM   2929  C  CD    . GLN A  1  378 ? 26.056   -5.239   367.876 1.00 82.88  ? 378 GLN 1 CD    1 
ATOM   2930  O  OE1   . GLN A  1  378 ? 26.634   -4.308   367.313 1.00 82.13  ? 378 GLN 1 OE1   1 
ATOM   2931  N  NE2   . GLN A  1  378 ? 26.662   -6.384   368.172 1.00 85.29  ? 378 GLN 1 NE2   1 
ATOM   2932  N  N     . GLY A  1  379 ? 21.347   -1.855   367.725 1.00 65.02  ? 379 GLY 1 N     1 
ATOM   2933  C  CA    . GLY A  1  379 ? 20.068   -1.607   367.117 1.00 63.28  ? 379 GLY 1 CA    1 
ATOM   2934  C  C     . GLY A  1  379 ? 19.988   -0.290   366.379 1.00 62.28  ? 379 GLY 1 C     1 
ATOM   2935  O  O     . GLY A  1  379 ? 20.823   0.603    366.524 1.00 59.69  ? 379 GLY 1 O     1 
ATOM   2936  N  N     . GLU A  1  380 ? 18.960   -0.207   365.542 1.00 65.83  ? 380 GLU 1 N     1 
ATOM   2937  C  CA    . GLU A  1  380 ? 18.545   1.024    364.893 1.00 70.20  ? 380 GLU 1 CA    1 
ATOM   2938  C  C     . GLU A  1  380 ? 17.064   1.220    365.185 1.00 69.03  ? 380 GLU 1 C     1 
ATOM   2939  O  O     . GLU A  1  380 ? 16.387   0.332    365.712 1.00 66.25  ? 380 GLU 1 O     1 
ATOM   2940  C  CB    . GLU A  1  380 ? 18.790   1.010    363.373 1.00 73.57  ? 380 GLU 1 CB    1 
ATOM   2941  C  CG    . GLU A  1  380 ? 20.232   0.778    362.954 1.00 76.94  ? 380 GLU 1 CG    1 
ATOM   2942  C  CD    . GLU A  1  380 ? 20.329   -0.046   361.682 1.00 81.64  ? 380 GLU 1 CD    1 
ATOM   2943  O  OE1   . GLU A  1  380 ? 19.540   0.222    360.750 1.00 83.08  ? 380 GLU 1 OE1   1 
ATOM   2944  O  OE2   . GLU A  1  380 ? 21.171   -0.969   361.618 1.00 83.80  ? 380 GLU 1 OE2   1 
ATOM   2945  N  N     . GLU A  1  381 ? 16.565   2.409    364.842 1.00 69.78  ? 381 GLU 1 N     1 
ATOM   2946  C  CA    . GLU A  1  381 ? 15.140   2.690    364.984 1.00 67.41  ? 381 GLU 1 CA    1 
ATOM   2947  C  C     . GLU A  1  381 ? 14.298   1.725    364.156 1.00 59.01  ? 381 GLU 1 C     1 
ATOM   2948  O  O     . GLU A  1  381 ? 13.139   1.448    364.499 1.00 53.80  ? 381 GLU 1 O     1 
ATOM   2949  C  CB    . GLU A  1  381 ? 14.868   4.141    364.593 1.00 70.60  ? 381 GLU 1 CB    1 
ATOM   2950  C  CG    . GLU A  1  381 ? 13.460   4.604    364.847 1.00 75.32  ? 381 GLU 1 CG    1 
ATOM   2951  C  CD    . GLU A  1  381 ? 13.336   6.091    364.646 1.00 81.51  ? 381 GLU 1 CD    1 
ATOM   2952  O  OE1   . GLU A  1  381 ? 14.261   6.813    365.077 1.00 83.24  ? 381 GLU 1 OE1   1 
ATOM   2953  O  OE2   . GLU A  1  381 ? 12.325   6.540    364.068 1.00 84.30  ? 381 GLU 1 OE2   1 
ATOM   2954  N  N     . LYS A  1  382 ? 14.864   1.231    363.052 1.00 55.39  ? 382 LYS 1 N     1 
ATOM   2955  C  CA    . LYS A  1  382 ? 14.199   0.235    362.220 1.00 49.20  ? 382 LYS 1 CA    1 
ATOM   2956  C  C     . LYS A  1  382 ? 13.814   -0.990   363.041 1.00 47.06  ? 382 LYS 1 C     1 
ATOM   2957  O  O     . LYS A  1  382 ? 12.724   -1.551   362.874 1.00 48.95  ? 382 LYS 1 O     1 
ATOM   2958  C  CB    . LYS A  1  382 ? 15.141   -0.181   361.088 1.00 45.47  ? 382 LYS 1 CB    1 
ATOM   2959  C  CG    . LYS A  1  382 ? 15.765   0.993    360.338 1.00 45.56  ? 382 LYS 1 CG    1 
ATOM   2960  C  CD    . LYS A  1  382 ? 16.717   0.533    359.236 1.00 44.56  ? 382 LYS 1 CD    1 
ATOM   2961  C  CE    . LYS A  1  382 ? 17.374   1.714    358.516 1.00 39.16  ? 382 LYS 1 CE    1 
ATOM   2962  N  NZ    . LYS A  1  382 ? 18.365   2.378    359.409 1.00 34.78  ? 382 LYS 1 NZ    1 
ATOM   2963  N  N     . ASP A  1  383 ? 14.705   -1.419   363.934 1.00 40.11  ? 383 ASP 1 N     1 
ATOM   2964  C  CA    . ASP A  1  383 ? 14.455   -2.588   364.772 1.00 36.74  ? 383 ASP 1 CA    1 
ATOM   2965  C  C     . ASP A  1  383 ? 13.285   -2.347   365.720 1.00 46.15  ? 383 ASP 1 C     1 
ATOM   2966  O  O     . ASP A  1  383 ? 12.512   -3.269   366.006 1.00 22.86  ? 383 ASP 1 O     1 
ATOM   2967  C  CB    . ASP A  1  383 ? 15.720   -2.903   365.552 1.00 30.52  ? 383 ASP 1 CB    1 
ATOM   2968  C  CG    . ASP A  1  383 ? 16.957   -2.852   364.676 1.00 22.93  ? 383 ASP 1 CG    1 
ATOM   2969  O  OD1   . ASP A  1  383 ? 16.855   -3.070   363.452 1.00 23.17  ? 383 ASP 1 OD1   1 
ATOM   2970  O  OD2   . ASP A  1  383 ? 18.038   -2.568   365.206 1.00 22.94  ? 383 ASP 1 OD2   1 
ATOM   2971  N  N     . VAL A  1  384 ? 13.158   -1.107   366.231 1.00 44.03  ? 384 VAL 1 N     1 
ATOM   2972  C  CA    . VAL A  1  384 ? 12.061   -0.734   367.134 1.00 36.33  ? 384 VAL 1 CA    1 
ATOM   2973  C  C     . VAL A  1  384 ? 10.731   -0.691   366.381 1.00 34.65  ? 384 VAL 1 C     1 
ATOM   2974  O  O     . VAL A  1  384 ? 9.706    -1.170   366.879 1.00 32.31  ? 384 VAL 1 O     1 
ATOM   2975  C  CB    . VAL A  1  384 ? 12.350   0.621    367.823 1.00 26.16  ? 384 VAL 1 CB    1 
ATOM   2976  C  CG1   . VAL A  1  384 ? 11.248   0.965    368.823 1.00 28.19  ? 384 VAL 1 CG1   1 
ATOM   2977  C  CG2   . VAL A  1  384 ? 13.722   0.653    368.507 1.00 27.32  ? 384 VAL 1 CG2   1 
ATOM   2978  N  N     . GLU A  1  385 ? 10.722   -0.111   365.178 1.00 33.26  ? 385 GLU 1 N     1 
ATOM   2979  C  CA    . GLU A  1  385 ? 9.499    -0.104   364.381 1.00 34.48  ? 385 GLU 1 CA    1 
ATOM   2980  C  C     . GLU A  1  385 ? 9.084    -1.527   364.040 1.00 35.08  ? 385 GLU 1 C     1 
ATOM   2981  O  O     . GLU A  1  385 ? 7.904    -1.888   364.148 1.00 31.90  ? 385 GLU 1 O     1 
ATOM   2982  C  CB    . GLU A  1  385 ? 9.707    0.726    363.117 1.00 40.68  ? 385 GLU 1 CB    1 
ATOM   2983  C  CG    . GLU A  1  385 ? 10.085   2.171    363.456 1.00 49.80  ? 385 GLU 1 CG    1 
ATOM   2984  C  CD    . GLU A  1  385 ? 10.143   3.097    362.260 1.00 54.36  ? 385 GLU 1 CD    1 
ATOM   2985  O  OE1   . GLU A  1  385 ? 9.216    3.062    361.420 1.00 58.67  ? 385 GLU 1 OE1   1 
ATOM   2986  O  OE2   . GLU A  1  385 ? 11.127   3.858    362.167 1.00 53.24  ? 385 GLU 1 OE2   1 
ATOM   2987  N  N     . ASN A  1  386 ? 10.057   -2.352   363.641 1.00 44.91  ? 386 ASN 1 N     1 
ATOM   2988  C  CA    . ASN A  1  386 ? 9.798    -3.755   363.334 1.00 50.57  ? 386 ASN 1 CA    1 
ATOM   2989  C  C     . ASN A  1  386 ? 9.199    -4.480   364.536 1.00 55.45  ? 386 ASN 1 C     1 
ATOM   2990  O  O     . ASN A  1  386 ? 8.216    -5.220   364.409 1.00 55.90  ? 386 ASN 1 O     1 
ATOM   2991  C  CB    . ASN A  1  386 ? 11.100   -4.440   362.901 1.00 48.53  ? 386 ASN 1 CB    1 
ATOM   2992  C  CG    . ASN A  1  386 ? 11.606   -3.961   361.546 1.00 45.06  ? 386 ASN 1 CG    1 
ATOM   2993  O  OD1   . ASN A  1  386 ? 10.949   -4.133   360.521 1.00 45.44  ? 386 ASN 1 OD1   1 
ATOM   2994  N  ND2   . ASN A  1  386 ? 12.814   -3.413   361.533 1.00 41.98  ? 386 ASN 1 ND2   1 
ATOM   2995  N  N     . LEU A  1  387 ? 9.812    -4.309   365.710 1.00 57.53  ? 387 LEU 1 N     1 
ATOM   2996  C  CA    . LEU A  1  387 ? 9.317    -4.970   366.911 1.00 60.54  ? 387 LEU 1 CA    1 
ATOM   2997  C  C     . LEU A  1  387 ? 7.911    -4.491   367.265 1.00 59.70  ? 387 LEU 1 C     1 
ATOM   2998  O  O     . LEU A  1  387 ? 7.061    -5.290   367.673 1.00 59.52  ? 387 LEU 1 O     1 
ATOM   2999  C  CB    . LEU A  1  387 ? 10.286   -4.727   368.065 1.00 64.84  ? 387 LEU 1 CB    1 
ATOM   3000  C  CG    . LEU A  1  387 ? 9.889    -5.328   369.413 1.00 66.68  ? 387 LEU 1 CG    1 
ATOM   3001  C  CD1   . LEU A  1  387 ? 9.538    -6.810   369.279 1.00 63.31  ? 387 LEU 1 CD1   1 
ATOM   3002  C  CD2   . LEU A  1  387 ? 10.989   -5.084   370.440 1.00 69.15  ? 387 LEU 1 CD2   1 
ATOM   3003  N  N     . GLU A  1  388 ? 7.648    -3.187   367.114 1.00 58.14  ? 388 GLU 1 N     1 
ATOM   3004  C  CA    . GLU A  1  388 ? 6.315    -2.650   367.381 1.00 55.33  ? 388 GLU 1 CA    1 
ATOM   3005  C  C     . GLU A  1  388 ? 5.274    -3.277   366.466 1.00 47.17  ? 388 GLU 1 C     1 
ATOM   3006  O  O     . GLU A  1  388 ? 4.149    -3.559   366.896 1.00 43.89  ? 388 GLU 1 O     1 
ATOM   3007  C  CB    . GLU A  1  388 ? 6.318    -1.126   367.221 1.00 61.32  ? 388 GLU 1 CB    1 
ATOM   3008  C  CG    . GLU A  1  388 ? 4.925    -0.508   367.060 1.00 64.23  ? 388 GLU 1 CG    1 
ATOM   3009  C  CD    . GLU A  1  388 ? 4.240    -0.248   368.385 1.00 64.78  ? 388 GLU 1 CD    1 
ATOM   3010  O  OE1   . GLU A  1  388 ? 3.776    -1.229   368.998 1.00 66.02  ? 388 GLU 1 OE1   1 
ATOM   3011  O  OE2   . GLU A  1  388 ? 4.129    0.925    368.796 1.00 64.55  ? 388 GLU 1 OE2   1 
ATOM   3012  N  N     . ALA A  1  389 ? 5.632    -3.498   365.197 1.00 45.72  ? 389 ALA 1 N     1 
ATOM   3013  C  CA    . ALA A  1  389 ? 4.695    -4.101   364.250 1.00 48.15  ? 389 ALA 1 CA    1 
ATOM   3014  C  C     . ALA A  1  389 ? 4.565    -5.613   364.420 1.00 47.39  ? 389 ALA 1 C     1 
ATOM   3015  O  O     . ALA A  1  389 ? 3.548    -6.185   364.011 1.00 45.01  ? 389 ALA 1 O     1 
ATOM   3016  C  CB    . ALA A  1  389 ? 5.122    -3.787   362.813 1.00 50.38  ? 389 ALA 1 CB    1 
ATOM   3017  N  N     . LEU A  1  390 ? 5.561    -6.263   365.036 1.00 47.61  ? 390 LEU 1 N     1 
ATOM   3018  C  CA    . LEU A  1  390 ? 5.563    -7.721   365.137 1.00 47.49  ? 390 LEU 1 CA    1 
ATOM   3019  C  C     . LEU A  1  390 ? 4.480    -8.248   366.073 1.00 43.45  ? 390 LEU 1 C     1 
ATOM   3020  O  O     . LEU A  1  390 ? 3.946    -9.338   365.844 1.00 47.93  ? 390 LEU 1 O     1 
ATOM   3021  C  CB    . LEU A  1  390 ? 6.933    -8.199   365.619 1.00 55.74  ? 390 LEU 1 CB    1 
ATOM   3022  C  CG    . LEU A  1  390 ? 8.035    -8.343   364.577 1.00 63.19  ? 390 LEU 1 CG    1 
ATOM   3023  C  CD1   . LEU A  1  390 ? 9.353    -8.736   365.234 1.00 67.59  ? 390 LEU 1 CD1   1 
ATOM   3024  C  CD2   . LEU A  1  390 ? 7.596    -9.399   363.572 1.00 64.21  ? 390 LEU 1 CD2   1 
ATOM   3025  N  N     . LEU A  1  391 ? 4.151    -7.508   367.126 1.00 33.76  ? 391 LEU 1 N     1 
ATOM   3026  C  CA    . LEU A  1  391 ? 3.318    -8.056   368.198 1.00 27.84  ? 391 LEU 1 CA    1 
ATOM   3027  C  C     . LEU A  1  391 ? 1.913    -8.457   367.751 1.00 27.21  ? 391 LEU 1 C     1 
ATOM   3028  O  O     . LEU A  1  391 ? 1.464    -9.551   368.131 1.00 23.17  ? 391 LEU 1 O     1 
ATOM   3029  C  CB    . LEU A  1  391 ? 3.277    -7.066   369.363 1.00 29.89  ? 391 LEU 1 CB    1 
ATOM   3030  C  CG    . LEU A  1  391 ? 4.648    -6.559   369.803 1.00 29.39  ? 391 LEU 1 CG    1 
ATOM   3031  C  CD1   . LEU A  1  391 ? 4.505    -5.540   370.927 1.00 34.20  ? 391 LEU 1 CD1   1 
ATOM   3032  C  CD2   . LEU A  1  391 ? 5.532    -7.700   370.212 1.00 23.10  ? 391 LEU 1 CD2   1 
ATOM   3033  N  N     . PRO A  1  392 ? 1.151    -7.634   367.021 1.00 33.70  ? 392 PRO 1 N     1 
ATOM   3034  C  CA    . PRO A  1  392 ? -0.249   -8.007   366.743 1.00 31.62  ? 392 PRO 1 CA    1 
ATOM   3035  C  C     . PRO A  1  392 ? -0.383   -9.251   365.896 1.00 36.05  ? 392 PRO 1 C     1 
ATOM   3036  O  O     . PRO A  1  392 ? -1.448   -9.884   365.912 1.00 38.63  ? 392 PRO 1 O     1 
ATOM   3037  C  CB    . PRO A  1  392 ? -0.803   -6.778   366.014 1.00 32.83  ? 392 PRO 1 CB    1 
ATOM   3038  C  CG    . PRO A  1  392 ? 0.407    -6.140   365.405 1.00 35.49  ? 392 PRO 1 CG    1 
ATOM   3039  C  CD    . PRO A  1  392 ? 1.487    -6.331   366.416 1.00 35.44  ? 392 PRO 1 CD    1 
ATOM   3040  N  N     . LEU A  1  393 ? 0.672    -9.637   365.175 1.00 34.32  ? 393 LEU 1 N     1 
ATOM   3041  C  CA    . LEU A  1  393 ? 0.623    -10.850  364.372 1.00 33.25  ? 393 LEU 1 CA    1 
ATOM   3042  C  C     . LEU A  1  393 ? 0.572    -12.085  365.259 1.00 40.01  ? 393 LEU 1 C     1 
ATOM   3043  O  O     . LEU A  1  393 ? 0.150    -13.156  364.803 1.00 39.81  ? 393 LEU 1 O     1 
ATOM   3044  C  CB    . LEU A  1  393 ? 1.840    -10.929  363.445 1.00 27.81  ? 393 LEU 1 CB    1 
ATOM   3045  C  CG    . LEU A  1  393 ? 2.078    -9.811   362.424 1.00 23.57  ? 393 LEU 1 CG    1 
ATOM   3046  C  CD1   . LEU A  1  393 ? 3.570    -9.708   362.091 1.00 23.90  ? 393 LEU 1 CD1   1 
ATOM   3047  C  CD2   . LEU A  1  393 ? 1.239    -9.960   361.158 1.00 23.20  ? 393 LEU 1 CD2   1 
ATOM   3048  N  N     . ILE A  1  394 ? 0.983    -11.936  366.516 1.00 40.47  ? 394 ILE 1 N     1 
ATOM   3049  C  CA    . ILE A  1  394 ? 1.020    -13.020  367.481 1.00 40.56  ? 394 ILE 1 CA    1 
ATOM   3050  C  C     . ILE A  1  394 ? -0.095   -12.889  368.507 1.00 38.79  ? 394 ILE 1 C     1 
ATOM   3051  O  O     . ILE A  1  394 ? -0.660   -13.887  368.958 1.00 29.97  ? 394 ILE 1 O     1 
ATOM   3052  C  CB    . ILE A  1  394 ? 2.394    -13.001  368.183 1.00 39.42  ? 394 ILE 1 CB    1 
ATOM   3053  C  CG1   . ILE A  1  394 ? 3.504    -12.930  367.142 1.00 41.14  ? 394 ILE 1 CG1   1 
ATOM   3054  C  CG2   . ILE A  1  394 ? 2.559    -14.230  369.059 1.00 40.70  ? 394 ILE 1 CG2   1 
ATOM   3055  C  CD1   . ILE A  1  394 ? 4.870    -12.757  367.734 1.00 41.71  ? 394 ILE 1 CD1   1 
ATOM   3056  N  N     . GLU A  1  395 ? -0.406   -11.653  368.894 1.00 53.68  ? 395 GLU 1 N     1 
ATOM   3057  C  CA    . GLU A  1  395 ? -1.340   -11.408  369.988 1.00 65.61  ? 395 GLU 1 CA    1 
ATOM   3058  C  C     . GLU A  1  395 ? -2.720   -11.963  369.667 1.00 72.46  ? 395 GLU 1 C     1 
ATOM   3059  O  O     . GLU A  1  395 ? -3.203   -12.882  370.337 1.00 75.35  ? 395 GLU 1 O     1 
ATOM   3060  C  CB    . GLU A  1  395 ? -1.406   -9.909   370.291 1.00 70.54  ? 395 GLU 1 CB    1 
ATOM   3061  C  CG    . GLU A  1  395 ? -2.482   -9.526   371.293 1.00 71.37  ? 395 GLU 1 CG    1 
ATOM   3062  C  CD    . GLU A  1  395 ? -2.307   -8.118   371.823 1.00 72.16  ? 395 GLU 1 CD    1 
ATOM   3063  O  OE1   . GLU A  1  395 ? -1.536   -7.347   371.212 1.00 67.67  ? 395 GLU 1 OE1   1 
ATOM   3064  O  OE2   . GLU A  1  395 ? -2.946   -7.783   372.844 1.00 75.51  ? 395 GLU 1 OE2   1 
ATOM   3065  N  N     . GLY A  1  396 ? -3.366   -11.420  368.631 1.00 73.21  ? 396 GLY 1 N     1 
ATOM   3066  C  CA    . GLY A  1  396 ? -4.760   -11.752  368.378 1.00 75.28  ? 396 GLY 1 CA    1 
ATOM   3067  C  C     . GLY A  1  396 ? -5.014   -13.219  368.069 1.00 78.02  ? 396 GLY 1 C     1 
ATOM   3068  O  O     . GLY A  1  396 ? -6.058   -13.765  368.441 1.00 79.81  ? 396 GLY 1 O     1 
ATOM   3069  N  N     . ARG A  1  397 ? -4.070   -13.883  367.401 1.00 77.02  ? 397 ARG 1 N     1 
ATOM   3070  C  CA    . ARG A  1  397 ? -4.318   -15.182  366.768 1.00 74.72  ? 397 ARG 1 CA    1 
ATOM   3071  C  C     . ARG A  1  397 ? -3.239   -16.187  367.158 1.00 75.63  ? 397 ARG 1 C     1 
ATOM   3072  O  O     . ARG A  1  397 ? -2.217   -16.323  366.481 1.00 77.67  ? 397 ARG 1 O     1 
ATOM   3073  C  CB    . ARG A  1  397 ? -4.426   -15.039  365.232 1.00 70.50  ? 397 ARG 1 CB    1 
ATOM   3074  C  CG    . ARG A  1  397 ? -3.178   -14.501  364.489 1.00 65.07  ? 397 ARG 1 CG    1 
ATOM   3075  C  CD    . ARG A  1  397 ? -3.347   -13.014  364.133 1.00 61.33  ? 397 ARG 1 CD    1 
ATOM   3076  N  NE    . ARG A  1  397 ? -2.482   -12.537  363.055 1.00 62.07  ? 397 ARG 1 NE    1 
ATOM   3077  C  CZ    . ARG A  1  397 ? -2.371   -11.256  362.715 1.00 58.73  ? 397 ARG 1 CZ    1 
ATOM   3078  N  NH1   . ARG A  1  397 ? -3.069   -10.339  363.368 1.00 42.42  ? 397 ARG 1 NH1   1 
ATOM   3079  N  NH2   . ARG A  1  397 ? -1.569   -10.889  361.727 1.00 74.95  ? 397 ARG 1 NH2   1 
ATOM   3080  N  N     . SER A  1  398 ? -3.491   -16.920  368.237 1.00 74.30  ? 398 SER 1 N     1 
ATOM   3081  C  CA    . SER A  1  398 ? -2.704   -18.098  368.573 1.00 73.17  ? 398 SER 1 CA    1 
ATOM   3082  C  C     . SER A  1  398 ? -3.616   -19.092  369.263 1.00 72.12  ? 398 SER 1 C     1 
ATOM   3083  O  O     . SER A  1  398 ? -4.675   -18.738  369.788 1.00 73.71  ? 398 SER 1 O     1 
ATOM   3084  C  CB    . SER A  1  398 ? -1.498   -17.798  369.472 1.00 76.80  ? 398 SER 1 CB    1 
ATOM   3085  O  OG    . SER A  1  398 ? -0.619   -16.884  368.853 1.00 80.92  ? 398 SER 1 OG    1 
ATOM   3086  N  N     . PHE A  1  399 ? -3.175   -20.350  369.261 1.00 67.52  ? 399 PHE 1 N     1 
ATOM   3087  C  CA    . PHE A  1  399 ? -4.019   -21.429  369.757 1.00 62.58  ? 399 PHE 1 CA    1 
ATOM   3088  C  C     . PHE A  1  399 ? -4.180   -21.374  371.272 1.00 61.19  ? 399 PHE 1 C     1 
ATOM   3089  O  O     . PHE A  1  399 ? -5.288   -21.565  371.789 1.00 58.79  ? 399 PHE 1 O     1 
ATOM   3090  C  CB    . PHE A  1  399 ? -3.453   -22.774  369.314 1.00 59.58  ? 399 PHE 1 CB    1 
ATOM   3091  C  CG    . PHE A  1  399 ? -4.428   -23.890  369.428 1.00 60.31  ? 399 PHE 1 CG    1 
ATOM   3092  C  CD1   . PHE A  1  399 ? -5.635   -23.837  368.757 1.00 60.23  ? 399 PHE 1 CD1   1 
ATOM   3093  C  CD2   . PHE A  1  399 ? -4.148   -24.991  370.213 1.00 60.79  ? 399 PHE 1 CD2   1 
ATOM   3094  C  CE1   . PHE A  1  399 ? -6.546   -24.868  368.870 1.00 60.28  ? 399 PHE 1 CE1   1 
ATOM   3095  C  CE2   . PHE A  1  399 ? -5.056   -26.023  370.325 1.00 60.69  ? 399 PHE 1 CE2   1 
ATOM   3096  C  CZ    . PHE A  1  399 ? -6.253   -25.961  369.652 1.00 60.04  ? 399 PHE 1 CZ    1 
ATOM   3097  N  N     . CYS A  1  400 ? -3.103   -21.094  371.997 1.00 61.84  ? 400 CYS 1 N     1 
ATOM   3098  C  CA    . CYS A  1  400 ? -3.195   -20.947  373.439 1.00 60.26  ? 400 CYS 1 CA    1 
ATOM   3099  C  C     . CYS A  1  400 ? -2.606   -19.602  373.834 1.00 61.36  ? 400 CYS 1 C     1 
ATOM   3100  O  O     . CYS A  1  400 ? -1.688   -19.102  373.173 1.00 62.19  ? 400 CYS 1 O     1 
ATOM   3101  C  CB    . CYS A  1  400 ? -2.472   -22.085  374.180 1.00 58.84  ? 400 CYS 1 CB    1 
ATOM   3102  S  SG    . CYS A  1  400 ? -0.689   -21.937  374.225 1.00 58.18  ? 400 CYS 1 SG    1 
ATOM   3103  N  N     . PRO A  1  401 ? -3.141   -18.974  374.885 1.00 55.66  ? 401 PRO 1 N     1 
ATOM   3104  C  CA    . PRO A  1  401 ? -2.777   -17.579  375.178 1.00 51.50  ? 401 PRO 1 CA    1 
ATOM   3105  C  C     . PRO A  1  401 ? -1.331   -17.372  375.606 1.00 39.83  ? 401 PRO 1 C     1 
ATOM   3106  O  O     . PRO A  1  401 ? -0.968   -16.232  375.906 1.00 43.66  ? 401 PRO 1 O     1 
ATOM   3107  C  CB    . PRO A  1  401 ? -3.736   -17.205  376.324 1.00 54.42  ? 401 PRO 1 CB    1 
ATOM   3108  C  CG    . PRO A  1  401 ? -4.896   -18.144  376.161 1.00 58.22  ? 401 PRO 1 CG    1 
ATOM   3109  C  CD    . PRO A  1  401 ? -4.285   -19.431  375.696 1.00 58.17  ? 401 PRO 1 CD    1 
ATOM   3110  N  N     . LEU A  1  402 ? -0.489   -18.411  375.624 1.00 32.16  ? 402 LEU 1 N     1 
ATOM   3111  C  CA    . LEU A  1  402 ? 0.907    -18.239  376.026 1.00 33.23  ? 402 LEU 1 CA    1 
ATOM   3112  C  C     . LEU A  1  402 ? 1.596    -17.181  375.177 1.00 39.31  ? 402 LEU 1 C     1 
ATOM   3113  O  O     . LEU A  1  402 ? 2.389    -16.380  375.687 1.00 44.12  ? 402 LEU 1 O     1 
ATOM   3114  C  CB    . LEU A  1  402 ? 1.659    -19.572  375.944 1.00 33.47  ? 402 LEU 1 CB    1 
ATOM   3115  C  CG    . LEU A  1  402 ? 2.982    -19.697  376.721 1.00 30.40  ? 402 LEU 1 CG    1 
ATOM   3116  C  CD1   . LEU A  1  402 ? 3.287    -21.157  377.103 1.00 27.03  ? 402 LEU 1 CD1   1 
ATOM   3117  C  CD2   . LEU A  1  402 ? 4.172    -19.075  375.981 1.00 29.10  ? 402 LEU 1 CD2   1 
ATOM   3118  N  N     . ALA A  1  403 ? 1.322    -17.182  373.872 1.00 39.67  ? 403 ALA 1 N     1 
ATOM   3119  C  CA    . ALA A  1  403 ? 1.861    -16.160  372.974 1.00 41.29  ? 403 ALA 1 CA    1 
ATOM   3120  C  C     . ALA A  1  403 ? 1.475    -14.736  373.408 1.00 31.70  ? 403 ALA 1 C     1 
ATOM   3121  O  O     . ALA A  1  403 ? 2.310    -13.820  373.364 1.00 23.61  ? 403 ALA 1 O     1 
ATOM   3122  C  CB    . ALA A  1  403 ? 1.399    -16.448  371.542 1.00 44.96  ? 403 ALA 1 CB    1 
ATOM   3123  N  N     . ASP A  1  404 ? 0.215    -14.525  373.808 1.00 28.10  ? 404 ASP 1 N     1 
ATOM   3124  C  CA    . ASP A  1  404 ? -0.164   -13.233  374.376 1.00 23.49  ? 404 ASP 1 CA    1 
ATOM   3125  C  C     . ASP A  1  404 ? 0.683    -12.909  375.588 1.00 23.48  ? 404 ASP 1 C     1 
ATOM   3126  O  O     . ASP A  1  404 ? 1.138    -11.774  375.748 1.00 38.11  ? 404 ASP 1 O     1 
ATOM   3127  C  CB    . ASP A  1  404 ? -1.646   -13.209  374.739 1.00 23.46  ? 404 ASP 1 CB    1 
ATOM   3128  C  CG    . ASP A  1  404 ? -2.527   -13.584  373.569 1.00 26.78  ? 404 ASP 1 CG    1 
ATOM   3129  O  OD1   . ASP A  1  404 ? -1.994   -14.195  372.617 1.00 36.84  ? 404 ASP 1 OD1   1 
ATOM   3130  O  OD2   . ASP A  1  404 ? -3.740   -13.276  373.590 1.00 23.42  ? 404 ASP 1 OD2   1 
ATOM   3131  N  N     . ALA A  1  405 ? 0.937    -13.904  376.433 1.00 24.30  ? 405 ALA 1 N     1 
ATOM   3132  C  CA    . ALA A  1  405 ? 1.781    -13.689  377.597 1.00 28.39  ? 405 ALA 1 CA    1 
ATOM   3133  C  C     . ALA A  1  405 ? 3.188    -13.255  377.219 1.00 30.86  ? 405 ALA 1 C     1 
ATOM   3134  O  O     . ALA A  1  405 ? 3.909    -12.716  378.067 1.00 36.71  ? 405 ALA 1 O     1 
ATOM   3135  C  CB    . ALA A  1  405 ? 1.834    -14.962  378.437 1.00 29.28  ? 405 ALA 1 CB    1 
ATOM   3136  N  N     . ALA A  1  406 ? 3.602    -13.475  375.975 1.00 30.91  ? 406 ALA 1 N     1 
ATOM   3137  C  CA    . ALA A  1  406 ? 4.890    -12.944  375.554 1.00 35.68  ? 406 ALA 1 CA    1 
ATOM   3138  C  C     . ALA A  1  406 ? 4.774    -11.544  374.956 1.00 35.53  ? 406 ALA 1 C     1 
ATOM   3139  O  O     . ALA A  1  406 ? 5.679    -10.719  375.150 1.00 34.23  ? 406 ALA 1 O     1 
ATOM   3140  C  CB    . ALA A  1  406 ? 5.550    -13.906  374.556 1.00 34.82  ? 406 ALA 1 CB    1 
ATOM   3141  N  N     . VAL A  1  407 ? 3.666    -11.255  374.269 1.00 36.15  ? 407 VAL 1 N     1 
ATOM   3142  C  CA    . VAL A  1  407 ? 3.528    -9.999   373.537 1.00 37.90  ? 407 VAL 1 CA    1 
ATOM   3143  C  C     . VAL A  1  407 ? 2.881    -8.905   374.391 1.00 40.71  ? 407 VAL 1 C     1 
ATOM   3144  O  O     . VAL A  1  407 ? 3.200    -7.725   374.217 1.00 43.82  ? 407 VAL 1 O     1 
ATOM   3145  C  CB    . VAL A  1  407 ? 2.743    -10.231  372.233 1.00 36.76  ? 407 VAL 1 CB    1 
ATOM   3146  C  CG1   . VAL A  1  407 ? 3.372    -11.401  371.436 1.00 40.37  ? 407 VAL 1 CG1   1 
ATOM   3147  C  CG2   . VAL A  1  407 ? 1.256    -10.426  372.496 1.00 34.89  ? 407 VAL 1 CG2   1 
ATOM   3148  N  N     . TRP A  1  408 ? 1.947    -9.259   375.282 1.00 42.30  ? 408 TRP 1 N     1 
ATOM   3149  C  CA    . TRP A  1  408 ? 1.314    -8.251   376.132 1.00 45.61  ? 408 TRP 1 CA    1 
ATOM   3150  C  C     . TRP A  1  408 ? 2.319    -7.501   376.992 1.00 43.79  ? 408 TRP 1 C     1 
ATOM   3151  O  O     . TRP A  1  408 ? 2.302    -6.256   376.979 1.00 45.44  ? 408 TRP 1 O     1 
ATOM   3152  C  CB    . TRP A  1  408 ? 0.225    -8.884   377.007 1.00 50.31  ? 408 TRP 1 CB    1 
ATOM   3153  C  CG    . TRP A  1  408 ? -1.152   -8.819   376.429 1.00 54.41  ? 408 TRP 1 CG    1 
ATOM   3154  C  CD1   . TRP A  1  408 ? -1.618   -7.915   375.525 1.00 54.06  ? 408 TRP 1 CD1   1 
ATOM   3155  C  CD2   . TRP A  1  408 ? -2.261   -9.665   376.758 1.00 58.53  ? 408 TRP 1 CD2   1 
ATOM   3156  N  NE1   . TRP A  1  408 ? -2.941   -8.165   375.241 1.00 55.18  ? 408 TRP 1 NE1   1 
ATOM   3157  C  CE2   . TRP A  1  408 ? -3.359   -9.231   375.991 1.00 57.80  ? 408 TRP 1 CE2   1 
ATOM   3158  C  CE3   . TRP A  1  408 ? -2.428   -10.757  377.617 1.00 61.27  ? 408 TRP 1 CE3   1 
ATOM   3159  C  CZ2   . TRP A  1  408 ? -4.605   -9.849   376.057 1.00 58.74  ? 408 TRP 1 CZ2   1 
ATOM   3160  C  CZ3   . TRP A  1  408 ? -3.665   -11.369  377.681 1.00 60.88  ? 408 TRP 1 CZ3   1 
ATOM   3161  C  CH2   . TRP A  1  408 ? -4.737   -10.914  376.908 1.00 59.91  ? 408 TRP 1 CH2   1 
ATOM   3162  N  N     . PRO A  1  409 ? 3.194    -8.156   377.765 1.00 42.18  ? 409 PRO 1 N     1 
ATOM   3163  C  CA    . PRO A  1  409 ? 4.128    -7.369   378.590 1.00 41.46  ? 409 PRO 1 CA    1 
ATOM   3164  C  C     . PRO A  1  409 ? 4.962    -6.408   377.764 1.00 37.22  ? 409 PRO 1 C     1 
ATOM   3165  O  O     . PRO A  1  409 ? 5.201    -5.276   378.194 1.00 39.62  ? 409 PRO 1 O     1 
ATOM   3166  C  CB    . PRO A  1  409 ? 4.980    -8.447   379.279 1.00 46.51  ? 409 PRO 1 CB    1 
ATOM   3167  C  CG    . PRO A  1  409 ? 4.810    -9.687   378.429 1.00 45.85  ? 409 PRO 1 CG    1 
ATOM   3168  C  CD    . PRO A  1  409 ? 3.415    -9.608   377.906 1.00 42.02  ? 409 PRO 1 CD    1 
ATOM   3169  N  N     . VAL A  1  410 ? 5.377    -6.824   376.566 1.00 31.41  ? 410 VAL 1 N     1 
ATOM   3170  C  CA    . VAL A  1  410 ? 6.112    -5.939   375.671 1.00 33.76  ? 410 VAL 1 CA    1 
ATOM   3171  C  C     . VAL A  1  410 ? 5.211    -4.815   375.187 1.00 41.79  ? 410 VAL 1 C     1 
ATOM   3172  O  O     . VAL A  1  410 ? 5.633    -3.653   375.109 1.00 45.10  ? 410 VAL 1 O     1 
ATOM   3173  C  CB    . VAL A  1  410 ? 6.698    -6.747   374.501 1.00 27.30  ? 410 VAL 1 CB    1 
ATOM   3174  C  CG1   . VAL A  1  410 ? 7.476    -5.862   373.552 1.00 23.00  ? 410 VAL 1 CG1   1 
ATOM   3175  C  CG2   . VAL A  1  410 ? 7.606    -7.807   375.047 1.00 26.96  ? 410 VAL 1 CG2   1 
ATOM   3176  N  N     . LYS A  1  411 ? 3.948    -5.133   374.885 1.00 43.39  ? 411 LYS 1 N     1 
ATOM   3177  C  CA    . LYS A  1  411 ? 3.018    -4.120   374.396 1.00 45.17  ? 411 LYS 1 CA    1 
ATOM   3178  C  C     . LYS A  1  411 ? 2.945    -2.938   375.360 1.00 37.78  ? 411 LYS 1 C     1 
ATOM   3179  O  O     . LYS A  1  411 ? 3.213    -1.791   374.983 1.00 33.11  ? 411 LYS 1 O     1 
ATOM   3180  C  CB    . LYS A  1  411 ? 1.628    -4.722   374.174 1.00 48.38  ? 411 LYS 1 CB    1 
ATOM   3181  C  CG    . LYS A  1  411 ? 0.654    -3.689   373.631 1.00 56.63  ? 411 LYS 1 CG    1 
ATOM   3182  C  CD    . LYS A  1  411 ? -0.789   -3.938   374.042 1.00 61.84  ? 411 LYS 1 CD    1 
ATOM   3183  C  CE    . LYS A  1  411 ? -1.663   -2.706   373.761 1.00 63.39  ? 411 LYS 1 CE    1 
ATOM   3184  N  NZ    . LYS A  1  411 ? -2.080   -2.551   372.334 1.00 62.52  ? 411 LYS 1 NZ    1 
ATOM   3185  N  N     . GLY A  1  412 ? 2.572    -3.204   376.613 1.00 38.54  ? 412 GLY 1 N     1 
ATOM   3186  C  CA    . GLY A  1  412 ? 2.616    -2.154   377.613 1.00 39.30  ? 412 GLY 1 CA    1 
ATOM   3187  C  C     . GLY A  1  412 ? 4.002    -1.559   377.755 1.00 41.89  ? 412 GLY 1 C     1 
ATOM   3188  O  O     . GLY A  1  412 ? 4.154    -0.340   377.865 1.00 44.39  ? 412 GLY 1 O     1 
ATOM   3189  N  N     . SER A  1  413 ? 5.037    -2.407   377.707 1.00 40.69  ? 413 SER 1 N     1 
ATOM   3190  C  CA    . SER A  1  413 ? 6.404    -1.903   377.761 1.00 40.97  ? 413 SER 1 CA    1 
ATOM   3191  C  C     . SER A  1  413 ? 6.675    -0.968   376.604 1.00 49.38  ? 413 SER 1 C     1 
ATOM   3192  O  O     . SER A  1  413 ? 7.567    -0.121   376.682 1.00 50.55  ? 413 SER 1 O     1 
ATOM   3193  C  CB    . SER A  1  413 ? 7.411    -3.041   377.712 1.00 36.84  ? 413 SER 1 CB    1 
ATOM   3194  O  OG    . SER A  1  413 ? 7.785    -3.279   376.367 1.00 35.08  ? 413 SER 1 OG    1 
ATOM   3195  N  N     . LEU A  1  414 ? 5.964    -1.159   375.497 1.00 57.16  ? 414 LEU 1 N     1 
ATOM   3196  C  CA    . LEU A  1  414 ? 5.960    -0.161   374.439 1.00 67.03  ? 414 LEU 1 CA    1 
ATOM   3197  C  C     . LEU A  1  414 ? 5.015    0.988    374.786 1.00 75.12  ? 414 LEU 1 C     1 
ATOM   3198  O  O     . LEU A  1  414 ? 5.446    2.146    374.874 1.00 76.41  ? 414 LEU 1 O     1 
ATOM   3199  C  CB    . LEU A  1  414 ? 5.587    -0.822   373.102 1.00 64.08  ? 414 LEU 1 CB    1 
ATOM   3200  C  CG    . LEU A  1  414 ? 6.767    -1.322   372.247 1.00 61.20  ? 414 LEU 1 CG    1 
ATOM   3201  C  CD1   . LEU A  1  414 ? 7.522    -2.431   372.917 1.00 57.08  ? 414 LEU 1 CD1   1 
ATOM   3202  C  CD2   . LEU A  1  414 ? 6.309    -1.787   370.869 1.00 59.83  ? 414 LEU 1 CD2   1 
ATOM   3203  N  N     . ARG A  1  415 ? 3.750    0.666    375.102 1.00 79.84  ? 415 ARG 1 N     1 
ATOM   3204  C  CA    . ARG A  1  415 ? 2.708    1.691    375.211 1.00 81.38  ? 415 ARG 1 CA    1 
ATOM   3205  C  C     . ARG A  1  415 ? 3.073    2.787    376.200 1.00 76.30  ? 415 ARG 1 C     1 
ATOM   3206  O  O     . ARG A  1  415 ? 2.685    3.945    376.014 1.00 73.37  ? 415 ARG 1 O     1 
ATOM   3207  C  CB    . ARG A  1  415 ? 1.378    1.048    375.610 1.00 86.40  ? 415 ARG 1 CB    1 
ATOM   3208  C  CG    . ARG A  1  415 ? 0.187    2.000    375.580 1.00 91.16  ? 415 ARG 1 CG    1 
ATOM   3209  C  CD    . ARG A  1  415 ? -0.868   1.608    376.613 1.00 95.90  ? 415 ARG 1 CD    1 
ATOM   3210  N  NE    . ARG A  1  415 ? -1.940   2.598    376.707 1.00 99.58  ? 415 ARG 1 NE    1 
ATOM   3211  C  CZ    . ARG A  1  415 ? -2.981   2.504    377.532 1.00 100.87 ? 415 ARG 1 CZ    1 
ATOM   3212  N  NH1   . ARG A  1  415 ? -3.104   1.457    378.339 1.00 101.44 ? 415 ARG 1 NH1   1 
ATOM   3213  N  NH2   . ARG A  1  415 ? -3.902   3.460    377.554 1.00 100.32 ? 415 ARG 1 NH2   1 
ATOM   3214  N  N     . HIS A  1  416 ? 3.830    2.447    377.242 1.00 77.48  ? 416 HIS 1 N     1 
ATOM   3215  C  CA    . HIS A  1  416 ? 4.276    3.422    378.221 1.00 76.95  ? 416 HIS 1 CA    1 
ATOM   3216  C  C     . HIS A  1  416 ? 5.777    3.677    378.185 1.00 83.53  ? 416 HIS 1 C     1 
ATOM   3217  O  O     . HIS A  1  416 ? 6.222    4.704    378.710 1.00 83.27  ? 416 HIS 1 O     1 
ATOM   3218  C  CB    . HIS A  1  416 ? 3.878    2.976    379.641 1.00 76.07  ? 416 HIS 1 CB    1 
ATOM   3219  C  CG    . HIS A  1  416 ? 2.396    2.889    379.866 1.00 66.01  ? 416 HIS 1 CG    1 
ATOM   3220  N  ND1   . HIS A  1  416 ? 1.596    4.005    380.006 1.00 72.08  ? 416 HIS 1 ND1   1 
ATOM   3221  C  CD2   . HIS A  1  416 ? 1.572    1.821    379.983 1.00 72.06  ? 416 HIS 1 CD2   1 
ATOM   3222  C  CE1   . HIS A  1  416 ? 0.344    3.628    380.197 1.00 66.37  ? 416 HIS 1 CE1   1 
ATOM   3223  N  NE2   . HIS A  1  416 ? 0.303    2.308    380.187 1.00 70.44  ? 416 HIS 1 NE2   1 
ATOM   3224  N  N     . PHE A  1  417 ? 6.567    2.787    377.560 1.00 85.03  ? 417 PHE 1 N     1 
ATOM   3225  C  CA    . PHE A  1  417 ? 8.018    2.935    377.625 1.00 86.45  ? 417 PHE 1 CA    1 
ATOM   3226  C  C     . PHE A  1  417 ? 8.697    2.724    376.275 1.00 81.21  ? 417 PHE 1 C     1 
ATOM   3227  O  O     . PHE A  1  417 ? 9.914    2.495    376.239 1.00 83.69  ? 417 PHE 1 O     1 
ATOM   3228  C  CB    . PHE A  1  417 ? 8.640    1.970    378.650 1.00 91.37  ? 417 PHE 1 CB    1 
ATOM   3229  C  CG    . PHE A  1  417 ? 7.941    1.951    379.984 1.00 95.08  ? 417 PHE 1 CG    1 
ATOM   3230  C  CD1   . PHE A  1  417 ? 6.932    1.035    380.240 1.00 96.62  ? 417 PHE 1 CD1   1 
ATOM   3231  C  CD2   . PHE A  1  417 ? 8.292    2.844    380.982 1.00 96.71  ? 417 PHE 1 CD2   1 
ATOM   3232  C  CE1   . PHE A  1  417 ? 6.288    1.007    381.465 1.00 97.57  ? 417 PHE 1 CE1   1 
ATOM   3233  C  CE2   . PHE A  1  417 ? 7.647    2.820    382.211 1.00 98.15  ? 417 PHE 1 CE2   1 
ATOM   3234  C  CZ    . PHE A  1  417 ? 6.645    1.899    382.449 1.00 98.31  ? 417 PHE 1 CZ    1 
ATOM   3235  N  N     . LYS A  1  418 ? 7.944    2.773    375.170 1.00 73.52  ? 418 LYS 1 N     1 
ATOM   3236  C  CA    . LYS A  1  418 ? 8.546    2.636    373.846 1.00 68.05  ? 418 LYS 1 CA    1 
ATOM   3237  C  C     . LYS A  1  418 ? 9.772    3.534    373.707 1.00 70.23  ? 418 LYS 1 C     1 
ATOM   3238  O  O     . LYS A  1  418 ? 10.785   3.139    373.114 1.00 68.89  ? 418 LYS 1 O     1 
ATOM   3239  C  CB    . LYS A  1  418 ? 7.511    2.954    372.763 1.00 60.40  ? 418 LYS 1 CB    1 
ATOM   3240  C  CG    . LYS A  1  418 ? 8.076    2.934    371.356 1.00 55.26  ? 418 LYS 1 CG    1 
ATOM   3241  C  CD    . LYS A  1  418 ? 7.033    3.276    370.309 1.00 50.47  ? 418 LYS 1 CD    1 
ATOM   3242  C  CE    . LYS A  1  418 ? 7.489    2.838    368.927 1.00 46.65  ? 418 LYS 1 CE    1 
ATOM   3243  N  NZ    . LYS A  1  418 ? 6.479    2.019    368.221 1.00 44.91  ? 418 LYS 1 NZ    1 
ATOM   3244  N  N     . ASP A  1  419 ? 9.693    4.741    374.271 1.00 73.10  ? 419 ASP 1 N     1 
ATOM   3245  C  CA    . ASP A  1  419 ? 10.788   5.703    374.235 1.00 78.12  ? 419 ASP 1 CA    1 
ATOM   3246  C  C     . ASP A  1  419 ? 12.122   5.059    374.603 1.00 77.62  ? 419 ASP 1 C     1 
ATOM   3247  O  O     . ASP A  1  419 ? 13.118   5.220    373.887 1.00 77.95  ? 419 ASP 1 O     1 
ATOM   3248  C  CB    . ASP A  1  419 ? 10.465   6.842    375.196 1.00 85.90  ? 419 ASP 1 CB    1 
ATOM   3249  C  CG    . ASP A  1  419 ? 9.018    7.307    375.078 1.00 93.06  ? 419 ASP 1 CG    1 
ATOM   3250  O  OD1   . ASP A  1  419 ? 8.367    6.985    374.058 1.00 94.89  ? 419 ASP 1 OD1   1 
ATOM   3251  O  OD2   . ASP A  1  419 ? 8.531    7.996    376.001 1.00 95.83  ? 419 ASP 1 OD2   1 
ATOM   3252  N  N     . GLN A  1  420 ? 12.149   4.320    375.723 1.00 76.19  ? 420 GLN 1 N     1 
ATOM   3253  C  CA    . GLN A  1  420 ? 13.366   3.638    376.175 1.00 71.71  ? 420 GLN 1 CA    1 
ATOM   3254  C  C     . GLN A  1  420 ? 14.022   2.859    375.042 1.00 65.00  ? 420 GLN 1 C     1 
ATOM   3255  O  O     . GLN A  1  420 ? 15.227   3.001    374.792 1.00 66.21  ? 420 GLN 1 O     1 
ATOM   3256  C  CB    . GLN A  1  420 ? 13.057   2.701    377.351 1.00 67.55  ? 420 GLN 1 CB    1 
ATOM   3257  C  CG    . GLN A  1  420 ? 14.184   2.603    378.389 1.00 63.51  ? 420 GLN 1 CG    1 
ATOM   3258  C  CD    . GLN A  1  420 ? 13.694   2.175    379.760 1.00 57.54  ? 420 GLN 1 CD    1 
ATOM   3259  O  OE1   . GLN A  1  420 ? 12.494   2.075    379.996 1.00 56.48  ? 420 GLN 1 OE1   1 
ATOM   3260  N  NE2   . GLN A  1  420 ? 14.624   1.937    380.675 1.00 57.57  ? 420 GLN 1 NE2   1 
ATOM   3261  N  N     . TYR A  1  421 ? 13.234   2.038    374.340 1.00 58.90  ? 421 TYR 1 N     1 
ATOM   3262  C  CA    . TYR A  1  421 ? 13.762   1.278    373.213 1.00 59.17  ? 421 TYR 1 CA    1 
ATOM   3263  C  C     . TYR A  1  421 ? 14.517   2.198    372.267 1.00 57.47  ? 421 TYR 1 C     1 
ATOM   3264  O  O     . TYR A  1  421 ? 15.722   2.031    372.034 1.00 57.56  ? 421 TYR 1 O     1 
ATOM   3265  C  CB    . TYR A  1  421 ? 12.621   0.584    372.461 1.00 65.85  ? 421 TYR 1 CB    1 
ATOM   3266  C  CG    . TYR A  1  421 ? 11.875   -0.487   373.237 1.00 72.17  ? 421 TYR 1 CG    1 
ATOM   3267  C  CD1   . TYR A  1  421 ? 10.876   -0.156   374.143 1.00 72.02  ? 421 TYR 1 CD1   1 
ATOM   3268  C  CD2   . TYR A  1  421 ? 12.175   -1.836   373.063 1.00 74.21  ? 421 TYR 1 CD2   1 
ATOM   3269  C  CE1   . TYR A  1  421 ? 10.195   -1.139   374.848 1.00 71.86  ? 421 TYR 1 CE1   1 
ATOM   3270  C  CE2   . TYR A  1  421 ? 11.505   -2.819   373.767 1.00 72.41  ? 421 TYR 1 CE2   1 
ATOM   3271  C  CZ    . TYR A  1  421 ? 10.516   -2.466   374.658 1.00 73.05  ? 421 TYR 1 CZ    1 
ATOM   3272  O  OH    . TYR A  1  421 ? 9.847    -3.443   375.361 1.00 74.69  ? 421 TYR 1 OH    1 
ATOM   3273  N  N     . LEU A  1  422 ? 13.817   3.229    371.782 1.00 54.86  ? 422 LEU 1 N     1 
ATOM   3274  C  CA    . LEU A  1  422 ? 14.388   4.174    370.829 1.00 48.55  ? 422 LEU 1 CA    1 
ATOM   3275  C  C     . LEU A  1  422 ? 15.715   4.719    371.329 1.00 52.06  ? 422 LEU 1 C     1 
ATOM   3276  O  O     . LEU A  1  422 ? 16.667   4.875    370.552 1.00 51.69  ? 422 LEU 1 O     1 
ATOM   3277  C  CB    . LEU A  1  422 ? 13.391   5.309    370.585 1.00 39.23  ? 422 LEU 1 CB    1 
ATOM   3278  C  CG    . LEU A  1  422 ? 12.023   4.891    370.044 1.00 34.65  ? 422 LEU 1 CG    1 
ATOM   3279  C  CD1   . LEU A  1  422 ? 11.028   6.021    370.177 1.00 34.70  ? 422 LEU 1 CD1   1 
ATOM   3280  C  CD2   . LEU A  1  422 ? 12.152   4.490    368.585 1.00 34.00  ? 422 LEU 1 CD2   1 
ATOM   3281  N  N     . ALA A  1  423 ? 15.800   4.984    372.633 1.00 55.08  ? 423 ALA 1 N     1 
ATOM   3282  C  CA    . ALA A  1  423 ? 17.044   5.466    373.219 1.00 58.97  ? 423 ALA 1 CA    1 
ATOM   3283  C  C     . ALA A  1  423 ? 18.186   4.501    372.928 1.00 60.00  ? 423 ALA 1 C     1 
ATOM   3284  O  O     . ALA A  1  423 ? 19.157   4.848    372.241 1.00 56.12  ? 423 ALA 1 O     1 
ATOM   3285  C  CB    . ALA A  1  423 ? 16.857   5.670    374.723 1.00 60.39  ? 423 ALA 1 CB    1 
ATOM   3286  N  N     . LEU A  1  424 ? 18.065   3.262    373.412 1.00 65.72  ? 424 LEU 1 N     1 
ATOM   3287  C  CA    . LEU A  1  424 ? 19.085   2.255    373.135 1.00 73.51  ? 424 LEU 1 CA    1 
ATOM   3288  C  C     . LEU A  1  424 ? 19.248   2.012    371.641 1.00 80.44  ? 424 LEU 1 C     1 
ATOM   3289  O  O     . LEU A  1  424 ? 20.263   1.443    371.217 1.00 81.41  ? 424 LEU 1 O     1 
ATOM   3290  C  CB    . LEU A  1  424 ? 18.758   0.951    373.866 1.00 74.70  ? 424 LEU 1 CB    1 
ATOM   3291  C  CG    . LEU A  1  424 ? 19.526   0.748    375.179 1.00 75.04  ? 424 LEU 1 CG    1 
ATOM   3292  C  CD1   . LEU A  1  424 ? 19.443   1.971    376.092 1.00 74.72  ? 424 LEU 1 CD1   1 
ATOM   3293  C  CD2   . LEU A  1  424 ? 19.071   -0.516   375.897 1.00 75.06  ? 424 LEU 1 CD2   1 
ATOM   3294  N  N     . ALA A  1  425 ? 18.252   2.401    370.842 1.00 84.20  ? 425 ALA 1 N     1 
ATOM   3295  C  CA    . ALA A  1  425 ? 18.409   2.407    369.394 1.00 87.16  ? 425 ALA 1 CA    1 
ATOM   3296  C  C     . ALA A  1  425 ? 19.257   3.594    368.951 1.00 86.69  ? 425 ALA 1 C     1 
ATOM   3297  O  O     . ALA A  1  425 ? 20.294   3.423    368.304 1.00 88.07  ? 425 ALA 1 O     1 
ATOM   3298  C  CB    . ALA A  1  425 ? 17.035   2.432    368.718 1.00 88.77  ? 425 ALA 1 CB    1 
ATOM   3299  N  N     . ARG A  1  426 ? 18.843   4.810    369.316 1.00 85.40  ? 426 ARG 1 N     1 
ATOM   3300  C  CA    . ARG A  1  426 ? 19.522   5.989    368.791 1.00 86.15  ? 426 ARG 1 CA    1 
ATOM   3301  C  C     . ARG A  1  426 ? 20.897   6.178    369.416 1.00 88.93  ? 426 ARG 1 C     1 
ATOM   3302  O  O     . ARG A  1  426 ? 21.787   6.753    368.779 1.00 89.93  ? 426 ARG 1 O     1 
ATOM   3303  C  CB    . ARG A  1  426 ? 18.663   7.234    369.003 1.00 86.08  ? 426 ARG 1 CB    1 
ATOM   3304  C  CG    . ARG A  1  426 ? 17.460   7.321    368.076 1.00 84.63  ? 426 ARG 1 CG    1 
ATOM   3305  C  CD    . ARG A  1  426 ? 16.470   8.360    368.566 1.00 84.23  ? 426 ARG 1 CD    1 
ATOM   3306  N  NE    . ARG A  1  426 ? 15.313   8.485    367.686 1.00 85.28  ? 426 ARG 1 NE    1 
ATOM   3307  C  CZ    . ARG A  1  426 ? 14.235   9.213    367.973 1.00 86.01  ? 426 ARG 1 CZ    1 
ATOM   3308  N  NH1   . ARG A  1  426 ? 14.172   9.884    369.115 1.00 86.30  ? 426 ARG 1 NH1   1 
ATOM   3309  N  NH2   . ARG A  1  426 ? 13.219   9.276    367.120 1.00 85.32  ? 426 ARG 1 NH2   1 
ATOM   3310  N  N     . GLU A  1  427 ? 21.103   5.682    370.636 1.00 91.29  ? 427 GLU 1 N     1 
ATOM   3311  C  CA    . GLU A  1  427 ? 22.381   5.856    371.315 1.00 95.72  ? 427 GLU 1 CA    1 
ATOM   3312  C  C     . GLU A  1  427 ? 23.322   4.682    371.110 1.00 94.26  ? 427 GLU 1 C     1 
ATOM   3313  O  O     . GLU A  1  427 ? 24.490   4.772    371.501 1.00 93.21  ? 427 GLU 1 O     1 
ATOM   3314  C  CB    . GLU A  1  427 ? 22.175   6.079    372.821 1.00 101.42 ? 427 GLU 1 CB    1 
ATOM   3315  C  CG    . GLU A  1  427 ? 21.124   7.128    373.169 1.00 104.98 ? 427 GLU 1 CG    1 
ATOM   3316  C  CD    . GLU A  1  427 ? 20.580   6.967    374.579 1.00 105.95 ? 427 GLU 1 CD    1 
ATOM   3317  O  OE1   . GLU A  1  427 ? 20.102   5.861    374.906 1.00 106.71 ? 427 GLU 1 OE1   1 
ATOM   3318  O  OE2   . GLU A  1  427 ? 20.619   7.944    375.356 1.00 105.22 ? 427 GLU 1 OE2   1 
ATOM   3319  N  N     . LYS A  1  428 ? 22.842   3.600    370.501 1.00 94.25  ? 428 LYS 1 N     1 
ATOM   3320  C  CA    . LYS A  1  428 ? 23.648   2.407    370.262 1.00 95.36  ? 428 LYS 1 CA    1 
ATOM   3321  C  C     . LYS A  1  428 ? 24.297   1.918    371.556 1.00 93.62  ? 428 LYS 1 C     1 
ATOM   3322  O  O     . LYS A  1  428 ? 25.478   1.563    371.593 1.00 96.85  ? 428 LYS 1 O     1 
ATOM   3323  C  CB    . LYS A  1  428 ? 24.700   2.671    369.184 1.00 97.97  ? 428 LYS 1 CB    1 
ATOM   3324  C  CG    . LYS A  1  428 ? 24.182   3.455    367.988 1.00 99.07  ? 428 LYS 1 CG    1 
ATOM   3325  C  CD    . LYS A  1  428 ? 23.293   2.590    367.112 1.00 100.57 ? 428 LYS 1 CD    1 
ATOM   3326  C  CE    . LYS A  1  428 ? 22.524   3.440    366.126 1.00 101.36 ? 428 LYS 1 CE    1 
ATOM   3327  N  NZ    . LYS A  1  428 ? 21.645   4.405    366.832 1.00 101.49 ? 428 LYS 1 NZ    1 
ATOM   3328  N  N     . ARG A  1  429 ? 23.511   1.892    372.628 1.00 86.82  ? 429 ARG 1 N     1 
ATOM   3329  C  CA    . ARG A  1  429 ? 24.026   1.565    373.943 1.00 79.81  ? 429 ARG 1 CA    1 
ATOM   3330  C  C     . ARG A  1  429 ? 23.556   0.185    374.373 1.00 77.10  ? 429 ARG 1 C     1 
ATOM   3331  O  O     . ARG A  1  429 ? 22.369   -0.136   374.218 1.00 77.41  ? 429 ARG 1 O     1 
ATOM   3332  C  CB    . ARG A  1  429 ? 23.572   2.607    374.966 1.00 72.57  ? 429 ARG 1 CB    1 
ATOM   3333  C  CG    . ARG A  1  429 ? 24.470   3.812    375.057 1.00 67.49  ? 429 ARG 1 CG    1 
ATOM   3334  C  CD    . ARG A  1  429 ? 23.944   4.753    376.108 1.00 64.19  ? 429 ARG 1 CD    1 
ATOM   3335  N  NE    . ARG A  1  429 ? 23.519   4.026    377.297 1.00 60.86  ? 429 ARG 1 NE    1 
ATOM   3336  C  CZ    . ARG A  1  429 ? 22.314   4.146    377.841 1.00 59.16  ? 429 ARG 1 CZ    1 
ATOM   3337  N  NH1   . ARG A  1  429 ? 21.422   4.964    377.299 1.00 58.77  ? 429 ARG 1 NH1   1 
ATOM   3338  N  NH2   . ARG A  1  429 ? 22.001   3.453    378.926 1.00 58.64  ? 429 ARG 1 NH2   1 
ATOM   3339  N  N     . PRO A  1  430 ? 24.445   -0.664   374.882 1.00 74.48  ? 430 PRO 1 N     1 
ATOM   3340  C  CA    . PRO A  1  430 ? 23.994   -1.925   375.478 1.00 72.97  ? 430 PRO 1 CA    1 
ATOM   3341  C  C     . PRO A  1  430 ? 23.158   -1.670   376.728 1.00 76.23  ? 430 PRO 1 C     1 
ATOM   3342  O  O     . PRO A  1  430 ? 23.173   -0.584   377.315 1.00 77.33  ? 430 PRO 1 O     1 
ATOM   3343  C  CB    . PRO A  1  430 ? 25.303   -2.648   375.813 1.00 70.43  ? 430 PRO 1 CB    1 
ATOM   3344  C  CG    . PRO A  1  430 ? 26.318   -1.546   375.936 1.00 70.37  ? 430 PRO 1 CG    1 
ATOM   3345  C  CD    . PRO A  1  430 ? 25.913   -0.535   374.904 1.00 71.00  ? 430 PRO 1 CD    1 
ATOM   3346  N  N     . VAL A  1  431 ? 22.394   -2.689   377.116 1.00 74.63  ? 431 VAL 1 N     1 
ATOM   3347  C  CA    . VAL A  1  431 ? 21.569   -2.551   378.322 1.00 74.71  ? 431 VAL 1 CA    1 
ATOM   3348  C  C     . VAL A  1  431 ? 22.481   -2.382   379.532 1.00 75.30  ? 431 VAL 1 C     1 
ATOM   3349  O  O     . VAL A  1  431 ? 23.574   -2.986   379.573 1.00 77.73  ? 431 VAL 1 O     1 
ATOM   3350  C  CB    . VAL A  1  431 ? 20.641   -3.767   378.492 1.00 72.45  ? 431 VAL 1 CB    1 
ATOM   3351  C  CG1   . VAL A  1  431 ? 19.538   -3.745   377.444 1.00 71.35  ? 431 VAL 1 CG1   1 
ATOM   3352  C  CG2   . VAL A  1  431 ? 21.446   -5.054   378.389 1.00 72.01  ? 431 VAL 1 CG2   1 
ATOM   3353  N  N     . PRO A  1  432 ? 22.112   -1.577   380.529 1.00 72.02  ? 432 PRO 1 N     1 
ATOM   3354  C  CA    . PRO A  1  432 ? 22.983   -1.418   381.701 1.00 69.72  ? 432 PRO 1 CA    1 
ATOM   3355  C  C     . PRO A  1  432 ? 23.179   -2.728   382.461 1.00 68.14  ? 432 PRO 1 C     1 
ATOM   3356  O  O     . PRO A  1  432 ? 22.233   -3.475   382.720 1.00 68.11  ? 432 PRO 1 O     1 
ATOM   3357  C  CB    . PRO A  1  432 ? 22.248   -0.371   382.552 1.00 69.82  ? 432 PRO 1 CB    1 
ATOM   3358  C  CG    . PRO A  1  432 ? 20.843   -0.319   382.009 1.00 70.11  ? 432 PRO 1 CG    1 
ATOM   3359  C  CD    . PRO A  1  432 ? 20.954   -0.665   380.562 1.00 70.35  ? 432 PRO 1 CD    1 
ATOM   3360  N  N     . ARG A  1  433 ? 24.435   -2.997   382.827 1.00 68.17  ? 433 ARG 1 N     1 
ATOM   3361  C  CA    . ARG A  1  433 ? 24.816   -4.192   383.579 1.00 72.35  ? 433 ARG 1 CA    1 
ATOM   3362  C  C     . ARG A  1  433 ? 25.516   -3.753   384.860 1.00 75.33  ? 433 ARG 1 C     1 
ATOM   3363  O  O     . ARG A  1  433 ? 26.739   -3.899   384.993 1.00 76.30  ? 433 ARG 1 O     1 
ATOM   3364  C  CB    . ARG A  1  433 ? 25.735   -5.098   382.760 1.00 74.95  ? 433 ARG 1 CB    1 
ATOM   3365  C  CG    . ARG A  1  433 ? 25.014   -5.999   381.788 1.00 77.03  ? 433 ARG 1 CG    1 
ATOM   3366  C  CD    . ARG A  1  433 ? 24.018   -6.874   382.517 1.00 77.57  ? 433 ARG 1 CD    1 
ATOM   3367  N  NE    . ARG A  1  433 ? 23.607   -8.011   381.706 1.00 77.75  ? 433 ARG 1 NE    1 
ATOM   3368  C  CZ    . ARG A  1  433 ? 22.578   -8.795   381.997 1.00 78.59  ? 433 ARG 1 CZ    1 
ATOM   3369  N  NH1   . ARG A  1  433 ? 21.847   -8.565   383.081 1.00 78.24  ? 433 ARG 1 NH1   1 
ATOM   3370  N  NH2   . ARG A  1  433 ? 22.275   -9.806   381.197 1.00 79.41  ? 433 ARG 1 NH2   1 
ATOM   3371  N  N     . PRO A  1  434 ? 24.776   -3.220   385.826 1.00 77.51  ? 434 PRO 1 N     1 
ATOM   3372  C  CA    . PRO A  1  434 ? 25.396   -2.756   387.068 1.00 79.82  ? 434 PRO 1 CA    1 
ATOM   3373  C  C     . PRO A  1  434 ? 25.536   -3.876   388.096 1.00 81.96  ? 434 PRO 1 C     1 
ATOM   3374  O  O     . PRO A  1  434 ? 24.994   -4.974   387.945 1.00 83.97  ? 434 PRO 1 O     1 
ATOM   3375  C  CB    . PRO A  1  434 ? 24.420   -1.676   387.550 1.00 79.86  ? 434 PRO 1 CB    1 
ATOM   3376  C  CG    . PRO A  1  434 ? 23.102   -2.162   387.072 1.00 80.68  ? 434 PRO 1 CG    1 
ATOM   3377  C  CD    . PRO A  1  434 ? 23.340   -2.888   385.774 1.00 79.28  ? 434 PRO 1 CD    1 
ATOM   3378  N  N     . SER A  1  435 ? 26.283   -3.571   389.156 1.00 81.98  ? 435 SER 1 N     1 
ATOM   3379  C  CA    . SER A  1  435 ? 26.475   -4.514   390.250 1.00 81.18  ? 435 SER 1 CA    1 
ATOM   3380  C  C     . SER A  1  435 ? 25.215   -4.520   391.106 1.00 79.04  ? 435 SER 1 C     1 
ATOM   3381  O  O     . SER A  1  435 ? 24.842   -3.489   391.679 1.00 77.24  ? 435 SER 1 O     1 
ATOM   3382  C  CB    . SER A  1  435 ? 27.701   -4.131   391.081 1.00 81.74  ? 435 SER 1 CB    1 
ATOM   3383  O  OG    . SER A  1  435 ? 27.988   -5.099   392.076 1.00 81.54  ? 435 SER 1 OG    1 
ATOM   3384  N  N     . LEU A  1  436 ? 24.549   -5.671   391.179 1.00 77.84  ? 436 LEU 1 N     1 
ATOM   3385  C  CA    . LEU A  1  436 ? 23.302   -5.797   391.920 1.00 74.55  ? 436 LEU 1 CA    1 
ATOM   3386  C  C     . LEU A  1  436 ? 23.367   -6.743   393.103 1.00 72.17  ? 436 LEU 1 C     1 
ATOM   3387  O  O     . LEU A  1  436 ? 22.631   -6.541   394.074 1.00 70.53  ? 436 LEU 1 O     1 
ATOM   3388  C  CB    . LEU A  1  436 ? 22.167   -6.256   390.987 1.00 73.65  ? 436 LEU 1 CB    1 
ATOM   3389  C  CG    . LEU A  1  436 ? 21.293   -5.151   390.380 1.00 73.43  ? 436 LEU 1 CG    1 
ATOM   3390  C  CD1   . LEU A  1  436 ? 22.132   -4.068   389.766 1.00 72.07  ? 436 LEU 1 CD1   1 
ATOM   3391  C  CD2   . LEU A  1  436 ? 20.346   -5.721   389.337 1.00 75.07  ? 436 LEU 1 CD2   1 
ATOM   3392  N  N     . TRP A  1  437 ? 24.239   -7.743   393.074 1.00 71.80  ? 437 TRP 1 N     1 
ATOM   3393  C  CA    . TRP A  1  437 ? 24.208   -8.805   394.064 1.00 72.78  ? 437 TRP 1 CA    1 
ATOM   3394  C  C     . TRP A  1  437 ? 25.376   -8.675   395.035 1.00 72.82  ? 437 TRP 1 C     1 
ATOM   3395  O  O     . TRP A  1  437 ? 26.416   -8.087   394.716 1.00 69.85  ? 437 TRP 1 O     1 
ATOM   3396  C  CB    . TRP A  1  437 ? 24.198   -10.187  393.387 1.00 71.37  ? 437 TRP 1 CB    1 
ATOM   3397  C  CG    . TRP A  1  437 ? 25.523   -10.796  393.117 1.00 69.11  ? 437 TRP 1 CG    1 
ATOM   3398  C  CD1   . TRP A  1  437 ? 26.599   -10.205  392.519 1.00 70.14  ? 437 TRP 1 CD1   1 
ATOM   3399  C  CD2   . TRP A  1  437 ? 25.920   -12.135  393.427 1.00 64.45  ? 437 TRP 1 CD2   1 
ATOM   3400  N  NE1   . TRP A  1  437 ? 27.645   -11.097  392.446 1.00 69.32  ? 437 TRP 1 NE1   1 
ATOM   3401  C  CE2   . TRP A  1  437 ? 27.252   -12.288  392.998 1.00 65.02  ? 437 TRP 1 CE2   1 
ATOM   3402  C  CE3   . TRP A  1  437 ? 25.281   -13.215  394.033 1.00 60.82  ? 437 TRP 1 CE3   1 
ATOM   3403  C  CZ2   . TRP A  1  437 ? 27.952   -13.477  393.154 1.00 62.08  ? 437 TRP 1 CZ2   1 
ATOM   3404  C  CZ3   . TRP A  1  437 ? 25.979   -14.393  394.187 1.00 60.76  ? 437 TRP 1 CZ3   1 
ATOM   3405  C  CH2   . TRP A  1  437 ? 27.300   -14.516  393.751 1.00 61.05  ? 437 TRP 1 CH2   1 
ATOM   3406  N  N     . ARG A  1  438 ? 25.158   -9.193   396.245 1.00 75.95  ? 438 ARG 1 N     1 
ATOM   3407  C  CA    . ARG A  1  438 ? 26.166   -9.224   397.305 1.00 75.53  ? 438 ARG 1 CA    1 
ATOM   3408  C  C     . ARG A  1  438 ? 26.488   -10.671  397.732 1.00 68.48  ? 438 ARG 1 C     1 
ATOM   3409  O  O     . ARG A  1  438 ? 26.436   -11.610  396.941 1.00 65.59  ? 438 ARG 1 O     1 
ATOM   3410  C  CB    . ARG A  1  438 ? 25.696   -8.405   398.517 1.00 79.35  ? 438 ARG 1 CB    1 
ATOM   3411  C  CG    . ARG A  1  438 ? 25.081   -7.036   398.188 1.00 80.40  ? 438 ARG 1 CG    1 
ATOM   3412  C  CD    . ARG A  1  438 ? 23.552   -7.097   398.150 1.00 81.65  ? 438 ARG 1 CD    1 
ATOM   3413  N  NE    . ARG A  1  438 ? 22.939   -5.771   398.162 1.00 82.64  ? 438 ARG 1 NE    1 
ATOM   3414  C  CZ    . ARG A  1  438 ? 21.629   -5.543   398.125 1.00 85.50  ? 438 ARG 1 CZ    1 
ATOM   3415  N  NH1   . ARG A  1  438 ? 20.769   -6.550   398.081 1.00 87.08  ? 438 ARG 1 NH1   1 
ATOM   3416  N  NH2   . ARG A  1  438 ? 21.177   -4.300   398.140 1.00 87.42  ? 438 ARG 1 NH2   1 
ATOM   3417  O  OXT   . ARG A  1  438 ? 26.822   -10.961  398.880 1.00 64.96  ? 438 ARG 1 OXT   1 
ATOM   3418  N  N     . PHE B  2  3   ? 17.089   -51.866  384.661 1.00 16.32  ? 3   PHE 2 N     1 
ATOM   3419  C  CA    . PHE B  2  3   ? 16.934   -50.786  385.619 1.00 16.93  ? 3   PHE 2 CA    1 
ATOM   3420  C  C     . PHE B  2  3   ? 15.578   -50.880  386.297 1.00 16.41  ? 3   PHE 2 C     1 
ATOM   3421  O  O     . PHE B  2  3   ? 15.492   -50.825  387.517 1.00 16.46  ? 3   PHE 2 O     1 
ATOM   3422  C  CB    . PHE B  2  3   ? 17.112   -49.434  384.934 1.00 30.82  ? 3   PHE 2 CB    1 
ATOM   3423  C  CG    . PHE B  2  3   ? 16.840   -48.243  385.833 1.00 43.55  ? 3   PHE 2 CG    1 
ATOM   3424  C  CD1   . PHE B  2  3   ? 17.824   -47.759  386.682 1.00 47.50  ? 3   PHE 2 CD1   1 
ATOM   3425  C  CD2   . PHE B  2  3   ? 15.618   -47.590  385.806 1.00 43.47  ? 3   PHE 2 CD2   1 
ATOM   3426  C  CE1   . PHE B  2  3   ? 17.581   -46.662  387.504 1.00 44.46  ? 3   PHE 2 CE1   1 
ATOM   3427  C  CE2   . PHE B  2  3   ? 15.381   -46.498  386.629 1.00 40.98  ? 3   PHE 2 CE2   1 
ATOM   3428  C  CZ    . PHE B  2  3   ? 16.362   -46.038  387.473 1.00 40.34  ? 3   PHE 2 CZ    1 
ATOM   3429  N  N     . PHE B  2  4   ? 14.507   -50.937  385.512 1.00 18.18  ? 4   PHE 2 N     1 
ATOM   3430  C  CA    . PHE B  2  4   ? 13.171   -51.134  386.064 1.00 26.30  ? 4   PHE 2 CA    1 
ATOM   3431  C  C     . PHE B  2  4   ? 12.841   -52.607  386.270 1.00 34.46  ? 4   PHE 2 C     1 
ATOM   3432  O  O     . PHE B  2  4   ? 11.755   -52.929  386.766 1.00 35.91  ? 4   PHE 2 O     1 
ATOM   3433  C  CB    . PHE B  2  4   ? 12.114   -50.482  385.169 1.00 33.43  ? 4   PHE 2 CB    1 
ATOM   3434  C  CG    . PHE B  2  4   ? 11.926   -49.007  385.419 1.00 35.47  ? 4   PHE 2 CG    1 
ATOM   3435  C  CD1   . PHE B  2  4   ? 11.329   -48.559  386.587 1.00 35.33  ? 4   PHE 2 CD1   1 
ATOM   3436  C  CD2   . PHE B  2  4   ? 12.356   -48.064  384.495 1.00 35.62  ? 4   PHE 2 CD2   1 
ATOM   3437  C  CE1   . PHE B  2  4   ? 11.148   -47.205  386.819 1.00 33.38  ? 4   PHE 2 CE1   1 
ATOM   3438  C  CE2   . PHE B  2  4   ? 12.178   -46.710  384.732 1.00 33.13  ? 4   PHE 2 CE2   1 
ATOM   3439  C  CZ    . PHE B  2  4   ? 11.575   -46.289  385.894 1.00 32.86  ? 4   PHE 2 CZ    1 
ATOM   3440  N  N     . ASP B  2  5   ? 13.740   -53.500  385.852 1.00 34.41  ? 5   ASP 2 N     1 
ATOM   3441  C  CA    . ASP B  2  5   ? 13.640   -54.906  386.218 1.00 35.96  ? 5   ASP 2 CA    1 
ATOM   3442  C  C     . ASP B  2  5   ? 13.600   -55.057  387.732 1.00 44.85  ? 5   ASP 2 C     1 
ATOM   3443  O  O     . ASP B  2  5   ? 12.766   -55.786  388.282 1.00 48.38  ? 5   ASP 2 O     1 
ATOM   3444  C  CB    . ASP B  2  5   ? 14.842   -55.656  385.636 1.00 30.36  ? 5   ASP 2 CB    1 
ATOM   3445  C  CG    . ASP B  2  5   ? 15.001   -55.432  384.129 1.00 31.10  ? 5   ASP 2 CG    1 
ATOM   3446  O  OD1   . ASP B  2  5   ? 14.037   -54.977  383.476 1.00 32.53  ? 5   ASP 2 OD1   1 
ATOM   3447  O  OD2   . ASP B  2  5   ? 16.101   -55.676  383.591 1.00 29.93  ? 5   ASP 2 OD2   1 
ATOM   3448  N  N     . ASP B  2  6   ? 14.482   -54.327  388.417 1.00 48.09  ? 6   ASP 2 N     1 
ATOM   3449  C  CA    . ASP B  2  6   ? 14.662   -54.427  389.862 1.00 50.74  ? 6   ASP 2 CA    1 
ATOM   3450  C  C     . ASP B  2  6   ? 13.367   -54.187  390.633 1.00 49.21  ? 6   ASP 2 C     1 
ATOM   3451  O  O     . ASP B  2  6   ? 12.941   -55.024  391.433 1.00 53.05  ? 6   ASP 2 O     1 
ATOM   3452  C  CB    . ASP B  2  6   ? 15.738   -53.435  390.298 1.00 54.29  ? 6   ASP 2 CB    1 
ATOM   3453  C  CG    . ASP B  2  6   ? 16.513   -53.914  391.493 1.00 60.33  ? 6   ASP 2 CG    1 
ATOM   3454  O  OD1   . ASP B  2  6   ? 15.938   -54.654  392.319 1.00 63.24  ? 6   ASP 2 OD1   1 
ATOM   3455  O  OD2   . ASP B  2  6   ? 17.695   -53.542  391.612 1.00 62.42  ? 6   ASP 2 OD2   1 
ATOM   3456  N  N     . LYS B  2  7   ? 12.722   -53.051  390.405 1.00 47.97  ? 7   LYS 2 N     1 
ATOM   3457  C  CA    . LYS B  2  7   ? 11.632   -52.603  391.274 1.00 52.61  ? 7   LYS 2 CA    1 
ATOM   3458  C  C     . LYS B  2  7   ? 10.288   -52.847  390.586 1.00 58.14  ? 7   LYS 2 C     1 
ATOM   3459  O  O     . LYS B  2  7   ? 9.760    -51.992  389.874 1.00 56.99  ? 7   LYS 2 O     1 
ATOM   3460  C  CB    . LYS B  2  7   ? 11.821   -51.137  391.660 1.00 53.79  ? 7   LYS 2 CB    1 
ATOM   3461  C  CG    . LYS B  2  7   ? 12.018   -50.164  390.493 1.00 49.91  ? 7   LYS 2 CG    1 
ATOM   3462  C  CD    . LYS B  2  7   ? 13.143   -49.162  390.736 1.00 41.84  ? 7   LYS 2 CD    1 
ATOM   3463  C  CE    . LYS B  2  7   ? 14.465   -49.826  391.036 1.00 35.42  ? 7   LYS 2 CE    1 
ATOM   3464  N  NZ    . LYS B  2  7   ? 15.588   -48.882  390.819 1.00 32.47  ? 7   LYS 2 NZ    1 
ATOM   3465  N  N     . GLN B  2  8   ? 9.712    -54.030  390.825 1.00 62.56  ? 8   GLN 2 N     1 
ATOM   3466  C  CA    . GLN B  2  8   ? 8.384    -54.331  390.301 1.00 65.63  ? 8   GLN 2 CA    1 
ATOM   3467  C  C     . GLN B  2  8   ? 7.279    -53.877  391.240 1.00 65.36  ? 8   GLN 2 C     1 
ATOM   3468  O  O     . GLN B  2  8   ? 6.168    -53.569  390.781 1.00 66.92  ? 8   GLN 2 O     1 
ATOM   3469  C  CB    . GLN B  2  8   ? 8.232    -55.832  390.031 1.00 69.19  ? 8   GLN 2 CB    1 
ATOM   3470  C  CG    . GLN B  2  8   ? 9.045    -56.340  388.851 1.00 72.46  ? 8   GLN 2 CG    1 
ATOM   3471  C  CD    . GLN B  2  8   ? 8.227    -56.388  387.574 1.00 75.03  ? 8   GLN 2 CD    1 
ATOM   3472  O  OE1   . GLN B  2  8   ? 7.031    -56.091  387.580 1.00 75.34  ? 8   GLN 2 OE1   1 
ATOM   3473  N  NE2   . GLN B  2  8   ? 8.864    -56.771  386.475 1.00 76.01  ? 8   GLN 2 NE2   1 
ATOM   3474  N  N     . ASP B  2  9   ? 7.562    -53.830  392.545 1.00 63.81  ? 9   ASP 2 N     1 
ATOM   3475  C  CA    . ASP B  2  9   ? 6.605    -53.267  393.489 1.00 64.83  ? 9   ASP 2 CA    1 
ATOM   3476  C  C     . ASP B  2  9   ? 6.319    -51.819  393.133 1.00 56.89  ? 9   ASP 2 C     1 
ATOM   3477  O  O     . ASP B  2  9   ? 5.173    -51.359  393.204 1.00 56.13  ? 9   ASP 2 O     1 
ATOM   3478  C  CB    . ASP B  2  9   ? 7.156    -53.335  394.913 1.00 72.63  ? 9   ASP 2 CB    1 
ATOM   3479  C  CG    . ASP B  2  9   ? 8.606    -52.870  395.000 1.00 81.51  ? 9   ASP 2 CG    1 
ATOM   3480  O  OD1   . ASP B  2  9   ? 9.338    -52.978  393.992 1.00 85.02  ? 9   ASP 2 OD1   1 
ATOM   3481  O  OD2   . ASP B  2  9   ? 9.010    -52.373  396.072 1.00 84.61  ? 9   ASP 2 OD2   1 
ATOM   3482  N  N     . PHE B  2  10  ? 7.361    -51.090  392.730 1.00 48.45  ? 10  PHE 2 N     1 
ATOM   3483  C  CA    . PHE B  2  10  ? 7.179    -49.708  392.316 1.00 37.48  ? 10  PHE 2 CA    1 
ATOM   3484  C  C     . PHE B  2  10  ? 6.384    -49.620  391.022 1.00 35.99  ? 10  PHE 2 C     1 
ATOM   3485  O  O     . PHE B  2  10  ? 5.515    -48.751  390.878 1.00 37.56  ? 10  PHE 2 O     1 
ATOM   3486  C  CB    . PHE B  2  10  ? 8.536    -49.019  392.171 1.00 30.13  ? 10  PHE 2 CB    1 
ATOM   3487  C  CG    . PHE B  2  10  ? 8.447    -47.657  391.559 1.00 26.28  ? 10  PHE 2 CG    1 
ATOM   3488  C  CD1   . PHE B  2  10  ? 7.928    -46.605  392.279 1.00 17.11  ? 10  PHE 2 CD1   1 
ATOM   3489  C  CD2   . PHE B  2  10  ? 8.886    -47.434  390.274 1.00 20.03  ? 10  PHE 2 CD2   1 
ATOM   3490  C  CE1   . PHE B  2  10  ? 7.837    -45.366  391.724 1.00 19.72  ? 10  PHE 2 CE1   1 
ATOM   3491  C  CE2   . PHE B  2  10  ? 8.790    -46.190  389.715 1.00 17.56  ? 10  PHE 2 CE2   1 
ATOM   3492  C  CZ    . PHE B  2  10  ? 8.268    -45.156  390.442 1.00 18.59  ? 10  PHE 2 CZ    1 
ATOM   3493  N  N     . LEU B  2  11  ? 6.630    -50.536  390.087 1.00 34.24  ? 11  LEU 2 N     1 
ATOM   3494  C  CA    . LEU B  2  11  ? 5.875    -50.510  388.841 1.00 37.04  ? 11  LEU 2 CA    1 
ATOM   3495  C  C     . LEU B  2  11  ? 4.393    -50.714  389.106 1.00 46.14  ? 11  LEU 2 C     1 
ATOM   3496  O  O     . LEU B  2  11  ? 3.551    -49.985  388.573 1.00 46.56  ? 11  LEU 2 O     1 
ATOM   3497  C  CB    . LEU B  2  11  ? 6.406    -51.571  387.872 1.00 30.91  ? 11  LEU 2 CB    1 
ATOM   3498  C  CG    . LEU B  2  11  ? 7.861    -51.364  387.462 1.00 26.59  ? 11  LEU 2 CG    1 
ATOM   3499  C  CD1   . LEU B  2  11  ? 8.383    -52.539  386.655 1.00 23.42  ? 11  LEU 2 CD1   1 
ATOM   3500  C  CD2   . LEU B  2  11  ? 7.972    -50.071  386.665 1.00 26.97  ? 11  LEU 2 CD2   1 
ATOM   3501  N  N     . GLU B  2  12  ? 4.055    -51.697  389.942 1.00 55.02  ? 12  GLU 2 N     1 
ATOM   3502  C  CA    . GLU B  2  12  ? 2.654    -51.900  390.294 1.00 58.48  ? 12  GLU 2 CA    1 
ATOM   3503  C  C     . GLU B  2  12  ? 2.084    -50.684  391.018 1.00 56.70  ? 12  GLU 2 C     1 
ATOM   3504  O  O     . GLU B  2  12  ? 0.991    -50.206  390.687 1.00 54.98  ? 12  GLU 2 O     1 
ATOM   3505  C  CB    . GLU B  2  12  ? 2.494    -53.162  391.138 1.00 59.53  ? 12  GLU 2 CB    1 
ATOM   3506  C  CG    . GLU B  2  12  ? 2.577    -54.430  390.326 1.00 62.71  ? 12  GLU 2 CG    1 
ATOM   3507  C  CD    . GLU B  2  12  ? 1.671    -55.492  390.885 1.00 70.42  ? 12  GLU 2 CD    1 
ATOM   3508  O  OE1   . GLU B  2  12  ? 0.643    -55.099  391.474 1.00 72.74  ? 12  GLU 2 OE1   1 
ATOM   3509  O  OE2   . GLU B  2  12  ? 1.968    -56.699  390.743 1.00 74.01  ? 12  GLU 2 OE2   1 
ATOM   3510  N  N     . GLU B  2  13  ? 2.826    -50.155  391.997 1.00 54.42  ? 13  GLU 2 N     1 
ATOM   3511  C  CA    . GLU B  2  13  ? 2.336    -49.018  392.769 1.00 55.49  ? 13  GLU 2 CA    1 
ATOM   3512  C  C     . GLU B  2  13  ? 2.001    -47.842  391.854 1.00 56.87  ? 13  GLU 2 C     1 
ATOM   3513  O  O     . GLU B  2  13  ? 0.999    -47.149  392.066 1.00 56.67  ? 13  GLU 2 O     1 
ATOM   3514  C  CB    . GLU B  2  13  ? 3.379    -48.620  393.825 1.00 54.34  ? 13  GLU 2 CB    1 
ATOM   3515  C  CG    . GLU B  2  13  ? 3.068    -47.328  394.601 1.00 50.93  ? 13  GLU 2 CG    1 
ATOM   3516  C  CD    . GLU B  2  13  ? 3.941    -47.143  395.845 1.00 43.14  ? 13  GLU 2 CD    1 
ATOM   3517  O  OE1   . GLU B  2  13  ? 4.996    -47.803  395.951 1.00 39.16  ? 13  GLU 2 OE1   1 
ATOM   3518  O  OE2   . GLU B  2  13  ? 3.550    -46.360  396.737 1.00 40.19  ? 13  GLU 2 OE2   1 
ATOM   3519  N  N     . THR B  2  14  ? 2.805    -47.632  390.807 1.00 56.98  ? 14  THR 2 N     1 
ATOM   3520  C  CA    . THR B  2  14  ? 2.576    -46.507  389.900 1.00 56.01  ? 14  THR 2 CA    1 
ATOM   3521  C  C     . THR B  2  14  ? 1.460    -46.803  388.897 1.00 54.06  ? 14  THR 2 C     1 
ATOM   3522  O  O     . THR B  2  14  ? 0.546    -45.987  388.711 1.00 50.22  ? 14  THR 2 O     1 
ATOM   3523  C  CB    . THR B  2  14  ? 3.875    -46.139  389.172 1.00 53.49  ? 14  THR 2 CB    1 
ATOM   3524  O  OG1   . THR B  2  14  ? 4.433    -47.306  388.553 1.00 53.74  ? 14  THR 2 OG1   1 
ATOM   3525  C  CG2   . THR B  2  14  ? 4.875    -45.562  390.141 1.00 50.02  ? 14  THR 2 CG2   1 
ATOM   3526  N  N     . PHE B  2  15  ? 1.504    -47.978  388.261 1.00 51.45  ? 15  PHE 2 N     1 
ATOM   3527  C  CA    . PHE B  2  15  ? 0.559    -48.305  387.199 1.00 51.41  ? 15  PHE 2 CA    1 
ATOM   3528  C  C     . PHE B  2  15  ? -0.849   -48.555  387.726 1.00 53.60  ? 15  PHE 2 C     1 
ATOM   3529  O  O     . PHE B  2  15  ? -1.806   -48.509  386.941 1.00 51.53  ? 15  PHE 2 O     1 
ATOM   3530  C  CB    . PHE B  2  15  ? 1.042    -49.539  386.436 1.00 48.79  ? 15  PHE 2 CB    1 
ATOM   3531  C  CG    . PHE B  2  15  ? 2.091    -49.258  385.391 1.00 46.19  ? 15  PHE 2 CG    1 
ATOM   3532  C  CD1   . PHE B  2  15  ? 1.781    -48.534  384.256 1.00 42.80  ? 15  PHE 2 CD1   1 
ATOM   3533  C  CD2   . PHE B  2  15  ? 3.377    -49.748  385.525 1.00 46.88  ? 15  PHE 2 CD2   1 
ATOM   3534  C  CE1   . PHE B  2  15  ? 2.740    -48.300  383.288 1.00 42.71  ? 15  PHE 2 CE1   1 
ATOM   3535  C  CE2   . PHE B  2  15  ? 4.336    -49.505  384.554 1.00 45.53  ? 15  PHE 2 CE2   1 
ATOM   3536  C  CZ    . PHE B  2  15  ? 4.013    -48.781  383.443 1.00 42.66  ? 15  PHE 2 CZ    1 
ATOM   3537  N  N     . ALA B  2  16  ? -0.995   -48.850  389.022 1.00 57.13  ? 16  ALA 2 N     1 
ATOM   3538  C  CA    . ALA B  2  16  ? -2.318   -48.962  389.624 1.00 55.79  ? 16  ALA 2 CA    1 
ATOM   3539  C  C     . ALA B  2  16  ? -2.950   -47.602  389.897 1.00 57.50  ? 16  ALA 2 C     1 
ATOM   3540  O  O     . ALA B  2  16  ? -4.156   -47.537  390.164 1.00 60.54  ? 16  ALA 2 O     1 
ATOM   3541  C  CB    . ALA B  2  16  ? -2.247   -49.775  390.922 1.00 54.71  ? 16  ALA 2 CB    1 
ATOM   3542  N  N     . LYS B  2  17  ? -2.176   -46.516  389.815 1.00 48.36  ? 17  LYS 2 N     1 
ATOM   3543  C  CA    . LYS B  2  17  ? -2.764   -45.194  389.964 1.00 41.95  ? 17  LYS 2 CA    1 
ATOM   3544  C  C     . LYS B  2  17  ? -3.512   -44.743  388.719 1.00 37.19  ? 17  LYS 2 C     1 
ATOM   3545  O  O     . LYS B  2  17  ? -4.349   -43.844  388.814 1.00 37.63  ? 17  LYS 2 O     1 
ATOM   3546  C  CB    . LYS B  2  17  ? -1.686   -44.163  390.286 1.00 44.29  ? 17  LYS 2 CB    1 
ATOM   3547  C  CG    . LYS B  2  17  ? -0.838   -44.493  391.489 1.00 47.71  ? 17  LYS 2 CG    1 
ATOM   3548  C  CD    . LYS B  2  17  ? 0.418    -43.633  391.506 1.00 49.16  ? 17  LYS 2 CD    1 
ATOM   3549  C  CE    . LYS B  2  17  ? 1.361    -44.077  392.616 1.00 48.28  ? 17  LYS 2 CE    1 
ATOM   3550  N  NZ    . LYS B  2  17  ? 2.668    -43.380  392.532 1.00 47.29  ? 17  LYS 2 NZ    1 
ATOM   3551  N  N     . TYR B  2  18  ? -3.261   -45.360  387.571 1.00 35.47  ? 18  TYR 2 N     1 
ATOM   3552  C  CA    . TYR B  2  18  ? -3.807   -44.919  386.297 1.00 34.09  ? 18  TYR 2 CA    1 
ATOM   3553  C  C     . TYR B  2  18  ? -4.749   -45.979  385.731 1.00 28.75  ? 18  TYR 2 C     1 
ATOM   3554  O  O     . TYR B  2  18  ? -4.643   -47.162  386.082 1.00 27.05  ? 18  TYR 2 O     1 
ATOM   3555  C  CB    . TYR B  2  18  ? -2.684   -44.640  385.284 1.00 37.23  ? 18  TYR 2 CB    1 
ATOM   3556  C  CG    . TYR B  2  18  ? -1.554   -43.831  385.868 1.00 41.90  ? 18  TYR 2 CG    1 
ATOM   3557  C  CD1   . TYR B  2  18  ? -1.747   -42.508  386.225 1.00 47.72  ? 18  TYR 2 CD1   1 
ATOM   3558  C  CD2   . TYR B  2  18  ? -0.305   -44.395  386.101 1.00 43.84  ? 18  TYR 2 CD2   1 
ATOM   3559  C  CE1   . TYR B  2  18  ? -0.723   -41.748  386.780 1.00 52.43  ? 18  TYR 2 CE1   1 
ATOM   3560  C  CE2   . TYR B  2  18  ? 0.732    -43.643  386.661 1.00 48.96  ? 18  TYR 2 CE2   1 
ATOM   3561  C  CZ    . TYR B  2  18  ? 0.511    -42.314  386.999 1.00 54.83  ? 18  TYR 2 CZ    1 
ATOM   3562  O  OH    . TYR B  2  18  ? 1.507    -41.535  387.557 1.00 59.36  ? 18  TYR 2 OH    1 
ATOM   3563  N  N     . PRO B  2  19  ? -5.705   -45.581  384.892 1.00 23.54  ? 19  PRO 2 N     1 
ATOM   3564  C  CA    . PRO B  2  19  ? -6.608   -46.564  384.309 1.00 20.50  ? 19  PRO 2 CA    1 
ATOM   3565  C  C     . PRO B  2  19  ? -5.824   -47.596  383.526 1.00 23.20  ? 19  PRO 2 C     1 
ATOM   3566  O  O     . PRO B  2  19  ? -4.724   -47.309  383.016 1.00 25.59  ? 19  PRO 2 O     1 
ATOM   3567  C  CB    . PRO B  2  19  ? -7.500   -45.719  383.389 1.00 19.26  ? 19  PRO 2 CB    1 
ATOM   3568  C  CG    . PRO B  2  19  ? -7.498   -44.376  384.024 1.00 18.27  ? 19  PRO 2 CG    1 
ATOM   3569  C  CD    . PRO B  2  19  ? -6.111   -44.201  384.571 1.00 27.04  ? 19  PRO 2 CD    1 
ATOM   3570  N  N     . PRO B  2  20  ? -6.350   -48.819  383.403 1.00 27.21  ? 20  PRO 2 N     1 
ATOM   3571  C  CA    . PRO B  2  20  ? -5.603   -49.882  382.703 1.00 31.07  ? 20  PRO 2 CA    1 
ATOM   3572  C  C     . PRO B  2  20  ? -5.265   -49.572  381.250 1.00 31.92  ? 20  PRO 2 C     1 
ATOM   3573  O  O     . PRO B  2  20  ? -4.307   -50.154  380.717 1.00 28.59  ? 20  PRO 2 O     1 
ATOM   3574  C  CB    . PRO B  2  20  ? -6.541   -51.092  382.813 1.00 30.39  ? 20  PRO 2 CB    1 
ATOM   3575  C  CG    . PRO B  2  20  ? -7.893   -50.516  383.182 1.00 28.22  ? 20  PRO 2 CG    1 
ATOM   3576  C  CD    . PRO B  2  20  ? -7.595   -49.317  384.006 1.00 27.39  ? 20  PRO 2 CD    1 
ATOM   3577  N  N     . GLU B  2  21  ? -6.014   -48.676  380.597 1.00 35.14  ? 21  GLU 2 N     1 
ATOM   3578  C  CA    . GLU B  2  21  ? -5.711   -48.225  379.245 1.00 35.30  ? 21  GLU 2 CA    1 
ATOM   3579  C  C     . GLU B  2  21  ? -4.825   -46.989  379.238 1.00 25.81  ? 21  GLU 2 C     1 
ATOM   3580  O  O     . GLU B  2  21  ? -4.323   -46.608  378.174 1.00 27.26  ? 21  GLU 2 O     1 
ATOM   3581  C  CB    . GLU B  2  21  ? -6.995   -47.883  378.481 1.00 41.36  ? 21  GLU 2 CB    1 
ATOM   3582  C  CG    . GLU B  2  21  ? -7.486   -46.456  378.729 1.00 44.52  ? 21  GLU 2 CG    1 
ATOM   3583  C  CD    . GLU B  2  21  ? -8.348   -46.323  379.961 1.00 48.55  ? 21  GLU 2 CD    1 
ATOM   3584  O  OE1   . GLU B  2  21  ? -8.397   -47.266  380.773 1.00 50.72  ? 21  GLU 2 OE1   1 
ATOM   3585  O  OE2   . GLU B  2  21  ? -8.980   -45.265  380.118 1.00 50.47  ? 21  GLU 2 OE2   1 
ATOM   3586  N  N     . GLY B  2  22  ? -4.592   -46.385  380.396 1.00 18.52  ? 22  GLY 2 N     1 
ATOM   3587  C  CA    . GLY B  2  22  ? -3.777   -45.197  380.459 1.00 18.79  ? 22  GLY 2 CA    1 
ATOM   3588  C  C     . GLY B  2  22  ? -2.437   -45.420  381.122 1.00 19.89  ? 22  GLY 2 C     1 
ATOM   3589  O  O     . GLY B  2  22  ? -1.934   -44.544  381.830 1.00 23.69  ? 22  GLY 2 O     1 
ATOM   3590  N  N     . ARG B  2  23  ? -1.857   -46.602  380.904 1.00 23.20  ? 23  ARG 2 N     1 
ATOM   3591  C  CA    . ARG B  2  23  ? -0.549   -46.916  381.465 1.00 22.79  ? 23  ARG 2 CA    1 
ATOM   3592  C  C     . ARG B  2  23  ? 0.489    -45.895  381.041 1.00 28.21  ? 23  ARG 2 C     1 
ATOM   3593  O  O     . ARG B  2  23  ? 1.453    -45.651  381.772 1.00 29.44  ? 23  ARG 2 O     1 
ATOM   3594  C  CB    . ARG B  2  23  ? -0.128   -48.323  381.033 1.00 23.86  ? 23  ARG 2 CB    1 
ATOM   3595  C  CG    . ARG B  2  23  ? -1.314   -49.209  380.614 1.00 26.71  ? 23  ARG 2 CG    1 
ATOM   3596  C  CD    . ARG B  2  23  ? -0.981   -50.688  380.608 1.00 27.63  ? 23  ARG 2 CD    1 
ATOM   3597  N  NE    . ARG B  2  23  ? -0.320   -51.109  381.835 1.00 32.93  ? 23  ARG 2 NE    1 
ATOM   3598  C  CZ    . ARG B  2  23  ? 0.825    -51.786  381.861 1.00 38.46  ? 23  ARG 2 CZ    1 
ATOM   3599  N  NH1   . ARG B  2  23  ? 1.428    -52.118  380.724 1.00 40.04  ? 23  ARG 2 NH1   1 
ATOM   3600  N  NH2   . ARG B  2  23  ? 1.365    -52.138  383.020 1.00 40.64  ? 23  ARG 2 NH2   1 
ATOM   3601  N  N     . ARG B  2  24  ? 0.297    -45.286  379.863 1.00 35.59  ? 24  ARG 2 N     1 
ATOM   3602  C  CA    . ARG B  2  24  ? 1.254    -44.346  379.282 1.00 40.85  ? 24  ARG 2 CA    1 
ATOM   3603  C  C     . ARG B  2  24  ? 1.462    -43.093  380.127 1.00 34.43  ? 24  ARG 2 C     1 
ATOM   3604  O  O     . ARG B  2  24  ? 2.531    -42.486  380.052 1.00 23.19  ? 24  ARG 2 O     1 
ATOM   3605  C  CB    . ARG B  2  24  ? 0.794    -43.984  377.866 1.00 52.80  ? 24  ARG 2 CB    1 
ATOM   3606  C  CG    . ARG B  2  24  ? 0.755    -45.190  376.912 1.00 64.95  ? 24  ARG 2 CG    1 
ATOM   3607  C  CD    . ARG B  2  24  ? 0.382    -44.748  375.507 1.00 75.37  ? 24  ARG 2 CD    1 
ATOM   3608  N  NE    . ARG B  2  24  ? 1.423    -43.938  374.881 1.00 82.40  ? 24  ARG 2 NE    1 
ATOM   3609  C  CZ    . ARG B  2  24  ? 1.327    -42.623  374.700 1.00 82.86  ? 24  ARG 2 CZ    1 
ATOM   3610  N  NH1   . ARG B  2  24  ? 0.245    -41.976  375.114 1.00 80.48  ? 24  ARG 2 NH1   1 
ATOM   3611  N  NH2   . ARG B  2  24  ? 2.311    -41.953  374.111 1.00 82.97  ? 24  ARG 2 NH2   1 
ATOM   3612  N  N     . ALA B  2  25  ? 0.488    -42.715  380.953 1.00 28.93  ? 25  ALA 2 N     1 
ATOM   3613  C  CA    . ALA B  2  25  ? 0.716    -41.646  381.917 1.00 29.15  ? 25  ALA 2 CA    1 
ATOM   3614  C  C     . ALA B  2  25  ? 1.964    -41.930  382.754 1.00 30.69  ? 25  ALA 2 C     1 
ATOM   3615  O  O     . ALA B  2  25  ? 2.772    -41.027  383.022 1.00 38.74  ? 25  ALA 2 O     1 
ATOM   3616  C  CB    . ALA B  2  25  ? -0.516   -41.484  382.809 1.00 29.26  ? 25  ALA 2 CB    1 
ATOM   3617  N  N     . ALA B  2  26  ? 2.149    -43.193  383.152 1.00 25.91  ? 26  ALA 2 N     1 
ATOM   3618  C  CA    . ALA B  2  26  ? 3.288    -43.600  383.963 1.00 23.33  ? 26  ALA 2 CA    1 
ATOM   3619  C  C     . ALA B  2  26  ? 4.627    -43.339  383.288 1.00 24.29  ? 26  ALA 2 C     1 
ATOM   3620  O  O     . ALA B  2  26  ? 5.660    -43.497  383.943 1.00 23.57  ? 26  ALA 2 O     1 
ATOM   3621  C  CB    . ALA B  2  26  ? 3.181    -45.075  384.326 1.00 23.29  ? 26  ALA 2 CB    1 
ATOM   3622  N  N     . ILE B  2  27  ? 4.644    -42.963  382.002 1.00 26.13  ? 27  ILE 2 N     1 
ATOM   3623  C  CA    . ILE B  2  27  ? 5.902    -42.572  381.363 1.00 26.99  ? 27  ILE 2 CA    1 
ATOM   3624  C  C     . ILE B  2  27  ? 6.512    -41.375  382.083 1.00 24.71  ? 27  ILE 2 C     1 
ATOM   3625  O  O     . ILE B  2  27  ? 7.737    -41.260  382.192 1.00 25.81  ? 27  ILE 2 O     1 
ATOM   3626  C  CB    . ILE B  2  27  ? 5.686    -42.268  379.863 1.00 25.43  ? 27  ILE 2 CB    1 
ATOM   3627  C  CG1   . ILE B  2  27  ? 5.116    -43.492  379.145 1.00 27.07  ? 27  ILE 2 CG1   1 
ATOM   3628  C  CG2   . ILE B  2  27  ? 7.005    -41.817  379.196 1.00 23.63  ? 27  ILE 2 CG2   1 
ATOM   3629  C  CD1   . ILE B  2  27  ? 4.598    -43.209  377.746 1.00 29.85  ? 27  ILE 2 CD1   1 
ATOM   3630  N  N     . MET B  2  28  ? 5.674    -40.464  382.593 1.00 23.63  ? 28  MET 2 N     1 
ATOM   3631  C  CA    . MET B  2  28  ? 6.241    -39.299  383.270 1.00 29.41  ? 28  MET 2 CA    1 
ATOM   3632  C  C     . MET B  2  28  ? 6.939    -39.647  384.580 1.00 30.82  ? 28  MET 2 C     1 
ATOM   3633  O  O     . MET B  2  28  ? 8.106    -39.253  384.749 1.00 27.12  ? 28  MET 2 O     1 
ATOM   3634  C  CB    . MET B  2  28  ? 5.179    -38.207  383.436 1.00 33.70  ? 28  MET 2 CB    1 
ATOM   3635  C  CG    . MET B  2  28  ? 4.727    -37.588  382.122 1.00 35.68  ? 28  MET 2 CG    1 
ATOM   3636  S  SD    . MET B  2  28  ? 4.635    -35.778  382.286 1.00 37.48  ? 28  MET 2 SD    1 
ATOM   3637  C  CE    . MET B  2  28  ? 6.322    -35.354  382.687 1.00 34.03  ? 28  MET 2 CE    1 
ATOM   3638  N  N     . PRO B  2  29  ? 6.331    -40.375  385.527 1.00 30.81  ? 29  PRO 2 N     1 
ATOM   3639  C  CA    . PRO B  2  29  ? 7.061    -40.659  386.780 1.00 29.92  ? 29  PRO 2 CA    1 
ATOM   3640  C  C     . PRO B  2  29  ? 8.192    -41.661  386.615 1.00 27.55  ? 29  PRO 2 C     1 
ATOM   3641  O  O     . PRO B  2  29  ? 9.226    -41.536  387.289 1.00 25.83  ? 29  PRO 2 O     1 
ATOM   3642  C  CB    . PRO B  2  29  ? 5.964    -41.189  387.714 1.00 30.77  ? 29  PRO 2 CB    1 
ATOM   3643  C  CG    . PRO B  2  29  ? 4.904    -41.685  386.816 1.00 32.78  ? 29  PRO 2 CG    1 
ATOM   3644  C  CD    . PRO B  2  29  ? 4.921    -40.796  385.613 1.00 34.71  ? 29  PRO 2 CD    1 
ATOM   3645  N  N     . LEU B  2  30  ? 8.016    -42.671  385.757 1.00 30.81  ? 30  LEU 2 N     1 
ATOM   3646  C  CA    . LEU B  2  30  ? 9.045    -43.694  385.588 1.00 38.56  ? 30  LEU 2 CA    1 
ATOM   3647  C  C     . LEU B  2  30  ? 10.361   -43.068  385.145 1.00 45.59  ? 30  LEU 2 C     1 
ATOM   3648  O  O     . LEU B  2  30  ? 11.413   -43.314  385.748 1.00 48.32  ? 30  LEU 2 O     1 
ATOM   3649  C  CB    . LEU B  2  30  ? 8.581    -44.746  384.577 1.00 41.71  ? 30  LEU 2 CB    1 
ATOM   3650  C  CG    . LEU B  2  30  ? 7.415    -45.662  384.969 1.00 44.50  ? 30  LEU 2 CG    1 
ATOM   3651  C  CD1   . LEU B  2  30  ? 7.130    -46.692  383.865 1.00 43.06  ? 30  LEU 2 CD1   1 
ATOM   3652  C  CD2   . LEU B  2  30  ? 7.654    -46.335  386.326 1.00 45.11  ? 30  LEU 2 CD2   1 
ATOM   3653  N  N     . LEU B  2  31  ? 10.311   -42.237  384.098 1.00 46.79  ? 31  LEU 2 N     1 
ATOM   3654  C  CA    . LEU B  2  31  ? 11.480   -41.462  383.685 1.00 45.90  ? 31  LEU 2 CA    1 
ATOM   3655  C  C     . LEU B  2  31  ? 12.153   -40.810  384.882 1.00 50.60  ? 31  LEU 2 C     1 
ATOM   3656  O  O     . LEU B  2  31  ? 13.378   -40.872  385.035 1.00 52.38  ? 31  LEU 2 O     1 
ATOM   3657  C  CB    . LEU B  2  31  ? 11.073   -40.380  382.678 1.00 39.51  ? 31  LEU 2 CB    1 
ATOM   3658  C  CG    . LEU B  2  31  ? 10.692   -40.704  381.231 1.00 33.72  ? 31  LEU 2 CG    1 
ATOM   3659  C  CD1   . LEU B  2  31  ? 10.042   -39.473  380.615 1.00 33.00  ? 31  LEU 2 CD1   1 
ATOM   3660  C  CD2   . LEU B  2  31  ? 11.905   -41.140  380.421 1.00 30.44  ? 31  LEU 2 CD2   1 
ATOM   3661  N  N     . ARG B  2  32  ? 11.352   -40.189  385.752 1.00 53.95  ? 32  ARG 2 N     1 
ATOM   3662  C  CA    . ARG B  2  32  ? 11.901   -39.456  386.887 1.00 58.07  ? 32  ARG 2 CA    1 
ATOM   3663  C  C     . ARG B  2  32  ? 12.720   -40.365  387.794 1.00 59.18  ? 32  ARG 2 C     1 
ATOM   3664  O  O     . ARG B  2  32  ? 13.773   -39.960  388.304 1.00 59.49  ? 32  ARG 2 O     1 
ATOM   3665  C  CB    . ARG B  2  32  ? 10.775   -38.783  387.671 1.00 59.15  ? 32  ARG 2 CB    1 
ATOM   3666  C  CG    . ARG B  2  32  ? 11.239   -38.145  388.967 1.00 59.12  ? 32  ARG 2 CG    1 
ATOM   3667  C  CD    . ARG B  2  32  ? 10.163   -37.285  389.602 1.00 56.54  ? 32  ARG 2 CD    1 
ATOM   3668  N  NE    . ARG B  2  32  ? 10.013   -36.041  388.864 1.00 54.63  ? 32  ARG 2 NE    1 
ATOM   3669  C  CZ    . ARG B  2  32  ? 10.826   -35.002  389.012 1.00 54.53  ? 32  ARG 2 CZ    1 
ATOM   3670  N  NH1   . ARG B  2  32  ? 11.842   -35.065  389.860 1.00 52.03  ? 32  ARG 2 NH1   1 
ATOM   3671  N  NH2   . ARG B  2  32  ? 10.636   -33.901  388.304 1.00 58.71  ? 32  ARG 2 NH2   1 
ATOM   3672  N  N     . ARG B  2  33  ? 12.258   -41.597  388.009 1.00 61.44  ? 33  ARG 2 N     1 
ATOM   3673  C  CA    . ARG B  2  33  ? 13.048   -42.508  388.827 1.00 66.84  ? 33  ARG 2 CA    1 
ATOM   3674  C  C     . ARG B  2  33  ? 14.439   -42.684  388.242 1.00 71.87  ? 33  ARG 2 C     1 
ATOM   3675  O  O     . ARG B  2  33  ? 15.424   -42.751  388.981 1.00 74.25  ? 33  ARG 2 O     1 
ATOM   3676  C  CB    . ARG B  2  33  ? 12.339   -43.851  388.982 1.00 68.55  ? 33  ARG 2 CB    1 
ATOM   3677  C  CG    . ARG B  2  33  ? 11.503   -43.933  390.255 1.00 71.96  ? 33  ARG 2 CG    1 
ATOM   3678  C  CD    . ARG B  2  33  ? 11.790   -45.197  391.054 1.00 74.57  ? 33  ARG 2 CD    1 
ATOM   3679  N  NE    . ARG B  2  33  ? 13.134   -45.240  391.622 1.00 76.96  ? 33  ARG 2 NE    1 
ATOM   3680  C  CZ    . ARG B  2  33  ? 13.509   -46.108  392.560 1.00 78.93  ? 33  ARG 2 CZ    1 
ATOM   3681  N  NH1   . ARG B  2  33  ? 12.645   -47.005  393.026 1.00 78.27  ? 33  ARG 2 NH1   1 
ATOM   3682  N  NH2   . ARG B  2  33  ? 14.748   -46.087  393.033 1.00 80.28  ? 33  ARG 2 NH2   1 
ATOM   3683  N  N     . VAL B  2  34  ? 14.540   -42.727  386.913 1.00 74.28  ? 34  VAL 2 N     1 
ATOM   3684  C  CA    . VAL B  2  34  ? 15.846   -42.773  386.267 1.00 79.90  ? 34  VAL 2 CA    1 
ATOM   3685  C  C     . VAL B  2  34  ? 16.663   -41.538  386.638 1.00 79.25  ? 34  VAL 2 C     1 
ATOM   3686  O  O     . VAL B  2  34  ? 17.803   -41.641  387.108 1.00 81.55  ? 34  VAL 2 O     1 
ATOM   3687  C  CB    . VAL B  2  34  ? 15.677   -42.894  384.739 1.00 84.36  ? 34  VAL 2 CB    1 
ATOM   3688  C  CG1   . VAL B  2  34  ? 17.024   -43.121  384.050 1.00 87.50  ? 34  VAL 2 CG1   1 
ATOM   3689  C  CG2   . VAL B  2  34  ? 14.671   -43.989  384.382 1.00 85.12  ? 34  VAL 2 CG2   1 
ATOM   3690  N  N     . GLN B  2  35  ? 16.060   -40.354  386.488 1.00 77.81  ? 35  GLN 2 N     1 
ATOM   3691  C  CA    . GLN B  2  35  ? 16.802   -39.098  386.584 1.00 77.24  ? 35  GLN 2 CA    1 
ATOM   3692  C  C     . GLN B  2  35  ? 17.559   -38.983  387.902 1.00 79.26  ? 35  GLN 2 C     1 
ATOM   3693  O  O     . GLN B  2  35  ? 18.785   -38.833  387.919 1.00 78.47  ? 35  GLN 2 O     1 
ATOM   3694  C  CB    . GLN B  2  35  ? 15.846   -37.918  386.406 1.00 78.12  ? 35  GLN 2 CB    1 
ATOM   3695  C  CG    . GLN B  2  35  ? 16.442   -36.736  385.669 1.00 80.61  ? 35  GLN 2 CG    1 
ATOM   3696  C  CD    . GLN B  2  35  ? 17.668   -36.180  386.358 1.00 83.29  ? 35  GLN 2 CD    1 
ATOM   3697  O  OE1   . GLN B  2  35  ? 18.753   -36.125  385.778 1.00 83.68  ? 35  GLN 2 OE1   1 
ATOM   3698  N  NE2   . GLN B  2  35  ? 17.507   -35.782  387.612 1.00 84.90  ? 35  GLN 2 NE2   1 
ATOM   3699  N  N     . GLN B  2  36  ? 16.841   -39.053  389.021 1.00 82.02  ? 36  GLN 2 N     1 
ATOM   3700  C  CA    . GLN B  2  36  ? 17.480   -38.922  390.323 1.00 85.04  ? 36  GLN 2 CA    1 
ATOM   3701  C  C     . GLN B  2  36  ? 18.315   -40.145  390.706 1.00 87.08  ? 36  GLN 2 C     1 
ATOM   3702  O  O     . GLN B  2  36  ? 19.135   -40.043  391.624 1.00 90.32  ? 36  GLN 2 O     1 
ATOM   3703  C  CB    . GLN B  2  36  ? 16.418   -38.635  391.391 1.00 85.36  ? 36  GLN 2 CB    1 
ATOM   3704  C  CG    . GLN B  2  36  ? 15.720   -39.871  391.941 1.00 84.35  ? 36  GLN 2 CG    1 
ATOM   3705  C  CD    . GLN B  2  36  ? 14.356   -39.553  392.523 1.00 82.56  ? 36  GLN 2 CD    1 
ATOM   3706  O  OE1   . GLN B  2  36  ? 13.852   -38.437  392.391 1.00 81.00  ? 36  GLN 2 OE1   1 
ATOM   3707  N  NE2   . GLN B  2  36  ? 13.752   -40.536  393.173 1.00 84.17  ? 36  GLN 2 NE2   1 
ATOM   3708  N  N     . GLU B  2  37  ? 18.134   -41.292  390.034 1.00 84.19  ? 37  GLU 2 N     1 
ATOM   3709  C  CA    . GLU B  2  37  ? 18.857   -42.498  390.440 1.00 81.09  ? 37  GLU 2 CA    1 
ATOM   3710  C  C     . GLU B  2  37  ? 20.164   -42.697  389.679 1.00 80.86  ? 37  GLU 2 C     1 
ATOM   3711  O  O     . GLU B  2  37  ? 21.151   -43.151  390.267 1.00 80.74  ? 37  GLU 2 O     1 
ATOM   3712  C  CB    . GLU B  2  37  ? 17.980   -43.740  390.275 1.00 80.88  ? 37  GLU 2 CB    1 
ATOM   3713  C  CG    . GLU B  2  37  ? 16.926   -43.894  391.359 1.00 82.91  ? 37  GLU 2 CG    1 
ATOM   3714  C  CD    . GLU B  2  37  ? 17.422   -44.653  392.571 1.00 85.65  ? 37  GLU 2 CD    1 
ATOM   3715  O  OE1   . GLU B  2  37  ? 18.045   -45.722  392.400 1.00 87.07  ? 37  GLU 2 OE1   1 
ATOM   3716  O  OE2   . GLU B  2  37  ? 17.175   -44.183  393.701 1.00 85.87  ? 37  GLU 2 OE2   1 
ATOM   3717  N  N     . GLU B  2  38  ? 20.184   -42.405  388.374 1.00 81.73  ? 38  GLU 2 N     1 
ATOM   3718  C  CA    . GLU B  2  38  ? 21.388   -42.537  387.561 1.00 80.96  ? 38  GLU 2 CA    1 
ATOM   3719  C  C     . GLU B  2  38  ? 21.949   -41.212  387.060 1.00 77.87  ? 38  GLU 2 C     1 
ATOM   3720  O  O     . GLU B  2  38  ? 23.086   -41.188  386.572 1.00 75.62  ? 38  GLU 2 O     1 
ATOM   3721  C  CB    . GLU B  2  38  ? 21.137   -43.448  386.351 1.00 80.45  ? 38  GLU 2 CB    1 
ATOM   3722  C  CG    . GLU B  2  38  ? 20.986   -44.916  386.679 1.00 79.03  ? 38  GLU 2 CG    1 
ATOM   3723  C  CD    . GLU B  2  38  ? 21.004   -45.765  385.432 1.00 78.43  ? 38  GLU 2 CD    1 
ATOM   3724  O  OE1   . GLU B  2  38  ? 20.511   -45.297  384.386 1.00 80.97  ? 38  GLU 2 OE1   1 
ATOM   3725  O  OE2   . GLU B  2  38  ? 21.529   -46.893  385.486 1.00 79.26  ? 38  GLU 2 OE2   1 
ATOM   3726  N  N     . GLY B  2  39  ? 21.194   -40.121  387.149 1.00 58.12  ? 39  GLY 2 N     1 
ATOM   3727  C  CA    . GLY B  2  39  ? 21.657   -38.821  386.721 1.00 58.56  ? 39  GLY 2 CA    1 
ATOM   3728  C  C     . GLY B  2  39  ? 21.290   -38.427  385.302 1.00 56.01  ? 39  GLY 2 C     1 
ATOM   3729  O  O     . GLY B  2  39  ? 21.187   -37.228  385.016 1.00 57.71  ? 39  GLY 2 O     1 
ATOM   3730  N  N     . TRP B  2  40  ? 21.097   -39.391  384.405 1.00 52.53  ? 40  TRP 2 N     1 
ATOM   3731  C  CA    . TRP B  2  40  ? 20.715   -39.047  383.041 1.00 50.22  ? 40  TRP 2 CA    1 
ATOM   3732  C  C     . TRP B  2  40  ? 20.019   -40.231  382.383 1.00 48.36  ? 40  TRP 2 C     1 
ATOM   3733  O  O     . TRP B  2  40  ? 20.162   -41.380  382.811 1.00 49.07  ? 40  TRP 2 O     1 
ATOM   3734  C  CB    . TRP B  2  40  ? 21.920   -38.595  382.216 1.00 50.47  ? 40  TRP 2 CB    1 
ATOM   3735  C  CG    . TRP B  2  40  ? 22.948   -39.641  381.948 1.00 50.76  ? 40  TRP 2 CG    1 
ATOM   3736  C  CD1   . TRP B  2  40  ? 23.836   -40.167  382.838 1.00 52.32  ? 40  TRP 2 CD1   1 
ATOM   3737  C  CD2   . TRP B  2  40  ? 23.224   -40.263  380.690 1.00 47.71  ? 40  TRP 2 CD2   1 
ATOM   3738  N  NE1   . TRP B  2  40  ? 24.643   -41.088  382.212 1.00 51.02  ? 40  TRP 2 NE1   1 
ATOM   3739  C  CE2   . TRP B  2  40  ? 24.281   -41.166  380.894 1.00 49.52  ? 40  TRP 2 CE2   1 
ATOM   3740  C  CE3   . TRP B  2  40  ? 22.669   -40.156  379.415 1.00 44.88  ? 40  TRP 2 CE3   1 
ATOM   3741  C  CZ2   . TRP B  2  40  ? 24.799   -41.945  379.867 1.00 49.83  ? 40  TRP 2 CZ2   1 
ATOM   3742  C  CZ3   . TRP B  2  40  ? 23.182   -40.929  378.402 1.00 44.32  ? 40  TRP 2 CZ3   1 
ATOM   3743  C  CH2   . TRP B  2  40  ? 24.233   -41.814  378.632 1.00 47.33  ? 40  TRP 2 CH2   1 
ATOM   3744  N  N     . ILE B  2  41  ? 19.288   -39.937  381.311 1.00 43.60  ? 41  ILE 2 N     1 
ATOM   3745  C  CA    . ILE B  2  41  ? 18.413   -40.912  380.673 1.00 40.07  ? 41  ILE 2 CA    1 
ATOM   3746  C  C     . ILE B  2  41  ? 19.140   -41.491  379.471 1.00 38.59  ? 41  ILE 2 C     1 
ATOM   3747  O  O     . ILE B  2  41  ? 19.456   -40.770  378.518 1.00 40.27  ? 41  ILE 2 O     1 
ATOM   3748  C  CB    . ILE B  2  41  ? 17.077   -40.279  380.251 1.00 37.87  ? 41  ILE 2 CB    1 
ATOM   3749  C  CG1   . ILE B  2  41  ? 16.383   -39.668  381.459 1.00 40.74  ? 41  ILE 2 CG1   1 
ATOM   3750  C  CG2   . ILE B  2  41  ? 16.154   -41.325  379.628 1.00 36.81  ? 41  ILE 2 CG2   1 
ATOM   3751  C  CD1   . ILE B  2  41  ? 15.212   -38.789  381.101 1.00 44.02  ? 41  ILE 2 CD1   1 
ATOM   3752  N  N     . ARG B  2  42  ? 19.421   -42.764  379.530 1.00 36.80  ? 42  ARG 2 N     1 
ATOM   3753  C  CA    . ARG B  2  42  ? 19.999   -43.495  378.421 1.00 36.71  ? 42  ARG 2 CA    1 
ATOM   3754  C  C     . ARG B  2  42  ? 18.885   -43.997  377.507 1.00 38.28  ? 42  ARG 2 C     1 
ATOM   3755  O  O     . ARG B  2  42  ? 17.747   -44.189  377.949 1.00 36.88  ? 42  ARG 2 O     1 
ATOM   3756  C  CB    . ARG B  2  42  ? 20.833   -44.665  378.939 1.00 37.43  ? 42  ARG 2 CB    1 
ATOM   3757  C  CG    . ARG B  2  42  ? 21.996   -44.210  379.802 1.00 36.30  ? 42  ARG 2 CG    1 
ATOM   3758  C  CD    . ARG B  2  42  ? 22.474   -45.277  380.755 1.00 34.43  ? 42  ARG 2 CD    1 
ATOM   3759  N  NE    . ARG B  2  42  ? 23.203   -44.679  381.871 1.00 32.24  ? 42  ARG 2 NE    1 
ATOM   3760  C  CZ    . ARG B  2  42  ? 24.517   -44.490  381.894 1.00 27.16  ? 42  ARG 2 CZ    1 
ATOM   3761  N  NH1   . ARG B  2  42  ? 25.260   -44.870  380.862 1.00 28.59  ? 42  ARG 2 NH1   1 
ATOM   3762  N  NH2   . ARG B  2  42  ? 25.090   -43.929  382.950 1.00 22.54  ? 42  ARG 2 NH2   1 
ATOM   3763  N  N     . PRO B  2  43  ? 19.185   -44.197  376.226 1.00 41.38  ? 43  PRO 2 N     1 
ATOM   3764  C  CA    . PRO B  2  43  ? 18.178   -44.790  375.333 1.00 44.41  ? 43  PRO 2 CA    1 
ATOM   3765  C  C     . PRO B  2  43  ? 17.634   -46.130  375.815 1.00 48.45  ? 43  PRO 2 C     1 
ATOM   3766  O  O     . PRO B  2  43  ? 16.450   -46.416  375.579 1.00 50.50  ? 43  PRO 2 O     1 
ATOM   3767  C  CB    . PRO B  2  43  ? 18.923   -44.897  373.991 1.00 44.10  ? 43  PRO 2 CB    1 
ATOM   3768  C  CG    . PRO B  2  43  ? 20.377   -44.502  374.280 1.00 42.04  ? 43  PRO 2 CG    1 
ATOM   3769  C  CD    . PRO B  2  43  ? 20.325   -43.634  375.484 1.00 40.69  ? 43  PRO 2 CD    1 
ATOM   3770  N  N     . GLU B  2  44  ? 18.453   -46.949  376.494 1.00 50.35  ? 44  GLU 2 N     1 
ATOM   3771  C  CA    . GLU B  2  44  ? 17.975   -48.226  377.027 1.00 53.25  ? 44  GLU 2 CA    1 
ATOM   3772  C  C     . GLU B  2  44  ? 16.812   -48.017  377.987 1.00 51.67  ? 44  GLU 2 C     1 
ATOM   3773  O  O     . GLU B  2  44  ? 15.849   -48.798  377.997 1.00 54.42  ? 44  GLU 2 O     1 
ATOM   3774  C  CB    . GLU B  2  44  ? 19.098   -48.973  377.753 1.00 58.56  ? 44  GLU 2 CB    1 
ATOM   3775  C  CG    . GLU B  2  44  ? 20.287   -49.393  376.909 1.00 63.55  ? 44  GLU 2 CG    1 
ATOM   3776  C  CD    . GLU B  2  44  ? 21.316   -48.287  376.752 1.00 65.24  ? 44  GLU 2 CD    1 
ATOM   3777  O  OE1   . GLU B  2  44  ? 21.050   -47.154  377.196 1.00 64.70  ? 44  GLU 2 OE1   1 
ATOM   3778  O  OE2   . GLU B  2  44  ? 22.383   -48.544  376.160 1.00 66.08  ? 44  GLU 2 OE2   1 
ATOM   3779  N  N     . ARG B  2  45  ? 16.895   -46.969  378.812 1.00 43.35  ? 45  ARG 2 N     1 
ATOM   3780  C  CA    . ARG B  2  45  ? 15.795   -46.644  379.710 1.00 32.77  ? 45  ARG 2 CA    1 
ATOM   3781  C  C     . ARG B  2  45  ? 14.532   -46.375  378.913 1.00 23.30  ? 45  ARG 2 C     1 
ATOM   3782  O  O     . ARG B  2  45  ? 13.439   -46.794  379.307 1.00 19.72  ? 45  ARG 2 O     1 
ATOM   3783  C  CB    . ARG B  2  45  ? 16.129   -45.413  380.559 1.00 28.38  ? 45  ARG 2 CB    1 
ATOM   3784  C  CG    . ARG B  2  45  ? 17.417   -45.451  381.362 1.00 29.42  ? 45  ARG 2 CG    1 
ATOM   3785  C  CD    . ARG B  2  45  ? 17.525   -46.661  382.253 1.00 37.56  ? 45  ARG 2 CD    1 
ATOM   3786  N  NE    . ARG B  2  45  ? 18.489   -47.614  381.718 1.00 50.51  ? 45  ARG 2 NE    1 
ATOM   3787  C  CZ    . ARG B  2  45  ? 19.256   -48.403  382.467 1.00 58.53  ? 45  ARG 2 CZ    1 
ATOM   3788  N  NH1   . ARG B  2  45  ? 19.183   -48.343  383.788 1.00 63.13  ? 45  ARG 2 NH1   1 
ATOM   3789  N  NH2   . ARG B  2  45  ? 20.101   -49.253  381.893 1.00 58.71  ? 45  ARG 2 NH2   1 
ATOM   3790  N  N     . ILE B  2  46  ? 14.671   -45.683  377.779 1.00 22.03  ? 46  ILE 2 N     1 
ATOM   3791  C  CA    . ILE B  2  46  ? 13.516   -45.291  376.972 1.00 18.26  ? 46  ILE 2 CA    1 
ATOM   3792  C  C     . ILE B  2  46  ? 12.873   -46.501  376.299 1.00 15.40  ? 46  ILE 2 C     1 
ATOM   3793  O  O     . ILE B  2  46  ? 11.642   -46.592  376.209 1.00 10.24  ? 46  ILE 2 O     1 
ATOM   3794  C  CB    . ILE B  2  46  ? 13.937   -44.211  375.960 1.00 16.02  ? 46  ILE 2 CB    1 
ATOM   3795  C  CG1   . ILE B  2  46  ? 14.291   -42.916  376.705 1.00 11.81  ? 46  ILE 2 CG1   1 
ATOM   3796  C  CG2   . ILE B  2  46  ? 12.865   -44.022  374.905 1.00 18.96  ? 46  ILE 2 CG2   1 
ATOM   3797  C  CD1   . ILE B  2  46  ? 14.495   -41.714  375.839 1.00 7.12   ? 46  ILE 2 CD1   1 
ATOM   3798  N  N     . GLU B  2  47  ? 13.695   -47.442  375.815 1.00 20.14  ? 47  GLU 2 N     1 
ATOM   3799  C  CA    . GLU B  2  47  ? 13.190   -48.693  375.240 1.00 26.79  ? 47  GLU 2 CA    1 
ATOM   3800  C  C     . GLU B  2  47  ? 12.480   -49.551  376.287 1.00 23.18  ? 47  GLU 2 C     1 
ATOM   3801  O  O     . GLU B  2  47  ? 11.454   -50.186  376.005 1.00 19.51  ? 47  GLU 2 O     1 
ATOM   3802  C  CB    . GLU B  2  47  ? 14.339   -49.489  374.615 1.00 35.57  ? 47  GLU 2 CB    1 
ATOM   3803  C  CG    . GLU B  2  47  ? 15.148   -48.772  373.537 1.00 45.84  ? 47  GLU 2 CG    1 
ATOM   3804  C  CD    . GLU B  2  47  ? 16.355   -49.599  373.100 1.00 56.60  ? 47  GLU 2 CD    1 
ATOM   3805  O  OE1   . GLU B  2  47  ? 16.328   -50.842  373.264 1.00 58.58  ? 47  GLU 2 OE1   1 
ATOM   3806  O  OE2   . GLU B  2  47  ? 17.345   -49.008  372.619 1.00 61.14  ? 47  GLU 2 OE2   1 
ATOM   3807  N  N     . GLU B  2  48  ? 13.030   -49.611  377.493 1.00 26.34  ? 48  GLU 2 N     1 
ATOM   3808  C  CA    . GLU B  2  48  ? 12.374   -50.390  378.531 1.00 32.39  ? 48  GLU 2 CA    1 
ATOM   3809  C  C     . GLU B  2  48  ? 11.058   -49.739  378.950 1.00 33.99  ? 48  GLU 2 C     1 
ATOM   3810  O  O     . GLU B  2  48  ? 10.066   -50.437  379.188 1.00 34.10  ? 48  GLU 2 O     1 
ATOM   3811  C  CB    . GLU B  2  48  ? 13.297   -50.533  379.736 1.00 38.44  ? 48  GLU 2 CB    1 
ATOM   3812  C  CG    . GLU B  2  48  ? 12.803   -51.508  380.776 1.00 39.44  ? 48  GLU 2 CG    1 
ATOM   3813  C  CD    . GLU B  2  48  ? 13.789   -51.658  381.906 1.00 40.71  ? 48  GLU 2 CD    1 
ATOM   3814  O  OE1   . GLU B  2  48  ? 14.955   -51.208  381.758 1.00 41.97  ? 48  GLU 2 OE1   1 
ATOM   3815  O  OE2   . GLU B  2  48  ? 13.387   -52.208  382.950 1.00 37.90  ? 48  GLU 2 OE2   1 
ATOM   3816  N  N     . ILE B  2  49  ? 11.034   -48.402  379.061 1.00 33.21  ? 49  ILE 2 N     1 
ATOM   3817  C  CA    . ILE B  2  49  ? 9.790    -47.694  379.372 1.00 33.05  ? 49  ILE 2 CA    1 
ATOM   3818  C  C     . ILE B  2  49  ? 8.746    -47.956  378.297 1.00 42.86  ? 49  ILE 2 C     1 
ATOM   3819  O  O     . ILE B  2  49  ? 7.561    -48.152  378.593 1.00 44.97  ? 49  ILE 2 O     1 
ATOM   3820  C  CB    . ILE B  2  49  ? 10.049   -46.185  379.550 1.00 21.17  ? 49  ILE 2 CB    1 
ATOM   3821  C  CG1   . ILE B  2  49  ? 10.947   -45.938  380.750 1.00 17.82  ? 49  ILE 2 CG1   1 
ATOM   3822  C  CG2   . ILE B  2  49  ? 8.744    -45.425  379.743 1.00 19.38  ? 49  ILE 2 CG2   1 
ATOM   3823  C  CD1   . ILE B  2  49  ? 11.237   -44.493  380.975 1.00 18.59  ? 49  ILE 2 CD1   1 
ATOM   3824  N  N     . ALA B  2  50  ? 9.168    -47.957  377.031 1.00 47.17  ? 50  ALA 2 N     1 
ATOM   3825  C  CA    . ALA B  2  50  ? 8.255    -48.281  375.943 1.00 47.76  ? 50  ALA 2 CA    1 
ATOM   3826  C  C     . ALA B  2  50  ? 7.705    -49.700  376.088 1.00 47.80  ? 50  ALA 2 C     1 
ATOM   3827  O  O     . ALA B  2  50  ? 6.498    -49.924  375.941 1.00 50.91  ? 50  ALA 2 O     1 
ATOM   3828  C  CB    . ALA B  2  50  ? 8.962    -48.107  374.600 1.00 47.65  ? 50  ALA 2 CB    1 
ATOM   3829  N  N     . ARG B  2  51  ? 8.572    -50.686  376.356 1.00 46.15  ? 51  ARG 2 N     1 
ATOM   3830  C  CA    . ARG B  2  51  ? 8.049    -52.047  376.487 1.00 46.46  ? 51  ARG 2 CA    1 
ATOM   3831  C  C     . ARG B  2  51  ? 7.085    -52.163  377.666 1.00 42.08  ? 51  ARG 2 C     1 
ATOM   3832  O  O     . ARG B  2  51  ? 6.001    -52.745  377.537 1.00 45.91  ? 51  ARG 2 O     1 
ATOM   3833  C  CB    . ARG B  2  51  ? 9.161    -53.088  376.641 1.00 52.25  ? 51  ARG 2 CB    1 
ATOM   3834  C  CG    . ARG B  2  51  ? 10.034   -53.308  375.426 1.00 56.57  ? 51  ARG 2 CG    1 
ATOM   3835  C  CD    . ARG B  2  51  ? 10.686   -54.680  375.515 1.00 59.01  ? 51  ARG 2 CD    1 
ATOM   3836  N  NE    . ARG B  2  51  ? 11.528   -54.830  376.692 1.00 60.26  ? 51  ARG 2 NE    1 
ATOM   3837  C  CZ    . ARG B  2  51  ? 12.815   -54.503  376.734 1.00 62.35  ? 51  ARG 2 CZ    1 
ATOM   3838  N  NH1   . ARG B  2  51  ? 13.412   -54.003  375.658 1.00 62.83  ? 51  ARG 2 NH1   1 
ATOM   3839  N  NH2   . ARG B  2  51  ? 13.506   -54.684  377.853 1.00 63.59  ? 51  ARG 2 NH2   1 
ATOM   3840  N  N     . LEU B  2  52  ? 7.433    -51.561  378.806 1.00 32.35  ? 52  LEU 2 N     1 
ATOM   3841  C  CA    . LEU B  2  52  ? 6.593    -51.674  379.994 1.00 21.09  ? 52  LEU 2 CA    1 
ATOM   3842  C  C     . LEU B  2  52  ? 5.249    -51.002  379.777 1.00 19.35  ? 52  LEU 2 C     1 
ATOM   3843  O  O     . LEU B  2  52  ? 4.209    -51.526  380.190 1.00 10.59  ? 52  LEU 2 O     1 
ATOM   3844  C  CB    . LEU B  2  52  ? 7.294    -51.048  381.205 1.00 19.36  ? 52  LEU 2 CB    1 
ATOM   3845  C  CG    . LEU B  2  52  ? 8.538    -51.697  381.815 1.00 11.04  ? 52  LEU 2 CG    1 
ATOM   3846  C  CD1   . LEU B  2  52  ? 9.296    -50.689  382.681 1.00 13.87  ? 52  LEU 2 CD1   1 
ATOM   3847  C  CD2   . LEU B  2  52  ? 8.120    -52.923  382.634 1.00 7.24   ? 52  LEU 2 CD2   1 
ATOM   3848  N  N     . VAL B  2  53  ? 5.257    -49.852  379.102 1.00 24.03  ? 53  VAL 2 N     1 
ATOM   3849  C  CA    . VAL B  2  53  ? 4.117    -48.943  379.080 1.00 28.08  ? 53  VAL 2 CA    1 
ATOM   3850  C  C     . VAL B  2  53  ? 3.214    -49.137  377.862 1.00 32.65  ? 53  VAL 2 C     1 
ATOM   3851  O  O     . VAL B  2  53  ? 2.131    -48.528  377.805 1.00 33.03  ? 53  VAL 2 O     1 
ATOM   3852  C  CB    . VAL B  2  53  ? 4.610    -47.481  379.165 1.00 17.12  ? 53  VAL 2 CB    1 
ATOM   3853  C  CG1   . VAL B  2  53  ? 5.399    -47.065  377.911 1.00 15.50  ? 53  VAL 2 CG1   1 
ATOM   3854  C  CG2   . VAL B  2  53  ? 3.478    -46.570  379.464 1.00 14.97  ? 53  VAL 2 CG2   1 
ATOM   3855  N  N     . GLY B  2  54  ? 3.632    -49.933  376.875 1.00 37.67  ? 54  GLY 2 N     1 
ATOM   3856  C  CA    . GLY B  2  54  ? 2.793    -50.243  375.732 1.00 40.17  ? 54  GLY 2 CA    1 
ATOM   3857  C  C     . GLY B  2  54  ? 2.759    -49.183  374.648 1.00 39.80  ? 54  GLY 2 C     1 
ATOM   3858  O  O     . GLY B  2  54  ? 1.673    -48.776  374.226 1.00 40.85  ? 54  GLY 2 O     1 
ATOM   3859  N  N     . THR B  2  55  ? 3.923    -48.714  374.202 1.00 37.88  ? 55  THR 2 N     1 
ATOM   3860  C  CA    . THR B  2  55  ? 4.019    -47.771  373.093 1.00 36.20  ? 55  THR 2 CA    1 
ATOM   3861  C  C     . THR B  2  55  ? 5.425    -47.871  372.514 1.00 33.11  ? 55  THR 2 C     1 
ATOM   3862  O  O     . THR B  2  55  ? 6.282    -48.586  373.037 1.00 33.99  ? 55  THR 2 O     1 
ATOM   3863  C  CB    . THR B  2  55  ? 3.688    -46.336  373.539 1.00 37.74  ? 55  THR 2 CB    1 
ATOM   3864  O  OG1   . THR B  2  55  ? 3.513    -45.494  372.390 1.00 35.90  ? 55  THR 2 OG1   1 
ATOM   3865  C  CG2   . THR B  2  55  ? 4.803    -45.766  374.390 1.00 38.24  ? 55  THR 2 CG2   1 
ATOM   3866  N  N     . THR B  2  56  ? 5.665    -47.132  371.456 1.00 30.55  ? 56  THR 2 N     1 
ATOM   3867  C  CA    . THR B  2  56  ? 6.930    -47.253  370.752 1.00 26.24  ? 56  THR 2 CA    1 
ATOM   3868  C  C     . THR B  2  56  ? 7.973    -46.325  371.363 1.00 30.89  ? 56  THR 2 C     1 
ATOM   3869  O  O     . THR B  2  56  ? 7.631    -45.277  371.928 1.00 31.74  ? 56  THR 2 O     1 
ATOM   3870  C  CB    . THR B  2  56  ? 6.762    -46.920  369.267 1.00 20.70  ? 56  THR 2 CB    1 
ATOM   3871  O  OG1   . THR B  2  56  ? 6.553    -45.511  369.109 1.00 13.49  ? 56  THR 2 OG1   1 
ATOM   3872  C  CG2   . THR B  2  56  ? 5.575    -47.696  368.662 1.00 18.16  ? 56  THR 2 CG2   1 
ATOM   3873  N  N     . PRO B  2  57  ? 9.249    -46.712  371.273 1.00 29.71  ? 57  PRO 2 N     1 
ATOM   3874  C  CA    . PRO B  2  57  ? 10.317   -45.826  371.759 1.00 24.20  ? 57  PRO 2 CA    1 
ATOM   3875  C  C     . PRO B  2  57  ? 10.245   -44.424  371.185 1.00 17.48  ? 57  PRO 2 C     1 
ATOM   3876  O  O     . PRO B  2  57  ? 10.599   -43.473  371.885 1.00 10.81  ? 57  PRO 2 O     1 
ATOM   3877  C  CB    . PRO B  2  57  ? 11.592   -46.557  371.313 1.00 20.58  ? 57  PRO 2 CB    1 
ATOM   3878  C  CG    . PRO B  2  57  ? 11.208   -48.000  371.293 1.00 21.01  ? 57  PRO 2 CG    1 
ATOM   3879  C  CD    . PRO B  2  57  ? 9.765    -48.036  370.864 1.00 27.49  ? 57  PRO 2 CD    1 
ATOM   3880  N  N     . THR B  2  58  ? 9.769    -44.267  369.942 1.00 20.16  ? 58  THR 2 N     1 
ATOM   3881  C  CA    . THR B  2  58  ? 9.691    -42.944  369.316 1.00 24.24  ? 58  THR 2 CA    1 
ATOM   3882  C  C     . THR B  2  58  ? 8.798    -42.002  370.122 1.00 29.41  ? 58  THR 2 C     1 
ATOM   3883  O  O     . THR B  2  58  ? 9.167    -40.849  370.398 1.00 27.67  ? 58  THR 2 O     1 
ATOM   3884  C  CB    . THR B  2  58  ? 9.205    -43.075  367.861 1.00 12.57  ? 58  THR 2 CB    1 
ATOM   3885  O  OG1   . THR B  2  58  ? 10.153   -43.846  367.103 1.00 7.62   ? 58  THR 2 OG1   1 
ATOM   3886  C  CG2   . THR B  2  58  ? 8.987    -41.711  367.194 1.00 12.68  ? 58  THR 2 CG2   1 
ATOM   3887  N  N     . GLU B  2  59  ? 7.619    -42.486  370.521 1.00 43.23  ? 59  GLU 2 N     1 
ATOM   3888  C  CA    . GLU B  2  59  ? 6.718    -41.680  371.339 1.00 48.03  ? 59  GLU 2 CA    1 
ATOM   3889  C  C     . GLU B  2  59  ? 7.349    -41.363  372.693 1.00 51.51  ? 59  GLU 2 C     1 
ATOM   3890  O  O     . GLU B  2  59  ? 7.227    -40.237  373.195 1.00 53.24  ? 59  GLU 2 O     1 
ATOM   3891  C  CB    . GLU B  2  59  ? 5.391    -42.425  371.531 1.00 53.97  ? 59  GLU 2 CB    1 
ATOM   3892  C  CG    . GLU B  2  59  ? 4.387    -42.278  370.393 1.00 56.27  ? 59  GLU 2 CG    1 
ATOM   3893  C  CD    . GLU B  2  59  ? 4.055    -40.840  370.067 1.00 61.65  ? 59  GLU 2 CD    1 
ATOM   3894  O  OE1   . GLU B  2  59  ? 3.847    -40.043  371.002 1.00 63.79  ? 59  GLU 2 OE1   1 
ATOM   3895  O  OE2   . GLU B  2  59  ? 3.992    -40.511  368.863 1.00 63.12  ? 59  GLU 2 OE2   1 
ATOM   3896  N  N     . VAL B  2  60  ? 8.047    -42.344  373.285 1.00 45.73  ? 60  VAL 2 N     1 
ATOM   3897  C  CA    . VAL B  2  60  ? 8.650    -42.165  374.606 1.00 44.88  ? 60  VAL 2 CA    1 
ATOM   3898  C  C     . VAL B  2  60  ? 9.751    -41.104  374.559 1.00 42.01  ? 60  VAL 2 C     1 
ATOM   3899  O  O     . VAL B  2  60  ? 9.870    -40.269  375.465 1.00 38.78  ? 60  VAL 2 O     1 
ATOM   3900  C  CB    . VAL B  2  60  ? 9.191    -43.511  375.135 1.00 41.77  ? 60  VAL 2 CB    1 
ATOM   3901  C  CG1   . VAL B  2  60  ? 9.838    -43.337  376.509 1.00 41.25  ? 60  VAL 2 CG1   1 
ATOM   3902  C  CG2   . VAL B  2  60  ? 8.107    -44.570  375.179 1.00 43.47  ? 60  VAL 2 CG2   1 
ATOM   3903  N  N     . MET B  2  61  ? 10.574   -41.124  373.508 1.00 42.13  ? 61  MET 2 N     1 
ATOM   3904  C  CA    . MET B  2  61  ? 11.641   -40.139  373.373 1.00 41.50  ? 61  MET 2 CA    1 
ATOM   3905  C  C     . MET B  2  61  ? 11.075   -38.759  373.085 1.00 42.92  ? 61  MET 2 C     1 
ATOM   3906  O  O     . MET B  2  61  ? 11.572   -37.755  373.611 1.00 45.24  ? 61  MET 2 O     1 
ATOM   3907  C  CB    . MET B  2  61  ? 12.620   -40.557  372.280 1.00 44.77  ? 61  MET 2 CB    1 
ATOM   3908  C  CG    . MET B  2  61  ? 13.661   -39.504  371.961 1.00 52.14  ? 61  MET 2 CG    1 
ATOM   3909  S  SD    . MET B  2  61  ? 15.126   -40.182  371.146 1.00 61.54  ? 61  MET 2 SD    1 
ATOM   3910  C  CE    . MET B  2  61  ? 14.514   -40.375  369.475 1.00 63.50  ? 61  MET 2 CE    1 
ATOM   3911  N  N     . GLY B  2  62  ? 10.052   -38.681  372.229 1.00 42.66  ? 62  GLY 2 N     1 
ATOM   3912  C  CA    . GLY B  2  62  ? 9.386    -37.404  372.025 1.00 39.50  ? 62  GLY 2 CA    1 
ATOM   3913  C  C     . GLY B  2  62  ? 8.878    -36.821  373.325 1.00 37.10  ? 62  GLY 2 C     1 
ATOM   3914  O  O     . GLY B  2  62  ? 9.023    -35.623  373.578 1.00 35.97  ? 62  GLY 2 O     1 
ATOM   3915  N  N     . VAL B  2  63  ? 8.326    -37.674  374.191 1.00 38.28  ? 63  VAL 2 N     1 
ATOM   3916  C  CA    . VAL B  2  63  ? 7.893    -37.226  375.514 1.00 42.15  ? 63  VAL 2 CA    1 
ATOM   3917  C  C     . VAL B  2  63  ? 9.087    -36.738  376.330 1.00 44.54  ? 63  VAL 2 C     1 
ATOM   3918  O  O     . VAL B  2  63  ? 9.109    -35.605  376.823 1.00 43.32  ? 63  VAL 2 O     1 
ATOM   3919  C  CB    . VAL B  2  63  ? 7.152    -38.355  376.248 1.00 42.92  ? 63  VAL 2 CB    1 
ATOM   3920  C  CG1   . VAL B  2  63  ? 6.997    -38.006  377.727 1.00 43.20  ? 63  VAL 2 CG1   1 
ATOM   3921  C  CG2   . VAL B  2  63  ? 5.802    -38.613  375.606 1.00 45.70  ? 63  VAL 2 CG2   1 
ATOM   3922  N  N     . ALA B  2  64  ? 10.096   -37.596  376.491 1.00 45.98  ? 64  ALA 2 N     1 
ATOM   3923  C  CA    . ALA B  2  64  ? 11.158   -37.317  377.453 1.00 44.28  ? 64  ALA 2 CA    1 
ATOM   3924  C  C     . ALA B  2  64  ? 11.958   -36.083  377.054 1.00 49.76  ? 64  ALA 2 C     1 
ATOM   3925  O  O     . ALA B  2  64  ? 12.350   -35.286  377.914 1.00 56.00  ? 64  ALA 2 O     1 
ATOM   3926  C  CB    . ALA B  2  64  ? 12.069   -38.536  377.598 1.00 39.62  ? 64  ALA 2 CB    1 
ATOM   3927  N  N     . SER B  2  65  ? 12.217   -35.908  375.757 1.00 49.64  ? 65  SER 2 N     1 
ATOM   3928  C  CA    . SER B  2  65  ? 12.997   -34.781  375.258 1.00 51.18  ? 65  SER 2 CA    1 
ATOM   3929  C  C     . SER B  2  65  ? 12.207   -33.473  375.224 1.00 50.60  ? 65  SER 2 C     1 
ATOM   3930  O  O     . SER B  2  65  ? 12.745   -32.442  374.792 1.00 49.58  ? 65  SER 2 O     1 
ATOM   3931  C  CB    . SER B  2  65  ? 13.555   -35.125  373.866 1.00 47.67  ? 65  SER 2 CB    1 
ATOM   3932  O  OG    . SER B  2  65  ? 12.603   -35.823  373.071 1.00 44.01  ? 65  SER 2 OG    1 
ATOM   3933  N  N     . PHE B  2  66  ? 10.976   -33.482  375.736 1.00 51.91  ? 66  PHE 2 N     1 
ATOM   3934  C  CA    . PHE B  2  66  ? 10.124   -32.302  375.691 1.00 49.84  ? 66  PHE 2 CA    1 
ATOM   3935  C  C     . PHE B  2  66  ? 10.445   -31.330  376.821 1.00 42.28  ? 66  PHE 2 C     1 
ATOM   3936  O  O     . PHE B  2  66  ? 10.247   -30.121  376.665 1.00 41.42  ? 66  PHE 2 O     1 
ATOM   3937  C  CB    . PHE B  2  66  ? 8.656    -32.739  375.760 1.00 57.61  ? 66  PHE 2 CB    1 
ATOM   3938  C  CG    . PHE B  2  66  ? 7.668    -31.636  375.522 1.00 61.38  ? 66  PHE 2 CG    1 
ATOM   3939  C  CD1   . PHE B  2  66  ? 7.272    -31.309  374.237 1.00 65.28  ? 66  PHE 2 CD1   1 
ATOM   3940  C  CD2   . PHE B  2  66  ? 7.134    -30.924  376.580 1.00 64.05  ? 66  PHE 2 CD2   1 
ATOM   3941  C  CE1   . PHE B  2  66  ? 6.353    -30.293  374.017 1.00 67.99  ? 66  PHE 2 CE1   1 
ATOM   3942  C  CE2   . PHE B  2  66  ? 6.222    -29.908  376.362 1.00 67.14  ? 66  PHE 2 CE2   1 
ATOM   3943  C  CZ    . PHE B  2  66  ? 5.834    -29.594  375.080 1.00 69.09  ? 66  PHE 2 CZ    1 
ATOM   3944  N  N     . TYR B  2  67  ? 10.938   -31.825  377.947 1.00 96.10  ? 67  TYR 2 N     1 
ATOM   3945  C  CA    . TYR B  2  67  ? 11.173   -30.997  379.119 1.00 94.29  ? 67  TYR 2 CA    1 
ATOM   3946  C  C     . TYR B  2  67  ? 12.660   -30.720  379.290 1.00 97.85  ? 67  TYR 2 C     1 
ATOM   3947  O  O     . TYR B  2  67  ? 13.519   -31.464  378.808 1.00 97.74  ? 67  TYR 2 O     1 
ATOM   3948  C  CB    . TYR B  2  67  ? 10.618   -31.663  380.381 1.00 85.17  ? 67  TYR 2 CB    1 
ATOM   3949  C  CG    . TYR B  2  67  ? 9.245    -32.260  380.196 1.00 79.65  ? 67  TYR 2 CG    1 
ATOM   3950  C  CD1   . TYR B  2  67  ? 8.107    -31.478  380.309 1.00 76.87  ? 67  TYR 2 CD1   1 
ATOM   3951  C  CD2   . TYR B  2  67  ? 9.085    -33.597  379.872 1.00 78.21  ? 67  TYR 2 CD2   1 
ATOM   3952  C  CE1   . TYR B  2  67  ? 6.841    -32.019  380.131 1.00 74.99  ? 67  TYR 2 CE1   1 
ATOM   3953  C  CE2   . TYR B  2  67  ? 7.820    -34.147  379.686 1.00 76.88  ? 67  TYR 2 CE2   1 
ATOM   3954  C  CZ    . TYR B  2  67  ? 6.701    -33.350  379.817 1.00 73.93  ? 67  TYR 2 CZ    1 
ATOM   3955  O  OH    . TYR B  2  67  ? 5.440    -33.878  379.638 1.00 70.92  ? 67  TYR 2 OH    1 
ATOM   3956  N  N     . SER B  2  68  ? 12.949   -29.622  379.988 1.00 103.29 ? 68  SER 2 N     1 
ATOM   3957  C  CA    . SER B  2  68  ? 14.330   -29.250  380.258 1.00 105.39 ? 68  SER 2 CA    1 
ATOM   3958  C  C     . SER B  2  68  ? 14.907   -30.102  381.382 1.00 107.74 ? 68  SER 2 C     1 
ATOM   3959  O  O     . SER B  2  68  ? 16.113   -30.373  381.400 1.00 109.70 ? 68  SER 2 O     1 
ATOM   3960  C  CB    . SER B  2  68  ? 14.418   -27.763  380.618 1.00 104.30 ? 68  SER 2 CB    1 
ATOM   3961  O  OG    . SER B  2  68  ? 14.295   -26.951  379.465 1.00 102.91 ? 68  SER 2 OG    1 
ATOM   3962  N  N     . TYR B  2  69  ? 14.050   -30.567  382.294 1.00 105.72 ? 69  TYR 2 N     1 
ATOM   3963  C  CA    . TYR B  2  69  ? 14.532   -31.261  383.483 1.00 103.67 ? 69  TYR 2 CA    1 
ATOM   3964  C  C     . TYR B  2  69  ? 15.245   -32.556  383.114 1.00 100.50 ? 69  TYR 2 C     1 
ATOM   3965  O  O     . TYR B  2  69  ? 16.307   -32.864  383.669 1.00 100.04 ? 69  TYR 2 O     1 
ATOM   3966  C  CB    . TYR B  2  69  ? 13.360   -31.528  384.431 1.00 105.77 ? 69  TYR 2 CB    1 
ATOM   3967  C  CG    . TYR B  2  69  ? 13.697   -32.329  385.666 1.00 108.57 ? 69  TYR 2 CG    1 
ATOM   3968  C  CD1   . TYR B  2  69  ? 14.201   -31.717  386.806 1.00 110.15 ? 69  TYR 2 CD1   1 
ATOM   3969  C  CD2   . TYR B  2  69  ? 13.502   -33.701  385.695 1.00 111.08 ? 69  TYR 2 CD2   1 
ATOM   3970  C  CE1   . TYR B  2  69  ? 14.508   -32.459  387.942 1.00 112.33 ? 69  TYR 2 CE1   1 
ATOM   3971  C  CE2   . TYR B  2  69  ? 13.805   -34.449  386.821 1.00 112.67 ? 69  TYR 2 CE2   1 
ATOM   3972  C  CZ    . TYR B  2  69  ? 14.307   -33.828  387.941 1.00 113.01 ? 69  TYR 2 CZ    1 
ATOM   3973  O  OH    . TYR B  2  69  ? 14.601   -34.591  389.050 1.00 112.03 ? 69  TYR 2 OH    1 
ATOM   3974  N  N     . TYR B  2  70  ? 14.701   -33.309  382.156 1.00 98.38  ? 70  TYR 2 N     1 
ATOM   3975  C  CA    . TYR B  2  70  ? 15.207   -34.648  381.860 1.00 96.92  ? 70  TYR 2 CA    1 
ATOM   3976  C  C     . TYR B  2  70  ? 16.550   -34.554  381.142 1.00 94.61  ? 70  TYR 2 C     1 
ATOM   3977  O  O     . TYR B  2  70  ? 16.670   -33.883  380.111 1.00 96.38  ? 70  TYR 2 O     1 
ATOM   3978  C  CB    . TYR B  2  70  ? 14.194   -35.436  381.028 1.00 95.67  ? 70  TYR 2 CB    1 
ATOM   3979  C  CG    . TYR B  2  70  ? 12.925   -35.748  381.793 1.00 96.45  ? 70  TYR 2 CG    1 
ATOM   3980  C  CD1   . TYR B  2  70  ? 12.974   -36.050  383.146 1.00 96.70  ? 70  TYR 2 CD1   1 
ATOM   3981  C  CD2   . TYR B  2  70  ? 11.681   -35.735  381.173 1.00 96.64  ? 70  TYR 2 CD2   1 
ATOM   3982  C  CE1   . TYR B  2  70  ? 11.821   -36.330  383.864 1.00 97.37  ? 70  TYR 2 CE1   1 
ATOM   3983  C  CE2   . TYR B  2  70  ? 10.521   -36.017  381.886 1.00 96.64  ? 70  TYR 2 CE2   1 
ATOM   3984  C  CZ    . TYR B  2  70  ? 10.598   -36.313  383.229 1.00 96.90  ? 70  TYR 2 CZ    1 
ATOM   3985  O  OH    . TYR B  2  70  ? 9.446    -36.588  383.933 1.00 96.62  ? 70  TYR 2 OH    1 
ATOM   3986  N  N     . GLN B  2  71  ? 17.565   -35.209  381.705 1.00 90.37  ? 71  GLN 2 N     1 
ATOM   3987  C  CA    . GLN B  2  71  ? 18.917   -35.184  381.167 1.00 83.66  ? 71  GLN 2 CA    1 
ATOM   3988  C  C     . GLN B  2  71  ? 19.161   -36.401  380.285 1.00 81.85  ? 71  GLN 2 C     1 
ATOM   3989  O  O     . GLN B  2  71  ? 18.766   -37.521  380.625 1.00 80.53  ? 71  GLN 2 O     1 
ATOM   3990  C  CB    . GLN B  2  71  ? 19.954   -35.138  382.294 1.00 78.96  ? 71  GLN 2 CB    1 
ATOM   3991  C  CG    . GLN B  2  71  ? 19.842   -33.903  383.176 1.00 75.14  ? 71  GLN 2 CG    1 
ATOM   3992  C  CD    . GLN B  2  71  ? 19.912   -32.618  382.384 1.00 72.96  ? 71  GLN 2 CD    1 
ATOM   3993  O  OE1   . GLN B  2  71  ? 20.702   -32.490  381.451 1.00 71.48  ? 71  GLN 2 OE1   1 
ATOM   3994  N  NE2   . GLN B  2  71  ? 19.055   -31.669  382.731 1.00 73.46  ? 71  GLN 2 NE2   1 
ATOM   3995  N  N     . PHE B  2  72  ? 19.801   -36.163  379.138 1.00 79.21  ? 72  PHE 2 N     1 
ATOM   3996  C  CA    . PHE B  2  72  ? 20.093   -37.212  378.176 1.00 75.98  ? 72  PHE 2 CA    1 
ATOM   3997  C  C     . PHE B  2  72  ? 21.585   -37.456  377.995 1.00 74.51  ? 72  PHE 2 C     1 
ATOM   3998  O  O     . PHE B  2  72  ? 21.960   -38.294  377.168 1.00 75.75  ? 72  PHE 2 O     1 
ATOM   3999  C  CB    . PHE B  2  72  ? 19.473   -36.873  376.815 1.00 75.94  ? 72  PHE 2 CB    1 
ATOM   4000  C  CG    . PHE B  2  72  ? 17.970   -36.970  376.779 1.00 74.70  ? 72  PHE 2 CG    1 
ATOM   4001  C  CD1   . PHE B  2  72  ? 17.178   -35.971  377.329 1.00 73.23  ? 72  PHE 2 CD1   1 
ATOM   4002  C  CD2   . PHE B  2  72  ? 17.348   -38.051  376.178 1.00 72.49  ? 72  PHE 2 CD2   1 
ATOM   4003  C  CE1   . PHE B  2  72  ? 15.798   -36.058  377.282 1.00 70.41  ? 72  PHE 2 CE1   1 
ATOM   4004  C  CE2   . PHE B  2  72  ? 15.969   -38.136  376.133 1.00 70.49  ? 72  PHE 2 CE2   1 
ATOM   4005  C  CZ    . PHE B  2  72  ? 15.199   -37.141  376.686 1.00 69.45  ? 72  PHE 2 CZ    1 
ATOM   4006  N  N     . VAL B  2  73  ? 22.443   -36.737  378.718 1.00 71.46  ? 73  VAL 2 N     1 
ATOM   4007  C  CA    . VAL B  2  73  ? 23.888   -36.974  378.704 1.00 71.44  ? 73  VAL 2 CA    1 
ATOM   4008  C  C     . VAL B  2  73  ? 24.369   -37.040  380.150 1.00 71.06  ? 73  VAL 2 C     1 
ATOM   4009  O  O     . VAL B  2  73  ? 23.729   -36.451  381.035 1.00 70.11  ? 73  VAL 2 O     1 
ATOM   4010  C  CB    . VAL B  2  73  ? 24.633   -35.897  377.894 1.00 68.84  ? 73  VAL 2 CB    1 
ATOM   4011  C  CG1   . VAL B  2  73  ? 24.220   -35.946  376.422 1.00 68.76  ? 73  VAL 2 CG1   1 
ATOM   4012  C  CG2   . VAL B  2  73  ? 24.392   -34.512  378.473 1.00 68.63  ? 73  VAL 2 CG2   1 
ATOM   4013  N  N     . PRO B  2  74  ? 25.472   -37.735  380.442 1.00 74.23  ? 74  PRO 2 N     1 
ATOM   4014  C  CA    . PRO B  2  74  ? 25.964   -37.781  381.822 1.00 72.91  ? 74  PRO 2 CA    1 
ATOM   4015  C  C     . PRO B  2  74  ? 26.188   -36.384  382.376 1.00 76.44  ? 74  PRO 2 C     1 
ATOM   4016  O  O     . PRO B  2  74  ? 26.651   -35.481  381.678 1.00 76.77  ? 74  PRO 2 O     1 
ATOM   4017  C  CB    . PRO B  2  74  ? 27.287   -38.546  381.700 1.00 72.90  ? 74  PRO 2 CB    1 
ATOM   4018  C  CG    . PRO B  2  74  ? 27.097   -39.403  380.520 1.00 73.55  ? 74  PRO 2 CG    1 
ATOM   4019  C  CD    . PRO B  2  74  ? 26.289   -38.581  379.556 1.00 74.40  ? 74  PRO 2 CD    1 
ATOM   4020  N  N     . THR B  2  75  ? 25.835   -36.214  383.642 1.00 77.83  ? 75  THR 2 N     1 
ATOM   4021  C  CA    . THR B  2  75  ? 25.965   -34.954  384.347 1.00 77.72  ? 75  THR 2 CA    1 
ATOM   4022  C  C     . THR B  2  75  ? 26.794   -35.216  385.596 1.00 80.21  ? 75  THR 2 C     1 
ATOM   4023  O  O     . THR B  2  75  ? 26.981   -36.365  386.008 1.00 79.86  ? 75  THR 2 O     1 
ATOM   4024  C  CB    . THR B  2  75  ? 24.590   -34.355  384.706 1.00 72.94  ? 75  THR 2 CB    1 
ATOM   4025  O  OG1   . THR B  2  75  ? 24.760   -33.017  385.185 1.00 72.93  ? 75  THR 2 OG1   1 
ATOM   4026  C  CG2   . THR B  2  75  ? 23.888   -35.182  385.776 1.00 70.36  ? 75  THR 2 CG2   1 
ATOM   4027  N  N     . GLY B  2  76  ? 27.328   -34.150  386.179 1.00 81.40  ? 76  GLY 2 N     1 
ATOM   4028  C  CA    . GLY B  2  76  ? 28.066   -34.292  387.419 1.00 81.85  ? 76  GLY 2 CA    1 
ATOM   4029  C  C     . GLY B  2  76  ? 27.185   -34.796  388.546 1.00 81.88  ? 76  GLY 2 C     1 
ATOM   4030  O  O     . GLY B  2  76  ? 25.960   -34.870  388.453 1.00 83.11  ? 76  GLY 2 O     1 
ATOM   4031  N  N     . LYS B  2  77  ? 27.843   -35.165  389.645 1.00 79.86  ? 77  LYS 2 N     1 
ATOM   4032  C  CA    . LYS B  2  77  ? 27.104   -35.650  390.802 1.00 79.46  ? 77  LYS 2 CA    1 
ATOM   4033  C  C     . LYS B  2  77  ? 26.234   -34.553  391.394 1.00 82.96  ? 77  LYS 2 C     1 
ATOM   4034  O  O     . LYS B  2  77  ? 25.153   -34.838  391.928 1.00 84.36  ? 77  LYS 2 O     1 
ATOM   4035  C  CB    . LYS B  2  77  ? 28.069   -36.203  391.847 1.00 79.07  ? 77  LYS 2 CB    1 
ATOM   4036  C  CG    . LYS B  2  77  ? 27.386   -36.839  393.035 1.00 80.48  ? 77  LYS 2 CG    1 
ATOM   4037  C  CD    . LYS B  2  77  ? 28.192   -38.028  393.522 1.00 82.44  ? 77  LYS 2 CD    1 
ATOM   4038  C  CE    . LYS B  2  77  ? 28.874   -37.748  394.843 1.00 83.56  ? 77  LYS 2 CE    1 
ATOM   4039  N  NZ    . LYS B  2  77  ? 29.154   -39.021  395.563 1.00 83.57  ? 77  LYS 2 NZ    1 
ATOM   4040  N  N     . TYR B  2  78  ? 26.684   -33.299  391.299 1.00 38.43  ? 78  TYR 2 N     1 
ATOM   4041  C  CA    . TYR B  2  78  ? 25.938   -32.121  391.751 1.00 35.79  ? 78  TYR 2 CA    1 
ATOM   4042  C  C     . TYR B  2  78  ? 25.663   -31.267  390.515 1.00 36.85  ? 78  TYR 2 C     1 
ATOM   4043  O  O     . TYR B  2  78  ? 26.551   -30.561  390.022 1.00 35.96  ? 78  TYR 2 O     1 
ATOM   4044  C  CB    . TYR B  2  78  ? 26.714   -31.341  392.809 1.00 29.27  ? 78  TYR 2 CB    1 
ATOM   4045  C  CG    . TYR B  2  78  ? 27.094   -32.166  394.022 1.00 26.93  ? 78  TYR 2 CG    1 
ATOM   4046  C  CD1   . TYR B  2  78  ? 26.148   -32.552  394.956 1.00 26.14  ? 78  TYR 2 CD1   1 
ATOM   4047  C  CD2   . TYR B  2  78  ? 28.400   -32.574  394.219 1.00 25.52  ? 78  TYR 2 CD2   1 
ATOM   4048  C  CE1   . TYR B  2  78  ? 26.503   -33.315  396.062 1.00 25.47  ? 78  TYR 2 CE1   1 
ATOM   4049  C  CE2   . TYR B  2  78  ? 28.758   -33.332  395.312 1.00 23.75  ? 78  TYR 2 CE2   1 
ATOM   4050  C  CZ    . TYR B  2  78  ? 27.812   -33.700  396.229 1.00 24.88  ? 78  TYR 2 CZ    1 
ATOM   4051  O  OH    . TYR B  2  78  ? 28.189   -34.455  397.316 1.00 28.02  ? 78  TYR 2 OH    1 
ATOM   4052  N  N     . HIS B  2  79  ? 24.419   -31.326  390.042 1.00 38.07  ? 79  HIS 2 N     1 
ATOM   4053  C  CA    . HIS B  2  79  ? 23.958   -30.628  388.843 1.00 37.04  ? 79  HIS 2 CA    1 
ATOM   4054  C  C     . HIS B  2  79  ? 23.308   -29.324  389.282 1.00 32.31  ? 79  HIS 2 C     1 
ATOM   4055  O  O     . HIS B  2  79  ? 22.135   -29.295  389.669 1.00 32.43  ? 79  HIS 2 O     1 
ATOM   4056  C  CB    . HIS B  2  79  ? 22.981   -31.501  388.066 1.00 44.73  ? 79  HIS 2 CB    1 
ATOM   4057  C  CG    . HIS B  2  79  ? 22.575   -30.932  386.743 1.00 47.63  ? 79  HIS 2 CG    1 
ATOM   4058  N  ND1   . HIS B  2  79  ? 23.485   -30.636  385.749 1.00 50.41  ? 79  HIS 2 ND1   1 
ATOM   4059  C  CD2   . HIS B  2  79  ? 21.355   -30.614  386.247 1.00 48.19  ? 79  HIS 2 CD2   1 
ATOM   4060  C  CE1   . HIS B  2  79  ? 22.844   -30.155  384.699 1.00 49.33  ? 79  HIS 2 CE1   1 
ATOM   4061  N  NE2   . HIS B  2  79  ? 21.551   -30.132  384.976 1.00 51.61  ? 79  HIS 2 NE2   1 
ATOM   4062  N  N     . LEU B  2  80  ? 24.074   -28.244  389.189 1.00 25.32  ? 80  LEU 2 N     1 
ATOM   4063  C  CA    . LEU B  2  80  ? 23.678   -26.943  389.714 1.00 25.07  ? 80  LEU 2 CA    1 
ATOM   4064  C  C     . LEU B  2  80  ? 22.681   -26.294  388.752 1.00 24.76  ? 80  LEU 2 C     1 
ATOM   4065  O  O     . LEU B  2  80  ? 23.022   -25.962  387.612 1.00 24.56  ? 80  LEU 2 O     1 
ATOM   4066  C  CB    . LEU B  2  80  ? 24.922   -26.084  389.928 1.00 28.16  ? 80  LEU 2 CB    1 
ATOM   4067  C  CG    . LEU B  2  80  ? 26.062   -26.807  390.659 1.00 24.83  ? 80  LEU 2 CG    1 
ATOM   4068  C  CD1   . LEU B  2  80  ? 27.372   -26.005  390.642 1.00 22.27  ? 80  LEU 2 CD1   1 
ATOM   4069  C  CD2   . LEU B  2  80  ? 25.645   -27.174  392.084 1.00 27.24  ? 80  LEU 2 CD2   1 
ATOM   4070  N  N     . GLN B  2  81  ? 21.432   -26.168  389.186 1.00 27.59  ? 81  GLN 2 N     1 
ATOM   4071  C  CA    . GLN B  2  81  ? 20.370   -25.574  388.384 1.00 33.45  ? 81  GLN 2 CA    1 
ATOM   4072  C  C     . GLN B  2  81  ? 20.134   -24.143  388.852 1.00 38.59  ? 81  GLN 2 C     1 
ATOM   4073  O  O     . GLN B  2  81  ? 19.700   -23.917  389.988 1.00 42.72  ? 81  GLN 2 O     1 
ATOM   4074  C  CB    . GLN B  2  81  ? 19.100   -26.417  388.465 1.00 35.71  ? 81  GLN 2 CB    1 
ATOM   4075  C  CG    . GLN B  2  81  ? 19.372   -27.905  388.294 1.00 36.54  ? 81  GLN 2 CG    1 
ATOM   4076  C  CD    . GLN B  2  81  ? 18.114   -28.718  388.252 1.00 38.62  ? 81  GLN 2 CD    1 
ATOM   4077  O  OE1   . GLN B  2  81  ? 17.189   -28.413  387.497 1.00 42.44  ? 81  GLN 2 OE1   1 
ATOM   4078  N  NE2   . GLN B  2  81  ? 18.087   -29.794  389.012 1.00 38.53  ? 81  GLN 2 NE2   1 
ATOM   4079  N  N     . VAL B  2  82  ? 20.427   -23.180  387.980 1.00 36.88  ? 82  VAL 2 N     1 
ATOM   4080  C  CA    . VAL B  2  82  ? 20.402   -21.768  388.331 1.00 36.12  ? 82  VAL 2 CA    1 
ATOM   4081  C  C     . VAL B  2  82  ? 19.124   -21.146  387.783 1.00 35.89  ? 82  VAL 2 C     1 
ATOM   4082  O  O     . VAL B  2  82  ? 18.809   -21.280  386.591 1.00 29.06  ? 82  VAL 2 O     1 
ATOM   4083  C  CB    . VAL B  2  82  ? 21.651   -21.041  387.797 1.00 32.85  ? 82  VAL 2 CB    1 
ATOM   4084  C  CG1   . VAL B  2  82  ? 21.631   -19.562  388.202 1.00 31.18  ? 82  VAL 2 CG1   1 
ATOM   4085  C  CG2   . VAL B  2  82  ? 22.937   -21.751  388.278 1.00 30.27  ? 82  VAL 2 CG2   1 
ATOM   4086  N  N     . CYS B  2  83  ? 18.377   -20.480  388.661 1.00 44.54  ? 83  CYS 2 N     1 
ATOM   4087  C  CA    . CYS B  2  83  ? 17.255   -19.667  388.219 1.00 54.95  ? 83  CYS 2 CA    1 
ATOM   4088  C  C     . CYS B  2  83  ? 17.782   -18.395  387.561 1.00 54.81  ? 83  CYS 2 C     1 
ATOM   4089  O  O     . CYS B  2  83  ? 18.619   -17.684  388.134 1.00 54.14  ? 83  CYS 2 O     1 
ATOM   4090  C  CB    . CYS B  2  83  ? 16.349   -19.313  389.395 1.00 62.73  ? 83  CYS 2 CB    1 
ATOM   4091  S  SG    . CYS B  2  83  ? 14.888   -18.382  388.913 1.00 70.19  ? 83  CYS 2 SG    1 
ATOM   4092  N  N     . ALA B  2  84  ? 17.267   -18.098  386.368 1.00 52.86  ? 84  ALA 2 N     1 
ATOM   4093  C  CA    . ALA B  2  84  ? 17.696   -16.947  385.586 1.00 50.82  ? 84  ALA 2 CA    1 
ATOM   4094  C  C     . ALA B  2  84  ? 16.562   -15.982  385.258 1.00 45.70  ? 84  ALA 2 C     1 
ATOM   4095  O  O     . ALA B  2  84  ? 16.769   -15.047  384.474 1.00 47.19  ? 84  ALA 2 O     1 
ATOM   4096  C  CB    . ALA B  2  84  ? 18.365   -17.423  384.291 1.00 53.28  ? 84  ALA 2 CB    1 
ATOM   4097  N  N     . THR B  2  85  ? 15.372   -16.189  385.813 1.00 41.76  ? 85  THR 2 N     1 
ATOM   4098  C  CA    . THR B  2  85  ? 14.227   -15.369  385.448 1.00 45.90  ? 85  THR 2 CA    1 
ATOM   4099  C  C     . THR B  2  85  ? 14.404   -13.940  385.971 1.00 50.63  ? 85  THR 2 C     1 
ATOM   4100  O  O     . THR B  2  85  ? 15.319   -13.634  386.739 1.00 53.78  ? 85  THR 2 O     1 
ATOM   4101  C  CB    . THR B  2  85  ? 12.938   -15.990  385.979 1.00 47.96  ? 85  THR 2 CB    1 
ATOM   4102  O  OG1   . THR B  2  85  ? 13.054   -17.410  385.911 1.00 47.68  ? 85  THR 2 OG1   1 
ATOM   4103  C  CG2   . THR B  2  85  ? 11.758   -15.587  385.112 1.00 48.44  ? 85  THR 2 CG2   1 
ATOM   4104  N  N     . LEU B  2  86  ? 13.493   -13.062  385.540 1.00 52.42  ? 86  LEU 2 N     1 
ATOM   4105  C  CA    . LEU B  2  86  ? 13.609   -11.633  385.820 1.00 55.34  ? 86  LEU 2 CA    1 
ATOM   4106  C  C     . LEU B  2  86  ? 13.777   -11.349  387.310 1.00 57.12  ? 86  LEU 2 C     1 
ATOM   4107  O  O     . LEU B  2  86  ? 14.714   -10.649  387.719 1.00 59.13  ? 86  LEU 2 O     1 
ATOM   4108  C  CB    . LEU B  2  86  ? 12.388   -10.886  385.272 1.00 56.42  ? 86  LEU 2 CB    1 
ATOM   4109  C  CG    . LEU B  2  86  ? 12.451   -9.364   385.471 1.00 57.63  ? 86  LEU 2 CG    1 
ATOM   4110  C  CD1   . LEU B  2  86  ? 13.500   -8.708   384.577 1.00 58.37  ? 86  LEU 2 CD1   1 
ATOM   4111  C  CD2   . LEU B  2  86  ? 11.094   -8.714   385.270 1.00 58.24  ? 86  LEU 2 CD2   1 
ATOM   4112  N  N     . SER B  2  87  ? 12.861   -11.870  388.135 1.00 51.66  ? 87  SER 2 N     1 
ATOM   4113  C  CA    . SER B  2  87  ? 12.861   -11.540  389.561 1.00 43.85  ? 87  SER 2 CA    1 
ATOM   4114  C  C     . SER B  2  87  ? 14.216   -11.844  390.193 1.00 31.80  ? 87  SER 2 C     1 
ATOM   4115  O  O     . SER B  2  87  ? 14.805   -11.001  390.880 1.00 28.80  ? 87  SER 2 O     1 
ATOM   4116  C  CB    . SER B  2  87  ? 11.734   -12.305  390.274 1.00 42.71  ? 87  SER 2 CB    1 
ATOM   4117  O  OG    . SER B  2  87  ? 10.447   -11.887  389.834 1.00 43.22  ? 87  SER 2 OG    1 
ATOM   4118  N  N     . CYS B  2  88  ? 14.732   -13.043  389.950 1.00 28.82  ? 88  CYS 2 N     1 
ATOM   4119  C  CA    . CYS B  2  88  ? 16.035   -13.423  390.478 1.00 27.27  ? 88  CYS 2 CA    1 
ATOM   4120  C  C     . CYS B  2  88  ? 17.180   -12.696  389.778 1.00 28.99  ? 88  CYS 2 C     1 
ATOM   4121  O  O     . CYS B  2  88  ? 18.260   -12.528  390.358 1.00 26.71  ? 88  CYS 2 O     1 
ATOM   4122  C  CB    . CYS B  2  88  ? 16.192   -14.936  390.364 1.00 23.57  ? 88  CYS 2 CB    1 
ATOM   4123  S  SG    . CYS B  2  88  ? 15.301   -15.744  391.668 1.00 22.49  ? 88  CYS 2 SG    1 
ATOM   4124  N  N     . LYS B  2  89  ? 16.979   -12.311  388.519 1.00 30.66  ? 89  LYS 2 N     1 
ATOM   4125  C  CA    . LYS B  2  89  ? 17.995   -11.561  387.792 1.00 37.68  ? 89  LYS 2 CA    1 
ATOM   4126  C  C     . LYS B  2  89  ? 18.230   -10.183  388.413 1.00 41.85  ? 89  LYS 2 C     1 
ATOM   4127  O  O     . LYS B  2  89  ? 19.369   -9.699   388.480 1.00 42.53  ? 89  LYS 2 O     1 
ATOM   4128  C  CB    . LYS B  2  89  ? 17.581   -11.439  386.324 1.00 42.44  ? 89  LYS 2 CB    1 
ATOM   4129  C  CG    . LYS B  2  89  ? 18.382   -10.404  385.564 1.00 48.43  ? 89  LYS 2 CG    1 
ATOM   4130  C  CD    . LYS B  2  89  ? 17.797   -10.116  384.194 1.00 50.73  ? 89  LYS 2 CD    1 
ATOM   4131  C  CE    . LYS B  2  89  ? 18.858   -10.219  383.107 1.00 51.45  ? 89  LYS 2 CE    1 
ATOM   4132  N  NZ    . LYS B  2  89  ? 18.295   -10.742  381.834 1.00 51.51  ? 89  LYS 2 NZ    1 
ATOM   4133  N  N     . LEU B  2  90  ? 17.156   -9.527   388.852 1.00 40.56  ? 90  LEU 2 N     1 
ATOM   4134  C  CA    . LEU B  2  90  ? 17.273   -8.241   389.529 1.00 36.15  ? 90  LEU 2 CA    1 
ATOM   4135  C  C     . LEU B  2  90  ? 18.080   -8.351   390.815 1.00 41.85  ? 90  LEU 2 C     1 
ATOM   4136  O  O     . LEU B  2  90  ? 18.540   -7.336   391.346 1.00 42.16  ? 90  LEU 2 O     1 
ATOM   4137  C  CB    . LEU B  2  90  ? 15.874   -7.709   389.823 1.00 31.68  ? 90  LEU 2 CB    1 
ATOM   4138  C  CG    . LEU B  2  90  ? 15.297   -6.741   388.801 1.00 29.12  ? 90  LEU 2 CG    1 
ATOM   4139  C  CD1   . LEU B  2  90  ? 14.990   -7.462   387.496 1.00 25.11  ? 90  LEU 2 CD1   1 
ATOM   4140  C  CD2   . LEU B  2  90  ? 14.052   -6.098   389.378 1.00 31.39  ? 90  LEU 2 CD2   1 
ATOM   4141  N  N     . ALA B  2  91  ? 18.260   -9.566   391.321 1.00 49.28  ? 91  ALA 2 N     1 
ATOM   4142  C  CA    . ALA B  2  91  ? 19.115   -9.841   392.465 1.00 58.15  ? 91  ALA 2 CA    1 
ATOM   4143  C  C     . ALA B  2  91  ? 20.518   -10.277  392.059 1.00 65.86  ? 91  ALA 2 C     1 
ATOM   4144  O  O     . ALA B  2  91  ? 21.283   -10.729  392.918 1.00 68.69  ? 91  ALA 2 O     1 
ATOM   4145  C  CB    . ALA B  2  91  ? 18.474   -10.915  393.350 1.00 56.93  ? 91  ALA 2 CB    1 
ATOM   4146  N  N     . GLY B  2  92  ? 20.854   -10.202  390.775 1.00 67.33  ? 92  GLY 2 N     1 
ATOM   4147  C  CA    . GLY B  2  92  ? 22.193   -10.476  390.303 1.00 64.66  ? 92  GLY 2 CA    1 
ATOM   4148  C  C     . GLY B  2  92  ? 22.436   -11.859  389.739 1.00 60.99  ? 92  GLY 2 C     1 
ATOM   4149  O  O     . GLY B  2  92  ? 23.578   -12.331  389.782 1.00 59.11  ? 92  GLY 2 O     1 
ATOM   4150  N  N     . ALA B  2  93  ? 21.406   -12.520  389.206 1.00 73.46  ? 93  ALA 2 N     1 
ATOM   4151  C  CA    . ALA B  2  93  ? 21.568   -13.890  388.731 1.00 72.37  ? 93  ALA 2 CA    1 
ATOM   4152  C  C     . ALA B  2  93  ? 22.573   -13.962  387.588 1.00 72.19  ? 93  ALA 2 C     1 
ATOM   4153  O  O     . ALA B  2  93  ? 23.306   -14.951  387.452 1.00 73.19  ? 93  ALA 2 O     1 
ATOM   4154  C  CB    . ALA B  2  93  ? 20.214   -14.456  388.301 1.00 72.89  ? 93  ALA 2 CB    1 
ATOM   4155  N  N     . GLU B  2  94  ? 22.602   -12.930  386.743 1.00 67.50  ? 94  GLU 2 N     1 
ATOM   4156  C  CA    . GLU B  2  94  ? 23.583   -12.872  385.665 1.00 64.88  ? 94  GLU 2 CA    1 
ATOM   4157  C  C     . GLU B  2  94  ? 24.999   -12.877  386.228 1.00 62.24  ? 94  GLU 2 C     1 
ATOM   4158  O  O     . GLU B  2  94  ? 25.869   -13.616  385.752 1.00 63.75  ? 94  GLU 2 O     1 
ATOM   4159  C  CB    . GLU B  2  94  ? 23.331   -11.634  384.805 1.00 65.05  ? 94  GLU 2 CB    1 
ATOM   4160  C  CG    . GLU B  2  94  ? 22.066   -11.729  383.978 1.00 69.51  ? 94  GLU 2 CG    1 
ATOM   4161  C  CD    . GLU B  2  94  ? 22.010   -12.992  383.136 1.00 74.10  ? 94  GLU 2 CD    1 
ATOM   4162  O  OE1   . GLU B  2  94  ? 23.020   -13.311  382.476 1.00 76.05  ? 94  GLU 2 OE1   1 
ATOM   4163  O  OE2   . GLU B  2  94  ? 20.963   -13.677  383.145 1.00 74.42  ? 94  GLU 2 OE2   1 
ATOM   4164  N  N     . GLU B  2  95  ? 25.251   -12.024  387.228 1.00 55.50  ? 95  GLU 2 N     1 
ATOM   4165  C  CA    . GLU B  2  95  ? 26.572   -11.958  387.843 1.00 45.15  ? 95  GLU 2 CA    1 
ATOM   4166  C  C     . GLU B  2  95  ? 26.948   -13.290  388.471 1.00 37.85  ? 95  GLU 2 C     1 
ATOM   4167  O  O     . GLU B  2  95  ? 28.097   -13.728  388.364 1.00 35.59  ? 95  GLU 2 O     1 
ATOM   4168  C  CB    . GLU B  2  95  ? 26.612   -10.828  388.878 1.00 44.76  ? 95  GLU 2 CB    1 
ATOM   4169  C  CG    . GLU B  2  95  ? 26.401   -9.408   388.277 1.00 44.72  ? 95  GLU 2 CG    1 
ATOM   4170  C  CD    . GLU B  2  95  ? 26.471   -8.277   389.306 1.00 44.26  ? 95  GLU 2 CD    1 
ATOM   4171  O  OE1   . GLU B  2  95  ? 25.759   -8.310   390.337 1.00 35.65  ? 95  GLU 2 OE1   1 
ATOM   4172  O  OE2   . GLU B  2  95  ? 27.276   -7.355   389.080 1.00 35.71  ? 95  GLU 2 OE2   1 
ATOM   4173  N  N     . LEU B  2  96  ? 25.981   -13.962  389.100 1.00 41.56  ? 96  LEU 2 N     1 
ATOM   4174  C  CA    . LEU B  2  96  ? 26.222   -15.279  389.698 1.00 43.18  ? 96  LEU 2 CA    1 
ATOM   4175  C  C     . LEU B  2  96  ? 26.606   -16.309  388.643 1.00 45.08  ? 96  LEU 2 C     1 
ATOM   4176  O  O     . LEU B  2  96  ? 27.526   -17.110  388.839 1.00 38.91  ? 96  LEU 2 O     1 
ATOM   4177  C  CB    . LEU B  2  96  ? 24.981   -15.751  390.458 1.00 39.87  ? 96  LEU 2 CB    1 
ATOM   4178  C  CG    . LEU B  2  96  ? 24.871   -17.259  390.708 1.00 35.91  ? 96  LEU 2 CG    1 
ATOM   4179  C  CD1   . LEU B  2  96  ? 26.015   -17.804  391.550 1.00 35.47  ? 96  LEU 2 CD1   1 
ATOM   4180  C  CD2   . LEU B  2  96  ? 23.552   -17.527  391.379 1.00 35.43  ? 96  LEU 2 CD2   1 
ATOM   4181  N  N     . TRP B  2  97  ? 25.858   -16.340  387.541 1.00 51.67  ? 97  TRP 2 N     1 
ATOM   4182  C  CA    . TRP B  2  97  ? 26.132   -17.302  386.483 1.00 53.92  ? 97  TRP 2 CA    1 
ATOM   4183  C  C     . TRP B  2  97  ? 27.499   -17.040  385.857 1.00 62.10  ? 97  TRP 2 C     1 
ATOM   4184  O  O     . TRP B  2  97  ? 28.276   -17.976  385.625 1.00 63.04  ? 97  TRP 2 O     1 
ATOM   4185  C  CB    . TRP B  2  97  ? 25.010   -17.239  385.441 1.00 48.81  ? 97  TRP 2 CB    1 
ATOM   4186  C  CG    . TRP B  2  97  ? 25.262   -18.061  384.212 1.00 47.07  ? 97  TRP 2 CG    1 
ATOM   4187  C  CD1   . TRP B  2  97  ? 25.641   -17.604  382.982 1.00 47.34  ? 97  TRP 2 CD1   1 
ATOM   4188  C  CD2   . TRP B  2  97  ? 25.179   -19.496  384.100 1.00 44.82  ? 97  TRP 2 CD2   1 
ATOM   4189  N  NE1   . TRP B  2  97  ? 25.778   -18.661  382.109 1.00 46.63  ? 97  TRP 2 NE1   1 
ATOM   4190  C  CE2   . TRP B  2  97  ? 25.505   -19.831  382.771 1.00 44.64  ? 97  TRP 2 CE2   1 
ATOM   4191  C  CE3   . TRP B  2  97  ? 24.854   -20.526  384.993 1.00 40.40  ? 97  TRP 2 CE3   1 
ATOM   4192  C  CZ2   . TRP B  2  97  ? 25.517   -21.153  382.316 1.00 40.83  ? 97  TRP 2 CZ2   1 
ATOM   4193  C  CZ3   . TRP B  2  97  ? 24.867   -21.832  384.536 1.00 38.09  ? 97  TRP 2 CZ3   1 
ATOM   4194  C  CH2   . TRP B  2  97  ? 25.199   -22.134  383.212 1.00 37.55  ? 97  TRP 2 CH2   1 
ATOM   4195  N  N     . ASP B  2  98  ? 27.821   -15.766  385.607 1.00 66.02  ? 98  ASP 2 N     1 
ATOM   4196  C  CA    . ASP B  2  98  ? 29.124   -15.413  385.051 1.00 71.12  ? 98  ASP 2 CA    1 
ATOM   4197  C  C     . ASP B  2  98  ? 30.255   -15.822  385.985 1.00 73.26  ? 98  ASP 2 C     1 
ATOM   4198  O  O     . ASP B  2  98  ? 31.252   -16.404  385.549 1.00 72.80  ? 98  ASP 2 O     1 
ATOM   4199  C  CB    . ASP B  2  98  ? 29.185   -13.915  384.772 1.00 74.14  ? 98  ASP 2 CB    1 
ATOM   4200  C  CG    . ASP B  2  98  ? 28.262   -13.501  383.650 1.00 76.00  ? 98  ASP 2 CG    1 
ATOM   4201  O  OD1   . ASP B  2  98  ? 28.302   -14.146  382.577 1.00 75.76  ? 98  ASP 2 OD1   1 
ATOM   4202  O  OD2   . ASP B  2  98  ? 27.515   -12.517  383.833 1.00 76.60  ? 98  ASP 2 OD2   1 
ATOM   4203  N  N     . TYR B  2  99  ? 30.118   -15.507  387.277 1.00 78.62  ? 99  TYR 2 N     1 
ATOM   4204  C  CA    . TYR B  2  99  ? 31.157   -15.833  388.251 1.00 84.51  ? 99  TYR 2 CA    1 
ATOM   4205  C  C     . TYR B  2  99  ? 31.323   -17.341  388.398 1.00 87.11  ? 99  TYR 2 C     1 
ATOM   4206  O  O     . TYR B  2  99  ? 32.448   -17.859  388.398 1.00 88.03  ? 99  TYR 2 O     1 
ATOM   4207  C  CB    . TYR B  2  99  ? 30.807   -15.200  389.601 1.00 88.09  ? 99  TYR 2 CB    1 
ATOM   4208  C  CG    . TYR B  2  99  ? 31.610   -15.735  390.772 1.00 90.49  ? 99  TYR 2 CG    1 
ATOM   4209  C  CD1   . TYR B  2  99  ? 32.971   -15.478  390.887 1.00 91.53  ? 99  TYR 2 CD1   1 
ATOM   4210  C  CD2   . TYR B  2  99  ? 31.012   -16.527  391.747 1.00 89.92  ? 99  TYR 2 CD2   1 
ATOM   4211  C  CE1   . TYR B  2  99  ? 33.710   -15.974  391.957 1.00 90.49  ? 99  TYR 2 CE1   1 
ATOM   4212  C  CE2   . TYR B  2  99  ? 31.746   -17.030  392.819 1.00 89.36  ? 99  TYR 2 CE2   1 
ATOM   4213  C  CZ    . TYR B  2  99  ? 33.095   -16.750  392.917 1.00 89.03  ? 99  TYR 2 CZ    1 
ATOM   4214  O  OH    . TYR B  2  99  ? 33.836   -17.241  393.973 1.00 86.96  ? 99  TYR 2 OH    1 
ATOM   4215  N  N     . LEU B  2  100 ? 30.208   -18.065  388.524 1.00 86.82  ? 100 LEU 2 N     1 
ATOM   4216  C  CA    . LEU B  2  100 ? 30.262   -19.518  388.639 1.00 85.81  ? 100 LEU 2 CA    1 
ATOM   4217  C  C     . LEU B  2  100 ? 30.978   -20.136  387.445 1.00 86.67  ? 100 LEU 2 C     1 
ATOM   4218  O  O     . LEU B  2  100 ? 31.907   -20.937  387.608 1.00 86.62  ? 100 LEU 2 O     1 
ATOM   4219  C  CB    . LEU B  2  100 ? 28.845   -20.081  388.764 1.00 83.13  ? 100 LEU 2 CB    1 
ATOM   4220  C  CG    . LEU B  2  100 ? 28.706   -21.579  389.042 1.00 82.27  ? 100 LEU 2 CG    1 
ATOM   4221  C  CD1   . LEU B  2  100 ? 29.187   -21.909  390.439 1.00 82.05  ? 100 LEU 2 CD1   1 
ATOM   4222  C  CD2   . LEU B  2  100 ? 27.264   -22.041  388.840 1.00 83.59  ? 100 LEU 2 CD2   1 
ATOM   4223  N  N     . THR B  2  101 ? 30.572   -19.753  386.230 1.00 87.63  ? 101 THR 2 N     1 
ATOM   4224  C  CA    . THR B  2  101 ? 31.166   -20.350  385.041 1.00 89.82  ? 101 THR 2 CA    1 
ATOM   4225  C  C     . THR B  2  101 ? 32.640   -19.982  384.909 1.00 87.56  ? 101 THR 2 C     1 
ATOM   4226  O  O     . THR B  2  101 ? 33.476   -20.856  384.659 1.00 86.72  ? 101 THR 2 O     1 
ATOM   4227  C  CB    . THR B  2  101 ? 30.382   -19.920  383.801 1.00 94.11  ? 101 THR 2 CB    1 
ATOM   4228  O  OG1   . THR B  2  101 ? 28.998   -20.247  383.978 1.00 95.59  ? 101 THR 2 OG1   1 
ATOM   4229  C  CG2   . THR B  2  101 ? 30.886   -20.647  382.577 1.00 95.08  ? 101 THR 2 CG2   1 
ATOM   4230  N  N     . GLU B  2  102 ? 32.984   -18.699  385.101 1.00 87.10  ? 102 GLU 2 N     1 
ATOM   4231  C  CA    . GLU B  2  102 ? 34.365   -18.258  384.921 1.00 86.18  ? 102 GLU 2 CA    1 
ATOM   4232  C  C     . GLU B  2  102 ? 35.294   -18.845  385.974 1.00 84.01  ? 102 GLU 2 C     1 
ATOM   4233  O  O     . GLU B  2  102 ? 36.490   -19.017  385.711 1.00 85.33  ? 102 GLU 2 O     1 
ATOM   4234  C  CB    . GLU B  2  102 ? 34.448   -16.731  384.965 1.00 88.94  ? 102 GLU 2 CB    1 
ATOM   4235  C  CG    . GLU B  2  102 ? 35.724   -16.159  384.349 1.00 93.98  ? 102 GLU 2 CG    1 
ATOM   4236  C  CD    . GLU B  2  102 ? 36.146   -14.837  384.984 1.00 97.61  ? 102 GLU 2 CD    1 
ATOM   4237  O  OE1   . GLU B  2  102 ? 35.544   -14.445  386.004 1.00 98.74  ? 102 GLU 2 OE1   1 
ATOM   4238  O  OE2   . GLU B  2  102 ? 37.087   -14.196  384.472 1.00 98.01  ? 102 GLU 2 OE2   1 
ATOM   4239  N  N     . THR B  2  103 ? 34.777   -19.150  387.166 1.00 80.86  ? 103 THR 2 N     1 
ATOM   4240  C  CA    . THR B  2  103 ? 35.588   -19.846  388.160 1.00 76.61  ? 103 THR 2 CA    1 
ATOM   4241  C  C     . THR B  2  103 ? 35.744   -21.317  387.796 1.00 69.80  ? 103 THR 2 C     1 
ATOM   4242  O  O     . THR B  2  103 ? 36.859   -21.851  387.773 1.00 67.78  ? 103 THR 2 O     1 
ATOM   4243  C  CB    . THR B  2  103 ? 34.969   -19.693  389.555 1.00 76.54  ? 103 THR 2 CB    1 
ATOM   4244  O  OG1   . THR B  2  103 ? 35.160   -18.352  390.025 1.00 74.79  ? 103 THR 2 OG1   1 
ATOM   4245  C  CG2   . THR B  2  103 ? 35.602   -20.665  390.548 1.00 77.49  ? 103 THR 2 CG2   1 
ATOM   4246  N  N     . LEU B  2  104 ? 34.632   -21.986  387.494 1.00 65.55  ? 104 LEU 2 N     1 
ATOM   4247  C  CA    . LEU B  2  104 ? 34.681   -23.412  387.201 1.00 61.94  ? 104 LEU 2 CA    1 
ATOM   4248  C  C     . LEU B  2  104 ? 35.159   -23.688  385.778 1.00 62.52  ? 104 LEU 2 C     1 
ATOM   4249  O  O     . LEU B  2  104 ? 35.879   -24.667  385.544 1.00 63.20  ? 104 LEU 2 O     1 
ATOM   4250  C  CB    . LEU B  2  104 ? 33.302   -24.029  387.442 1.00 59.33  ? 104 LEU 2 CB    1 
ATOM   4251  C  CG    . LEU B  2  104 ? 32.734   -23.837  388.856 1.00 56.36  ? 104 LEU 2 CG    1 
ATOM   4252  C  CD1   . LEU B  2  104 ? 31.314   -24.364  388.963 1.00 53.77  ? 104 LEU 2 CD1   1 
ATOM   4253  C  CD2   . LEU B  2  104 ? 33.629   -24.495  389.901 1.00 56.72  ? 104 LEU 2 CD2   1 
ATOM   4254  N  N     . GLY B  2  105 ? 34.783   -22.842  384.823 1.00 65.52  ? 105 GLY 2 N     1 
ATOM   4255  C  CA    . GLY B  2  105 ? 35.179   -23.060  383.442 1.00 63.85  ? 105 GLY 2 CA    1 
ATOM   4256  C  C     . GLY B  2  105 ? 34.384   -24.136  382.733 1.00 62.84  ? 105 GLY 2 C     1 
ATOM   4257  O  O     . GLY B  2  105 ? 34.963   -24.938  381.987 1.00 63.75  ? 105 GLY 2 O     1 
ATOM   4258  N  N     . ILE B  2  106 ? 33.071   -24.200  382.969 1.00 58.94  ? 106 ILE 2 N     1 
ATOM   4259  C  CA    . ILE B  2  106 ? 32.217   -25.255  382.433 1.00 51.02  ? 106 ILE 2 CA    1 
ATOM   4260  C  C     . ILE B  2  106 ? 31.136   -24.629  381.563 1.00 47.53  ? 106 ILE 2 C     1 
ATOM   4261  O  O     . ILE B  2  106 ? 30.644   -23.532  381.843 1.00 44.23  ? 106 ILE 2 O     1 
ATOM   4262  C  CB    . ILE B  2  106 ? 31.558   -26.108  383.542 1.00 46.30  ? 106 ILE 2 CB    1 
ATOM   4263  C  CG1   . ILE B  2  106 ? 32.449   -26.209  384.775 1.00 46.79  ? 106 ILE 2 CG1   1 
ATOM   4264  C  CG2   . ILE B  2  106 ? 31.208   -27.495  383.026 1.00 44.10  ? 106 ILE 2 CG2   1 
ATOM   4265  C  CD1   . ILE B  2  106 ? 31.752   -26.878  385.946 1.00 49.74  ? 106 ILE 2 CD1   1 
ATOM   4266  N  N     . GLY B  2  107 ? 30.745   -25.345  380.514 1.00 47.14  ? 107 GLY 2 N     1 
ATOM   4267  C  CA    . GLY B  2  107 ? 29.553   -25.003  379.777 1.00 46.64  ? 107 GLY 2 CA    1 
ATOM   4268  C  C     . GLY B  2  107 ? 28.354   -25.767  380.302 1.00 46.55  ? 107 GLY 2 C     1 
ATOM   4269  O  O     . GLY B  2  107 ? 28.490   -26.748  381.043 1.00 45.45  ? 107 GLY 2 O     1 
ATOM   4270  N  N     . PRO B  2  108 ? 27.149   -25.328  379.923 1.00 44.43  ? 108 PRO 2 N     1 
ATOM   4271  C  CA    . PRO B  2  108 ? 25.929   -26.015  380.395 1.00 44.27  ? 108 PRO 2 CA    1 
ATOM   4272  C  C     . PRO B  2  108 ? 25.853   -27.484  380.011 1.00 45.94  ? 108 PRO 2 C     1 
ATOM   4273  O  O     . PRO B  2  108 ? 25.179   -28.258  380.706 1.00 47.68  ? 108 PRO 2 O     1 
ATOM   4274  C  CB    . PRO B  2  108 ? 24.787   -25.214  379.755 1.00 40.88  ? 108 PRO 2 CB    1 
ATOM   4275  C  CG    . PRO B  2  108 ? 25.403   -23.959  379.229 1.00 41.99  ? 108 PRO 2 CG    1 
ATOM   4276  C  CD    . PRO B  2  108 ? 26.880   -24.069  379.211 1.00 40.43  ? 108 PRO 2 CD    1 
ATOM   4277  N  N     . GLY B  2  109 ? 26.527   -27.895  378.940 1.00 47.24  ? 109 GLY 2 N     1 
ATOM   4278  C  CA    . GLY B  2  109 ? 26.468   -29.269  378.495 1.00 46.74  ? 109 GLY 2 CA    1 
ATOM   4279  C  C     . GLY B  2  109 ? 27.495   -30.157  379.167 1.00 47.55  ? 109 GLY 2 C     1 
ATOM   4280  O  O     . GLY B  2  109 ? 27.241   -31.346  379.382 1.00 49.25  ? 109 GLY 2 O     1 
ATOM   4281  N  N     . GLU B  2  110 ? 28.636   -29.593  379.550 1.00 47.76  ? 110 GLU 2 N     1 
ATOM   4282  C  CA    . GLU B  2  110 ? 29.756   -30.381  380.032 1.00 47.23  ? 110 GLU 2 CA    1 
ATOM   4283  C  C     . GLU B  2  110 ? 29.787   -30.405  381.561 1.00 46.29  ? 110 GLU 2 C     1 
ATOM   4284  O  O     . GLU B  2  110 ? 28.896   -29.873  382.238 1.00 42.52  ? 110 GLU 2 O     1 
ATOM   4285  C  CB    . GLU B  2  110 ? 31.066   -29.835  379.466 1.00 50.43  ? 110 GLU 2 CB    1 
ATOM   4286  C  CG    . GLU B  2  110 ? 31.046   -28.331  379.275 1.00 53.06  ? 110 GLU 2 CG    1 
ATOM   4287  C  CD    . GLU B  2  110 ? 32.381   -27.780  378.823 1.00 56.39  ? 110 GLU 2 CD    1 
ATOM   4288  O  OE1   . GLU B  2  110 ? 33.333   -28.573  378.649 1.00 57.46  ? 110 GLU 2 OE1   1 
ATOM   4289  O  OE2   . GLU B  2  110 ? 32.475   -26.548  378.645 1.00 57.28  ? 110 GLU 2 OE2   1 
ATOM   4290  N  N     . VAL B  2  111 ? 30.842   -31.014  382.108 1.00 47.67  ? 111 VAL 2 N     1 
ATOM   4291  C  CA    . VAL B  2  111 ? 31.014   -31.191  383.544 1.00 52.85  ? 111 VAL 2 CA    1 
ATOM   4292  C  C     . VAL B  2  111 ? 32.449   -30.832  383.896 1.00 58.63  ? 111 VAL 2 C     1 
ATOM   4293  O  O     . VAL B  2  111 ? 33.373   -31.041  383.105 1.00 60.12  ? 111 VAL 2 O     1 
ATOM   4294  C  CB    . VAL B  2  111 ? 30.701   -32.637  383.996 1.00 52.25  ? 111 VAL 2 CB    1 
ATOM   4295  C  CG1   . VAL B  2  111 ? 31.578   -33.631  383.247 1.00 54.26  ? 111 VAL 2 CG1   1 
ATOM   4296  C  CG2   . VAL B  2  111 ? 30.876   -32.790  385.497 1.00 52.91  ? 111 VAL 2 CG2   1 
ATOM   4297  N  N     . THR B  2  112 ? 32.625   -30.284  385.096 1.00 64.67  ? 112 THR 2 N     1 
ATOM   4298  C  CA    . THR B  2  112 ? 33.953   -29.971  385.594 1.00 72.98  ? 112 THR 2 CA    1 
ATOM   4299  C  C     . THR B  2  112 ? 34.831   -31.223  385.562 1.00 72.79  ? 112 THR 2 C     1 
ATOM   4300  O  O     . THR B  2  112 ? 34.332   -32.348  385.684 1.00 74.23  ? 112 THR 2 O     1 
ATOM   4301  C  CB    . THR B  2  112 ? 33.858   -29.404  387.018 1.00 76.17  ? 112 THR 2 CB    1 
ATOM   4302  O  OG1   . THR B  2  112 ? 35.014   -28.608  387.316 1.00 78.47  ? 112 THR 2 OG1   1 
ATOM   4303  C  CG2   . THR B  2  112 ? 33.687   -30.501  388.064 1.00 77.24  ? 112 THR 2 CG2   1 
ATOM   4304  N  N     . PRO B  2  113 ? 36.141   -31.068  385.347 1.00 74.14  ? 113 PRO 2 N     1 
ATOM   4305  C  CA    . PRO B  2  113 ? 37.014   -32.247  385.398 1.00 76.91  ? 113 PRO 2 CA    1 
ATOM   4306  C  C     . PRO B  2  113 ? 37.072   -32.872  386.778 1.00 81.98  ? 113 PRO 2 C     1 
ATOM   4307  O  O     . PRO B  2  113 ? 37.413   -34.058  386.891 1.00 82.15  ? 113 PRO 2 O     1 
ATOM   4308  C  CB    . PRO B  2  113 ? 38.384   -31.714  384.952 1.00 75.64  ? 113 PRO 2 CB    1 
ATOM   4309  C  CG    . PRO B  2  113 ? 38.214   -30.272  384.663 1.00 73.16  ? 113 PRO 2 CG    1 
ATOM   4310  C  CD    . PRO B  2  113 ? 36.887   -29.817  385.144 1.00 72.84  ? 113 PRO 2 CD    1 
ATOM   4311  N  N     . ASP B  2  114 ? 36.732   -32.115  387.828 1.00 82.84  ? 114 ASP 2 N     1 
ATOM   4312  C  CA    . ASP B  2  114 ? 36.569   -32.711  389.150 1.00 82.25  ? 114 ASP 2 CA    1 
ATOM   4313  C  C     . ASP B  2  114 ? 35.506   -33.801  389.129 1.00 78.38  ? 114 ASP 2 C     1 
ATOM   4314  O  O     . ASP B  2  114 ? 35.554   -34.732  389.939 1.00 77.83  ? 114 ASP 2 O     1 
ATOM   4315  C  CB    . ASP B  2  114 ? 36.209   -31.631  390.170 1.00 83.68  ? 114 ASP 2 CB    1 
ATOM   4316  C  CG    . ASP B  2  114 ? 37.062   -30.384  390.025 1.00 84.67  ? 114 ASP 2 CG    1 
ATOM   4317  O  OD1   . ASP B  2  114 ? 38.307   -30.495  390.031 1.00 85.30  ? 114 ASP 2 OD1   1 
ATOM   4318  O  OD2   . ASP B  2  114 ? 36.482   -29.285  389.905 1.00 84.86  ? 114 ASP 2 OD2   1 
ATOM   4319  N  N     . GLY B  2  115 ? 34.543   -33.695  388.215 1.00 75.47  ? 115 GLY 2 N     1 
ATOM   4320  C  CA    . GLY B  2  115 ? 33.584   -34.749  387.963 1.00 74.67  ? 115 GLY 2 CA    1 
ATOM   4321  C  C     . GLY B  2  115 ? 32.280   -34.654  388.719 1.00 71.82  ? 115 GLY 2 C     1 
ATOM   4322  O  O     . GLY B  2  115 ? 31.459   -35.578  388.621 1.00 71.25  ? 115 GLY 2 O     1 
ATOM   4323  N  N     . LEU B  2  116 ? 32.059   -33.574  389.470 1.00 67.54  ? 116 LEU 2 N     1 
ATOM   4324  C  CA    . LEU B  2  116 ? 30.861   -33.451  390.283 1.00 63.20  ? 116 LEU 2 CA    1 
ATOM   4325  C  C     . LEU B  2  116 ? 30.067   -32.178  390.031 1.00 66.34  ? 116 LEU 2 C     1 
ATOM   4326  O  O     . LEU B  2  116 ? 28.974   -32.035  390.591 1.00 67.23  ? 116 LEU 2 O     1 
ATOM   4327  C  CB    . LEU B  2  116 ? 31.224   -33.530  391.776 1.00 56.82  ? 116 LEU 2 CB    1 
ATOM   4328  C  CG    . LEU B  2  116 ? 32.181   -32.474  392.344 1.00 48.15  ? 116 LEU 2 CG    1 
ATOM   4329  C  CD1   . LEU B  2  116 ? 31.799   -32.121  393.769 1.00 43.09  ? 116 LEU 2 CD1   1 
ATOM   4330  C  CD2   . LEU B  2  116 ? 33.619   -32.944  392.273 1.00 48.80  ? 116 LEU 2 CD2   1 
ATOM   4331  N  N     . PHE B  2  117 ? 30.561   -31.256  389.206 1.00 36.98  ? 117 PHE 2 N     1 
ATOM   4332  C  CA    . PHE B  2  117 ? 29.910   -29.960  389.036 1.00 36.93  ? 117 PHE 2 CA    1 
ATOM   4333  C  C     . PHE B  2  117 ? 29.456   -29.784  387.598 1.00 41.07  ? 117 PHE 2 C     1 
ATOM   4334  O  O     . PHE B  2  117 ? 30.284   -29.667  386.684 1.00 41.28  ? 117 PHE 2 O     1 
ATOM   4335  C  CB    . PHE B  2  117 ? 30.837   -28.826  389.457 1.00 26.73  ? 117 PHE 2 CB    1 
ATOM   4336  C  CG    . PHE B  2  117 ? 31.017   -28.744  390.927 1.00 19.87  ? 117 PHE 2 CG    1 
ATOM   4337  C  CD1   . PHE B  2  117 ? 29.922   -28.817  391.765 1.00 15.39  ? 117 PHE 2 CD1   1 
ATOM   4338  C  CD2   . PHE B  2  117 ? 32.277   -28.635  391.483 1.00 20.67  ? 117 PHE 2 CD2   1 
ATOM   4339  C  CE1   . PHE B  2  117 ? 30.074   -28.756  393.132 1.00 16.77  ? 117 PHE 2 CE1   1 
ATOM   4340  C  CE2   . PHE B  2  117 ? 32.436   -28.575  392.856 1.00 20.99  ? 117 PHE 2 CE2   1 
ATOM   4341  C  CZ    . PHE B  2  117 ? 31.326   -28.636  393.677 1.00 19.86  ? 117 PHE 2 CZ    1 
ATOM   4342  N  N     . SER B  2  118 ? 28.144   -29.697  387.419 1.00 42.85  ? 118 SER 2 N     1 
ATOM   4343  C  CA    . SER B  2  118 ? 27.526   -29.383  386.148 1.00 41.88  ? 118 SER 2 CA    1 
ATOM   4344  C  C     . SER B  2  118 ? 26.689   -28.127  386.320 1.00 43.03  ? 118 SER 2 C     1 
ATOM   4345  O  O     . SER B  2  118 ? 26.290   -27.766  387.433 1.00 46.00  ? 118 SER 2 O     1 
ATOM   4346  C  CB    . SER B  2  118 ? 26.631   -30.532  385.661 1.00 41.39  ? 118 SER 2 CB    1 
ATOM   4347  O  OG    . SER B  2  118 ? 27.309   -31.779  385.674 1.00 39.47  ? 118 SER 2 OG    1 
ATOM   4348  N  N     . VAL B  2  119 ? 26.423   -27.463  385.201 1.00 40.18  ? 119 VAL 2 N     1 
ATOM   4349  C  CA    . VAL B  2  119 ? 25.667   -26.220  385.210 1.00 32.20  ? 119 VAL 2 CA    1 
ATOM   4350  C  C     . VAL B  2  119 ? 24.522   -26.348  384.218 1.00 28.63  ? 119 VAL 2 C     1 
ATOM   4351  O  O     . VAL B  2  119 ? 24.577   -27.135  383.266 1.00 27.29  ? 119 VAL 2 O     1 
ATOM   4352  C  CB    . VAL B  2  119 ? 26.539   -24.976  384.897 1.00 28.88  ? 119 VAL 2 CB    1 
ATOM   4353  C  CG1   . VAL B  2  119 ? 27.417   -24.624  386.097 1.00 21.42  ? 119 VAL 2 CG1   1 
ATOM   4354  C  CG2   . VAL B  2  119 ? 27.370   -25.178  383.636 1.00 32.67  ? 119 VAL 2 CG2   1 
ATOM   4355  N  N     . GLN B  2  120 ? 23.462   -25.589  384.480 1.00 23.10  ? 120 GLN 2 N     1 
ATOM   4356  C  CA    . GLN B  2  120 ? 22.294   -25.516  383.616 1.00 20.51  ? 120 GLN 2 CA    1 
ATOM   4357  C  C     . GLN B  2  120 ? 21.471   -24.313  384.030 1.00 15.97  ? 120 GLN 2 C     1 
ATOM   4358  O  O     . GLN B  2  120 ? 21.257   -24.114  385.228 1.00 19.94  ? 120 GLN 2 O     1 
ATOM   4359  C  CB    . GLN B  2  120 ? 21.443   -26.782  383.715 1.00 21.52  ? 120 GLN 2 CB    1 
ATOM   4360  C  CG    . GLN B  2  120 ? 20.146   -26.680  382.945 1.00 26.29  ? 120 GLN 2 CG    1 
ATOM   4361  C  CD    . GLN B  2  120 ? 19.278   -27.880  383.111 1.00 10.17  ? 120 GLN 2 CD    1 
ATOM   4362  O  OE1   . GLN B  2  120 ? 19.668   -28.972  382.725 1.00 17.31  ? 120 GLN 2 OE1   1 
ATOM   4363  N  NE2   . GLN B  2  120 ? 18.088   -27.694  383.670 1.00 10.27  ? 120 GLN 2 NE2   1 
ATOM   4364  N  N     . LYS B  2  121 ? 21.009   -23.503  383.080 1.00 11.37  ? 121 LYS 2 N     1 
ATOM   4365  C  CA    . LYS B  2  121 ? 20.090   -22.442  383.464 1.00 17.52  ? 121 LYS 2 CA    1 
ATOM   4366  C  C     . LYS B  2  121 ? 18.667   -22.966  383.535 1.00 15.28  ? 121 LYS 2 C     1 
ATOM   4367  O  O     . LYS B  2  121 ? 18.257   -23.807  382.743 1.00 10.58  ? 121 LYS 2 O     1 
ATOM   4368  C  CB    . LYS B  2  121 ? 20.133   -21.268  382.487 1.00 21.15  ? 121 LYS 2 CB    1 
ATOM   4369  C  CG    . LYS B  2  121 ? 20.770   -20.010  383.059 1.00 25.06  ? 121 LYS 2 CG    1 
ATOM   4370  C  CD    . LYS B  2  121 ? 20.869   -18.901  382.025 1.00 27.19  ? 121 LYS 2 CD    1 
ATOM   4371  C  CE    . LYS B  2  121 ? 21.817   -19.251  380.913 1.00 32.33  ? 121 LYS 2 CE    1 
ATOM   4372  N  NZ    . LYS B  2  121 ? 22.016   -18.092  380.001 1.00 35.50  ? 121 LYS 2 NZ    1 
ATOM   4373  N  N     . VAL B  2  122 ? 17.881   -22.386  384.435 1.00 26.38  ? 122 VAL 2 N     1 
ATOM   4374  C  CA    . VAL B  2  122 ? 16.481   -22.759  384.572 1.00 37.86  ? 122 VAL 2 CA    1 
ATOM   4375  C  C     . VAL B  2  122 ? 15.690   -21.477  384.788 1.00 46.00  ? 122 VAL 2 C     1 
ATOM   4376  O  O     . VAL B  2  122 ? 16.193   -20.501  385.356 1.00 46.02  ? 122 VAL 2 O     1 
ATOM   4377  C  CB    . VAL B  2  122 ? 16.248   -23.783  385.732 1.00 41.94  ? 122 VAL 2 CB    1 
ATOM   4378  C  CG1   . VAL B  2  122 ? 14.755   -24.023  385.985 1.00 44.01  ? 122 VAL 2 CG1   1 
ATOM   4379  C  CG2   . VAL B  2  122 ? 16.945   -25.124  385.461 1.00 40.44  ? 122 VAL 2 CG2   1 
ATOM   4380  N  N     . GLU B  2  123 ? 14.456   -21.470  384.297 1.00 51.69  ? 123 GLU 2 N     1 
ATOM   4381  C  CA    . GLU B  2  123 ? 13.572   -20.327  384.471 1.00 58.43  ? 123 GLU 2 CA    1 
ATOM   4382  C  C     . GLU B  2  123 ? 12.994   -20.371  385.885 1.00 64.24  ? 123 GLU 2 C     1 
ATOM   4383  O  O     . GLU B  2  123 ? 13.514   -21.062  386.767 1.00 63.26  ? 123 GLU 2 O     1 
ATOM   4384  C  CB    . GLU B  2  123 ? 12.515   -20.308  383.368 1.00 58.71  ? 123 GLU 2 CB    1 
ATOM   4385  C  CG    . GLU B  2  123 ? 13.100   -20.167  381.967 1.00 59.98  ? 123 GLU 2 CG    1 
ATOM   4386  C  CD    . GLU B  2  123 ? 14.097   -19.017  381.855 1.00 62.26  ? 123 GLU 2 CD    1 
ATOM   4387  O  OE1   . GLU B  2  123 ? 13.718   -17.871  382.168 1.00 63.22  ? 123 GLU 2 OE1   1 
ATOM   4388  O  OE2   . GLU B  2  123 ? 15.266   -19.253  381.468 1.00 62.36  ? 123 GLU 2 OE2   1 
ATOM   4389  N  N     . CYS B  2  124 ? 11.944   -19.584  386.126 1.00 69.40  ? 124 CYS 2 N     1 
ATOM   4390  C  CA    . CYS B  2  124 ? 11.415   -19.368  387.472 1.00 73.78  ? 124 CYS 2 CA    1 
ATOM   4391  C  C     . CYS B  2  124 ? 11.215   -20.670  388.235 1.00 78.48  ? 124 CYS 2 C     1 
ATOM   4392  O  O     . CYS B  2  124 ? 10.453   -21.546  387.810 1.00 78.34  ? 124 CYS 2 O     1 
ATOM   4393  C  CB    . CYS B  2  124 ? 10.099   -18.593  387.391 1.00 73.08  ? 124 CYS 2 CB    1 
ATOM   4394  S  SG    . CYS B  2  124 ? 9.392    -18.197  388.988 1.00 73.57  ? 124 CYS 2 SG    1 
ATOM   4395  N  N     . LEU B  2  125 ? 11.921   -20.790  389.357 1.00 80.91  ? 125 LEU 2 N     1 
ATOM   4396  C  CA    . LEU B  2  125 ? 11.804   -21.926  390.258 1.00 81.93  ? 125 LEU 2 CA    1 
ATOM   4397  C  C     . LEU B  2  125 ? 10.688   -21.745  391.284 1.00 84.00  ? 125 LEU 2 C     1 
ATOM   4398  O  O     . LEU B  2  125 ? 10.596   -22.530  392.234 1.00 85.87  ? 125 LEU 2 O     1 
ATOM   4399  C  CB    . LEU B  2  125 ? 13.147   -22.174  390.960 1.00 82.07  ? 125 LEU 2 CB    1 
ATOM   4400  C  CG    . LEU B  2  125 ? 14.286   -22.733  390.093 1.00 82.33  ? 125 LEU 2 CG    1 
ATOM   4401  C  CD1   . LEU B  2  125 ? 15.610   -22.806  390.849 1.00 83.83  ? 125 LEU 2 CD1   1 
ATOM   4402  C  CD2   . LEU B  2  125 ? 13.924   -24.113  389.571 1.00 81.32  ? 125 LEU 2 CD2   1 
ATOM   4403  N  N     . GLY B  2  126 ? 9.840    -20.734  391.113 1.00 84.62  ? 126 GLY 2 N     1 
ATOM   4404  C  CA    . GLY B  2  126 ? 8.712    -20.543  392.003 1.00 87.00  ? 126 GLY 2 CA    1 
ATOM   4405  C  C     . GLY B  2  126 ? 9.047    -20.124  393.417 1.00 88.82  ? 126 GLY 2 C     1 
ATOM   4406  O  O     . GLY B  2  126 ? 8.240    -20.354  394.323 1.00 91.67  ? 126 GLY 2 O     1 
ATOM   4407  N  N     . SER B  2  127 ? 10.229   -19.537  393.643 1.00 84.03  ? 127 SER 2 N     1 
ATOM   4408  C  CA    . SER B  2  127 ? 10.594   -18.947  394.938 1.00 79.25  ? 127 SER 2 CA    1 
ATOM   4409  C  C     . SER B  2  127 ? 11.283   -17.616  394.647 1.00 77.11  ? 127 SER 2 C     1 
ATOM   4410  O  O     . SER B  2  127 ? 12.512   -17.541  394.606 1.00 77.11  ? 127 SER 2 O     1 
ATOM   4411  C  CB    . SER B  2  127 ? 11.483   -19.893  395.741 1.00 78.65  ? 127 SER 2 CB    1 
ATOM   4412  O  OG    . SER B  2  127 ? 12.690   -20.196  395.057 1.00 78.79  ? 127 SER 2 OG    1 
ATOM   4413  N  N     . CYS B  2  128 ? 10.492   -16.556  394.493 1.00 78.30  ? 128 CYS 2 N     1 
ATOM   4414  C  CA    . CYS B  2  128 ? 11.051   -15.308  393.983 1.00 78.31  ? 128 CYS 2 CA    1 
ATOM   4415  C  C     . CYS B  2  128 ? 11.513   -14.345  395.073 1.00 75.87  ? 128 CYS 2 C     1 
ATOM   4416  O  O     . CYS B  2  128 ? 12.513   -13.646  394.875 1.00 74.05  ? 128 CYS 2 O     1 
ATOM   4417  C  CB    . CYS B  2  128 ? 10.024   -14.623  393.071 1.00 79.21  ? 128 CYS 2 CB    1 
ATOM   4418  S  SG    . CYS B  2  128 ? 9.298    -15.729  391.831 1.00 77.54  ? 128 CYS 2 SG    1 
ATOM   4419  N  N     . HIS B  2  129 ? 10.835   -14.315  396.227 1.00 74.75  ? 129 HIS 2 N     1 
ATOM   4420  C  CA    . HIS B  2  129 ? 11.216   -13.415  397.313 1.00 71.80  ? 129 HIS 2 CA    1 
ATOM   4421  C  C     . HIS B  2  129 ? 12.546   -13.805  397.946 1.00 67.84  ? 129 HIS 2 C     1 
ATOM   4422  O  O     . HIS B  2  129 ? 13.219   -12.950  398.534 1.00 67.70  ? 129 HIS 2 O     1 
ATOM   4423  C  CB    . HIS B  2  129 ? 10.108   -13.355  398.375 1.00 72.11  ? 129 HIS 2 CB    1 
ATOM   4424  C  CG    . HIS B  2  129 ? 9.723    -14.690  398.938 1.00 74.17  ? 129 HIS 2 CG    1 
ATOM   4425  N  ND1   . HIS B  2  129 ? 9.078    -15.657  398.192 1.00 75.80  ? 129 HIS 2 ND1   1 
ATOM   4426  C  CD2   . HIS B  2  129 ? 9.876    -15.213  400.178 1.00 77.11  ? 129 HIS 2 CD2   1 
ATOM   4427  C  CE1   . HIS B  2  129 ? 8.855    -16.717  398.949 1.00 75.37  ? 129 HIS 2 CE1   1 
ATOM   4428  N  NE2   . HIS B  2  129 ? 9.331    -16.474  400.158 1.00 74.96  ? 129 HIS 2 NE2   1 
ATOM   4429  N  N     . THR B  2  130 ? 12.951   -15.065  397.812 1.00 61.45  ? 130 THR 2 N     1 
ATOM   4430  C  CA    . THR B  2  130 ? 14.206   -15.561  398.355 1.00 55.60  ? 130 THR 2 CA    1 
ATOM   4431  C  C     . THR B  2  130 ? 15.328   -15.532  397.321 1.00 53.04  ? 130 THR 2 C     1 
ATOM   4432  O  O     . THR B  2  130 ? 16.272   -16.327  397.394 1.00 52.51  ? 130 THR 2 O     1 
ATOM   4433  C  CB    . THR B  2  130 ? 13.991   -16.970  398.902 1.00 49.40  ? 130 THR 2 CB    1 
ATOM   4434  O  OG1   . THR B  2  130 ? 13.255   -17.741  397.944 1.00 46.45  ? 130 THR 2 OG1   1 
ATOM   4435  C  CG2   . THR B  2  130 ? 13.204   -16.925  400.205 1.00 48.40  ? 130 THR 2 CG2   1 
ATOM   4436  N  N     . ALA B  2  131 ? 15.236   -14.618  396.360 1.00 53.26  ? 131 ALA 2 N     1 
ATOM   4437  C  CA    . ALA B  2  131 ? 16.184   -14.550  395.261 1.00 56.40  ? 131 ALA 2 CA    1 
ATOM   4438  C  C     . ALA B  2  131 ? 17.588   -14.213  395.770 1.00 57.57  ? 131 ALA 2 C     1 
ATOM   4439  O  O     . ALA B  2  131 ? 17.741   -13.508  396.773 1.00 61.07  ? 131 ALA 2 O     1 
ATOM   4440  C  CB    . ALA B  2  131 ? 15.731   -13.494  394.255 1.00 58.72  ? 131 ALA 2 CB    1 
ATOM   4441  N  N     . PRO B  2  132 ? 18.641   -14.714  395.101 1.00 56.65  ? 132 PRO 2 N     1 
ATOM   4442  C  CA    . PRO B  2  132 ? 18.551   -15.682  393.996 1.00 53.53  ? 132 PRO 2 CA    1 
ATOM   4443  C  C     . PRO B  2  132 ? 18.376   -17.134  394.458 1.00 48.53  ? 132 PRO 2 C     1 
ATOM   4444  O  O     . PRO B  2  132 ? 18.478   -17.422  395.650 1.00 47.37  ? 132 PRO 2 O     1 
ATOM   4445  C  CB    . PRO B  2  132 ? 19.876   -15.486  393.256 1.00 56.98  ? 132 PRO 2 CB    1 
ATOM   4446  C  CG    . PRO B  2  132 ? 20.806   -15.008  394.291 1.00 57.02  ? 132 PRO 2 CG    1 
ATOM   4447  C  CD    . PRO B  2  132 ? 20.002   -14.168  395.242 1.00 54.63  ? 132 PRO 2 CD    1 
ATOM   4448  N  N     . VAL B  2  133 ? 18.110   -18.040  393.521 1.00 73.87  ? 133 VAL 2 N     1 
ATOM   4449  C  CA    . VAL B  2  133 ? 17.743   -19.411  393.848 1.00 66.82  ? 133 VAL 2 CA    1 
ATOM   4450  C  C     . VAL B  2  133 ? 18.619   -20.378  393.060 1.00 66.14  ? 133 VAL 2 C     1 
ATOM   4451  O  O     . VAL B  2  133 ? 19.044   -20.087  391.938 1.00 66.97  ? 133 VAL 2 O     1 
ATOM   4452  C  CB    . VAL B  2  133 ? 16.245   -19.662  393.549 1.00 60.59  ? 133 VAL 2 CB    1 
ATOM   4453  C  CG1   . VAL B  2  133 ? 15.785   -20.932  394.185 1.00 62.06  ? 133 VAL 2 CG1   1 
ATOM   4454  C  CG2   . VAL B  2  133 ? 15.401   -18.515  394.046 1.00 57.87  ? 133 VAL 2 CG2   1 
ATOM   4455  N  N     . ILE B  2  134 ? 18.868   -21.546  393.649 1.00 66.69  ? 134 ILE 2 N     1 
ATOM   4456  C  CA    . ILE B  2  134 ? 19.630   -22.620  393.011 1.00 69.06  ? 134 ILE 2 CA    1 
ATOM   4457  C  C     . ILE B  2  134 ? 19.083   -23.946  393.527 1.00 71.92  ? 134 ILE 2 C     1 
ATOM   4458  O  O     . ILE B  2  134 ? 18.682   -24.046  394.689 1.00 75.97  ? 134 ILE 2 O     1 
ATOM   4459  C  CB    . ILE B  2  134 ? 21.148   -22.483  393.285 1.00 70.27  ? 134 ILE 2 CB    1 
ATOM   4460  C  CG1   . ILE B  2  134 ? 21.794   -21.507  392.294 1.00 71.69  ? 134 ILE 2 CG1   1 
ATOM   4461  C  CG2   . ILE B  2  134 ? 21.857   -23.841  393.233 1.00 69.85  ? 134 ILE 2 CG2   1 
ATOM   4462  C  CD1   . ILE B  2  134 ? 23.302   -21.339  392.454 1.00 71.81  ? 134 ILE 2 CD1   1 
ATOM   4463  N  N     . GLN B  2  135 ? 19.043   -24.962  392.656 1.00 70.68  ? 135 GLN 2 N     1 
ATOM   4464  C  CA    . GLN B  2  135 ? 18.646   -26.315  393.041 1.00 68.31  ? 135 GLN 2 CA    1 
ATOM   4465  C  C     . GLN B  2  135 ? 19.779   -27.292  392.751 1.00 68.89  ? 135 GLN 2 C     1 
ATOM   4466  O  O     . GLN B  2  135 ? 20.550   -27.107  391.801 1.00 71.09  ? 135 GLN 2 O     1 
ATOM   4467  C  CB    . GLN B  2  135 ? 17.373   -26.776  392.302 1.00 65.16  ? 135 GLN 2 CB    1 
ATOM   4468  C  CG    . GLN B  2  135 ? 16.997   -28.239  392.564 1.00 61.18  ? 135 GLN 2 CG    1 
ATOM   4469  C  CD    . GLN B  2  135 ? 15.752   -28.679  391.824 1.00 57.63  ? 135 GLN 2 CD    1 
ATOM   4470  O  OE1   . GLN B  2  135 ? 15.667   -28.577  390.601 1.00 59.86  ? 135 GLN 2 OE1   1 
ATOM   4471  N  NE2   . GLN B  2  135 ? 14.777   -29.182  392.566 1.00 53.37  ? 135 GLN 2 NE2   1 
ATOM   4472  N  N     . VAL B  2  136 ? 19.885   -28.336  393.571 1.00 68.97  ? 136 VAL 2 N     1 
ATOM   4473  C  CA    . VAL B  2  136 ? 20.916   -29.356  393.392 1.00 73.09  ? 136 VAL 2 CA    1 
ATOM   4474  C  C     . VAL B  2  136 ? 20.197   -30.682  393.164 1.00 78.36  ? 136 VAL 2 C     1 
ATOM   4475  O  O     . VAL B  2  136 ? 19.928   -31.460  394.085 1.00 81.89  ? 136 VAL 2 O     1 
ATOM   4476  C  CB    . VAL B  2  136 ? 21.885   -29.429  394.575 1.00 72.62  ? 136 VAL 2 CB    1 
ATOM   4477  C  CG1   . VAL B  2  136 ? 22.961   -30.482  394.322 1.00 71.65  ? 136 VAL 2 CG1   1 
ATOM   4478  C  CG2   . VAL B  2  136 ? 22.519   -28.063  394.819 1.00 73.93  ? 136 VAL 2 CG2   1 
ATOM   4479  N  N     . ASN B  2  137 ? 19.876   -30.926  391.900 1.00 80.51  ? 137 ASN 2 N     1 
ATOM   4480  C  CA    . ASN B  2  137 ? 19.576   -32.195  391.246 1.00 83.73  ? 137 ASN 2 CA    1 
ATOM   4481  C  C     . ASN B  2  137 ? 18.243   -32.831  391.620 1.00 83.34  ? 137 ASN 2 C     1 
ATOM   4482  O  O     . ASN B  2  137 ? 17.652   -33.523  390.787 1.00 81.62  ? 137 ASN 2 O     1 
ATOM   4483  C  CB    . ASN B  2  137 ? 20.661   -33.227  391.594 1.00 87.86  ? 137 ASN 2 CB    1 
ATOM   4484  C  CG    . ASN B  2  137 ? 22.070   -32.721  391.340 1.00 89.35  ? 137 ASN 2 CG    1 
ATOM   4485  O  OD1   . ASN B  2  137 ? 22.300   -31.520  391.224 1.00 88.53  ? 137 ASN 2 OD1   1 
ATOM   4486  N  ND2   . ASN B  2  137 ? 23.024   -33.647  391.246 1.00 89.45  ? 137 ASN 2 ND2   1 
ATOM   4487  N  N     . ASP B  2  138 ? 17.740   -32.604  392.835 1.00 86.65  ? 138 ASP 2 N     1 
ATOM   4488  C  CA    . ASP B  2  138 ? 16.344   -32.896  393.149 1.00 90.66  ? 138 ASP 2 CA    1 
ATOM   4489  C  C     . ASP B  2  138 ? 15.863   -32.115  394.365 1.00 91.19  ? 138 ASP 2 C     1 
ATOM   4490  O  O     . ASP B  2  138 ? 14.685   -32.189  394.729 1.00 93.30  ? 138 ASP 2 O     1 
ATOM   4491  C  CB    . ASP B  2  138 ? 16.140   -34.399  393.388 1.00 93.14  ? 138 ASP 2 CB    1 
ATOM   4492  C  CG    . ASP B  2  138 ? 16.935   -34.916  394.573 1.00 97.32  ? 138 ASP 2 CG    1 
ATOM   4493  O  OD1   . ASP B  2  138 ? 18.182   -34.929  394.504 1.00 99.56  ? 138 ASP 2 OD1   1 
ATOM   4494  O  OD2   . ASP B  2  138 ? 16.308   -35.322  395.575 1.00 98.46  ? 138 ASP 2 OD2   1 
ATOM   4495  N  N     . GLU B  2  139 ? 16.750   -31.354  394.983 1.00 88.08  ? 139 GLU 2 N     1 
ATOM   4496  C  CA    . GLU B  2  139 ? 16.564   -31.065  396.397 1.00 83.65  ? 139 GLU 2 CA    1 
ATOM   4497  C  C     . GLU B  2  139 ? 15.941   -29.696  396.607 1.00 80.45  ? 139 GLU 2 C     1 
ATOM   4498  O  O     . GLU B  2  139 ? 15.922   -28.864  395.695 1.00 81.17  ? 139 GLU 2 O     1 
ATOM   4499  C  CB    . GLU B  2  139 ? 17.910   -31.156  397.129 1.00 84.67  ? 139 GLU 2 CB    1 
ATOM   4500  C  CG    . GLU B  2  139 ? 18.717   -32.399  396.788 1.00 86.93  ? 139 GLU 2 CG    1 
ATOM   4501  C  CD    . GLU B  2  139 ? 18.245   -33.615  397.549 1.00 91.58  ? 139 GLU 2 CD    1 
ATOM   4502  O  OE1   . GLU B  2  139 ? 17.431   -33.447  398.480 1.00 94.06  ? 139 GLU 2 OE1   1 
ATOM   4503  O  OE2   . GLU B  2  139 ? 18.676   -34.738  397.217 1.00 93.60  ? 139 GLU 2 OE2   1 
ATOM   4504  N  N     . PRO B  2  140 ? 15.368   -29.451  397.790 1.00 76.95  ? 140 PRO 2 N     1 
ATOM   4505  C  CA    . PRO B  2  140 ? 14.840   -28.113  398.092 1.00 75.95  ? 140 PRO 2 CA    1 
ATOM   4506  C  C     . PRO B  2  140 ? 15.870   -27.036  397.771 1.00 74.85  ? 140 PRO 2 C     1 
ATOM   4507  O  O     . PRO B  2  140 ? 17.072   -27.211  398.000 1.00 75.27  ? 140 PRO 2 O     1 
ATOM   4508  C  CB    . PRO B  2  140 ? 14.540   -28.180  399.593 1.00 75.17  ? 140 PRO 2 CB    1 
ATOM   4509  C  CG    . PRO B  2  140 ? 14.302   -29.625  399.869 1.00 74.00  ? 140 PRO 2 CG    1 
ATOM   4510  C  CD    . PRO B  2  140 ? 15.079   -30.425  398.861 1.00 73.79  ? 140 PRO 2 CD    1 
ATOM   4511  N  N     . TYR B  2  141 ? 15.397   -25.923  397.212 1.00 70.92  ? 141 TYR 2 N     1 
ATOM   4512  C  CA    . TYR B  2  141 ? 16.321   -24.925  396.694 1.00 68.77  ? 141 TYR 2 CA    1 
ATOM   4513  C  C     . TYR B  2  141 ? 17.193   -24.377  397.815 1.00 66.46  ? 141 TYR 2 C     1 
ATOM   4514  O  O     . TYR B  2  141 ? 16.740   -24.207  398.952 1.00 67.27  ? 141 TYR 2 O     1 
ATOM   4515  C  CB    . TYR B  2  141 ? 15.579   -23.763  396.023 1.00 68.37  ? 141 TYR 2 CB    1 
ATOM   4516  C  CG    . TYR B  2  141 ? 14.351   -24.140  395.228 1.00 69.90  ? 141 TYR 2 CG    1 
ATOM   4517  C  CD1   . TYR B  2  141 ? 14.434   -25.016  394.159 1.00 71.20  ? 141 TYR 2 CD1   1 
ATOM   4518  C  CD2   . TYR B  2  141 ? 13.106   -23.597  395.533 1.00 70.21  ? 141 TYR 2 CD2   1 
ATOM   4519  C  CE1   . TYR B  2  141 ? 13.302   -25.371  393.430 1.00 72.59  ? 141 TYR 2 CE1   1 
ATOM   4520  C  CE2   . TYR B  2  141 ? 11.969   -23.944  394.806 1.00 71.31  ? 141 TYR 2 CE2   1 
ATOM   4521  C  CZ    . TYR B  2  141 ? 12.076   -24.833  393.754 1.00 70.85  ? 141 TYR 2 CZ    1 
ATOM   4522  O  OH    . TYR B  2  141 ? 10.966   -25.193  393.020 1.00 67.16  ? 141 TYR 2 OH    1 
ATOM   4523  N  N     . VAL B  2  142 ? 18.458   -24.117  397.491 1.00 63.71  ? 142 VAL 2 N     1 
ATOM   4524  C  CA    . VAL B  2  142 ? 19.343   -23.340  398.348 1.00 58.09  ? 142 VAL 2 CA    1 
ATOM   4525  C  C     . VAL B  2  142 ? 19.055   -21.896  397.969 1.00 56.44  ? 142 VAL 2 C     1 
ATOM   4526  O  O     . VAL B  2  142 ? 19.503   -21.415  396.931 1.00 55.19  ? 142 VAL 2 O     1 
ATOM   4527  C  CB    . VAL B  2  142 ? 20.819   -23.694  398.148 1.00 54.58  ? 142 VAL 2 CB    1 
ATOM   4528  C  CG1   . VAL B  2  142 ? 21.709   -22.721  398.911 1.00 50.50  ? 142 VAL 2 CG1   1 
ATOM   4529  C  CG2   . VAL B  2  142 ? 21.101   -25.142  398.552 1.00 57.02  ? 142 VAL 2 CG2   1 
ATOM   4530  N  N     . GLU B  2  143 ? 18.244   -21.228  398.776 1.00 59.60  ? 143 GLU 2 N     1 
ATOM   4531  C  CA    . GLU B  2  143 ? 17.702   -19.930  398.421 1.00 59.23  ? 143 GLU 2 CA    1 
ATOM   4532  C  C     . GLU B  2  143 ? 18.579   -18.831  399.016 1.00 63.84  ? 143 GLU 2 C     1 
ATOM   4533  O  O     . GLU B  2  143 ? 19.579   -19.094  399.685 1.00 65.79  ? 143 GLU 2 O     1 
ATOM   4534  C  CB    . GLU B  2  143 ? 16.245   -19.853  398.886 1.00 52.98  ? 143 GLU 2 CB    1 
ATOM   4535  C  CG    . GLU B  2  143 ? 15.394   -20.982  398.296 1.00 48.86  ? 143 GLU 2 CG    1 
ATOM   4536  C  CD    . GLU B  2  143 ? 14.036   -21.115  398.949 1.00 48.44  ? 143 GLU 2 CD    1 
ATOM   4537  O  OE1   . GLU B  2  143 ? 13.577   -20.138  399.567 1.00 52.65  ? 143 GLU 2 OE1   1 
ATOM   4538  O  OE2   . GLU B  2  143 ? 13.424   -22.195  398.845 1.00 45.07  ? 143 GLU 2 OE2   1 
ATOM   4539  N  N     . CYS B  2  144 ? 18.199   -17.581  398.753 1.00 66.29  ? 144 CYS 2 N     1 
ATOM   4540  C  CA    . CYS B  2  144 ? 18.893   -16.407  399.285 1.00 71.51  ? 144 CYS 2 CA    1 
ATOM   4541  C  C     . CYS B  2  144 ? 20.390   -16.486  398.992 1.00 67.54  ? 144 CYS 2 C     1 
ATOM   4542  O  O     . CYS B  2  144 ? 21.231   -16.232  399.857 1.00 65.68  ? 144 CYS 2 O     1 
ATOM   4543  C  CB    . CYS B  2  144 ? 18.654   -16.256  400.792 1.00 79.71  ? 144 CYS 2 CB    1 
ATOM   4544  S  SG    . CYS B  2  144 ? 17.047   -16.820  401.427 1.00 85.85  ? 144 CYS 2 SG    1 
ATOM   4545  N  N     . VAL B  2  145 ? 20.727   -16.838  397.751 1.00 66.84  ? 145 VAL 2 N     1 
ATOM   4546  C  CA    . VAL B  2  145 ? 22.107   -17.169  397.406 1.00 66.90  ? 145 VAL 2 CA    1 
ATOM   4547  C  C     . VAL B  2  145 ? 22.948   -15.902  397.353 1.00 69.36  ? 145 VAL 2 C     1 
ATOM   4548  O  O     . VAL B  2  145 ? 22.981   -15.202  396.337 1.00 68.79  ? 145 VAL 2 O     1 
ATOM   4549  C  CB    . VAL B  2  145 ? 22.201   -17.922  396.064 1.00 64.24  ? 145 VAL 2 CB    1 
ATOM   4550  C  CG1   . VAL B  2  145 ? 23.648   -18.317  395.772 1.00 63.14  ? 145 VAL 2 CG1   1 
ATOM   4551  C  CG2   . VAL B  2  145 ? 21.312   -19.135  396.073 1.00 64.11  ? 145 VAL 2 CG2   1 
ATOM   4552  N  N     . THR B  2  146 ? 23.664   -15.621  398.431 1.00 71.00  ? 146 THR 2 N     1 
ATOM   4553  C  CA    . THR B  2  146 ? 24.641   -14.550  398.426 1.00 71.75  ? 146 THR 2 CA    1 
ATOM   4554  C  C     . THR B  2  146 ? 26.021   -15.127  398.142 1.00 69.01  ? 146 THR 2 C     1 
ATOM   4555  O  O     . THR B  2  146 ? 26.221   -16.343  398.114 1.00 66.55  ? 146 THR 2 O     1 
ATOM   4556  C  CB    . THR B  2  146 ? 24.626   -13.792  399.760 1.00 74.57  ? 146 THR 2 CB    1 
ATOM   4557  O  OG1   . THR B  2  146 ? 25.536   -12.687  399.690 1.00 79.40  ? 146 THR 2 OG1   1 
ATOM   4558  C  CG2   . THR B  2  146 ? 25.022   -14.700  400.921 1.00 71.51  ? 146 THR 2 CG2   1 
ATOM   4559  N  N     . ARG B  2  147 ? 26.979   -14.227  397.911 1.00 101.45 ? 147 ARG 2 N     1 
ATOM   4560  C  CA    . ARG B  2  147 ? 28.333   -14.666  397.596 1.00 100.96 ? 147 ARG 2 CA    1 
ATOM   4561  C  C     . ARG B  2  147 ? 28.883   -15.551  398.706 1.00 100.97 ? 147 ARG 2 C     1 
ATOM   4562  O  O     . ARG B  2  147 ? 29.510   -16.581  398.437 1.00 97.52  ? 147 ARG 2 O     1 
ATOM   4563  C  CB    . ARG B  2  147 ? 29.234   -13.448  397.372 1.00 98.22  ? 147 ARG 2 CB    1 
ATOM   4564  C  CG    . ARG B  2  147 ? 30.198   -13.583  396.204 1.00 95.39  ? 147 ARG 2 CG    1 
ATOM   4565  C  CD    . ARG B  2  147 ? 30.602   -12.224  395.666 1.00 91.91  ? 147 ARG 2 CD    1 
ATOM   4566  N  NE    . ARG B  2  147 ? 29.472   -11.304  395.570 1.00 90.57  ? 147 ARG 2 NE    1 
ATOM   4567  C  CZ    . ARG B  2  147 ? 29.520   -10.136  394.935 1.00 91.18  ? 147 ARG 2 CZ    1 
ATOM   4568  N  NH1   . ARG B  2  147 ? 30.642   -9.746   394.341 1.00 92.37  ? 147 ARG 2 NH1   1 
ATOM   4569  N  NH2   . ARG B  2  147 ? 28.451   -9.351   394.891 1.00 90.30  ? 147 ARG 2 NH2   1 
ATOM   4570  N  N     . ALA B  2  148 ? 28.624   -15.181  399.961 1.00 105.77 ? 148 ALA 2 N     1 
ATOM   4571  C  CA    . ALA B  2  148 ? 29.069   -16.001  401.081 1.00 109.91 ? 148 ALA 2 CA    1 
ATOM   4572  C  C     . ALA B  2  148 ? 28.327   -17.328  401.111 1.00 115.12 ? 148 ALA 2 C     1 
ATOM   4573  O  O     . ALA B  2  148 ? 28.940   -18.384  401.294 1.00 115.37 ? 148 ALA 2 O     1 
ATOM   4574  C  CB    . ALA B  2  148 ? 28.877   -15.247  402.397 1.00 109.54 ? 148 ALA 2 CB    1 
ATOM   4575  N  N     . ARG B  2  149 ? 27.003   -17.291  400.933 1.00 120.48 ? 149 ARG 2 N     1 
ATOM   4576  C  CA    . ARG B  2  149 ? 26.217   -18.523  400.896 1.00 124.47 ? 149 ARG 2 CA    1 
ATOM   4577  C  C     . ARG B  2  149 ? 26.641   -19.408  399.730 1.00 127.79 ? 149 ARG 2 C     1 
ATOM   4578  O  O     . ARG B  2  149 ? 26.787   -20.626  399.884 1.00 126.53 ? 149 ARG 2 O     1 
ATOM   4579  C  CB    . ARG B  2  149 ? 24.726   -18.188  400.798 1.00 123.75 ? 149 ARG 2 CB    1 
ATOM   4580  C  CG    . ARG B  2  149 ? 23.790   -19.088  401.599 1.00 122.94 ? 149 ARG 2 CG    1 
ATOM   4581  C  CD    . ARG B  2  149 ? 22.472   -18.363  401.852 1.00 122.94 ? 149 ARG 2 CD    1 
ATOM   4582  N  NE    . ARG B  2  149 ? 21.703   -18.913  402.965 1.00 123.71 ? 149 ARG 2 NE    1 
ATOM   4583  C  CZ    . ARG B  2  149 ? 20.967   -20.022  402.902 1.00 125.66 ? 149 ARG 2 CZ    1 
ATOM   4584  N  NH1   . ARG B  2  149 ? 20.890   -20.719  401.774 1.00 126.51 ? 149 ARG 2 NH1   1 
ATOM   4585  N  NH2   . ARG B  2  149 ? 20.299   -20.436  403.970 1.00 126.16 ? 149 ARG 2 NH2   1 
ATOM   4586  N  N     . LEU B  2  150 ? 26.852   -18.804  398.558 1.00 131.86 ? 150 LEU 2 N     1 
ATOM   4587  C  CA    . LEU B  2  150 ? 27.313   -19.546  397.387 1.00 134.88 ? 150 LEU 2 CA    1 
ATOM   4588  C  C     . LEU B  2  150 ? 28.653   -20.229  397.652 1.00 132.80 ? 150 LEU 2 C     1 
ATOM   4589  O  O     . LEU B  2  150 ? 28.802   -21.438  397.434 1.00 132.59 ? 150 LEU 2 O     1 
ATOM   4590  C  CB    . LEU B  2  150 ? 27.398   -18.593  396.188 1.00 138.57 ? 150 LEU 2 CB    1 
ATOM   4591  C  CG    . LEU B  2  150 ? 27.833   -19.049  394.789 1.00 141.09 ? 150 LEU 2 CG    1 
ATOM   4592  C  CD1   . LEU B  2  150 ? 29.349   -18.960  394.626 1.00 142.24 ? 150 LEU 2 CD1   1 
ATOM   4593  C  CD2   . LEU B  2  150 ? 27.334   -20.460  394.493 1.00 141.43 ? 150 LEU 2 CD2   1 
ATOM   4594  N  N     . GLU B  2  151 ? 29.643   -19.464  398.124 1.00 129.84 ? 151 GLU 2 N     1 
ATOM   4595  C  CA    . GLU B  2  151 ? 30.978   -20.013  398.350 1.00 127.03 ? 151 GLU 2 CA    1 
ATOM   4596  C  C     . GLU B  2  151 ? 30.977   -21.060  399.461 1.00 122.90 ? 151 GLU 2 C     1 
ATOM   4597  O  O     . GLU B  2  151 ? 31.705   -22.058  399.381 1.00 122.99 ? 151 GLU 2 O     1 
ATOM   4598  C  CB    . GLU B  2  151 ? 31.956   -18.878  398.659 1.00 128.54 ? 151 GLU 2 CB    1 
ATOM   4599  C  CG    . GLU B  2  151 ? 32.272   -17.998  397.453 1.00 130.14 ? 151 GLU 2 CG    1 
ATOM   4600  C  CD    . GLU B  2  151 ? 32.780   -16.624  397.846 1.00 131.23 ? 151 GLU 2 CD    1 
ATOM   4601  O  OE1   . GLU B  2  151 ? 33.385   -16.500  398.931 1.00 131.58 ? 151 GLU 2 OE1   1 
ATOM   4602  O  OE2   . GLU B  2  151 ? 32.576   -15.666  397.072 1.00 131.54 ? 151 GLU 2 OE2   1 
ATOM   4603  N  N     . ALA B  2  152 ? 30.166   -20.856  400.504 1.00 118.08 ? 152 ALA 2 N     1 
ATOM   4604  C  CA    . ALA B  2  152 ? 30.100   -21.822  401.595 1.00 110.82 ? 152 ALA 2 CA    1 
ATOM   4605  C  C     . ALA B  2  152 ? 29.449   -23.114  401.132 1.00 102.84 ? 152 ALA 2 C     1 
ATOM   4606  O  O     . ALA B  2  152 ? 29.922   -24.206  401.464 1.00 103.64 ? 152 ALA 2 O     1 
ATOM   4607  C  CB    . ALA B  2  152 ? 29.338   -21.228  402.781 1.00 111.35 ? 152 ALA 2 CB    1 
ATOM   4608  N  N     . LEU B  2  153 ? 28.349   -23.005  400.383 1.00 95.66  ? 153 LEU 2 N     1 
ATOM   4609  C  CA    . LEU B  2  153 ? 27.743   -24.164  399.743 1.00 91.99  ? 153 LEU 2 CA    1 
ATOM   4610  C  C     . LEU B  2  153 ? 28.767   -24.909  398.896 1.00 89.96  ? 153 LEU 2 C     1 
ATOM   4611  O  O     . LEU B  2  153 ? 28.859   -26.141  398.947 1.00 88.56  ? 153 LEU 2 O     1 
ATOM   4612  C  CB    . LEU B  2  153 ? 26.556   -23.701  398.893 1.00 90.78  ? 153 LEU 2 CB    1 
ATOM   4613  C  CG    . LEU B  2  153 ? 25.680   -24.691  398.125 1.00 89.09  ? 153 LEU 2 CG    1 
ATOM   4614  C  CD1   . LEU B  2  153 ? 26.219   -24.909  396.708 1.00 88.32  ? 153 LEU 2 CD1   1 
ATOM   4615  C  CD2   . LEU B  2  153 ? 25.540   -26.007  398.882 1.00 89.10  ? 153 LEU 2 CD2   1 
ATOM   4616  N  N     . LEU B  2  154 ? 29.549   -24.167  398.109 1.00 90.39  ? 154 LEU 2 N     1 
ATOM   4617  C  CA    . LEU B  2  154 ? 30.512   -24.796  397.211 1.00 92.05  ? 154 LEU 2 CA    1 
ATOM   4618  C  C     . LEU B  2  154 ? 31.602   -25.530  397.985 1.00 94.32  ? 154 LEU 2 C     1 
ATOM   4619  O  O     . LEU B  2  154 ? 31.972   -26.654  397.631 1.00 94.84  ? 154 LEU 2 O     1 
ATOM   4620  C  CB    . LEU B  2  154 ? 31.116   -23.746  396.279 1.00 92.26  ? 154 LEU 2 CB    1 
ATOM   4621  C  CG    . LEU B  2  154 ? 30.331   -23.575  394.976 1.00 92.93  ? 154 LEU 2 CG    1 
ATOM   4622  C  CD1   . LEU B  2  154 ? 31.100   -22.723  393.979 1.00 94.00  ? 154 LEU 2 CD1   1 
ATOM   4623  C  CD2   . LEU B  2  154 ? 29.984   -24.935  394.375 1.00 92.42  ? 154 LEU 2 CD2   1 
ATOM   4624  N  N     . ALA B  2  155 ? 32.134   -24.908  399.038 1.00 97.50  ? 155 ALA 2 N     1 
ATOM   4625  C  CA    . ALA B  2  155 ? 33.186   -25.550  399.822 1.00 98.77  ? 155 ALA 2 CA    1 
ATOM   4626  C  C     . ALA B  2  155 ? 32.650   -26.759  400.585 1.00 96.26  ? 155 ALA 2 C     1 
ATOM   4627  O  O     . ALA B  2  155 ? 33.328   -27.790  400.682 1.00 95.96  ? 155 ALA 2 O     1 
ATOM   4628  C  CB    . ALA B  2  155 ? 33.817   -24.539  400.782 1.00 100.58 ? 155 ALA 2 CB    1 
ATOM   4629  N  N     . GLY B  2  156 ? 31.432   -26.656  401.123 1.00 93.30  ? 156 GLY 2 N     1 
ATOM   4630  C  CA    . GLY B  2  156 ? 30.847   -27.782  401.830 1.00 89.04  ? 156 GLY 2 CA    1 
ATOM   4631  C  C     . GLY B  2  156 ? 30.602   -28.962  400.914 1.00 87.17  ? 156 GLY 2 C     1 
ATOM   4632  O  O     . GLY B  2  156 ? 30.941   -30.100  401.247 1.00 88.58  ? 156 GLY 2 O     1 
ATOM   4633  N  N     . LEU B  2  157 ? 30.015   -28.706  399.739 1.00 83.05  ? 157 LEU 2 N     1 
ATOM   4634  C  CA    . LEU B  2  157 ? 29.833   -29.782  398.771 1.00 79.86  ? 157 LEU 2 CA    1 
ATOM   4635  C  C     . LEU B  2  157 ? 31.176   -30.332  398.317 1.00 76.73  ? 157 LEU 2 C     1 
ATOM   4636  O  O     . LEU B  2  157 ? 31.306   -31.533  398.057 1.00 78.15  ? 157 LEU 2 O     1 
ATOM   4637  C  CB    . LEU B  2  157 ? 29.034   -29.291  397.562 1.00 82.87  ? 157 LEU 2 CB    1 
ATOM   4638  C  CG    . LEU B  2  157 ? 27.616   -28.779  397.816 1.00 76.47  ? 157 LEU 2 CG    1 
ATOM   4639  C  CD1   . LEU B  2  157 ? 26.929   -28.427  396.501 1.00 76.45  ? 157 LEU 2 CD1   1 
ATOM   4640  C  CD2   . LEU B  2  157 ? 26.798   -29.766  398.626 1.00 76.50  ? 157 LEU 2 CD2   1 
ATOM   4641  N  N     . ARG B  2  158 ? 32.184   -29.466  398.227 1.00 76.41  ? 158 ARG 2 N     1 
ATOM   4642  C  CA    . ARG B  2  158 ? 33.519   -29.897  397.841 1.00 77.35  ? 158 ARG 2 CA    1 
ATOM   4643  C  C     . ARG B  2  158 ? 34.125   -30.801  398.910 1.00 80.06  ? 158 ARG 2 C     1 
ATOM   4644  O  O     . ARG B  2  158 ? 34.895   -31.717  398.593 1.00 85.01  ? 158 ARG 2 O     1 
ATOM   4645  C  CB    . ARG B  2  158 ? 34.393   -28.660  397.615 1.00 81.63  ? 158 ARG 2 CB    1 
ATOM   4646  C  CG    . ARG B  2  158 ? 35.003   -28.522  396.228 1.00 82.19  ? 158 ARG 2 CG    1 
ATOM   4647  C  CD    . ARG B  2  158 ? 35.481   -27.082  396.014 1.00 84.30  ? 158 ARG 2 CD    1 
ATOM   4648  N  NE    . ARG B  2  158 ? 35.504   -26.699  394.604 1.00 85.00  ? 158 ARG 2 NE    1 
ATOM   4649  C  CZ    . ARG B  2  158 ? 35.419   -25.445  394.170 1.00 82.90  ? 158 ARG 2 CZ    1 
ATOM   4650  N  NH1   . ARG B  2  158 ? 35.293   -24.446  395.033 1.00 81.58  ? 158 ARG 2 NH1   1 
ATOM   4651  N  NH2   . ARG B  2  158 ? 35.444   -25.187  392.868 1.00 81.20  ? 158 ARG 2 NH2   1 
ATOM   4652  N  N     . ALA B  2  159 ? 33.768   -30.570  400.174 1.00 132.41 ? 159 ALA 2 N     1 
ATOM   4653  C  CA    . ALA B  2  159 ? 34.243   -31.361  401.299 1.00 133.92 ? 159 ALA 2 CA    1 
ATOM   4654  C  C     . ALA B  2  159 ? 33.265   -32.456  401.709 1.00 137.02 ? 159 ALA 2 C     1 
ATOM   4655  O  O     . ALA B  2  159 ? 33.490   -33.116  402.727 1.00 137.61 ? 159 ALA 2 O     1 
ATOM   4656  C  CB    . ALA B  2  159 ? 34.536   -30.456  402.497 1.00 134.54 ? 159 ALA 2 CB    1 
ATOM   4657  N  N     . GLY B  2  160 ? 32.185   -32.656  400.956 1.00 136.41 ? 160 GLY 2 N     1 
ATOM   4658  C  CA    . GLY B  2  160 ? 31.300   -33.780  401.198 1.00 134.40 ? 160 GLY 2 CA    1 
ATOM   4659  C  C     . GLY B  2  160 ? 30.190   -33.570  402.203 1.00 132.62 ? 160 GLY 2 C     1 
ATOM   4660  O  O     . GLY B  2  160 ? 29.637   -34.557  402.698 1.00 130.26 ? 160 GLY 2 O     1 
ATOM   4661  N  N     . LYS B  2  161 ? 29.854   -32.328  402.541 1.00 135.18 ? 161 LYS 2 N     1 
ATOM   4662  C  CA    . LYS B  2  161 ? 28.723   -32.074  403.425 1.00 138.06 ? 161 LYS 2 CA    1 
ATOM   4663  C  C     . LYS B  2  161 ? 27.414   -32.261  402.665 1.00 140.23 ? 161 LYS 2 C     1 
ATOM   4664  O  O     . LYS B  2  161 ? 27.249   -31.739  401.559 1.00 140.71 ? 161 LYS 2 O     1 
ATOM   4665  C  CB    . LYS B  2  161 ? 28.789   -30.657  404.002 1.00 137.64 ? 161 LYS 2 CB    1 
ATOM   4666  C  CG    . LYS B  2  161 ? 29.480   -30.533  405.356 1.00 136.05 ? 161 LYS 2 CG    1 
ATOM   4667  C  CD    . LYS B  2  161 ? 29.434   -29.097  405.865 1.00 133.03 ? 161 LYS 2 CD    1 
ATOM   4668  C  CE    . LYS B  2  161 ? 29.007   -29.056  407.325 1.00 131.71 ? 161 LYS 2 CE    1 
ATOM   4669  N  NZ    . LYS B  2  161 ? 28.229   -27.828  407.650 1.00 131.60 ? 161 LYS 2 NZ    1 
ATOM   4670  N  N     . ARG B  2  162 ? 26.487   -33.015  403.253 1.00 140.77 ? 162 ARG 2 N     1 
ATOM   4671  C  CA    . ARG B  2  162 ? 25.189   -33.213  402.623 1.00 139.71 ? 162 ARG 2 CA    1 
ATOM   4672  C  C     . ARG B  2  162 ? 24.404   -31.909  402.629 1.00 137.78 ? 162 ARG 2 C     1 
ATOM   4673  O  O     . ARG B  2  162 ? 24.398   -31.177  403.622 1.00 137.40 ? 162 ARG 2 O     1 
ATOM   4674  C  CB    . ARG B  2  162 ? 24.390   -34.302  403.338 1.00 141.00 ? 162 ARG 2 CB    1 
ATOM   4675  C  CG    . ARG B  2  162 ? 24.935   -35.714  403.180 1.00 142.37 ? 162 ARG 2 CG    1 
ATOM   4676  C  CD    . ARG B  2  162 ? 23.853   -36.743  403.508 1.00 143.91 ? 162 ARG 2 CD    1 
ATOM   4677  N  NE    . ARG B  2  162 ? 23.405   -36.666  404.894 1.00 144.85 ? 162 ARG 2 NE    1 
ATOM   4678  C  CZ    . ARG B  2  162 ? 23.937   -37.362  405.894 1.00 145.05 ? 162 ARG 2 CZ    1 
ATOM   4679  N  NH1   . ARG B  2  162 ? 24.938   -38.199  405.664 1.00 145.14 ? 162 ARG 2 NH1   1 
ATOM   4680  N  NH2   . ARG B  2  162 ? 23.459   -37.224  407.124 1.00 145.15 ? 162 ARG 2 NH2   1 
ATOM   4681  N  N     . LEU B  2  163 ? 23.743   -31.617  401.506 1.00 137.92 ? 163 LEU 2 N     1 
ATOM   4682  C  CA    . LEU B  2  163 ? 22.985   -30.374  401.392 1.00 140.83 ? 163 LEU 2 CA    1 
ATOM   4683  C  C     . LEU B  2  163 ? 21.983   -30.232  402.531 1.00 143.32 ? 163 LEU 2 C     1 
ATOM   4684  O  O     . LEU B  2  163 ? 21.730   -29.121  403.013 1.00 142.55 ? 163 LEU 2 O     1 
ATOM   4685  C  CB    . LEU B  2  163 ? 22.271   -30.314  400.040 1.00 142.24 ? 163 LEU 2 CB    1 
ATOM   4686  C  CG    . LEU B  2  163 ? 21.545   -29.004  399.717 1.00 142.85 ? 163 LEU 2 CG    1 
ATOM   4687  C  CD1   . LEU B  2  163 ? 21.813   -28.607  398.280 1.00 142.93 ? 163 LEU 2 CD1   1 
ATOM   4688  C  CD2   . LEU B  2  163 ? 20.043   -29.104  399.974 1.00 142.85 ? 163 LEU 2 CD2   1 
ATOM   4689  N  N     . GLU B  2  164 ? 21.395   -31.350  402.966 1.00 146.50 ? 164 GLU 2 N     1 
ATOM   4690  C  CA    . GLU B  2  164 ? 20.449   -31.320  404.076 1.00 149.49 ? 164 GLU 2 CA    1 
ATOM   4691  C  C     . GLU B  2  164 ? 21.070   -30.714  405.329 1.00 152.25 ? 164 GLU 2 C     1 
ATOM   4692  O  O     . GLU B  2  164 ? 20.361   -30.112  406.145 1.00 152.63 ? 164 GLU 2 O     1 
ATOM   4693  C  CB    . GLU B  2  164 ? 19.952   -32.735  404.371 1.00 149.78 ? 164 GLU 2 CB    1 
ATOM   4694  C  CG    . GLU B  2  164 ? 21.080   -33.716  404.665 1.00 151.12 ? 164 GLU 2 CG    1 
ATOM   4695  C  CD    . GLU B  2  164 ? 20.652   -35.166  404.555 1.00 152.92 ? 164 GLU 2 CD    1 
ATOM   4696  O  OE1   . GLU B  2  164 ? 19.786   -35.474  403.710 1.00 153.62 ? 164 GLU 2 OE1   1 
ATOM   4697  O  OE2   . GLU B  2  164 ? 21.180   -36.002  405.321 1.00 153.56 ? 164 GLU 2 OE2   1 
ATOM   4698  N  N     . GLU B  2  165 ? 22.384   -30.861  405.501 1.00 153.40 ? 165 GLU 2 N     1 
ATOM   4699  C  CA    . GLU B  2  165 ? 23.096   -30.387  406.688 1.00 155.16 ? 165 GLU 2 CA    1 
ATOM   4700  C  C     . GLU B  2  165 ? 24.330   -29.591  406.263 1.00 152.93 ? 165 GLU 2 C     1 
ATOM   4701  O  O     . GLU B  2  165 ? 25.434   -30.134  406.178 1.00 153.89 ? 165 GLU 2 O     1 
ATOM   4702  C  CB    . GLU B  2  165 ? 23.469   -31.565  407.580 1.00 156.23 ? 165 GLU 2 CB    1 
ATOM   4703  C  CG    . GLU B  2  165 ? 23.966   -32.770  406.804 1.00 157.93 ? 165 GLU 2 CG    1 
ATOM   4704  C  CD    . GLU B  2  165 ? 23.897   -34.036  407.616 1.00 159.47 ? 165 GLU 2 CD    1 
ATOM   4705  O  OE1   . GLU B  2  165 ? 22.857   -34.260  408.268 1.00 160.29 ? 165 GLU 2 OE1   1 
ATOM   4706  O  OE2   . GLU B  2  165 ? 24.879   -34.807  407.602 1.00 160.38 ? 165 GLU 2 OE2   1 
ATOM   4707  N  N     . ILE B  2  166 ? 24.144   -28.300  406.001 1.00 87.61  ? 166 ILE 2 N     1 
ATOM   4708  C  CA    . ILE B  2  166 ? 25.249   -27.384  405.732 1.00 87.18  ? 166 ILE 2 CA    1 
ATOM   4709  C  C     . ILE B  2  166 ? 24.976   -26.083  406.468 1.00 87.23  ? 166 ILE 2 C     1 
ATOM   4710  O  O     . ILE B  2  166 ? 23.840   -25.596  406.493 1.00 87.75  ? 166 ILE 2 O     1 
ATOM   4711  C  CB    . ILE B  2  166 ? 25.463   -27.136  404.218 1.00 90.97  ? 166 ILE 2 CB    1 
ATOM   4712  C  CG1   . ILE B  2  166 ? 26.033   -28.387  403.539 1.00 92.56  ? 166 ILE 2 CG1   1 
ATOM   4713  C  CG2   . ILE B  2  166 ? 26.362   -25.926  403.967 1.00 89.52  ? 166 ILE 2 CG2   1 
ATOM   4714  C  CD1   . ILE B  2  166 ? 26.631   -28.147  402.153 1.00 93.22  ? 166 ILE 2 CD1   1 
ATOM   4715  N  N     . GLU B  2  167 ? 26.017   -25.523  407.074 1.00 83.56  ? 167 GLU 2 N     1 
ATOM   4716  C  CA    . GLU B  2  167 ? 25.896   -24.248  407.764 1.00 81.53  ? 167 GLU 2 CA    1 
ATOM   4717  C  C     . GLU B  2  167 ? 25.829   -23.124  406.735 1.00 77.59  ? 167 GLU 2 C     1 
ATOM   4718  O  O     . GLU B  2  167 ? 26.780   -22.905  405.979 1.00 76.41  ? 167 GLU 2 O     1 
ATOM   4719  C  CB    . GLU B  2  167 ? 27.064   -24.050  408.734 1.00 81.56  ? 167 GLU 2 CB    1 
ATOM   4720  C  CG    . GLU B  2  167 ? 28.449   -24.335  408.146 1.00 79.27  ? 167 GLU 2 CG    1 
ATOM   4721  C  CD    . GLU B  2  167 ? 29.583   -23.873  409.051 1.00 74.17  ? 167 GLU 2 CD    1 
ATOM   4722  O  OE1   . GLU B  2  167 ? 29.394   -23.825  410.287 1.00 71.64  ? 167 GLU 2 OE1   1 
ATOM   4723  O  OE2   . GLU B  2  167 ? 30.672   -23.571  408.522 1.00 71.84  ? 167 GLU 2 OE2   1 
ATOM   4724  N  N     . LEU B  2  168 ? 24.699   -22.422  406.696 1.00 76.52  ? 168 LEU 2 N     1 
ATOM   4725  C  CA    . LEU B  2  168 ? 24.458   -21.384  405.703 1.00 76.40  ? 168 LEU 2 CA    1 
ATOM   4726  C  C     . LEU B  2  168 ? 24.329   -20.033  406.397 1.00 76.35  ? 168 LEU 2 C     1 
ATOM   4727  O  O     . LEU B  2  168 ? 23.418   -19.848  407.225 1.00 72.67  ? 168 LEU 2 O     1 
ATOM   4728  C  CB    . LEU B  2  168 ? 23.200   -21.700  404.886 1.00 75.72  ? 168 LEU 2 CB    1 
ATOM   4729  C  CG    . LEU B  2  168 ? 23.229   -22.960  404.014 1.00 74.75  ? 168 LEU 2 CG    1 
ATOM   4730  C  CD1   . LEU B  2  168 ? 21.825   -23.359  403.578 1.00 73.92  ? 168 LEU 2 CD1   1 
ATOM   4731  C  CD2   . LEU B  2  168 ? 24.127   -22.748  402.801 1.00 73.99  ? 168 LEU 2 CD2   1 
ATOM   4732  N  N     . PRO B  2  169 ? 25.221   -19.078  406.124 1.00 81.15  ? 169 PRO 2 N     1 
ATOM   4733  C  CA    . PRO B  2  169 ? 25.072   -17.733  406.698 1.00 84.27  ? 169 PRO 2 CA    1 
ATOM   4734  C  C     . PRO B  2  169 ? 23.768   -17.079  406.257 1.00 89.03  ? 169 PRO 2 C     1 
ATOM   4735  O  O     . PRO B  2  169 ? 23.227   -17.376  405.190 1.00 92.65  ? 169 PRO 2 O     1 
ATOM   4736  C  CB    . PRO B  2  169 ? 26.291   -16.973  406.157 1.00 83.50  ? 169 PRO 2 CB    1 
ATOM   4737  C  CG    . PRO B  2  169 ? 26.802   -17.806  405.010 1.00 84.27  ? 169 PRO 2 CG    1 
ATOM   4738  C  CD    . PRO B  2  169 ? 26.468   -19.222  405.353 1.00 83.34  ? 169 PRO 2 CD    1 
ATOM   4739  N  N     . GLY B  2  170 ? 23.259   -16.183  407.099 1.00 89.05  ? 170 GLY 2 N     1 
ATOM   4740  C  CA    . GLY B  2  170 ? 22.043   -15.465  406.787 1.00 88.46  ? 170 GLY 2 CA    1 
ATOM   4741  C  C     . GLY B  2  170 ? 20.799   -16.293  407.055 1.00 89.84  ? 170 GLY 2 C     1 
ATOM   4742  O  O     . GLY B  2  170 ? 20.846   -17.490  407.346 1.00 87.78  ? 170 GLY 2 O     1 
ATOM   4743  N  N     . LYS B  2  171 ? 19.654   -15.625  406.943 1.00 93.13  ? 171 LYS 2 N     1 
ATOM   4744  C  CA    . LYS B  2  171 ? 18.352   -16.241  407.148 1.00 95.13  ? 171 LYS 2 CA    1 
ATOM   4745  C  C     . LYS B  2  171 ? 17.602   -16.348  405.827 1.00 93.56  ? 171 LYS 2 C     1 
ATOM   4746  O  O     . LYS B  2  171 ? 17.661   -15.439  404.994 1.00 91.71  ? 171 LYS 2 O     1 
ATOM   4747  C  CB    . LYS B  2  171 ? 17.527   -15.435  408.156 1.00 97.73  ? 171 LYS 2 CB    1 
ATOM   4748  C  CG    . LYS B  2  171 ? 17.503   -13.941  407.862 1.00 99.39  ? 171 LYS 2 CG    1 
ATOM   4749  C  CD    . LYS B  2  171 ? 16.269   -13.276  408.443 1.00 99.79  ? 171 LYS 2 CD    1 
ATOM   4750  C  CE    . LYS B  2  171 ? 16.496   -11.786  408.619 1.00 98.88  ? 171 LYS 2 CE    1 
ATOM   4751  N  NZ    . LYS B  2  171 ? 16.384   -11.073  407.323 1.00 97.95  ? 171 LYS 2 NZ    1 
ATOM   4752  N  N     . CYS B  2  172 ? 16.919   -17.475  405.635 1.00 94.58  ? 172 CYS 2 N     1 
ATOM   4753  C  CA    . CYS B  2  172 ? 16.046   -17.708  404.489 1.00 95.52  ? 172 CYS 2 CA    1 
ATOM   4754  C  C     . CYS B  2  172 ? 14.648   -17.904  405.055 1.00 91.82  ? 172 CYS 2 C     1 
ATOM   4755  O  O     . CYS B  2  172 ? 14.371   -18.933  405.683 1.00 91.21  ? 172 CYS 2 O     1 
ATOM   4756  C  CB    . CYS B  2  172 ? 16.472   -18.930  403.671 1.00 99.38  ? 172 CYS 2 CB    1 
ATOM   4757  S  SG    . CYS B  2  172 ? 17.604   -18.651  402.279 1.00 103.15 ? 172 CYS 2 SG    1 
ATOM   4758  N  N     . GLY B  2  173 ? 13.776   -16.921  404.843 1.00 87.07  ? 173 GLY 2 N     1 
ATOM   4759  C  CA    . GLY B  2  173 ? 12.453   -16.988  405.428 1.00 80.73  ? 173 GLY 2 CA    1 
ATOM   4760  C  C     . GLY B  2  173 ? 11.676   -18.189  404.930 1.00 74.11  ? 173 GLY 2 C     1 
ATOM   4761  O  O     . GLY B  2  173 ? 11.987   -18.791  403.900 1.00 73.02  ? 173 GLY 2 O     1 
ATOM   4762  N  N     . HIS B  2  174 ? 10.625   -18.533  405.672 1.00 69.66  ? 174 HIS 2 N     1 
ATOM   4763  C  CA    . HIS B  2  174 ? 9.806    -19.661  405.249 1.00 68.67  ? 174 HIS 2 CA    1 
ATOM   4764  C  C     . HIS B  2  174 ? 8.846    -19.239  404.145 1.00 68.75  ? 174 HIS 2 C     1 
ATOM   4765  O  O     . HIS B  2  174 ? 8.974    -19.677  402.999 1.00 68.16  ? 174 HIS 2 O     1 
ATOM   4766  C  CB    . HIS B  2  174 ? 9.052    -20.253  406.443 1.00 69.09  ? 174 HIS 2 CB    1 
ATOM   4767  C  CG    . HIS B  2  174 ? 8.515    -21.631  406.196 1.00 68.37  ? 174 HIS 2 CG    1 
ATOM   4768  N  ND1   . HIS B  2  174 ? 9.327    -22.706  405.897 1.00 64.86  ? 174 HIS 2 ND1   1 
ATOM   4769  C  CD2   . HIS B  2  174 ? 7.246    -22.105  406.201 1.00 64.79  ? 174 HIS 2 CD2   1 
ATOM   4770  C  CE1   . HIS B  2  174 ? 8.580    -23.783  405.734 1.00 64.80  ? 174 HIS 2 CE1   1 
ATOM   4771  N  NE2   . HIS B  2  174 ? 7.315    -23.445  405.912 1.00 68.08  ? 174 HIS 2 NE2   1 
ATOM   4772  N  N     . HIS B  2  175 ? 7.909    -18.343  404.464 1.00 70.51  ? 175 HIS 2 N     1 
ATOM   4773  C  CA    . HIS B  2  175 ? 6.991    -17.796  403.474 1.00 67.82  ? 175 HIS 2 CA    1 
ATOM   4774  C  C     . HIS B  2  175 ? 7.043    -16.278  403.361 1.00 64.73  ? 175 HIS 2 C     1 
ATOM   4775  O  O     . HIS B  2  175 ? 6.561    -15.735  402.359 1.00 64.67  ? 175 HIS 2 O     1 
ATOM   4776  C  CB    . HIS B  2  175 ? 5.542    -18.240  403.764 1.00 68.24  ? 175 HIS 2 CB    1 
ATOM   4777  C  CG    . HIS B  2  175 ? 5.097    -18.032  405.183 1.00 68.45  ? 175 HIS 2 CG    1 
ATOM   4778  N  ND1   . HIS B  2  175 ? 5.818    -18.483  406.270 1.00 64.78  ? 175 HIS 2 ND1   1 
ATOM   4779  C  CD2   . HIS B  2  175 ? 3.980    -17.454  405.687 1.00 64.69  ? 175 HIS 2 CD2   1 
ATOM   4780  C  CE1   . HIS B  2  175 ? 5.174    -18.174  407.381 1.00 64.80  ? 175 HIS 2 CE1   1 
ATOM   4781  N  NE2   . HIS B  2  175 ? 4.056    -17.550  407.055 1.00 64.75  ? 175 HIS 2 NE2   1 
ATOM   4782  N  N     . VAL B  2  176 ? 7.634    -15.587  404.337 1.00 65.97  ? 176 VAL 2 N     1 
ATOM   4783  C  CA    . VAL B  2  176 ? 7.958    -14.172  404.236 1.00 69.17  ? 176 VAL 2 CA    1 
ATOM   4784  C  C     . VAL B  2  176 ? 9.426    -14.015  404.613 1.00 72.23  ? 176 VAL 2 C     1 
ATOM   4785  O  O     . VAL B  2  176 ? 10.013   -14.869  405.281 1.00 70.58  ? 176 VAL 2 O     1 
ATOM   4786  C  CB    . VAL B  2  176 ? 7.054    -13.294  405.133 1.00 67.34  ? 176 VAL 2 CB    1 
ATOM   4787  C  CG1   . VAL B  2  176 ? 5.603    -13.345  404.642 1.00 65.55  ? 176 VAL 2 CG1   1 
ATOM   4788  C  CG2   . VAL B  2  176 ? 7.159    -13.723  406.600 1.00 66.30  ? 176 VAL 2 CG2   1 
ATOM   4789  N  N     . HIS B  2  177 ? 10.028   -12.912  404.176 1.00 77.08  ? 177 HIS 2 N     1 
ATOM   4790  C  CA    . HIS B  2  177 ? 11.477   -12.801  404.295 1.00 79.23  ? 177 HIS 2 CA    1 
ATOM   4791  C  C     . HIS B  2  177 ? 11.875   -11.347  404.504 1.00 83.60  ? 177 HIS 2 C     1 
ATOM   4792  O  O     . HIS B  2  177 ? 11.507   -10.480  403.706 1.00 82.42  ? 177 HIS 2 O     1 
ATOM   4793  C  CB    . HIS B  2  177 ? 12.141   -13.395  403.043 1.00 79.52  ? 177 HIS 2 CB    1 
ATOM   4794  C  CG    . HIS B  2  177 ? 13.637   -13.336  403.049 1.00 72.82  ? 177 HIS 2 CG    1 
ATOM   4795  N  ND1   . HIS B  2  177 ? 14.402   -13.954  404.016 1.00 77.51  ? 177 HIS 2 ND1   1 
ATOM   4796  C  CD2   . HIS B  2  177 ? 14.510   -12.769  402.182 1.00 78.49  ? 177 HIS 2 CD2   1 
ATOM   4797  C  CE1   . HIS B  2  177 ? 15.680   -13.747  403.758 1.00 74.77  ? 177 HIS 2 CE1   1 
ATOM   4798  N  NE2   . HIS B  2  177 ? 15.774   -13.034  402.650 1.00 78.78  ? 177 HIS 2 NE2   1 
ATOM   4799  N  N     . GLU B  2  178 ? 12.599   -11.085  405.593 1.00 87.02  ? 178 GLU 2 N     1 
ATOM   4800  C  CA    . GLU B  2  178 ? 13.027   -9.740   405.966 1.00 92.47  ? 178 GLU 2 CA    1 
ATOM   4801  C  C     . GLU B  2  178 ? 14.376   -9.471   405.302 1.00 99.38  ? 178 GLU 2 C     1 
ATOM   4802  O  O     . GLU B  2  178 ? 15.368   -10.143  405.605 1.00 98.70  ? 178 GLU 2 O     1 
ATOM   4803  C  CB    . GLU B  2  178 ? 13.122   -9.603   407.484 1.00 92.89  ? 178 GLU 2 CB    1 
ATOM   4804  C  CG    . GLU B  2  178 ? 14.008   -8.446   407.959 1.00 91.60  ? 178 GLU 2 CG    1 
ATOM   4805  C  CD    . GLU B  2  178 ? 13.225   -7.268   408.511 1.00 88.01  ? 178 GLU 2 CD    1 
ATOM   4806  O  OE1   . GLU B  2  178 ? 12.001   -7.389   408.709 1.00 87.13  ? 178 GLU 2 OE1   1 
ATOM   4807  O  OE2   . GLU B  2  178 ? 13.845   -6.210   408.737 1.00 86.93  ? 178 GLU 2 OE2   1 
ATOM   4808  N  N     . VAL B  2  179 ? 14.412   -8.513   404.377 1.00 104.70 ? 179 VAL 2 N     1 
ATOM   4809  C  CA    . VAL B  2  179 ? 15.634   -8.158   403.662 1.00 108.56 ? 179 VAL 2 CA    1 
ATOM   4810  C  C     . VAL B  2  179 ? 16.186   -6.868   404.257 1.00 110.19 ? 179 VAL 2 C     1 
ATOM   4811  O  O     . VAL B  2  179 ? 15.444   -5.895   404.451 1.00 108.89 ? 179 VAL 2 O     1 
ATOM   4812  C  CB    . VAL B  2  179 ? 15.374   -8.009   402.151 1.00 105.83 ? 179 VAL 2 CB    1 
ATOM   4813  C  CG1   . VAL B  2  179 ? 16.684   -7.805   401.391 1.00 106.05 ? 179 VAL 2 CG1   1 
ATOM   4814  C  CG2   . VAL B  2  179 ? 14.620   -9.215   401.615 1.00 104.49 ? 179 VAL 2 CG2   1 
ATOM   4815  N  N     . GLU B  2  180 ? 17.482   -6.862   404.559 1.00 115.24 ? 180 GLU 2 N     1 
ATOM   4816  C  CA    . GLU B  2  180 ? 18.153   -5.664   405.060 1.00 119.96 ? 180 GLU 2 CA    1 
ATOM   4817  C  C     . GLU B  2  180 ? 19.499   -5.469   404.364 1.00 120.77 ? 180 GLU 2 C     1 
ATOM   4818  O  O     . GLU B  2  180 ? 20.344   -6.365   404.361 1.00 120.87 ? 180 GLU 2 O     1 
ATOM   4819  C  CB    . GLU B  2  180 ? 18.351   -5.732   406.579 1.00 124.58 ? 180 GLU 2 CB    1 
ATOM   4820  C  CG    . GLU B  2  180 ? 17.056   -5.774   407.378 1.00 127.01 ? 180 GLU 2 CG    1 
ATOM   4821  C  CD    . GLU B  2  180 ? 17.250   -5.391   408.833 1.00 128.33 ? 180 GLU 2 CD    1 
ATOM   4822  O  OE1   . GLU B  2  180 ? 17.440   -4.186   409.112 1.00 127.80 ? 180 GLU 2 OE1   1 
ATOM   4823  O  OE2   . GLU B  2  180 ? 17.215   -6.295   409.695 1.00 128.70 ? 180 GLU 2 OE2   1 
ATOM   4824  N  N     . MET C  3  1   ? -30.268  -28.452  355.167 1.00 22.40  ? 1   MET 3 N     1 
ATOM   4825  C  CA    . MET C  3  1   ? -28.878  -27.989  355.150 1.00 27.09  ? 1   MET 3 CA    1 
ATOM   4826  C  C     . MET C  3  1   ? -28.663  -26.554  355.675 1.00 23.04  ? 1   MET 3 C     1 
ATOM   4827  O  O     . MET C  3  1   ? -29.580  -25.744  355.742 1.00 21.63  ? 1   MET 3 O     1 
ATOM   4828  C  CB    . MET C  3  1   ? -28.280  -28.127  353.732 1.00 29.62  ? 1   MET 3 CB    1 
ATOM   4829  C  CG    . MET C  3  1   ? -28.063  -29.581  353.249 1.00 28.58  ? 1   MET 3 CG    1 
ATOM   4830  S  SD    . MET C  3  1   ? -26.844  -29.753  351.903 1.00 24.46  ? 1   MET 3 SD    1 
ATOM   4831  C  CE    . MET C  3  1   ? -27.950  -29.570  350.492 1.00 25.95  ? 1   MET 3 CE    1 
ATOM   4832  N  N     . VAL C  3  2   ? -27.408  -26.265  356.004 1.00 21.66  ? 2   VAL 3 N     1 
ATOM   4833  C  CA    . VAL C  3  2   ? -26.982  -25.009  356.603 1.00 22.28  ? 2   VAL 3 CA    1 
ATOM   4834  C  C     . VAL C  3  2   ? -26.646  -24.036  355.482 1.00 22.40  ? 2   VAL 3 C     1 
ATOM   4835  O  O     . VAL C  3  2   ? -26.083  -24.423  354.453 1.00 22.38  ? 2   VAL 3 O     1 
ATOM   4836  C  CB    . VAL C  3  2   ? -25.779  -25.247  357.542 1.00 22.05  ? 2   VAL 3 CB    1 
ATOM   4837  C  CG1   . VAL C  3  2   ? -24.919  -24.016  357.664 1.00 33.29  ? 2   VAL 3 CG1   1 
ATOM   4838  C  CG2   . VAL C  3  2   ? -26.249  -25.671  358.935 1.00 21.83  ? 2   VAL 3 CG2   1 
ATOM   4839  N  N     . ARG C  3  3   ? -27.049  -22.776  355.671 1.00 22.72  ? 3   ARG 3 N     1 
ATOM   4840  C  CA    . ARG C  3  3   ? -26.823  -21.686  354.727 1.00 23.10  ? 3   ARG 3 CA    1 
ATOM   4841  C  C     . ARG C  3  3   ? -25.556  -20.931  355.120 1.00 23.43  ? 3   ARG 3 C     1 
ATOM   4842  O  O     . ARG C  3  3   ? -25.435  -20.501  356.269 1.00 23.52  ? 3   ARG 3 O     1 
ATOM   4843  C  CB    . ARG C  3  3   ? -28.015  -20.737  354.749 1.00 23.27  ? 3   ARG 3 CB    1 
ATOM   4844  C  CG    . ARG C  3  3   ? -28.388  -20.141  353.426 1.00 35.94  ? 3   ARG 3 CG    1 
ATOM   4845  C  CD    . ARG C  3  3   ? -29.485  -20.919  352.782 1.00 33.68  ? 3   ARG 3 CD    1 
ATOM   4846  N  NE    . ARG C  3  3   ? -30.141  -20.118  351.762 1.00 36.52  ? 3   ARG 3 NE    1 
ATOM   4847  C  CZ    . ARG C  3  3   ? -31.425  -20.231  351.455 1.00 43.26  ? 3   ARG 3 CZ    1 
ATOM   4848  N  NH1   . ARG C  3  3   ? -32.179  -21.127  352.088 1.00 46.46  ? 3   ARG 3 NH1   1 
ATOM   4849  N  NH2   . ARG C  3  3   ? -31.952  -19.467  350.506 1.00 44.26  ? 3   ARG 3 NH2   1 
ATOM   4850  N  N     . VAL C  3  4   ? -24.582  -20.824  354.209 1.00 28.07  ? 4   VAL 3 N     1 
ATOM   4851  C  CA    . VAL C  3  4   ? -23.358  -20.083  354.508 1.00 36.18  ? 4   VAL 3 CA    1 
ATOM   4852  C  C     . VAL C  3  4   ? -23.111  -19.049  353.413 1.00 50.21  ? 4   VAL 3 C     1 
ATOM   4853  O  O     . VAL C  3  4   ? -23.553  -19.217  352.273 1.00 55.95  ? 4   VAL 3 O     1 
ATOM   4854  C  CB    . VAL C  3  4   ? -22.139  -21.026  354.662 1.00 43.51  ? 4   VAL 3 CB    1 
ATOM   4855  C  CG1   . VAL C  3  4   ? -20.882  -20.258  355.082 1.00 44.27  ? 4   VAL 3 CG1   1 
ATOM   4856  C  CG2   . VAL C  3  4   ? -22.444  -22.117  355.671 1.00 48.28  ? 4   VAL 3 CG2   1 
ATOM   4857  N  N     . LYS C  3  5   ? -22.410  -17.966  353.765 1.00 55.49  ? 5   LYS 3 N     1 
ATOM   4858  C  CA    . LYS C  3  5   ? -22.106  -16.885  352.831 1.00 62.28  ? 5   LYS 3 CA    1 
ATOM   4859  C  C     . LYS C  3  5   ? -20.619  -16.546  352.866 1.00 64.64  ? 5   LYS 3 C     1 
ATOM   4860  O  O     . LYS C  3  5   ? -20.087  -16.205  353.928 1.00 69.31  ? 5   LYS 3 O     1 
ATOM   4861  C  CB    . LYS C  3  5   ? -22.932  -15.638  353.148 1.00 64.56  ? 5   LYS 3 CB    1 
ATOM   4862  C  CG    . LYS C  3  5   ? -22.798  -14.563  352.083 1.00 71.68  ? 5   LYS 3 CG    1 
ATOM   4863  C  CD    . LYS C  3  5   ? -23.652  -13.340  352.374 1.00 78.52  ? 5   LYS 3 CD    1 
ATOM   4864  C  CE    . LYS C  3  5   ? -22.891  -12.053  352.062 1.00 85.54  ? 5   LYS 3 CE    1 
ATOM   4865  N  NZ    . LYS C  3  5   ? -21.907  -11.679  353.120 1.00 86.40  ? 5   LYS 3 NZ    1 
ATOM   4866  N  N     . VAL C  3  6   ? -19.950  -16.652  351.709 1.00 58.87  ? 6   VAL 3 N     1 
ATOM   4867  C  CA    . VAL C  3  6   ? -18.571  -16.191  351.528 1.00 53.01  ? 6   VAL 3 CA    1 
ATOM   4868  C  C     . VAL C  3  6   ? -18.502  -15.002  350.568 1.00 43.62  ? 6   VAL 3 C     1 
ATOM   4869  O  O     . VAL C  3  6   ? -18.514  -15.166  349.338 1.00 26.17  ? 6   VAL 3 O     1 
ATOM   4870  C  CB    . VAL C  3  6   ? -17.648  -17.319  351.041 1.00 49.06  ? 6   VAL 3 CB    1 
ATOM   4871  C  CG1   . VAL C  3  6   ? -16.186  -16.814  350.998 1.00 44.92  ? 6   VAL 3 CG1   1 
ATOM   4872  C  CG2   . VAL C  3  6   ? -17.835  -18.576  351.904 1.00 50.37  ? 6   VAL 3 CG2   1 
ATOM   4873  N  N     . ASN C  3  7   ? -18.529  -13.802  351.140 1.00 26.48  ? 7   ASN 3 N     1 
ATOM   4874  C  CA    . ASN C  3  7   ? -18.102  -12.526  350.568 1.00 39.43  ? 7   ASN 3 CA    1 
ATOM   4875  C  C     . ASN C  3  7   ? -18.965  -11.999  349.427 1.00 41.93  ? 7   ASN 3 C     1 
ATOM   4876  O  O     . ASN C  3  7   ? -19.040  -10.781  349.228 1.00 36.27  ? 7   ASN 3 O     1 
ATOM   4877  C  CB    . ASN C  3  7   ? -16.660  -12.634  350.032 1.00 27.12  ? 7   ASN 3 CB    1 
ATOM   4878  C  CG    . ASN C  3  7   ? -15.605  -12.184  351.033 1.00 28.40  ? 7   ASN 3 CG    1 
ATOM   4879  O  OD1   . ASN C  3  7   ? -14.767  -12.958  351.485 1.00 27.20  ? 7   ASN 3 OD1   1 
ATOM   4880  N  ND2   . ASN C  3  7   ? -15.670  -10.923  351.407 1.00 32.11  ? 7   ASN 3 ND2   1 
ATOM   4881  N  N     . ASP C  3  8   ? -19.605  -12.886  348.664 1.00 47.65  ? 8   ASP 3 N     1 
ATOM   4882  C  CA    . ASP C  3  8   ? -20.741  -12.555  347.810 1.00 46.61  ? 8   ASP 3 CA    1 
ATOM   4883  C  C     . ASP C  3  8   ? -21.580  -13.789  347.489 1.00 44.76  ? 8   ASP 3 C     1 
ATOM   4884  O  O     . ASP C  3  8   ? -22.595  -13.683  346.791 1.00 45.95  ? 8   ASP 3 O     1 
ATOM   4885  C  CB    . ASP C  3  8   ? -20.263  -11.858  346.527 1.00 47.02  ? 8   ASP 3 CB    1 
ATOM   4886  C  CG    . ASP C  3  8   ? -19.248  -12.688  345.740 1.00 48.78  ? 8   ASP 3 CG    1 
ATOM   4887  O  OD1   . ASP C  3  8   ? -19.575  -13.796  345.250 1.00 47.96  ? 8   ASP 3 OD1   1 
ATOM   4888  O  OD2   . ASP C  3  8   ? -18.095  -12.221  345.622 1.00 48.03  ? 8   ASP 3 OD2   1 
ATOM   4889  N  N     . ARG C  3  9   ? -21.176  -14.968  347.973 1.00 40.98  ? 9   ARG 3 N     1 
ATOM   4890  C  CA    . ARG C  3  9   ? -21.790  -16.199  347.488 1.00 42.71  ? 9   ARG 3 CA    1 
ATOM   4891  C  C     . ARG C  3  9   ? -22.396  -17.024  348.615 1.00 37.78  ? 9   ARG 3 C     1 
ATOM   4892  O  O     . ARG C  3  9   ? -21.770  -17.241  349.651 1.00 25.16  ? 9   ARG 3 O     1 
ATOM   4893  C  CB    . ARG C  3  9   ? -20.771  -17.035  346.729 1.00 44.50  ? 9   ARG 3 CB    1 
ATOM   4894  C  CG    . ARG C  3  9   ? -20.708  -16.684  345.259 1.00 50.28  ? 9   ARG 3 CG    1 
ATOM   4895  C  CD    . ARG C  3  9   ? -19.760  -17.586  344.498 1.00 53.01  ? 9   ARG 3 CD    1 
ATOM   4896  N  NE    . ARG C  3  9   ? -18.856  -16.813  343.659 1.00 55.07  ? 9   ARG 3 NE    1 
ATOM   4897  C  CZ    . ARG C  3  9   ? -17.534  -16.891  343.725 1.00 57.74  ? 9   ARG 3 CZ    1 
ATOM   4898  N  NH1   . ARG C  3  9   ? -16.958  -17.721  344.583 1.00 58.19  ? 9   ARG 3 NH1   1 
ATOM   4899  N  NH2   . ARG C  3  9   ? -16.788  -16.146  342.920 1.00 60.21  ? 9   ARG 3 NH2   1 
ATOM   4900  N  N     . ILE C  3  10  ? -23.576  -17.579  348.356 1.00 34.43  ? 10  ILE 3 N     1 
ATOM   4901  C  CA    . ILE C  3  10  ? -24.347  -18.299  349.359 1.00 30.69  ? 10  ILE 3 CA    1 
ATOM   4902  C  C     . ILE C  3  10  ? -24.428  -19.754  348.928 1.00 30.08  ? 10  ILE 3 C     1 
ATOM   4903  O  O     . ILE C  3  10  ? -24.769  -20.049  347.775 1.00 24.10  ? 10  ILE 3 O     1 
ATOM   4904  C  CB    . ILE C  3  10  ? -25.750  -17.685  349.527 1.00 31.53  ? 10  ILE 3 CB    1 
ATOM   4905  C  CG1   . ILE C  3  10  ? -25.659  -16.180  349.749 1.00 38.09  ? 10  ILE 3 CG1   1 
ATOM   4906  C  CG2   . ILE C  3  10  ? -26.470  -18.267  350.716 1.00 33.21  ? 10  ILE 3 CG2   1 
ATOM   4907  C  CD1   . ILE C  3  10  ? -26.944  -15.464  349.423 1.00 43.42  ? 10  ILE 3 CD1   1 
ATOM   4908  N  N     . VAL C  3  11  ? -24.123  -20.660  349.851 1.00 23.88  ? 11  VAL 3 N     1 
ATOM   4909  C  CA    . VAL C  3  11  ? -24.052  -22.086  349.563 1.00 38.33  ? 11  VAL 3 CA    1 
ATOM   4910  C  C     . VAL C  3  11  ? -24.890  -22.834  350.596 1.00 42.63  ? 11  VAL 3 C     1 
ATOM   4911  O  O     . VAL C  3  11  ? -24.835  -22.513  351.792 1.00 42.38  ? 11  VAL 3 O     1 
ATOM   4912  C  CB    . VAL C  3  11  ? -22.604  -22.625  349.544 1.00 23.47  ? 11  VAL 3 CB    1 
ATOM   4913  C  CG1   . VAL C  3  11  ? -22.566  -23.884  348.747 1.00 32.17  ? 11  VAL 3 CG1   1 
ATOM   4914  C  CG2   . VAL C  3  11  ? -21.646  -21.648  348.903 1.00 23.90  ? 11  VAL 3 CG2   1 
ATOM   4915  N  N     . GLU C  3  12  ? -25.723  -23.770  350.115 1.00 39.46  ? 12  GLU 3 N     1 
ATOM   4916  C  CA    . GLU C  3  12  ? -26.254  -24.849  350.944 1.00 29.97  ? 12  GLU 3 CA    1 
ATOM   4917  C  C     . GLU C  3  12  ? -25.128  -25.817  351.252 1.00 22.26  ? 12  GLU 3 C     1 
ATOM   4918  O  O     . GLU C  3  12  ? -24.398  -26.228  350.348 1.00 22.19  ? 12  GLU 3 O     1 
ATOM   4919  C  CB    . GLU C  3  12  ? -27.367  -25.617  350.213 1.00 38.91  ? 12  GLU 3 CB    1 
ATOM   4920  C  CG    . GLU C  3  12  ? -28.645  -24.865  349.850 1.00 48.76  ? 12  GLU 3 CG    1 
ATOM   4921  C  CD    . GLU C  3  12  ? -29.526  -24.533  351.047 1.00 50.35  ? 12  GLU 3 CD    1 
ATOM   4922  O  OE1   . GLU C  3  12  ? -29.672  -25.373  351.960 1.00 48.34  ? 12  GLU 3 OE1   1 
ATOM   4923  O  OE2   . GLU C  3  12  ? -30.028  -23.394  351.104 1.00 51.86  ? 12  GLU 3 OE2   1 
ATOM   4924  N  N     . VAL C  3  13  ? -24.984  -26.189  352.517 1.00 23.48  ? 13  VAL 3 N     1 
ATOM   4925  C  CA    . VAL C  3  13  ? -23.880  -27.058  352.916 1.00 29.79  ? 13  VAL 3 CA    1 
ATOM   4926  C  C     . VAL C  3  13  ? -24.290  -27.863  354.145 1.00 36.99  ? 13  VAL 3 C     1 
ATOM   4927  O  O     . VAL C  3  13  ? -24.893  -27.308  355.077 1.00 47.87  ? 13  VAL 3 O     1 
ATOM   4928  C  CB    . VAL C  3  13  ? -22.603  -26.242  353.181 1.00 30.61  ? 13  VAL 3 CB    1 
ATOM   4929  C  CG1   . VAL C  3  13  ? -22.673  -25.487  354.525 1.00 22.40  ? 13  VAL 3 CG1   1 
ATOM   4930  C  CG2   . VAL C  3  13  ? -21.399  -27.131  353.118 1.00 22.12  ? 13  VAL 3 CG2   1 
ATOM   4931  N  N     . PRO C  3  14  ? -23.998  -29.162  354.191 1.00 30.46  ? 14  PRO 3 N     1 
ATOM   4932  C  CA    . PRO C  3  14  ? -24.416  -29.993  355.332 1.00 24.25  ? 14  PRO 3 CA    1 
ATOM   4933  C  C     . PRO C  3  14  ? -23.849  -29.474  356.643 1.00 21.03  ? 14  PRO 3 C     1 
ATOM   4934  O  O     . PRO C  3  14  ? -22.778  -28.849  356.665 1.00 21.32  ? 14  PRO 3 O     1 
ATOM   4935  C  CB    . PRO C  3  14  ? -23.838  -31.375  354.986 1.00 31.52  ? 14  PRO 3 CB    1 
ATOM   4936  C  CG    . PRO C  3  14  ? -22.819  -31.125  353.896 1.00 35.09  ? 14  PRO 3 CG    1 
ATOM   4937  C  CD    . PRO C  3  14  ? -23.362  -29.963  353.137 1.00 32.33  ? 14  PRO 3 CD    1 
ATOM   4938  N  N     . PRO C  3  15  ? -24.502  -29.777  357.770 1.00 20.84  ? 15  PRO 3 N     1 
ATOM   4939  C  CA    . PRO C  3  15  ? -24.196  -29.056  359.019 1.00 26.17  ? 15  PRO 3 CA    1 
ATOM   4940  C  C     . PRO C  3  15  ? -22.787  -29.231  359.575 1.00 38.31  ? 15  PRO 3 C     1 
ATOM   4941  O  O     . PRO C  3  15  ? -22.219  -28.240  360.058 1.00 46.31  ? 15  PRO 3 O     1 
ATOM   4942  C  CB    . PRO C  3  15  ? -25.257  -29.600  359.988 1.00 24.70  ? 15  PRO 3 CB    1 
ATOM   4943  C  CG    . PRO C  3  15  ? -25.682  -30.883  359.415 1.00 20.36  ? 15  PRO 3 CG    1 
ATOM   4944  C  CD    . PRO C  3  15  ? -25.647  -30.682  357.937 1.00 22.70  ? 15  PRO 3 CD    1 
ATOM   4945  N  N     . GLY C  3  16  ? -22.197  -30.431  359.533 1.00 37.20  ? 16  GLY 3 N     1 
ATOM   4946  C  CA    . GLY C  3  16  ? -20.909  -30.654  360.183 1.00 20.87  ? 16  GLY 3 CA    1 
ATOM   4947  C  C     . GLY C  3  16  ? -19.721  -30.084  359.423 1.00 21.19  ? 16  GLY 3 C     1 
ATOM   4948  O  O     . GLY C  3  16  ? -18.565  -30.429  359.689 1.00 21.21  ? 16  GLY 3 O     1 
ATOM   4949  N  N     . THR C  3  17  ? -20.009  -29.177  358.492 1.00 22.80  ? 17  THR 3 N     1 
ATOM   4950  C  CA    . THR C  3  17  ? -19.015  -28.667  357.559 1.00 28.17  ? 17  THR 3 CA    1 
ATOM   4951  C  C     . THR C  3  17  ? -18.041  -27.707  358.234 1.00 35.63  ? 17  THR 3 C     1 
ATOM   4952  O  O     . THR C  3  17  ? -18.430  -26.845  359.028 1.00 34.12  ? 17  THR 3 O     1 
ATOM   4953  C  CB    . THR C  3  17  ? -19.713  -27.962  356.397 1.00 31.38  ? 17  THR 3 CB    1 
ATOM   4954  O  OG1   . THR C  3  17  ? -20.427  -28.928  355.612 1.00 31.32  ? 17  THR 3 OG1   1 
ATOM   4955  C  CG2   . THR C  3  17  ? -18.720  -27.219  355.518 1.00 35.25  ? 17  THR 3 CG2   1 
ATOM   4956  N  N     . SER C  3  18  ? -16.763  -27.854  357.884 1.00 40.40  ? 18  SER 3 N     1 
ATOM   4957  C  CA    . SER C  3  18  ? -15.712  -26.937  358.302 1.00 35.92  ? 18  SER 3 CA    1 
ATOM   4958  C  C     . SER C  3  18  ? -15.715  -25.667  357.462 1.00 24.68  ? 18  SER 3 C     1 
ATOM   4959  O  O     . SER C  3  18  ? -15.961  -25.703  356.253 1.00 23.04  ? 18  SER 3 O     1 
ATOM   4960  C  CB    . SER C  3  18  ? -14.350  -27.619  358.164 1.00 42.52  ? 18  SER 3 CB    1 
ATOM   4961  O  OG    . SER C  3  18  ? -13.294  -26.675  358.177 1.00 48.96  ? 18  SER 3 OG    1 
ATOM   4962  N  N     . VAL C  3  19  ? -15.374  -24.545  358.104 1.00 28.28  ? 19  VAL 3 N     1 
ATOM   4963  C  CA    . VAL C  3  19  ? -15.387  -23.260  357.403 1.00 32.86  ? 19  VAL 3 CA    1 
ATOM   4964  C  C     . VAL C  3  19  ? -14.472  -23.301  356.182 1.00 35.54  ? 19  VAL 3 C     1 
ATOM   4965  O  O     . VAL C  3  19  ? -14.729  -22.618  355.189 1.00 38.24  ? 19  VAL 3 O     1 
ATOM   4966  C  CB    . VAL C  3  19  ? -15.024  -22.089  358.348 1.00 31.67  ? 19  VAL 3 CB    1 
ATOM   4967  C  CG1   . VAL C  3  19  ? -14.940  -20.809  357.566 1.00 24.57  ? 19  VAL 3 CG1   1 
ATOM   4968  C  CG2   . VAL C  3  19  ? -16.072  -21.928  359.470 1.00 24.02  ? 19  VAL 3 CG2   1 
ATOM   4969  N  N     . MET C  3  20  ? -13.396  -24.088  356.229 1.00 30.10  ? 20  MET 3 N     1 
ATOM   4970  C  CA    . MET C  3  20  ? -12.479  -24.151  355.092 1.00 28.22  ? 20  MET 3 CA    1 
ATOM   4971  C  C     . MET C  3  20  ? -13.142  -24.798  353.874 1.00 23.78  ? 20  MET 3 C     1 
ATOM   4972  O  O     . MET C  3  20  ? -13.027  -24.303  352.740 1.00 23.99  ? 20  MET 3 O     1 
ATOM   4973  C  CB    . MET C  3  20  ? -11.222  -24.921  355.505 1.00 27.60  ? 20  MET 3 CB    1 
ATOM   4974  C  CG    . MET C  3  20  ? -10.212  -25.136  354.404 1.00 26.14  ? 20  MET 3 CG    1 
ATOM   4975  S  SD    . MET C  3  20  ? -8.544   -25.311  355.088 1.00 24.23  ? 20  MET 3 SD    1 
ATOM   4976  C  CE    . MET C  3  20  ? -8.613   -27.002  355.648 1.00 23.69  ? 20  MET 3 CE    1 
ATOM   4977  N  N     . ASP C  3  21  ? -13.836  -25.913  354.089 1.00 32.12  ? 21  ASP 3 N     1 
ATOM   4978  C  CA    . ASP C  3  21  ? -14.531  -26.559  352.984 1.00 34.69  ? 21  ASP 3 CA    1 
ATOM   4979  C  C     . ASP C  3  21  ? -15.639  -25.669  352.440 1.00 33.54  ? 21  ASP 3 C     1 
ATOM   4980  O  O     . ASP C  3  21  ? -15.868  -25.629  351.232 1.00 35.20  ? 21  ASP 3 O     1 
ATOM   4981  C  CB    . ASP C  3  21  ? -15.069  -27.927  353.414 1.00 34.20  ? 21  ASP 3 CB    1 
ATOM   4982  C  CG    . ASP C  3  21  ? -13.964  -28.948  353.617 1.00 22.46  ? 21  ASP 3 CG    1 
ATOM   4983  O  OD1   . ASP C  3  21  ? -13.211  -29.210  352.663 1.00 22.52  ? 21  ASP 3 OD1   1 
ATOM   4984  O  OD2   . ASP C  3  21  ? -13.839  -29.475  354.732 1.00 22.27  ? 21  ASP 3 OD2   1 
ATOM   4985  N  N     . ALA C  3  22  ? -16.324  -24.931  353.319 1.00 31.29  ? 22  ALA 3 N     1 
ATOM   4986  C  CA    . ALA C  3  22  ? -17.393  -24.034  352.872 1.00 28.44  ? 22  ALA 3 CA    1 
ATOM   4987  C  C     . ALA C  3  22  ? -16.832  -22.840  352.082 1.00 27.70  ? 22  ALA 3 C     1 
ATOM   4988  O  O     . ALA C  3  22  ? -17.436  -22.399  351.093 1.00 35.39  ? 22  ALA 3 O     1 
ATOM   4989  C  CB    . ALA C  3  22  ? -18.231  -23.587  354.078 1.00 27.26  ? 22  ALA 3 CB    1 
ATOM   4990  N  N     . VAL C  3  23  ? -15.692  -22.290  352.508 1.00 31.29  ? 23  VAL 3 N     1 
ATOM   4991  C  CA    . VAL C  3  23  ? -15.048  -21.223  351.748 1.00 24.68  ? 23  VAL 3 CA    1 
ATOM   4992  C  C     . VAL C  3  23  ? -14.679  -21.711  350.349 1.00 30.40  ? 23  VAL 3 C     1 
ATOM   4993  O  O     . VAL C  3  23  ? -14.999  -21.059  349.350 1.00 24.86  ? 23  VAL 3 O     1 
ATOM   4994  C  CB    . VAL C  3  23  ? -13.807  -20.709  352.501 1.00 24.96  ? 23  VAL 3 CB    1 
ATOM   4995  C  CG1   . VAL C  3  23  ? -12.912  -19.859  351.583 1.00 25.38  ? 23  VAL 3 CG1   1 
ATOM   4996  C  CG2   . VAL C  3  23  ? -14.210  -19.952  353.748 1.00 27.74  ? 23  VAL 3 CG2   1 
ATOM   4997  N  N     . PHE C  3  24  ? -13.997  -22.874  350.253 1.00 33.68  ? 24  PHE 3 N     1 
ATOM   4998  C  CA    . PHE C  3  24  ? -13.606  -23.402  348.934 1.00 24.37  ? 24  PHE 3 CA    1 
ATOM   4999  C  C     . PHE C  3  24  ? -14.820  -23.794  348.109 1.00 24.13  ? 24  PHE 3 C     1 
ATOM   5000  O  O     . PHE C  3  24  ? -14.814  -23.668  346.878 1.00 24.24  ? 24  PHE 3 O     1 
ATOM   5001  C  CB    . PHE C  3  24  ? -12.660  -24.604  349.065 1.00 24.14  ? 24  PHE 3 CB    1 
ATOM   5002  C  CG    . PHE C  3  24  ? -11.233  -24.225  349.382 1.00 28.51  ? 24  PHE 3 CG    1 
ATOM   5003  C  CD1   . PHE C  3  24  ? -10.381  -23.773  348.384 1.00 28.71  ? 24  PHE 3 CD1   1 
ATOM   5004  C  CD2   . PHE C  3  24  ? -10.739  -24.312  350.673 1.00 34.33  ? 24  PHE 3 CD2   1 
ATOM   5005  C  CE1   . PHE C  3  24  ? -9.076   -23.412  348.679 1.00 30.51  ? 24  PHE 3 CE1   1 
ATOM   5006  C  CE2   . PHE C  3  24  ? -9.430   -23.949  350.958 1.00 24.69  ? 24  PHE 3 CE2   1 
ATOM   5007  C  CZ    . PHE C  3  24  ? -8.609   -23.507  349.964 1.00 24.99  ? 24  PHE 3 CZ    1 
ATOM   5008  N  N     . HIS C  3  25  ? -15.859  -24.275  348.784 1.00 23.82  ? 25  HIS 3 N     1 
ATOM   5009  C  CA    . HIS C  3  25  ? -17.116  -24.635  348.155 1.00 23.59  ? 25  HIS 3 CA    1 
ATOM   5010  C  C     . HIS C  3  25  ? -17.786  -23.412  347.555 1.00 23.90  ? 25  HIS 3 C     1 
ATOM   5011  O  O     . HIS C  3  25  ? -18.472  -23.514  346.533 1.00 23.84  ? 25  HIS 3 O     1 
ATOM   5012  C  CB    . HIS C  3  25  ? -17.981  -25.332  349.216 1.00 23.22  ? 25  HIS 3 CB    1 
ATOM   5013  C  CG    . HIS C  3  25  ? -19.204  -26.011  348.683 1.00 33.36  ? 25  HIS 3 CG    1 
ATOM   5014  N  ND1   . HIS C  3  25  ? -19.266  -26.561  347.421 1.00 22.80  ? 25  HIS 3 ND1   1 
ATOM   5015  C  CD2   . HIS C  3  25  ? -20.377  -26.321  349.289 1.00 22.65  ? 25  HIS 3 CD2   1 
ATOM   5016  C  CE1   . HIS C  3  25  ? -20.455  -27.110  347.247 1.00 22.51  ? 25  HIS 3 CE1   1 
ATOM   5017  N  NE2   . HIS C  3  25  ? -21.144  -26.987  348.368 1.00 22.41  ? 25  HIS 3 NE2   1 
ATOM   5018  N  N     . ALA C  3  26  ? -17.549  -22.239  348.140 1.00 36.38  ? 26  ALA 3 N     1 
ATOM   5019  C  CA    . ALA C  3  26  ? -18.103  -21.005  347.604 1.00 32.20  ? 26  ALA 3 CA    1 
ATOM   5020  C  C     . ALA C  3  26  ? -17.246  -20.407  346.496 1.00 30.03  ? 26  ALA 3 C     1 
ATOM   5021  O  O     . ALA C  3  26  ? -17.716  -19.519  345.781 1.00 27.57  ? 26  ALA 3 O     1 
ATOM   5022  C  CB    . ALA C  3  26  ? -18.279  -19.984  348.728 1.00 24.79  ? 26  ALA 3 CB    1 
ATOM   5023  N  N     . GLY C  3  27  ? -16.033  -20.902  346.299 1.00 31.72  ? 27  GLY 3 N     1 
ATOM   5024  C  CA    . GLY C  3  27  ? -15.178  -20.424  345.235 1.00 34.74  ? 27  GLY 3 CA    1 
ATOM   5025  C  C     . GLY C  3  27  ? -14.064  -19.490  345.651 1.00 32.53  ? 27  GLY 3 C     1 
ATOM   5026  O  O     . GLY C  3  27  ? -13.376  -18.946  344.775 1.00 31.71  ? 27  GLY 3 O     1 
ATOM   5027  N  N     . TYR C  3  28  ? -13.861  -19.284  346.943 1.00 25.66  ? 28  TYR 3 N     1 
ATOM   5028  C  CA    . TYR C  3  28  ? -12.758  -18.450  347.367 1.00 34.49  ? 28  TYR 3 CA    1 
ATOM   5029  C  C     . TYR C  3  28  ? -11.620  -19.354  347.855 1.00 35.08  ? 28  TYR 3 C     1 
ATOM   5030  O  O     . TYR C  3  28  ? -11.701  -20.581  347.784 1.00 25.53  ? 28  TYR 3 O     1 
ATOM   5031  C  CB    . TYR C  3  28  ? -13.261  -17.425  348.394 1.00 32.37  ? 28  TYR 3 CB    1 
ATOM   5032  C  CG    . TYR C  3  28  ? -14.090  -16.354  347.709 1.00 29.63  ? 28  TYR 3 CG    1 
ATOM   5033  C  CD1   . TYR C  3  28  ? -15.459  -16.513  347.538 1.00 29.51  ? 28  TYR 3 CD1   1 
ATOM   5034  C  CD2   . TYR C  3  28  ? -13.494  -15.239  347.141 1.00 26.91  ? 28  TYR 3 CD2   1 
ATOM   5035  C  CE1   . TYR C  3  28  ? -16.222  -15.560  346.885 1.00 30.14  ? 28  TYR 3 CE1   1 
ATOM   5036  C  CE2   . TYR C  3  28  ? -14.252  -14.281  346.476 1.00 27.48  ? 28  TYR 3 CE2   1 
ATOM   5037  C  CZ    . TYR C  3  28  ? -15.611  -14.448  346.352 1.00 33.56  ? 28  TYR 3 CZ    1 
ATOM   5038  O  OH    . TYR C  3  28  ? -16.353  -13.498  345.695 1.00 41.58  ? 28  TYR 3 OH    1 
ATOM   5039  N  N     . ASP C  3  29  ? -10.567  -18.748  348.392 1.00 32.19  ? 29  ASP 3 N     1 
ATOM   5040  C  CA    . ASP C  3  29  ? -9.313   -19.443  348.629 1.00 27.85  ? 29  ASP 3 CA    1 
ATOM   5041  C  C     . ASP C  3  29  ? -8.640   -18.839  349.849 1.00 26.38  ? 29  ASP 3 C     1 
ATOM   5042  O  O     . ASP C  3  29  ? -8.852   -17.673  350.187 1.00 26.68  ? 29  ASP 3 O     1 
ATOM   5043  C  CB    . ASP C  3  29  ? -8.388   -19.367  347.401 1.00 27.59  ? 29  ASP 3 CB    1 
ATOM   5044  C  CG    . ASP C  3  29  ? -8.354   -17.977  346.782 1.00 27.18  ? 29  ASP 3 CG    1 
ATOM   5045  O  OD1   . ASP C  3  29  ? -9.390   -17.284  346.823 1.00 30.76  ? 29  ASP 3 OD1   1 
ATOM   5046  O  OD2   . ASP C  3  29  ? -7.283   -17.550  346.304 1.00 30.90  ? 29  ASP 3 OD2   1 
ATOM   5047  N  N     . VAL C  3  30  ? -7.806   -19.646  350.494 1.00 26.23  ? 30  VAL 3 N     1 
ATOM   5048  C  CA    . VAL C  3  30  ? -7.164   -19.291  351.758 1.00 26.37  ? 30  VAL 3 CA    1 
ATOM   5049  C  C     . VAL C  3  30  ? -6.045   -20.310  351.950 1.00 26.23  ? 30  VAL 3 C     1 
ATOM   5050  O  O     . VAL C  3  30  ? -6.151   -21.416  351.412 1.00 25.92  ? 30  VAL 3 O     1 
ATOM   5051  C  CB    . VAL C  3  30  ? -8.194   -19.261  352.907 1.00 26.17  ? 30  VAL 3 CB    1 
ATOM   5052  C  CG1   . VAL C  3  30  ? -8.764   -20.650  353.183 1.00 30.82  ? 30  VAL 3 CG1   1 
ATOM   5053  C  CG2   . VAL C  3  30  ? -7.631   -18.621  354.178 1.00 26.39  ? 30  VAL 3 CG2   1 
ATOM   5054  N  N     . PRO C  3  31  ? -4.899   -19.946  352.532 1.00 26.49  ? 31  PRO 3 N     1 
ATOM   5055  C  CA    . PRO C  3  31  ? -3.793   -20.901  352.646 1.00 29.53  ? 31  PRO 3 CA    1 
ATOM   5056  C  C     . PRO C  3  31  ? -4.154   -22.089  353.514 1.00 33.44  ? 31  PRO 3 C     1 
ATOM   5057  O  O     . PRO C  3  31  ? -5.113   -22.099  354.291 1.00 34.59  ? 31  PRO 3 O     1 
ATOM   5058  C  CB    . PRO C  3  31  ? -2.670   -20.098  353.299 1.00 26.77  ? 31  PRO 3 CB    1 
ATOM   5059  C  CG    . PRO C  3  31  ? -2.962   -18.755  352.972 1.00 40.01  ? 31  PRO 3 CG    1 
ATOM   5060  C  CD    . PRO C  3  31  ? -4.453   -18.600  352.893 1.00 35.74  ? 31  PRO 3 CD    1 
ATOM   5061  N  N     . LEU C  3  32  ? -3.294   -23.089  353.419 1.00 32.95  ? 32  LEU 3 N     1 
ATOM   5062  C  CA    . LEU C  3  32  ? -3.518   -24.345  354.107 1.00 25.34  ? 32  LEU 3 CA    1 
ATOM   5063  C  C     . LEU C  3  32  ? -2.147   -24.977  354.274 1.00 25.37  ? 32  LEU 3 C     1 
ATOM   5064  O  O     . LEU C  3  32  ? -1.486   -25.290  353.278 1.00 31.46  ? 32  LEU 3 O     1 
ATOM   5065  C  CB    . LEU C  3  32  ? -4.474   -25.233  353.316 1.00 40.28  ? 32  LEU 3 CB    1 
ATOM   5066  C  CG    . LEU C  3  32  ? -4.637   -26.659  353.852 1.00 44.62  ? 32  LEU 3 CG    1 
ATOM   5067  C  CD1   . LEU C  3  32  ? -5.047   -26.632  355.286 1.00 44.26  ? 32  LEU 3 CD1   1 
ATOM   5068  C  CD2   . LEU C  3  32  ? -5.650   -27.477  353.062 1.00 45.11  ? 32  LEU 3 CD2   1 
ATOM   5069  N  N     . PHE C  3  33  ? -1.673   -25.052  355.514 1.00 25.37  ? 33  PHE 3 N     1 
ATOM   5070  C  CA    . PHE C  3  33  ? -0.468   -25.816  355.817 1.00 25.34  ? 33  PHE 3 CA    1 
ATOM   5071  C  C     . PHE C  3  33  ? -0.730   -26.942  356.806 1.00 29.03  ? 33  PHE 3 C     1 
ATOM   5072  O  O     . PHE C  3  33  ? -0.399   -28.099  356.521 1.00 26.72  ? 33  PHE 3 O     1 
ATOM   5073  C  CB    . PHE C  3  33  ? 0.630    -24.898  356.378 1.00 27.38  ? 33  PHE 3 CB    1 
ATOM   5074  C  CG    . PHE C  3  33  ? 1.322    -24.060  355.355 1.00 26.19  ? 33  PHE 3 CG    1 
ATOM   5075  C  CD1   . PHE C  3  33  ? 1.496    -24.515  354.066 1.00 31.14  ? 33  PHE 3 CD1   1 
ATOM   5076  C  CD2   . PHE C  3  33  ? 1.782    -22.793  355.685 1.00 26.63  ? 33  PHE 3 CD2   1 
ATOM   5077  C  CE1   . PHE C  3  33  ? 2.132    -23.731  353.127 1.00 30.69  ? 33  PHE 3 CE1   1 
ATOM   5078  C  CE2   . PHE C  3  33  ? 2.414    -22.007  354.746 1.00 35.82  ? 33  PHE 3 CE2   1 
ATOM   5079  C  CZ    . PHE C  3  33  ? 2.588    -22.478  353.468 1.00 32.06  ? 33  PHE 3 CZ    1 
ATOM   5080  N  N     . CYS C  3  34  ? -1.339   -26.651  357.960 1.00 29.69  ? 34  CYS 3 N     1 
ATOM   5081  C  CA    . CYS C  3  34  ? -1.352   -27.647  359.029 1.00 32.92  ? 34  CYS 3 CA    1 
ATOM   5082  C  C     . CYS C  3  34  ? -2.336   -28.771  358.736 1.00 28.06  ? 34  CYS 3 C     1 
ATOM   5083  O  O     . CYS C  3  34  ? -2.058   -29.938  359.035 1.00 23.73  ? 34  CYS 3 O     1 
ATOM   5084  C  CB    . CYS C  3  34  ? -1.696   -26.988  360.369 1.00 31.84  ? 34  CYS 3 CB    1 
ATOM   5085  S  SG    . CYS C  3  34  ? -3.420   -26.556  360.599 1.00 36.09  ? 34  CYS 3 SG    1 
ATOM   5086  N  N     . SER C  3  35  ? -3.474   -28.439  358.140 1.00 34.66  ? 35  SER 3 N     1 
ATOM   5087  C  CA    . SER C  3  35  ? -4.523   -29.407  357.883 1.00 37.11  ? 35  SER 3 CA    1 
ATOM   5088  C  C     . SER C  3  35  ? -4.348   -30.049  356.515 1.00 40.19  ? 35  SER 3 C     1 
ATOM   5089  O  O     . SER C  3  35  ? -3.764   -29.463  355.593 1.00 39.77  ? 35  SER 3 O     1 
ATOM   5090  C  CB    . SER C  3  35  ? -5.897   -28.746  357.958 1.00 38.37  ? 35  SER 3 CB    1 
ATOM   5091  O  OG    . SER C  3  35  ? -6.002   -27.948  359.122 1.00 35.73  ? 35  SER 3 OG    1 
ATOM   5092  N  N     . GLU C  3  36  ? -4.903   -31.257  356.383 1.00 38.83  ? 36  GLU 3 N     1 
ATOM   5093  C  CA    . GLU C  3  36  ? -4.775   -32.044  355.167 1.00 29.52  ? 36  GLU 3 CA    1 
ATOM   5094  C  C     . GLU C  3  36  ? -5.961   -32.997  355.112 1.00 26.88  ? 36  GLU 3 C     1 
ATOM   5095  O  O     . GLU C  3  36  ? -6.436   -33.460  356.152 1.00 28.28  ? 36  GLU 3 O     1 
ATOM   5096  C  CB    . GLU C  3  36  ? -3.436   -32.806  355.156 1.00 25.97  ? 36  GLU 3 CB    1 
ATOM   5097  C  CG    . GLU C  3  36  ? -3.263   -33.808  354.058 1.00 24.08  ? 36  GLU 3 CG    1 
ATOM   5098  C  CD    . GLU C  3  36  ? -3.246   -33.149  352.701 1.00 22.86  ? 36  GLU 3 CD    1 
ATOM   5099  O  OE1   . GLU C  3  36  ? -4.332   -32.785  352.220 1.00 22.81  ? 36  GLU 3 OE1   1 
ATOM   5100  O  OE2   . GLU C  3  36  ? -2.155   -32.983  352.118 1.00 23.12  ? 36  GLU 3 OE2   1 
ATOM   5101  N  N     . LYS C  3  37  ? -6.424   -33.304  353.894 1.00 37.05  ? 37  LYS 3 N     1 
ATOM   5102  C  CA    . LYS C  3  37  ? -7.499   -34.277  353.717 1.00 21.81  ? 37  LYS 3 CA    1 
ATOM   5103  C  C     . LYS C  3  37  ? -7.164   -35.556  354.458 1.00 21.45  ? 37  LYS 3 C     1 
ATOM   5104  O  O     . LYS C  3  37  ? -6.011   -35.981  354.499 1.00 27.69  ? 37  LYS 3 O     1 
ATOM   5105  C  CB    . LYS C  3  37  ? -7.742   -34.615  352.236 1.00 21.74  ? 37  LYS 3 CB    1 
ATOM   5106  C  CG    . LYS C  3  37  ? -8.240   -33.492  351.333 1.00 22.04  ? 37  LYS 3 CG    1 
ATOM   5107  C  CD    . LYS C  3  37  ? -7.874   -33.799  349.870 1.00 22.92  ? 37  LYS 3 CD    1 
ATOM   5108  C  CE    . LYS C  3  37  ? -8.302   -32.665  348.950 1.00 22.40  ? 37  LYS 3 CE    1 
ATOM   5109  N  NZ    . LYS C  3  37  ? -8.307   -33.031  347.513 1.00 22.37  ? 37  LYS 3 NZ    1 
ATOM   5110  N  N     . HIS C  3  38  ? -8.186   -36.147  355.067 1.00 30.11  ? 38  HIS 3 N     1 
ATOM   5111  C  CA    . HIS C  3  38  ? -8.145   -37.430  355.761 1.00 35.47  ? 38  HIS 3 CA    1 
ATOM   5112  C  C     . HIS C  3  38  ? -7.225   -37.373  356.980 1.00 33.17  ? 38  HIS 3 C     1 
ATOM   5113  O  O     . HIS C  3  38  ? -6.883   -38.419  357.566 1.00 20.53  ? 38  HIS 3 O     1 
ATOM   5114  C  CB    . HIS C  3  38  ? -7.766   -38.551  354.778 1.00 20.47  ? 38  HIS 3 CB    1 
ATOM   5115  C  CG    . HIS C  3  38  ? -8.488   -38.426  353.471 1.00 20.46  ? 38  HIS 3 CG    1 
ATOM   5116  N  ND1   . HIS C  3  38  ? -9.837   -38.660  353.338 1.00 20.20  ? 38  HIS 3 ND1   1 
ATOM   5117  C  CD2   . HIS C  3  38  ? -8.041   -38.104  352.234 1.00 25.44  ? 38  HIS 3 CD2   1 
ATOM   5118  C  CE1   . HIS C  3  38  ? -10.196  -38.453  352.084 1.00 20.27  ? 38  HIS 3 CE1   1 
ATOM   5119  N  NE2   . HIS C  3  38  ? -9.123   -38.124  351.391 1.00 20.55  ? 38  HIS 3 NE2   1 
ATOM   5120  N  N     . LEU C  3  39  ? -6.870   -36.151  357.399 1.00 31.48  ? 39  LEU 3 N     1 
ATOM   5121  C  CA    . LEU C  3  39  ? -6.085   -35.899  358.599 1.00 31.54  ? 39  LEU 3 CA    1 
ATOM   5122  C  C     . LEU C  3  39  ? -6.874   -35.013  359.566 1.00 30.09  ? 39  LEU 3 C     1 
ATOM   5123  O  O     . LEU C  3  39  ? -7.567   -34.077  359.155 1.00 21.63  ? 39  LEU 3 O     1 
ATOM   5124  C  CB    . LEU C  3  39  ? -4.725   -35.249  358.253 1.00 33.48  ? 39  LEU 3 CB    1 
ATOM   5125  C  CG    . LEU C  3  39  ? -3.644   -36.096  357.551 1.00 30.74  ? 39  LEU 3 CG    1 
ATOM   5126  C  CD1   . LEU C  3  39  ? -2.305   -35.383  357.654 1.00 27.49  ? 39  LEU 3 CD1   1 
ATOM   5127  C  CD2   . LEU C  3  39  ? -3.537   -37.547  358.076 1.00 21.29  ? 39  LEU 3 CD2   1 
ATOM   5128  N  N     . SER C  3  40  ? -6.745   -35.316  360.854 1.00 29.26  ? 40  SER 3 N     1 
ATOM   5129  C  CA    . SER C  3  40  ? -7.479   -34.610  361.883 1.00 21.39  ? 40  SER 3 CA    1 
ATOM   5130  C  C     . SER C  3  40  ? -6.961   -33.200  361.873 1.00 43.85  ? 40  SER 3 C     1 
ATOM   5131  O  O     . SER C  3  40  ? -5.759   -33.002  362.090 1.00 22.12  ? 40  SER 3 O     1 
ATOM   5132  C  CB    . SER C  3  40  ? -7.241   -35.132  363.282 1.00 21.23  ? 40  SER 3 CB    1 
ATOM   5133  O  OG    . SER C  3  40  ? -5.857   -35.059  363.588 1.00 30.81  ? 40  SER 3 OG    1 
ATOM   5134  N  N     . PRO C  3  41  ? -7.800   -32.201  361.654 1.00 36.67  ? 41  PRO 3 N     1 
ATOM   5135  C  CA    . PRO C  3  41  ? -7.309   -30.827  361.729 1.00 26.01  ? 41  PRO 3 CA    1 
ATOM   5136  C  C     . PRO C  3  41  ? -7.038   -30.453  363.172 1.00 26.55  ? 41  PRO 3 C     1 
ATOM   5137  O  O     . PRO C  3  41  ? -7.851   -30.716  364.059 1.00 29.80  ? 41  PRO 3 O     1 
ATOM   5138  C  CB    . PRO C  3  41  ? -8.465   -30.010  361.160 1.00 22.62  ? 41  PRO 3 CB    1 
ATOM   5139  C  CG    . PRO C  3  41  ? -9.669   -30.832  361.508 1.00 32.01  ? 41  PRO 3 CG    1 
ATOM   5140  C  CD    . PRO C  3  41  ? -9.244   -32.267  361.361 1.00 35.49  ? 41  PRO 3 CD    1 
ATOM   5141  N  N     . ILE C  3  42  ? -5.900   -29.810  363.392 1.00 23.78  ? 42  ILE 3 N     1 
ATOM   5142  C  CA    . ILE C  3  42  ? -5.571   -29.176  364.665 1.00 25.57  ? 42  ILE 3 CA    1 
ATOM   5143  C  C     . ILE C  3  42  ? -4.882   -27.865  364.336 1.00 27.47  ? 42  ILE 3 C     1 
ATOM   5144  O  O     . ILE C  3  42  ? -3.993   -27.831  363.483 1.00 30.98  ? 42  ILE 3 O     1 
ATOM   5145  C  CB    . ILE C  3  42  ? -4.714   -30.087  365.567 1.00 23.03  ? 42  ILE 3 CB    1 
ATOM   5146  C  CG1   . ILE C  3  42  ? -3.659   -30.876  364.769 1.00 26.98  ? 42  ILE 3 CG1   1 
ATOM   5147  C  CG2   . ILE C  3  42  ? -5.606   -31.031  366.369 1.00 22.59  ? 42  ILE 3 CG2   1 
ATOM   5148  C  CD1   . ILE C  3  42  ? -2.386   -30.160  364.345 1.00 23.42  ? 42  ILE 3 CD1   1 
ATOM   5149  N  N     . GLY C  3  43  ? -5.296   -26.778  364.970 1.00 26.63  ? 43  GLY 3 N     1 
ATOM   5150  C  CA    . GLY C  3  43  ? -4.794   -25.508  364.486 1.00 30.56  ? 43  GLY 3 CA    1 
ATOM   5151  C  C     . GLY C  3  43  ? -3.330   -25.297  364.803 1.00 33.48  ? 43  GLY 3 C     1 
ATOM   5152  O  O     . GLY C  3  43  ? -2.971   -24.994  365.944 1.00 37.30  ? 43  GLY 3 O     1 
ATOM   5153  N  N     . ALA C  3  44  ? -2.469   -25.467  363.804 1.00 24.81  ? 44  ALA 3 N     1 
ATOM   5154  C  CA    . ALA C  3  44  ? -1.037   -25.300  364.014 1.00 31.77  ? 44  ALA 3 CA    1 
ATOM   5155  C  C     . ALA C  3  44  ? -0.422   -24.221  363.136 1.00 28.34  ? 44  ALA 3 C     1 
ATOM   5156  O  O     . ALA C  3  44  ? 0.247    -23.308  363.640 1.00 25.92  ? 44  ALA 3 O     1 
ATOM   5157  C  CB    . ALA C  3  44  ? -0.334   -26.650  363.771 1.00 30.52  ? 44  ALA 3 CB    1 
ATOM   5158  N  N     . CYS C  3  45  ? -0.625   -24.310  361.825 1.00 31.16  ? 45  CYS 3 N     1 
ATOM   5159  C  CA    . CYS C  3  45  ? -0.069   -23.344  360.892 1.00 39.02  ? 45  CYS 3 CA    1 
ATOM   5160  C  C     . CYS C  3  45  ? -0.792   -21.996  360.930 1.00 39.49  ? 45  CYS 3 C     1 
ATOM   5161  O  O     . CYS C  3  45  ? -0.191   -20.980  360.569 1.00 42.81  ? 45  CYS 3 O     1 
ATOM   5162  C  CB    . CYS C  3  45  ? -0.029   -23.992  359.505 1.00 40.55  ? 45  CYS 3 CB    1 
ATOM   5163  S  SG    . CYS C  3  45  ? -1.587   -24.426  358.718 1.00 25.44  ? 45  CYS 3 SG    1 
ATOM   5164  N  N     . ARG C  3  46  ? -2.051   -21.963  361.371 1.00 44.12  ? 46  ARG 3 N     1 
ATOM   5165  C  CA    . ARG C  3  46  ? -2.801   -20.718  361.546 1.00 47.12  ? 46  ARG 3 CA    1 
ATOM   5166  C  C     . ARG C  3  46  ? -2.868   -19.931  360.241 1.00 51.78  ? 46  ARG 3 C     1 
ATOM   5167  O  O     . ARG C  3  46  ? -2.900   -18.691  360.244 1.00 54.96  ? 46  ARG 3 O     1 
ATOM   5168  C  CB    . ARG C  3  46  ? -2.215   -19.863  362.677 1.00 46.61  ? 46  ARG 3 CB    1 
ATOM   5169  C  CG    . ARG C  3  46  ? -1.906   -20.675  363.933 1.00 46.08  ? 46  ARG 3 CG    1 
ATOM   5170  C  CD    . ARG C  3  46  ? -2.593   -20.148  365.184 1.00 48.31  ? 46  ARG 3 CD    1 
ATOM   5171  N  NE    . ARG C  3  46  ? -4.049   -20.247  365.081 1.00 44.79  ? 46  ARG 3 NE    1 
ATOM   5172  C  CZ    . ARG C  3  46  ? -4.748   -21.359  365.297 1.00 25.61  ? 46  ARG 3 CZ    1 
ATOM   5173  N  NH1   . ARG C  3  46  ? -4.144   -22.482  365.620 1.00 25.37  ? 46  ARG 3 NH1   1 
ATOM   5174  N  NH2   . ARG C  3  46  ? -6.062   -21.345  365.184 1.00 25.42  ? 46  ARG 3 NH2   1 
ATOM   5175  N  N     . MET C  3  47  ? -2.862   -20.656  359.117 1.00 49.07  ? 47  MET 3 N     1 
ATOM   5176  C  CA    . MET C  3  47  ? -2.976   -20.033  357.807 1.00 50.66  ? 47  MET 3 CA    1 
ATOM   5177  C  C     . MET C  3  47  ? -4.420   -19.873  357.363 1.00 52.13  ? 47  MET 3 C     1 
ATOM   5178  O  O     . MET C  3  47  ? -4.754   -18.906  356.661 1.00 56.50  ? 47  MET 3 O     1 
ATOM   5179  C  CB    . MET C  3  47  ? -2.209   -20.852  356.766 1.00 53.11  ? 47  MET 3 CB    1 
ATOM   5180  C  CG    . MET C  3  47  ? -0.723   -20.583  356.757 1.00 60.80  ? 47  MET 3 CG    1 
ATOM   5181  S  SD    . MET C  3  47  ? -0.344   -18.893  356.236 1.00 71.59  ? 47  MET 3 SD    1 
ATOM   5182  C  CE    . MET C  3  47  ? 1.443    -18.918  356.275 1.00 71.44  ? 47  MET 3 CE    1 
ATOM   5183  N  N     . CYS C  3  48  ? -5.295   -20.762  357.807 1.00 47.31  ? 48  CYS 3 N     1 
ATOM   5184  C  CA    . CYS C  3  48  ? -6.660   -20.786  357.314 1.00 50.03  ? 48  CYS 3 CA    1 
ATOM   5185  C  C     . CYS C  3  48  ? -7.551   -19.760  358.006 1.00 42.18  ? 48  CYS 3 C     1 
ATOM   5186  O  O     . CYS C  3  48  ? -8.783   -19.876  357.949 1.00 37.15  ? 48  CYS 3 O     1 
ATOM   5187  C  CB    . CYS C  3  48  ? -7.227   -22.195  357.496 1.00 50.38  ? 48  CYS 3 CB    1 
ATOM   5188  S  SG    . CYS C  3  48  ? -7.728   -22.533  359.181 1.00 54.08  ? 48  CYS 3 SG    1 
ATOM   5189  N  N     . LEU C  3  49  ? -6.951   -18.749  358.622 1.00 26.27  ? 49  LEU 3 N     1 
ATOM   5190  C  CA    . LEU C  3  49  ? -7.713   -17.779  359.390 1.00 32.14  ? 49  LEU 3 CA    1 
ATOM   5191  C  C     . LEU C  3  49  ? -8.606   -16.951  358.471 1.00 33.78  ? 49  LEU 3 C     1 
ATOM   5192  O  O     . LEU C  3  49  ? -8.168   -16.479  357.419 1.00 35.16  ? 49  LEU 3 O     1 
ATOM   5193  C  CB    . LEU C  3  49  ? -6.764   -16.892  360.195 1.00 32.68  ? 49  LEU 3 CB    1 
ATOM   5194  C  CG    . LEU C  3  49  ? -5.875   -17.661  361.180 1.00 26.67  ? 49  LEU 3 CG    1 
ATOM   5195  C  CD1   . LEU C  3  49  ? -5.072   -16.774  362.123 1.00 27.03  ? 49  LEU 3 CD1   1 
ATOM   5196  C  CD2   . LEU C  3  49  ? -6.773   -18.561  361.990 1.00 26.23  ? 49  LEU 3 CD2   1 
ATOM   5197  N  N     . VAL C  3  50  ? -9.877   -16.829  358.848 1.00 33.95  ? 50  VAL 3 N     1 
ATOM   5198  C  CA    . VAL C  3  50  ? -10.856  -16.013  358.156 1.00 32.30  ? 50  VAL 3 CA    1 
ATOM   5199  C  C     . VAL C  3  50  ? -11.523  -15.110  359.184 1.00 38.92  ? 50  VAL 3 C     1 
ATOM   5200  O  O     . VAL C  3  50  ? -11.238  -15.181  360.380 1.00 42.35  ? 50  VAL 3 O     1 
ATOM   5201  C  CB    . VAL C  3  50  ? -11.914  -16.853  357.414 1.00 26.16  ? 50  VAL 3 CB    1 
ATOM   5202  C  CG1   . VAL C  3  50  ? -11.282  -17.645  356.288 1.00 28.52  ? 50  VAL 3 CG1   1 
ATOM   5203  C  CG2   . VAL C  3  50  ? -12.641  -17.755  358.388 1.00 25.75  ? 50  VAL 3 CG2   1 
ATOM   5204  N  N     . ARG C  3  51  ? -12.437  -14.272  358.709 1.00 40.10  ? 51  ARG 3 N     1 
ATOM   5205  C  CA    . ARG C  3  51  ? -13.263  -13.464  359.589 1.00 39.31  ? 51  ARG 3 CA    1 
ATOM   5206  C  C     . ARG C  3  51  ? -14.681  -14.015  359.574 1.00 39.71  ? 51  ARG 3 C     1 
ATOM   5207  O  O     . ARG C  3  51  ? -15.157  -14.494  358.544 1.00 43.06  ? 51  ARG 3 O     1 
ATOM   5208  C  CB    . ARG C  3  51  ? -13.262  -12.003  359.151 1.00 38.16  ? 51  ARG 3 CB    1 
ATOM   5209  C  CG    . ARG C  3  51  ? -13.699  -11.055  360.240 1.00 38.13  ? 51  ARG 3 CG    1 
ATOM   5210  C  CD    . ARG C  3  51  ? -13.698  -9.637   359.736 1.00 41.32  ? 51  ARG 3 CD    1 
ATOM   5211  N  NE    . ARG C  3  51  ? -13.937  -8.682   360.806 1.00 46.31  ? 51  ARG 3 NE    1 
ATOM   5212  C  CZ    . ARG C  3  51  ? -14.183  -7.394   360.597 1.00 52.63  ? 51  ARG 3 CZ    1 
ATOM   5213  N  NH1   . ARG C  3  51  ? -14.219  -6.918   359.359 1.00 54.81  ? 51  ARG 3 NH1   1 
ATOM   5214  N  NH2   . ARG C  3  51  ? -14.398  -6.580   361.623 1.00 54.76  ? 51  ARG 3 NH2   1 
ATOM   5215  N  N     . ILE C  3  52  ? -15.361  -13.936  360.717 1.00 35.89  ? 52  ILE 3 N     1 
ATOM   5216  C  CA    . ILE C  3  52  ? -16.673  -14.553  360.885 1.00 33.07  ? 52  ILE 3 CA    1 
ATOM   5217  C  C     . ILE C  3  52  ? -17.621  -13.577  361.569 1.00 31.90  ? 52  ILE 3 C     1 
ATOM   5218  O  O     . ILE C  3  52  ? -17.276  -12.976  362.592 1.00 31.48  ? 52  ILE 3 O     1 
ATOM   5219  C  CB    . ILE C  3  52  ? -16.571  -15.857  361.698 1.00 29.34  ? 52  ILE 3 CB    1 
ATOM   5220  C  CG1   . ILE C  3  52  ? -16.012  -16.966  360.816 1.00 29.73  ? 52  ILE 3 CG1   1 
ATOM   5221  C  CG2   . ILE C  3  52  ? -17.919  -16.250  362.290 1.00 25.39  ? 52  ILE 3 CG2   1 
ATOM   5222  C  CD1   . ILE C  3  52  ? -16.055  -18.325  361.451 1.00 33.17  ? 52  ILE 3 CD1   1 
ATOM   5223  N  N     . GLY C  3  53  ? -18.806  -13.415  360.998 1.00 26.17  ? 53  GLY 3 N     1 
ATOM   5224  C  CA    . GLY C  3  53  ? -19.893  -12.700  361.649 1.00 26.24  ? 53  GLY 3 CA    1 
ATOM   5225  C  C     . GLY C  3  53  ? -21.089  -13.624  361.756 1.00 25.82  ? 53  GLY 3 C     1 
ATOM   5226  O  O     . GLY C  3  53  ? -21.487  -14.241  360.768 1.00 25.63  ? 53  GLY 3 O     1 
ATOM   5227  N  N     . LEU C  3  54  ? -21.708  -13.652  362.933 1.00 25.71  ? 54  LEU 3 N     1 
ATOM   5228  C  CA    . LEU C  3  54  ? -22.750  -14.632  363.244 1.00 25.30  ? 54  LEU 3 CA    1 
ATOM   5229  C  C     . LEU C  3  54  ? -23.938  -13.935  363.892 1.00 25.37  ? 54  LEU 3 C     1 
ATOM   5230  O  O     . LEU C  3  54  ? -24.081  -13.917  365.122 1.00 28.52  ? 54  LEU 3 O     1 
ATOM   5231  C  CB    . LEU C  3  54  ? -22.194  -15.761  364.127 1.00 37.41  ? 54  LEU 3 CB    1 
ATOM   5232  C  CG    . LEU C  3  54  ? -22.848  -17.164  364.144 1.00 34.88  ? 54  LEU 3 CG    1 
ATOM   5233  C  CD1   . LEU C  3  54  ? -23.291  -17.655  362.773 1.00 24.36  ? 54  LEU 3 CD1   1 
ATOM   5234  C  CD2   . LEU C  3  54  ? -21.941  -18.210  364.789 1.00 24.28  ? 54  LEU 3 CD2   1 
ATOM   5235  N  N     . PRO C  3  55  ? -24.824  -13.348  363.080 1.00 25.47  ? 55  PRO 3 N     1 
ATOM   5236  C  CA    . PRO C  3  55  ? -26.029  -12.675  363.568 1.00 29.19  ? 55  PRO 3 CA    1 
ATOM   5237  C  C     . PRO C  3  55  ? -27.274  -13.557  363.620 1.00 25.16  ? 55  PRO 3 C     1 
ATOM   5238  O  O     . PRO C  3  55  ? -28.209  -13.269  362.867 1.00 25.18  ? 55  PRO 3 O     1 
ATOM   5239  C  CB    . PRO C  3  55  ? -26.223  -11.568  362.538 1.00 32.40  ? 55  PRO 3 CB    1 
ATOM   5240  C  CG    . PRO C  3  55  ? -25.713  -12.183  361.241 1.00 31.06  ? 55  PRO 3 CG    1 
ATOM   5241  C  CD    . PRO C  3  55  ? -24.713  -13.266  361.613 1.00 25.55  ? 55  PRO 3 CD    1 
ATOM   5242  N  N     . ILE C  3  73  ? -24.896  -7.598   362.317 1.00 111.77 ? 73  ILE 3 N     1 
ATOM   5243  C  CA    . ILE C  3  73  ? -23.506  -7.749   361.901 1.00 111.83 ? 73  ILE 3 CA    1 
ATOM   5244  C  C     . ILE C  3  73  ? -22.597  -7.747   363.127 1.00 110.25 ? 73  ILE 3 C     1 
ATOM   5245  O  O     . ILE C  3  73  ? -22.280  -6.695   363.687 1.00 111.02 ? 73  ILE 3 O     1 
ATOM   5246  C  CB    . ILE C  3  73  ? -23.083  -6.642   360.891 1.00 110.91 ? 73  ILE 3 CB    1 
ATOM   5247  C  CG1   . ILE C  3  73  ? -23.499  -5.243   361.373 1.00 109.59 ? 73  ILE 3 CG1   1 
ATOM   5248  C  CG2   . ILE C  3  73  ? -23.664  -6.931   359.508 1.00 111.08 ? 73  ILE 3 CG2   1 
ATOM   5249  C  CD1   . ILE C  3  73  ? -22.963  -4.102   360.514 1.00 108.59 ? 73  ILE 3 CD1   1 
ATOM   5250  N  N     . GLN C  3  74  ? -22.170  -8.936   363.544 1.00 107.59 ? 74  GLN 3 N     1 
ATOM   5251  C  CA    . GLN C  3  74  ? -21.384  -9.095   364.765 1.00 103.62 ? 74  GLN 3 CA    1 
ATOM   5252  C  C     . GLN C  3  74  ? -20.132  -9.897   364.426 1.00 99.51  ? 74  GLN 3 C     1 
ATOM   5253  O  O     . GLN C  3  74  ? -20.116  -11.125  364.552 1.00 100.16 ? 74  GLN 3 O     1 
ATOM   5254  C  CB    . GLN C  3  74  ? -22.219  -9.752   365.856 1.00 104.87 ? 74  GLN 3 CB    1 
ATOM   5255  C  CG    . GLN C  3  74  ? -22.915  -8.750   366.770 1.00 105.26 ? 74  GLN 3 CG    1 
ATOM   5256  C  CD    . GLN C  3  74  ? -23.670  -9.417   367.899 1.00 105.76 ? 74  GLN 3 CD    1 
ATOM   5257  O  OE1   . GLN C  3  74  ? -23.227  -10.428  368.447 1.00 107.13 ? 74  GLN 3 OE1   1 
ATOM   5258  N  NE2   . GLN C  3  74  ? -24.816  -8.849   368.260 1.00 104.57 ? 74  GLN 3 NE2   1 
ATOM   5259  N  N     . TRP C  3  75  ? -19.084  -9.194   363.999 1.00 91.54  ? 75  TRP 3 N     1 
ATOM   5260  C  CA    . TRP C  3  75  ? -17.836  -9.852   363.644 1.00 87.90  ? 75  TRP 3 CA    1 
ATOM   5261  C  C     . TRP C  3  75  ? -17.180  -10.416  364.897 1.00 75.39  ? 75  TRP 3 C     1 
ATOM   5262  O  O     . TRP C  3  75  ? -17.204  -9.794   365.962 1.00 74.66  ? 75  TRP 3 O     1 
ATOM   5263  C  CB    . TRP C  3  75  ? -16.881  -8.868   362.968 1.00 93.13  ? 75  TRP 3 CB    1 
ATOM   5264  C  CG    . TRP C  3  75  ? -17.326  -8.368   361.627 1.00 100.89 ? 75  TRP 3 CG    1 
ATOM   5265  C  CD1   . TRP C  3  75  ? -17.562  -7.069   361.279 1.00 103.62 ? 75  TRP 3 CD1   1 
ATOM   5266  C  CD2   . TRP C  3  75  ? -17.567  -9.146   360.448 1.00 103.07 ? 75  TRP 3 CD2   1 
ATOM   5267  N  NE1   . TRP C  3  75  ? -17.941  -6.990   359.963 1.00 105.10 ? 75  TRP 3 NE1   1 
ATOM   5268  C  CE2   . TRP C  3  75  ? -17.954  -8.252   359.430 1.00 105.18 ? 75  TRP 3 CE2   1 
ATOM   5269  C  CE3   . TRP C  3  75  ? -17.498  -10.509  360.153 1.00 104.79 ? 75  TRP 3 CE3   1 
ATOM   5270  C  CZ2   . TRP C  3  75  ? -18.270  -8.677   358.144 1.00 106.20 ? 75  TRP 3 CZ2   1 
ATOM   5271  C  CZ3   . TRP C  3  75  ? -17.813  -10.927  358.874 1.00 105.71 ? 75  TRP 3 CZ3   1 
ATOM   5272  C  CH2   . TRP C  3  75  ? -18.193  -10.015  357.886 1.00 106.39 ? 75  TRP 3 CH2   1 
ATOM   5273  N  N     . GLN C  3  76  ? -16.607  -11.610  364.772 1.00 68.99  ? 76  GLN 3 N     1 
ATOM   5274  C  CA    . GLN C  3  76  ? -15.888  -12.192  365.894 1.00 61.51  ? 76  GLN 3 CA    1 
ATOM   5275  C  C     . GLN C  3  76  ? -14.666  -11.335  366.229 1.00 55.86  ? 76  GLN 3 C     1 
ATOM   5276  O  O     . GLN C  3  76  ? -14.109  -10.662  365.354 1.00 59.31  ? 76  GLN 3 O     1 
ATOM   5277  C  CB    . GLN C  3  76  ? -15.461  -13.629  365.580 1.00 62.62  ? 76  GLN 3 CB    1 
ATOM   5278  C  CG    . GLN C  3  76  ? -16.600  -14.574  365.204 1.00 62.93  ? 76  GLN 3 CG    1 
ATOM   5279  C  CD    . GLN C  3  76  ? -16.970  -15.532  366.322 1.00 61.98  ? 76  GLN 3 CD    1 
ATOM   5280  O  OE1   . GLN C  3  76  ? -16.561  -16.689  366.322 1.00 62.16  ? 76  GLN 3 OE1   1 
ATOM   5281  N  NE2   . GLN C  3  76  ? -17.754  -15.053  367.278 1.00 61.10  ? 76  GLN 3 NE2   1 
ATOM   5282  N  N     . PRO C  3  77  ? -14.215  -11.358  367.488 1.00 43.66  ? 77  PRO 3 N     1 
ATOM   5283  C  CA    . PRO C  3  77  ? -13.062  -10.521  367.859 1.00 37.34  ? 77  PRO 3 CA    1 
ATOM   5284  C  C     . PRO C  3  77  ? -11.789  -10.904  367.126 1.00 39.41  ? 77  PRO 3 C     1 
ATOM   5285  O  O     . PRO C  3  77  ? -11.126  -10.038  366.544 1.00 40.28  ? 77  PRO 3 O     1 
ATOM   5286  C  CB    . PRO C  3  77  ? -12.954  -10.735  369.375 1.00 35.86  ? 77  PRO 3 CB    1 
ATOM   5287  C  CG    . PRO C  3  77  ? -14.313  -11.200  369.793 1.00 37.05  ? 77  PRO 3 CG    1 
ATOM   5288  C  CD    . PRO C  3  77  ? -14.816  -12.019  368.659 1.00 40.24  ? 77  PRO 3 CD    1 
ATOM   5289  N  N     . LYS C  3  78  ? -11.421  -12.178  367.147 1.00 42.11  ? 78  LYS 3 N     1 
ATOM   5290  C  CA    . LYS C  3  78  ? -10.199  -12.659  366.522 1.00 44.92  ? 78  LYS 3 CA    1 
ATOM   5291  C  C     . LYS C  3  78  ? -10.536  -13.563  365.343 1.00 44.29  ? 78  LYS 3 C     1 
ATOM   5292  O  O     . LYS C  3  78  ? -11.647  -14.094  365.232 1.00 47.86  ? 78  LYS 3 O     1 
ATOM   5293  C  CB    . LYS C  3  78  ? -9.334   -13.422  367.532 1.00 43.07  ? 78  LYS 3 CB    1 
ATOM   5294  C  CG    . LYS C  3  78  ? -10.134  -14.410  368.394 1.00 47.01  ? 78  LYS 3 CG    1 
ATOM   5295  C  CD    . LYS C  3  78  ? -9.296   -14.991  369.544 1.00 49.33  ? 78  LYS 3 CD    1 
ATOM   5296  C  CE    . LYS C  3  78  ? -10.113  -15.938  370.439 1.00 46.99  ? 78  LYS 3 CE    1 
ATOM   5297  N  NZ    . LYS C  3  78  ? -9.249   -16.780  371.321 1.00 41.77  ? 78  LYS 3 NZ    1 
ATOM   5298  N  N     . LEU C  3  79  ? -9.560   -13.723  364.452 1.00 43.68  ? 79  LEU 3 N     1 
ATOM   5299  C  CA    . LEU C  3  79  ? -9.777   -14.491  363.231 1.00 39.82  ? 79  LEU 3 CA    1 
ATOM   5300  C  C     . LEU C  3  79  ? -10.007  -15.972  363.532 1.00 39.05  ? 79  LEU 3 C     1 
ATOM   5301  O  O     . LEU C  3  79  ? -9.214   -16.621  364.222 1.00 40.29  ? 79  LEU 3 O     1 
ATOM   5302  C  CB    . LEU C  3  79  ? -8.588   -14.331  362.295 1.00 35.10  ? 79  LEU 3 CB    1 
ATOM   5303  C  CG    . LEU C  3  79  ? -8.265   -12.881  362.011 1.00 31.66  ? 79  LEU 3 CG    1 
ATOM   5304  C  CD1   . LEU C  3  79  ? -6.788   -12.769  361.638 1.00 31.87  ? 79  LEU 3 CD1   1 
ATOM   5305  C  CD2   . LEU C  3  79  ? -9.208   -12.344  360.920 1.00 29.78  ? 79  LEU 3 CD2   1 
ATOM   5306  N  N     . ALA C  3  80  ? -11.064  -16.525  362.971 1.00 36.59  ? 80  ALA 3 N     1 
ATOM   5307  C  CA    . ALA C  3  80  ? -11.414  -17.888  363.302 1.00 42.22  ? 80  ALA 3 CA    1 
ATOM   5308  C  C     . ALA C  3  80  ? -10.575  -18.839  362.465 1.00 46.96  ? 80  ALA 3 C     1 
ATOM   5309  O  O     . ALA C  3  80  ? -10.333  -18.596  361.279 1.00 54.92  ? 80  ALA 3 O     1 
ATOM   5310  C  CB    . ALA C  3  80  ? -12.903  -18.139  363.061 1.00 41.83  ? 80  ALA 3 CB    1 
ATOM   5311  N  N     . ALA C  3  81  ? -10.086  -19.895  363.113 1.00 43.67  ? 81  ALA 3 N     1 
ATOM   5312  C  CA    . ALA C  3  81  ? -9.385   -20.989  362.448 1.00 35.44  ? 81  ALA 3 CA    1 
ATOM   5313  C  C     . ALA C  3  81  ? -10.405  -21.785  361.663 1.00 26.59  ? 81  ALA 3 C     1 
ATOM   5314  O  O     . ALA C  3  81  ? -11.188  -22.542  362.236 1.00 26.34  ? 81  ALA 3 O     1 
ATOM   5315  C  CB    . ALA C  3  81  ? -8.687   -21.877  363.467 1.00 35.59  ? 81  ALA 3 CB    1 
ATOM   5316  N  N     . SER C  3  82  ? -10.419  -21.588  360.347 1.00 27.61  ? 82  SER 3 N     1 
ATOM   5317  C  CA    . SER C  3  82  ? -11.397  -22.264  359.511 1.00 32.61  ? 82  SER 3 CA    1 
ATOM   5318  C  C     . SER C  3  82  ? -11.117  -23.758  359.374 1.00 24.14  ? 82  SER 3 C     1 
ATOM   5319  O  O     . SER C  3  82  ? -12.013  -24.493  358.952 1.00 23.82  ? 82  SER 3 O     1 
ATOM   5320  C  CB    . SER C  3  82  ? -11.488  -21.554  358.147 1.00 24.79  ? 82  SER 3 CB    1 
ATOM   5321  O  OG    . SER C  3  82  ? -10.285  -21.592  357.405 1.00 24.98  ? 82  SER 3 OG    1 
ATOM   5322  N  N     . CYS C  3  83  ? -9.940   -24.227  359.804 1.00 24.16  ? 83  CYS 3 N     1 
ATOM   5323  C  CA    . CYS C  3  83  ? -9.584   -25.638  359.691 1.00 23.79  ? 83  CYS 3 CA    1 
ATOM   5324  C  C     . CYS C  3  83  ? -10.269  -26.493  360.752 1.00 28.38  ? 83  CYS 3 C     1 
ATOM   5325  O  O     . CYS C  3  83  ? -10.662  -27.629  360.466 1.00 24.91  ? 83  CYS 3 O     1 
ATOM   5326  C  CB    . CYS C  3  83  ? -8.059   -25.796  359.789 1.00 23.97  ? 83  CYS 3 CB    1 
ATOM   5327  S  SG    . CYS C  3  83  ? -7.316   -25.921  361.467 1.00 23.98  ? 83  CYS 3 SG    1 
ATOM   5328  N  N     . VAL C  3  84  ? -10.489  -25.953  361.948 1.00 31.81  ? 84  VAL 3 N     1 
ATOM   5329  C  CA    . VAL C  3  84  ? -11.048  -26.709  363.060 1.00 23.16  ? 84  VAL 3 CA    1 
ATOM   5330  C  C     . VAL C  3  84  ? -12.360  -26.120  363.562 1.00 23.14  ? 84  VAL 3 C     1 
ATOM   5331  O  O     . VAL C  3  84  ? -12.818  -26.478  364.646 1.00 22.94  ? 84  VAL 3 O     1 
ATOM   5332  C  CB    . VAL C  3  84  ? -10.035  -26.801  364.220 1.00 31.65  ? 84  VAL 3 CB    1 
ATOM   5333  C  CG1   . VAL C  3  84  ? -8.951   -27.777  363.917 1.00 26.42  ? 84  VAL 3 CG1   1 
ATOM   5334  C  CG2   . VAL C  3  84  ? -9.397   -25.462  364.435 1.00 23.72  ? 84  VAL 3 CG2   1 
ATOM   5335  N  N     . THR C  3  85  ? -12.981  -25.233  362.793 1.00 36.92  ? 85  THR 3 N     1 
ATOM   5336  C  CA    . THR C  3  85  ? -14.204  -24.559  363.204 1.00 30.48  ? 85  THR 3 CA    1 
ATOM   5337  C  C     . THR C  3  85  ? -15.372  -25.092  362.389 1.00 27.89  ? 85  THR 3 C     1 
ATOM   5338  O  O     . THR C  3  85  ? -15.260  -25.255  361.167 1.00 25.34  ? 85  THR 3 O     1 
ATOM   5339  C  CB    . THR C  3  85  ? -14.088  -23.038  363.043 1.00 29.37  ? 85  THR 3 CB    1 
ATOM   5340  O  OG1   . THR C  3  85  ? -12.919  -22.562  363.730 1.00 24.11  ? 85  THR 3 OG1   1 
ATOM   5341  C  CG2   . THR C  3  85  ? -15.323  -22.337  363.609 1.00 32.19  ? 85  THR 3 CG2   1 
ATOM   5342  N  N     . ALA C  3  86  ? -16.451  -25.454  363.080 1.00 30.00  ? 86  ALA 3 N     1 
ATOM   5343  C  CA    . ALA C  3  86  ? -17.681  -25.864  362.419 1.00 30.70  ? 86  ALA 3 CA    1 
ATOM   5344  C  C     . ALA C  3  86  ? -18.431  -24.624  361.931 1.00 50.69  ? 86  ALA 3 C     1 
ATOM   5345  O  O     . ALA C  3  86  ? -18.114  -23.481  362.299 1.00 56.70  ? 86  ALA 3 O     1 
ATOM   5346  C  CB    . ALA C  3  86  ? -18.565  -26.686  363.356 1.00 23.07  ? 86  ALA 3 CB    1 
ATOM   5347  N  N     . VAL C  3  87  ? -19.448  -24.858  361.101 1.00 49.23  ? 87  VAL 3 N     1 
ATOM   5348  C  CA    . VAL C  3  87  ? -20.243  -23.779  360.526 1.00 50.70  ? 87  VAL 3 CA    1 
ATOM   5349  C  C     . VAL C  3  87  ? -21.612  -23.764  361.194 1.00 44.97  ? 87  VAL 3 C     1 
ATOM   5350  O  O     . VAL C  3  87  ? -22.138  -24.807  361.617 1.00 47.47  ? 87  VAL 3 O     1 
ATOM   5351  C  CB    . VAL C  3  87  ? -20.381  -23.915  358.990 1.00 49.23  ? 87  VAL 3 CB    1 
ATOM   5352  C  CG1   . VAL C  3  87  ? -19.018  -23.780  358.300 1.00 50.27  ? 87  VAL 3 CG1   1 
ATOM   5353  C  CG2   . VAL C  3  87  ? -21.051  -25.247  358.622 1.00 49.01  ? 87  VAL 3 CG2   1 
ATOM   5354  N  N     . ALA C  3  88  ? -22.193  -22.560  361.279 1.00 34.90  ? 88  ALA 3 N     1 
ATOM   5355  C  CA    . ALA C  3  88  ? -23.554  -22.370  361.753 1.00 27.20  ? 88  ALA 3 CA    1 
ATOM   5356  C  C     . ALA C  3  88  ? -24.352  -21.642  360.685 1.00 26.94  ? 88  ALA 3 C     1 
ATOM   5357  O  O     . ALA C  3  88  ? -23.793  -21.002  359.790 1.00 23.41  ? 88  ALA 3 O     1 
ATOM   5358  C  CB    . ALA C  3  88  ? -23.599  -21.577  363.067 1.00 24.40  ? 88  ALA 3 CB    1 
ATOM   5359  N  N     . ASP C  3  89  ? -25.671  -21.793  360.779 1.00 22.96  ? 89  ASP 3 N     1 
ATOM   5360  C  CA    . ASP C  3  89  ? -26.577  -21.216  359.803 1.00 30.17  ? 89  ASP 3 CA    1 
ATOM   5361  C  C     . ASP C  3  89  ? -26.443  -19.687  359.785 1.00 33.27  ? 89  ASP 3 C     1 
ATOM   5362  O  O     . ASP C  3  89  ? -26.245  -19.043  360.825 1.00 35.97  ? 89  ASP 3 O     1 
ATOM   5363  C  CB    . ASP C  3  89  ? -28.012  -21.633  360.124 1.00 22.82  ? 89  ASP 3 CB    1 
ATOM   5364  C  CG    . ASP C  3  89  ? -28.870  -21.755  358.885 1.00 24.99  ? 89  ASP 3 CG    1 
ATOM   5365  O  OD1   . ASP C  3  89  ? -28.700  -20.936  357.959 1.00 24.73  ? 89  ASP 3 OD1   1 
ATOM   5366  O  OD2   . ASP C  3  89  ? -29.767  -22.621  358.862 1.00 23.50  ? 89  ASP 3 OD2   1 
ATOM   5367  N  N     . GLY C  3  90  ? -26.531  -19.105  358.590 1.00 30.11  ? 90  GLY 3 N     1 
ATOM   5368  C  CA    . GLY C  3  90  ? -26.460  -17.666  358.430 1.00 27.13  ? 90  GLY 3 CA    1 
ATOM   5369  C  C     . GLY C  3  90  ? -25.187  -17.031  358.954 1.00 24.47  ? 90  GLY 3 C     1 
ATOM   5370  O  O     . GLY C  3  90  ? -25.259  -16.134  359.794 1.00 35.97  ? 90  GLY 3 O     1 
ATOM   5371  N  N     . MET C  3  91  ? -24.022  -17.470  358.486 1.00 31.54  ? 91  MET 3 N     1 
ATOM   5372  C  CA    . MET C  3  91  ? -22.754  -16.897  358.914 1.00 36.05  ? 91  MET 3 CA    1 
ATOM   5373  C  C     . MET C  3  91  ? -22.046  -16.243  357.734 1.00 39.56  ? 91  MET 3 C     1 
ATOM   5374  O  O     . MET C  3  91  ? -22.075  -16.773  356.619 1.00 41.95  ? 91  MET 3 O     1 
ATOM   5375  C  CB    . MET C  3  91  ? -21.871  -17.957  359.548 1.00 37.66  ? 91  MET 3 CB    1 
ATOM   5376  C  CG    . MET C  3  91  ? -20.546  -17.425  360.022 1.00 43.60  ? 91  MET 3 CG    1 
ATOM   5377  S  SD    . MET C  3  91  ? -19.589  -18.731  360.754 1.00 52.06  ? 91  MET 3 SD    1 
ATOM   5378  C  CE    . MET C  3  91  ? -19.418  -19.892  359.393 1.00 55.02  ? 91  MET 3 CE    1 
ATOM   5379  N  N     . VAL C  3  92  ? -21.416  -15.085  357.980 1.00 40.28  ? 92  VAL 3 N     1 
ATOM   5380  C  CA    . VAL C  3  92  ? -20.692  -14.333  356.950 1.00 39.85  ? 92  VAL 3 CA    1 
ATOM   5381  C  C     . VAL C  3  92  ? -19.196  -14.544  357.156 1.00 39.87  ? 92  VAL 3 C     1 
ATOM   5382  O  O     . VAL C  3  92  ? -18.691  -14.366  358.272 1.00 42.91  ? 92  VAL 3 O     1 
ATOM   5383  C  CB    . VAL C  3  92  ? -21.041  -12.832  357.008 1.00 43.87  ? 92  VAL 3 CB    1 
ATOM   5384  C  CG1   . VAL C  3  92  ? -20.241  -12.031  355.969 1.00 45.74  ? 92  VAL 3 CG1   1 
ATOM   5385  C  CG2   . VAL C  3  92  ? -22.537  -12.605  356.833 1.00 43.60  ? 92  VAL 3 CG2   1 
ATOM   5386  N  N     . VAL C  3  93  ? -18.472  -14.856  356.080 1.00 32.90  ? 93  VAL 3 N     1 
ATOM   5387  C  CA    . VAL C  3  93  ? -17.047  -15.178  356.149 1.00 33.31  ? 93  VAL 3 CA    1 
ATOM   5388  C  C     . VAL C  3  93  ? -16.270  -14.245  355.226 1.00 29.27  ? 93  VAL 3 C     1 
ATOM   5389  O  O     . VAL C  3  93  ? -16.575  -14.148  354.032 1.00 33.30  ? 93  VAL 3 O     1 
ATOM   5390  C  CB    . VAL C  3  93  ? -16.776  -16.649  355.787 1.00 37.21  ? 93  VAL 3 CB    1 
ATOM   5391  C  CG1   . VAL C  3  93  ? -15.284  -16.957  355.929 1.00 25.74  ? 93  VAL 3 CG1   1 
ATOM   5392  C  CG2   . VAL C  3  93  ? -17.652  -17.594  356.641 1.00 25.22  ? 93  VAL 3 CG2   1 
ATOM   5393  N  N     . ASP C  3  94  ? -15.262  -13.576  355.780 1.00 26.75  ? 94  ASP 3 N     1 
ATOM   5394  C  CA    . ASP C  3  94  ? -14.479  -12.575  355.064 1.00 31.03  ? 94  ASP 3 CA    1 
ATOM   5395  C  C     . ASP C  3  94  ? -13.039  -13.054  354.914 1.00 27.24  ? 94  ASP 3 C     1 
ATOM   5396  O  O     . ASP C  3  94  ? -12.306  -13.150  355.912 1.00 27.27  ? 94  ASP 3 O     1 
ATOM   5397  C  CB    . ASP C  3  94  ? -14.526  -11.250  355.824 1.00 37.55  ? 94  ASP 3 CB    1 
ATOM   5398  C  CG    . ASP C  3  94  ? -13.799  -10.122  355.113 1.00 42.73  ? 94  ASP 3 CG    1 
ATOM   5399  O  OD1   . ASP C  3  94  ? -13.263  -10.340  354.006 1.00 45.21  ? 94  ASP 3 OD1   1 
ATOM   5400  O  OD2   . ASP C  3  94  ? -13.781  -9.000   355.661 1.00 43.75  ? 94  ASP 3 OD2   1 
ATOM   5401  N  N     . THR C  3  95  ? -12.623  -13.277  353.656 1.00 27.29  ? 95  THR 3 N     1 
ATOM   5402  C  CA    . THR C  3  95  ? -11.272  -13.704  353.303 1.00 29.40  ? 95  THR 3 CA    1 
ATOM   5403  C  C     . THR C  3  95  ? -10.559  -12.728  352.376 1.00 29.16  ? 95  THR 3 C     1 
ATOM   5404  O  O     . THR C  3  95  ? -9.414   -12.996  351.982 1.00 27.90  ? 95  THR 3 O     1 
ATOM   5405  C  CB    . THR C  3  95  ? -11.282  -15.085  352.615 1.00 33.89  ? 95  THR 3 CB    1 
ATOM   5406  O  OG1   . THR C  3  95  ? -11.598  -14.927  351.225 1.00 39.31  ? 95  THR 3 OG1   1 
ATOM   5407  C  CG2   . THR C  3  95  ? -12.285  -16.059  353.253 1.00 32.94  ? 95  THR 3 CG2   1 
ATOM   5408  N  N     . LEU C  3  96  ? -11.209  -11.625  351.988 1.00 31.78  ? 96  LEU 3 N     1 
ATOM   5409  C  CA    . LEU C  3  96  ? -10.622  -10.650  351.073 1.00 38.02  ? 96  LEU 3 CA    1 
ATOM   5410  C  C     . LEU C  3  96  ? -10.298  -9.309   351.728 1.00 29.68  ? 96  LEU 3 C     1 
ATOM   5411  O  O     . LEU C  3  96  ? -9.649   -8.466   351.090 1.00 29.27  ? 96  LEU 3 O     1 
ATOM   5412  C  CB    . LEU C  3  96  ? -11.555  -10.412  349.872 1.00 43.93  ? 96  LEU 3 CB    1 
ATOM   5413  C  CG    . LEU C  3  96  ? -11.678  -11.556  348.857 1.00 41.32  ? 96  LEU 3 CG    1 
ATOM   5414  C  CD1   . LEU C  3  96  ? -13.064  -11.558  348.207 1.00 28.01  ? 96  LEU 3 CD1   1 
ATOM   5415  C  CD2   . LEU C  3  96  ? -10.546  -11.477  347.814 1.00 40.53  ? 96  LEU 3 CD2   1 
ATOM   5416  N  N     . SER C  3  97  ? -10.707  -9.103   352.978 1.00 32.90  ? 97  SER 3 N     1 
ATOM   5417  C  CA    . SER C  3  97  ? -10.355  -7.885   353.685 1.00 35.33  ? 97  SER 3 CA    1 
ATOM   5418  C  C     . SER C  3  97  ? -8.842   -7.771   353.775 1.00 39.68  ? 97  SER 3 C     1 
ATOM   5419  O  O     . SER C  3  97  ? -8.123   -8.771   353.870 1.00 33.43  ? 97  SER 3 O     1 
ATOM   5420  C  CB    . SER C  3  97  ? -10.961  -7.866   355.093 1.00 34.76  ? 97  SER 3 CB    1 
ATOM   5421  O  OG    . SER C  3  97  ? -12.306  -7.421   355.088 1.00 31.51  ? 97  SER 3 OG    1 
ATOM   5422  N  N     . ASP C  3  98  ? -8.363   -6.528   353.719 1.00 46.59  ? 98  ASP 3 N     1 
ATOM   5423  C  CA    . ASP C  3  98  ? -6.927   -6.267   353.768 1.00 51.36  ? 98  ASP 3 CA    1 
ATOM   5424  C  C     . ASP C  3  98  ? -6.301   -6.852   355.033 1.00 51.88  ? 98  ASP 3 C     1 
ATOM   5425  O  O     . ASP C  3  98  ? -5.120   -7.235   355.028 1.00 50.83  ? 98  ASP 3 O     1 
ATOM   5426  C  CB    . ASP C  3  98  ? -6.690   -4.760   353.664 1.00 52.12  ? 98  ASP 3 CB    1 
ATOM   5427  C  CG    . ASP C  3  98  ? -6.946   -4.224   352.252 1.00 53.56  ? 98  ASP 3 CG    1 
ATOM   5428  O  OD1   . ASP C  3  98  ? -6.636   -4.919   351.254 1.00 52.24  ? 98  ASP 3 OD1   1 
ATOM   5429  O  OD2   . ASP C  3  98  ? -7.489   -3.104   352.141 1.00 55.33  ? 98  ASP 3 OD2   1 
ATOM   5430  N  N     . VAL C  3  99  ? -7.094   -6.953   356.108 1.00 50.10  ? 99  VAL 3 N     1 
ATOM   5431  C  CA    . VAL C  3  99  ? -6.633   -7.538   357.366 1.00 48.22  ? 99  VAL 3 CA    1 
ATOM   5432  C  C     . VAL C  3  99  ? -6.253   -9.004   357.171 1.00 43.88  ? 99  VAL 3 C     1 
ATOM   5433  O  O     . VAL C  3  99  ? -5.199   -9.459   357.645 1.00 44.07  ? 99  VAL 3 O     1 
ATOM   5434  C  CB    . VAL C  3  99  ? -7.725   -7.386   358.447 1.00 45.98  ? 99  VAL 3 CB    1 
ATOM   5435  C  CG1   . VAL C  3  99  ? -7.231   -7.873   359.825 1.00 42.34  ? 99  VAL 3 CG1   1 
ATOM   5436  C  CG2   . VAL C  3  99  ? -8.243   -5.952   358.508 1.00 47.93  ? 99  VAL 3 CG2   1 
ATOM   5437  N  N     . VAL C  3  100 ? -7.091   -9.766   356.466 1.00 39.20  ? 100 VAL 3 N     1 
ATOM   5438  C  CA    . VAL C  3  100 ? -6.801   -11.187  356.297 1.00 38.50  ? 100 VAL 3 CA    1 
ATOM   5439  C  C     . VAL C  3  100 ? -5.518   -11.372  355.492 1.00 39.06  ? 100 VAL 3 C     1 
ATOM   5440  O  O     . VAL C  3  100 ? -4.595   -12.077  355.920 1.00 38.58  ? 100 VAL 3 O     1 
ATOM   5441  C  CB    . VAL C  3  100 ? -7.998   -11.923  355.652 1.00 35.04  ? 100 VAL 3 CB    1 
ATOM   5442  C  CG1   . VAL C  3  100 ? -7.583   -13.292  355.097 1.00 27.95  ? 100 VAL 3 CG1   1 
ATOM   5443  C  CG2   . VAL C  3  100 ? -9.135   -12.102  356.661 1.00 38.55  ? 100 VAL 3 CG2   1 
ATOM   5444  N  N     . ARG C  3  101 ? -5.413   -10.695  354.347 1.00 37.52  ? 101 ARG 3 N     1 
ATOM   5445  C  CA    . ARG C  3  101 ? -4.233   -10.888  353.509 1.00 40.47  ? 101 ARG 3 CA    1 
ATOM   5446  C  C     . ARG C  3  101 ? -2.963   -10.434  354.230 1.00 41.97  ? 101 ARG 3 C     1 
ATOM   5447  O  O     . ARG C  3  101 ? -1.926   -11.111  354.160 1.00 39.17  ? 101 ARG 3 O     1 
ATOM   5448  C  CB    . ARG C  3  101 ? -4.429   -10.165  352.169 1.00 40.40  ? 101 ARG 3 CB    1 
ATOM   5449  C  CG    . ARG C  3  101 ? -5.361   -10.915  351.212 1.00 29.18  ? 101 ARG 3 CG    1 
ATOM   5450  C  CD    . ARG C  3  101 ? -5.395   -10.382  349.777 1.00 29.41  ? 101 ARG 3 CD    1 
ATOM   5451  N  NE    . ARG C  3  101 ? -5.645   -8.944   349.699 1.00 29.80  ? 101 ARG 3 NE    1 
ATOM   5452  C  CZ    . ARG C  3  101 ? -4.723   -8.027   349.400 1.00 34.23  ? 101 ARG 3 CZ    1 
ATOM   5453  N  NH1   . ARG C  3  101 ? -3.472   -8.388   349.130 1.00 31.49  ? 101 ARG 3 NH1   1 
ATOM   5454  N  NH2   . ARG C  3  101 ? -5.056   -6.738   349.355 1.00 36.53  ? 101 ARG 3 NH2   1 
ATOM   5455  N  N     . GLU C  3  102 ? -3.054   -9.336   354.994 1.00 45.96  ? 102 GLU 3 N     1 
ATOM   5456  C  CA    . GLU C  3  102 ? -1.918   -8.857   355.783 1.00 46.95  ? 102 GLU 3 CA    1 
ATOM   5457  C  C     . GLU C  3  102 ? -1.453   -9.917   356.771 1.00 46.66  ? 102 GLU 3 C     1 
ATOM   5458  O  O     . GLU C  3  102 ? -0.257   -10.238  356.856 1.00 51.99  ? 102 GLU 3 O     1 
ATOM   5459  C  CB    . GLU C  3  102 ? -2.317   -7.592   356.545 1.00 45.35  ? 102 GLU 3 CB    1 
ATOM   5460  C  CG    . GLU C  3  102 ? -1.215   -7.005   357.409 1.00 49.89  ? 102 GLU 3 CG    1 
ATOM   5461  C  CD    . GLU C  3  102 ? -1.674   -5.772   358.177 1.00 56.61  ? 102 GLU 3 CD    1 
ATOM   5462  O  OE1   . GLU C  3  102 ? -2.735   -5.209   357.822 1.00 59.54  ? 102 GLU 3 OE1   1 
ATOM   5463  O  OE2   . GLU C  3  102 ? -0.957   -5.343   359.114 1.00 57.43  ? 102 GLU 3 OE2   1 
ATOM   5464  N  N     . ALA C  3  103 ? -2.396   -10.478  357.529 1.00 40.59  ? 103 ALA 3 N     1 
ATOM   5465  C  CA    . ALA C  3  103 ? -2.034   -11.476  358.522 1.00 36.44  ? 103 ALA 3 CA    1 
ATOM   5466  C  C     . ALA C  3  103 ? -1.441   -12.720  357.862 1.00 35.46  ? 103 ALA 3 C     1 
ATOM   5467  O  O     . ALA C  3  103 ? -0.493   -13.329  358.388 1.00 28.94  ? 103 ALA 3 O     1 
ATOM   5468  C  CB    . ALA C  3  103 ? -3.265   -11.813  359.360 1.00 28.90  ? 103 ALA 3 CB    1 
ATOM   5469  N  N     . GLN C  3  104 ? -1.975   -13.094  356.692 1.00 37.88  ? 104 GLN 3 N     1 
ATOM   5470  C  CA    . GLN C  3  104 ? -1.493   -14.283  355.980 1.00 40.43  ? 104 GLN 3 CA    1 
ATOM   5471  C  C     . GLN C  3  104 ? -0.058   -14.090  355.501 1.00 38.96  ? 104 GLN 3 C     1 
ATOM   5472  O  O     . GLN C  3  104 ? 0.762    -15.015  355.578 1.00 38.21  ? 104 GLN 3 O     1 
ATOM   5473  C  CB    . GLN C  3  104 ? -2.423   -14.620  354.804 1.00 39.32  ? 104 GLN 3 CB    1 
ATOM   5474  C  CG    . GLN C  3  104 ? -3.765   -15.228  355.241 1.00 35.01  ? 104 GLN 3 CG    1 
ATOM   5475  C  CD    . GLN C  3  104 ? -4.716   -15.521  354.088 1.00 27.77  ? 104 GLN 3 CD    1 
ATOM   5476  O  OE1   . GLN C  3  104 ? -5.736   -16.171  354.272 1.00 27.41  ? 104 GLN 3 OE1   1 
ATOM   5477  N  NE2   . GLN C  3  104 ? -4.354   -15.098  352.890 1.00 28.01  ? 104 GLN 3 NE2   1 
ATOM   5478  N  N     . ALA C  3  105 ? 0.248    -12.904  354.966 1.00 36.00  ? 105 ALA 3 N     1 
ATOM   5479  C  CA    . ALA C  3  105 ? 1.618    -12.608  354.567 1.00 33.02  ? 105 ALA 3 CA    1 
ATOM   5480  C  C     . ALA C  3  105 ? 2.548    -12.676  355.771 1.00 32.46  ? 105 ALA 3 C     1 
ATOM   5481  O  O     . ALA C  3  105 ? 3.657    -13.221  355.682 1.00 29.81  ? 105 ALA 3 O     1 
ATOM   5482  C  CB    . ALA C  3  105 ? 1.687    -11.229  353.907 1.00 30.13  ? 105 ALA 3 CB    1 
ATOM   5483  N  N     . GLY C  3  106 ? 2.097    -12.161  356.918 1.00 36.72  ? 106 GLY 3 N     1 
ATOM   5484  C  CA    . GLY C  3  106 ? 2.931    -12.211  358.111 1.00 37.20  ? 106 GLY 3 CA    1 
ATOM   5485  C  C     . GLY C  3  106 ? 3.255    -13.631  358.540 1.00 37.57  ? 106 GLY 3 C     1 
ATOM   5486  O  O     . GLY C  3  106 ? 4.404    -13.944  358.877 1.00 29.60  ? 106 GLY 3 O     1 
ATOM   5487  N  N     . MET C  3  107 ? 2.243    -14.511  358.535 1.00 42.69  ? 107 MET 3 N     1 
ATOM   5488  C  CA    . MET C  3  107 ? 2.468    -15.929  358.860 1.00 49.47  ? 107 MET 3 CA    1 
ATOM   5489  C  C     . MET C  3  107 ? 3.349    -16.639  357.836 1.00 41.26  ? 107 MET 3 C     1 
ATOM   5490  O  O     . MET C  3  107 ? 4.104    -17.548  358.198 1.00 28.50  ? 107 MET 3 O     1 
ATOM   5491  C  CB    . MET C  3  107 ? 1.137    -16.669  358.993 1.00 53.66  ? 107 MET 3 CB    1 
ATOM   5492  C  CG    . MET C  3  107 ? 1.146    -17.760  360.037 1.00 61.26  ? 107 MET 3 CG    1 
ATOM   5493  S  SD    . MET C  3  107 ? 1.214    -17.093  361.694 1.00 74.73  ? 107 MET 3 SD    1 
ATOM   5494  C  CE    . MET C  3  107 ? -0.387   -16.283  361.810 1.00 80.08  ? 107 MET 3 CE    1 
ATOM   5495  N  N     . VAL C  3  108 ? 3.245    -16.261  356.559 1.00 43.98  ? 108 VAL 3 N     1 
ATOM   5496  C  CA    . VAL C  3  108 ? 4.164    -16.781  355.545 1.00 37.78  ? 108 VAL 3 CA    1 
ATOM   5497  C  C     . VAL C  3  108 ? 5.600    -16.385  355.882 1.00 34.47  ? 108 VAL 3 C     1 
ATOM   5498  O  O     . VAL C  3  108 ? 6.526    -17.193  355.752 1.00 31.79  ? 108 VAL 3 O     1 
ATOM   5499  C  CB    . VAL C  3  108 ? 3.752    -16.297  354.136 1.00 37.30  ? 108 VAL 3 CB    1 
ATOM   5500  C  CG1   . VAL C  3  108 ? 4.876    -16.507  353.140 1.00 34.64  ? 108 VAL 3 CG1   1 
ATOM   5501  C  CG2   . VAL C  3  108 ? 2.484    -17.009  353.637 1.00 28.56  ? 108 VAL 3 CG2   1 
ATOM   5502  N  N     . GLU C  3  109 ? 5.809    -15.130  356.305 1.00 34.55  ? 109 GLU 3 N     1 
ATOM   5503  C  CA    . GLU C  3  109 ? 7.152    -14.694  356.704 1.00 38.90  ? 109 GLU 3 CA    1 
ATOM   5504  C  C     . GLU C  3  109 ? 7.653    -15.508  357.892 1.00 40.77  ? 109 GLU 3 C     1 
ATOM   5505  O  O     . GLU C  3  109 ? 8.807    -15.967  357.918 1.00 35.61  ? 109 GLU 3 O     1 
ATOM   5506  C  CB    . GLU C  3  109 ? 7.174    -13.195  357.044 1.00 30.41  ? 109 GLU 3 CB    1 
ATOM   5507  C  CG    . GLU C  3  109 ? 8.426    -12.794  357.879 1.00 30.74  ? 109 GLU 3 CG    1 
ATOM   5508  C  CD    . GLU C  3  109 ? 8.580    -11.294  358.153 1.00 31.20  ? 109 GLU 3 CD    1 
ATOM   5509  O  OE1   . GLU C  3  109 ? 7.566    -10.564  358.219 1.00 40.67  ? 109 GLU 3 OE1   1 
ATOM   5510  O  OE2   . GLU C  3  109 ? 9.730    -10.847  358.345 1.00 31.55  ? 109 GLU 3 OE2   1 
ATOM   5511  N  N     . PHE C  3  110 ? 6.794    -15.688  358.896 1.00 40.21  ? 110 PHE 3 N     1 
ATOM   5512  C  CA    . PHE C  3  110 ? 7.188    -16.492  360.049 1.00 44.11  ? 110 PHE 3 CA    1 
ATOM   5513  C  C     . PHE C  3  110 ? 7.498    -17.935  359.654 1.00 35.49  ? 110 PHE 3 C     1 
ATOM   5514  O  O     . PHE C  3  110 ? 8.343    -18.575  360.286 1.00 34.66  ? 110 PHE 3 O     1 
ATOM   5515  C  CB    . PHE C  3  110 ? 6.114    -16.464  361.142 1.00 44.45  ? 110 PHE 3 CB    1 
ATOM   5516  C  CG    . PHE C  3  110 ? 5.982    -15.135  361.848 1.00 44.92  ? 110 PHE 3 CG    1 
ATOM   5517  C  CD1   . PHE C  3  110 ? 7.095    -14.353  362.083 1.00 43.16  ? 110 PHE 3 CD1   1 
ATOM   5518  C  CD2   . PHE C  3  110 ? 4.753    -14.692  362.309 1.00 43.43  ? 110 PHE 3 CD2   1 
ATOM   5519  C  CE1   . PHE C  3  110 ? 6.983    -13.145  362.745 1.00 43.94  ? 110 PHE 3 CE1   1 
ATOM   5520  C  CE2   . PHE C  3  110 ? 4.640    -13.476  362.974 1.00 42.46  ? 110 PHE 3 CE2   1 
ATOM   5521  C  CZ    . PHE C  3  110 ? 5.758    -12.707  363.188 1.00 42.14  ? 110 PHE 3 CZ    1 
ATOM   5522  N  N     . THR C  3  111 ? 6.804    -18.474  358.643 1.00 35.11  ? 111 THR 3 N     1 
ATOM   5523  C  CA    . THR C  3  111 ? 7.101    -19.837  358.195 1.00 39.10  ? 111 THR 3 CA    1 
ATOM   5524  C  C     . THR C  3  111 ? 8.426    -19.893  357.439 1.00 42.70  ? 111 THR 3 C     1 
ATOM   5525  O  O     . THR C  3  111 ? 9.251    -20.783  357.682 1.00 43.36  ? 111 THR 3 O     1 
ATOM   5526  C  CB    . THR C  3  111 ? 5.959    -20.394  357.327 1.00 42.85  ? 111 THR 3 CB    1 
ATOM   5527  O  OG1   . THR C  3  111 ? 4.763    -20.505  358.107 1.00 50.37  ? 111 THR 3 OG1   1 
ATOM   5528  C  CG2   . THR C  3  111 ? 6.294    -21.779  356.801 1.00 36.36  ? 111 THR 3 CG2   1 
ATOM   5529  N  N     . LEU C  3  112 ? 8.660    -18.932  356.543 1.00 42.21  ? 112 LEU 3 N     1 
ATOM   5530  C  CA    . LEU C  3  112 ? 9.891    -18.860  355.759 1.00 42.40  ? 112 LEU 3 CA    1 
ATOM   5531  C  C     . LEU C  3  112 ? 11.106   -18.462  356.592 1.00 41.51  ? 112 LEU 3 C     1 
ATOM   5532  O  O     . LEU C  3  112 ? 12.234   -18.558  356.096 1.00 37.08  ? 112 LEU 3 O     1 
ATOM   5533  C  CB    . LEU C  3  112 ? 9.700    -17.865  354.603 1.00 44.33  ? 112 LEU 3 CB    1 
ATOM   5534  C  CG    . LEU C  3  112 ? 8.650    -18.250  353.560 1.00 44.91  ? 112 LEU 3 CG    1 
ATOM   5535  C  CD1   . LEU C  3  112 ? 8.566    -17.240  352.419 1.00 43.12  ? 112 LEU 3 CD1   1 
ATOM   5536  C  CD2   . LEU C  3  112 ? 9.034    -19.604  353.026 1.00 46.83  ? 112 LEU 3 CD2   1 
ATOM   5537  N  N     . LEU C  3  113 ? 10.886   -18.077  357.853 1.00 43.23  ? 113 LEU 3 N     1 
ATOM   5538  C  CA    . LEU C  3  113 ? 11.914   -17.576  358.759 1.00 38.38  ? 113 LEU 3 CA    1 
ATOM   5539  C  C     . LEU C  3  113 ? 13.256   -18.296  358.681 1.00 30.04  ? 113 LEU 3 C     1 
ATOM   5540  O  O     . LEU C  3  113 ? 14.269   -17.703  358.307 1.00 30.44  ? 113 LEU 3 O     1 
ATOM   5541  C  CB    . LEU C  3  113 ? 11.375   -17.698  360.185 1.00 38.15  ? 113 LEU 3 CB    1 
ATOM   5542  C  CG    . LEU C  3  113 ? 11.800   -16.698  361.236 1.00 39.39  ? 113 LEU 3 CG    1 
ATOM   5543  C  CD1   . LEU C  3  113 ? 11.056   -15.371  361.053 1.00 39.61  ? 113 LEU 3 CD1   1 
ATOM   5544  C  CD2   . LEU C  3  113 ? 11.590   -17.317  362.611 1.00 40.24  ? 113 LEU 3 CD2   1 
ATOM   5545  N  N     . ASN C  3  114 ? 13.279   -19.582  359.014 1.00 34.99  ? 114 ASN 3 N     1 
ATOM   5546  C  CA    . ASN C  3  114 ? 14.524   -20.332  359.126 1.00 38.23  ? 114 ASN 3 CA    1 
ATOM   5547  C  C     . ASN C  3  114 ? 14.711   -21.331  357.986 1.00 38.41  ? 114 ASN 3 C     1 
ATOM   5548  O  O     . ASN C  3  114 ? 15.435   -22.319  358.144 1.00 35.30  ? 114 ASN 3 O     1 
ATOM   5549  C  CB    . ASN C  3  114 ? 14.584   -21.048  360.477 1.00 39.76  ? 114 ASN 3 CB    1 
ATOM   5550  C  CG    . ASN C  3  114 ? 14.899   -20.108  361.624 1.00 43.85  ? 114 ASN 3 CG    1 
ATOM   5551  O  OD1   . ASN C  3  114 ? 15.774   -19.264  361.507 1.00 50.80  ? 114 ASN 3 OD1   1 
ATOM   5552  N  ND2   . ASN C  3  114 ? 14.206   -20.267  362.747 1.00 41.42  ? 114 ASN 3 ND2   1 
ATOM   5553  N  N     . HIS C  3  115 ? 14.080   -21.091  356.840 1.00 39.42  ? 115 HIS 3 N     1 
ATOM   5554  C  CA    . HIS C  3  115 ? 14.194   -22.018  355.729 1.00 38.63  ? 115 HIS 3 CA    1 
ATOM   5555  C  C     . HIS C  3  115 ? 15.578   -21.923  355.087 1.00 30.76  ? 115 HIS 3 C     1 
ATOM   5556  O  O     . HIS C  3  115 ? 16.220   -20.871  355.123 1.00 30.06  ? 115 HIS 3 O     1 
ATOM   5557  C  CB    . HIS C  3  115 ? 13.090   -21.760  354.703 1.00 42.78  ? 115 HIS 3 CB    1 
ATOM   5558  C  CG    . HIS C  3  115 ? 12.454   -23.014  354.173 1.00 39.29  ? 115 HIS 3 CG    1 
ATOM   5559  N  ND1   . HIS C  3  115 ? 11.695   -23.856  354.961 1.00 28.25  ? 115 HIS 3 ND1   1 
ATOM   5560  C  CD2   . HIS C  3  115 ? 12.451   -23.555  352.930 1.00 36.72  ? 115 HIS 3 CD2   1 
ATOM   5561  C  CE1   . HIS C  3  115 ? 11.266   -24.866  354.230 1.00 27.90  ? 115 HIS 3 CE1   1 
ATOM   5562  N  NE2   . HIS C  3  115 ? 11.709   -24.707  352.996 1.00 28.09  ? 115 HIS 3 NE2   1 
ATOM   5563  N  N     . PRO C  3  116 ? 16.085   -23.038  354.550 1.00 37.16  ? 116 PRO 3 N     1 
ATOM   5564  C  CA    . PRO C  3  116 ? 17.511   -23.104  354.191 1.00 38.13  ? 116 PRO 3 CA    1 
ATOM   5565  C  C     . PRO C  3  116 ? 17.902   -22.400  352.899 1.00 44.00  ? 116 PRO 3 C     1 
ATOM   5566  O  O     . PRO C  3  116 ? 19.111   -22.268  352.644 1.00 45.38  ? 116 PRO 3 O     1 
ATOM   5567  C  CB    . PRO C  3  116 ? 17.760   -24.615  354.078 1.00 38.67  ? 116 PRO 3 CB    1 
ATOM   5568  C  CG    . PRO C  3  116 ? 16.414   -25.176  353.718 1.00 35.89  ? 116 PRO 3 CG    1 
ATOM   5569  C  CD    . PRO C  3  116 ? 15.452   -24.372  354.522 1.00 35.45  ? 116 PRO 3 CD    1 
ATOM   5570  N  N     . LEU C  3  117 ? 16.941   -21.914  352.104 1.00 38.71  ? 117 LEU 3 N     1 
ATOM   5571  C  CA    . LEU C  3  117 ? 17.211   -21.348  350.777 1.00 40.91  ? 117 LEU 3 CA    1 
ATOM   5572  C  C     . LEU C  3  117 ? 17.697   -22.456  349.834 1.00 35.72  ? 117 LEU 3 C     1 
ATOM   5573  O  O     . LEU C  3  117 ? 18.674   -22.299  349.102 1.00 30.46  ? 117 LEU 3 O     1 
ATOM   5574  C  CB    . LEU C  3  117 ? 18.210   -20.177  350.846 1.00 40.00  ? 117 LEU 3 CB    1 
ATOM   5575  C  CG    . LEU C  3  117 ? 17.862   -18.819  351.492 1.00 39.40  ? 117 LEU 3 CG    1 
ATOM   5576  C  CD1   . LEU C  3  117 ? 19.124   -18.112  351.967 1.00 31.64  ? 117 LEU 3 CD1   1 
ATOM   5577  C  CD2   . LEU C  3  117 ? 17.110   -17.926  350.539 1.00 31.32  ? 117 LEU 3 CD2   1 
ATOM   5578  N  N     . ASP C  3  118 ? 16.995   -23.594  349.868 1.00 38.10  ? 118 ASP 3 N     1 
ATOM   5579  C  CA    . ASP C  3  118 ? 17.356   -24.786  349.104 1.00 37.45  ? 118 ASP 3 CA    1 
ATOM   5580  C  C     . ASP C  3  118 ? 16.462   -25.032  347.892 1.00 41.41  ? 118 ASP 3 C     1 
ATOM   5581  O  O     . ASP C  3  118 ? 16.616   -26.068  347.236 1.00 35.95  ? 118 ASP 3 O     1 
ATOM   5582  C  CB    . ASP C  3  118 ? 17.364   -26.025  350.015 1.00 37.33  ? 118 ASP 3 CB    1 
ATOM   5583  C  CG    . ASP C  3  118 ? 18.494   -25.994  351.044 1.00 38.04  ? 118 ASP 3 CG    1 
ATOM   5584  O  OD1   . ASP C  3  118 ? 19.368   -25.111  350.942 1.00 41.30  ? 118 ASP 3 OD1   1 
ATOM   5585  O  OD2   . ASP C  3  118 ? 18.508   -26.837  351.963 1.00 37.31  ? 118 ASP 3 OD2   1 
ATOM   5586  N  N     . CYS C  3  119 ? 15.551   -24.102  347.571 1.00 43.99  ? 119 CYS 3 N     1 
ATOM   5587  C  CA    . CYS C  3  119 ? 14.638   -24.267  346.437 1.00 47.25  ? 119 CYS 3 CA    1 
ATOM   5588  C  C     . CYS C  3  119 ? 15.313   -24.767  345.167 1.00 49.30  ? 119 CYS 3 C     1 
ATOM   5589  O  O     . CYS C  3  119 ? 14.867   -25.792  344.622 1.00 48.50  ? 119 CYS 3 O     1 
ATOM   5590  C  CB    . CYS C  3  119 ? 13.921   -22.942  346.131 1.00 44.18  ? 119 CYS 3 CB    1 
ATOM   5591  S  SG    . CYS C  3  119 ? 12.824   -22.323  347.388 1.00 43.96  ? 119 CYS 3 SG    1 
ATOM   5592  N  N     . PRO C  3  120 ? 16.380   -24.136  344.662 1.00 47.25  ? 120 PRO 3 N     1 
ATOM   5593  C  CA    . PRO C  3  120 ? 16.903   -24.558  343.351 1.00 45.25  ? 120 PRO 3 CA    1 
ATOM   5594  C  C     . PRO C  3  120 ? 17.419   -25.984  343.307 1.00 33.25  ? 120 PRO 3 C     1 
ATOM   5595  O  O     . PRO C  3  120 ? 17.270   -26.649  342.278 1.00 29.30  ? 120 PRO 3 O     1 
ATOM   5596  C  CB    . PRO C  3  120 ? 18.006   -23.529  343.077 1.00 48.41  ? 120 PRO 3 CB    1 
ATOM   5597  C  CG    . PRO C  3  120 ? 18.385   -22.998  344.412 1.00 50.85  ? 120 PRO 3 CG    1 
ATOM   5598  C  CD    . PRO C  3  120 ? 17.114   -22.972  345.191 1.00 50.02  ? 120 PRO 3 CD    1 
ATOM   5599  N  N     . THR C  3  121 ? 18.024   -26.477  344.380 1.00 29.38  ? 121 THR 3 N     1 
ATOM   5600  C  CA    . THR C  3  121 ? 18.441   -27.869  344.435 1.00 29.07  ? 121 THR 3 CA    1 
ATOM   5601  C  C     . THR C  3  121 ? 17.448   -28.747  345.202 1.00 31.42  ? 121 THR 3 C     1 
ATOM   5602  O  O     . THR C  3  121 ? 17.684   -29.955  345.357 1.00 28.25  ? 121 THR 3 O     1 
ATOM   5603  C  CB    . THR C  3  121 ? 19.838   -27.961  345.056 1.00 29.32  ? 121 THR 3 CB    1 
ATOM   5604  O  OG1   . THR C  3  121 ? 20.283   -29.319  345.066 1.00 29.03  ? 121 THR 3 OG1   1 
ATOM   5605  C  CG2   . THR C  3  121 ? 19.838   -27.428  346.485 1.00 29.39  ? 121 THR 3 CG2   1 
ATOM   5606  N  N     . CYS C  3  122 ? 16.301   -28.192  345.590 1.00 38.62  ? 122 CYS 3 N     1 
ATOM   5607  C  CA    . CYS C  3  122 ? 15.304   -28.948  346.336 1.00 38.95  ? 122 CYS 3 CA    1 
ATOM   5608  C  C     . CYS C  3  122 ? 14.601   -29.929  345.418 1.00 37.62  ? 122 CYS 3 C     1 
ATOM   5609  O  O     . CYS C  3  122 ? 14.164   -29.570  344.321 1.00 37.02  ? 122 CYS 3 O     1 
ATOM   5610  C  CB    . CYS C  3  122 ? 14.275   -28.007  346.959 1.00 40.27  ? 122 CYS 3 CB    1 
ATOM   5611  S  SG    . CYS C  3  122 ? 13.271   -28.703  348.283 1.00 40.43  ? 122 CYS 3 SG    1 
ATOM   5612  N  N     . ASP C  3  123 ? 14.510   -31.178  345.865 1.00 38.66  ? 123 ASP 3 N     1 
ATOM   5613  C  CA    . ASP C  3  123 ? 13.853   -32.195  345.058 1.00 39.16  ? 123 ASP 3 CA    1 
ATOM   5614  C  C     . ASP C  3  123 ? 12.355   -31.937  344.946 1.00 36.91  ? 123 ASP 3 C     1 
ATOM   5615  O  O     . ASP C  3  123 ? 11.723   -32.428  344.004 1.00 33.50  ? 123 ASP 3 O     1 
ATOM   5616  C  CB    . ASP C  3  123 ? 14.142   -33.582  345.660 1.00 26.42  ? 123 ASP 3 CB    1 
ATOM   5617  C  CG    . ASP C  3  123 ? 14.521   -34.621  344.625 1.00 26.27  ? 123 ASP 3 CG    1 
ATOM   5618  O  OD1   . ASP C  3  123 ? 14.509   -34.342  343.411 1.00 26.42  ? 123 ASP 3 OD1   1 
ATOM   5619  O  OD2   . ASP C  3  123 ? 14.944   -35.702  345.053 1.00 26.02  ? 123 ASP 3 OD2   1 
ATOM   5620  N  N     . LYS C  3  124 ? 11.784   -31.118  345.834 1.00 26.63  ? 124 LYS 3 N     1 
ATOM   5621  C  CA    . LYS C  3  124 ? 10.353   -30.864  345.747 1.00 41.38  ? 124 LYS 3 CA    1 
ATOM   5622  C  C     . LYS C  3  124 ? 10.014   -30.003  344.545 1.00 46.13  ? 124 LYS 3 C     1 
ATOM   5623  O  O     . LYS C  3  124 ? 8.926    -30.147  343.985 1.00 53.27  ? 124 LYS 3 O     1 
ATOM   5624  C  CB    . LYS C  3  124 ? 9.840    -30.194  347.018 1.00 35.37  ? 124 LYS 3 CB    1 
ATOM   5625  C  CG    . LYS C  3  124 ? 9.033    -31.114  347.908 1.00 35.80  ? 124 LYS 3 CG    1 
ATOM   5626  C  CD    . LYS C  3  124 ? 7.570    -31.183  347.474 1.00 38.40  ? 124 LYS 3 CD    1 
ATOM   5627  C  CE    . LYS C  3  124 ? 6.714    -32.063  348.407 1.00 40.98  ? 124 LYS 3 CE    1 
ATOM   5628  N  NZ    . LYS C  3  124 ? 6.769    -33.551  348.172 1.00 40.57  ? 124 LYS 3 NZ    1 
ATOM   5629  N  N     . GLY C  3  125 ? 10.932   -29.136  344.120 1.00 41.31  ? 125 GLY 3 N     1 
ATOM   5630  C  CA    . GLY C  3  125 ? 10.737   -28.317  342.934 1.00 32.91  ? 125 GLY 3 CA    1 
ATOM   5631  C  C     . GLY C  3  125 ? 9.393    -27.629  342.894 1.00 27.33  ? 125 GLY 3 C     1 
ATOM   5632  O  O     . GLY C  3  125 ? 8.873    -27.169  343.917 1.00 27.30  ? 125 GLY 3 O     1 
ATOM   5633  N  N     . GLY C  3  126 ? 8.778    -27.644  341.709 1.00 27.28  ? 126 GLY 3 N     1 
ATOM   5634  C  CA    . GLY C  3  126 ? 7.581    -26.864  341.456 1.00 27.29  ? 126 GLY 3 CA    1 
ATOM   5635  C  C     . GLY C  3  126 ? 6.369    -27.276  342.264 1.00 26.89  ? 126 GLY 3 C     1 
ATOM   5636  O  O     . GLY C  3  126 ? 5.461    -26.461  342.462 1.00 26.94  ? 126 GLY 3 O     1 
ATOM   5637  N  N     . ALA C  3  127 ? 6.325    -28.513  342.740 1.00 28.38  ? 127 ALA 3 N     1 
ATOM   5638  C  CA    . ALA C  3  127 ? 5.156    -29.014  343.471 1.00 32.51  ? 127 ALA 3 CA    1 
ATOM   5639  C  C     . ALA C  3  127 ? 5.354    -28.862  344.978 1.00 33.37  ? 127 ALA 3 C     1 
ATOM   5640  O  O     . ALA C  3  127 ? 5.265    -29.823  345.753 1.00 29.20  ? 127 ALA 3 O     1 
ATOM   5641  C  CB    . ALA C  3  127 ? 4.886    -30.473  343.110 1.00 37.52  ? 127 ALA 3 CB    1 
ATOM   5642  N  N     . CYS C  3  128 ? 5.574    -27.620  345.404 1.00 36.73  ? 128 CYS 3 N     1 
ATOM   5643  C  CA    . CYS C  3  128 ? 5.805    -27.316  346.812 1.00 39.89  ? 128 CYS 3 CA    1 
ATOM   5644  C  C     . CYS C  3  128 ? 4.759    -26.312  347.264 1.00 39.37  ? 128 CYS 3 C     1 
ATOM   5645  O  O     . CYS C  3  128 ? 4.673    -25.207  346.716 1.00 26.90  ? 128 CYS 3 O     1 
ATOM   5646  C  CB    . CYS C  3  128 ? 7.214    -26.783  347.062 1.00 34.57  ? 128 CYS 3 CB    1 
ATOM   5647  S  SG    . CYS C  3  128 ? 7.423    -26.117  348.739 1.00 35.42  ? 128 CYS 3 SG    1 
ATOM   5648  N  N     . GLU C  3  129 ? 3.975    -26.717  348.263 1.00 42.07  ? 129 GLU 3 N     1 
ATOM   5649  C  CA    . GLU C  3  129 ? 2.834    -25.939  348.726 1.00 40.94  ? 129 GLU 3 CA    1 
ATOM   5650  C  C     . GLU C  3  129 ? 3.271    -24.590  349.282 1.00 44.05  ? 129 GLU 3 C     1 
ATOM   5651  O  O     . GLU C  3  129 ? 2.609    -23.575  349.048 1.00 42.63  ? 129 GLU 3 O     1 
ATOM   5652  C  CB    . GLU C  3  129 ? 2.076    -26.753  349.780 1.00 38.63  ? 129 GLU 3 CB    1 
ATOM   5653  C  CG    . GLU C  3  129 ? 1.904    -28.228  349.357 1.00 36.11  ? 129 GLU 3 CG    1 
ATOM   5654  C  CD    . GLU C  3  129 ? 0.903    -29.035  350.185 1.00 37.38  ? 129 GLU 3 CD    1 
ATOM   5655  O  OE1   . GLU C  3  129 ? 0.004    -28.462  350.853 1.00 38.17  ? 129 GLU 3 OE1   1 
ATOM   5656  O  OE2   . GLU C  3  129 ? 1.040    -30.275  350.170 1.00 36.93  ? 129 GLU 3 OE2   1 
ATOM   5657  N  N     . LEU C  3  130 ? 4.390    -24.551  350.007 1.00 46.03  ? 130 LEU 3 N     1 
ATOM   5658  C  CA    . LEU C  3  130 ? 4.839    -23.283  350.581 1.00 43.21  ? 130 LEU 3 CA    1 
ATOM   5659  C  C     . LEU C  3  130 ? 5.150    -22.266  349.492 1.00 35.53  ? 130 LEU 3 C     1 
ATOM   5660  O  O     . LEU C  3  130 ? 4.755    -21.103  349.593 1.00 28.88  ? 130 LEU 3 O     1 
ATOM   5661  C  CB    . LEU C  3  130 ? 6.065    -23.501  351.472 1.00 39.55  ? 130 LEU 3 CB    1 
ATOM   5662  C  CG    . LEU C  3  130 ? 6.749    -22.255  352.052 1.00 33.22  ? 130 LEU 3 CG    1 
ATOM   5663  C  CD1   . LEU C  3  130 ? 5.739    -21.301  352.666 1.00 27.93  ? 130 LEU 3 CD1   1 
ATOM   5664  C  CD2   . LEU C  3  130 ? 7.775    -22.692  353.094 1.00 38.59  ? 130 LEU 3 CD2   1 
ATOM   5665  N  N     . GLN C  3  131 ? 5.867    -22.688  348.444 1.00 33.60  ? 131 GLN 3 N     1 
ATOM   5666  C  CA    . GLN C  3  131 ? 6.137    -21.804  347.315 1.00 30.19  ? 131 GLN 3 CA    1 
ATOM   5667  C  C     . GLN C  3  131 ? 4.841    -21.185  346.795 1.00 34.42  ? 131 GLN 3 C     1 
ATOM   5668  O  O     . GLN C  3  131 ? 4.740    -19.960  346.621 1.00 36.80  ? 131 GLN 3 O     1 
ATOM   5669  C  CB    . GLN C  3  131 ? 6.823    -22.551  346.169 1.00 28.12  ? 131 GLN 3 CB    1 
ATOM   5670  C  CG    . GLN C  3  131 ? 8.316    -22.287  345.993 1.00 28.49  ? 131 GLN 3 CG    1 
ATOM   5671  C  CD    . GLN C  3  131 ? 8.846    -22.895  344.708 1.00 28.49  ? 131 GLN 3 CD    1 
ATOM   5672  O  OE1   . GLN C  3  131 ? 8.133    -23.619  344.016 1.00 28.18  ? 131 GLN 3 OE1   1 
ATOM   5673  N  NE2   . GLN C  3  131 ? 10.128   -22.702  344.447 1.00 28.82  ? 131 GLN 3 NE2   1 
ATOM   5674  N  N     . ASP C  3  132 ? 3.848    -22.039  346.505 1.00 35.00  ? 132 ASP 3 N     1 
ATOM   5675  C  CA    . ASP C  3  132 ? 2.641    -21.575  345.828 1.00 27.65  ? 132 ASP 3 CA    1 
ATOM   5676  C  C     . ASP C  3  132 ? 1.811    -20.677  346.732 1.00 34.39  ? 132 ASP 3 C     1 
ATOM   5677  O  O     . ASP C  3  132 ? 1.309    -19.651  346.280 1.00 34.91  ? 132 ASP 3 O     1 
ATOM   5678  C  CB    . ASP C  3  132 ? 1.800    -22.754  345.325 1.00 27.18  ? 132 ASP 3 CB    1 
ATOM   5679  C  CG    . ASP C  3  132 ? 2.526    -23.605  344.292 1.00 27.12  ? 132 ASP 3 CG    1 
ATOM   5680  O  OD1   . ASP C  3  132 ? 3.751    -23.792  344.417 1.00 40.12  ? 132 ASP 3 OD1   1 
ATOM   5681  O  OD2   . ASP C  3  132 ? 1.876    -24.072  343.333 1.00 26.93  ? 132 ASP 3 OD2   1 
ATOM   5682  N  N     . ARG C  3  133 ? 1.655    -21.035  348.012 1.00 34.68  ? 133 ARG 3 N     1 
ATOM   5683  C  CA    . ARG C  3  133 ? 0.884    -20.176  348.915 1.00 36.98  ? 133 ARG 3 CA    1 
ATOM   5684  C  C     . ARG C  3  133 ? 1.621    -18.860  349.209 1.00 35.55  ? 133 ARG 3 C     1 
ATOM   5685  O  O     . ARG C  3  133 ? 0.982    -17.823  349.425 1.00 36.27  ? 133 ARG 3 O     1 
ATOM   5686  C  CB    . ARG C  3  133 ? 0.540    -20.913  350.215 1.00 38.56  ? 133 ARG 3 CB    1 
ATOM   5687  C  CG    . ARG C  3  133 ? 0.157    -22.401  350.064 1.00 43.22  ? 133 ARG 3 CG    1 
ATOM   5688  C  CD    . ARG C  3  133 ? -1.249   -22.710  349.526 1.00 45.36  ? 133 ARG 3 CD    1 
ATOM   5689  N  NE    . ARG C  3  133 ? -1.357   -22.579  348.070 1.00 45.06  ? 133 ARG 3 NE    1 
ATOM   5690  C  CZ    . ARG C  3  133 ? -1.425   -23.622  347.243 1.00 37.09  ? 133 ARG 3 CZ    1 
ATOM   5691  N  NH1   . ARG C  3  133 ? -1.385   -24.844  347.735 1.00 25.87  ? 133 ARG 3 NH1   1 
ATOM   5692  N  NH2   . ARG C  3  133 ? -1.526   -23.448  345.933 1.00 33.98  ? 133 ARG 3 NH2   1 
ATOM   5693  N  N     . THR C  3  134 ? 2.957    -18.881  349.249 1.00 28.31  ? 134 THR 3 N     1 
ATOM   5694  C  CA    . THR C  3  134 ? 3.718    -17.648  349.407 1.00 33.15  ? 134 THR 3 CA    1 
ATOM   5695  C  C     . THR C  3  134 ? 3.485    -16.717  348.221 1.00 37.48  ? 134 THR 3 C     1 
ATOM   5696  O  O     . THR C  3  134 ? 3.118    -15.550  348.399 1.00 42.34  ? 134 THR 3 O     1 
ATOM   5697  C  CB    . THR C  3  134 ? 5.212    -17.979  349.567 1.00 28.97  ? 134 THR 3 CB    1 
ATOM   5698  O  OG1   . THR C  3  134 ? 5.458    -18.539  350.863 1.00 35.73  ? 134 THR 3 OG1   1 
ATOM   5699  C  CG2   . THR C  3  134 ? 6.089    -16.748  349.381 1.00 29.84  ? 134 THR 3 CG2   1 
ATOM   5700  N  N     . VAL C  3  135 ? 3.621    -17.234  346.994 1.00 35.91  ? 135 VAL 3 N     1 
ATOM   5701  C  CA    . VAL C  3  135 ? 3.402    -16.380  345.827 1.00 36.43  ? 135 VAL 3 CA    1 
ATOM   5702  C  C     . VAL C  3  135 ? 1.933    -16.039  345.656 1.00 29.17  ? 135 VAL 3 C     1 
ATOM   5703  O  O     . VAL C  3  135 ? 1.604    -15.098  344.935 1.00 29.43  ? 135 VAL 3 O     1 
ATOM   5704  C  CB    . VAL C  3  135 ? 3.936    -17.018  344.534 1.00 39.15  ? 135 VAL 3 CB    1 
ATOM   5705  C  CG1   . VAL C  3  135 ? 2.910    -17.994  343.956 1.00 42.44  ? 135 VAL 3 CG1   1 
ATOM   5706  C  CG2   . VAL C  3  135 ? 4.281    -15.933  343.515 1.00 36.13  ? 135 VAL 3 CG2   1 
ATOM   5707  N  N     . GLU C  3  136 ? 1.035    -16.805  346.268 1.00 28.75  ? 136 GLU 3 N     1 
ATOM   5708  C  CA    . GLU C  3  136 ? -0.389   -16.498  346.208 1.00 33.62  ? 136 GLU 3 CA    1 
ATOM   5709  C  C     . GLU C  3  136 ? -0.747   -15.355  347.141 1.00 28.82  ? 136 GLU 3 C     1 
ATOM   5710  O  O     . GLU C  3  136 ? -1.322   -14.350  346.719 1.00 29.49  ? 136 GLU 3 O     1 
ATOM   5711  C  CB    . GLU C  3  136 ? -1.212   -17.727  346.568 1.00 28.07  ? 136 GLU 3 CB    1 
ATOM   5712  C  CG    . GLU C  3  136 ? -1.328   -18.743  345.483 1.00 27.81  ? 136 GLU 3 CG    1 
ATOM   5713  C  CD    . GLU C  3  136 ? -1.883   -20.016  346.025 1.00 27.31  ? 136 GLU 3 CD    1 
ATOM   5714  O  OE1   . GLU C  3  136 ? -2.420   -20.831  345.251 1.00 30.69  ? 136 GLU 3 OE1   1 
ATOM   5715  O  OE2   . GLU C  3  136 ? -1.781   -20.194  347.251 1.00 27.20  ? 136 GLU 3 OE2   1 
ATOM   5716  N  N     . TYR C  3  137 ? -0.429   -15.510  348.424 1.00 28.76  ? 137 TYR 3 N     1 
ATOM   5717  C  CA    . TYR C  3  137 ? -0.910   -14.608  349.454 1.00 35.00  ? 137 TYR 3 CA    1 
ATOM   5718  C  C     . TYR C  3  137 ? 0.167    -13.693  350.023 1.00 33.35  ? 137 TYR 3 C     1 
ATOM   5719  O  O     . TYR C  3  137 ? -0.170   -12.739  350.738 1.00 33.13  ? 137 TYR 3 O     1 
ATOM   5720  C  CB    . TYR C  3  137 ? -1.539   -15.419  350.597 1.00 33.17  ? 137 TYR 3 CB    1 
ATOM   5721  C  CG    . TYR C  3  137 ? -2.596   -16.422  350.149 1.00 32.66  ? 137 TYR 3 CG    1 
ATOM   5722  C  CD1   . TYR C  3  137 ? -3.915   -16.052  349.899 1.00 27.94  ? 137 TYR 3 CD1   1 
ATOM   5723  C  CD2   . TYR C  3  137 ? -2.254   -17.739  349.951 1.00 36.61  ? 137 TYR 3 CD2   1 
ATOM   5724  C  CE1   . TYR C  3  137 ? -4.861   -16.985  349.491 1.00 38.84  ? 137 TYR 3 CE1   1 
ATOM   5725  C  CE2   . TYR C  3  137 ? -3.182   -18.676  349.553 1.00 41.99  ? 137 TYR 3 CE2   1 
ATOM   5726  C  CZ    . TYR C  3  137 ? -4.479   -18.313  349.321 1.00 45.38  ? 137 TYR 3 CZ    1 
ATOM   5727  O  OH    . TYR C  3  137 ? -5.342   -19.327  348.921 1.00 46.35  ? 137 TYR 3 OH    1 
ATOM   5728  N  N     . GLY C  3  138 ? 1.446    -13.944  349.716 1.00 22.75  ? 138 GLY 3 N     1 
ATOM   5729  C  CA    . GLY C  3  138 ? 2.516    -13.205  350.350 1.00 22.82  ? 138 GLY 3 CA    1 
ATOM   5730  C  C     . GLY C  3  138 ? 2.730    -11.841  349.728 1.00 26.24  ? 138 GLY 3 C     1 
ATOM   5731  O  O     . GLY C  3  138 ? 2.347    -11.587  348.583 1.00 22.67  ? 138 GLY 3 O     1 
ATOM   5732  N  N     . LEU C  3  139 ? 3.376    -10.967  350.504 1.00 38.05  ? 139 LEU 3 N     1 
ATOM   5733  C  CA    . LEU C  3  139 ? 3.716    -9.596   350.106 1.00 49.85  ? 139 LEU 3 CA    1 
ATOM   5734  C  C     . LEU C  3  139 ? 2.468    -8.819   349.669 1.00 67.71  ? 139 LEU 3 C     1 
ATOM   5735  O  O     . LEU C  3  139 ? 2.284    -8.470   348.499 1.00 69.17  ? 139 LEU 3 O     1 
ATOM   5736  C  CB    . LEU C  3  139 ? 4.805    -9.562   349.023 1.00 44.88  ? 139 LEU 3 CB    1 
ATOM   5737  C  CG    . LEU C  3  139 ? 6.191    -10.083  349.419 1.00 36.42  ? 139 LEU 3 CG    1 
ATOM   5738  C  CD1   . LEU C  3  139 ? 7.106    -10.146  348.208 1.00 32.19  ? 139 LEU 3 CD1   1 
ATOM   5739  C  CD2   . LEU C  3  139 ? 6.796    -9.220   350.525 1.00 33.72  ? 139 LEU 3 CD2   1 
ATOM   5740  N  N     . TYR C  3  140 ? 1.604    -8.563   350.653 1.00 81.93  ? 140 TYR 3 N     1 
ATOM   5741  C  CA    . TYR C  3  140 ? 0.471    -7.679   350.422 1.00 97.96  ? 140 TYR 3 CA    1 
ATOM   5742  C  C     . TYR C  3  140 ? 0.964    -6.334   349.892 1.00 97.65  ? 140 TYR 3 C     1 
ATOM   5743  O  O     . TYR C  3  140 ? 2.054    -5.866   350.233 1.00 99.39  ? 140 TYR 3 O     1 
ATOM   5744  C  CB    . TYR C  3  140 ? -0.337   -7.491   351.717 1.00 115.82 ? 140 TYR 3 CB    1 
ATOM   5745  C  CG    . TYR C  3  140 ? -1.061   -6.159   351.819 1.00 134.42 ? 140 TYR 3 CG    1 
ATOM   5746  C  CD1   . TYR C  3  140 ? -2.335   -5.993   351.295 1.00 142.12 ? 140 TYR 3 CD1   1 
ATOM   5747  C  CD2   . TYR C  3  140 ? -0.470   -5.067   352.452 1.00 142.73 ? 140 TYR 3 CD2   1 
ATOM   5748  C  CE1   . TYR C  3  140 ? -2.997   -4.770   351.384 1.00 147.03 ? 140 TYR 3 CE1   1 
ATOM   5749  C  CE2   . TYR C  3  140 ? -1.126   -3.845   352.547 1.00 149.25 ? 140 TYR 3 CE2   1 
ATOM   5750  C  CZ    . TYR C  3  140 ? -2.388   -3.703   352.012 1.00 152.07 ? 140 TYR 3 CZ    1 
ATOM   5751  O  OH    . TYR C  3  140 ? -3.039   -2.492   352.105 1.00 156.83 ? 140 TYR 3 OH    1 
ATOM   5752  N  N     . GLU C  3  141 ? 0.154    -5.718   349.036 1.00 93.90  ? 141 GLU 3 N     1 
ATOM   5753  C  CA    . GLU C  3  141 ? 0.504    -4.458   348.379 1.00 87.11  ? 141 GLU 3 CA    1 
ATOM   5754  C  C     . GLU C  3  141 ? 0.393    -3.335   349.400 1.00 81.15  ? 141 GLU 3 C     1 
ATOM   5755  O  O     . GLU C  3  141 ? -0.698   -2.853   349.703 1.00 78.81  ? 141 GLU 3 O     1 
ATOM   5756  C  CB    . GLU C  3  141 ? -0.385   -4.225   347.161 1.00 85.77  ? 141 GLU 3 CB    1 
ATOM   5757  C  CG    . GLU C  3  141 ? 0.306    -3.485   346.023 1.00 84.79  ? 141 GLU 3 CG    1 
ATOM   5758  C  CD    . GLU C  3  141 ? -0.401   -3.670   344.695 1.00 83.29  ? 141 GLU 3 CD    1 
ATOM   5759  O  OE1   . GLU C  3  141 ? -0.238   -4.748   344.093 1.00 82.43  ? 141 GLU 3 OE1   1 
ATOM   5760  O  OE2   . GLU C  3  141 ? -1.128   -2.754   344.257 1.00 83.14  ? 141 GLU 3 OE2   1 
ATOM   5761  N  N     . LYS C  3  142 ? 1.540    -2.918   349.929 1.00 79.78  ? 142 LYS 3 N     1 
ATOM   5762  C  CA    . LYS C  3  142 ? 1.603    -1.928   350.994 1.00 80.46  ? 142 LYS 3 CA    1 
ATOM   5763  C  C     . LYS C  3  142 ? 1.493    -0.512   350.444 1.00 82.78  ? 142 LYS 3 C     1 
ATOM   5764  O  O     . LYS C  3  142 ? 2.141    -0.159   349.452 1.00 85.20  ? 142 LYS 3 O     1 
ATOM   5765  C  CB    . LYS C  3  142 ? 2.925    -2.074   351.743 1.00 78.93  ? 142 LYS 3 CB    1 
ATOM   5766  C  CG    . LYS C  3  142 ? 3.088    -3.378   352.496 1.00 76.88  ? 142 LYS 3 CG    1 
ATOM   5767  C  CD    . LYS C  3  142 ? 4.447    -3.435   353.158 1.00 75.29  ? 142 LYS 3 CD    1 
ATOM   5768  C  CE    . LYS C  3  142 ? 5.522    -3.520   352.085 1.00 72.94  ? 142 LYS 3 CE    1 
ATOM   5769  N  NZ    . LYS C  3  142 ? 5.383    -4.740   351.240 1.00 70.24  ? 142 LYS 3 NZ    1 
ATOM   5770  N  N     . TYR C  3  143 ? 0.681    0.301    351.110 1.00 81.18  ? 143 TYR 3 N     1 
ATOM   5771  C  CA    . TYR C  3  143 ? 0.459    1.686    350.715 1.00 78.73  ? 143 TYR 3 CA    1 
ATOM   5772  C  C     . TYR C  3  143 ? 0.485    2.616    351.930 1.00 76.75  ? 143 TYR 3 C     1 
ATOM   5773  O  O     . TYR C  3  143 ? -0.203   2.376    352.924 1.00 75.61  ? 143 TYR 3 O     1 
ATOM   5774  C  CB    . TYR C  3  143 ? -0.875   1.817    349.970 1.00 79.20  ? 143 TYR 3 CB    1 
ATOM   5775  C  CG    . TYR C  3  143 ? -0.803   1.456    348.497 1.00 78.45  ? 143 TYR 3 CG    1 
ATOM   5776  C  CD1   . TYR C  3  143 ? 0.266    1.874    347.718 1.00 79.56  ? 143 TYR 3 CD1   1 
ATOM   5777  C  CD2   . TYR C  3  143 ? -1.805   0.714    347.882 1.00 74.66  ? 143 TYR 3 CD2   1 
ATOM   5778  C  CE1   . TYR C  3  143 ? 0.342    1.557    346.371 1.00 77.21  ? 143 TYR 3 CE1   1 
ATOM   5779  C  CE2   . TYR C  3  143 ? -1.735   0.395    346.528 1.00 72.42  ? 143 TYR 3 CE2   1 
ATOM   5780  C  CZ    . TYR C  3  143 ? -0.655   0.821    345.782 1.00 72.62  ? 143 TYR 3 CZ    1 
ATOM   5781  O  OH    . TYR C  3  143 ? -0.559   0.521    344.441 1.00 69.83  ? 143 TYR 3 OH    1 
ATOM   5782  N  N     . PRO C  3  148 ? 3.401    4.390    343.643 1.00 89.48  ? 148 PRO 3 N     1 
ATOM   5783  C  CA    . PRO C  3  148 ? 4.460    4.882    344.530 1.00 92.13  ? 148 PRO 3 CA    1 
ATOM   5784  C  C     . PRO C  3  148 ? 5.865    4.549    344.030 1.00 92.22  ? 148 PRO 3 C     1 
ATOM   5785  O  O     . PRO C  3  148 ? 6.808    5.282    344.327 1.00 93.96  ? 148 PRO 3 O     1 
ATOM   5786  C  CB    . PRO C  3  148 ? 4.163    4.164    345.846 1.00 92.28  ? 148 PRO 3 CB    1 
ATOM   5787  C  CG    . PRO C  3  148 ? 3.537    2.877    345.429 1.00 90.69  ? 148 PRO 3 CG    1 
ATOM   5788  C  CD    . PRO C  3  148 ? 2.828    3.119    344.119 1.00 89.07  ? 148 PRO 3 CD    1 
ATOM   5789  N  N     . LEU C  3  149 ? 5.990    3.439    343.301 1.00 88.30  ? 149 LEU 3 N     1 
ATOM   5790  C  CA    . LEU C  3  149 ? 7.252    3.031    342.686 1.00 81.45  ? 149 LEU 3 CA    1 
ATOM   5791  C  C     . LEU C  3  149 ? 8.355    2.913    343.736 1.00 84.57  ? 149 LEU 3 C     1 
ATOM   5792  O  O     . LEU C  3  149 ? 9.526    3.200    343.471 1.00 85.06  ? 149 LEU 3 O     1 
ATOM   5793  C  CB    . LEU C  3  149 ? 7.651    3.996    341.559 1.00 73.74  ? 149 LEU 3 CB    1 
ATOM   5794  C  CG    . LEU C  3  149 ? 8.658    3.570    340.487 1.00 66.63  ? 149 LEU 3 CG    1 
ATOM   5795  C  CD1   . LEU C  3  149 ? 8.294    4.201    339.153 1.00 65.16  ? 149 LEU 3 CD1   1 
ATOM   5796  C  CD2   . LEU C  3  149 ? 10.063   3.965    340.876 1.00 63.67  ? 149 LEU 3 CD2   1 
ATOM   5797  N  N     . GLU C  3  150 ? 7.979    2.525    344.950 1.00 85.54  ? 150 GLU 3 N     1 
ATOM   5798  C  CA    . GLU C  3  150 ? 8.919    2.393    346.054 1.00 85.06  ? 150 GLU 3 CA    1 
ATOM   5799  C  C     . GLU C  3  150 ? 9.554    1.002    346.050 1.00 71.79  ? 150 GLU 3 C     1 
ATOM   5800  O  O     . GLU C  3  150 ? 8.894    0.004    345.736 1.00 68.82  ? 150 GLU 3 O     1 
ATOM   5801  C  CB    . GLU C  3  150 ? 8.205    2.668    347.378 1.00 93.26  ? 150 GLU 3 CB    1 
ATOM   5802  C  CG    . GLU C  3  150 ? 9.128    2.877    348.563 1.00 99.23  ? 150 GLU 3 CG    1 
ATOM   5803  C  CD    . GLU C  3  150 ? 8.366    3.248    349.814 1.00 105.04 ? 150 GLU 3 CD    1 
ATOM   5804  O  OE1   . GLU C  3  150 ? 7.121    3.313    349.751 1.00 106.88 ? 150 GLU 3 OE1   1 
ATOM   5805  O  OE2   . GLU C  3  150 ? 9.006    3.469    350.861 1.00 107.85 ? 150 GLU 3 OE2   1 
ATOM   5806  N  N     . LEU C  3  151 ? 10.837   0.941    346.403 1.00 62.59  ? 151 LEU 3 N     1 
ATOM   5807  C  CA    . LEU C  3  151 ? 11.592   -0.302   346.284 1.00 51.63  ? 151 LEU 3 CA    1 
ATOM   5808  C  C     . LEU C  3  151 ? 11.243   -1.218   347.453 1.00 51.32  ? 151 LEU 3 C     1 
ATOM   5809  O  O     . LEU C  3  151 ? 11.412   -0.820   348.614 1.00 48.11  ? 151 LEU 3 O     1 
ATOM   5810  C  CB    . LEU C  3  151 ? 13.087   -0.013   346.260 1.00 40.18  ? 151 LEU 3 CB    1 
ATOM   5811  C  CG    . LEU C  3  151 ? 14.075   -1.167   346.120 1.00 28.89  ? 151 LEU 3 CG    1 
ATOM   5812  C  CD1   . LEU C  3  151 ? 13.890   -1.795   344.757 1.00 24.44  ? 151 LEU 3 CD1   1 
ATOM   5813  C  CD2   . LEU C  3  151 ? 15.505   -0.701   346.296 1.00 25.38  ? 151 LEU 3 CD2   1 
ATOM   5814  N  N     . PRO C  3  152 ? 10.789   -2.441   347.202 1.00 54.87  ? 152 PRO 3 N     1 
ATOM   5815  C  CA    . PRO C  3  152 ? 10.403   -3.340   348.294 1.00 53.30  ? 152 PRO 3 CA    1 
ATOM   5816  C  C     . PRO C  3  152 ? 11.529   -4.214   348.829 1.00 50.65  ? 152 PRO 3 C     1 
ATOM   5817  O  O     . PRO C  3  152 ? 12.464   -4.602   348.123 1.00 51.93  ? 152 PRO 3 O     1 
ATOM   5818  C  CB    . PRO C  3  152 ? 9.318    -4.212   347.640 1.00 54.35  ? 152 PRO 3 CB    1 
ATOM   5819  C  CG    . PRO C  3  152 ? 9.589    -4.125   346.130 1.00 55.49  ? 152 PRO 3 CG    1 
ATOM   5820  C  CD    . PRO C  3  152 ? 10.638   -3.080   345.884 1.00 55.57  ? 152 PRO 3 CD    1 
ATOM   5821  N  N     . VAL C  3  153 ? 11.378   -4.581   350.102 1.00 42.70  ? 153 VAL 3 N     1 
ATOM   5822  C  CA    . VAL C  3  153 ? 12.281   -5.498   350.785 1.00 33.98  ? 153 VAL 3 CA    1 
ATOM   5823  C  C     . VAL C  3  153 ? 11.511   -6.775   351.046 1.00 27.57  ? 153 VAL 3 C     1 
ATOM   5824  O  O     . VAL C  3  153 ? 10.350   -6.735   351.472 1.00 25.15  ? 153 VAL 3 O     1 
ATOM   5825  C  CB    . VAL C  3  153 ? 12.837   -4.916   352.098 1.00 34.52  ? 153 VAL 3 CB    1 
ATOM   5826  C  CG1   . VAL C  3  153 ? 11.733   -4.756   353.151 1.00 35.06  ? 153 VAL 3 CG1   1 
ATOM   5827  C  CG2   . VAL C  3  153 ? 13.963   -5.803   352.623 1.00 32.12  ? 153 VAL 3 CG2   1 
ATOM   5828  N  N     . TYR C  3  154 ? 12.143   -7.909   350.755 1.00 26.91  ? 154 TYR 3 N     1 
ATOM   5829  C  CA    . TYR C  3  154 ? 11.429   -9.179   350.828 1.00 25.80  ? 154 TYR 3 CA    1 
ATOM   5830  C  C     . TYR C  3  154 ? 11.332   -9.686   352.263 1.00 27.26  ? 154 TYR 3 C     1 
ATOM   5831  O  O     . TYR C  3  154 ? 10.237   -9.993   352.747 1.00 23.20  ? 154 TYR 3 O     1 
ATOM   5832  C  CB    . TYR C  3  154 ? 12.097   -10.230  349.936 1.00 20.33  ? 154 TYR 3 CB    1 
ATOM   5833  C  CG    . TYR C  3  154 ? 11.954   -9.970   348.449 1.00 17.69  ? 154 TYR 3 CG    1 
ATOM   5834  C  CD1   . TYR C  3  154 ? 10.810   -10.352  347.770 1.00 17.26  ? 154 TYR 3 CD1   1 
ATOM   5835  C  CD2   . TYR C  3  154 ? 12.987   -9.404   347.710 1.00 22.81  ? 154 TYR 3 CD2   1 
ATOM   5836  C  CE1   . TYR C  3  154 ? 10.670   -10.129  346.414 1.00 17.16  ? 154 TYR 3 CE1   1 
ATOM   5837  C  CE2   . TYR C  3  154 ? 12.853   -9.190   346.342 1.00 27.03  ? 154 TYR 3 CE2   1 
ATOM   5838  C  CZ    . TYR C  3  154 ? 11.688   -9.558   345.706 1.00 17.26  ? 154 TYR 3 CZ    1 
ATOM   5839  O  OH    . TYR C  3  154 ? 11.518   -9.360   344.356 1.00 21.04  ? 154 TYR 3 OH    1 
ATOM   5840  N  N     . THR C  3  155 ? 12.463   -9.767   352.967 1.00 30.74  ? 155 THR 3 N     1 
ATOM   5841  C  CA    . THR C  3  155 ? 12.502   -10.340  354.304 1.00 31.06  ? 155 THR 3 CA    1 
ATOM   5842  C  C     . THR C  3  155 ? 13.088   -9.352   355.313 1.00 25.43  ? 155 THR 3 C     1 
ATOM   5843  O  O     . THR C  3  155 ? 13.967   -8.540   354.996 1.00 18.58  ? 155 THR 3 O     1 
ATOM   5844  C  CB    . THR C  3  155 ? 13.306   -11.681  354.308 1.00 29.99  ? 155 THR 3 CB    1 
ATOM   5845  O  OG1   . THR C  3  155 ? 13.111   -12.376  355.547 1.00 31.04  ? 155 THR 3 OG1   1 
ATOM   5846  C  CG2   . THR C  3  155 ? 14.800   -11.461  354.114 1.00 30.89  ? 155 THR 3 CG2   1 
ATOM   5847  N  N     . ARG C  3  156 ? 12.570   -9.437   356.537 1.00 19.94  ? 156 ARG 3 N     1 
ATOM   5848  C  CA    . ARG C  3  156 ? 12.987   -8.652   357.686 1.00 18.81  ? 156 ARG 3 CA    1 
ATOM   5849  C  C     . ARG C  3  156 ? 13.994   -9.392   358.549 1.00 18.83  ? 156 ARG 3 C     1 
ATOM   5850  O  O     . ARG C  3  156 ? 14.959   -8.791   359.033 1.00 19.06  ? 156 ARG 3 O     1 
ATOM   5851  C  CB    . ARG C  3  156 ? 11.752   -8.312   358.518 1.00 18.89  ? 156 ARG 3 CB    1 
ATOM   5852  C  CG    . ARG C  3  156 ? 10.728   -7.599   357.674 1.00 22.15  ? 156 ARG 3 CG    1 
ATOM   5853  C  CD    . ARG C  3  156 ? 10.317   -6.277   358.251 1.00 23.34  ? 156 ARG 3 CD    1 
ATOM   5854  N  NE    . ARG C  3  156 ? 9.383    -6.456   359.352 1.00 23.38  ? 156 ARG 3 NE    1 
ATOM   5855  C  CZ    . ARG C  3  156 ? 8.086    -6.686   359.166 1.00 23.55  ? 156 ARG 3 CZ    1 
ATOM   5856  N  NH1   . ARG C  3  156 ? 7.599    -6.772   357.932 1.00 18.87  ? 156 ARG 3 NH1   1 
ATOM   5857  N  NH2   . ARG C  3  156 ? 7.273    -6.836   360.201 1.00 25.18  ? 156 ARG 3 NH2   1 
ATOM   5858  N  N     . PHE C  3  157 ? 13.780   -10.703  358.722 1.00 30.85  ? 157 PHE 3 N     1 
ATOM   5859  C  CA    . PHE C  3  157 ? 14.645   -11.601  359.486 1.00 25.16  ? 157 PHE 3 CA    1 
ATOM   5860  C  C     . PHE C  3  157 ? 16.020   -11.714  358.829 1.00 22.83  ? 157 PHE 3 C     1 
ATOM   5861  O  O     . PHE C  3  157 ? 16.201   -12.429  357.832 1.00 18.30  ? 157 PHE 3 O     1 
ATOM   5862  C  CB    . PHE C  3  157 ? 13.979   -12.991  359.596 1.00 22.71  ? 157 PHE 3 CB    1 
ATOM   5863  C  CG    . PHE C  3  157 ? 14.734   -13.991  360.459 1.00 20.91  ? 157 PHE 3 CG    1 
ATOM   5864  C  CD1   . PHE C  3  157 ? 14.659   -13.945  361.845 1.00 23.62  ? 157 PHE 3 CD1   1 
ATOM   5865  C  CD2   . PHE C  3  157 ? 15.529   -14.977  359.885 1.00 23.41  ? 157 PHE 3 CD2   1 
ATOM   5866  C  CE1   . PHE C  3  157 ? 15.366   -14.879  362.637 1.00 23.04  ? 157 PHE 3 CE1   1 
ATOM   5867  C  CE2   . PHE C  3  157 ? 16.234   -15.894  360.678 1.00 17.98  ? 157 PHE 3 CE2   1 
ATOM   5868  C  CZ    . PHE C  3  157 ? 16.149   -15.837  362.048 1.00 18.15  ? 157 PHE 3 CZ    1 
ATOM   5869  N  N     . GLU C  3  158 ? 17.007   -11.055  359.435 1.00 29.24  ? 158 GLU 3 N     1 
ATOM   5870  C  CA    . GLU C  3  158 ? 18.381   -11.029  358.947 1.00 34.46  ? 158 GLU 3 CA    1 
ATOM   5871  C  C     . GLU C  3  158 ? 19.345   -11.615  359.967 1.00 32.96  ? 158 GLU 3 C     1 
ATOM   5872  O  O     . GLU C  3  158 ? 20.534   -11.258  359.970 1.00 33.03  ? 158 GLU 3 O     1 
ATOM   5873  C  CB    . GLU C  3  158 ? 18.794   -9.598   358.611 1.00 38.57  ? 158 GLU 3 CB    1 
ATOM   5874  C  CG    . GLU C  3  158 ? 18.300   -8.578   359.603 1.00 36.72  ? 158 GLU 3 CG    1 
ATOM   5875  C  CD    . GLU C  3  158 ? 18.621   -7.206   359.125 1.00 38.08  ? 158 GLU 3 CD    1 
ATOM   5876  O  OE1   . GLU C  3  158 ? 18.028   -6.804   358.103 1.00 36.56  ? 158 GLU 3 OE1   1 
ATOM   5877  O  OE2   . GLU C  3  158 ? 19.498   -6.554   359.722 1.00 42.04  ? 158 GLU 3 OE2   1 
ATOM   5878  N  N     . PHE C  3  159 ? 18.841   -12.473  360.854 1.00 26.16  ? 159 PHE 3 N     1 
ATOM   5879  C  CA    . PHE C  3  159 ? 19.593   -13.034  361.960 1.00 21.43  ? 159 PHE 3 CA    1 
ATOM   5880  C  C     . PHE C  3  159 ? 20.121   -14.413  361.562 1.00 19.06  ? 159 PHE 3 C     1 
ATOM   5881  O  O     . PHE C  3  159 ? 19.983   -14.864  360.417 1.00 18.40  ? 159 PHE 3 O     1 
ATOM   5882  C  CB    . PHE C  3  159 ? 18.721   -13.106  363.223 1.00 18.99  ? 159 PHE 3 CB    1 
ATOM   5883  C  CG    . PHE C  3  159 ? 18.255   -11.765  363.741 1.00 24.21  ? 159 PHE 3 CG    1 
ATOM   5884  C  CD1   . PHE C  3  159 ? 17.169   -11.121  363.175 1.00 27.39  ? 159 PHE 3 CD1   1 
ATOM   5885  C  CD2   . PHE C  3  159 ? 18.884   -11.162  364.820 1.00 26.06  ? 159 PHE 3 CD2   1 
ATOM   5886  C  CE1   . PHE C  3  159 ? 16.736   -9.887   363.661 1.00 29.20  ? 159 PHE 3 CE1   1 
ATOM   5887  C  CE2   . PHE C  3  159 ? 18.449   -9.925   365.307 1.00 28.28  ? 159 PHE 3 CE2   1 
ATOM   5888  C  CZ    . PHE C  3  159 ? 17.375   -9.293   364.721 1.00 28.94  ? 159 PHE 3 CZ    1 
ATOM   5889  N  N     . THR C  3  160 ? 20.750   -15.089  362.513 1.00 23.24  ? 160 THR 3 N     1 
ATOM   5890  C  CA    . THR C  3  160 ? 21.288   -16.411  362.251 1.00 26.24  ? 160 THR 3 CA    1 
ATOM   5891  C  C     . THR C  3  160 ? 20.126   -17.394  362.209 1.00 33.49  ? 160 THR 3 C     1 
ATOM   5892  O  O     . THR C  3  160 ? 19.270   -17.402  363.098 1.00 33.92  ? 160 THR 3 O     1 
ATOM   5893  C  CB    . THR C  3  160 ? 22.311   -16.797  363.322 1.00 27.09  ? 160 THR 3 CB    1 
ATOM   5894  O  OG1   . THR C  3  160 ? 23.294   -15.763  363.414 1.00 31.37  ? 160 THR 3 OG1   1 
ATOM   5895  C  CG2   . THR C  3  160 ? 23.022   -18.095  362.956 1.00 22.19  ? 160 THR 3 CG2   1 
ATOM   5896  N  N     . ARG C  3  161 ? 20.067   -18.178  361.144 1.00 34.87  ? 161 ARG 3 N     1 
ATOM   5897  C  CA    . ARG C  3  161 ? 18.974   -19.106  360.909 1.00 36.46  ? 161 ARG 3 CA    1 
ATOM   5898  C  C     . ARG C  3  161 ? 19.238   -20.457  361.567 1.00 26.18  ? 161 ARG 3 C     1 
ATOM   5899  O  O     . ARG C  3  161 ? 20.349   -20.762  362.000 1.00 17.53  ? 161 ARG 3 O     1 
ATOM   5900  C  CB    . ARG C  3  161 ? 18.722   -19.249  359.401 1.00 36.82  ? 161 ARG 3 CB    1 
ATOM   5901  C  CG    . ARG C  3  161 ? 18.106   -17.974  358.762 1.00 38.29  ? 161 ARG 3 CG    1 
ATOM   5902  C  CD    . ARG C  3  161 ? 18.209   -17.985  357.241 1.00 35.74  ? 161 ARG 3 CD    1 
ATOM   5903  N  NE    . ARG C  3  161 ? 17.571   -16.839  356.582 1.00 29.87  ? 161 ARG 3 NE    1 
ATOM   5904  C  CZ    . ARG C  3  161 ? 16.288   -16.798  356.203 1.00 21.37  ? 161 ARG 3 CZ    1 
ATOM   5905  N  NH1   . ARG C  3  161 ? 15.492   -17.842  356.395 1.00 24.21  ? 161 ARG 3 NH1   1 
ATOM   5906  N  NH2   . ARG C  3  161 ? 15.799   -15.722  355.597 1.00 25.47  ? 161 ARG 3 NH2   1 
ATOM   5907  N  N     . ARG C  3  162 ? 18.166   -21.233  361.698 1.00 32.66  ? 162 ARG 3 N     1 
ATOM   5908  C  CA    . ARG C  3  162 ? 18.230   -22.560  362.307 1.00 32.70  ? 162 ARG 3 CA    1 
ATOM   5909  C  C     . ARG C  3  162 ? 18.902   -23.565  361.374 1.00 33.88  ? 162 ARG 3 C     1 
ATOM   5910  O  O     . ARG C  3  162 ? 18.521   -23.696  360.207 1.00 34.67  ? 162 ARG 3 O     1 
ATOM   5911  C  CB    . ARG C  3  162 ? 16.815   -23.037  362.654 1.00 31.93  ? 162 ARG 3 CB    1 
ATOM   5912  C  CG    . ARG C  3  162 ? 16.743   -24.371  363.364 1.00 26.28  ? 162 ARG 3 CG    1 
ATOM   5913  C  CD    . ARG C  3  162 ? 15.419   -25.059  363.047 1.00 28.03  ? 162 ARG 3 CD    1 
ATOM   5914  N  NE    . ARG C  3  162 ? 14.215   -24.361  363.510 1.00 32.26  ? 162 ARG 3 NE    1 
ATOM   5915  C  CZ    . ARG C  3  162 ? 13.300   -23.803  362.716 1.00 16.63  ? 162 ARG 3 CZ    1 
ATOM   5916  N  NH1   . ARG C  3  162 ? 13.434   -23.831  361.396 1.00 16.47  ? 162 ARG 3 NH1   1 
ATOM   5917  N  NH2   . ARG C  3  162 ? 12.236   -23.223  363.255 1.00 16.73  ? 162 ARG 3 NH2   1 
ATOM   5918  N  N     . HIS C  3  163 ? 19.884   -24.295  361.894 1.00 27.73  ? 163 HIS 3 N     1 
ATOM   5919  C  CA    . HIS C  3  163 ? 20.593   -25.306  361.121 1.00 28.48  ? 163 HIS 3 CA    1 
ATOM   5920  C  C     . HIS C  3  163 ? 20.505   -26.620  361.877 1.00 28.07  ? 163 HIS 3 C     1 
ATOM   5921  O  O     . HIS C  3  163 ? 20.929   -26.701  363.034 1.00 33.32  ? 163 HIS 3 O     1 
ATOM   5922  C  CB    . HIS C  3  163 ? 22.058   -24.930  360.888 1.00 32.24  ? 163 HIS 3 CB    1 
ATOM   5923  C  CG    . HIS C  3  163 ? 22.250   -23.639  360.158 1.00 40.12  ? 163 HIS 3 CG    1 
ATOM   5924  N  ND1   . HIS C  3  163 ? 23.111   -22.658  360.607 1.00 40.38  ? 163 HIS 3 ND1   1 
ATOM   5925  C  CD2   . HIS C  3  163 ? 21.690   -23.160  359.022 1.00 42.98  ? 163 HIS 3 CD2   1 
ATOM   5926  C  CE1   . HIS C  3  163 ? 23.078   -21.632  359.776 1.00 43.04  ? 163 HIS 3 CE1   1 
ATOM   5927  N  NE2   . HIS C  3  163 ? 22.221   -21.909  358.808 1.00 40.10  ? 163 HIS 3 NE2   1 
ATOM   5928  N  N     . VAL C  3  164 ? 19.951   -27.642  361.232 1.00 25.90  ? 164 VAL 3 N     1 
ATOM   5929  C  CA    . VAL C  3  164 ? 19.907   -28.972  361.824 1.00 25.44  ? 164 VAL 3 CA    1 
ATOM   5930  C  C     . VAL C  3  164 ? 20.389   -29.969  360.784 1.00 25.84  ? 164 VAL 3 C     1 
ATOM   5931  O  O     . VAL C  3  164 ? 20.832   -29.587  359.694 1.00 21.04  ? 164 VAL 3 O     1 
ATOM   5932  C  CB    . VAL C  3  164 ? 18.508   -29.352  362.351 1.00 15.98  ? 164 VAL 3 CB    1 
ATOM   5933  C  CG1   . VAL C  3  164 ? 18.086   -28.444  363.500 1.00 16.24  ? 164 VAL 3 CG1   1 
ATOM   5934  C  CG2   . VAL C  3  164 ? 17.496   -29.330  361.241 1.00 16.61  ? 164 VAL 3 CG2   1 
ATOM   5935  N  N     . ASP C  3  165 ? 20.316   -31.249  361.136 1.00 27.49  ? 165 ASP 3 N     1 
ATOM   5936  C  CA    . ASP C  3  165 ? 20.828   -32.313  360.289 1.00 24.60  ? 165 ASP 3 CA    1 
ATOM   5937  C  C     . ASP C  3  165 ? 20.065   -32.375  358.974 1.00 21.70  ? 165 ASP 3 C     1 
ATOM   5938  O  O     . ASP C  3  165 ? 18.844   -32.206  358.932 1.00 23.74  ? 165 ASP 3 O     1 
ATOM   5939  C  CB    . ASP C  3  165 ? 20.748   -33.637  361.036 1.00 27.61  ? 165 ASP 3 CB    1 
ATOM   5940  C  CG    . ASP C  3  165 ? 21.097   -34.812  360.171 1.00 35.48  ? 165 ASP 3 CG    1 
ATOM   5941  O  OD1   . ASP C  3  165 ? 22.240   -34.869  359.671 1.00 38.20  ? 165 ASP 3 OD1   1 
ATOM   5942  O  OD2   . ASP C  3  165 ? 20.261   -35.719  360.044 1.00 38.47  ? 165 ASP 3 OD2   1 
ATOM   5943  N  N     . LYS C  3  166 ? 20.804   -32.643  357.901 1.00 19.60  ? 166 LYS 3 N     1 
ATOM   5944  C  CA    . LYS C  3  166 ? 20.336   -32.495  356.533 1.00 19.51  ? 166 LYS 3 CA    1 
ATOM   5945  C  C     . LYS C  3  166 ? 20.525   -33.812  355.806 1.00 17.49  ? 166 LYS 3 C     1 
ATOM   5946  O  O     . LYS C  3  166 ? 21.424   -34.590  356.138 1.00 18.47  ? 166 LYS 3 O     1 
ATOM   5947  C  CB    . LYS C  3  166 ? 21.127   -31.410  355.807 1.00 19.30  ? 166 LYS 3 CB    1 
ATOM   5948  C  CG    . LYS C  3  166 ? 20.378   -30.508  354.860 1.00 18.96  ? 166 LYS 3 CG    1 
ATOM   5949  C  CD    . LYS C  3  166 ? 21.261   -29.289  354.584 1.00 25.24  ? 166 LYS 3 CD    1 
ATOM   5950  C  CE    . LYS C  3  166 ? 20.723   -28.339  353.521 1.00 29.16  ? 166 LYS 3 CE    1 
ATOM   5951  N  NZ    . LYS C  3  166 ? 19.415   -27.718  353.836 1.00 31.54  ? 166 LYS 3 NZ    1 
ATOM   5952  N  N     . HIS C  3  167 ? 19.681   -34.040  354.801 1.00 19.78  ? 167 HIS 3 N     1 
ATOM   5953  C  CA    . HIS C  3  167 ? 19.678   -35.263  353.995 1.00 21.33  ? 167 HIS 3 CA    1 
ATOM   5954  C  C     . HIS C  3  167 ? 19.908   -36.468  354.899 1.00 20.69  ? 167 HIS 3 C     1 
ATOM   5955  O  O     . HIS C  3  167 ? 20.880   -37.211  354.773 1.00 30.31  ? 167 HIS 3 O     1 
ATOM   5956  C  CB    . HIS C  3  167 ? 20.701   -35.215  352.860 1.00 14.10  ? 167 HIS 3 CB    1 
ATOM   5957  C  CG    . HIS C  3  167 ? 22.069   -34.795  353.297 1.00 18.37  ? 167 HIS 3 CG    1 
ATOM   5958  N  ND1   . HIS C  3  167 ? 22.945   -35.655  353.931 1.00 17.40  ? 167 HIS 3 ND1   1 
ATOM   5959  C  CD2   . HIS C  3  167 ? 22.702   -33.599  353.220 1.00 22.98  ? 167 HIS 3 CD2   1 
ATOM   5960  C  CE1   . HIS C  3  167 ? 24.064   -35.011  354.209 1.00 19.43  ? 167 HIS 3 CE1   1 
ATOM   5961  N  NE2   . HIS C  3  167 ? 23.942   -33.763  353.789 1.00 21.37  ? 167 HIS 3 NE2   1 
ATOM   5962  N  N     . HIS C  3  168 ? 18.971   -36.656  355.824 1.00 20.79  ? 168 HIS 3 N     1 
ATOM   5963  C  CA    . HIS C  3  168 ? 19.095   -37.721  356.804 1.00 20.03  ? 168 HIS 3 CA    1 
ATOM   5964  C  C     . HIS C  3  168 ? 18.283   -38.907  356.309 1.00 19.56  ? 168 HIS 3 C     1 
ATOM   5965  O  O     . HIS C  3  168 ? 17.041   -38.823  356.265 1.00 13.72  ? 168 HIS 3 O     1 
ATOM   5966  C  CB    . HIS C  3  168 ? 18.591   -37.256  358.169 1.00 14.26  ? 168 HIS 3 CB    1 
ATOM   5967  C  CG    . HIS C  3  168 ? 18.752   -38.275  359.254 1.00 23.70  ? 168 HIS 3 CG    1 
ATOM   5968  N  ND1   . HIS C  3  168 ? 19.989   -38.732  359.660 1.00 21.06  ? 168 HIS 3 ND1   1 
ATOM   5969  C  CD2   . HIS C  3  168 ? 17.836   -38.942  360.000 1.00 21.92  ? 168 HIS 3 CD2   1 
ATOM   5970  C  CE1   . HIS C  3  168 ? 19.828   -39.631  360.614 1.00 21.70  ? 168 HIS 3 CE1   1 
ATOM   5971  N  NE2   . HIS C  3  168 ? 18.532   -39.778  360.837 1.00 21.81  ? 168 HIS 3 NE2   1 
ATOM   5972  N  N     . PRO C  3  169 ? 18.927   -40.007  355.876 1.00 20.67  ? 169 PRO 3 N     1 
ATOM   5973  C  CA    . PRO C  3  169 ? 18.168   -41.181  355.415 1.00 13.35  ? 169 PRO 3 CA    1 
ATOM   5974  C  C     . PRO C  3  169 ? 17.366   -41.843  356.526 1.00 13.34  ? 169 PRO 3 C     1 
ATOM   5975  O  O     . PRO C  3  169 ? 17.950   -42.429  357.440 1.00 14.54  ? 169 PRO 3 O     1 
ATOM   5976  C  CB    . PRO C  3  169 ? 19.269   -42.111  354.886 1.00 17.93  ? 169 PRO 3 CB    1 
ATOM   5977  C  CG    . PRO C  3  169 ? 20.533   -41.660  355.620 1.00 13.45  ? 169 PRO 3 CG    1 
ATOM   5978  C  CD    . PRO C  3  169 ? 20.382   -40.178  355.702 1.00 13.66  ? 169 PRO 3 CD    1 
ATOM   5979  N  N     . LEU C  3  170 ? 16.036   -41.716  356.495 1.00 13.28  ? 170 LEU 3 N     1 
ATOM   5980  C  CA    . LEU C  3  170 ? 15.212   -42.399  357.483 1.00 30.58  ? 170 LEU 3 CA    1 
ATOM   5981  C  C     . LEU C  3  170 ? 15.012   -43.871  357.176 1.00 31.41  ? 170 LEU 3 C     1 
ATOM   5982  O  O     . LEU C  3  170 ? 14.760   -44.656  358.095 1.00 35.51  ? 170 LEU 3 O     1 
ATOM   5983  C  CB    . LEU C  3  170 ? 13.846   -41.740  357.616 1.00 13.28  ? 170 LEU 3 CB    1 
ATOM   5984  C  CG    . LEU C  3  170 ? 13.834   -40.557  358.565 1.00 24.18  ? 170 LEU 3 CG    1 
ATOM   5985  C  CD1   . LEU C  3  170 ? 12.399   -40.136  358.850 1.00 27.34  ? 170 LEU 3 CD1   1 
ATOM   5986  C  CD2   . LEU C  3  170 ? 14.550   -40.963  359.854 1.00 23.72  ? 170 LEU 3 CD2   1 
ATOM   5987  N  N     . SER C  3  171 ? 15.130   -44.268  355.920 1.00 24.52  ? 171 SER 3 N     1 
ATOM   5988  C  CA    . SER C  3  171 ? 14.904   -45.643  355.502 1.00 24.20  ? 171 SER 3 CA    1 
ATOM   5989  C  C     . SER C  3  171 ? 15.371   -45.763  354.062 1.00 22.05  ? 171 SER 3 C     1 
ATOM   5990  O  O     . SER C  3  171 ? 15.459   -44.754  353.358 1.00 21.51  ? 171 SER 3 O     1 
ATOM   5991  C  CB    . SER C  3  171 ? 13.417   -46.024  355.613 1.00 22.54  ? 171 SER 3 CB    1 
ATOM   5992  O  OG    . SER C  3  171 ? 12.756   -45.809  354.368 1.00 22.91  ? 171 SER 3 OG    1 
ATOM   5993  N  N     . PRO C  3  172 ? 15.647   -46.964  353.601 1.00 12.24  ? 172 PRO 3 N     1 
ATOM   5994  C  CA    . PRO C  3  172 ? 16.219   -47.122  352.260 1.00 12.10  ? 172 PRO 3 CA    1 
ATOM   5995  C  C     . PRO C  3  172 ? 15.411   -46.483  351.136 1.00 12.03  ? 172 PRO 3 C     1 
ATOM   5996  O  O     . PRO C  3  172 ? 15.890   -46.433  349.998 1.00 11.94  ? 172 PRO 3 O     1 
ATOM   5997  C  CB    . PRO C  3  172 ? 16.292   -48.645  352.096 1.00 21.53  ? 172 PRO 3 CB    1 
ATOM   5998  C  CG    . PRO C  3  172 ? 15.492   -49.228  353.222 1.00 11.90  ? 172 PRO 3 CG    1 
ATOM   5999  C  CD    . PRO C  3  172 ? 15.570   -48.241  354.318 1.00 12.15  ? 172 PRO 3 CD    1 
ATOM   6000  N  N     . PHE C  3  173 ? 14.192   -46.002  351.426 1.00 12.05  ? 173 PHE 3 N     1 
ATOM   6001  C  CA    . PHE C  3  173 ? 13.361   -45.347  350.422 1.00 11.99  ? 173 PHE 3 CA    1 
ATOM   6002  C  C     . PHE C  3  173 ? 13.098   -43.878  350.711 1.00 24.71  ? 173 PHE 3 C     1 
ATOM   6003  O  O     . PHE C  3  173 ? 12.772   -43.131  349.777 1.00 12.19  ? 173 PHE 3 O     1 
ATOM   6004  C  CB    . PHE C  3  173 ? 12.014   -46.064  350.293 1.00 11.82  ? 173 PHE 3 CB    1 
ATOM   6005  C  CG    . PHE C  3  173 ? 12.146   -47.552  350.167 1.00 17.85  ? 173 PHE 3 CG    1 
ATOM   6006  C  CD1   . PHE C  3  173 ? 13.025   -48.103  349.257 1.00 17.99  ? 173 PHE 3 CD1   1 
ATOM   6007  C  CD2   . PHE C  3  173 ? 11.403   -48.405  350.964 1.00 11.57  ? 173 PHE 3 CD2   1 
ATOM   6008  C  CE1   . PHE C  3  173 ? 13.163   -49.472  349.147 1.00 11.33  ? 173 PHE 3 CE1   1 
ATOM   6009  C  CE2   . PHE C  3  173 ? 11.545   -49.760  350.850 1.00 11.40  ? 173 PHE 3 CE2   1 
ATOM   6010  C  CZ    . PHE C  3  173 ? 12.426   -50.290  349.938 1.00 11.28  ? 173 PHE 3 CZ    1 
ATOM   6011  N  N     . VAL C  3  174 ? 13.317   -43.430  351.950 1.00 21.14  ? 174 VAL 3 N     1 
ATOM   6012  C  CA    . VAL C  3  174 ? 12.885   -42.126  352.448 1.00 16.94  ? 174 VAL 3 CA    1 
ATOM   6013  C  C     . VAL C  3  174 ? 14.105   -41.392  352.974 1.00 18.03  ? 174 VAL 3 C     1 
ATOM   6014  O  O     . VAL C  3  174 ? 14.949   -41.981  353.659 1.00 12.87  ? 174 VAL 3 O     1 
ATOM   6015  C  CB    . VAL C  3  174 ? 11.809   -42.258  353.552 1.00 15.16  ? 174 VAL 3 CB    1 
ATOM   6016  C  CG1   . VAL C  3  174 ? 11.618   -40.971  354.286 1.00 12.90  ? 174 VAL 3 CG1   1 
ATOM   6017  C  CG2   . VAL C  3  174 ? 10.487   -42.638  352.929 1.00 30.50  ? 174 VAL 3 CG2   1 
ATOM   6018  N  N     . ILE C  3  175 ? 14.182   -40.100  352.677 1.00 12.98  ? 175 ILE 3 N     1 
ATOM   6019  C  CA    . ILE C  3  175 ? 15.269   -39.267  353.165 1.00 13.21  ? 175 ILE 3 CA    1 
ATOM   6020  C  C     . ILE C  3  175 ? 14.640   -38.079  353.874 1.00 13.43  ? 175 ILE 3 C     1 
ATOM   6021  O  O     . ILE C  3  175 ? 13.574   -37.593  353.480 1.00 13.40  ? 175 ILE 3 O     1 
ATOM   6022  C  CB    . ILE C  3  175 ? 16.210   -38.835  352.019 1.00 13.20  ? 175 ILE 3 CB    1 
ATOM   6023  C  CG1   . ILE C  3  175 ? 17.655   -38.867  352.496 1.00 17.14  ? 175 ILE 3 CG1   1 
ATOM   6024  C  CG2   . ILE C  3  175 ? 15.888   -37.443  351.535 1.00 13.34  ? 175 ILE 3 CG2   1 
ATOM   6025  C  CD1   . ILE C  3  175 ? 18.662   -38.659  351.401 1.00 22.75  ? 175 ILE 3 CD1   1 
ATOM   6026  N  N     . LEU C  3  176 ? 15.315   -37.599  354.917 1.00 19.84  ? 176 LEU 3 N     1 
ATOM   6027  C  CA    . LEU C  3  176 ? 14.737   -36.643  355.857 1.00 20.67  ? 176 LEU 3 CA    1 
ATOM   6028  C  C     . LEU C  3  176 ? 15.655   -35.437  356.010 1.00 27.75  ? 176 LEU 3 C     1 
ATOM   6029  O  O     . LEU C  3  176 ? 16.814   -35.585  356.413 1.00 37.29  ? 176 LEU 3 O     1 
ATOM   6030  C  CB    . LEU C  3  176 ? 14.492   -37.314  357.212 1.00 19.94  ? 176 LEU 3 CB    1 
ATOM   6031  C  CG    . LEU C  3  176 ? 14.076   -36.360  358.327 1.00 20.89  ? 176 LEU 3 CG    1 
ATOM   6032  C  CD1   . LEU C  3  176 ? 12.767   -35.667  357.997 1.00 25.36  ? 176 LEU 3 CD1   1 
ATOM   6033  C  CD2   . LEU C  3  176 ? 14.000   -37.067  359.688 1.00 14.19  ? 176 LEU 3 CD2   1 
ATOM   6034  N  N     . ASP C  3  177 ? 15.134   -34.242  355.700 1.00 22.47  ? 177 ASP 3 N     1 
ATOM   6035  C  CA    . ASP C  3  177 ? 15.846   -32.975  355.864 1.00 16.00  ? 177 ASP 3 CA    1 
ATOM   6036  C  C     . ASP C  3  177 ? 15.062   -32.202  356.919 1.00 19.82  ? 177 ASP 3 C     1 
ATOM   6037  O  O     . ASP C  3  177 ? 13.960   -31.715  356.642 1.00 22.19  ? 177 ASP 3 O     1 
ATOM   6038  C  CB    . ASP C  3  177 ? 15.933   -32.218  354.527 1.00 19.72  ? 177 ASP 3 CB    1 
ATOM   6039  C  CG    . ASP C  3  177 ? 16.890   -30.994  354.566 1.00 18.61  ? 177 ASP 3 CG    1 
ATOM   6040  O  OD1   . ASP C  3  177 ? 16.825   -30.164  355.498 1.00 21.75  ? 177 ASP 3 OD1   1 
ATOM   6041  O  OD2   . ASP C  3  177 ? 17.678   -30.821  353.606 1.00 14.68  ? 177 ASP 3 OD2   1 
ATOM   6042  N  N     . ARG C  3  178 ? 15.579   -32.155  358.148 1.00 16.82  ? 178 ARG 3 N     1 
ATOM   6043  C  CA    . ARG C  3  178 ? 14.836   -31.509  359.230 1.00 22.47  ? 178 ARG 3 CA    1 
ATOM   6044  C  C     . ARG C  3  178 ? 14.844   -29.985  359.142 1.00 25.08  ? 178 ARG 3 C     1 
ATOM   6045  O  O     . ARG C  3  178 ? 14.121   -29.332  359.908 1.00 21.19  ? 178 ARG 3 O     1 
ATOM   6046  C  CB    . ARG C  3  178 ? 15.386   -31.928  360.592 1.00 23.17  ? 178 ARG 3 CB    1 
ATOM   6047  C  CG    . ARG C  3  178 ? 15.272   -33.387  360.882 1.00 18.93  ? 178 ARG 3 CG    1 
ATOM   6048  C  CD    . ARG C  3  178 ? 16.344   -33.778  361.851 1.00 20.90  ? 178 ARG 3 CD    1 
ATOM   6049  N  NE    . ARG C  3  178 ? 16.289   -35.199  362.119 1.00 27.11  ? 178 ARG 3 NE    1 
ATOM   6050  C  CZ    . ARG C  3  178 ? 16.936   -35.786  363.115 1.00 35.24  ? 178 ARG 3 CZ    1 
ATOM   6051  N  NH1   . ARG C  3  178 ? 17.709   -35.066  363.921 1.00 40.08  ? 178 ARG 3 NH1   1 
ATOM   6052  N  NH2   . ARG C  3  178 ? 16.827   -37.096  363.292 1.00 35.45  ? 178 ARG 3 NH2   1 
ATOM   6053  N  N     . GLU C  3  179 ? 15.655   -29.401  358.257 1.00 27.05  ? 179 GLU 3 N     1 
ATOM   6054  C  CA    . GLU C  3  179 ? 15.640   -27.950  358.103 1.00 34.87  ? 179 GLU 3 CA    1 
ATOM   6055  C  C     . GLU C  3  179 ? 14.406   -27.506  357.337 1.00 35.38  ? 179 GLU 3 C     1 
ATOM   6056  O  O     . GLU C  3  179 ? 13.821   -26.460  357.641 1.00 41.61  ? 179 GLU 3 O     1 
ATOM   6057  C  CB    . GLU C  3  179 ? 16.903   -27.467  357.385 1.00 43.35  ? 179 GLU 3 CB    1 
ATOM   6058  C  CG    . GLU C  3  179 ? 18.196   -27.717  358.161 1.00 52.85  ? 179 GLU 3 CG    1 
ATOM   6059  C  CD    . GLU C  3  179 ? 19.437   -27.225  357.437 1.00 58.63  ? 179 GLU 3 CD    1 
ATOM   6060  O  OE1   . GLU C  3  179 ? 19.352   -26.901  356.234 1.00 61.50  ? 179 GLU 3 OE1   1 
ATOM   6061  O  OE2   . GLU C  3  179 ? 20.516   -27.222  358.062 1.00 60.74  ? 179 GLU 3 OE2   1 
ATOM   6062  N  N     . ARG C  3  180 ? 14.015   -28.277  356.320 1.00 29.65  ? 180 ARG 3 N     1 
ATOM   6063  C  CA    . ARG C  3  180 ? 12.873   -27.901  355.493 1.00 29.35  ? 180 ARG 3 CA    1 
ATOM   6064  C  C     . ARG C  3  180 ? 11.537   -28.081  356.210 1.00 27.04  ? 180 ARG 3 C     1 
ATOM   6065  O  O     . ARG C  3  180 ? 10.535   -27.524  355.756 1.00 33.25  ? 180 ARG 3 O     1 
ATOM   6066  C  CB    . ARG C  3  180 ? 12.899   -28.657  354.162 1.00 25.15  ? 180 ARG 3 CB    1 
ATOM   6067  C  CG    . ARG C  3  180 ? 14.035   -28.148  353.282 1.00 14.86  ? 180 ARG 3 CG    1 
ATOM   6068  C  CD    . ARG C  3  180 ? 14.198   -28.909  352.001 1.00 15.32  ? 180 ARG 3 CD    1 
ATOM   6069  N  NE    . ARG C  3  180 ? 15.541   -28.692  351.487 1.00 17.66  ? 180 ARG 3 NE    1 
ATOM   6070  C  CZ    . ARG C  3  180 ? 16.174   -29.538  350.683 1.00 24.31  ? 180 ARG 3 CZ    1 
ATOM   6071  N  NH1   . ARG C  3  180 ? 15.577   -30.648  350.281 1.00 29.12  ? 180 ARG 3 NH1   1 
ATOM   6072  N  NH2   . ARG C  3  180 ? 17.409   -29.280  350.282 1.00 28.91  ? 180 ARG 3 NH2   1 
ATOM   6073  N  N     . CYS C  3  181 ? 11.491   -28.866  357.283 1.00 20.42  ? 181 CYS 3 N     1 
ATOM   6074  C  CA    . CYS C  3  181 ? 10.265   -29.023  358.061 1.00 25.26  ? 181 CYS 3 CA    1 
ATOM   6075  C  C     . CYS C  3  181 ? 9.814    -27.667  358.618 1.00 23.42  ? 181 CYS 3 C     1 
ATOM   6076  O  O     . CYS C  3  181 ? 10.600   -26.940  359.241 1.00 15.53  ? 181 CYS 3 O     1 
ATOM   6077  C  CB    . CYS C  3  181 ? 10.511   -30.028  359.197 1.00 27.37  ? 181 CYS 3 CB    1 
ATOM   6078  S  SG    . CYS C  3  181 ? 9.158    -30.364  360.357 1.00 15.02  ? 181 CYS 3 SG    1 
ATOM   6079  N  N     . ILE C  3  182 ? 8.540    -27.330  358.389 1.00 28.10  ? 182 ILE 3 N     1 
ATOM   6080  C  CA    . ILE C  3  182 ? 7.934    -26.115  358.929 1.00 30.55  ? 182 ILE 3 CA    1 
ATOM   6081  C  C     . ILE C  3  182 ? 7.119    -26.410  360.185 1.00 33.74  ? 182 ILE 3 C     1 
ATOM   6082  O  O     . ILE C  3  182 ? 6.358    -25.554  360.646 1.00 40.15  ? 182 ILE 3 O     1 
ATOM   6083  C  CB    . ILE C  3  182 ? 7.071    -25.382  357.876 1.00 26.67  ? 182 ILE 3 CB    1 
ATOM   6084  C  CG1   . ILE C  3  182 ? 5.865    -26.226  357.458 1.00 23.21  ? 182 ILE 3 CG1   1 
ATOM   6085  C  CG2   . ILE C  3  182 ? 7.912    -24.980  356.665 1.00 25.56  ? 182 ILE 3 CG2   1 
ATOM   6086  C  CD1   . ILE C  3  182 ? 4.887    -25.502  356.534 1.00 22.96  ? 182 ILE 3 CD1   1 
ATOM   6087  N  N     . HIS C  3  183 ? 7.252    -27.609  360.740 1.00 30.39  ? 183 HIS 3 N     1 
ATOM   6088  C  CA    . HIS C  3  183 ? 6.577    -27.993  361.974 1.00 25.99  ? 183 HIS 3 CA    1 
ATOM   6089  C  C     . HIS C  3  183 ? 5.058    -27.931  361.800 1.00 22.73  ? 183 HIS 3 C     1 
ATOM   6090  O  O     . HIS C  3  183 ? 4.362    -27.137  362.436 1.00 15.52  ? 183 HIS 3 O     1 
ATOM   6091  C  CB    . HIS C  3  183 ? 7.023    -27.126  363.152 1.00 28.71  ? 183 HIS 3 CB    1 
ATOM   6092  C  CG    . HIS C  3  183 ? 8.512    -26.936  363.251 1.00 24.58  ? 183 HIS 3 CG    1 
ATOM   6093  N  ND1   . HIS C  3  183 ? 9.200    -26.062  362.430 1.00 26.74  ? 183 HIS 3 ND1   1 
ATOM   6094  C  CD2   . HIS C  3  183 ? 9.433    -27.459  364.099 1.00 29.07  ? 183 HIS 3 CD2   1 
ATOM   6095  C  CE1   . HIS C  3  183 ? 10.481   -26.076  362.748 1.00 23.96  ? 183 HIS 3 CE1   1 
ATOM   6096  N  NE2   . HIS C  3  183 ? 10.649   -26.912  363.758 1.00 28.61  ? 183 HIS 3 NE2   1 
ATOM   6097  N  N     . CYS C  3  184 ? 4.578    -28.690  360.815 1.00 31.27  ? 184 CYS 3 N     1 
ATOM   6098  C  CA    . CYS C  3  184 ? 3.195    -29.147  360.777 1.00 33.99  ? 184 CYS 3 CA    1 
ATOM   6099  C  C     . CYS C  3  184 ? 3.124    -30.488  361.520 1.00 30.78  ? 184 CYS 3 C     1 
ATOM   6100  O  O     . CYS C  3  184 ? 4.069    -30.889  362.200 1.00 29.35  ? 184 CYS 3 O     1 
ATOM   6101  C  CB    . CYS C  3  184 ? 2.699    -29.156  359.328 1.00 35.68  ? 184 CYS 3 CB    1 
ATOM   6102  S  SG    . CYS C  3  184 ? 2.852    -30.670  358.380 1.00 33.19  ? 184 CYS 3 SG    1 
ATOM   6103  N  N     . LYS C  3  185 ? 2.017    -31.216  361.409 1.00 31.31  ? 185 LYS 3 N     1 
ATOM   6104  C  CA    . LYS C  3  185 ? 1.881    -32.475  362.142 1.00 28.19  ? 185 LYS 3 CA    1 
ATOM   6105  C  C     . LYS C  3  185 ? 1.597    -33.663  361.229 1.00 30.52  ? 185 LYS 3 C     1 
ATOM   6106  O  O     . LYS C  3  185 ? 1.352    -34.764  361.728 1.00 28.13  ? 185 LYS 3 O     1 
ATOM   6107  C  CB    . LYS C  3  185 ? 0.773    -32.359  363.199 1.00 27.84  ? 185 LYS 3 CB    1 
ATOM   6108  C  CG    . LYS C  3  185 ? 1.127    -32.900  364.579 1.00 22.65  ? 185 LYS 3 CG    1 
ATOM   6109  C  CD    . LYS C  3  185 ? 0.028    -32.547  365.580 1.00 19.68  ? 185 LYS 3 CD    1 
ATOM   6110  C  CE    . LYS C  3  185 ? 0.400    -32.936  367.002 1.00 16.93  ? 185 LYS 3 CE    1 
ATOM   6111  N  NZ    . LYS C  3  185 ? -0.701   -32.593  367.944 1.00 17.56  ? 185 LYS 3 NZ    1 
ATOM   6112  N  N     . ARG C  3  186 ? 1.671    -33.471  359.911 1.00 26.40  ? 186 ARG 3 N     1 
ATOM   6113  C  CA    . ARG C  3  186 ? 1.077    -34.405  358.961 1.00 24.84  ? 186 ARG 3 CA    1 
ATOM   6114  C  C     . ARG C  3  186 ? 1.677    -35.806  359.073 1.00 30.98  ? 186 ARG 3 C     1 
ATOM   6115  O  O     . ARG C  3  186 ? 0.945    -36.803  359.045 1.00 30.50  ? 186 ARG 3 O     1 
ATOM   6116  C  CB    . ARG C  3  186 ? 1.226    -33.853  357.544 1.00 22.19  ? 186 ARG 3 CB    1 
ATOM   6117  C  CG    . ARG C  3  186 ? 0.253    -32.693  357.232 1.00 26.07  ? 186 ARG 3 CG    1 
ATOM   6118  C  CD    . ARG C  3  186 ? 0.416    -32.151  355.810 1.00 30.03  ? 186 ARG 3 CD    1 
ATOM   6119  N  NE    . ARG C  3  186 ? -0.431   -30.987  355.546 1.00 37.23  ? 186 ARG 3 NE    1 
ATOM   6120  C  CZ    . ARG C  3  186 ? -0.664   -30.496  354.330 1.00 37.22  ? 186 ARG 3 CZ    1 
ATOM   6121  N  NH1   . ARG C  3  186 ? -0.128   -31.090  353.268 1.00 39.02  ? 186 ARG 3 NH1   1 
ATOM   6122  N  NH2   . ARG C  3  186 ? -1.419   -29.404  354.168 1.00 30.42  ? 186 ARG 3 NH2   1 
ATOM   6123  N  N     . CYS C  3  187 ? 3.004    -35.918  359.189 1.00 40.24  ? 187 CYS 3 N     1 
ATOM   6124  C  CA    . CYS C  3  187 ? 3.615    -37.255  359.187 1.00 43.97  ? 187 CYS 3 CA    1 
ATOM   6125  C  C     . CYS C  3  187 ? 3.325    -38.025  360.480 1.00 39.52  ? 187 CYS 3 C     1 
ATOM   6126  O  O     . CYS C  3  187 ? 2.947    -39.207  360.434 1.00 36.38  ? 187 CYS 3 O     1 
ATOM   6127  C  CB    . CYS C  3  187 ? 5.126    -37.158  358.901 1.00 41.36  ? 187 CYS 3 CB    1 
ATOM   6128  S  SG    . CYS C  3  187 ? 6.121    -36.104  359.959 1.00 37.78  ? 187 CYS 3 SG    1 
ATOM   6129  N  N     . VAL C  3  188 ? 3.445    -37.356  361.635 1.00 36.66  ? 188 VAL 3 N     1 
ATOM   6130  C  CA    . VAL C  3  188 ? 3.164    -38.002  362.917 1.00 26.67  ? 188 VAL 3 CA    1 
ATOM   6131  C  C     . VAL C  3  188 ? 1.664    -38.289  363.068 1.00 18.87  ? 188 VAL 3 C     1 
ATOM   6132  O  O     . VAL C  3  188 ? 1.269    -39.357  363.558 1.00 19.81  ? 188 VAL 3 O     1 
ATOM   6133  C  CB    . VAL C  3  188 ? 3.730    -37.147  364.085 1.00 21.70  ? 188 VAL 3 CB    1 
ATOM   6134  C  CG1   . VAL C  3  188 ? 5.127    -36.665  363.768 1.00 17.84  ? 188 VAL 3 CG1   1 
ATOM   6135  C  CG2   . VAL C  3  188 ? 2.853    -35.930  364.415 1.00 18.99  ? 188 VAL 3 CG2   1 
ATOM   6136  N  N     . ARG C  3  189 ? 0.812    -37.376  362.585 1.00 19.99  ? 189 ARG 3 N     1 
ATOM   6137  C  CA    . ARG C  3  189 ? -0.631   -37.576  362.631 1.00 13.69  ? 189 ARG 3 CA    1 
ATOM   6138  C  C     . ARG C  3  189 ? -1.039   -38.750  361.762 1.00 13.40  ? 189 ARG 3 C     1 
ATOM   6139  O  O     . ARG C  3  189 ? -1.901   -39.546  362.149 1.00 18.51  ? 189 ARG 3 O     1 
ATOM   6140  C  CB    . ARG C  3  189 ? -1.354   -36.307  362.178 1.00 32.28  ? 189 ARG 3 CB    1 
ATOM   6141  C  CG    . ARG C  3  189 ? -2.684   -36.065  362.879 1.00 26.13  ? 189 ARG 3 CG    1 
ATOM   6142  C  CD    . ARG C  3  189 ? -2.980   -34.576  363.014 1.00 23.32  ? 189 ARG 3 CD    1 
ATOM   6143  N  NE    . ARG C  3  189 ? -3.317   -33.967  361.737 1.00 26.97  ? 189 ARG 3 NE    1 
ATOM   6144  C  CZ    . ARG C  3  189 ? -2.727   -32.870  361.281 1.00 38.33  ? 189 ARG 3 CZ    1 
ATOM   6145  N  NH1   . ARG C  3  189 ? -1.768   -32.304  362.000 1.00 41.19  ? 189 ARG 3 NH1   1 
ATOM   6146  N  NH2   . ARG C  3  189 ? -3.086   -32.344  360.114 1.00 43.82  ? 189 ARG 3 NH2   1 
ATOM   6147  N  N     . TYR C  3  190 ? -0.464   -38.836  360.556 1.00 20.57  ? 190 TYR 3 N     1 
ATOM   6148  C  CA    . TYR C  3  190 ? -0.691   -39.975  359.668 1.00 17.35  ? 190 TYR 3 CA    1 
ATOM   6149  C  C     . TYR C  3  190 ? -0.310   -41.279  360.366 1.00 12.93  ? 190 TYR 3 C     1 
ATOM   6150  O  O     . TYR C  3  190 ? -1.143   -42.171  360.560 1.00 12.80  ? 190 TYR 3 O     1 
ATOM   6151  C  CB    . TYR C  3  190 ? 0.113    -39.774  358.370 1.00 19.75  ? 190 TYR 3 CB    1 
ATOM   6152  C  CG    . TYR C  3  190 ? 0.318    -41.031  357.515 1.00 20.53  ? 190 TYR 3 CG    1 
ATOM   6153  C  CD1   . TYR C  3  190 ? -0.652   -41.462  356.628 1.00 12.83  ? 190 TYR 3 CD1   1 
ATOM   6154  C  CD2   . TYR C  3  190 ? 1.488    -41.768  357.591 1.00 26.33  ? 190 TYR 3 CD2   1 
ATOM   6155  C  CE1   . TYR C  3  190 ? -0.458   -42.573  355.864 1.00 12.27  ? 190 TYR 3 CE1   1 
ATOM   6156  C  CE2   . TYR C  3  190 ? 1.674    -42.885  356.823 1.00 12.43  ? 190 TYR 3 CE2   1 
ATOM   6157  C  CZ    . TYR C  3  190 ? 0.700    -43.282  355.968 1.00 12.24  ? 190 TYR 3 CZ    1 
ATOM   6158  O  OH    . TYR C  3  190 ? 0.865    -44.408  355.198 1.00 18.91  ? 190 TYR 3 OH    1 
ATOM   6159  N  N     . PHE C  3  191 ? 0.947    -41.367  360.806 1.00 20.93  ? 191 PHE 3 N     1 
ATOM   6160  C  CA    . PHE C  3  191 ? 1.473    -42.585  361.412 1.00 24.29  ? 191 PHE 3 CA    1 
ATOM   6161  C  C     . PHE C  3  191 ? 0.626    -43.039  362.603 1.00 24.09  ? 191 PHE 3 C     1 
ATOM   6162  O  O     . PHE C  3  191 ? 0.439    -44.244  362.825 1.00 21.02  ? 191 PHE 3 O     1 
ATOM   6163  C  CB    . PHE C  3  191 ? 2.921    -42.345  361.836 1.00 13.10  ? 191 PHE 3 CB    1 
ATOM   6164  C  CG    . PHE C  3  191 ? 3.908    -42.772  360.806 1.00 12.98  ? 191 PHE 3 CG    1 
ATOM   6165  C  CD1   . PHE C  3  191 ? 3.901    -44.055  360.332 1.00 12.75  ? 191 PHE 3 CD1   1 
ATOM   6166  C  CD2   . PHE C  3  191 ? 4.821    -41.889  360.286 1.00 13.20  ? 191 PHE 3 CD2   1 
ATOM   6167  C  CE1   . PHE C  3  191 ? 4.791    -44.453  359.383 1.00 12.64  ? 191 PHE 3 CE1   1 
ATOM   6168  C  CE2   . PHE C  3  191 ? 5.718    -42.305  359.328 1.00 12.97  ? 191 PHE 3 CE2   1 
ATOM   6169  C  CZ    . PHE C  3  191 ? 5.692    -43.586  358.885 1.00 12.74  ? 191 PHE 3 CZ    1 
ATOM   6170  N  N     . GLU C  3  192 ? 0.106    -42.093  363.382 1.00 23.16  ? 192 GLU 3 N     1 
ATOM   6171  C  CA    . GLU C  3  192 ? -0.748   -42.462  364.505 1.00 29.12  ? 192 GLU 3 CA    1 
ATOM   6172  C  C     . GLU C  3  192 ? -2.129   -42.896  364.046 1.00 21.06  ? 192 GLU 3 C     1 
ATOM   6173  O  O     . GLU C  3  192 ? -2.716   -43.808  364.636 1.00 12.95  ? 192 GLU 3 O     1 
ATOM   6174  C  CB    . GLU C  3  192 ? -0.870   -41.297  365.489 1.00 40.47  ? 192 GLU 3 CB    1 
ATOM   6175  C  CG    . GLU C  3  192 ? -1.644   -41.637  366.770 1.00 47.21  ? 192 GLU 3 CG    1 
ATOM   6176  C  CD    . GLU C  3  192 ? -3.155   -41.383  366.645 1.00 47.05  ? 192 GLU 3 CD    1 
ATOM   6177  O  OE1   . GLU C  3  192 ? -3.562   -40.470  365.895 1.00 47.95  ? 192 GLU 3 OE1   1 
ATOM   6178  O  OE2   . GLU C  3  192 ? -3.938   -42.113  367.291 1.00 44.31  ? 192 GLU 3 OE2   1 
ATOM   6179  N  N     . GLU C  3  193 ? -2.683   -42.226  363.028 1.00 23.45  ? 193 GLU 3 N     1 
ATOM   6180  C  CA    . GLU C  3  193 ? -4.066   -42.452  362.604 1.00 16.48  ? 193 GLU 3 CA    1 
ATOM   6181  C  C     . GLU C  3  193 ? -4.197   -43.544  361.555 1.00 20.97  ? 193 GLU 3 C     1 
ATOM   6182  O  O     . GLU C  3  193 ? -4.908   -44.525  361.772 1.00 23.94  ? 193 GLU 3 O     1 
ATOM   6183  C  CB    . GLU C  3  193 ? -4.701   -41.180  362.040 1.00 21.13  ? 193 GLU 3 CB    1 
ATOM   6184  C  CG    . GLU C  3  193 ? -5.297   -40.272  363.085 1.00 23.90  ? 193 GLU 3 CG    1 
ATOM   6185  C  CD    . GLU C  3  193 ? -5.483   -38.855  362.619 1.00 13.28  ? 193 GLU 3 CD    1 
ATOM   6186  O  OE1   . GLU C  3  193 ? -5.891   -38.585  361.464 1.00 13.18  ? 193 GLU 3 OE1   1 
ATOM   6187  O  OE2   . GLU C  3  193 ? -5.163   -37.998  363.443 1.00 13.51  ? 193 GLU 3 OE2   1 
ATOM   6188  N  N     . VAL C  3  194 ? -3.542   -43.377  360.409 1.00 13.34  ? 194 VAL 3 N     1 
ATOM   6189  C  CA    . VAL C  3  194 ? -3.806   -44.240  359.254 1.00 12.71  ? 194 VAL 3 CA    1 
ATOM   6190  C  C     . VAL C  3  194 ? -3.239   -45.653  359.435 1.00 9.54   ? 194 VAL 3 C     1 
ATOM   6191  O  O     . VAL C  3  194 ? -4.027   -46.611  359.461 1.00 11.29  ? 194 VAL 3 O     1 
ATOM   6192  C  CB    . VAL C  3  194 ? -3.293   -43.599  357.953 1.00 14.52  ? 194 VAL 3 CB    1 
ATOM   6193  C  CG1   . VAL C  3  194 ? -3.404   -44.598  356.799 1.00 15.14  ? 194 VAL 3 CG1   1 
ATOM   6194  C  CG2   . VAL C  3  194 ? -4.035   -42.310  357.667 1.00 9.57   ? 194 VAL 3 CG2   1 
ATOM   6195  N  N     . PRO C  3  195 ? -1.897   -45.865  359.575 1.00 9.66   ? 195 PRO 3 N     1 
ATOM   6196  C  CA    . PRO C  3  195 ? -1.403   -47.245  359.672 1.00 9.62   ? 195 PRO 3 CA    1 
ATOM   6197  C  C     . PRO C  3  195 ? -1.491   -47.831  361.070 1.00 16.59  ? 195 PRO 3 C     1 
ATOM   6198  O  O     . PRO C  3  195 ? -1.543   -49.052  361.245 1.00 18.52  ? 195 PRO 3 O     1 
ATOM   6199  C  CB    . PRO C  3  195 ? 0.055    -47.117  359.228 1.00 15.72  ? 195 PRO 3 CB    1 
ATOM   6200  C  CG    . PRO C  3  195 ? 0.442    -45.794  359.717 1.00 16.19  ? 195 PRO 3 CG    1 
ATOM   6201  C  CD    . PRO C  3  195 ? -0.765   -44.918  359.571 1.00 9.84   ? 195 PRO 3 CD    1 
ATOM   6202  N  N     . GLY C  3  196 ? -1.489   -46.969  362.074 1.00 11.70  ? 196 GLY 3 N     1 
ATOM   6203  C  CA    . GLY C  3  196 ? -1.426   -47.433  363.439 1.00 11.18  ? 196 GLY 3 CA    1 
ATOM   6204  C  C     . GLY C  3  196 ? -0.025   -47.777  363.868 1.00 20.09  ? 196 GLY 3 C     1 
ATOM   6205  O  O     . GLY C  3  196 ? 0.159    -48.560  364.804 1.00 28.45  ? 196 GLY 3 O     1 
ATOM   6206  N  N     . ASP C  3  197 ? 0.974    -47.181  363.229 1.00 12.16  ? 197 ASP 3 N     1 
ATOM   6207  C  CA    . ASP C  3  197 ? 2.384    -47.412  363.526 1.00 16.11  ? 197 ASP 3 CA    1 
ATOM   6208  C  C     . ASP C  3  197 ? 2.979    -46.051  363.850 1.00 18.72  ? 197 ASP 3 C     1 
ATOM   6209  O  O     . ASP C  3  197 ? 3.235    -45.249  362.951 1.00 18.99  ? 197 ASP 3 O     1 
ATOM   6210  C  CB    . ASP C  3  197 ? 3.104    -48.090  362.362 1.00 22.09  ? 197 ASP 3 CB    1 
ATOM   6211  C  CG    . ASP C  3  197 ? 2.749    -49.575  362.223 1.00 26.09  ? 197 ASP 3 CG    1 
ATOM   6212  O  OD1   . ASP C  3  197 ? 2.742    -50.309  363.242 1.00 26.17  ? 197 ASP 3 OD1   1 
ATOM   6213  O  OD2   . ASP C  3  197 ? 2.444    -50.005  361.088 1.00 28.67  ? 197 ASP 3 OD2   1 
ATOM   6214  N  N     . GLU C  3  198 ? 3.165    -45.782  365.138 1.00 21.26  ? 198 GLU 3 N     1 
ATOM   6215  C  CA    . GLU C  3  198 ? 3.683    -44.501  365.621 1.00 21.61  ? 198 GLU 3 CA    1 
ATOM   6216  C  C     . GLU C  3  198 ? 5.206    -44.576  365.604 1.00 18.07  ? 198 GLU 3 C     1 
ATOM   6217  O  O     . GLU C  3  198 ? 5.855    -44.849  366.614 1.00 17.07  ? 198 GLU 3 O     1 
ATOM   6218  C  CB    . GLU C  3  198 ? 3.134    -44.224  367.016 1.00 21.07  ? 198 GLU 3 CB    1 
ATOM   6219  C  CG    . GLU C  3  198 ? 1.680    -43.781  366.992 1.00 23.00  ? 198 GLU 3 CG    1 
ATOM   6220  C  CD    . GLU C  3  198 ? 0.876    -44.362  368.139 1.00 23.00  ? 198 GLU 3 CD    1 
ATOM   6221  O  OE1   . GLU C  3  198 ? 0.958    -45.598  368.356 1.00 21.74  ? 198 GLU 3 OE1   1 
ATOM   6222  O  OE2   . GLU C  3  198 ? 0.117    -43.598  368.773 1.00 22.13  ? 198 GLU 3 OE2   1 
ATOM   6223  N  N     . VAL C  3  199 ? 5.779    -44.382  364.413 1.00 10.91  ? 199 VAL 3 N     1 
ATOM   6224  C  CA    . VAL C  3  199 ? 7.229    -44.470  364.234 1.00 11.04  ? 199 VAL 3 CA    1 
ATOM   6225  C  C     . VAL C  3  199 ? 7.830    -43.154  363.751 1.00 13.40  ? 199 VAL 3 C     1 
ATOM   6226  O  O     . VAL C  3  199 ? 8.838    -43.142  363.034 1.00 11.22  ? 199 VAL 3 O     1 
ATOM   6227  C  CB    . VAL C  3  199 ? 7.606    -45.623  363.286 1.00 12.70  ? 199 VAL 3 CB    1 
ATOM   6228  C  CG1   . VAL C  3  199 ? 7.241    -46.950  363.916 1.00 13.00  ? 199 VAL 3 CG1   1 
ATOM   6229  C  CG2   . VAL C  3  199 ? 6.919    -45.429  361.944 1.00 14.36  ? 199 VAL 3 CG2   1 
ATOM   6230  N  N     . LEU C  3  200 ? 7.225    -42.041  364.142 1.00 11.22  ? 200 LEU 3 N     1 
ATOM   6231  C  CA    . LEU C  3  200 ? 7.782    -40.746  363.796 1.00 11.35  ? 200 LEU 3 CA    1 
ATOM   6232  C  C     . LEU C  3  200 ? 7.134    -39.703  364.691 1.00 23.91  ? 200 LEU 3 C     1 
ATOM   6233  O  O     . LEU C  3  200 ? 5.905    -39.652  364.792 1.00 27.26  ? 200 LEU 3 O     1 
ATOM   6234  C  CB    . LEU C  3  200 ? 7.534    -40.426  362.317 1.00 16.65  ? 200 LEU 3 CB    1 
ATOM   6235  C  CG    . LEU C  3  200 ? 8.620    -39.690  361.527 1.00 15.77  ? 200 LEU 3 CG    1 
ATOM   6236  C  CD1   . LEU C  3  200 ? 9.911    -40.474  361.552 1.00 18.40  ? 200 LEU 3 CD1   1 
ATOM   6237  C  CD2   . LEU C  3  200 ? 8.175    -39.438  360.084 1.00 11.21  ? 200 LEU 3 CD2   1 
ATOM   6238  N  N     . ASP C  3  201 ? 7.955    -38.896  365.353 1.00 23.76  ? 201 ASP 3 N     1 
ATOM   6239  C  CA    . ASP C  3  201 ? 7.459    -37.819  366.194 1.00 17.61  ? 201 ASP 3 CA    1 
ATOM   6240  C  C     . ASP C  3  201 ? 8.619    -36.899  366.535 1.00 14.54  ? 201 ASP 3 C     1 
ATOM   6241  O  O     . ASP C  3  201 ? 9.788    -37.265  366.392 1.00 12.42  ? 201 ASP 3 O     1 
ATOM   6242  C  CB    . ASP C  3  201 ? 6.803    -38.355  367.463 1.00 18.21  ? 201 ASP 3 CB    1 
ATOM   6243  C  CG    . ASP C  3  201 ? 5.792    -37.399  368.023 1.00 23.32  ? 201 ASP 3 CG    1 
ATOM   6244  O  OD1   . ASP C  3  201 ? 5.968    -36.186  367.810 1.00 25.39  ? 201 ASP 3 OD1   1 
ATOM   6245  O  OD2   . ASP C  3  201 ? 4.820    -37.845  368.667 1.00 26.40  ? 201 ASP 3 OD2   1 
ATOM   6246  N  N     . PHE C  3  202 ? 8.271    -35.703  367.004 1.00 16.83  ? 202 PHE 3 N     1 
ATOM   6247  C  CA    . PHE C  3  202 ? 9.251    -34.667  367.289 1.00 23.03  ? 202 PHE 3 CA    1 
ATOM   6248  C  C     . PHE C  3  202 ? 10.128   -35.086  368.476 1.00 26.60  ? 202 PHE 3 C     1 
ATOM   6249  O  O     . PHE C  3  202 ? 9.810    -36.015  369.224 1.00 12.94  ? 202 PHE 3 O     1 
ATOM   6250  C  CB    . PHE C  3  202 ? 8.541    -33.333  367.562 1.00 22.92  ? 202 PHE 3 CB    1 
ATOM   6251  C  CG    . PHE C  3  202 ? 7.641    -32.877  366.431 1.00 16.65  ? 202 PHE 3 CG    1 
ATOM   6252  C  CD1   . PHE C  3  202 ? 8.162    -32.378  365.254 1.00 15.35  ? 202 PHE 3 CD1   1 
ATOM   6253  C  CD2   . PHE C  3  202 ? 6.263    -32.953  366.556 1.00 12.65  ? 202 PHE 3 CD2   1 
ATOM   6254  C  CE1   . PHE C  3  202 ? 7.314    -31.964  364.216 1.00 13.21  ? 202 PHE 3 CE1   1 
ATOM   6255  C  CE2   . PHE C  3  202 ? 5.433    -32.542  365.527 1.00 12.49  ? 202 PHE 3 CE2   1 
ATOM   6256  C  CZ    . PHE C  3  202 ? 5.962    -32.051  364.363 1.00 12.54  ? 202 PHE 3 CZ    1 
ATOM   6257  N  N     . ILE C  3  203 ? 11.220   -34.353  368.681 1.00 33.03  ? 203 ILE 3 N     1 
ATOM   6258  C  CA    . ILE C  3  203 ? 12.112   -34.659  369.794 1.00 37.93  ? 203 ILE 3 CA    1 
ATOM   6259  C  C     . ILE C  3  203 ? 12.075   -33.573  370.858 1.00 47.79  ? 203 ILE 3 C     1 
ATOM   6260  O  O     . ILE C  3  203 ? 11.541   -33.792  371.951 1.00 57.67  ? 203 ILE 3 O     1 
ATOM   6261  C  CB    . ILE C  3  203 ? 13.545   -34.862  369.285 1.00 41.69  ? 203 ILE 3 CB    1 
ATOM   6262  C  CG1   . ILE C  3  203 ? 13.581   -36.051  368.334 1.00 44.73  ? 203 ILE 3 CG1   1 
ATOM   6263  C  CG2   . ILE C  3  203 ? 14.511   -35.032  370.434 1.00 45.59  ? 203 ILE 3 CG2   1 
ATOM   6264  C  CD1   . ILE C  3  203 ? 12.966   -37.305  368.924 1.00 46.88  ? 203 ILE 3 CD1   1 
ATOM   6265  N  N     . GLU C  3  204 ? 12.559   -32.380  370.529 1.00 39.74  ? 204 GLU 3 N     1 
ATOM   6266  C  CA    . GLU C  3  204 ? 12.647   -31.301  371.495 1.00 27.66  ? 204 GLU 3 CA    1 
ATOM   6267  C  C     . GLU C  3  204 ? 11.435   -30.400  371.298 1.00 17.76  ? 204 GLU 3 C     1 
ATOM   6268  O  O     . GLU C  3  204 ? 10.491   -30.771  370.595 1.00 18.09  ? 204 GLU 3 O     1 
ATOM   6269  C  CB    . GLU C  3  204 ? 13.976   -30.572  371.317 1.00 29.75  ? 204 GLU 3 CB    1 
ATOM   6270  C  CG    . GLU C  3  204 ? 15.204   -31.403  371.715 1.00 29.82  ? 204 GLU 3 CG    1 
ATOM   6271  C  CD    . GLU C  3  204 ? 16.485   -30.595  371.645 1.00 33.55  ? 204 GLU 3 CD    1 
ATOM   6272  O  OE1   . GLU C  3  204 ? 16.409   -29.371  371.869 1.00 35.12  ? 204 GLU 3 OE1   1 
ATOM   6273  O  OE2   . GLU C  3  204 ? 17.568   -31.173  371.411 1.00 34.75  ? 204 GLU 3 OE2   1 
ATOM   6274  N  N     . ARG C  3  205 ? 11.443   -29.216  371.933 1.00 14.81  ? 205 ARG 3 N     1 
ATOM   6275  C  CA    . ARG C  3  205 ? 10.382   -28.210  371.760 1.00 22.33  ? 205 ARG 3 CA    1 
ATOM   6276  C  C     . ARG C  3  205 ? 10.959   -26.849  371.410 1.00 19.86  ? 205 ARG 3 C     1 
ATOM   6277  O  O     . ARG C  3  205 ? 12.142   -26.748  371.073 1.00 15.31  ? 205 ARG 3 O     1 
ATOM   6278  C  CB    . ARG C  3  205 ? 9.501    -28.092  373.009 1.00 14.84  ? 205 ARG 3 CB    1 
ATOM   6279  C  CG    . ARG C  3  205 ? 10.183   -27.572  374.253 1.00 15.22  ? 205 ARG 3 CG    1 
ATOM   6280  C  CD    . ARG C  3  205 ? 9.141    -27.329  375.335 1.00 15.23  ? 205 ARG 3 CD    1 
ATOM   6281  N  NE    . ARG C  3  205 ? 9.751    -27.245  376.657 1.00 29.81  ? 205 ARG 3 NE    1 
ATOM   6282  C  CZ    . ARG C  3  205 ? 10.457   -26.212  377.099 1.00 24.18  ? 205 ARG 3 CZ    1 
ATOM   6283  N  NH1   . ARG C  3  205 ? 10.628   -25.146  376.328 1.00 20.82  ? 205 ARG 3 NH1   1 
ATOM   6284  N  NH2   . ARG C  3  205 ? 10.987   -26.249  378.315 1.00 16.17  ? 205 ARG 3 NH2   1 
ATOM   6285  N  N     . GLY C  3  206 ? 10.123   -25.809  371.448 1.00 27.31  ? 206 GLY 3 N     1 
ATOM   6286  C  CA    . GLY C  3  206 ? 10.491   -24.464  371.039 1.00 35.29  ? 206 GLY 3 CA    1 
ATOM   6287  C  C     . GLY C  3  206 ? 10.839   -24.444  369.563 1.00 35.99  ? 206 GLY 3 C     1 
ATOM   6288  O  O     . GLY C  3  206 ? 10.363   -25.268  368.763 1.00 39.37  ? 206 GLY 3 O     1 
ATOM   6289  N  N     . VAL C  3  207 ? 11.711   -23.500  369.198 1.00 29.13  ? 207 VAL 3 N     1 
ATOM   6290  C  CA    . VAL C  3  207 ? 12.224   -23.462  367.831 1.00 19.83  ? 207 VAL 3 CA    1 
ATOM   6291  C  C     . VAL C  3  207 ? 13.250   -24.558  367.562 1.00 18.00  ? 207 VAL 3 C     1 
ATOM   6292  O  O     . VAL C  3  207 ? 13.653   -24.759  366.411 1.00 15.40  ? 207 VAL 3 O     1 
ATOM   6293  C  CB    . VAL C  3  207 ? 12.796   -22.059  367.566 1.00 22.64  ? 207 VAL 3 CB    1 
ATOM   6294  C  CG1   . VAL C  3  207 ? 11.669   -21.112  367.225 1.00 15.91  ? 207 VAL 3 CG1   1 
ATOM   6295  C  CG2   . VAL C  3  207 ? 13.612   -21.575  368.775 1.00 16.33  ? 207 VAL 3 CG2   1 
ATOM   6296  N  N     . HIS C  3  208 ? 13.661   -25.299  368.578 1.00 19.34  ? 208 HIS 3 N     1 
ATOM   6297  C  CA    . HIS C  3  208 ? 14.633   -26.361  368.396 1.00 28.67  ? 208 HIS 3 CA    1 
ATOM   6298  C  C     . HIS C  3  208 ? 13.978   -27.676  368.000 1.00 35.47  ? 208 HIS 3 C     1 
ATOM   6299  O  O     . HIS C  3  208 ? 14.674   -28.689  367.860 1.00 40.94  ? 208 HIS 3 O     1 
ATOM   6300  C  CB    . HIS C  3  208 ? 15.451   -26.543  369.675 1.00 27.21  ? 208 HIS 3 CB    1 
ATOM   6301  C  CG    . HIS C  3  208 ? 16.198   -25.308  370.072 1.00 27.64  ? 208 HIS 3 CG    1 
ATOM   6302  N  ND1   . HIS C  3  208 ? 16.975   -24.596  369.179 1.00 26.64  ? 208 HIS 3 ND1   1 
ATOM   6303  C  CD2   . HIS C  3  208 ? 16.267   -24.644  371.251 1.00 25.32  ? 208 HIS 3 CD2   1 
ATOM   6304  C  CE1   . HIS C  3  208 ? 17.501   -23.555  369.796 1.00 25.12  ? 208 HIS 3 CE1   1 
ATOM   6305  N  NE2   . HIS C  3  208 ? 17.086   -23.560  371.052 1.00 20.81  ? 208 HIS 3 NE2   1 
ATOM   6306  N  N     . THR C  3  209 ? 12.658   -27.678  367.826 1.00 34.83  ? 209 THR 3 N     1 
ATOM   6307  C  CA    . THR C  3  209 ? 11.932   -28.907  367.544 1.00 29.21  ? 209 THR 3 CA    1 
ATOM   6308  C  C     . THR C  3  209 ? 12.369   -29.491  366.208 1.00 24.76  ? 209 THR 3 C     1 
ATOM   6309  O  O     . THR C  3  209 ? 12.697   -28.763  365.268 1.00 16.64  ? 209 THR 3 O     1 
ATOM   6310  C  CB    . THR C  3  209 ? 10.434   -28.623  367.508 1.00 37.37  ? 209 THR 3 CB    1 
ATOM   6311  O  OG1   . THR C  3  209 ? 10.080   -27.800  368.628 1.00 40.16  ? 209 THR 3 OG1   1 
ATOM   6312  C  CG2   . THR C  3  209 ? 9.651    -29.933  367.573 1.00 37.89  ? 209 THR 3 CG2   1 
ATOM   6313  N  N     . PHE C  3  210 ? 12.398   -30.817  366.137 1.00 30.10  ? 210 PHE 3 N     1 
ATOM   6314  C  CA    . PHE C  3  210 ? 12.736   -31.496  364.892 1.00 37.22  ? 210 PHE 3 CA    1 
ATOM   6315  C  C     . PHE C  3  210 ? 12.157   -32.907  364.887 1.00 25.83  ? 210 PHE 3 C     1 
ATOM   6316  O  O     . PHE C  3  210 ? 11.983   -33.531  365.936 1.00 20.52  ? 210 PHE 3 O     1 
ATOM   6317  C  CB    . PHE C  3  210 ? 14.262   -31.537  364.684 1.00 41.12  ? 210 PHE 3 CB    1 
ATOM   6318  C  CG    . PHE C  3  210 ? 15.013   -32.322  365.742 1.00 44.54  ? 210 PHE 3 CG    1 
ATOM   6319  C  CD1   . PHE C  3  210 ? 15.262   -33.679  365.594 1.00 43.76  ? 210 PHE 3 CD1   1 
ATOM   6320  C  CD2   . PHE C  3  210 ? 15.476   -31.692  366.885 1.00 43.79  ? 210 PHE 3 CD2   1 
ATOM   6321  C  CE1   . PHE C  3  210 ? 15.965   -34.381  366.567 1.00 44.66  ? 210 PHE 3 CE1   1 
ATOM   6322  C  CE2   . PHE C  3  210 ? 16.173   -32.399  367.858 1.00 43.25  ? 210 PHE 3 CE2   1 
ATOM   6323  C  CZ    . PHE C  3  210 ? 16.416   -33.735  367.697 1.00 43.46  ? 210 PHE 3 CZ    1 
ATOM   6324  N  N     . ILE C  3  211 ? 11.927   -33.422  363.700 1.00 13.18  ? 211 ILE 3 N     1 
ATOM   6325  C  CA    . ILE C  3  211 ? 11.410   -34.775  363.576 1.00 23.91  ? 211 ILE 3 CA    1 
ATOM   6326  C  C     . ILE C  3  211 ? 12.561   -35.740  363.832 1.00 26.27  ? 211 ILE 3 C     1 
ATOM   6327  O  O     . ILE C  3  211 ? 13.722   -35.447  363.523 1.00 20.68  ? 211 ILE 3 O     1 
ATOM   6328  C  CB    . ILE C  3  211 ? 10.757   -34.998  362.191 1.00 18.72  ? 211 ILE 3 CB    1 
ATOM   6329  C  CG1   . ILE C  3  211 ? 9.327    -34.468  362.181 1.00 13.50  ? 211 ILE 3 CG1   1 
ATOM   6330  C  CG2   . ILE C  3  211 ? 10.708   -36.469  361.793 1.00 13.77  ? 211 ILE 3 CG2   1 
ATOM   6331  C  CD1   . ILE C  3  211 ? 8.366    -35.361  362.919 1.00 12.19  ? 211 ILE 3 CD1   1 
ATOM   6332  N  N     . GLY C  3  212 ? 12.261   -36.845  364.512 1.00 22.93  ? 212 GLY 3 N     1 
ATOM   6333  C  CA    . GLY C  3  212 ? 13.237   -37.894  364.734 1.00 12.70  ? 212 GLY 3 CA    1 
ATOM   6334  C  C     . GLY C  3  212 ? 12.512   -39.168  365.084 1.00 12.40  ? 212 GLY 3 C     1 
ATOM   6335  O  O     . GLY C  3  212 ? 11.292   -39.189  365.241 1.00 12.21  ? 212 GLY 3 O     1 
ATOM   6336  N  N     . THR C  3  213 ? 13.288   -40.238  365.209 1.00 15.74  ? 213 THR 3 N     1 
ATOM   6337  C  CA    . THR C  3  213 ? 12.744   -41.524  365.615 1.00 14.26  ? 213 THR 3 CA    1 
ATOM   6338  C  C     . THR C  3  213 ? 13.813   -42.331  366.337 1.00 21.41  ? 213 THR 3 C     1 
ATOM   6339  O  O     . THR C  3  213 ? 15.015   -42.180  366.086 1.00 12.39  ? 213 THR 3 O     1 
ATOM   6340  C  CB    . THR C  3  213 ? 12.216   -42.346  364.430 1.00 17.70  ? 213 THR 3 CB    1 
ATOM   6341  O  OG1   . THR C  3  213 ? 11.809   -43.638  364.901 1.00 11.66  ? 213 THR 3 OG1   1 
ATOM   6342  C  CG2   . THR C  3  213 ? 13.291   -42.493  363.362 1.00 20.52  ? 213 THR 3 CG2   1 
ATOM   6343  N  N     . MET C  3  214 ? 13.348   -43.186  367.247 1.00 24.13  ? 214 MET 3 N     1 
ATOM   6344  C  CA    . MET C  3  214 ? 14.147   -44.290  367.743 1.00 23.16  ? 214 MET 3 CA    1 
ATOM   6345  C  C     . MET C  3  214 ? 13.766   -45.586  367.050 1.00 21.55  ? 214 MET 3 C     1 
ATOM   6346  O  O     . MET C  3  214 ? 14.416   -46.618  367.271 1.00 22.76  ? 214 MET 3 O     1 
ATOM   6347  C  CB    . MET C  3  214 ? 13.999   -44.442  369.261 1.00 25.29  ? 214 MET 3 CB    1 
ATOM   6348  C  CG    . MET C  3  214 ? 15.025   -43.653  370.044 1.00 29.33  ? 214 MET 3 CG    1 
ATOM   6349  S  SD    . MET C  3  214 ? 15.063   -44.185  371.776 1.00 37.19  ? 214 MET 3 SD    1 
ATOM   6350  C  CE    . MET C  3  214 ? 15.332   -42.625  372.605 1.00 39.49  ? 214 MET 3 CE    1 
ATOM   6351  N  N     . ASP C  3  215 ? 12.725   -45.543  366.225 1.00 11.73  ? 215 ASP 3 N     1 
ATOM   6352  C  CA    . ASP C  3  215 ? 12.401   -46.606  365.281 1.00 20.50  ? 215 ASP 3 CA    1 
ATOM   6353  C  C     . ASP C  3  215 ? 12.924   -46.133  363.923 1.00 19.02  ? 215 ASP 3 C     1 
ATOM   6354  O  O     . ASP C  3  215 ? 12.354   -45.229  363.311 1.00 11.47  ? 215 ASP 3 O     1 
ATOM   6355  C  CB    . ASP C  3  215 ? 10.896   -46.871  365.267 1.00 20.77  ? 215 ASP 3 CB    1 
ATOM   6356  C  CG    . ASP C  3  215 ? 10.323   -47.133  366.669 1.00 20.50  ? 215 ASP 3 CG    1 
ATOM   6357  O  OD1   . ASP C  3  215 ? 10.383   -48.293  367.137 1.00 19.25  ? 215 ASP 3 OD1   1 
ATOM   6358  O  OD2   . ASP C  3  215 ? 9.786    -46.182  367.288 1.00 17.76  ? 215 ASP 3 OD2   1 
ATOM   6359  N  N     . PHE C  3  216 ? 14.038   -46.718  363.475 1.00 21.35  ? 216 PHE 3 N     1 
ATOM   6360  C  CA    . PHE C  3  216 ? 14.810   -46.228  362.333 1.00 18.66  ? 216 PHE 3 CA    1 
ATOM   6361  C  C     . PHE C  3  216 ? 14.392   -46.886  361.018 1.00 22.85  ? 216 PHE 3 C     1 
ATOM   6362  O  O     . PHE C  3  216 ? 14.260   -46.213  359.996 1.00 19.66  ? 216 PHE 3 O     1 
ATOM   6363  C  CB    . PHE C  3  216 ? 16.306   -46.436  362.598 1.00 19.33  ? 216 PHE 3 CB    1 
ATOM   6364  C  CG    . PHE C  3  216 ? 16.754   -45.897  363.929 1.00 13.58  ? 216 PHE 3 CG    1 
ATOM   6365  C  CD1   . PHE C  3  216 ? 17.023   -44.549  364.099 1.00 14.73  ? 216 PHE 3 CD1   1 
ATOM   6366  C  CD2   . PHE C  3  216 ? 16.874   -46.737  365.021 1.00 12.34  ? 216 PHE 3 CD2   1 
ATOM   6367  C  CE1   . PHE C  3  216 ? 17.414   -44.061  365.328 1.00 12.41  ? 216 PHE 3 CE1   1 
ATOM   6368  C  CE2   . PHE C  3  216 ? 17.265   -46.247  366.247 1.00 14.64  ? 216 PHE 3 CE2   1 
ATOM   6369  C  CZ    . PHE C  3  216 ? 17.533   -44.914  366.398 1.00 12.39  ? 216 PHE 3 CZ    1 
ATOM   6370  N  N     . GLY C  3  217 ? 14.213   -48.207  361.017 1.00 23.05  ? 217 GLY 3 N     1 
ATOM   6371  C  CA    . GLY C  3  217 ? 13.843   -48.886  359.787 1.00 28.80  ? 217 GLY 3 CA    1 
ATOM   6372  C  C     . GLY C  3  217 ? 12.542   -48.407  359.165 1.00 30.83  ? 217 GLY 3 C     1 
ATOM   6373  O  O     . GLY C  3  217 ? 12.234   -48.802  358.032 1.00 30.27  ? 217 GLY 3 O     1 
ATOM   6374  N  N     . LEU C  3  218 ? 11.796   -47.538  359.862 1.00 26.72  ? 218 LEU 3 N     1 
ATOM   6375  C  CA    . LEU C  3  218 ? 10.445   -47.132  359.487 1.00 22.94  ? 218 LEU 3 CA    1 
ATOM   6376  C  C     . LEU C  3  218 ? 9.634    -48.407  359.276 1.00 21.19  ? 218 LEU 3 C     1 
ATOM   6377  O  O     . LEU C  3  218 ? 9.343    -48.800  358.137 1.00 17.68  ? 218 LEU 3 O     1 
ATOM   6378  C  CB    . LEU C  3  218 ? 10.461   -46.224  358.251 1.00 18.34  ? 218 LEU 3 CB    1 
ATOM   6379  C  CG    . LEU C  3  218 ? 10.565   -44.700  358.468 1.00 15.54  ? 218 LEU 3 CG    1 
ATOM   6380  C  CD1   . LEU C  3  218 ? 9.207    -44.141  358.843 1.00 19.05  ? 218 LEU 3 CD1   1 
ATOM   6381  C  CD2   . LEU C  3  218 ? 11.612   -44.275  359.499 1.00 11.70  ? 218 LEU 3 CD2   1 
ATOM   6382  N  N     . PRO C  3  219 ? 9.276    -49.084  360.370 1.00 23.62  ? 219 PRO 3 N     1 
ATOM   6383  C  CA    . PRO C  3  219 ? 8.696    -50.438  360.251 1.00 24.36  ? 219 PRO 3 CA    1 
ATOM   6384  C  C     . PRO C  3  219 ? 7.377    -50.510  359.490 1.00 21.61  ? 219 PRO 3 C     1 
ATOM   6385  O  O     . PRO C  3  219 ? 7.128    -51.501  358.786 1.00 18.50  ? 219 PRO 3 O     1 
ATOM   6386  C  CB    . PRO C  3  219 ? 8.526    -50.859  361.723 1.00 26.57  ? 219 PRO 3 CB    1 
ATOM   6387  C  CG    . PRO C  3  219 ? 9.537    -49.987  362.481 1.00 26.12  ? 219 PRO 3 CG    1 
ATOM   6388  C  CD    . PRO C  3  219 ? 9.472    -48.679  361.775 1.00 20.21  ? 219 PRO 3 CD    1 
ATOM   6389  N  N     . SER C  3  220 ? 6.520    -49.496  359.613 1.00 21.15  ? 220 SER 3 N     1 
ATOM   6390  C  CA    . SER C  3  220 ? 5.244    -49.510  358.907 1.00 16.08  ? 220 SER 3 CA    1 
ATOM   6391  C  C     . SER C  3  220 ? 5.463    -49.746  357.412 1.00 9.94   ? 220 SER 3 C     1 
ATOM   6392  O  O     . SER C  3  220 ? 6.426    -49.262  356.814 1.00 12.44  ? 220 SER 3 O     1 
ATOM   6393  C  CB    . SER C  3  220 ? 4.458    -48.209  359.162 1.00 12.10  ? 220 SER 3 CB    1 
ATOM   6394  O  OG    . SER C  3  220 ? 4.712    -47.204  358.198 1.00 25.24  ? 220 SER 3 OG    1 
ATOM   6395  N  N     . GLY C  3  221 ? 4.642    -50.603  356.845 1.00 9.76   ? 221 GLY 3 N     1 
ATOM   6396  C  CA    . GLY C  3  221 ? 4.719    -50.807  355.420 1.00 21.23  ? 221 GLY 3 CA    1 
ATOM   6397  C  C     . GLY C  3  221 ? 3.994    -49.772  354.600 1.00 18.91  ? 221 GLY 3 C     1 
ATOM   6398  O  O     . GLY C  3  221 ? 3.976    -49.862  353.370 1.00 17.22  ? 221 GLY 3 O     1 
ATOM   6399  N  N     . PHE C  3  222 ? 3.372    -48.789  355.240 1.00 9.63   ? 222 PHE 3 N     1 
ATOM   6400  C  CA    . PHE C  3  222 ? 2.710    -47.719  354.519 1.00 10.21  ? 222 PHE 3 CA    1 
ATOM   6401  C  C     . PHE C  3  222 ? 3.453    -46.415  354.739 1.00 18.23  ? 222 PHE 3 C     1 
ATOM   6402  O  O     . PHE C  3  222 ? 2.848    -45.345  354.747 1.00 29.61  ? 222 PHE 3 O     1 
ATOM   6403  C  CB    . PHE C  3  222 ? 1.253    -47.610  354.955 1.00 9.49   ? 222 PHE 3 CB    1 
ATOM   6404  C  CG    . PHE C  3  222 ? 0.485    -48.913  354.808 1.00 14.60  ? 222 PHE 3 CG    1 
ATOM   6405  C  CD1   . PHE C  3  222 ? -0.104   -49.268  353.601 1.00 18.07  ? 222 PHE 3 CD1   1 
ATOM   6406  C  CD2   . PHE C  3  222 ? 0.360    -49.789  355.874 1.00 13.31  ? 222 PHE 3 CD2   1 
ATOM   6407  C  CE1   . PHE C  3  222 ? -0.795   -50.449  353.472 1.00 8.99   ? 222 PHE 3 CE1   1 
ATOM   6408  C  CE2   . PHE C  3  222 ? -0.334   -50.975  355.734 1.00 9.17   ? 222 PHE 3 CE2   1 
ATOM   6409  C  CZ    . PHE C  3  222 ? -0.907   -51.298  354.540 1.00 9.01   ? 222 PHE 3 CZ    1 
ATOM   6410  N  N     . SER C  3  223 ? 4.776    -46.501  354.923 1.00 16.00  ? 223 SER 3 N     1 
ATOM   6411  C  CA    . SER C  3  223 ? 5.567    -45.336  355.302 1.00 12.33  ? 223 SER 3 CA    1 
ATOM   6412  C  C     . SER C  3  223 ? 5.703    -44.329  354.174 1.00 14.97  ? 223 SER 3 C     1 
ATOM   6413  O  O     . SER C  3  223 ? 5.950    -43.154  354.447 1.00 12.83  ? 223 SER 3 O     1 
ATOM   6414  C  CB    . SER C  3  223 ? 6.975    -45.744  355.716 1.00 11.41  ? 223 SER 3 CB    1 
ATOM   6415  O  OG    . SER C  3  223 ? 7.688    -46.155  354.565 1.00 10.20  ? 223 SER 3 OG    1 
ATOM   6416  N  N     . GLY C  3  224 ? 5.516    -44.755  352.922 1.00 20.05  ? 224 GLY 3 N     1 
ATOM   6417  C  CA    . GLY C  3  224 ? 5.839    -43.925  351.771 1.00 18.97  ? 224 GLY 3 CA    1 
ATOM   6418  C  C     . GLY C  3  224 ? 4.874    -42.789  351.524 1.00 9.91   ? 224 GLY 3 C     1 
ATOM   6419  O  O     . GLY C  3  224 ? 5.187    -41.893  350.743 1.00 11.94  ? 224 GLY 3 O     1 
ATOM   6420  N  N     . ASN C  3  225 ? 3.691    -42.827  352.134 1.00 11.81  ? 225 ASN 3 N     1 
ATOM   6421  C  CA    . ASN C  3  225 ? 2.667    -41.835  351.820 1.00 9.79   ? 225 ASN 3 CA    1 
ATOM   6422  C  C     . ASN C  3  225 ? 3.012    -40.456  352.369 1.00 22.83  ? 225 ASN 3 C     1 
ATOM   6423  O  O     . ASN C  3  225 ? 2.683    -39.446  351.733 1.00 17.07  ? 225 ASN 3 O     1 
ATOM   6424  C  CB    . ASN C  3  225 ? 1.314    -42.326  352.304 1.00 11.59  ? 225 ASN 3 CB    1 
ATOM   6425  C  CG    . ASN C  3  225 ? 0.760    -43.390  351.395 1.00 11.35  ? 225 ASN 3 CG    1 
ATOM   6426  O  OD1   . ASN C  3  225 ? 1.100    -43.421  350.215 1.00 9.40   ? 225 ASN 3 OD1   1 
ATOM   6427  N  ND2   . ASN C  3  225 ? -0.002   -44.329  351.946 1.00 9.36   ? 225 ASN 3 ND2   1 
ATOM   6428  N  N     . ILE C  3  226 ? 3.705    -40.384  353.510 1.00 25.88  ? 226 ILE 3 N     1 
ATOM   6429  C  CA    . ILE C  3  226 ? 4.189    -39.087  353.988 1.00 31.02  ? 226 ILE 3 CA    1 
ATOM   6430  C  C     . ILE C  3  226 ? 5.069    -38.452  352.930 1.00 10.36  ? 226 ILE 3 C     1 
ATOM   6431  O  O     . ILE C  3  226 ? 5.154    -37.225  352.850 1.00 14.27  ? 226 ILE 3 O     1 
ATOM   6432  C  CB    . ILE C  3  226 ? 4.956    -39.217  355.327 1.00 30.67  ? 226 ILE 3 CB    1 
ATOM   6433  C  CG1   . ILE C  3  226 ? 6.059    -40.279  355.167 1.00 29.74  ? 226 ILE 3 CG1   1 
ATOM   6434  C  CG2   . ILE C  3  226 ? 3.980    -39.406  356.516 1.00 10.47  ? 226 ILE 3 CG2   1 
ATOM   6435  C  CD1   . ILE C  3  226 ? 6.772    -40.773  356.420 1.00 26.23  ? 226 ILE 3 CD1   1 
ATOM   6436  N  N     . THR C  3  227 ? 5.737    -39.269  352.101 1.00 12.37  ? 227 THR 3 N     1 
ATOM   6437  C  CA    . THR C  3  227 ? 6.548    -38.710  351.026 1.00 20.64  ? 227 THR 3 CA    1 
ATOM   6438  C  C     . THR C  3  227 ? 5.738    -37.733  350.196 1.00 22.64  ? 227 THR 3 C     1 
ATOM   6439  O  O     . THR C  3  227 ? 6.245    -36.683  349.781 1.00 36.39  ? 227 THR 3 O     1 
ATOM   6440  C  CB    . THR C  3  227 ? 7.146    -39.826  350.169 1.00 10.26  ? 227 THR 3 CB    1 
ATOM   6441  O  OG1   . THR C  3  227 ? 8.232    -40.443  350.880 1.00 10.38  ? 227 THR 3 OG1   1 
ATOM   6442  C  CG2   . THR C  3  227 ? 7.611    -39.340  348.803 1.00 10.28  ? 227 THR 3 CG2   1 
ATOM   6443  N  N     . ASP C  3  228 ? 4.456    -38.019  350.003 1.00 22.05  ? 228 ASP 3 N     1 
ATOM   6444  C  CA    . ASP C  3  228 ? 3.631    -37.082  349.246 1.00 26.86  ? 228 ASP 3 CA    1 
ATOM   6445  C  C     . ASP C  3  228 ? 3.083    -35.939  350.107 1.00 22.00  ? 228 ASP 3 C     1 
ATOM   6446  O  O     . ASP C  3  228 ? 2.928    -34.815  349.610 1.00 21.73  ? 228 ASP 3 O     1 
ATOM   6447  C  CB    . ASP C  3  228 ? 2.497    -37.830  348.555 1.00 23.15  ? 228 ASP 3 CB    1 
ATOM   6448  C  CG    . ASP C  3  228 ? 3.005    -38.923  347.647 1.00 13.04  ? 228 ASP 3 CG    1 
ATOM   6449  O  OD1   . ASP C  3  228 ? 4.206    -38.917  347.289 1.00 9.80   ? 228 ASP 3 OD1   1 
ATOM   6450  O  OD2   . ASP C  3  228 ? 2.183    -39.759  347.244 1.00 9.54   ? 228 ASP 3 OD2   1 
ATOM   6451  N  N     . ILE C  3  229 ? 2.844    -36.188  351.399 1.00 23.29  ? 229 ILE 3 N     1 
ATOM   6452  C  CA    . ILE C  3  229 ? 2.070    -35.259  352.224 1.00 24.21  ? 229 ILE 3 CA    1 
ATOM   6453  C  C     . ILE C  3  229 ? 2.895    -34.039  352.640 1.00 22.35  ? 229 ILE 3 C     1 
ATOM   6454  O  O     . ILE C  3  229 ? 2.348    -32.939  352.770 1.00 10.79  ? 229 ILE 3 O     1 
ATOM   6455  C  CB    . ILE C  3  229 ? 1.498    -35.982  353.456 1.00 25.68  ? 229 ILE 3 CB    1 
ATOM   6456  C  CG1   . ILE C  3  229 ? 0.866    -37.316  353.094 1.00 17.27  ? 229 ILE 3 CG1   1 
ATOM   6457  C  CG2   . ILE C  3  229 ? 0.452    -35.134  354.125 1.00 30.71  ? 229 ILE 3 CG2   1 
ATOM   6458  C  CD1   . ILE C  3  229 ? 0.336    -38.005  354.301 1.00 10.04  ? 229 ILE 3 CD1   1 
ATOM   6459  N  N     . CYS C  3  230 ? 4.178    -34.241  352.982 1.00 10.87  ? 230 CYS 3 N     1 
ATOM   6460  C  CA    . CYS C  3  230 ? 5.092    -33.217  353.487 1.00 16.02  ? 230 CYS 3 CA    1 
ATOM   6461  C  C     . CYS C  3  230 ? 5.028    -32.009  352.549 1.00 22.38  ? 230 CYS 3 C     1 
ATOM   6462  O  O     . CYS C  3  230 ? 5.489    -32.086  351.401 1.00 26.40  ? 230 CYS 3 O     1 
ATOM   6463  C  CB    . CYS C  3  230 ? 6.507    -33.812  353.597 1.00 16.23  ? 230 CYS 3 CB    1 
ATOM   6464  S  SG    . CYS C  3  230 ? 7.770    -32.946  354.599 1.00 11.76  ? 230 CYS 3 SG    1 
ATOM   6465  N  N     . PRO C  3  231 ? 4.448    -30.882  352.976 1.00 19.04  ? 231 PRO 3 N     1 
ATOM   6466  C  CA    . PRO C  3  231 ? 4.356    -29.724  352.075 1.00 25.93  ? 231 PRO 3 CA    1 
ATOM   6467  C  C     . PRO C  3  231 ? 5.708    -29.149  351.704 1.00 30.09  ? 231 PRO 3 C     1 
ATOM   6468  O  O     . PRO C  3  231 ? 5.764    -28.147  350.974 1.00 43.22  ? 231 PRO 3 O     1 
ATOM   6469  C  CB    . PRO C  3  231 ? 3.508    -28.719  352.875 1.00 23.44  ? 231 PRO 3 CB    1 
ATOM   6470  C  CG    . PRO C  3  231 ? 3.607    -29.182  354.290 1.00 23.81  ? 231 PRO 3 CG    1 
ATOM   6471  C  CD    . PRO C  3  231 ? 3.744    -30.652  354.247 1.00 22.41  ? 231 PRO 3 CD    1 
ATOM   6472  N  N     . VAL C  3  232 ? 6.787    -29.741  352.212 1.00 23.11  ? 232 VAL 3 N     1 
ATOM   6473  C  CA    . VAL C  3  232 ? 8.144    -29.298  351.956 1.00 22.55  ? 232 VAL 3 CA    1 
ATOM   6474  C  C     . VAL C  3  232 ? 8.956    -30.503  351.475 1.00 23.90  ? 232 VAL 3 C     1 
ATOM   6475  O  O     . VAL C  3  232 ? 8.432    -31.603  351.323 1.00 21.27  ? 232 VAL 3 O     1 
ATOM   6476  C  CB    . VAL C  3  232 ? 8.771    -28.613  353.198 1.00 21.82  ? 232 VAL 3 CB    1 
ATOM   6477  C  CG1   . VAL C  3  232 ? 8.147    -27.204  353.420 1.00 12.71  ? 232 VAL 3 CG1   1 
ATOM   6478  C  CG2   . VAL C  3  232 ? 8.612    -29.470  354.457 1.00 18.43  ? 232 VAL 3 CG2   1 
ATOM   6479  N  N     . GLY C  3  233 ? 10.234   -30.278  351.178 1.00 24.63  ? 233 GLY 3 N     1 
ATOM   6480  C  CA    . GLY C  3  233 ? 11.064   -31.354  350.675 1.00 12.22  ? 233 GLY 3 CA    1 
ATOM   6481  C  C     . GLY C  3  233 ? 11.749   -32.141  351.773 1.00 12.28  ? 233 GLY 3 C     1 
ATOM   6482  O  O     . GLY C  3  233 ? 12.781   -32.776  351.540 1.00 12.32  ? 233 GLY 3 O     1 
ATOM   6483  N  N     . ALA C  3  234 ? 11.169   -32.145  352.971 1.00 14.64  ? 234 ALA 3 N     1 
ATOM   6484  C  CA    . ALA C  3  234 ? 11.820   -32.834  354.078 1.00 22.43  ? 234 ALA 3 CA    1 
ATOM   6485  C  C     . ALA C  3  234 ? 11.939   -34.323  353.780 1.00 29.63  ? 234 ALA 3 C     1 
ATOM   6486  O  O     . ALA C  3  234 ? 13.041   -34.839  353.563 1.00 33.81  ? 234 ALA 3 O     1 
ATOM   6487  C  CB    . ALA C  3  234 ? 11.037   -32.604  355.373 1.00 23.24  ? 234 ALA 3 CB    1 
ATOM   6488  N  N     . LEU C  3  235 ? 10.802   -35.010  353.683 1.00 27.52  ? 235 LEU 3 N     1 
ATOM   6489  C  CA    . LEU C  3  235 ? 10.762   -36.447  353.443 1.00 19.43  ? 235 LEU 3 CA    1 
ATOM   6490  C  C     . LEU C  3  235 ? 10.620   -36.672  351.943 1.00 11.38  ? 235 LEU 3 C     1 
ATOM   6491  O  O     . LEU C  3  235 ? 9.603    -36.304  351.343 1.00 11.24  ? 235 LEU 3 O     1 
ATOM   6492  C  CB    . LEU C  3  235 ? 9.610    -37.093  354.198 1.00 14.25  ? 235 LEU 3 CB    1 
ATOM   6493  C  CG    . LEU C  3  235 ? 9.699    -37.130  355.717 1.00 11.46  ? 235 LEU 3 CG    1 
ATOM   6494  C  CD1   . LEU C  3  235 ? 8.322    -37.499  356.302 1.00 11.23  ? 235 LEU 3 CD1   1 
ATOM   6495  C  CD2   . LEU C  3  235 ? 10.839   -38.034  356.194 1.00 11.53  ? 235 LEU 3 CD2   1 
ATOM   6496  N  N     . LEU C  3  236 ? 11.650   -37.249  351.337 1.00 11.40  ? 236 LEU 3 N     1 
ATOM   6497  C  CA    . LEU C  3  236 ? 11.710   -37.431  349.892 1.00 12.49  ? 236 LEU 3 CA    1 
ATOM   6498  C  C     . LEU C  3  236 ? 12.043   -38.877  349.554 1.00 18.06  ? 236 LEU 3 C     1 
ATOM   6499  O  O     . LEU C  3  236 ? 12.450   -39.667  350.409 1.00 20.80  ? 236 LEU 3 O     1 
ATOM   6500  C  CB    . LEU C  3  236 ? 12.732   -36.500  349.235 1.00 11.53  ? 236 LEU 3 CB    1 
ATOM   6501  C  CG    . LEU C  3  236 ? 12.390   -35.018  349.352 1.00 11.72  ? 236 LEU 3 CG    1 
ATOM   6502  C  CD1   . LEU C  3  236 ? 13.592   -34.142  349.037 1.00 12.03  ? 236 LEU 3 CD1   1 
ATOM   6503  C  CD2   . LEU C  3  236 ? 11.210   -34.736  348.433 1.00 18.72  ? 236 LEU 3 CD2   1 
ATOM   6504  N  N     . ASP C  3  237 ? 11.844   -39.225  348.292 1.00 21.10  ? 237 ASP 3 N     1 
ATOM   6505  C  CA    . ASP C  3  237 ? 12.032   -40.598  347.851 1.00 26.61  ? 237 ASP 3 CA    1 
ATOM   6506  C  C     . ASP C  3  237 ? 13.492   -40.799  347.466 1.00 30.42  ? 237 ASP 3 C     1 
ATOM   6507  O  O     . ASP C  3  237 ? 14.007   -40.128  346.562 1.00 35.58  ? 237 ASP 3 O     1 
ATOM   6508  C  CB    . ASP C  3  237 ? 11.100   -40.957  346.693 1.00 24.91  ? 237 ASP 3 CB    1 
ATOM   6509  C  CG    . ASP C  3  237 ? 11.247   -42.413  346.262 1.00 25.52  ? 237 ASP 3 CG    1 
ATOM   6510  O  OD1   . ASP C  3  237 ? 11.952   -43.189  346.943 1.00 28.39  ? 237 ASP 3 OD1   1 
ATOM   6511  O  OD2   . ASP C  3  237 ? 10.664   -42.783  345.231 1.00 28.32  ? 237 ASP 3 OD2   1 
ATOM   6512  N  N     . LEU C  3  238 ? 14.169   -41.675  348.205 1.00 25.87  ? 238 LEU 3 N     1 
ATOM   6513  C  CA    . LEU C  3  238 ? 15.555   -42.003  347.896 1.00 24.54  ? 238 LEU 3 CA    1 
ATOM   6514  C  C     . LEU C  3  238 ? 15.679   -42.656  346.525 1.00 26.57  ? 238 LEU 3 C     1 
ATOM   6515  O  O     . LEU C  3  238 ? 16.570   -42.311  345.740 1.00 26.24  ? 238 LEU 3 O     1 
ATOM   6516  C  CB    . LEU C  3  238 ? 16.110   -42.925  348.980 1.00 26.11  ? 238 LEU 3 CB    1 
ATOM   6517  C  CG    . LEU C  3  238 ? 17.623   -43.098  349.038 1.00 24.11  ? 238 LEU 3 CG    1 
ATOM   6518  C  CD1   . LEU C  3  238 ? 18.322   -41.776  348.757 1.00 26.18  ? 238 LEU 3 CD1   1 
ATOM   6519  C  CD2   . LEU C  3  238 ? 18.043   -43.723  350.376 1.00 18.83  ? 238 LEU 3 CD2   1 
ATOM   6520  N  N     . THR C  3  239 ? 14.810   -43.635  346.233 1.00 27.28  ? 239 THR 3 N     1 
ATOM   6521  C  CA    . THR C  3  239 ? 14.918   -44.395  344.988 1.00 26.42  ? 239 THR 3 CA    1 
ATOM   6522  C  C     . THR C  3  239 ? 14.624   -43.527  343.772 1.00 23.03  ? 239 THR 3 C     1 
ATOM   6523  O  O     . THR C  3  239 ? 15.022   -43.874  342.657 1.00 22.58  ? 239 THR 3 O     1 
ATOM   6524  C  CB    . THR C  3  239 ? 13.987   -45.623  345.027 1.00 31.98  ? 239 THR 3 CB    1 
ATOM   6525  O  OG1   . THR C  3  239 ? 14.381   -46.571  344.028 1.00 29.47  ? 239 THR 3 OG1   1 
ATOM   6526  C  CG2   . THR C  3  239 ? 12.560   -45.242  344.742 1.00 35.73  ? 239 THR 3 CG2   1 
ATOM   6527  N  N     . ALA C  3  240 ? 14.004   -42.373  343.974 1.00 20.26  ? 240 ALA 3 N     1 
ATOM   6528  C  CA    . ALA C  3  240 ? 13.807   -41.411  342.897 1.00 23.06  ? 240 ALA 3 CA    1 
ATOM   6529  C  C     . ALA C  3  240 ? 14.491   -40.072  343.183 1.00 14.90  ? 240 ALA 3 C     1 
ATOM   6530  O  O     . ALA C  3  240 ? 14.110   -39.048  342.610 1.00 10.92  ? 240 ALA 3 O     1 
ATOM   6531  C  CB    . ALA C  3  240 ? 12.314   -41.213  342.632 1.00 29.30  ? 240 ALA 3 CB    1 
ATOM   6532  N  N     . ARG C  3  241 ? 15.513   -40.069  344.035 1.00 15.17  ? 241 ARG 3 N     1 
ATOM   6533  C  CA    . ARG C  3  241 ? 16.221   -38.841  344.366 1.00 12.64  ? 241 ARG 3 CA    1 
ATOM   6534  C  C     . ARG C  3  241 ? 17.112   -38.404  343.199 1.00 14.16  ? 241 ARG 3 C     1 
ATOM   6535  O  O     . ARG C  3  241 ? 17.852   -39.211  342.627 1.00 11.48  ? 241 ARG 3 O     1 
ATOM   6536  C  CB    . ARG C  3  241 ? 17.076   -39.068  345.614 1.00 15.07  ? 241 ARG 3 CB    1 
ATOM   6537  C  CG    . ARG C  3  241 ? 18.397   -38.286  345.653 1.00 19.75  ? 241 ARG 3 CG    1 
ATOM   6538  C  CD    . ARG C  3  241 ? 18.946   -38.256  347.071 1.00 18.14  ? 241 ARG 3 CD    1 
ATOM   6539  N  NE    . ARG C  3  241 ? 18.343   -37.167  347.823 1.00 17.97  ? 241 ARG 3 NE    1 
ATOM   6540  C  CZ    . ARG C  3  241 ? 18.983   -36.093  348.284 1.00 24.81  ? 241 ARG 3 CZ    1 
ATOM   6541  N  NH1   . ARG C  3  241 ? 20.292   -35.919  348.092 1.00 27.05  ? 241 ARG 3 NH1   1 
ATOM   6542  N  NH2   . ARG C  3  241 ? 18.302   -35.181  348.968 1.00 29.89  ? 241 ARG 3 NH2   1 
ATOM   6543  N  N     . PHE C  3  242 ? 17.033   -37.114  342.857 1.00 19.94  ? 242 PHE 3 N     1 
ATOM   6544  C  CA    . PHE C  3  242 ? 17.906   -36.455  341.877 1.00 25.47  ? 242 PHE 3 CA    1 
ATOM   6545  C  C     . PHE C  3  242 ? 17.848   -37.142  340.507 1.00 32.23  ? 242 PHE 3 C     1 
ATOM   6546  O  O     . PHE C  3  242 ? 18.838   -37.667  339.984 1.00 30.88  ? 242 PHE 3 O     1 
ATOM   6547  C  CB    . PHE C  3  242 ? 19.346   -36.359  342.386 1.00 25.18  ? 242 PHE 3 CB    1 
ATOM   6548  C  CG    . PHE C  3  242 ? 19.589   -35.223  343.343 1.00 21.56  ? 242 PHE 3 CG    1 
ATOM   6549  C  CD1   . PHE C  3  242 ? 18.539   -34.602  343.982 1.00 19.91  ? 242 PHE 3 CD1   1 
ATOM   6550  C  CD2   . PHE C  3  242 ? 20.879   -34.802  343.630 1.00 15.29  ? 242 PHE 3 CD2   1 
ATOM   6551  C  CE1   . PHE C  3  242 ? 18.769   -33.568  344.887 1.00 18.54  ? 242 PHE 3 CE1   1 
ATOM   6552  C  CE2   . PHE C  3  242 ? 21.094   -33.783  344.526 1.00 12.96  ? 242 PHE 3 CE2   1 
ATOM   6553  C  CZ    . PHE C  3  242 ? 20.036   -33.170  345.152 1.00 14.58  ? 242 PHE 3 CZ    1 
ATOM   6554  N  N     . ARG C  3  243 ? 16.643   -37.185  339.956 1.00 32.48  ? 243 ARG 3 N     1 
ATOM   6555  C  CA    . ARG C  3  243 ? 16.421   -37.646  338.590 1.00 24.43  ? 243 ARG 3 CA    1 
ATOM   6556  C  C     . ARG C  3  243 ? 15.867   -36.543  337.703 1.00 14.13  ? 243 ARG 3 C     1 
ATOM   6557  O  O     . ARG C  3  243 ? 16.328   -36.350  336.570 1.00 11.28  ? 243 ARG 3 O     1 
ATOM   6558  C  CB    . ARG C  3  243 ? 15.465   -38.856  338.602 1.00 20.79  ? 243 ARG 3 CB    1 
ATOM   6559  C  CG    . ARG C  3  243 ? 16.069   -40.193  338.977 1.00 18.73  ? 243 ARG 3 CG    1 
ATOM   6560  C  CD    . ARG C  3  243 ? 16.652   -40.871  337.744 1.00 16.78  ? 243 ARG 3 CD    1 
ATOM   6561  N  NE    . ARG C  3  243 ? 16.904   -42.303  337.940 1.00 20.95  ? 243 ARG 3 NE    1 
ATOM   6562  C  CZ    . ARG C  3  243 ? 16.027   -43.289  337.718 1.00 18.71  ? 243 ARG 3 CZ    1 
ATOM   6563  N  NH1   . ARG C  3  243 ? 14.791   -43.039  337.308 1.00 10.18  ? 243 ARG 3 NH1   1 
ATOM   6564  N  NH2   . ARG C  3  243 ? 16.402   -44.551  337.913 1.00 20.97  ? 243 ARG 3 NH2   1 
ATOM   6565  N  N     . ALA C  3  244 ? 14.890   -35.803  338.194 1.00 12.40  ? 244 ALA 3 N     1 
ATOM   6566  C  CA    . ALA C  3  244 ? 14.292   -34.754  337.404 1.00 14.01  ? 244 ALA 3 CA    1 
ATOM   6567  C  C     . ALA C  3  244 ? 13.412   -33.941  338.332 1.00 21.14  ? 244 ALA 3 C     1 
ATOM   6568  O  O     . ALA C  3  244 ? 13.079   -34.374  339.444 1.00 18.58  ? 244 ALA 3 O     1 
ATOM   6569  C  CB    . ALA C  3  244 ? 13.476   -35.332  336.243 1.00 10.97  ? 244 ALA 3 CB    1 
ATOM   6570  N  N     . ARG C  3  245 ? 13.036   -32.760  337.852 1.00 25.56  ? 245 ARG 3 N     1 
ATOM   6571  C  CA    . ARG C  3  245 ? 12.155   -31.856  338.575 1.00 19.97  ? 245 ARG 3 CA    1 
ATOM   6572  C  C     . ARG C  3  245 ? 10.696   -32.227  338.332 1.00 30.12  ? 245 ARG 3 C     1 
ATOM   6573  O  O     . ARG C  3  245 ? 10.344   -32.856  337.335 1.00 10.92  ? 245 ARG 3 O     1 
ATOM   6574  C  CB    . ARG C  3  245 ? 12.419   -30.406  338.169 1.00 29.62  ? 245 ARG 3 CB    1 
ATOM   6575  C  CG    . ARG C  3  245 ? 13.882   -30.009  338.132 1.00 11.95  ? 245 ARG 3 CG    1 
ATOM   6576  C  CD    . ARG C  3  245 ? 14.578   -30.246  339.466 1.00 12.11  ? 245 ARG 3 CD    1 
ATOM   6577  N  NE    . ARG C  3  245 ? 13.960   -29.513  340.568 1.00 16.96  ? 245 ARG 3 NE    1 
ATOM   6578  C  CZ    . ARG C  3  245 ? 14.245   -28.245  340.879 1.00 21.56  ? 245 ARG 3 CZ    1 
ATOM   6579  N  NH1   . ARG C  3  245 ? 15.123   -27.558  340.153 1.00 28.06  ? 245 ARG 3 NH1   1 
ATOM   6580  N  NH2   . ARG C  3  245 ? 13.650   -27.648  341.910 1.00 19.22  ? 245 ARG 3 NH2   1 
ATOM   6581  N  N     . ASN C  3  246 ? 9.841    -31.785  339.253 1.00 11.12  ? 246 ASN 3 N     1 
ATOM   6582  C  CA    . ASN C  3  246 ? 8.446    -32.213  339.251 1.00 10.85  ? 246 ASN 3 CA    1 
ATOM   6583  C  C     . ASN C  3  246 ? 7.775    -31.951  337.909 1.00 10.70  ? 246 ASN 3 C     1 
ATOM   6584  O  O     . ASN C  3  246 ? 6.965    -32.758  337.444 1.00 23.21  ? 246 ASN 3 O     1 
ATOM   6585  C  CB    . ASN C  3  246 ? 7.705    -31.520  340.396 1.00 10.92  ? 246 ASN 3 CB    1 
ATOM   6586  C  CG    . ASN C  3  246 ? 8.166    -31.994  341.763 1.00 11.01  ? 246 ASN 3 CG    1 
ATOM   6587  O  OD1   . ASN C  3  246 ? 9.343    -31.874  342.101 1.00 11.23  ? 246 ASN 3 OD1   1 
ATOM   6588  N  ND2   . ASN C  3  246 ? 7.231    -32.438  342.586 1.00 10.85  ? 246 ASN 3 ND2   1 
ATOM   6589  N  N     . TRP C  3  247 ? 8.086    -30.834  337.268 1.00 14.70  ? 247 TRP 3 N     1 
ATOM   6590  C  CA    . TRP C  3  247 ? 7.465    -30.615  335.969 1.00 16.69  ? 247 TRP 3 CA    1 
ATOM   6591  C  C     . TRP C  3  247 ? 8.159    -31.427  334.871 1.00 13.68  ? 247 TRP 3 C     1 
ATOM   6592  O  O     . TRP C  3  247 ? 7.477    -31.951  333.982 1.00 12.92  ? 247 TRP 3 O     1 
ATOM   6593  C  CB    . TRP C  3  247 ? 7.463    -29.114  335.616 1.00 24.23  ? 247 TRP 3 CB    1 
ATOM   6594  C  CG    . TRP C  3  247 ? 8.853    -28.557  335.359 1.00 11.22  ? 247 TRP 3 CG    1 
ATOM   6595  C  CD1   . TRP C  3  247 ? 9.506    -28.510  334.167 1.00 11.25  ? 247 TRP 3 CD1   1 
ATOM   6596  C  CD2   . TRP C  3  247 ? 9.753    -28.011  336.331 1.00 11.50  ? 247 TRP 3 CD2   1 
ATOM   6597  N  NE1   . TRP C  3  247 ? 10.747   -27.963  334.330 1.00 11.53  ? 247 TRP 3 NE1   1 
ATOM   6598  C  CE2   . TRP C  3  247 ? 10.925   -27.649  335.649 1.00 11.69  ? 247 TRP 3 CE2   1 
ATOM   6599  C  CE3   . TRP C  3  247 ? 9.679    -27.793  337.713 1.00 11.62  ? 247 TRP 3 CE3   1 
ATOM   6600  C  CZ2   . TRP C  3  247 ? 12.015   -27.070  336.294 1.00 13.13  ? 247 TRP 3 CZ2   1 
ATOM   6601  C  CZ3   . TRP C  3  247 ? 10.764   -27.226  338.356 1.00 11.92  ? 247 TRP 3 CZ3   1 
ATOM   6602  C  CH2   . TRP C  3  247 ? 11.918   -26.869  337.647 1.00 13.84  ? 247 TRP 3 CH2   1 
ATOM   6603  N  N     . GLU C  3  248 ? 9.481    -31.643  334.968 1.00 19.86  ? 248 GLU 3 N     1 
ATOM   6604  C  CA    . GLU C  3  248 ? 10.191   -32.296  333.865 1.00 10.77  ? 248 GLU 3 CA    1 
ATOM   6605  C  C     . GLU C  3  248 ? 9.705    -33.710  333.644 1.00 11.68  ? 248 GLU 3 C     1 
ATOM   6606  O  O     . GLU C  3  248 ? 9.742    -34.199  332.511 1.00 10.35  ? 248 GLU 3 O     1 
ATOM   6607  C  CB    . GLU C  3  248 ? 11.711   -32.312  334.087 1.00 12.25  ? 248 GLU 3 CB    1 
ATOM   6608  C  CG    . GLU C  3  248 ? 12.462   -31.142  333.459 1.00 11.26  ? 248 GLU 3 CG    1 
ATOM   6609  C  CD    . GLU C  3  248 ? 13.959   -31.182  333.709 1.00 11.50  ? 248 GLU 3 CD    1 
ATOM   6610  O  OE1   . GLU C  3  248 ? 14.365   -31.343  334.872 1.00 11.61  ? 248 GLU 3 OE1   1 
ATOM   6611  O  OE2   . GLU C  3  248 ? 14.730   -31.138  332.728 1.00 11.56  ? 248 GLU 3 OE2   1 
ATOM   6612  N  N     . MET C  3  249 ? 9.174    -34.337  334.690 1.00 19.11  ? 249 MET 3 N     1 
ATOM   6613  C  CA    . MET C  3  249 ? 8.673    -35.704  334.645 1.00 18.70  ? 249 MET 3 CA    1 
ATOM   6614  C  C     . MET C  3  249 ? 7.397    -35.765  333.837 1.00 26.20  ? 249 MET 3 C     1 
ATOM   6615  O  O     . MET C  3  249 ? 6.581    -34.837  333.836 1.00 35.27  ? 249 MET 3 O     1 
ATOM   6616  C  CB    . MET C  3  249 ? 8.366    -36.195  336.052 1.00 12.99  ? 249 MET 3 CB    1 
ATOM   6617  C  CG    . MET C  3  249 ? 9.450    -35.898  337.030 1.00 14.44  ? 249 MET 3 CG    1 
ATOM   6618  S  SD    . MET C  3  249 ? 9.476    -37.203  338.209 1.00 11.38  ? 249 MET 3 SD    1 
ATOM   6619  C  CE    . MET C  3  249 ? 10.404   -36.500  339.571 1.00 10.53  ? 249 MET 3 CE    1 
ATOM   6620  N  N     . GLU C  3  250 ? 7.224    -36.874  333.157 1.00 18.05  ? 250 GLU 3 N     1 
ATOM   6621  C  CA    . GLU C  3  250 ? 6.032    -37.115  332.381 1.00 22.11  ? 250 GLU 3 CA    1 
ATOM   6622  C  C     . GLU C  3  250 ? 5.093    -37.948  333.250 1.00 24.05  ? 250 GLU 3 C     1 
ATOM   6623  O  O     . GLU C  3  250 ? 5.405    -39.099  333.587 1.00 28.62  ? 250 GLU 3 O     1 
ATOM   6624  C  CB    . GLU C  3  250 ? 6.401    -37.787  331.064 1.00 28.77  ? 250 GLU 3 CB    1 
ATOM   6625  C  CG    . GLU C  3  250 ? 5.315    -37.757  330.028 1.00 38.15  ? 250 GLU 3 CG    1 
ATOM   6626  C  CD    . GLU C  3  250 ? 5.778    -38.334  328.710 1.00 45.30  ? 250 GLU 3 CD    1 
ATOM   6627  O  OE1   . GLU C  3  250 ? 7.003    -38.559  328.540 1.00 45.78  ? 250 GLU 3 OE1   1 
ATOM   6628  O  OE2   . GLU C  3  250 ? 4.911    -38.575  327.849 1.00 49.81  ? 250 GLU 3 OE2   1 
ATOM   6629  N  N     . GLU C  3  251 ? 3.949    -37.356  333.611 1.00 18.48  ? 251 GLU 3 N     1 
ATOM   6630  C  CA    . GLU C  3  251 ? 3.021    -37.912  334.588 1.00 14.39  ? 251 GLU 3 CA    1 
ATOM   6631  C  C     . GLU C  3  251 ? 1.970    -38.670  333.787 1.00 20.62  ? 251 GLU 3 C     1 
ATOM   6632  O  O     . GLU C  3  251 ? 1.238    -38.056  333.000 1.00 25.39  ? 251 GLU 3 O     1 
ATOM   6633  C  CB    . GLU C  3  251 ? 2.362    -36.779  335.389 1.00 9.07   ? 251 GLU 3 CB    1 
ATOM   6634  C  CG    . GLU C  3  251 ? 3.349    -35.612  335.766 1.00 41.09  ? 251 GLU 3 CG    1 
ATOM   6635  C  CD    . GLU C  3  251 ? 2.727    -34.388  336.521 1.00 31.66  ? 251 GLU 3 CD    1 
ATOM   6636  O  OE1   . GLU C  3  251 ? 1.633    -33.894  336.145 1.00 27.71  ? 251 GLU 3 OE1   1 
ATOM   6637  O  OE2   . GLU C  3  251 ? 3.392    -33.848  337.434 1.00 28.54  ? 251 GLU 3 OE2   1 
ATOM   6638  N  N     . THR C  3  252 ? 1.863    -39.982  334.001 1.00 22.34  ? 252 THR 3 N     1 
ATOM   6639  C  CA    . THR C  3  252 ? 0.809    -40.763  333.350 1.00 20.83  ? 252 THR 3 CA    1 
ATOM   6640  C  C     . THR C  3  252 ? -0.007   -41.458  334.424 1.00 17.81  ? 252 THR 3 C     1 
ATOM   6641  O  O     . THR C  3  252 ? 0.512    -42.348  335.127 1.00 14.20  ? 252 THR 3 O     1 
ATOM   6642  C  CB    . THR C  3  252 ? 1.376    -41.784  332.366 1.00 23.68  ? 252 THR 3 CB    1 
ATOM   6643  O  OG1   . THR C  3  252 ? 2.176    -41.110  331.386 1.00 8.29   ? 252 THR 3 OG1   1 
ATOM   6644  C  CG2   . THR C  3  252 ? 0.247    -42.492  331.636 1.00 8.03   ? 252 THR 3 CG2   1 
ATOM   6645  N  N     . PRO C  3  253 ? -1.258   -41.054  334.613 1.00 27.89  ? 253 PRO 3 N     1 
ATOM   6646  C  CA    . PRO C  3  253 ? -2.125   -41.729  335.598 1.00 21.04  ? 253 PRO 3 CA    1 
ATOM   6647  C  C     . PRO C  3  253 ? -2.570   -43.117  335.142 1.00 7.98   ? 253 PRO 3 C     1 
ATOM   6648  O  O     . PRO C  3  253 ? -3.055   -43.298  334.025 1.00 9.42   ? 253 PRO 3 O     1 
ATOM   6649  C  CB    . PRO C  3  253 ? -3.299   -40.747  335.744 1.00 33.25  ? 253 PRO 3 CB    1 
ATOM   6650  C  CG    . PRO C  3  253 ? -3.238   -39.836  334.485 1.00 33.77  ? 253 PRO 3 CG    1 
ATOM   6651  C  CD    . PRO C  3  253 ? -1.799   -39.759  334.132 1.00 28.35  ? 253 PRO 3 CD    1 
ATOM   6652  N  N     . THR C  3  254 ? -2.393   -44.097  336.023 1.00 9.60   ? 254 THR 3 N     1 
ATOM   6653  C  CA    . THR C  3  254 ? -2.711   -45.514  335.712 1.00 20.60  ? 254 THR 3 CA    1 
ATOM   6654  C  C     . THR C  3  254 ? -3.142   -46.221  337.000 1.00 30.32  ? 254 THR 3 C     1 
ATOM   6655  O  O     . THR C  3  254 ? -3.500   -45.575  337.993 1.00 30.28  ? 254 THR 3 O     1 
ATOM   6656  C  CB    . THR C  3  254 ? -1.538   -46.271  335.025 1.00 23.75  ? 254 THR 3 CB    1 
ATOM   6657  O  OG1   . THR C  3  254 ? -1.962   -47.609  334.720 1.00 16.12  ? 254 THR 3 OG1   1 
ATOM   6658  C  CG2   . THR C  3  254 ? -0.291   -46.374  335.899 1.00 20.85  ? 254 THR 3 CG2   1 
ATOM   6659  N  N     . THR C  3  255 ? -3.133   -47.554  336.979 1.00 26.91  ? 255 THR 3 N     1 
ATOM   6660  C  CA    . THR C  3  255 ? -3.583   -48.358  338.104 1.00 27.58  ? 255 THR 3 CA    1 
ATOM   6661  C  C     . THR C  3  255 ? -2.555   -49.447  338.367 1.00 27.26  ? 255 THR 3 C     1 
ATOM   6662  O  O     . THR C  3  255 ? -2.072   -50.086  337.432 1.00 30.69  ? 255 THR 3 O     1 
ATOM   6663  C  CB    . THR C  3  255 ? -4.973   -48.957  337.797 1.00 22.46  ? 255 THR 3 CB    1 
ATOM   6664  O  OG1   . THR C  3  255 ? -5.916   -47.885  337.634 1.00 25.84  ? 255 THR 3 OG1   1 
ATOM   6665  C  CG2   . THR C  3  255 ? -5.437   -49.903  338.886 1.00 13.74  ? 255 THR 3 CG2   1 
ATOM   6666  N  N     . CYS C  3  256 ? -2.262   -49.700  339.642 1.00 23.67  ? 256 CYS 3 N     1 
ATOM   6667  C  CA    . CYS C  3  256 ? -1.225   -50.658  340.018 1.00 20.27  ? 256 CYS 3 CA    1 
ATOM   6668  C  C     . CYS C  3  256 ? -1.809   -52.059  340.115 1.00 15.85  ? 256 CYS 3 C     1 
ATOM   6669  O  O     . CYS C  3  256 ? -2.817   -52.282  340.795 1.00 24.44  ? 256 CYS 3 O     1 
ATOM   6670  C  CB    . CYS C  3  256 ? -0.593   -50.258  341.352 1.00 23.45  ? 256 CYS 3 CB    1 
ATOM   6671  S  SG    . CYS C  3  256 ? 0.430    -51.476  342.198 1.00 8.23   ? 256 CYS 3 SG    1 
ATOM   6672  N  N     . ALA C  3  257 ? -1.159   -52.998  339.454 1.00 15.11  ? 257 ALA 3 N     1 
ATOM   6673  C  CA    . ALA C  3  257 ? -1.673   -54.349  339.329 1.00 9.21   ? 257 ALA 3 CA    1 
ATOM   6674  C  C     . ALA C  3  257 ? -0.795   -55.373  340.046 1.00 7.74   ? 257 ALA 3 C     1 
ATOM   6675  O  O     . ALA C  3  257 ? -0.654   -56.513  339.590 1.00 17.81  ? 257 ALA 3 O     1 
ATOM   6676  C  CB    . ALA C  3  257 ? -1.850   -54.706  337.857 1.00 9.05   ? 257 ALA 3 CB    1 
ATOM   6677  N  N     . LEU C  3  258 ? -0.144   -54.968  341.133 1.00 7.90   ? 258 LEU 3 N     1 
ATOM   6678  C  CA    . LEU C  3  258 ? 0.608    -55.931  341.922 1.00 19.60  ? 258 LEU 3 CA    1 
ATOM   6679  C  C     . LEU C  3  258 ? -0.311   -56.767  342.798 1.00 23.78  ? 258 LEU 3 C     1 
ATOM   6680  O  O     . LEU C  3  258 ? 0.003    -57.926  343.095 1.00 25.97  ? 258 LEU 3 O     1 
ATOM   6681  C  CB    . LEU C  3  258 ? 1.648    -55.229  342.792 1.00 8.16   ? 258 LEU 3 CB    1 
ATOM   6682  C  CG    . LEU C  3  258 ? 2.987    -54.957  342.119 1.00 8.26   ? 258 LEU 3 CG    1 
ATOM   6683  C  CD1   . LEU C  3  258 ? 3.636    -53.737  342.716 1.00 8.43   ? 258 LEU 3 CD1   1 
ATOM   6684  C  CD2   . LEU C  3  258 ? 3.882    -56.168  342.266 1.00 17.88  ? 258 LEU 3 CD2   1 
ATOM   6685  N  N     . CYS C  3  259 ? -1.461   -56.222  343.183 1.00 26.35  ? 259 CYS 3 N     1 
ATOM   6686  C  CA    . CYS C  3  259 ? -2.363   -56.885  344.116 1.00 24.61  ? 259 CYS 3 CA    1 
ATOM   6687  C  C     . CYS C  3  259 ? -3.787   -56.460  343.780 1.00 30.17  ? 259 CYS 3 C     1 
ATOM   6688  O  O     . CYS C  3  259 ? -3.992   -55.534  342.984 1.00 37.99  ? 259 CYS 3 O     1 
ATOM   6689  C  CB    . CYS C  3  259 ? -1.981   -56.539  345.560 1.00 18.05  ? 259 CYS 3 CB    1 
ATOM   6690  S  SG    . CYS C  3  259 ? -2.907   -55.178  346.180 1.00 8.59   ? 259 CYS 3 SG    1 
ATOM   6691  N  N     . PRO C  3  260 ? -4.802   -57.133  344.348 1.00 16.15  ? 260 PRO 3 N     1 
ATOM   6692  C  CA    . PRO C  3  260 ? -6.171   -56.936  343.848 1.00 20.51  ? 260 PRO 3 CA    1 
ATOM   6693  C  C     . PRO C  3  260 ? -6.845   -55.637  344.266 1.00 7.49   ? 260 PRO 3 C     1 
ATOM   6694  O  O     . PRO C  3  260 ? -7.965   -55.383  343.810 1.00 13.23  ? 260 PRO 3 O     1 
ATOM   6695  C  CB    . PRO C  3  260 ? -6.942   -58.130  344.426 1.00 7.36   ? 260 PRO 3 CB    1 
ATOM   6696  C  CG    . PRO C  3  260 ? -6.012   -58.865  345.264 1.00 13.92  ? 260 PRO 3 CG    1 
ATOM   6697  C  CD    . PRO C  3  260 ? -4.784   -58.087  345.464 1.00 15.71  ? 260 PRO 3 CD    1 
ATOM   6698  N  N     . VAL C  3  261 ? -6.247   -54.820  345.132 1.00 11.94  ? 261 VAL 3 N     1 
ATOM   6699  C  CA    . VAL C  3  261 ? -6.901   -53.559  345.463 1.00 17.36  ? 261 VAL 3 CA    1 
ATOM   6700  C  C     . VAL C  3  261 ? -6.694   -52.510  344.381 1.00 18.96  ? 261 VAL 3 C     1 
ATOM   6701  O  O     . VAL C  3  261 ? -7.490   -51.562  344.302 1.00 24.63  ? 261 VAL 3 O     1 
ATOM   6702  C  CB    . VAL C  3  261 ? -6.457   -52.987  346.823 1.00 7.86   ? 261 VAL 3 CB    1 
ATOM   6703  C  CG1   . VAL C  3  261 ? -6.519   -54.039  347.896 1.00 19.23  ? 261 VAL 3 CG1   1 
ATOM   6704  C  CG2   . VAL C  3  261 ? -5.059   -52.459  346.729 1.00 8.00   ? 261 VAL 3 CG2   1 
ATOM   6705  N  N     . GLY C  3  262 ? -5.674   -52.660  343.533 1.00 10.04  ? 262 GLY 3 N     1 
ATOM   6706  C  CA    . GLY C  3  262 ? -5.504   -51.769  342.401 1.00 9.87   ? 262 GLY 3 CA    1 
ATOM   6707  C  C     . GLY C  3  262 ? -5.642   -50.290  342.721 1.00 7.80   ? 262 GLY 3 C     1 
ATOM   6708  O  O     . GLY C  3  262 ? -6.534   -49.612  342.191 1.00 7.73   ? 262 GLY 3 O     1 
ATOM   6709  N  N     . CYS C  3  263 ? -4.806   -49.779  343.618 1.00 9.60   ? 263 CYS 3 N     1 
ATOM   6710  C  CA    . CYS C  3  263 ? -4.874   -48.359  343.922 1.00 18.19  ? 263 CYS 3 CA    1 
ATOM   6711  C  C     . CYS C  3  263 ? -4.543   -47.533  342.682 1.00 16.15  ? 263 CYS 3 C     1 
ATOM   6712  O  O     . CYS C  3  263 ? -3.779   -47.961  341.803 1.00 13.23  ? 263 CYS 3 O     1 
ATOM   6713  C  CB    . CYS C  3  263 ? -3.905   -47.966  345.039 1.00 18.57  ? 263 CYS 3 CB    1 
ATOM   6714  S  SG    . CYS C  3  263 ? -3.825   -48.922  346.555 1.00 10.63  ? 263 CYS 3 SG    1 
ATOM   6715  N  N     . GLY C  3  264 ? -5.083   -46.314  342.640 1.00 8.09   ? 264 GLY 3 N     1 
ATOM   6716  C  CA    . GLY C  3  264 ? -4.797   -45.424  341.528 1.00 9.71   ? 264 GLY 3 CA    1 
ATOM   6717  C  C     . GLY C  3  264 ? -3.458   -44.770  341.764 1.00 9.92   ? 264 GLY 3 C     1 
ATOM   6718  O  O     . GLY C  3  264 ? -3.213   -44.199  342.831 1.00 8.40   ? 264 GLY 3 O     1 
ATOM   6719  N  N     . ILE C  3  265 ? -2.590   -44.827  340.751 1.00 24.82  ? 265 ILE 3 N     1 
ATOM   6720  C  CA    . ILE C  3  265 ? -1.217   -44.348  340.865 1.00 20.76  ? 265 ILE 3 CA    1 
ATOM   6721  C  C     . ILE C  3  265 ? -0.940   -43.356  339.743 1.00 8.44   ? 265 ILE 3 C     1 
ATOM   6722  O  O     . ILE C  3  265 ? -1.690   -43.243  338.774 1.00 8.31   ? 265 ILE 3 O     1 
ATOM   6723  C  CB    . ILE C  3  265 ? -0.165   -45.497  340.803 1.00 21.30  ? 265 ILE 3 CB    1 
ATOM   6724  C  CG1   . ILE C  3  265 ? -0.234   -46.235  339.465 1.00 8.30   ? 265 ILE 3 CG1   1 
ATOM   6725  C  CG2   . ILE C  3  265 ? -0.286   -46.496  341.976 1.00 8.46   ? 265 ILE 3 CG2   1 
ATOM   6726  C  CD1   . ILE C  3  265 ? 0.732    -47.396  339.387 1.00 14.43  ? 265 ILE 3 CD1   1 
ATOM   6727  N  N     . THR C  3  266 ? 0.185    -42.671  339.869 1.00 10.32  ? 266 THR 3 N     1 
ATOM   6728  C  CA    . THR C  3  266 ? 0.691    -41.762  338.853 1.00 10.37  ? 266 THR 3 CA    1 
ATOM   6729  C  C     . THR C  3  266 ? 2.109    -42.225  338.550 1.00 11.98  ? 266 THR 3 C     1 
ATOM   6730  O  O     . THR C  3  266 ? 2.922    -42.369  339.471 1.00 14.13  ? 266 THR 3 O     1 
ATOM   6731  C  CB    . THR C  3  266 ? 0.630    -40.294  339.345 1.00 10.73  ? 266 THR 3 CB    1 
ATOM   6732  O  OG1   . THR C  3  266 ? -0.727   -39.930  339.619 1.00 18.61  ? 266 THR 3 OG1   1 
ATOM   6733  C  CG2   . THR C  3  266 ? 1.190    -39.283  338.336 1.00 11.96  ? 266 THR 3 CG2   1 
ATOM   6734  N  N     . ALA C  3  267 ? 2.368    -42.599  337.294 1.00 8.62   ? 267 ALA 3 N     1 
ATOM   6735  C  CA    . ALA C  3  267 ? 3.677    -43.096  336.889 1.00 20.28  ? 267 ALA 3 CA    1 
ATOM   6736  C  C     . ALA C  3  267 ? 4.441    -41.925  336.291 1.00 14.26  ? 267 ALA 3 C     1 
ATOM   6737  O  O     . ALA C  3  267 ? 4.095    -41.433  335.206 1.00 8.72   ? 267 ALA 3 O     1 
ATOM   6738  C  CB    . ALA C  3  267 ? 3.566    -44.247  335.890 1.00 22.39  ? 267 ALA 3 CB    1 
ATOM   6739  N  N     . ASP C  3  268 ? 5.487    -41.501  336.987 1.00 13.22  ? 268 ASP 3 N     1 
ATOM   6740  C  CA    . ASP C  3  268 ? 6.342    -40.408  336.578 1.00 14.18  ? 268 ASP 3 CA    1 
ATOM   6741  C  C     . ASP C  3  268 ? 7.565    -40.980  335.859 1.00 14.73  ? 268 ASP 3 C     1 
ATOM   6742  O  O     . ASP C  3  268 ? 8.451    -41.571  336.493 1.00 9.38   ? 268 ASP 3 O     1 
ATOM   6743  C  CB    . ASP C  3  268 ? 6.707    -39.604  337.823 1.00 15.17  ? 268 ASP 3 CB    1 
ATOM   6744  C  CG    . ASP C  3  268 ? 5.465    -39.089  338.595 1.00 19.17  ? 268 ASP 3 CG    1 
ATOM   6745  O  OD1   . ASP C  3  268 ? 4.414    -38.755  337.996 1.00 9.24   ? 268 ASP 3 OD1   1 
ATOM   6746  O  OD2   . ASP C  3  268 ? 5.521    -39.080  339.837 1.00 9.46   ? 268 ASP 3 OD2   1 
ATOM   6747  N  N     . THR C  3  269 ? 7.610    -40.765  334.537 1.00 21.55  ? 269 THR 3 N     1 
ATOM   6748  C  CA    . THR C  3  269 ? 8.594    -41.322  333.615 1.00 27.27  ? 269 THR 3 CA    1 
ATOM   6749  C  C     . THR C  3  269 ? 9.258    -40.201  332.821 1.00 27.69  ? 269 THR 3 C     1 
ATOM   6750  O  O     . THR C  3  269 ? 8.635    -39.182  332.527 1.00 27.68  ? 269 THR 3 O     1 
ATOM   6751  C  CB    . THR C  3  269 ? 7.933    -42.303  332.621 1.00 21.54  ? 269 THR 3 CB    1 
ATOM   6752  O  OG1   . THR C  3  269 ? 6.699    -41.750  332.134 1.00 8.89   ? 269 THR 3 OG1   1 
ATOM   6753  C  CG2   . THR C  3  269 ? 7.638    -43.597  333.302 1.00 18.74  ? 269 THR 3 CG2   1 
ATOM   6754  N  N     . ARG C  3  270 ? 10.533   -40.381  332.479 1.00 25.93  ? 270 ARG 3 N     1 
ATOM   6755  C  CA    . ARG C  3  270 ? 11.220   -39.415  331.625 1.00 17.09  ? 270 ARG 3 CA    1 
ATOM   6756  C  C     . ARG C  3  270 ? 12.407   -40.097  330.947 1.00 16.25  ? 270 ARG 3 C     1 
ATOM   6757  O  O     . ARG C  3  270 ? 13.190   -40.799  331.605 1.00 14.53  ? 270 ARG 3 O     1 
ATOM   6758  C  CB    . ARG C  3  270 ? 11.682   -38.209  332.434 1.00 16.85  ? 270 ARG 3 CB    1 
ATOM   6759  C  CG    . ARG C  3  270 ? 12.521   -37.200  331.673 1.00 10.31  ? 270 ARG 3 CG    1 
ATOM   6760  C  CD    . ARG C  3  270 ? 13.028   -36.208  332.707 1.00 23.82  ? 270 ARG 3 CD    1 
ATOM   6761  N  NE    . ARG C  3  270 ? 14.164   -35.434  332.245 1.00 18.36  ? 270 ARG 3 NE    1 
ATOM   6762  C  CZ    . ARG C  3  270 ? 14.040   -34.286  331.590 1.00 33.73  ? 270 ARG 3 CZ    1 
ATOM   6763  N  NH1   . ARG C  3  270 ? 12.828   -33.808  331.324 1.00 40.25  ? 270 ARG 3 NH1   1 
ATOM   6764  N  NH2   . ARG C  3  270 ? 15.120   -33.617  331.204 1.00 41.79  ? 270 ARG 3 NH2   1 
ATOM   6765  N  N     . SER C  3  271 ? 12.533   -39.872  329.631 1.00 16.81  ? 271 SER 3 N     1 
ATOM   6766  C  CA    . SER C  3  271 ? 13.630   -40.388  328.806 1.00 12.66  ? 271 SER 3 CA    1 
ATOM   6767  C  C     . SER C  3  271 ? 13.686   -41.907  328.832 1.00 11.42  ? 271 SER 3 C     1 
ATOM   6768  O  O     . SER C  3  271 ? 14.767   -42.495  328.876 1.00 12.17  ? 271 SER 3 O     1 
ATOM   6769  C  CB    . SER C  3  271 ? 14.984   -39.790  329.200 1.00 16.13  ? 271 SER 3 CB    1 
ATOM   6770  O  OG    . SER C  3  271 ? 15.180   -38.481  328.687 1.00 18.14  ? 271 SER 3 OG    1 
ATOM   6771  N  N     . GLY C  3  272 ? 12.514   -42.551  328.856 1.00 13.75  ? 272 GLY 3 N     1 
ATOM   6772  C  CA    . GLY C  3  272 ? 12.459   -43.995  328.702 1.00 23.17  ? 272 GLY 3 CA    1 
ATOM   6773  C  C     . GLY C  3  272 ? 12.714   -44.816  329.949 1.00 23.06  ? 272 GLY 3 C     1 
ATOM   6774  O  O     . GLY C  3  272 ? 12.820   -46.048  329.854 1.00 22.06  ? 272 GLY 3 O     1 
ATOM   6775  N  N     . GLU C  3  273 ? 12.840   -44.178  331.110 1.00 19.30  ? 273 GLU 3 N     1 
ATOM   6776  C  CA    . GLU C  3  273 ? 13.121   -44.863  332.361 1.00 19.78  ? 273 GLU 3 CA    1 
ATOM   6777  C  C     . GLU C  3  273 ? 12.100   -44.423  333.401 1.00 18.87  ? 273 GLU 3 C     1 
ATOM   6778  O  O     . GLU C  3  273 ? 11.498   -43.353  333.288 1.00 15.48  ? 273 GLU 3 O     1 
ATOM   6779  C  CB    . GLU C  3  273 ? 14.573   -44.591  332.824 1.00 28.14  ? 273 GLU 3 CB    1 
ATOM   6780  C  CG    . GLU C  3  273 ? 14.959   -43.128  332.708 1.00 35.93  ? 273 GLU 3 CG    1 
ATOM   6781  C  CD    . GLU C  3  273 ? 16.420   -42.874  332.994 1.00 40.47  ? 273 GLU 3 CD    1 
ATOM   6782  O  OE1   . GLU C  3  273 ? 17.249   -43.789  332.774 1.00 32.13  ? 273 GLU 3 OE1   1 
ATOM   6783  O  OE2   . GLU C  3  273 ? 16.738   -41.743  333.424 1.00 46.11  ? 273 GLU 3 OE2   1 
ATOM   6784  N  N     . LEU C  3  274 ? 11.842   -45.301  334.363 1.00 9.31   ? 274 LEU 3 N     1 
ATOM   6785  C  CA    . LEU C  3  274 ? 10.855   -45.042  335.405 1.00 9.24   ? 274 LEU 3 CA    1 
ATOM   6786  C  C     . LEU C  3  274 ? 11.501   -44.204  336.499 1.00 19.95  ? 274 LEU 3 C     1 
ATOM   6787  O  O     . LEU C  3  274 ? 12.395   -44.678  337.204 1.00 9.60   ? 274 LEU 3 O     1 
ATOM   6788  C  CB    . LEU C  3  274 ? 10.316   -46.355  335.961 1.00 10.55  ? 274 LEU 3 CB    1 
ATOM   6789  C  CG    . LEU C  3  274 ? 9.172    -46.301  336.971 1.00 9.04   ? 274 LEU 3 CG    1 
ATOM   6790  C  CD1   . LEU C  3  274 ? 8.030    -45.460  336.445 1.00 8.94   ? 274 LEU 3 CD1   1 
ATOM   6791  C  CD2   . LEU C  3  274 ? 8.691    -47.694  337.226 1.00 10.70  ? 274 LEU 3 CD2   1 
ATOM   6792  N  N     . LEU C  3  275 ? 11.043   -42.966  336.664 1.00 15.87  ? 275 LEU 3 N     1 
ATOM   6793  C  CA    . LEU C  3  275 ? 11.660   -42.128  337.683 1.00 20.22  ? 275 LEU 3 CA    1 
ATOM   6794  C  C     . LEU C  3  275 ? 11.008   -42.332  339.048 1.00 22.51  ? 275 LEU 3 C     1 
ATOM   6795  O  O     . LEU C  3  275 ? 11.668   -42.790  339.989 1.00 22.88  ? 275 LEU 3 O     1 
ATOM   6796  C  CB    . LEU C  3  275 ? 11.582   -40.649  337.287 1.00 26.25  ? 275 LEU 3 CB    1 
ATOM   6797  C  CG    . LEU C  3  275 ? 12.195   -40.169  335.971 1.00 23.83  ? 275 LEU 3 CG    1 
ATOM   6798  C  CD1   . LEU C  3  275 ? 12.007   -38.677  335.968 1.00 22.51  ? 275 LEU 3 CD1   1 
ATOM   6799  C  CD2   . LEU C  3  275 ? 13.660   -40.532  335.802 1.00 10.26  ? 275 LEU 3 CD2   1 
ATOM   6800  N  N     . ARG C  3  276 ? 9.714    -42.021  339.166 1.00 20.03  ? 276 ARG 3 N     1 
ATOM   6801  C  CA    . ARG C  3  276 ? 9.069    -42.030  340.476 1.00 21.15  ? 276 ARG 3 CA    1 
ATOM   6802  C  C     . ARG C  3  276 ? 7.592    -42.363  340.361 1.00 27.22  ? 276 ARG 3 C     1 
ATOM   6803  O  O     . ARG C  3  276 ? 6.914    -41.899  339.442 1.00 30.64  ? 276 ARG 3 O     1 
ATOM   6804  C  CB    . ARG C  3  276 ? 9.231    -40.689  341.167 1.00 9.86   ? 276 ARG 3 CB    1 
ATOM   6805  C  CG    . ARG C  3  276 ? 8.412    -40.477  342.421 1.00 9.84   ? 276 ARG 3 CG    1 
ATOM   6806  C  CD    . ARG C  3  276 ? 8.740    -39.062  342.891 1.00 26.61  ? 276 ARG 3 CD    1 
ATOM   6807  N  NE    . ARG C  3  276 ? 8.150    -38.059  342.001 1.00 24.67  ? 276 ARG 3 NE    1 
ATOM   6808  C  CZ    . ARG C  3  276 ? 8.269    -36.736  342.113 1.00 10.33  ? 276 ARG 3 CZ    1 
ATOM   6809  N  NH1   . ARG C  3  276 ? 8.971    -36.176  343.084 1.00 10.58  ? 276 ARG 3 NH1   1 
ATOM   6810  N  NH2   . ARG C  3  276 ? 7.686    -35.973  341.209 1.00 10.30  ? 276 ARG 3 NH2   1 
ATOM   6811  N  N     . ILE C  3  277 ? 7.077    -43.101  341.344 1.00 23.67  ? 277 ILE 3 N     1 
ATOM   6812  C  CA    . ILE C  3  277 ? 5.667    -43.483  341.399 1.00 19.44  ? 277 ILE 3 CA    1 
ATOM   6813  C  C     . ILE C  3  277 ? 4.994    -42.788  342.566 1.00 28.76  ? 277 ILE 3 C     1 
ATOM   6814  O  O     . ILE C  3  277 ? 5.497    -42.842  343.697 1.00 43.77  ? 277 ILE 3 O     1 
ATOM   6815  C  CB    . ILE C  3  277 ? 5.509    -44.992  341.556 1.00 9.08   ? 277 ILE 3 CB    1 
ATOM   6816  C  CG1   . ILE C  3  277 ? 6.043    -45.656  340.299 1.00 10.80  ? 277 ILE 3 CG1   1 
ATOM   6817  C  CG2   . ILE C  3  277 ? 4.081    -45.312  341.968 1.00 8.95   ? 277 ILE 3 CG2   1 
ATOM   6818  C  CD1   . ILE C  3  277 ? 5.322    -45.249  339.065 1.00 8.86   ? 277 ILE 3 CD1   1 
ATOM   6819  N  N     . ARG C  3  278 ? 3.823    -42.197  342.319 1.00 20.19  ? 278 ARG 3 N     1 
ATOM   6820  C  CA    . ARG C  3  278 ? 3.124    -41.468  343.370 1.00 19.95  ? 278 ARG 3 CA    1 
ATOM   6821  C  C     . ARG C  3  278 ? 1.648    -41.848  343.441 1.00 9.05   ? 278 ARG 3 C     1 
ATOM   6822  O  O     . ARG C  3  278 ? 1.111    -42.558  342.591 1.00 8.89   ? 278 ARG 3 O     1 
ATOM   6823  C  CB    . ARG C  3  278 ? 3.285    -39.962  343.174 1.00 9.32   ? 278 ARG 3 CB    1 
ATOM   6824  C  CG    . ARG C  3  278 ? 4.670    -39.563  342.746 1.00 9.46   ? 278 ARG 3 CG    1 
ATOM   6825  C  CD    . ARG C  3  278 ? 4.829    -38.071  342.770 1.00 14.86  ? 278 ARG 3 CD    1 
ATOM   6826  N  NE    . ARG C  3  278 ? 3.562    -37.389  342.547 1.00 25.70  ? 278 ARG 3 NE    1 
ATOM   6827  C  CZ    . ARG C  3  278 ? 3.180    -36.877  341.381 1.00 31.94  ? 278 ARG 3 CZ    1 
ATOM   6828  N  NH1   . ARG C  3  278 ? 3.962    -36.974  340.309 1.00 29.08  ? 278 ARG 3 NH1   1 
ATOM   6829  N  NH2   . ARG C  3  278 ? 2.004    -36.273  341.288 1.00 38.30  ? 278 ARG 3 NH2   1 
ATOM   6830  N  N     . ALA C  3  279 ? 0.989    -41.334  344.475 1.00 10.92  ? 279 ALA 3 N     1 
ATOM   6831  C  CA    . ALA C  3  279 ? -0.403   -41.664  344.734 1.00 8.97   ? 279 ALA 3 CA    1 
ATOM   6832  C  C     . ALA C  3  279 ? -1.351   -40.825  343.890 1.00 23.06  ? 279 ALA 3 C     1 
ATOM   6833  O  O     . ALA C  3  279 ? -1.165   -39.616  343.727 1.00 17.32  ? 279 ALA 3 O     1 
ATOM   6834  C  CB    . ALA C  3  279 ? -0.726   -41.440  346.210 1.00 9.06   ? 279 ALA 3 CB    1 
ATOM   6835  N  N     . ARG C  3  280 ? -2.391   -41.469  343.377 1.00 21.94  ? 280 ARG 3 N     1 
ATOM   6836  C  CA    . ARG C  3  280 ? -3.465   -40.784  342.678 1.00 19.19  ? 280 ARG 3 CA    1 
ATOM   6837  C  C     . ARG C  3  280 ? -4.752   -40.997  343.450 1.00 20.08  ? 280 ARG 3 C     1 
ATOM   6838  O  O     . ARG C  3  280 ? -5.084   -42.129  343.815 1.00 20.95  ? 280 ARG 3 O     1 
ATOM   6839  C  CB    . ARG C  3  280 ? -3.621   -41.271  341.236 1.00 10.13  ? 280 ARG 3 CB    1 
ATOM   6840  C  CG    . ARG C  3  280 ? -4.507   -40.355  340.391 1.00 8.37   ? 280 ARG 3 CG    1 
ATOM   6841  C  CD    . ARG C  3  280 ? -4.442   -40.733  338.933 1.00 8.24   ? 280 ARG 3 CD    1 
ATOM   6842  N  NE    . ARG C  3  280 ? -4.548   -42.172  338.747 1.00 21.03  ? 280 ARG 3 NE    1 
ATOM   6843  C  CZ    . ARG C  3  280 ? -5.699   -42.819  338.610 1.00 21.33  ? 280 ARG 3 CZ    1 
ATOM   6844  N  NH1   . ARG C  3  280 ? -6.846   -42.150  338.606 1.00 18.89  ? 280 ARG 3 NH1   1 
ATOM   6845  N  NH2   . ARG C  3  280 ? -5.704   -44.140  338.459 1.00 19.99  ? 280 ARG 3 NH2   1 
ATOM   6846  N  N     . GLU C  3  281 ? -5.441   -39.910  343.733 1.00 20.54  ? 281 GLU 3 N     1 
ATOM   6847  C  CA    . GLU C  3  281 ? -6.647   -39.966  344.536 1.00 19.93  ? 281 GLU 3 CA    1 
ATOM   6848  C  C     . GLU C  3  281 ? -7.833   -40.470  343.731 1.00 23.21  ? 281 GLU 3 C     1 
ATOM   6849  O  O     . GLU C  3  281 ? -8.161   -39.927  342.666 1.00 18.92  ? 281 GLU 3 O     1 
ATOM   6850  C  CB    . GLU C  3  281 ? -6.955   -38.598  345.120 1.00 17.38  ? 281 GLU 3 CB    1 
ATOM   6851  C  CG    . GLU C  3  281 ? -8.397   -38.391  345.467 1.00 16.35  ? 281 GLU 3 CG    1 
ATOM   6852  C  CD    . GLU C  3  281 ? -8.555   -37.092  346.149 1.00 8.67   ? 281 GLU 3 CD    1 
ATOM   6853  O  OE1   . GLU C  3  281 ? -7.963   -36.126  345.633 1.00 10.50  ? 281 GLU 3 OE1   1 
ATOM   6854  O  OE2   . GLU C  3  281 ? -9.311   -37.013  347.135 1.00 8.68   ? 281 GLU 3 OE2   1 
ATOM   6855  N  N     . VAL C  3  282 ? -8.493   -41.487  344.284 1.00 27.22  ? 282 VAL 3 N     1 
ATOM   6856  C  CA    . VAL C  3  282 ? -9.733   -42.074  343.779 1.00 22.39  ? 282 VAL 3 CA    1 
ATOM   6857  C  C     . VAL C  3  282 ? -10.509  -42.623  344.979 1.00 15.98  ? 282 VAL 3 C     1 
ATOM   6858  O  O     . VAL C  3  282 ? -10.387  -43.812  345.321 1.00 18.58  ? 282 VAL 3 O     1 
ATOM   6859  C  CB    . VAL C  3  282 ? -9.444   -43.131  342.695 1.00 11.32  ? 282 VAL 3 CB    1 
ATOM   6860  C  CG1   . VAL C  3  282 ? -8.352   -44.134  343.109 1.00 9.58   ? 282 VAL 3 CG1   1 
ATOM   6861  C  CG2   . VAL C  3  282 ? -10.724  -43.819  342.267 1.00 20.72  ? 282 VAL 3 CG2   1 
ATOM   6862  N  N     . PRO C  3  283 ? -11.290  -41.776  345.670 1.00 17.03  ? 283 PRO 3 N     1 
ATOM   6863  C  CA    . PRO C  3  283 ? -11.866  -42.183  346.972 1.00 13.45  ? 283 PRO 3 CA    1 
ATOM   6864  C  C     . PRO C  3  283 ? -12.768  -43.410  346.922 1.00 9.27   ? 283 PRO 3 C     1 
ATOM   6865  O  O     . PRO C  3  283 ? -13.050  -44.001  347.972 1.00 7.96   ? 283 PRO 3 O     1 
ATOM   6866  C  CB    . PRO C  3  283 ? -12.650  -40.939  347.425 1.00 14.80  ? 283 PRO 3 CB    1 
ATOM   6867  C  CG    . PRO C  3  283 ? -12.613  -39.971  346.278 1.00 17.04  ? 283 PRO 3 CG    1 
ATOM   6868  C  CD    . PRO C  3  283 ? -11.490  -40.346  345.384 1.00 15.51  ? 283 PRO 3 CD    1 
ATOM   6869  N  N     . GLU C  3  284 ? -13.221  -43.815  345.748 1.00 7.80   ? 284 GLU 3 N     1 
ATOM   6870  C  CA    . GLU C  3  284 ? -14.033  -45.016  345.672 1.00 18.94  ? 284 GLU 3 CA    1 
ATOM   6871  C  C     . GLU C  3  284 ? -13.258  -46.240  346.167 1.00 26.60  ? 284 GLU 3 C     1 
ATOM   6872  O  O     . GLU C  3  284 ? -13.850  -47.161  346.751 1.00 27.09  ? 284 GLU 3 O     1 
ATOM   6873  C  CB    . GLU C  3  284 ? -14.525  -45.216  344.237 1.00 25.20  ? 284 GLU 3 CB    1 
ATOM   6874  C  CG    . GLU C  3  284 ? -14.761  -43.926  343.469 1.00 27.49  ? 284 GLU 3 CG    1 
ATOM   6875  C  CD    . GLU C  3  284 ? -16.001  -43.196  343.939 1.00 28.66  ? 284 GLU 3 CD    1 
ATOM   6876  O  OE1   . GLU C  3  284 ? -16.870  -43.855  344.534 1.00 27.91  ? 284 GLU 3 OE1   1 
ATOM   6877  O  OE2   . GLU C  3  284 ? -16.142  -41.981  343.675 1.00 28.61  ? 284 GLU 3 OE2   1 
ATOM   6878  N  N     . VAL C  3  285 ? -11.942  -46.270  345.934 1.00 27.00  ? 285 VAL 3 N     1 
ATOM   6879  C  CA    . VAL C  3  285 ? -11.100  -47.396  346.326 1.00 27.49  ? 285 VAL 3 CA    1 
ATOM   6880  C  C     . VAL C  3  285 ? -9.971   -47.014  347.290 1.00 21.65  ? 285 VAL 3 C     1 
ATOM   6881  O  O     . VAL C  3  285 ? -10.003  -47.396  348.464 1.00 25.87  ? 285 VAL 3 O     1 
ATOM   6882  C  CB    . VAL C  3  285 ? -10.568  -48.105  345.061 1.00 25.57  ? 285 VAL 3 CB    1 
ATOM   6883  C  CG1   . VAL C  3  285 ? -10.011  -47.103  344.064 1.00 23.75  ? 285 VAL 3 CG1   1 
ATOM   6884  C  CG2   . VAL C  3  285 ? -9.474   -49.123  345.435 1.00 26.64  ? 285 VAL 3 CG2   1 
ATOM   6885  N  N     . ASN C  3  286 ? -9.003   -46.221  346.849 1.00 20.37  ? 286 ASN 3 N     1 
ATOM   6886  C  CA    . ASN C  3  286 ? -7.924   -45.768  347.721 1.00 16.80  ? 286 ASN 3 CA    1 
ATOM   6887  C  C     . ASN C  3  286 ? -7.956   -44.252  347.798 1.00 13.15  ? 286 ASN 3 C     1 
ATOM   6888  O  O     . ASN C  3  286 ? -8.179   -43.573  346.789 1.00 20.39  ? 286 ASN 3 O     1 
ATOM   6889  C  CB    . ASN C  3  286 ? -6.547   -46.329  347.290 1.00 14.61  ? 286 ASN 3 CB    1 
ATOM   6890  C  CG    . ASN C  3  286 ? -5.783   -45.430  346.310 1.00 14.86  ? 286 ASN 3 CG    1 
ATOM   6891  O  OD1   . ASN C  3  286 ? -6.306   -44.991  345.282 1.00 20.40  ? 286 ASN 3 OD1   1 
ATOM   6892  N  ND2   . ASN C  3  286 ? -4.561   -45.112  346.663 1.00 10.20  ? 286 ASN 3 ND2   1 
ATOM   6893  N  N     . GLU C  3  287 ? -7.838   -43.730  349.009 1.00 12.53  ? 287 GLU 3 N     1 
ATOM   6894  C  CA    . GLU C  3  287 ? -8.225   -42.338  349.135 1.00 20.35  ? 287 GLU 3 CA    1 
ATOM   6895  C  C     . GLU C  3  287 ? -7.159   -41.456  348.505 1.00 14.94  ? 287 GLU 3 C     1 
ATOM   6896  O  O     . GLU C  3  287 ? -7.344   -40.940  347.401 1.00 8.59   ? 287 GLU 3 O     1 
ATOM   6897  C  CB    . GLU C  3  287 ? -8.421   -41.968  350.607 1.00 27.49  ? 287 GLU 3 CB    1 
ATOM   6898  C  CG    . GLU C  3  287 ? -9.663   -42.540  351.220 1.00 10.28  ? 287 GLU 3 CG    1 
ATOM   6899  C  CD    . GLU C  3  287 ? -9.538   -42.652  352.699 1.00 8.68   ? 287 GLU 3 CD    1 
ATOM   6900  O  OE1   . GLU C  3  287 ? -8.435   -42.977  353.173 1.00 10.55  ? 287 GLU 3 OE1   1 
ATOM   6901  O  OE2   . GLU C  3  287 ? -10.524  -42.372  353.393 1.00 10.41  ? 287 GLU 3 OE2   1 
ATOM   6902  N  N     . ILE C  3  288 ? -5.998   -41.376  349.146 1.00 15.83  ? 288 ILE 3 N     1 
ATOM   6903  C  CA    . ILE C  3  288 ? -4.852   -40.674  348.588 1.00 18.14  ? 288 ILE 3 CA    1 
ATOM   6904  C  C     . ILE C  3  288 ? -3.598   -41.512  348.816 1.00 12.89  ? 288 ILE 3 C     1 
ATOM   6905  O  O     . ILE C  3  288 ? -2.472   -41.014  348.698 1.00 10.94  ? 288 ILE 3 O     1 
ATOM   6906  C  CB    . ILE C  3  288 ? -4.705   -39.275  349.207 1.00 22.96  ? 288 ILE 3 CB    1 
ATOM   6907  C  CG1   . ILE C  3  288 ? -4.434   -39.390  350.705 1.00 28.48  ? 288 ILE 3 CG1   1 
ATOM   6908  C  CG2   . ILE C  3  288 ? -5.967   -38.435  348.955 1.00 23.25  ? 288 ILE 3 CG2   1 
ATOM   6909  C  CD1   . ILE C  3  288 ? -4.272   -38.050  351.424 1.00 31.74  ? 288 ILE 3 CD1   1 
ATOM   6910  N  N     . TRP C  3  289 ? -3.784   -42.795  349.149 1.00 20.84  ? 289 TRP 3 N     1 
ATOM   6911  C  CA    . TRP C  3  289 ? -2.721   -43.637  349.690 1.00 21.53  ? 289 TRP 3 CA    1 
ATOM   6912  C  C     . TRP C  3  289 ? -2.181   -44.645  348.684 1.00 8.89   ? 289 TRP 3 C     1 
ATOM   6913  O  O     . TRP C  3  289 ? -2.889   -45.120  347.798 1.00 10.48  ? 289 TRP 3 O     1 
ATOM   6914  C  CB    . TRP C  3  289 ? -3.169   -44.424  350.938 1.00 18.12  ? 289 TRP 3 CB    1 
ATOM   6915  C  CG    . TRP C  3  289 ? -3.880   -43.647  351.987 1.00 14.10  ? 289 TRP 3 CG    1 
ATOM   6916  C  CD1   . TRP C  3  289 ? -5.075   -43.959  352.581 1.00 15.56  ? 289 TRP 3 CD1   1 
ATOM   6917  C  CD2   . TRP C  3  289 ? -3.462   -42.394  352.555 1.00 12.69  ? 289 TRP 3 CD2   1 
ATOM   6918  N  NE1   . TRP C  3  289 ? -5.402   -42.993  353.509 1.00 20.48  ? 289 TRP 3 NE1   1 
ATOM   6919  C  CE2   . TRP C  3  289 ? -4.436   -42.018  353.500 1.00 18.60  ? 289 TRP 3 CE2   1 
ATOM   6920  C  CE3   . TRP C  3  289 ? -2.354   -41.560  352.361 1.00 9.37   ? 289 TRP 3 CE3   1 
ATOM   6921  C  CZ2   . TRP C  3  289 ? -4.336   -40.843  354.239 1.00 18.66  ? 289 TRP 3 CZ2   1 
ATOM   6922  C  CZ3   . TRP C  3  289 ? -2.259   -40.417  353.095 1.00 9.52   ? 289 TRP 3 CZ3   1 
ATOM   6923  C  CH2   . TRP C  3  289 ? -3.241   -40.059  354.022 1.00 18.45  ? 289 TRP 3 CH2   1 
ATOM   6924  N  N     . ILE C  3  290 ? -0.904   -44.969  348.858 1.00 14.72  ? 290 ILE 3 N     1 
ATOM   6925  C  CA    . ILE C  3  290 ? -0.235   -46.065  348.173 1.00 16.41  ? 290 ILE 3 CA    1 
ATOM   6926  C  C     . ILE C  3  290 ? 0.636    -46.766  349.209 1.00 14.84  ? 290 ILE 3 C     1 
ATOM   6927  O  O     . ILE C  3  290 ? 1.035    -46.173  350.218 1.00 14.37  ? 290 ILE 3 O     1 
ATOM   6928  C  CB    . ILE C  3  290 ? 0.588    -45.557  346.959 1.00 18.37  ? 290 ILE 3 CB    1 
ATOM   6929  C  CG1   . ILE C  3  290 ? -0.338   -45.023  345.876 1.00 10.60  ? 290 ILE 3 CG1   1 
ATOM   6930  C  CG2   . ILE C  3  290 ? 1.457    -46.632  346.362 1.00 25.16  ? 290 ILE 3 CG2   1 
ATOM   6931  C  CD1   . ILE C  3  290 ? -1.184   -46.066  345.300 1.00 10.37  ? 290 ILE 3 CD1   1 
ATOM   6932  N  N     . CYS C  3  291 ? 0.880    -48.052  348.993 1.00 15.44  ? 291 CYS 3 N     1 
ATOM   6933  C  CA    . CYS C  3  291 ? 1.746    -48.789  349.894 1.00 21.36  ? 291 CYS 3 CA    1 
ATOM   6934  C  C     . CYS C  3  291 ? 3.208    -48.688  349.426 1.00 19.73  ? 291 CYS 3 C     1 
ATOM   6935  O  O     . CYS C  3  291 ? 3.519    -48.165  348.352 1.00 12.56  ? 291 CYS 3 O     1 
ATOM   6936  C  CB    . CYS C  3  291 ? 1.265    -50.243  350.026 1.00 24.07  ? 291 CYS 3 CB    1 
ATOM   6937  S  SG    . CYS C  3  291 ? 1.731    -51.349  348.712 1.00 25.95  ? 291 CYS 3 SG    1 
ATOM   6938  N  N     . ASP C  3  292 ? 4.113    -49.130  350.306 1.00 27.93  ? 292 ASP 3 N     1 
ATOM   6939  C  CA    . ASP C  3  292 ? 5.543    -49.116  350.007 1.00 30.11  ? 292 ASP 3 CA    1 
ATOM   6940  C  C     . ASP C  3  292 ? 5.888    -50.097  348.889 1.00 27.76  ? 292 ASP 3 C     1 
ATOM   6941  O  O     . ASP C  3  292 ? 6.804    -49.851  348.093 1.00 31.67  ? 292 ASP 3 O     1 
ATOM   6942  C  CB    . ASP C  3  292 ? 6.354    -49.459  351.255 1.00 28.74  ? 292 ASP 3 CB    1 
ATOM   6943  C  CG    . ASP C  3  292 ? 6.364    -48.335  352.270 1.00 26.23  ? 292 ASP 3 CG    1 
ATOM   6944  O  OD1   . ASP C  3  292 ? 5.983    -47.190  351.922 1.00 25.78  ? 292 ASP 3 OD1   1 
ATOM   6945  O  OD2   . ASP C  3  292 ? 6.784    -48.596  353.414 1.00 24.35  ? 292 ASP 3 OD2   1 
ATOM   6946  N  N     . ALA C  3  293 ? 5.209    -51.245  348.855 1.00 18.78  ? 293 ALA 3 N     1 
ATOM   6947  C  CA    . ALA C  3  293 ? 5.475    -52.202  347.789 1.00 17.52  ? 293 ALA 3 CA    1 
ATOM   6948  C  C     . ALA C  3  293 ? 5.052    -51.650  346.436 1.00 17.37  ? 293 ALA 3 C     1 
ATOM   6949  O  O     . ALA C  3  293 ? 5.671    -51.976  345.417 1.00 21.95  ? 293 ALA 3 O     1 
ATOM   6950  C  CB    . ALA C  3  293 ? 4.777    -53.532  348.070 1.00 16.66  ? 293 ALA 3 CB    1 
ATOM   6951  N  N     . GLY C  3  294 ? 4.013    -50.816  346.404 1.00 10.69  ? 294 GLY 3 N     1 
ATOM   6952  C  CA    . GLY C  3  294 ? 3.578    -50.210  345.165 1.00 8.81   ? 294 GLY 3 CA    1 
ATOM   6953  C  C     . GLY C  3  294 ? 4.395    -49.000  344.763 1.00 8.94   ? 294 GLY 3 C     1 
ATOM   6954  O  O     . GLY C  3  294 ? 4.667    -48.801  343.570 1.00 8.90   ? 294 GLY 3 O     1 
ATOM   6955  N  N     . ARG C  3  295 ? 4.797    -48.191  345.755 1.00 14.44  ? 295 ARG 3 N     1 
ATOM   6956  C  CA    . ARG C  3  295 ? 5.405    -46.884  345.509 1.00 17.04  ? 295 ARG 3 CA    1 
ATOM   6957  C  C     . ARG C  3  295 ? 6.925    -46.948  345.396 1.00 24.37  ? 295 ARG 3 C     1 
ATOM   6958  O  O     . ARG C  3  295 ? 7.532    -46.166  344.647 1.00 26.00  ? 295 ARG 3 O     1 
ATOM   6959  C  CB    . ARG C  3  295 ? 5.022    -45.907  346.621 1.00 13.10  ? 295 ARG 3 CB    1 
ATOM   6960  C  CG    . ARG C  3  295 ? 5.870    -44.652  346.714 1.00 15.99  ? 295 ARG 3 CG    1 
ATOM   6961  C  CD    . ARG C  3  295 ? 5.542    -43.931  347.995 1.00 18.13  ? 295 ARG 3 CD    1 
ATOM   6962  N  NE    . ARG C  3  295 ? 4.098    -43.787  348.089 1.00 9.89   ? 295 ARG 3 NE    1 
ATOM   6963  C  CZ    . ARG C  3  295 ? 3.414    -42.777  347.603 1.00 9.47   ? 295 ARG 3 CZ    1 
ATOM   6964  N  NH1   . ARG C  3  295 ? 4.045    -41.804  346.981 1.00 15.45  ? 295 ARG 3 NH1   1 
ATOM   6965  N  NH2   . ARG C  3  295 ? 2.105    -42.750  347.742 1.00 9.36   ? 295 ARG 3 NH2   1 
ATOM   6966  N  N     . PHE C  3  296 ? 7.573    -47.814  346.174 1.00 29.10  ? 296 PHE 3 N     1 
ATOM   6967  C  CA    . PHE C  3  296 ? 9.023    -47.960  346.107 1.00 27.47  ? 296 PHE 3 CA    1 
ATOM   6968  C  C     . PHE C  3  296 ? 9.431    -49.251  345.402 1.00 24.42  ? 296 PHE 3 C     1 
ATOM   6969  O  O     . PHE C  3  296 ? 10.627   -49.496  345.211 1.00 26.77  ? 296 PHE 3 O     1 
ATOM   6970  C  CB    . PHE C  3  296 ? 9.639    -47.910  347.518 1.00 27.66  ? 296 PHE 3 CB    1 
ATOM   6971  C  CG    . PHE C  3  296 ? 9.296    -46.656  348.292 1.00 24.26  ? 296 PHE 3 CG    1 
ATOM   6972  C  CD1   . PHE C  3  296 ? 9.626    -45.401  347.810 1.00 20.98  ? 296 PHE 3 CD1   1 
ATOM   6973  C  CD2   . PHE C  3  296 ? 8.647    -46.738  349.516 1.00 24.57  ? 296 PHE 3 CD2   1 
ATOM   6974  C  CE1   . PHE C  3  296 ? 9.293    -44.253  348.540 1.00 19.84  ? 296 PHE 3 CE1   1 
ATOM   6975  C  CE2   . PHE C  3  296 ? 8.326    -45.588  350.237 1.00 17.66  ? 296 PHE 3 CE2   1 
ATOM   6976  C  CZ    . PHE C  3  296 ? 8.645    -44.359  349.749 1.00 12.11  ? 296 PHE 3 CZ    1 
ATOM   6977  N  N     . GLY C  3  297 ? 8.468    -50.076  345.008 1.00 15.50  ? 297 GLY 3 N     1 
ATOM   6978  C  CA    . GLY C  3  297 ? 8.781    -51.337  344.377 1.00 18.09  ? 297 GLY 3 CA    1 
ATOM   6979  C  C     . GLY C  3  297 ? 8.838    -51.273  342.865 1.00 22.60  ? 297 GLY 3 C     1 
ATOM   6980  O  O     . GLY C  3  297 ? 8.183    -52.069  342.186 1.00 24.27  ? 297 GLY 3 O     1 
ATOM   6981  N  N     . HIS C  3  298 ? 9.587    -50.322  342.318 1.00 20.69  ? 298 HIS 3 N     1 
ATOM   6982  C  CA    . HIS C  3  298 ? 9.651    -50.162  340.879 1.00 9.12   ? 298 HIS 3 CA    1 
ATOM   6983  C  C     . HIS C  3  298 ? 11.042   -50.352  340.286 1.00 9.21   ? 298 HIS 3 C     1 
ATOM   6984  O  O     . HIS C  3  298 ? 11.177   -50.303  339.062 1.00 9.14   ? 298 HIS 3 O     1 
ATOM   6985  C  CB    . HIS C  3  298 ? 9.070    -48.790  340.503 1.00 17.46  ? 298 HIS 3 CB    1 
ATOM   6986  C  CG    . HIS C  3  298 ? 9.814    -47.612  341.067 1.00 9.31   ? 298 HIS 3 CG    1 
ATOM   6987  N  ND1   . HIS C  3  298 ? 10.981   -47.129  340.512 1.00 9.43   ? 298 HIS 3 ND1   1 
ATOM   6988  C  CD2   . HIS C  3  298 ? 9.529    -46.800  342.114 1.00 9.41   ? 298 HIS 3 CD2   1 
ATOM   6989  C  CE1   . HIS C  3  298 ? 11.390   -46.081  341.202 1.00 9.59   ? 298 HIS 3 CE1   1 
ATOM   6990  N  NE2   . HIS C  3  298 ? 10.527   -45.862  342.178 1.00 11.50  ? 298 HIS 3 NE2   1 
ATOM   6991  N  N     . GLU C  3  299 ? 12.055   -50.656  341.103 1.00 9.36   ? 299 GLU 3 N     1 
ATOM   6992  C  CA    . GLU C  3  299 ? 13.446   -50.709  340.635 1.00 15.60  ? 299 GLU 3 CA    1 
ATOM   6993  C  C     . GLU C  3  299 ? 13.686   -51.753  339.546 1.00 11.30  ? 299 GLU 3 C     1 
ATOM   6994  O  O     . GLU C  3  299 ? 14.699   -51.677  338.835 1.00 9.42   ? 299 GLU 3 O     1 
ATOM   6995  C  CB    . GLU C  3  299 ? 14.414   -50.975  341.789 1.00 17.35  ? 299 GLU 3 CB    1 
ATOM   6996  C  CG    . GLU C  3  299 ? 14.458   -49.871  342.840 1.00 23.34  ? 299 GLU 3 CG    1 
ATOM   6997  C  CD    . GLU C  3  299 ? 15.432   -48.749  342.527 1.00 28.20  ? 299 GLU 3 CD    1 
ATOM   6998  O  OE1   . GLU C  3  299 ? 15.351   -48.155  341.429 1.00 24.39  ? 299 GLU 3 OE1   1 
ATOM   6999  O  OE2   . GLU C  3  299 ? 16.289   -48.461  343.381 1.00 30.23  ? 299 GLU 3 OE2   1 
ATOM   7000  N  N     . TRP C  3  300 ? 12.855   -52.783  339.482 1.00 13.11  ? 300 TRP 3 N     1 
ATOM   7001  C  CA    . TRP C  3  300 ? 13.067   -53.856  338.527 1.00 11.84  ? 300 TRP 3 CA    1 
ATOM   7002  C  C     . TRP C  3  300 ? 12.583   -53.475  337.131 1.00 12.81  ? 300 TRP 3 C     1 
ATOM   7003  O  O     . TRP C  3  300 ? 13.051   -54.054  336.143 1.00 13.92  ? 300 TRP 3 O     1 
ATOM   7004  C  CB    . TRP C  3  300 ? 12.345   -55.121  338.998 1.00 8.97   ? 300 TRP 3 CB    1 
ATOM   7005  C  CG    . TRP C  3  300 ? 10.916   -54.849  339.417 1.00 10.64  ? 300 TRP 3 CG    1 
ATOM   7006  C  CD1   . TRP C  3  300 ? 10.460   -54.520  340.663 1.00 8.92   ? 300 TRP 3 CD1   1 
ATOM   7007  C  CD2   . TRP C  3  300 ? 9.783    -54.795  338.553 1.00 14.30  ? 300 TRP 3 CD2   1 
ATOM   7008  N  NE1   . TRP C  3  300 ? 9.101    -54.319  340.632 1.00 8.79   ? 300 TRP 3 NE1   1 
ATOM   7009  C  CE2   . TRP C  3  300 ? 8.663    -54.476  339.344 1.00 11.64  ? 300 TRP 3 CE2   1 
ATOM   7010  C  CE3   . TRP C  3  300 ? 9.600    -55.013  337.186 1.00 8.57   ? 300 TRP 3 CE3   1 
ATOM   7011  C  CZ2   . TRP C  3  300 ? 7.382    -54.363  338.808 1.00 13.94  ? 300 TRP 3 CZ2   1 
ATOM   7012  C  CZ3   . TRP C  3  300 ? 8.340    -54.903  336.662 1.00 8.41   ? 300 TRP 3 CZ3   1 
ATOM   7013  C  CH2   . TRP C  3  300 ? 7.244    -54.580  337.464 1.00 14.75  ? 300 TRP 3 CH2   1 
ATOM   7014  N  N     . ALA C  3  301 ? 11.691   -52.490  337.012 1.00 12.67  ? 301 ALA 3 N     1 
ATOM   7015  C  CA    . ALA C  3  301 ? 11.044   -52.270  335.723 1.00 17.90  ? 301 ALA 3 CA    1 
ATOM   7016  C  C     . ALA C  3  301 ? 12.033   -51.689  334.716 1.00 26.07  ? 301 ALA 3 C     1 
ATOM   7017  O  O     . ALA C  3  301 ? 12.242   -52.263  333.638 1.00 25.72  ? 301 ALA 3 O     1 
ATOM   7018  C  CB    . ALA C  3  301 ? 9.826    -51.352  335.896 1.00 16.12  ? 301 ALA 3 CB    1 
ATOM   7019  N  N     . ASP C  3  302 ? 12.744   -50.627  335.111 1.00 28.88  ? 302 ASP 3 N     1 
ATOM   7020  C  CA    . ASP C  3  302 ? 13.556   -49.777  334.239 1.00 25.96  ? 302 ASP 3 CA    1 
ATOM   7021  C  C     . ASP C  3  302 ? 15.035   -50.170  334.184 1.00 33.58  ? 302 ASP 3 C     1 
ATOM   7022  O  O     . ASP C  3  302 ? 15.810   -49.511  333.473 1.00 36.99  ? 302 ASP 3 O     1 
ATOM   7023  C  CB    . ASP C  3  302 ? 13.425   -48.288  334.658 1.00 12.23  ? 302 ASP 3 CB    1 
ATOM   7024  C  CG    . ASP C  3  302 ? 13.943   -48.004  336.086 1.00 9.38   ? 302 ASP 3 CG    1 
ATOM   7025  O  OD1   . ASP C  3  302 ? 13.760   -48.835  336.991 1.00 9.37   ? 302 ASP 3 OD1   1 
ATOM   7026  O  OD2   . ASP C  3  302 ? 14.623   -46.982  336.292 1.00 9.62   ? 302 ASP 3 OD2   1 
ATOM   7027  N  N     . GLN C  3  303 ? 15.443   -51.232  334.884 1.00 27.03  ? 303 GLN 3 N     1 
ATOM   7028  C  CA    . GLN C  3  303 ? 16.853   -51.607  334.959 1.00 23.04  ? 303 GLN 3 CA    1 
ATOM   7029  C  C     . GLN C  3  303 ? 17.247   -52.694  333.955 1.00 23.56  ? 303 GLN 3 C     1 
ATOM   7030  O  O     . GLN C  3  303 ? 18.050   -52.431  333.053 1.00 23.99  ? 303 GLN 3 O     1 
ATOM   7031  C  CB    . GLN C  3  303 ? 17.185   -52.024  336.401 1.00 17.99  ? 303 GLN 3 CB    1 
ATOM   7032  C  CG    . GLN C  3  303 ? 18.669   -51.981  336.749 1.00 27.44  ? 303 GLN 3 CG    1 
ATOM   7033  C  CD    . GLN C  3  303 ? 19.360   -50.631  336.521 1.00 36.54  ? 303 GLN 3 CD    1 
ATOM   7034  O  OE1   . GLN C  3  303 ? 19.200   -49.686  337.302 1.00 37.87  ? 303 GLN 3 OE1   1 
ATOM   7035  N  NE2   . GLN C  3  303 ? 20.143   -50.546  335.446 1.00 38.30  ? 303 GLN 3 NE2   1 
ATOM   7036  N  N     . ASN C  3  304 ? 16.668   -53.902  334.080 1.00 27.42  ? 304 ASN 3 N     1 
ATOM   7037  C  CA    . ASN C  3  304 ? 17.015   -55.108  333.307 1.00 21.39  ? 304 ASN 3 CA    1 
ATOM   7038  C  C     . ASN C  3  304 ? 15.739   -55.764  332.795 1.00 28.22  ? 304 ASN 3 C     1 
ATOM   7039  O  O     . ASN C  3  304 ? 14.979   -56.324  333.589 1.00 26.53  ? 304 ASN 3 O     1 
ATOM   7040  C  CB    . ASN C  3  304 ? 17.815   -56.107  334.163 1.00 13.71  ? 304 ASN 3 CB    1 
ATOM   7041  C  CG    . ASN C  3  304 ? 19.279   -56.232  333.742 1.00 10.59  ? 304 ASN 3 CG    1 
ATOM   7042  O  OD1   . ASN C  3  304 ? 19.614   -56.060  332.573 1.00 14.02  ? 304 ASN 3 OD1   1 
ATOM   7043  N  ND2   . ASN C  3  304 ? 20.158   -56.489  334.700 1.00 9.48   ? 304 ASN 3 ND2   1 
ATOM   7044  N  N     . ARG C  3  305 ? 15.527   -55.757  331.476 1.00 22.95  ? 305 ARG 3 N     1 
ATOM   7045  C  CA    . ARG C  3  305 ? 14.334   -56.391  330.918 1.00 24.05  ? 305 ARG 3 CA    1 
ATOM   7046  C  C     . ARG C  3  305 ? 14.585   -56.780  329.467 1.00 24.38  ? 305 ARG 3 C     1 
ATOM   7047  O  O     . ARG C  3  305 ? 15.443   -56.210  328.786 1.00 28.83  ? 305 ARG 3 O     1 
ATOM   7048  C  CB    . ARG C  3  305 ? 13.109   -55.471  331.052 1.00 20.32  ? 305 ARG 3 CB    1 
ATOM   7049  C  CG    . ARG C  3  305 ? 13.218   -54.124  330.345 1.00 20.44  ? 305 ARG 3 CG    1 
ATOM   7050  C  CD    . ARG C  3  305 ? 12.049   -53.248  330.759 1.00 8.49   ? 305 ARG 3 CD    1 
ATOM   7051  N  NE    . ARG C  3  305 ? 10.781   -53.895  330.469 1.00 23.36  ? 305 ARG 3 NE    1 
ATOM   7052  C  CZ    . ARG C  3  305 ? 9.592    -53.350  330.704 1.00 25.28  ? 305 ARG 3 CZ    1 
ATOM   7053  N  NH1   . ARG C  3  305 ? 9.498    -52.139  331.247 1.00 25.67  ? 305 ARG 3 NH1   1 
ATOM   7054  N  NH2   . ARG C  3  305 ? 8.490    -54.020  330.398 1.00 23.04  ? 305 ARG 3 NH2   1 
ATOM   7055  N  N     . LEU C  3  306 ? 13.785   -57.732  328.990 1.00 23.52  ? 306 LEU 3 N     1 
ATOM   7056  C  CA    . LEU C  3  306 ? 14.045   -58.404  327.722 1.00 17.10  ? 306 LEU 3 CA    1 
ATOM   7057  C  C     . LEU C  3  306 ? 13.472   -57.595  326.571 1.00 9.65   ? 306 LEU 3 C     1 
ATOM   7058  O  O     . LEU C  3  306 ? 12.273   -57.307  326.549 1.00 9.11   ? 306 LEU 3 O     1 
ATOM   7059  C  CB    . LEU C  3  306 ? 13.450   -59.824  327.753 1.00 21.38  ? 306 LEU 3 CB    1 
ATOM   7060  C  CG    . LEU C  3  306 ? 13.380   -60.726  326.510 1.00 22.09  ? 306 LEU 3 CG    1 
ATOM   7061  C  CD1   . LEU C  3  306 ? 14.739   -61.224  326.051 1.00 29.75  ? 306 LEU 3 CD1   1 
ATOM   7062  C  CD2   . LEU C  3  306 ? 12.476   -61.894  326.744 1.00 20.56  ? 306 LEU 3 CD2   1 
ATOM   7063  N  N     . LYS C  3  307 ? 14.323   -57.269  325.601 1.00 8.96   ? 307 LYS 3 N     1 
ATOM   7064  C  CA    . LYS C  3  307 ? 13.932   -56.397  324.510 1.00 17.23  ? 307 LYS 3 CA    1 
ATOM   7065  C  C     . LYS C  3  307 ? 14.023   -57.044  323.132 1.00 15.01  ? 307 LYS 3 C     1 
ATOM   7066  O  O     . LYS C  3  307 ? 13.443   -56.512  322.179 1.00 12.71  ? 307 LYS 3 O     1 
ATOM   7067  C  CB    . LYS C  3  307 ? 14.778   -55.107  324.544 1.00 21.20  ? 307 LYS 3 CB    1 
ATOM   7068  C  CG    . LYS C  3  307 ? 14.583   -54.251  325.811 1.00 19.50  ? 307 LYS 3 CG    1 
ATOM   7069  C  CD    . LYS C  3  307 ? 15.463   -53.039  325.771 1.00 20.22  ? 307 LYS 3 CD    1 
ATOM   7070  C  CE    . LYS C  3  307 ? 15.366   -52.419  324.407 1.00 29.79  ? 307 LYS 3 CE    1 
ATOM   7071  N  NZ    . LYS C  3  307 ? 16.344   -51.334  324.254 1.00 42.80  ? 307 LYS 3 NZ    1 
ATOM   7072  N  N     . THR C  3  308 ? 14.666   -58.195  323.001 1.00 18.02  ? 308 THR 3 N     1 
ATOM   7073  C  CA    . THR C  3  308 ? 14.673   -58.834  321.696 1.00 16.19  ? 308 THR 3 CA    1 
ATOM   7074  C  C     . THR C  3  308 ? 14.214   -60.280  321.848 1.00 10.03  ? 308 THR 3 C     1 
ATOM   7075  O  O     . THR C  3  308 ? 14.620   -60.978  322.792 1.00 9.78   ? 308 THR 3 O     1 
ATOM   7076  C  CB    . THR C  3  308 ? 16.061   -58.748  321.028 1.00 21.58  ? 308 THR 3 CB    1 
ATOM   7077  O  OG1   . THR C  3  308 ? 17.056   -59.342  321.870 1.00 27.53  ? 308 THR 3 OG1   1 
ATOM   7078  C  CG2   . THR C  3  308 ? 16.429   -57.302  320.768 1.00 18.95  ? 308 THR 3 CG2   1 
ATOM   7079  N  N     . PRO C  3  309 ? 13.344   -60.754  320.957 1.00 10.77  ? 309 PRO 3 N     1 
ATOM   7080  C  CA    . PRO C  3  309 ? 12.890   -62.135  321.074 1.00 7.50   ? 309 PRO 3 CA    1 
ATOM   7081  C  C     . PRO C  3  309 ? 14.067   -63.076  320.935 1.00 21.77  ? 309 PRO 3 C     1 
ATOM   7082  O  O     . PRO C  3  309 ? 15.027   -62.804  320.208 1.00 15.18  ? 309 PRO 3 O     1 
ATOM   7083  C  CB    . PRO C  3  309 ? 11.891   -62.288  319.920 1.00 8.78   ? 309 PRO 3 CB    1 
ATOM   7084  C  CG    . PRO C  3  309 ? 12.219   -61.202  318.979 1.00 7.39   ? 309 PRO 3 CG    1 
ATOM   7085  C  CD    . PRO C  3  309 ? 12.725   -60.071  319.809 1.00 12.89  ? 309 PRO 3 CD    1 
ATOM   7086  N  N     . LEU C  3  310 ? 14.022   -64.143  321.718 1.00 21.24  ? 310 LEU 3 N     1 
ATOM   7087  C  CA    . LEU C  3  310 ? 15.010   -65.200  321.663 1.00 23.95  ? 310 LEU 3 CA    1 
ATOM   7088  C  C     . LEU C  3  310 ? 14.356   -66.449  321.093 1.00 17.62  ? 310 LEU 3 C     1 
ATOM   7089  O  O     . LEU C  3  310 ? 13.160   -66.698  321.282 1.00 8.66   ? 310 LEU 3 O     1 
ATOM   7090  C  CB    . LEU C  3  310 ? 15.637   -65.488  323.038 1.00 24.83  ? 310 LEU 3 CB    1 
ATOM   7091  C  CG    . LEU C  3  310 ? 16.334   -64.289  323.700 1.00 30.16  ? 310 LEU 3 CG    1 
ATOM   7092  C  CD1   . LEU C  3  310 ? 16.919   -64.660  325.067 1.00 31.31  ? 310 LEU 3 CD1   1 
ATOM   7093  C  CD2   . LEU C  3  310 ? 17.407   -63.706  322.766 1.00 31.43  ? 310 LEU 3 CD2   1 
ATOM   7094  N  N     . VAL C  3  311 ? 15.173   -67.214  320.378 1.00 20.08  ? 311 VAL 3 N     1 
ATOM   7095  C  CA    . VAL C  3  311 ? 14.790   -68.473  319.768 1.00 17.22  ? 311 VAL 3 CA    1 
ATOM   7096  C  C     . VAL C  3  311 ? 15.874   -69.477  320.098 1.00 14.19  ? 311 VAL 3 C     1 
ATOM   7097  O  O     . VAL C  3  311 ? 17.048   -69.122  320.238 1.00 14.55  ? 311 VAL 3 O     1 
ATOM   7098  C  CB    . VAL C  3  311 ? 14.598   -68.363  318.232 1.00 19.50  ? 311 VAL 3 CB    1 
ATOM   7099  C  CG1   . VAL C  3  311 ? 15.941   -68.101  317.516 1.00 15.47  ? 311 VAL 3 CG1   1 
ATOM   7100  C  CG2   . VAL C  3  311 ? 13.891   -69.638  317.678 1.00 19.39  ? 311 VAL 3 CG2   1 
ATOM   7101  N  N     . ARG C  3  312 ? 15.455   -70.719  320.310 1.00 15.11  ? 312 ARG 3 N     1 
ATOM   7102  C  CA    . ARG C  3  312 ? 16.366   -71.813  320.608 1.00 14.89  ? 312 ARG 3 CA    1 
ATOM   7103  C  C     . ARG C  3  312 ? 16.738   -72.530  319.325 1.00 16.61  ? 312 ARG 3 C     1 
ATOM   7104  O  O     . ARG C  3  312 ? 15.868   -73.103  318.659 1.00 14.30  ? 312 ARG 3 O     1 
ATOM   7105  C  CB    . ARG C  3  312 ? 15.738   -72.784  321.597 1.00 15.88  ? 312 ARG 3 CB    1 
ATOM   7106  C  CG    . ARG C  3  312 ? 16.597   -73.983  321.868 1.00 18.02  ? 312 ARG 3 CG    1 
ATOM   7107  C  CD    . ARG C  3  312 ? 16.182   -74.674  323.153 1.00 23.32  ? 312 ARG 3 CD    1 
ATOM   7108  N  NE    . ARG C  3  312 ? 16.326   -73.825  324.330 1.00 23.96  ? 312 ARG 3 NE    1 
ATOM   7109  C  CZ    . ARG C  3  312 ? 16.247   -74.290  325.577 1.00 25.56  ? 312 ARG 3 CZ    1 
ATOM   7110  N  NH1   . ARG C  3  312 ? 15.987   -75.580  325.800 1.00 26.72  ? 312 ARG 3 NH1   1 
ATOM   7111  N  NH2   . ARG C  3  312 ? 16.418   -73.467  326.606 1.00 22.53  ? 312 ARG 3 NH2   1 
ATOM   7112  N  N     . LYS C  3  313 ? 18.017   -72.493  318.969 1.00 18.08  ? 313 LYS 3 N     1 
ATOM   7113  C  CA    . LYS C  3  313 ? 18.458   -73.172  317.765 1.00 31.78  ? 313 LYS 3 CA    1 
ATOM   7114  C  C     . LYS C  3  313 ? 19.387   -74.346  318.069 1.00 52.08  ? 313 LYS 3 C     1 
ATOM   7115  O  O     . LYS C  3  313 ? 19.061   -75.507  317.774 1.00 52.47  ? 313 LYS 3 O     1 
ATOM   7116  C  CB    . LYS C  3  313 ? 19.131   -72.158  316.833 1.00 18.75  ? 313 LYS 3 CB    1 
ATOM   7117  C  CG    . LYS C  3  313 ? 18.951   -72.495  315.369 1.00 15.16  ? 313 LYS 3 CG    1 
ATOM   7118  C  CD    . LYS C  3  313 ? 17.562   -72.108  314.871 1.00 9.34   ? 313 LYS 3 CD    1 
ATOM   7119  C  CE    . LYS C  3  313 ? 17.595   -71.844  313.368 1.00 14.61  ? 313 LYS 3 CE    1 
ATOM   7120  N  NZ    . LYS C  3  313 ? 16.767   -70.691  312.928 1.00 15.77  ? 313 LYS 3 NZ    1 
ATOM   7121  N  N     . GLU C  3  314 ? 20.542   -74.086  318.670 1.00 65.16  ? 314 GLU 3 N     1 
ATOM   7122  C  CA    . GLU C  3  314 ? 21.419   -75.151  319.151 1.00 70.67  ? 314 GLU 3 CA    1 
ATOM   7123  C  C     . GLU C  3  314 ? 21.318   -75.291  320.667 1.00 59.95  ? 314 GLU 3 C     1 
ATOM   7124  O  O     . GLU C  3  314 ? 22.284   -75.089  321.403 1.00 62.51  ? 314 GLU 3 O     1 
ATOM   7125  C  CB    . GLU C  3  314 ? 22.855   -74.892  318.703 1.00 84.19  ? 314 GLU 3 CB    1 
ATOM   7126  C  CG    . GLU C  3  314 ? 22.981   -74.682  317.209 1.00 96.34  ? 314 GLU 3 CG    1 
ATOM   7127  C  CD    . GLU C  3  314 ? 22.993   -75.998  316.458 1.00 105.11 ? 314 GLU 3 CD    1 
ATOM   7128  O  OE1   . GLU C  3  314 ? 23.876   -76.837  316.740 1.00 109.13 ? 314 GLU 3 OE1   1 
ATOM   7129  O  OE2   . GLU C  3  314 ? 22.108   -76.204  315.601 1.00 109.20 ? 314 GLU 3 OE2   1 
ATOM   7130  N  N     . GLY C  3  315 ? 20.126   -75.633  321.137 1.00 49.37  ? 315 GLY 3 N     1 
ATOM   7131  C  CA    . GLY C  3  315 ? 19.922   -75.751  322.566 1.00 44.58  ? 315 GLY 3 CA    1 
ATOM   7132  C  C     . GLY C  3  315 ? 20.284   -74.523  323.381 1.00 43.81  ? 315 GLY 3 C     1 
ATOM   7133  O  O     . GLY C  3  315 ? 20.542   -74.659  324.583 1.00 41.27  ? 315 GLY 3 O     1 
ATOM   7134  N  N     . ARG C  3  316 ? 20.340   -73.342  322.747 1.00 42.73  ? 316 ARG 3 N     1 
ATOM   7135  C  CA    . ARG C  3  316 ? 20.615   -72.068  323.419 1.00 37.90  ? 316 ARG 3 CA    1 
ATOM   7136  C  C     . ARG C  3  316 ? 19.822   -70.962  322.738 1.00 30.48  ? 316 ARG 3 C     1 
ATOM   7137  O  O     . ARG C  3  316 ? 19.417   -71.092  321.580 1.00 36.38  ? 316 ARG 3 O     1 
ATOM   7138  C  CB    . ARG C  3  316 ? 22.101   -71.688  323.376 1.00 32.35  ? 316 ARG 3 CB    1 
ATOM   7139  C  CG    . ARG C  3  316 ? 22.636   -71.360  321.980 1.00 29.69  ? 316 ARG 3 CG    1 
ATOM   7140  C  CD    . ARG C  3  316 ? 23.816   -70.416  322.107 1.00 25.87  ? 316 ARG 3 CD    1 
ATOM   7141  N  NE    . ARG C  3  316 ? 24.205   -69.801  320.847 1.00 18.82  ? 316 ARG 3 NE    1 
ATOM   7142  C  CZ    . ARG C  3  316 ? 24.718   -68.580  320.744 1.00 10.94  ? 316 ARG 3 CZ    1 
ATOM   7143  N  NH1   . ARG C  3  316 ? 24.910   -67.847  321.832 1.00 15.02  ? 316 ARG 3 NH1   1 
ATOM   7144  N  NH2   . ARG C  3  316 ? 25.048   -68.094  319.556 1.00 9.58   ? 316 ARG 3 NH2   1 
ATOM   7145  N  N     . LEU C  3  317 ? 19.658   -69.845  323.443 1.00 25.88  ? 317 LEU 3 N     1 
ATOM   7146  C  CA    . LEU C  3  317 ? 18.796   -68.764  322.978 1.00 29.89  ? 317 LEU 3 CA    1 
ATOM   7147  C  C     . LEU C  3  317 ? 19.604   -67.721  322.207 1.00 35.80  ? 317 LEU 3 C     1 
ATOM   7148  O  O     . LEU C  3  317 ? 20.664   -67.281  322.668 1.00 39.59  ? 317 LEU 3 O     1 
ATOM   7149  C  CB    . LEU C  3  317 ? 18.071   -68.105  324.157 1.00 33.10  ? 317 LEU 3 CB    1 
ATOM   7150  C  CG    . LEU C  3  317 ? 16.945   -68.839  324.909 1.00 29.89  ? 317 LEU 3 CG    1 
ATOM   7151  C  CD1   . LEU C  3  317 ? 15.886   -69.335  323.936 1.00 24.58  ? 317 LEU 3 CD1   1 
ATOM   7152  C  CD2   . LEU C  3  317 ? 17.449   -69.973  325.802 1.00 31.41  ? 317 LEU 3 CD2   1 
ATOM   7153  N  N     . VAL C  3  318 ? 19.093   -67.322  321.038 1.00 35.86  ? 318 VAL 3 N     1 
ATOM   7154  C  CA    . VAL C  3  318 ? 19.737   -66.354  320.150 1.00 37.17  ? 318 VAL 3 CA    1 
ATOM   7155  C  C     . VAL C  3  318 ? 18.685   -65.333  319.742 1.00 35.12  ? 318 VAL 3 C     1 
ATOM   7156  O  O     . VAL C  3  318 ? 17.516   -65.690  319.559 1.00 41.12  ? 318 VAL 3 O     1 
ATOM   7157  C  CB    . VAL C  3  318 ? 20.340   -67.036  318.896 1.00 35.24  ? 318 VAL 3 CB    1 
ATOM   7158  C  CG1   . VAL C  3  318 ? 21.005   -66.017  317.958 1.00 33.30  ? 318 VAL 3 CG1   1 
ATOM   7159  C  CG2   . VAL C  3  318 ? 21.300   -68.157  319.294 1.00 37.41  ? 318 VAL 3 CG2   1 
ATOM   7160  N  N     . GLU C  3  319 ? 19.089   -64.062  319.641 1.00 29.19  ? 319 GLU 3 N     1 
ATOM   7161  C  CA    . GLU C  3  319 ? 18.172   -63.020  319.189 1.00 24.73  ? 319 GLU 3 CA    1 
ATOM   7162  C  C     . GLU C  3  319 ? 17.621   -63.390  317.821 1.00 14.43  ? 319 GLU 3 C     1 
ATOM   7163  O  O     . GLU C  3  319 ? 18.360   -63.835  316.939 1.00 12.16  ? 319 GLU 3 O     1 
ATOM   7164  C  CB    . GLU C  3  319 ? 18.876   -61.662  319.078 1.00 32.02  ? 319 GLU 3 CB    1 
ATOM   7165  C  CG    . GLU C  3  319 ? 19.541   -61.143  320.332 1.00 33.65  ? 319 GLU 3 CG    1 
ATOM   7166  C  CD    . GLU C  3  319 ? 20.715   -60.241  320.000 1.00 32.32  ? 319 GLU 3 CD    1 
ATOM   7167  O  OE1   . GLU C  3  319 ? 21.345   -60.446  318.936 1.00 30.76  ? 319 GLU 3 OE1   1 
ATOM   7168  O  OE2   . GLU C  3  319 ? 21.021   -59.348  320.813 1.00 31.45  ? 319 GLU 3 OE2   1 
ATOM   7169  N  N     . ALA C  3  320 ? 16.336   -63.118  317.615 1.00 8.75   ? 320 ALA 3 N     1 
ATOM   7170  C  CA    . ALA C  3  320 ? 15.665   -63.533  316.396 1.00 8.75   ? 320 ALA 3 CA    1 
ATOM   7171  C  C     . ALA C  3  320 ? 14.715   -62.457  315.916 1.00 9.03   ? 320 ALA 3 C     1 
ATOM   7172  O  O     . ALA C  3  320 ? 14.183   -61.679  316.710 1.00 8.55   ? 320 ALA 3 O     1 
ATOM   7173  C  CB    . ALA C  3  320 ? 14.860   -64.822  316.596 1.00 8.86   ? 320 ALA 3 CB    1 
ATOM   7174  N  N     . THR C  3  321 ? 14.464   -62.461  314.610 1.00 13.04  ? 321 THR 3 N     1 
ATOM   7175  C  CA    . THR C  3  321 ? 13.425   -61.607  314.065 1.00 15.99  ? 321 THR 3 CA    1 
ATOM   7176  C  C     . THR C  3  321 ? 12.067   -62.156  314.472 1.00 18.96  ? 321 THR 3 C     1 
ATOM   7177  O  O     . THR C  3  321 ? 11.904   -63.364  314.676 1.00 22.66  ? 321 THR 3 O     1 
ATOM   7178  C  CB    . THR C  3  321 ? 13.497   -61.561  312.538 1.00 11.32  ? 321 THR 3 CB    1 
ATOM   7179  O  OG1   . THR C  3  321 ? 14.861   -61.611  312.113 1.00 8.67   ? 321 THR 3 OG1   1 
ATOM   7180  C  CG2   . THR C  3  321 ? 12.898   -60.261  312.045 1.00 15.20  ? 321 THR 3 CG2   1 
ATOM   7181  N  N     . TRP C  3  322 ? 11.070   -61.266  314.561 1.00 19.53  ? 322 TRP 3 N     1 
ATOM   7182  C  CA    . TRP C  3  322 ? 9.716    -61.751  314.817 1.00 19.64  ? 322 TRP 3 CA    1 
ATOM   7183  C  C     . TRP C  3  322 ? 9.276    -62.715  313.727 1.00 25.88  ? 322 TRP 3 C     1 
ATOM   7184  O  O     . TRP C  3  322 ? 8.618    -63.721  314.018 1.00 27.60  ? 322 TRP 3 O     1 
ATOM   7185  C  CB    . TRP C  3  322 ? 8.732    -60.572  314.957 1.00 15.61  ? 322 TRP 3 CB    1 
ATOM   7186  C  CG    . TRP C  3  322 ? 8.771    -59.952  316.341 1.00 13.38  ? 322 TRP 3 CG    1 
ATOM   7187  C  CD1   . TRP C  3  322 ? 9.641    -59.000  316.786 1.00 11.87  ? 322 TRP 3 CD1   1 
ATOM   7188  C  CD2   . TRP C  3  322 ? 7.884    -60.226  317.444 1.00 10.51  ? 322 TRP 3 CD2   1 
ATOM   7189  N  NE1   . TRP C  3  322 ? 9.381    -58.696  318.104 1.00 10.00  ? 322 TRP 3 NE1   1 
ATOM   7190  C  CE2   . TRP C  3  322 ? 8.305    -59.428  318.528 1.00 11.74  ? 322 TRP 3 CE2   1 
ATOM   7191  C  CE3   . TRP C  3  322 ? 6.789    -61.079  317.627 1.00 12.55  ? 322 TRP 3 CE3   1 
ATOM   7192  C  CZ2   . TRP C  3  322 ? 7.668    -59.455  319.771 1.00 13.07  ? 322 TRP 3 CZ2   1 
ATOM   7193  C  CZ3   . TRP C  3  322 ? 6.156    -61.101  318.868 1.00 10.92  ? 322 TRP 3 CZ3   1 
ATOM   7194  C  CH2   . TRP C  3  322 ? 6.598    -60.295  319.918 1.00 13.54  ? 322 TRP 3 CH2   1 
ATOM   7195  N  N     . GLU C  3  323 ? 9.739    -62.494  312.492 1.00 30.86  ? 323 GLU 3 N     1 
ATOM   7196  C  CA    . GLU C  3  323 ? 9.428    -63.404  311.394 1.00 37.59  ? 323 GLU 3 CA    1 
ATOM   7197  C  C     . GLU C  3  323 ? 9.987    -64.801  311.636 1.00 33.79  ? 323 GLU 3 C     1 
ATOM   7198  O  O     . GLU C  3  323 ? 9.273    -65.794  311.481 1.00 28.33  ? 323 GLU 3 O     1 
ATOM   7199  C  CB    . GLU C  3  323 ? 9.991    -62.858  310.081 1.00 44.42  ? 323 GLU 3 CB    1 
ATOM   7200  C  CG    . GLU C  3  323 ? 9.600    -61.442  309.699 1.00 49.07  ? 323 GLU 3 CG    1 
ATOM   7201  C  CD    . GLU C  3  323 ? 9.660    -61.250  308.193 1.00 55.93  ? 323 GLU 3 CD    1 
ATOM   7202  O  OE1   . GLU C  3  323 ? 10.601   -61.777  307.559 1.00 59.84  ? 323 GLU 3 OE1   1 
ATOM   7203  O  OE2   . GLU C  3  323 ? 8.773    -60.579  307.636 1.00 58.19  ? 323 GLU 3 OE2   1 
ATOM   7204  N  N     . GLU C  3  324 ? 11.273   -64.902  311.999 1.00 38.38  ? 324 GLU 3 N     1 
ATOM   7205  C  CA    . GLU C  3  324 ? 11.874   -66.222  312.197 1.00 41.35  ? 324 GLU 3 CA    1 
ATOM   7206  C  C     . GLU C  3  324 ? 11.308   -66.912  313.432 1.00 39.32  ? 324 GLU 3 C     1 
ATOM   7207  O  O     . GLU C  3  324 ? 11.117   -68.138  313.438 1.00 41.00  ? 324 GLU 3 O     1 
ATOM   7208  C  CB    . GLU C  3  324 ? 13.400   -66.123  312.290 1.00 44.10  ? 324 GLU 3 CB    1 
ATOM   7209  C  CG    . GLU C  3  324 ? 14.098   -65.838  310.961 1.00 44.83  ? 324 GLU 3 CG    1 
ATOM   7210  C  CD    . GLU C  3  324 ? 15.602   -65.721  311.114 1.00 47.15  ? 324 GLU 3 CD    1 
ATOM   7211  O  OE1   . GLU C  3  324 ? 16.168   -66.435  311.970 1.00 47.58  ? 324 GLU 3 OE1   1 
ATOM   7212  O  OE2   . GLU C  3  324 ? 16.223   -64.929  310.374 1.00 48.66  ? 324 GLU 3 OE2   1 
ATOM   7213  N  N     . ALA C  3  325 ? 11.008   -66.136  314.475 1.00 31.95  ? 325 ALA 3 N     1 
ATOM   7214  C  CA    . ALA C  3  325 ? 10.375   -66.710  315.654 1.00 27.82  ? 325 ALA 3 CA    1 
ATOM   7215  C  C     . ALA C  3  325 ? 9.021    -67.306  315.290 1.00 26.81  ? 325 ALA 3 C     1 
ATOM   7216  O  O     . ALA C  3  325 ? 8.694    -68.431  315.692 1.00 21.51  ? 325 ALA 3 O     1 
ATOM   7217  C  CB    . ALA C  3  325 ? 10.228   -65.639  316.736 1.00 25.77  ? 325 ALA 3 CB    1 
ATOM   7218  N  N     . PHE C  3  326 ? 8.239    -66.576  314.483 1.00 28.77  ? 326 PHE 3 N     1 
ATOM   7219  C  CA    . PHE C  3  326 ? 6.944    -67.075  314.028 1.00 28.37  ? 326 PHE 3 CA    1 
ATOM   7220  C  C     . PHE C  3  326 ? 7.092    -68.261  313.065 1.00 32.92  ? 326 PHE 3 C     1 
ATOM   7221  O  O     . PHE C  3  326 ? 6.219    -69.135  313.023 1.00 36.47  ? 326 PHE 3 O     1 
ATOM   7222  C  CB    . PHE C  3  326 ? 6.132    -65.945  313.379 1.00 23.34  ? 326 PHE 3 CB    1 
ATOM   7223  C  CG    . PHE C  3  326 ? 4.816    -66.410  312.800 1.00 24.88  ? 326 PHE 3 CG    1 
ATOM   7224  C  CD1   . PHE C  3  326 ? 3.979    -67.246  313.529 1.00 8.23   ? 326 PHE 3 CD1   1 
ATOM   7225  C  CD2   . PHE C  3  326 ? 4.431    -66.046  311.519 1.00 19.44  ? 326 PHE 3 CD2   1 
ATOM   7226  C  CE1   . PHE C  3  326 ? 2.794    -67.686  313.003 1.00 8.19   ? 326 PHE 3 CE1   1 
ATOM   7227  C  CE2   . PHE C  3  326 ? 3.229    -66.503  310.989 1.00 15.62  ? 326 PHE 3 CE2   1 
ATOM   7228  C  CZ    . PHE C  3  326 ? 2.418    -67.318  311.737 1.00 14.26  ? 326 PHE 3 CZ    1 
ATOM   7229  N  N     . LEU C  3  327 ? 8.166    -68.313  312.276 1.00 30.70  ? 327 LEU 3 N     1 
ATOM   7230  C  CA    . LEU C  3  327 ? 8.416    -69.514  311.480 1.00 24.88  ? 327 LEU 3 CA    1 
ATOM   7231  C  C     . LEU C  3  327 ? 8.601    -70.724  312.378 1.00 28.98  ? 327 LEU 3 C     1 
ATOM   7232  O  O     . LEU C  3  327 ? 7.965    -71.768  312.177 1.00 28.41  ? 327 LEU 3 O     1 
ATOM   7233  C  CB    . LEU C  3  327 ? 9.639    -69.342  310.579 1.00 18.84  ? 327 LEU 3 CB    1 
ATOM   7234  C  CG    . LEU C  3  327 ? 9.331    -69.020  309.115 1.00 11.34  ? 327 LEU 3 CG    1 
ATOM   7235  C  CD1   . LEU C  3  327 ? 10.562   -69.210  308.241 1.00 8.85   ? 327 LEU 3 CD1   1 
ATOM   7236  C  CD2   . LEU C  3  327 ? 8.189    -69.910  308.615 1.00 15.65  ? 327 LEU 3 CD2   1 
ATOM   7237  N  N     . ALA C  3  328 ? 9.484    -70.601  313.372 1.00 30.38  ? 328 ALA 3 N     1 
ATOM   7238  C  CA    . ALA C  3  328 ? 9.704    -71.701  314.311 1.00 34.20  ? 328 ALA 3 CA    1 
ATOM   7239  C  C     . ALA C  3  328 ? 8.408    -72.072  315.030 1.00 30.24  ? 328 ALA 3 C     1 
ATOM   7240  O  O     . ALA C  3  328 ? 8.165    -73.252  315.312 1.00 29.35  ? 328 ALA 3 O     1 
ATOM   7241  C  CB    . ALA C  3  328 ? 10.811   -71.320  315.302 1.00 34.99  ? 328 ALA 3 CB    1 
ATOM   7242  N  N     . LEU C  3  329 ? 7.571    -71.062  315.297 1.00 27.18  ? 329 LEU 3 N     1 
ATOM   7243  C  CA    . LEU C  3  329 ? 6.250    -71.205  315.917 1.00 19.90  ? 329 LEU 3 CA    1 
ATOM   7244  C  C     . LEU C  3  329 ? 5.296    -72.039  315.055 1.00 18.01  ? 329 LEU 3 C     1 
ATOM   7245  O  O     . LEU C  3  329 ? 4.586    -72.922  315.557 1.00 17.56  ? 329 LEU 3 O     1 
ATOM   7246  C  CB    . LEU C  3  329 ? 5.690    -69.798  316.139 1.00 16.79  ? 329 LEU 3 CB    1 
ATOM   7247  C  CG    . LEU C  3  329 ? 4.816    -69.375  317.310 1.00 11.11  ? 329 LEU 3 CG    1 
ATOM   7248  C  CD1   . LEU C  3  329 ? 5.641    -69.188  318.581 1.00 16.99  ? 329 LEU 3 CD1   1 
ATOM   7249  C  CD2   . LEU C  3  329 ? 4.026    -68.109  316.941 1.00 8.22   ? 329 LEU 3 CD2   1 
ATOM   7250  N  N     . LYS C  3  330 ? 5.200    -71.696  313.766 1.00 16.59  ? 330 LYS 3 N     1 
ATOM   7251  C  CA    . LYS C  3  330 ? 4.424    -72.479  312.809 1.00 26.04  ? 330 LYS 3 CA    1 
ATOM   7252  C  C     . LYS C  3  330 ? 4.902    -73.924  312.752 1.00 39.18  ? 330 LYS 3 C     1 
ATOM   7253  O  O     . LYS C  3  330 ? 4.098    -74.867  312.777 1.00 44.11  ? 330 LYS 3 O     1 
ATOM   7254  C  CB    . LYS C  3  330 ? 4.566    -71.870  311.419 1.00 30.44  ? 330 LYS 3 CB    1 
ATOM   7255  C  CG    . LYS C  3  330 ? 3.710    -70.689  311.115 1.00 36.53  ? 330 LYS 3 CG    1 
ATOM   7256  C  CD    . LYS C  3  330 ? 3.892    -70.324  309.653 1.00 40.92  ? 330 LYS 3 CD    1 
ATOM   7257  C  CE    . LYS C  3  330 ? 2.844    -69.350  309.180 1.00 43.13  ? 330 LYS 3 CE    1 
ATOM   7258  N  NZ    . LYS C  3  330 ? 3.432    -68.384  308.206 1.00 47.05  ? 330 LYS 3 NZ    1 
ATOM   7259  N  N     . GLU C  3  331 ? 6.217    -74.118  312.633 1.00 38.27  ? 331 GLU 3 N     1 
ATOM   7260  C  CA    . GLU C  3  331 ? 6.708    -75.478  312.469 1.00 33.33  ? 331 GLU 3 CA    1 
ATOM   7261  C  C     . GLU C  3  331 ? 6.475    -76.279  313.733 1.00 28.52  ? 331 GLU 3 C     1 
ATOM   7262  O  O     . GLU C  3  331 ? 5.984    -77.410  313.666 1.00 34.53  ? 331 GLU 3 O     1 
ATOM   7263  C  CB    . GLU C  3  331 ? 8.181    -75.479  312.046 1.00 35.48  ? 331 GLU 3 CB    1 
ATOM   7264  C  CG    . GLU C  3  331 ? 8.746    -76.882  311.725 1.00 42.31  ? 331 GLU 3 CG    1 
ATOM   7265  C  CD    . GLU C  3  331 ? 8.259    -77.475  310.402 1.00 41.89  ? 331 GLU 3 CD    1 
ATOM   7266  O  OE1   . GLU C  3  331 ? 7.623    -76.750  309.614 1.00 40.82  ? 331 GLU 3 OE1   1 
ATOM   7267  O  OE2   . GLU C  3  331 ? 8.529    -78.673  310.146 1.00 39.98  ? 331 GLU 3 OE2   1 
ATOM   7268  N  N     . GLY C  3  332 ? 6.681    -75.659  314.896 1.00 21.67  ? 332 GLY 3 N     1 
ATOM   7269  C  CA    . GLY C  3  332 ? 6.533    -76.379  316.146 1.00 17.16  ? 332 GLY 3 CA    1 
ATOM   7270  C  C     . GLY C  3  332 ? 5.099    -76.667  316.526 1.00 8.80   ? 332 GLY 3 C     1 
ATOM   7271  O  O     . GLY C  3  332 ? 4.835    -77.620  317.261 1.00 10.04  ? 332 GLY 3 O     1 
ATOM   7272  N  N     . LEU C  3  333 ? 4.158    -75.855  316.063 1.00 8.66   ? 333 LEU 3 N     1 
ATOM   7273  C  CA    . LEU C  3  333 ? 2.765    -76.101  316.403 1.00 15.57  ? 333 LEU 3 CA    1 
ATOM   7274  C  C     . LEU C  3  333 ? 1.949    -76.694  315.256 1.00 11.16  ? 333 LEU 3 C     1 
ATOM   7275  O  O     . LEU C  3  333 ? 0.755    -76.941  315.441 1.00 8.52   ? 333 LEU 3 O     1 
ATOM   7276  C  CB    . LEU C  3  333 ? 2.120    -74.793  316.895 1.00 16.68  ? 333 LEU 3 CB    1 
ATOM   7277  C  CG    . LEU C  3  333 ? 2.839    -74.040  318.028 1.00 16.49  ? 333 LEU 3 CG    1 
ATOM   7278  C  CD1   . LEU C  3  333 ? 2.155    -72.712  318.329 1.00 13.96  ? 333 LEU 3 CD1   1 
ATOM   7279  C  CD2   . LEU C  3  333 ? 2.946    -74.895  319.276 1.00 21.89  ? 333 LEU 3 CD2   1 
ATOM   7280  N  N     . LYS C  3  334 ? 2.564    -76.969  314.099 1.00 23.91  ? 334 LYS 3 N     1 
ATOM   7281  C  CA    . LYS C  3  334 ? 1.812    -77.477  312.948 1.00 37.53  ? 334 LYS 3 CA    1 
ATOM   7282  C  C     . LYS C  3  334 ? 1.102    -78.788  313.263 1.00 39.86  ? 334 LYS 3 C     1 
ATOM   7283  O  O     . LYS C  3  334 ? -0.057   -78.990  312.881 1.00 44.35  ? 334 LYS 3 O     1 
ATOM   7284  C  CB    . LYS C  3  334 ? 2.741    -77.694  311.751 1.00 49.60  ? 334 LYS 3 CB    1 
ATOM   7285  C  CG    . LYS C  3  334 ? 2.023    -78.269  310.522 1.00 57.60  ? 334 LYS 3 CG    1 
ATOM   7286  C  CD    . LYS C  3  334 ? 2.984    -78.557  309.367 1.00 62.37  ? 334 LYS 3 CD    1 
ATOM   7287  C  CE    . LYS C  3  334 ? 3.833    -79.793  309.641 1.00 64.47  ? 334 LYS 3 CE    1 
ATOM   7288  N  NZ    . LYS C  3  334 ? 5.077    -79.511  310.413 1.00 66.78  ? 334 LYS 3 NZ    1 
ATOM   7289  N  N     . GLU C  3  335 ? 1.789    -79.700  313.939 1.00 37.35  ? 335 GLU 3 N     1 
ATOM   7290  C  CA    . GLU C  3  335 ? 1.263    -81.019  314.244 1.00 38.43  ? 335 GLU 3 CA    1 
ATOM   7291  C  C     . GLU C  3  335 ? 0.621    -81.074  315.624 1.00 38.51  ? 335 GLU 3 C     1 
ATOM   7292  O  O     . GLU C  3  335 ? 0.630    -82.121  316.277 1.00 43.96  ? 335 GLU 3 O     1 
ATOM   7293  C  CB    . GLU C  3  335 ? 2.375    -82.055  314.121 1.00 43.78  ? 335 GLU 3 CB    1 
ATOM   7294  C  CG    . GLU C  3  335 ? 2.612    -82.532  312.695 1.00 49.90  ? 335 GLU 3 CG    1 
ATOM   7295  C  CD    . GLU C  3  335 ? 1.427    -83.299  312.109 1.00 54.17  ? 335 GLU 3 CD    1 
ATOM   7296  O  OE1   . GLU C  3  335 ? 0.700    -83.978  312.871 1.00 54.46  ? 335 GLU 3 OE1   1 
ATOM   7297  O  OE2   . GLU C  3  335 ? 1.228    -83.232  310.878 1.00 55.78  ? 335 GLU 3 OE2   1 
ATOM   7298  N  N     . ALA C  3  336 ? 0.011    -79.983  316.060 1.00 32.12  ? 336 ALA 3 N     1 
ATOM   7299  C  CA    . ALA C  3  336 ? -0.517   -79.883  317.412 1.00 25.79  ? 336 ALA 3 CA    1 
ATOM   7300  C  C     . ALA C  3  336 ? -2.033   -80.045  317.364 1.00 19.44  ? 336 ALA 3 C     1 
ATOM   7301  O  O     . ALA C  3  336 ? -2.702   -79.394  316.552 1.00 18.67  ? 336 ALA 3 O     1 
ATOM   7302  C  CB    . ALA C  3  336 ? -0.123   -78.531  318.019 1.00 25.37  ? 336 ALA 3 CB    1 
ATOM   7303  N  N     . ARG C  3  337 ? -2.573   -80.929  318.211 1.00 13.05  ? 337 ARG 3 N     1 
ATOM   7304  C  CA    . ARG C  3  337 ? -4.024   -81.053  318.340 1.00 21.36  ? 337 ARG 3 CA    1 
ATOM   7305  C  C     . ARG C  3  337 ? -4.503   -80.150  319.466 1.00 8.32   ? 337 ARG 3 C     1 
ATOM   7306  O  O     . ARG C  3  337 ? -3.881   -80.089  320.526 1.00 8.34   ? 337 ARG 3 O     1 
ATOM   7307  C  CB    . ARG C  3  337 ? -4.497   -82.499  318.595 1.00 29.34  ? 337 ARG 3 CB    1 
ATOM   7308  C  CG    . ARG C  3  337 ? -3.927   -83.180  319.830 1.00 40.85  ? 337 ARG 3 CG    1 
ATOM   7309  C  CD    . ARG C  3  337 ? -2.541   -83.753  319.607 1.00 50.24  ? 337 ARG 3 CD    1 
ATOM   7310  N  NE    . ARG C  3  337 ? -2.358   -85.052  320.250 1.00 52.51  ? 337 ARG 3 NE    1 
ATOM   7311  C  CZ    . ARG C  3  337 ? -1.186   -85.687  320.335 1.00 51.93  ? 337 ARG 3 CZ    1 
ATOM   7312  N  NH1   . ARG C  3  337 ? -0.086   -85.167  319.793 1.00 51.21  ? 337 ARG 3 NH1   1 
ATOM   7313  N  NH2   . ARG C  3  337 ? -1.107   -86.849  320.964 1.00 51.44  ? 337 ARG 3 NH2   1 
ATOM   7314  N  N     . GLY C  3  338 ? -5.634   -79.479  319.238 1.00 8.23   ? 338 GLY 3 N     1 
ATOM   7315  C  CA    . GLY C  3  338 ? -6.053   -78.362  320.069 1.00 13.41  ? 338 GLY 3 CA    1 
ATOM   7316  C  C     . GLY C  3  338 ? -6.339   -78.701  321.518 1.00 16.24  ? 338 GLY 3 C     1 
ATOM   7317  O  O     . GLY C  3  338 ? -6.412   -77.783  322.347 1.00 8.03   ? 338 GLY 3 O     1 
ATOM   7318  N  N     . GLU C  3  339 ? -6.448   -79.983  321.856 1.00 23.70  ? 339 GLU 3 N     1 
ATOM   7319  C  CA    . GLU C  3  339 ? -6.656   -80.381  323.240 1.00 23.14  ? 339 GLU 3 CA    1 
ATOM   7320  C  C     . GLU C  3  339 ? -5.338   -80.631  323.957 1.00 23.90  ? 339 GLU 3 C     1 
ATOM   7321  O  O     . GLU C  3  339 ? -5.350   -81.024  325.126 1.00 31.44  ? 339 GLU 3 O     1 
ATOM   7322  C  CB    . GLU C  3  339 ? -7.542   -81.639  323.331 1.00 17.76  ? 339 GLU 3 CB    1 
ATOM   7323  C  CG    . GLU C  3  339 ? -6.865   -82.951  322.891 1.00 18.10  ? 339 GLU 3 CG    1 
ATOM   7324  C  CD    . GLU C  3  339 ? -7.160   -83.334  321.447 1.00 19.58  ? 339 GLU 3 CD    1 
ATOM   7325  O  OE1   . GLU C  3  339 ? -7.860   -82.572  320.753 1.00 18.98  ? 339 GLU 3 OE1   1 
ATOM   7326  O  OE2   . GLU C  3  339 ? -6.683   -84.399  321.004 1.00 22.03  ? 339 GLU 3 OE2   1 
ATOM   7327  N  N     . GLU C  3  340 ? -4.202   -80.363  323.314 1.00 18.88  ? 340 GLU 3 N     1 
ATOM   7328  C  CA    . GLU C  3  340 ? -2.932   -80.442  324.010 1.00 21.00  ? 340 GLU 3 CA    1 
ATOM   7329  C  C     . GLU C  3  340 ? -2.303   -79.078  324.235 1.00 24.11  ? 340 GLU 3 C     1 
ATOM   7330  O  O     . GLU C  3  340 ? -1.311   -78.994  324.964 1.00 28.25  ? 340 GLU 3 O     1 
ATOM   7331  C  CB    . GLU C  3  340 ? -1.934   -81.353  323.271 1.00 29.22  ? 340 GLU 3 CB    1 
ATOM   7332  C  CG    . GLU C  3  340 ? -2.345   -82.832  323.188 1.00 36.09  ? 340 GLU 3 CG    1 
ATOM   7333  C  CD    . GLU C  3  340 ? -2.828   -83.413  324.519 1.00 38.92  ? 340 GLU 3 CD    1 
ATOM   7334  O  OE1   . GLU C  3  340 ? -2.194   -83.165  325.569 1.00 38.61  ? 340 GLU 3 OE1   1 
ATOM   7335  O  OE2   . GLU C  3  340 ? -3.836   -84.153  324.505 1.00 38.24  ? 340 GLU 3 OE2   1 
ATOM   7336  N  N     . VAL C  3  341 ? -2.870   -78.013  323.663 1.00 22.22  ? 341 VAL 3 N     1 
ATOM   7337  C  CA    . VAL C  3  341 ? -2.355   -76.652  323.815 1.00 23.34  ? 341 VAL 3 CA    1 
ATOM   7338  C  C     . VAL C  3  341 ? -2.942   -76.030  325.075 1.00 25.76  ? 341 VAL 3 C     1 
ATOM   7339  O  O     . VAL C  3  341 ? -4.165   -76.008  325.261 1.00 33.24  ? 341 VAL 3 O     1 
ATOM   7340  C  CB    . VAL C  3  341 ? -2.687   -75.794  322.578 1.00 14.20  ? 341 VAL 3 CB    1 
ATOM   7341  C  CG1   . VAL C  3  341 ? -1.946   -74.486  322.624 1.00 13.72  ? 341 VAL 3 CG1   1 
ATOM   7342  C  CG2   . VAL C  3  341 ? -2.312   -76.525  321.291 1.00 8.22   ? 341 VAL 3 CG2   1 
ATOM   7343  N  N     . GLY C  3  342 ? -2.080   -75.470  325.915 1.00 24.51  ? 342 GLY 3 N     1 
ATOM   7344  C  CA    . GLY C  3  342 ? -2.510   -74.780  327.112 1.00 28.75  ? 342 GLY 3 CA    1 
ATOM   7345  C  C     . GLY C  3  342 ? -2.385   -73.279  326.939 1.00 35.01  ? 342 GLY 3 C     1 
ATOM   7346  O  O     . GLY C  3  342 ? -1.501   -72.791  326.227 1.00 38.51  ? 342 GLY 3 O     1 
ATOM   7347  N  N     . LEU C  3  343 ? -3.291   -72.549  327.592 1.00 28.43  ? 343 LEU 3 N     1 
ATOM   7348  C  CA    . LEU C  3  343 ? -3.287   -71.090  327.620 1.00 18.07  ? 343 LEU 3 CA    1 
ATOM   7349  C  C     . LEU C  3  343 ? -3.124   -70.676  329.070 1.00 14.99  ? 343 LEU 3 C     1 
ATOM   7350  O  O     . LEU C  3  343 ? -4.101   -70.605  329.823 1.00 12.83  ? 343 LEU 3 O     1 
ATOM   7351  C  CB    . LEU C  3  343 ? -4.560   -70.499  327.039 1.00 10.39  ? 343 LEU 3 CB    1 
ATOM   7352  C  CG    . LEU C  3  343 ? -4.785   -70.722  325.561 1.00 9.87   ? 343 LEU 3 CG    1 
ATOM   7353  C  CD1   . LEU C  3  343 ? -6.097   -70.067  325.151 1.00 13.34  ? 343 LEU 3 CD1   1 
ATOM   7354  C  CD2   . LEU C  3  343 ? -3.592   -70.156  324.783 1.00 7.73   ? 343 LEU 3 CD2   1 
ATOM   7355  N  N     . TYR C  3  344 ? -1.896   -70.365  329.449 1.00 15.32  ? 344 TYR 3 N     1 
ATOM   7356  C  CA    . TYR C  3  344 ? -1.584   -70.062  330.836 1.00 18.71  ? 344 TYR 3 CA    1 
ATOM   7357  C  C     . TYR C  3  344 ? -1.141   -68.607  330.857 1.00 31.60  ? 344 TYR 3 C     1 
ATOM   7358  O  O     . TYR C  3  344 ? -0.097   -68.267  330.291 1.00 35.73  ? 344 TYR 3 O     1 
ATOM   7359  C  CB    . TYR C  3  344 ? -0.485   -70.971  331.360 1.00 20.90  ? 344 TYR 3 CB    1 
ATOM   7360  C  CG    . TYR C  3  344 ? -0.847   -72.434  331.337 1.00 26.74  ? 344 TYR 3 CG    1 
ATOM   7361  C  CD1   . TYR C  3  344 ? -1.827   -72.942  332.166 1.00 30.24  ? 344 TYR 3 CD1   1 
ATOM   7362  C  CD2   . TYR C  3  344 ? -0.174   -73.329  330.510 1.00 29.68  ? 344 TYR 3 CD2   1 
ATOM   7363  C  CE1   . TYR C  3  344 ? -2.150   -74.310  332.148 1.00 30.59  ? 344 TYR 3 CE1   1 
ATOM   7364  C  CE2   . TYR C  3  344 ? -0.485   -74.693  330.495 1.00 27.61  ? 344 TYR 3 CE2   1 
ATOM   7365  C  CZ    . TYR C  3  344 ? -1.471   -75.175  331.313 1.00 26.45  ? 344 TYR 3 CZ    1 
ATOM   7366  O  OH    . TYR C  3  344 ? -1.777   -76.518  331.294 1.00 19.31  ? 344 TYR 3 OH    1 
ATOM   7367  N  N     . LEU C  3  345 ? -1.937   -67.747  331.485 1.00 29.72  ? 345 LEU 3 N     1 
ATOM   7368  C  CA    . LEU C  3  345 ? -1.658   -66.321  331.529 1.00 20.26  ? 345 LEU 3 CA    1 
ATOM   7369  C  C     . LEU C  3  345 ? -1.143   -65.915  332.902 1.00 17.07  ? 345 LEU 3 C     1 
ATOM   7370  O  O     . LEU C  3  345 ? -1.112   -66.696  333.859 1.00 7.55   ? 345 LEU 3 O     1 
ATOM   7371  C  CB    . LEU C  3  345 ? -2.900   -65.497  331.180 1.00 14.28  ? 345 LEU 3 CB    1 
ATOM   7372  C  CG    . LEU C  3  345 ? -3.715   -65.895  329.954 1.00 11.71  ? 345 LEU 3 CG    1 
ATOM   7373  C  CD1   . LEU C  3  345 ? -4.887   -64.957  329.836 1.00 12.73  ? 345 LEU 3 CD1   1 
ATOM   7374  C  CD2   . LEU C  3  345 ? -2.866   -65.853  328.713 1.00 7.47   ? 345 LEU 3 CD2   1 
ATOM   7375  N  N     . ALA C  3  346 ? -0.753   -64.650  332.978 1.00 27.67  ? 346 ALA 3 N     1 
ATOM   7376  C  CA    . ALA C  3  346 ? -0.294   -64.022  334.203 1.00 37.35  ? 346 ALA 3 CA    1 
ATOM   7377  C  C     . ALA C  3  346 ? -1.474   -63.493  335.010 1.00 39.62  ? 346 ALA 3 C     1 
ATOM   7378  O  O     . ALA C  3  346 ? -2.613   -63.442  334.542 1.00 39.19  ? 346 ALA 3 O     1 
ATOM   7379  C  CB    . ALA C  3  346 ? 0.672    -62.880  333.887 1.00 44.82  ? 346 ALA 3 CB    1 
ATOM   7380  N  N     . HIS C  3  347 ? -1.182   -63.109  336.253 1.00 37.06  ? 347 HIS 3 N     1 
ATOM   7381  C  CA    . HIS C  3  347 ? -2.205   -62.577  337.138 1.00 36.01  ? 347 HIS 3 CA    1 
ATOM   7382  C  C     . HIS C  3  347 ? -2.623   -61.162  336.741 1.00 44.00  ? 347 HIS 3 C     1 
ATOM   7383  O  O     . HIS C  3  347 ? -3.732   -60.729  337.085 1.00 49.56  ? 347 HIS 3 O     1 
ATOM   7384  C  CB    . HIS C  3  347 ? -1.695   -62.611  338.577 1.00 35.41  ? 347 HIS 3 CB    1 
ATOM   7385  C  CG    . HIS C  3  347 ? -0.723   -61.521  338.903 1.00 29.09  ? 347 HIS 3 CG    1 
ATOM   7386  N  ND1   . HIS C  3  347 ? -1.093   -60.370  339.576 1.00 34.57  ? 347 HIS 3 ND1   1 
ATOM   7387  C  CD2   . HIS C  3  347 ? 0.598    -61.394  338.631 1.00 33.21  ? 347 HIS 3 CD2   1 
ATOM   7388  C  CE1   . HIS C  3  347 ? -0.034   -59.595  339.726 1.00 29.75  ? 347 HIS 3 CE1   1 
ATOM   7389  N  NE2   . HIS C  3  347 ? 1.002    -60.193  339.161 1.00 33.00  ? 347 HIS 3 NE2   1 
ATOM   7390  N  N     . ASP C  3  348 ? -1.764   -60.431  336.037 1.00 40.53  ? 348 ASP 3 N     1 
ATOM   7391  C  CA    . ASP C  3  348 ? -2.102   -59.092  335.579 1.00 38.31  ? 348 ASP 3 CA    1 
ATOM   7392  C  C     . ASP C  3  348 ? -2.767   -59.104  334.212 1.00 27.04  ? 348 ASP 3 C     1 
ATOM   7393  O  O     . ASP C  3  348 ? -2.903   -58.045  333.594 1.00 21.88  ? 348 ASP 3 O     1 
ATOM   7394  C  CB    . ASP C  3  348 ? -0.856   -58.199  335.526 1.00 50.65  ? 348 ASP 3 CB    1 
ATOM   7395  C  CG    . ASP C  3  348 ? 0.290    -58.840  334.761 1.00 61.28  ? 348 ASP 3 CG    1 
ATOM   7396  O  OD1   . ASP C  3  348 ? 0.048    -59.411  333.676 1.00 64.35  ? 348 ASP 3 OD1   1 
ATOM   7397  O  OD2   . ASP C  3  348 ? 1.439    -58.775  335.240 1.00 65.40  ? 348 ASP 3 OD2   1 
ATOM   7398  N  N     . ALA C  3  349 ? -3.160   -60.267  333.714 1.00 22.41  ? 349 ALA 3 N     1 
ATOM   7399  C  CA    . ALA C  3  349 ? -3.771   -60.320  332.401 1.00 18.05  ? 349 ALA 3 CA    1 
ATOM   7400  C  C     . ALA C  3  349 ? -5.036   -59.471  332.411 1.00 11.95  ? 349 ALA 3 C     1 
ATOM   7401  O  O     . ALA C  3  349 ? -5.818   -59.502  333.364 1.00 7.84   ? 349 ALA 3 O     1 
ATOM   7402  C  CB    . ALA C  3  349 ? -4.085   -61.768  332.005 1.00 19.06  ? 349 ALA 3 CB    1 
ATOM   7403  N  N     . THR C  3  350 ? -5.150   -58.614  331.410 1.00 10.76  ? 350 THR 3 N     1 
ATOM   7404  C  CA    . THR C  3  350 ? -6.262   -57.700  331.268 1.00 13.16  ? 350 THR 3 CA    1 
ATOM   7405  C  C     . THR C  3  350 ? -7.555   -58.420  330.895 1.00 6.74   ? 350 THR 3 C     1 
ATOM   7406  O  O     . THR C  3  350 ? -7.566   -59.570  330.459 1.00 7.36   ? 350 THR 3 O     1 
ATOM   7407  C  CB    . THR C  3  350 ? -5.947   -56.691  330.182 1.00 21.73  ? 350 THR 3 CB    1 
ATOM   7408  O  OG1   . THR C  3  350 ? -5.941   -57.390  328.930 1.00 25.20  ? 350 THR 3 OG1   1 
ATOM   7409  C  CG2   . THR C  3  350 ? -4.587   -56.029  330.434 1.00 24.32  ? 350 THR 3 CG2   1 
ATOM   7410  N  N     . LEU C  3  351 ? -8.659   -57.688  331.038 1.00 9.63   ? 351 LEU 3 N     1 
ATOM   7411  C  CA    . LEU C  3  351 ? -9.960   -58.170  330.586 1.00 9.62   ? 351 LEU 3 CA    1 
ATOM   7412  C  C     . LEU C  3  351 ? -9.927   -58.477  329.094 1.00 8.01   ? 351 LEU 3 C     1 
ATOM   7413  O  O     . LEU C  3  351 ? -10.593  -59.403  328.617 1.00 8.01   ? 351 LEU 3 O     1 
ATOM   7414  C  CB    . LEU C  3  351 ? -11.027  -57.122  330.885 1.00 8.00   ? 351 LEU 3 CB    1 
ATOM   7415  C  CG    . LEU C  3  351 ? -11.992  -57.449  332.008 1.00 8.00   ? 351 LEU 3 CG    1 
ATOM   7416  C  CD1   . LEU C  3  351 ? -11.172  -57.807  333.205 1.00 8.01   ? 351 LEU 3 CD1   1 
ATOM   7417  C  CD2   . LEU C  3  351 ? -12.907  -56.304  332.284 1.00 7.99   ? 351 LEU 3 CD2   1 
ATOM   7418  N  N     . GLU C  3  352 ? -9.222   -57.644  328.333 1.00 8.00   ? 352 GLU 3 N     1 
ATOM   7419  C  CA    . GLU C  3  352 ? -9.098   -57.856  326.901 1.00 8.00   ? 352 GLU 3 CA    1 
ATOM   7420  C  C     . GLU C  3  352 ? -8.432   -59.192  326.628 1.00 13.67  ? 352 GLU 3 C     1 
ATOM   7421  O  O     . GLU C  3  352 ? -8.901   -59.994  325.806 1.00 14.74  ? 352 GLU 3 O     1 
ATOM   7422  C  CB    . GLU C  3  352 ? -8.289   -56.718  326.271 1.00 11.26  ? 352 GLU 3 CB    1 
ATOM   7423  C  CG    . GLU C  3  352 ? -9.011   -55.322  326.218 1.00 14.24  ? 352 GLU 3 CG    1 
ATOM   7424  C  CD    . GLU C  3  352 ? -8.955   -54.446  327.473 1.00 7.99   ? 352 GLU 3 CD    1 
ATOM   7425  O  OE1   . GLU C  3  352 ? -8.446   -54.844  328.536 1.00 8.06   ? 352 GLU 3 OE1   1 
ATOM   7426  O  OE2   . GLU C  3  352 ? -9.571   -53.368  327.414 1.00 7.97   ? 352 GLU 3 OE2   1 
ATOM   7427  N  N     . GLU C  3  353 ? -7.321   -59.437  327.329 1.00 17.80  ? 353 GLU 3 N     1 
ATOM   7428  C  CA    . GLU C  3  353 ? -6.547   -60.660  327.152 1.00 19.68  ? 353 GLU 3 CA    1 
ATOM   7429  C  C     . GLU C  3  353 ? -7.317   -61.878  327.651 1.00 10.55  ? 353 GLU 3 C     1 
ATOM   7430  O  O     . GLU C  3  353 ? -7.439   -62.877  326.935 1.00 8.04   ? 353 GLU 3 O     1 
ATOM   7431  C  CB    . GLU C  3  353 ? -5.208   -60.506  327.886 1.00 24.93  ? 353 GLU 3 CB    1 
ATOM   7432  C  CG    . GLU C  3  353 ? -4.285   -59.471  327.238 1.00 28.30  ? 353 GLU 3 CG    1 
ATOM   7433  C  CD    . GLU C  3  353 ? -3.088   -59.112  328.100 1.00 32.94  ? 353 GLU 3 CD    1 
ATOM   7434  O  OE1   . GLU C  3  353 ? -2.972   -59.643  329.225 1.00 34.73  ? 353 GLU 3 OE1   1 
ATOM   7435  O  OE2   . GLU C  3  353 ? -2.253   -58.302  327.646 1.00 34.54  ? 353 GLU 3 OE2   1 
ATOM   7436  N  N     . GLY C  3  354 ? -7.884   -61.791  328.852 1.00 9.65   ? 354 GLY 3 N     1 
ATOM   7437  C  CA    . GLY C  3  354 ? -8.678   -62.890  329.342 1.00 8.05   ? 354 GLY 3 CA    1 
ATOM   7438  C  C     . GLY C  3  354 ? -9.788   -63.245  328.377 1.00 16.22  ? 354 GLY 3 C     1 
ATOM   7439  O  O     . GLY C  3  354 ? -10.019  -64.421  328.095 1.00 25.39  ? 354 GLY 3 O     1 
ATOM   7440  N  N     . LEU C  3  355 ? -10.443  -62.235  327.799 1.00 19.14  ? 355 LEU 3 N     1 
ATOM   7441  C  CA    . LEU C  3  355 ? -11.521  -62.513  326.855 1.00 17.56  ? 355 LEU 3 CA    1 
ATOM   7442  C  C     . LEU C  3  355 ? -10.999  -63.174  325.587 1.00 21.52  ? 355 LEU 3 C     1 
ATOM   7443  O  O     . LEU C  3  355 ? -11.665  -64.051  325.021 1.00 26.15  ? 355 LEU 3 O     1 
ATOM   7444  C  CB    . LEU C  3  355 ? -12.279  -61.239  326.503 1.00 18.53  ? 355 LEU 3 CB    1 
ATOM   7445  C  CG    . LEU C  3  355 ? -13.373  -61.515  325.475 1.00 18.41  ? 355 LEU 3 CG    1 
ATOM   7446  C  CD1   . LEU C  3  355 ? -14.288  -62.598  326.017 1.00 17.54  ? 355 LEU 3 CD1   1 
ATOM   7447  C  CD2   . LEU C  3  355 ? -14.150  -60.245  325.107 1.00 23.29  ? 355 LEU 3 CD2   1 
ATOM   7448  N  N     . LEU C  3  356 ? -9.835   -62.745  325.089 1.00 20.85  ? 356 LEU 3 N     1 
ATOM   7449  C  CA    . LEU C  3  356 ? -9.369   -63.349  323.841 1.00 18.06  ? 356 LEU 3 CA    1 
ATOM   7450  C  C     . LEU C  3  356 ? -8.887   -64.781  324.069 1.00 20.77  ? 356 LEU 3 C     1 
ATOM   7451  O  O     . LEU C  3  356 ? -9.152   -65.666  323.248 1.00 27.32  ? 356 LEU 3 O     1 
ATOM   7452  C  CB    . LEU C  3  356 ? -8.293   -62.491  323.177 1.00 15.30  ? 356 LEU 3 CB    1 
ATOM   7453  C  CG    . LEU C  3  356 ? -7.414   -63.183  322.133 1.00 10.89  ? 356 LEU 3 CG    1 
ATOM   7454  C  CD1   . LEU C  3  356 ? -8.243   -63.624  320.928 1.00 8.16   ? 356 LEU 3 CD1   1 
ATOM   7455  C  CD2   . LEU C  3  356 ? -6.311   -62.243  321.698 1.00 13.24  ? 356 LEU 3 CD2   1 
ATOM   7456  N  N     . ALA C  3  357 ? -8.198   -65.043  325.182 1.00 14.71  ? 357 ALA 3 N     1 
ATOM   7457  C  CA    . ALA C  3  357 ? -7.808   -66.425  325.476 1.00 15.65  ? 357 ALA 3 CA    1 
ATOM   7458  C  C     . ALA C  3  357 ? -9.039   -67.300  325.687 1.00 11.22  ? 357 ALA 3 C     1 
ATOM   7459  O  O     . ALA C  3  357 ? -9.097   -68.432  325.196 1.00 8.06   ? 357 ALA 3 O     1 
ATOM   7460  C  CB    . ALA C  3  357 ? -6.880   -66.481  326.695 1.00 16.84  ? 357 ALA 3 CB    1 
ATOM   7461  N  N     . SER C  3  358 ? -10.051  -66.775  326.383 1.00 9.04   ? 358 SER 3 N     1 
ATOM   7462  C  CA    . SER C  3  358 ? -11.290  -67.511  326.592 1.00 10.60  ? 358 SER 3 CA    1 
ATOM   7463  C  C     . SER C  3  358 ? -11.909  -67.894  325.258 1.00 19.41  ? 358 SER 3 C     1 
ATOM   7464  O  O     . SER C  3  358 ? -12.076  -69.083  324.957 1.00 24.05  ? 358 SER 3 O     1 
ATOM   7465  C  CB    . SER C  3  358 ? -12.253  -66.643  327.411 1.00 9.65   ? 358 SER 3 CB    1 
ATOM   7466  O  OG    . SER C  3  358 ? -13.614  -67.033  327.292 1.00 8.04   ? 358 SER 3 OG    1 
ATOM   7467  N  N     . GLU C  3  359 ? -12.164  -66.895  324.403 1.00 25.34  ? 359 GLU 3 N     1 
ATOM   7468  C  CA    . GLU C  3  359 ? -12.784  -67.167  323.108 1.00 23.19  ? 359 GLU 3 CA    1 
ATOM   7469  C  C     . GLU C  3  359 ? -11.932  -68.099  322.264 1.00 23.33  ? 359 GLU 3 C     1 
ATOM   7470  O  O     . GLU C  3  359 ? -12.466  -68.929  321.517 1.00 23.36  ? 359 GLU 3 O     1 
ATOM   7471  C  CB    . GLU C  3  359 ? -13.047  -65.849  322.367 1.00 22.45  ? 359 GLU 3 CB    1 
ATOM   7472  C  CG    . GLU C  3  359 ? -14.025  -64.936  323.059 1.00 23.47  ? 359 GLU 3 CG    1 
ATOM   7473  C  CD    . GLU C  3  359 ? -15.438  -65.513  323.036 1.00 28.17  ? 359 GLU 3 CD    1 
ATOM   7474  O  OE1   . GLU C  3  359 ? -15.676  -66.534  323.709 1.00 29.79  ? 359 GLU 3 OE1   1 
ATOM   7475  O  OE2   . GLU C  3  359 ? -16.318  -64.955  322.340 1.00 30.51  ? 359 GLU 3 OE2   1 
ATOM   7476  N  N     . LEU C  3  360 ? -10.615  -68.004  322.394 1.00 18.47  ? 360 LEU 3 N     1 
ATOM   7477  C  CA    . LEU C  3  360 ? -9.749   -68.834  321.580 1.00 19.42  ? 360 LEU 3 CA    1 
ATOM   7478  C  C     . LEU C  3  360 ? -9.829   -70.286  322.048 1.00 25.80  ? 360 LEU 3 C     1 
ATOM   7479  O  O     . LEU C  3  360 ? -9.860   -71.212  321.231 1.00 27.02  ? 360 LEU 3 O     1 
ATOM   7480  C  CB    . LEU C  3  360 ? -8.326   -68.263  321.633 1.00 14.81  ? 360 LEU 3 CB    1 
ATOM   7481  C  CG    . LEU C  3  360 ? -7.117   -69.015  321.089 1.00 9.88   ? 360 LEU 3 CG    1 
ATOM   7482  C  CD1   . LEU C  3  360 ? -7.158   -68.971  319.578 1.00 11.56  ? 360 LEU 3 CD1   1 
ATOM   7483  C  CD2   . LEU C  3  360 ? -5.811   -68.441  321.606 1.00 9.48   ? 360 LEU 3 CD2   1 
ATOM   7484  N  N     . ALA C  3  361 ? -9.935   -70.499  323.360 1.00 34.18  ? 361 ALA 3 N     1 
ATOM   7485  C  CA    . ALA C  3  361 ? -10.145  -71.847  323.874 1.00 41.98  ? 361 ALA 3 CA    1 
ATOM   7486  C  C     . ALA C  3  361 ? -11.557  -72.340  323.582 1.00 46.92  ? 361 ALA 3 C     1 
ATOM   7487  O  O     . ALA C  3  361 ? -11.799  -73.554  323.563 1.00 50.61  ? 361 ALA 3 O     1 
ATOM   7488  C  CB    . ALA C  3  361 ? -9.866   -71.889  325.379 1.00 43.35  ? 361 ALA 3 CB    1 
ATOM   7489  N  N     . LYS C  3  362 ? -12.495  -71.426  323.340 1.00 45.29  ? 362 LYS 3 N     1 
ATOM   7490  C  CA    . LYS C  3  362 ? -13.792  -71.841  322.815 1.00 41.59  ? 362 LYS 3 CA    1 
ATOM   7491  C  C     . LYS C  3  362 ? -13.623  -72.427  321.419 1.00 40.15  ? 362 LYS 3 C     1 
ATOM   7492  O  O     . LYS C  3  362 ? -14.011  -73.574  321.159 1.00 38.82  ? 362 LYS 3 O     1 
ATOM   7493  C  CB    . LYS C  3  362 ? -14.767  -70.657  322.794 1.00 37.01  ? 362 LYS 3 CB    1 
ATOM   7494  C  CG    . LYS C  3  362 ? -16.083  -70.932  322.046 1.00 33.12  ? 362 LYS 3 CG    1 
ATOM   7495  C  CD    . LYS C  3  362 ? -16.817  -69.625  321.727 1.00 27.08  ? 362 LYS 3 CD    1 
ATOM   7496  C  CE    . LYS C  3  362 ? -18.344  -69.787  321.798 1.00 21.59  ? 362 LYS 3 CE    1 
ATOM   7497  N  NZ    . LYS C  3  362 ? -19.111  -69.021  320.768 1.00 18.37  ? 362 LYS 3 NZ    1 
ATOM   7498  N  N     . ALA C  3  363 ? -12.989  -71.668  320.521 1.00 40.46  ? 363 ALA 3 N     1 
ATOM   7499  C  CA    . ALA C  3  363 ? -12.673  -72.202  319.201 1.00 40.84  ? 363 ALA 3 CA    1 
ATOM   7500  C  C     . ALA C  3  363 ? -11.711  -73.378  319.319 1.00 53.67  ? 363 ALA 3 C     1 
ATOM   7501  O  O     . ALA C  3  363 ? -12.053  -74.523  318.995 1.00 56.73  ? 363 ALA 3 O     1 
ATOM   7502  C  CB    . ALA C  3  363 ? -12.070  -71.111  318.315 1.00 34.01  ? 363 ALA 3 CB    1 
ATOM   7503  N  N     . LEU C  3  364 ? -10.520  -73.119  319.845 1.00 55.21  ? 364 LEU 3 N     1 
ATOM   7504  C  CA    . LEU C  3  364 ? -9.500   -74.150  320.031 1.00 49.91  ? 364 LEU 3 CA    1 
ATOM   7505  C  C     . LEU C  3  364 ? -9.882   -75.000  321.241 1.00 48.04  ? 364 LEU 3 C     1 
ATOM   7506  O  O     . LEU C  3  364 ? -9.696   -74.587  322.387 1.00 48.58  ? 364 LEU 3 O     1 
ATOM   7507  C  CB    . LEU C  3  364 ? -8.128   -73.498  320.187 1.00 42.01  ? 364 LEU 3 CB    1 
ATOM   7508  C  CG    . LEU C  3  364 ? -6.933   -74.367  320.563 1.00 37.72  ? 364 LEU 3 CG    1 
ATOM   7509  C  CD1   . LEU C  3  364 ? -6.209   -74.833  319.324 1.00 38.35  ? 364 LEU 3 CD1   1 
ATOM   7510  C  CD2   . LEU C  3  364 ? -5.985   -73.597  321.476 1.00 36.01  ? 364 LEU 3 CD2   1 
ATOM   7511  N  N     . LYS C  3  365 ? -10.442  -76.185  320.990 1.00 42.59  ? 365 LYS 3 N     1 
ATOM   7512  C  CA    . LYS C  3  365 ? -11.008  -77.007  322.061 1.00 38.20  ? 365 LYS 3 CA    1 
ATOM   7513  C  C     . LYS C  3  365 ? -9.879   -77.437  322.979 1.00 38.05  ? 365 LYS 3 C     1 
ATOM   7514  O  O     . LYS C  3  365 ? -9.151   -78.382  322.671 1.00 40.44  ? 365 LYS 3 O     1 
ATOM   7515  C  CB    . LYS C  3  365 ? -11.678  -78.257  321.498 1.00 35.61  ? 365 LYS 3 CB    1 
ATOM   7516  C  CG    . LYS C  3  365 ? -12.802  -78.050  320.507 1.00 31.27  ? 365 LYS 3 CG    1 
ATOM   7517  C  CD    . LYS C  3  365 ? -13.124  -79.377  319.816 1.00 20.74  ? 365 LYS 3 CD    1 
ATOM   7518  C  CE    . LYS C  3  365 ? -14.213  -79.202  318.782 1.00 13.00  ? 365 LYS 3 CE    1 
ATOM   7519  N  NZ    . LYS C  3  365 ? -14.249  -80.341  317.838 1.00 8.23   ? 365 LYS 3 NZ    1 
ATOM   7520  N  N     . THR C  3  366 ? -9.741   -76.780  324.132 1.00 32.58  ? 366 THR 3 N     1 
ATOM   7521  C  CA    . THR C  3  366 ? -8.692   -77.173  325.068 1.00 30.75  ? 366 THR 3 CA    1 
ATOM   7522  C  C     . THR C  3  366 ? -9.229   -77.149  326.495 1.00 30.47  ? 366 THR 3 C     1 
ATOM   7523  O  O     . THR C  3  366 ? -9.804   -76.130  326.932 1.00 29.80  ? 366 THR 3 O     1 
ATOM   7524  C  CB    . THR C  3  366 ? -7.447   -76.283  324.958 1.00 24.01  ? 366 THR 3 CB    1 
ATOM   7525  O  OG1   . THR C  3  366 ? -6.521   -76.650  325.989 1.00 23.52  ? 366 THR 3 OG1   1 
ATOM   7526  C  CG2   . THR C  3  366 ? -7.785   -74.779  325.059 1.00 24.13  ? 366 THR 3 CG2   1 
ATOM   7527  N  N     . PRO C  3  367 ? -9.045   -78.231  327.253 1.00 29.08  ? 367 PRO 3 N     1 
ATOM   7528  C  CA    . PRO C  3  367 ? -9.611   -78.268  328.604 1.00 27.84  ? 367 PRO 3 CA    1 
ATOM   7529  C  C     . PRO C  3  367 ? -8.743   -77.571  329.627 1.00 32.09  ? 367 PRO 3 C     1 
ATOM   7530  O  O     . PRO C  3  367 ? -9.241   -77.198  330.700 1.00 35.09  ? 367 PRO 3 O     1 
ATOM   7531  C  CB    . PRO C  3  367 ? -9.719   -79.773  328.889 1.00 26.14  ? 367 PRO 3 CB    1 
ATOM   7532  C  CG    . PRO C  3  367 ? -8.570   -80.357  328.103 1.00 28.03  ? 367 PRO 3 CG    1 
ATOM   7533  C  CD    . PRO C  3  367 ? -8.489   -79.538  326.843 1.00 27.42  ? 367 PRO 3 CD    1 
ATOM   7534  N  N     . HIS C  3  368 ? -7.475   -77.345  329.321 1.00 31.43  ? 368 HIS 3 N     1 
ATOM   7535  C  CA    . HIS C  3  368 ? -6.547   -76.749  330.276 1.00 26.11  ? 368 HIS 3 CA    1 
ATOM   7536  C  C     . HIS C  3  368 ? -6.124   -75.367  329.776 1.00 20.70  ? 368 HIS 3 C     1 
ATOM   7537  O  O     . HIS C  3  368 ? -5.271   -75.236  328.891 1.00 17.34  ? 368 HIS 3 O     1 
ATOM   7538  C  CB    . HIS C  3  368 ? -5.339   -77.657  330.528 1.00 26.23  ? 368 HIS 3 CB    1 
ATOM   7539  C  CG    . HIS C  3  368 ? -4.958   -78.508  329.352 1.00 14.92  ? 368 HIS 3 CG    1 
ATOM   7540  N  ND1   . HIS C  3  368 ? -5.360   -79.819  329.221 1.00 12.85  ? 368 HIS 3 ND1   1 
ATOM   7541  C  CD2   . HIS C  3  368 ? -4.270   -78.212  328.223 1.00 20.03  ? 368 HIS 3 CD2   1 
ATOM   7542  C  CE1   . HIS C  3  368 ? -4.889   -80.308  328.088 1.00 16.10  ? 368 HIS 3 CE1   1 
ATOM   7543  N  NE2   . HIS C  3  368 ? -4.234   -79.350  327.459 1.00 17.67  ? 368 HIS 3 NE2   1 
ATOM   7544  N  N     . LEU C  3  369 ? -6.715   -74.343  330.366 1.00 21.04  ? 369 LEU 3 N     1 
ATOM   7545  C  CA    . LEU C  3  369 ? -6.111   -73.029  330.440 1.00 25.77  ? 369 LEU 3 CA    1 
ATOM   7546  C  C     . LEU C  3  369 ? -6.211   -72.586  331.886 1.00 38.05  ? 369 LEU 3 C     1 
ATOM   7547  O  O     . LEU C  3  369 ? -7.048   -73.078  332.643 1.00 42.62  ? 369 LEU 3 O     1 
ATOM   7548  C  CB    . LEU C  3  369 ? -6.795   -72.006  329.512 1.00 18.06  ? 369 LEU 3 CB    1 
ATOM   7549  C  CG    . LEU C  3  369 ? -8.312   -71.789  329.467 1.00 9.00   ? 369 LEU 3 CG    1 
ATOM   7550  C  CD1   . LEU C  3  369 ? -8.896   -71.326  330.758 1.00 9.74   ? 369 LEU 3 CD1   1 
ATOM   7551  C  CD2   . LEU C  3  369 ? -8.620   -70.770  328.400 1.00 11.63  ? 369 LEU 3 CD2   1 
ATOM   7552  N  N     . ASP C  3  370 ? -5.367   -71.649  332.280 1.00 39.64  ? 370 ASP 3 N     1 
ATOM   7553  C  CA    . ASP C  3  370 ? -5.456   -71.214  333.658 1.00 38.45  ? 370 ASP 3 CA    1 
ATOM   7554  C  C     . ASP C  3  370 ? -4.815   -69.832  333.738 1.00 35.30  ? 370 ASP 3 C     1 
ATOM   7555  O  O     . ASP C  3  370 ? -4.569   -69.183  332.714 1.00 37.44  ? 370 ASP 3 O     1 
ATOM   7556  C  CB    . ASP C  3  370 ? -4.820   -72.263  334.580 1.00 36.93  ? 370 ASP 3 CB    1 
ATOM   7557  C  CG    . ASP C  3  370 ? -5.480   -72.303  335.932 1.00 42.66  ? 370 ASP 3 CG    1 
ATOM   7558  O  OD1   . ASP C  3  370 ? -6.561   -71.699  336.059 1.00 44.03  ? 370 ASP 3 OD1   1 
ATOM   7559  O  OD2   . ASP C  3  370 ? -4.972   -72.966  336.846 1.00 44.37  ? 370 ASP 3 OD2   1 
ATOM   7560  N  N     . PHE C  3  371 ? -4.576   -69.365  334.955 1.00 28.39  ? 371 PHE 3 N     1 
ATOM   7561  C  CA    . PHE C  3  371 ? -3.875   -68.114  335.156 1.00 22.82  ? 371 PHE 3 CA    1 
ATOM   7562  C  C     . PHE C  3  371 ? -3.063   -68.225  336.435 1.00 23.57  ? 371 PHE 3 C     1 
ATOM   7563  O  O     . PHE C  3  371 ? -3.219   -69.168  337.211 1.00 22.28  ? 371 PHE 3 O     1 
ATOM   7564  C  CB    . PHE C  3  371 ? -4.848   -66.941  335.165 1.00 23.38  ? 371 PHE 3 CB    1 
ATOM   7565  C  CG    . PHE C  3  371 ? -5.959   -67.061  336.182 1.00 26.62  ? 371 PHE 3 CG    1 
ATOM   7566  C  CD1   . PHE C  3  371 ? -7.096   -67.797  335.904 1.00 25.99  ? 371 PHE 3 CD1   1 
ATOM   7567  C  CD2   . PHE C  3  371 ? -5.883   -66.406  337.402 1.00 24.36  ? 371 PHE 3 CD2   1 
ATOM   7568  C  CE1   . PHE C  3  371 ? -8.134   -67.886  336.833 1.00 25.18  ? 371 PHE 3 CE1   1 
ATOM   7569  C  CE2   . PHE C  3  371 ? -6.917   -66.497  338.321 1.00 22.54  ? 371 PHE 3 CE2   1 
ATOM   7570  C  CZ    . PHE C  3  371 ? -8.038   -67.236  338.034 1.00 24.05  ? 371 PHE 3 CZ    1 
ATOM   7571  N  N     . GLN C  3  372 ? -2.206   -67.232  336.666 1.00 19.05  ? 372 GLN 3 N     1 
ATOM   7572  C  CA    . GLN C  3  372 ? -1.146   -67.411  337.649 1.00 16.38  ? 372 GLN 3 CA    1 
ATOM   7573  C  C     . GLN C  3  372 ? -1.691   -67.531  339.069 1.00 9.66   ? 372 GLN 3 C     1 
ATOM   7574  O  O     . GLN C  3  372 ? -1.201   -68.346  339.852 1.00 8.21   ? 372 GLN 3 O     1 
ATOM   7575  C  CB    . GLN C  3  372 ? -0.128   -66.271  337.555 1.00 20.58  ? 372 GLN 3 CB    1 
ATOM   7576  C  CG    . GLN C  3  372 ? 1.177    -66.554  338.301 1.00 24.67  ? 372 GLN 3 CG    1 
ATOM   7577  C  CD    . GLN C  3  372 ? 2.202    -65.444  338.148 1.00 28.83  ? 372 GLN 3 CD    1 
ATOM   7578  O  OE1   . GLN C  3  372 ? 1.929    -64.414  337.536 1.00 37.31  ? 372 GLN 3 OE1   1 
ATOM   7579  N  NE2   . GLN C  3  372 ? 3.373    -65.633  338.740 1.00 25.02  ? 372 GLN 3 NE2   1 
ATOM   7580  N  N     . GLY C  3  373 ? -2.682   -66.730  339.436 1.00 8.18   ? 373 GLY 3 N     1 
ATOM   7581  C  CA    . GLY C  3  373 ? -3.094   -66.755  340.828 1.00 19.71  ? 373 GLY 3 CA    1 
ATOM   7582  C  C     . GLY C  3  373 ? -4.430   -67.405  341.095 1.00 12.94  ? 373 GLY 3 C     1 
ATOM   7583  O  O     . GLY C  3  373 ? -5.127   -67.029  342.043 1.00 8.17   ? 373 GLY 3 O     1 
ATOM   7584  N  N     . ARG C  3  374 ? -4.791   -68.389  340.270 1.00 21.35  ? 374 ARG 3 N     1 
ATOM   7585  C  CA    . ARG C  3  374 ? -6.091   -69.042  340.392 1.00 21.01  ? 374 ARG 3 CA    1 
ATOM   7586  C  C     . ARG C  3  374 ? -6.168   -69.803  341.704 1.00 18.35  ? 374 ARG 3 C     1 
ATOM   7587  O  O     . ARG C  3  374 ? -5.264   -70.578  342.044 1.00 26.49  ? 374 ARG 3 O     1 
ATOM   7588  C  CB    . ARG C  3  374 ? -6.339   -70.009  339.233 1.00 17.87  ? 374 ARG 3 CB    1 
ATOM   7589  C  CG    . ARG C  3  374 ? -7.793   -70.445  339.074 1.00 8.16   ? 374 ARG 3 CG    1 
ATOM   7590  C  CD    . ARG C  3  374 ? -7.931   -71.907  338.694 1.00 9.80   ? 374 ARG 3 CD    1 
ATOM   7591  N  NE    . ARG C  3  374 ? -7.595   -72.795  339.796 1.00 26.31  ? 374 ARG 3 NE    1 
ATOM   7592  C  CZ    . ARG C  3  374 ? -7.443   -74.109  339.684 1.00 8.19   ? 374 ARG 3 CZ    1 
ATOM   7593  N  NH1   . ARG C  3  374 ? -7.585   -74.691  338.503 1.00 10.01  ? 374 ARG 3 NH1   1 
ATOM   7594  N  NH2   . ARG C  3  374 ? -7.143   -74.834  340.754 1.00 8.20   ? 374 ARG 3 NH2   1 
ATOM   7595  N  N     . THR C  3  375 ? -7.273   -69.628  342.398 1.00 10.30  ? 375 THR 3 N     1 
ATOM   7596  C  CA    . THR C  3  375 ? -7.538   -70.315  343.644 1.00 18.13  ? 375 THR 3 CA    1 
ATOM   7597  C  C     . THR C  3  375 ? -8.403   -71.528  343.350 1.00 18.54  ? 375 THR 3 C     1 
ATOM   7598  O  O     . THR C  3  375 ? -9.136   -71.558  342.358 1.00 22.96  ? 375 THR 3 O     1 
ATOM   7599  C  CB    . THR C  3  375 ? -8.244   -69.397  344.635 1.00 26.34  ? 375 THR 3 CB    1 
ATOM   7600  O  OG1   . THR C  3  375 ? -9.417   -68.863  344.012 1.00 33.38  ? 375 THR 3 OG1   1 
ATOM   7601  C  CG2   . THR C  3  375 ? -7.321   -68.246  345.038 1.00 22.71  ? 375 THR 3 CG2   1 
ATOM   7602  N  N     . ALA C  3  376 ? -8.294   -72.548  344.204 1.00 17.20  ? 376 ALA 3 N     1 
ATOM   7603  C  CA    . ALA C  3  376 ? -9.190   -73.694  344.068 1.00 16.17  ? 376 ALA 3 CA    1 
ATOM   7604  C  C     . ALA C  3  376 ? -10.641  -73.235  344.102 1.00 15.96  ? 376 ALA 3 C     1 
ATOM   7605  O  O     . ALA C  3  376 ? -11.483  -73.750  343.358 1.00 13.52  ? 376 ALA 3 O     1 
ATOM   7606  C  CB    . ALA C  3  376 ? -8.921   -74.723  345.167 1.00 14.61  ? 376 ALA 3 CB    1 
ATOM   7607  N  N     . ALA C  3  377 ? -10.948  -72.259  344.947 1.00 16.83  ? 377 ALA 3 N     1 
ATOM   7608  C  CA    . ALA C  3  377 ? -12.267  -71.651  344.940 1.00 19.35  ? 377 ALA 3 CA    1 
ATOM   7609  C  C     . ALA C  3  377 ? -12.163  -70.215  344.447 1.00 12.26  ? 377 ALA 3 C     1 
ATOM   7610  O  O     . ALA C  3  377 ? -11.440  -69.403  345.046 1.00 9.78   ? 377 ALA 3 O     1 
ATOM   7611  C  CB    . ALA C  3  377 ? -12.903  -71.698  346.326 1.00 24.02  ? 377 ALA 3 CB    1 
ATOM   7612  N  N     . PRO C  3  378 ? -12.843  -69.868  343.359 1.00 21.94  ? 378 PRO 3 N     1 
ATOM   7613  C  CA    . PRO C  3  378 ? -12.741  -68.508  342.819 1.00 19.24  ? 378 PRO 3 CA    1 
ATOM   7614  C  C     . PRO C  3  378 ? -13.256  -67.475  343.813 1.00 17.96  ? 378 PRO 3 C     1 
ATOM   7615  O  O     . PRO C  3  378 ? -14.118  -67.754  344.651 1.00 12.64  ? 378 PRO 3 O     1 
ATOM   7616  C  CB    . PRO C  3  378 ? -13.619  -68.548  341.558 1.00 17.51  ? 378 PRO 3 CB    1 
ATOM   7617  C  CG    . PRO C  3  378 ? -13.811  -69.963  341.247 1.00 24.50  ? 378 PRO 3 CG    1 
ATOM   7618  C  CD    . PRO C  3  378 ? -13.556  -70.791  342.463 1.00 26.52  ? 378 PRO 3 CD    1 
ATOM   7619  N  N     . ALA C  3  379 ? -12.666  -66.279  343.746 1.00 18.97  ? 379 ALA 3 N     1 
ATOM   7620  C  CA    . ALA C  3  379 ? -13.172  -65.129  344.486 1.00 8.11   ? 379 ALA 3 CA    1 
ATOM   7621  C  C     . ALA C  3  379 ? -14.509  -64.646  343.949 1.00 13.59  ? 379 ALA 3 C     1 
ATOM   7622  O  O     . ALA C  3  379 ? -15.266  -64.001  344.683 1.00 15.09  ? 379 ALA 3 O     1 
ATOM   7623  C  CB    . ALA C  3  379 ? -12.159  -63.993  344.436 1.00 9.73   ? 379 ALA 3 CB    1 
ATOM   7624  N  N     . SER C  3  380 ? -14.845  -65.000  342.710 1.00 8.09   ? 380 SER 3 N     1 
ATOM   7625  C  CA    . SER C  3  380 ? -16.144  -64.644  342.172 1.00 16.80  ? 380 SER 3 CA    1 
ATOM   7626  C  C     . SER C  3  380 ? -17.265  -65.455  342.823 1.00 17.01  ? 380 SER 3 C     1 
ATOM   7627  O  O     . SER C  3  380 ? -18.437  -65.100  342.653 1.00 18.36  ? 380 SER 3 O     1 
ATOM   7628  C  CB    . SER C  3  380 ? -16.136  -64.852  340.651 1.00 14.31  ? 380 SER 3 CB    1 
ATOM   7629  O  OG    . SER C  3  380 ? -15.188  -64.009  340.014 1.00 8.06   ? 380 SER 3 OG    1 
ATOM   7630  N  N     . LEU C  3  381 ? -16.926  -66.507  343.588 1.00 14.95  ? 381 LEU 3 N     1 
ATOM   7631  C  CA    . LEU C  3  381 ? -17.918  -67.242  344.377 1.00 13.88  ? 381 LEU 3 CA    1 
ATOM   7632  C  C     . LEU C  3  381 ? -18.718  -66.328  345.290 1.00 17.30  ? 381 LEU 3 C     1 
ATOM   7633  O  O     . LEU C  3  381 ? -19.898  -66.582  345.556 1.00 23.57  ? 381 LEU 3 O     1 
ATOM   7634  C  CB    . LEU C  3  381 ? -17.248  -68.327  345.228 1.00 12.49  ? 381 LEU 3 CB    1 
ATOM   7635  C  CG    . LEU C  3  381 ? -17.294  -69.793  344.802 1.00 14.13  ? 381 LEU 3 CG    1 
ATOM   7636  C  CD1   . LEU C  3  381 ? -18.685  -70.380  345.018 1.00 9.96   ? 381 LEU 3 CD1   1 
ATOM   7637  C  CD2   . LEU C  3  381 ? -16.879  -69.915  343.356 1.00 19.03  ? 381 LEU 3 CD2   1 
ATOM   7638  N  N     . PHE C  3  382 ? -18.129  -65.264  345.724 1.00 13.42  ? 382 PHE 3 N     1 
ATOM   7639  C  CA    . PHE C  3  382 ? -18.656  -64.478  346.801 1.00 12.60  ? 382 PHE 3 CA    1 
ATOM   7640  C  C     . PHE C  3  382 ? -19.146  -63.135  346.278 1.00 15.44  ? 382 PHE 3 C     1 
ATOM   7641  O  O     . PHE C  3  382 ? -18.707  -62.674  345.219 1.00 26.25  ? 382 PHE 3 O     1 
ATOM   7642  C  CB    . PHE C  3  382 ? -17.576  -64.277  347.870 1.00 11.24  ? 382 PHE 3 CB    1 
ATOM   7643  C  CG    . PHE C  3  382 ? -16.899  -65.559  348.288 1.00 12.45  ? 382 PHE 3 CG    1 
ATOM   7644  C  CD1   . PHE C  3  382 ? -15.870  -66.110  347.536 1.00 16.77  ? 382 PHE 3 CD1   1 
ATOM   7645  C  CD2   . PHE C  3  382 ? -17.307  -66.228  349.426 1.00 8.12   ? 382 PHE 3 CD2   1 
ATOM   7646  C  CE1   . PHE C  3  382 ? -15.267  -67.288  347.919 1.00 15.85  ? 382 PHE 3 CE1   1 
ATOM   7647  C  CE2   . PHE C  3  382 ? -16.703  -67.405  349.797 1.00 8.13   ? 382 PHE 3 CE2   1 
ATOM   7648  C  CZ    . PHE C  3  382 ? -15.689  -67.927  349.044 1.00 8.14   ? 382 PHE 3 CZ    1 
ATOM   7649  N  N     . PRO C  3  383 ? -20.102  -62.516  346.964 1.00 13.46  ? 383 PRO 3 N     1 
ATOM   7650  C  CA    . PRO C  3  383 ? -20.555  -61.172  346.573 1.00 11.14  ? 383 PRO 3 CA    1 
ATOM   7651  C  C     . PRO C  3  383 ? -19.487  -60.128  346.853 1.00 8.04   ? 383 PRO 3 C     1 
ATOM   7652  O  O     . PRO C  3  383 ? -18.966  -60.033  347.974 1.00 8.05   ? 383 PRO 3 O     1 
ATOM   7653  C  CB    . PRO C  3  383 ? -21.797  -60.951  347.447 1.00 12.08  ? 383 PRO 3 CB    1 
ATOM   7654  C  CG    . PRO C  3  383 ? -21.731  -62.003  348.530 1.00 11.69  ? 383 PRO 3 CG    1 
ATOM   7655  C  CD    . PRO C  3  383 ? -20.938  -63.134  348.009 1.00 10.64  ? 383 PRO 3 CD    1 
ATOM   7656  N  N     . PRO C  3  384 ? -19.110  -59.351  345.841 1.00 8.03   ? 384 PRO 3 N     1 
ATOM   7657  C  CA    . PRO C  3  384 ? -18.145  -58.258  346.050 1.00 34.19  ? 384 PRO 3 CA    1 
ATOM   7658  C  C     . PRO C  3  384 ? -18.733  -57.084  346.840 1.00 24.00  ? 384 PRO 3 C     1 
ATOM   7659  O  O     . PRO C  3  384 ? -19.875  -56.667  346.622 1.00 22.46  ? 384 PRO 3 O     1 
ATOM   7660  C  CB    . PRO C  3  384 ? -17.788  -57.836  344.620 1.00 30.84  ? 384 PRO 3 CB    1 
ATOM   7661  C  CG    . PRO C  3  384 ? -18.084  -59.058  343.799 1.00 23.96  ? 384 PRO 3 CG    1 
ATOM   7662  C  CD    . PRO C  3  384 ? -19.267  -59.690  344.418 1.00 46.72  ? 384 PRO 3 CD    1 
ATOM   7663  N  N     . ALA C  3  385 ? -17.907  -56.496  347.703 1.00 17.06  ? 385 ALA 3 N     1 
ATOM   7664  C  CA    . ALA C  3  385 ? -18.304  -55.383  348.551 1.00 13.25  ? 385 ALA 3 CA    1 
ATOM   7665  C  C     . ALA C  3  385 ? -17.471  -54.154  348.216 1.00 19.39  ? 385 ALA 3 C     1 
ATOM   7666  O  O     . ALA C  3  385 ? -16.275  -54.265  347.950 1.00 30.07  ? 385 ALA 3 O     1 
ATOM   7667  C  CB    . ALA C  3  385 ? -18.121  -55.750  350.031 1.00 8.03   ? 385 ALA 3 CB    1 
ATOM   7668  N  N     . SER C  3  386 ? -18.096  -52.982  348.223 1.00 14.55  ? 386 SER 3 N     1 
ATOM   7669  C  CA    . SER C  3  386 ? -17.350  -51.740  348.073 1.00 9.69   ? 386 SER 3 CA    1 
ATOM   7670  C  C     . SER C  3  386 ? -16.693  -51.411  349.409 1.00 8.01   ? 386 SER 3 C     1 
ATOM   7671  O  O     . SER C  3  386 ? -17.195  -51.770  350.476 1.00 8.02   ? 386 SER 3 O     1 
ATOM   7672  C  CB    . SER C  3  386 ? -18.301  -50.607  347.618 1.00 19.36  ? 386 SER 3 CB    1 
ATOM   7673  O  OG    . SER C  3  386 ? -17.815  -49.271  347.759 1.00 24.13  ? 386 SER 3 OG    1 
ATOM   7674  N  N     . LEU C  3  387 ? -15.541  -50.751  349.350 1.00 16.02  ? 387 LEU 3 N     1 
ATOM   7675  C  CA    . LEU C  3  387 ? -14.841  -50.431  350.588 1.00 15.59  ? 387 LEU 3 CA    1 
ATOM   7676  C  C     . LEU C  3  387 ? -15.664  -49.474  351.446 1.00 28.66  ? 387 LEU 3 C     1 
ATOM   7677  O  O     . LEU C  3  387 ? -15.678  -49.596  352.677 1.00 39.71  ? 387 LEU 3 O     1 
ATOM   7678  C  CB    . LEU C  3  387 ? -13.466  -49.830  350.275 1.00 14.72  ? 387 LEU 3 CB    1 
ATOM   7679  C  CG    . LEU C  3  387 ? -12.588  -50.790  349.471 1.00 11.59  ? 387 LEU 3 CG    1 
ATOM   7680  C  CD1   . LEU C  3  387 ? -11.217  -50.270  349.178 1.00 8.06   ? 387 LEU 3 CD1   1 
ATOM   7681  C  CD2   . LEU C  3  387 ? -12.491  -52.061  350.223 1.00 20.27  ? 387 LEU 3 CD2   1 
ATOM   7682  N  N     . GLU C  3  388 ? -16.374  -48.517  350.821 1.00 18.40  ? 388 GLU 3 N     1 
ATOM   7683  C  CA    . GLU C  3  388 ? -17.183  -47.602  351.629 1.00 21.76  ? 388 GLU 3 CA    1 
ATOM   7684  C  C     . GLU C  3  388 ? -18.341  -48.333  352.306 1.00 8.00   ? 388 GLU 3 C     1 
ATOM   7685  O  O     . GLU C  3  388 ? -18.744  -47.955  353.417 1.00 8.00   ? 388 GLU 3 O     1 
ATOM   7686  C  CB    . GLU C  3  388 ? -17.704  -46.400  350.819 1.00 23.97  ? 388 GLU 3 CB    1 
ATOM   7687  C  CG    . GLU C  3  388 ? -16.616  -45.367  350.371 1.00 21.30  ? 388 GLU 3 CG    1 
ATOM   7688  C  CD    . GLU C  3  388 ? -17.157  -44.127  349.600 1.00 14.85  ? 388 GLU 3 CD    1 
ATOM   7689  O  OE1   . GLU C  3  388 ? -18.325  -44.110  349.143 1.00 12.46  ? 388 GLU 3 OE1   1 
ATOM   7690  O  OE2   . GLU C  3  388 ? -16.383  -43.158  349.451 1.00 11.69  ? 388 GLU 3 OE2   1 
ATOM   7691  N  N     . ASP C  3  389 ? -18.859  -49.393  351.672 1.00 7.99   ? 389 ASP 3 N     1 
ATOM   7692  C  CA    . ASP C  3  389 ? -19.777  -50.303  352.352 1.00 7.99   ? 389 ASP 3 CA    1 
ATOM   7693  C  C     . ASP C  3  389 ? -19.134  -50.875  353.600 1.00 8.01   ? 389 ASP 3 C     1 
ATOM   7694  O  O     . ASP C  3  389 ? -19.790  -51.030  354.636 1.00 8.01   ? 389 ASP 3 O     1 
ATOM   7695  C  CB    . ASP C  3  389 ? -20.184  -51.451  351.431 1.00 23.33  ? 389 ASP 3 CB    1 
ATOM   7696  C  CG    . ASP C  3  389 ? -20.837  -50.974  350.175 1.00 17.53  ? 389 ASP 3 CG    1 
ATOM   7697  O  OD1   . ASP C  3  389 ? -21.241  -49.795  350.148 1.00 24.36  ? 389 ASP 3 OD1   1 
ATOM   7698  O  OD2   . ASP C  3  389 ? -20.980  -51.779  349.231 1.00 13.13  ? 389 ASP 3 OD2   1 
ATOM   7699  N  N     . LEU C  3  390 ? -17.843  -51.195  353.514 1.00 9.63   ? 390 LEU 3 N     1 
ATOM   7700  C  CA    . LEU C  3  390 ? -17.122  -51.668  354.686 1.00 10.38  ? 390 LEU 3 CA    1 
ATOM   7701  C  C     . LEU C  3  390 ? -17.084  -50.604  355.771 1.00 17.88  ? 390 LEU 3 C     1 
ATOM   7702  O  O     . LEU C  3  390 ? -17.224  -50.916  356.957 1.00 20.13  ? 390 LEU 3 O     1 
ATOM   7703  C  CB    . LEU C  3  390 ? -15.709  -52.103  354.310 1.00 12.08  ? 390 LEU 3 CB    1 
ATOM   7704  C  CG    . LEU C  3  390 ? -14.945  -52.640  355.522 1.00 18.83  ? 390 LEU 3 CG    1 
ATOM   7705  C  CD1   . LEU C  3  390 ? -15.408  -54.017  355.877 1.00 22.45  ? 390 LEU 3 CD1   1 
ATOM   7706  C  CD2   . LEU C  3  390 ? -13.457  -52.680  355.244 1.00 19.43  ? 390 LEU 3 CD2   1 
ATOM   7707  N  N     . LEU C  3  391 ? -16.892  -49.337  355.386 1.00 21.96  ? 391 LEU 3 N     1 
ATOM   7708  C  CA    . LEU C  3  391 ? -16.919  -48.265  356.384 1.00 19.99  ? 391 LEU 3 CA    1 
ATOM   7709  C  C     . LEU C  3  391 ? -18.283  -48.158  357.054 1.00 16.76  ? 391 LEU 3 C     1 
ATOM   7710  O  O     . LEU C  3  391 ? -18.374  -47.859  358.252 1.00 11.00  ? 391 LEU 3 O     1 
ATOM   7711  C  CB    . LEU C  3  391 ? -16.556  -46.920  355.748 1.00 23.45  ? 391 LEU 3 CB    1 
ATOM   7712  C  CG    . LEU C  3  391 ? -15.142  -46.855  355.174 1.00 31.90  ? 391 LEU 3 CG    1 
ATOM   7713  C  CD1   . LEU C  3  391 ? -14.771  -45.439  354.709 1.00 34.16  ? 391 LEU 3 CD1   1 
ATOM   7714  C  CD2   . LEU C  3  391 ? -14.134  -47.386  356.193 1.00 35.31  ? 391 LEU 3 CD2   1 
ATOM   7715  N  N     . GLN C  3  392 ? -19.346  -48.430  356.306 1.00 21.27  ? 392 GLN 3 N     1 
ATOM   7716  C  CA    . GLN C  3  392 ? -20.686  -48.409  356.876 1.00 23.95  ? 392 GLN 3 CA    1 
ATOM   7717  C  C     . GLN C  3  392 ? -21.048  -49.704  357.607 1.00 20.01  ? 392 GLN 3 C     1 
ATOM   7718  O  O     . GLN C  3  392 ? -22.063  -49.737  358.316 1.00 19.27  ? 392 GLN 3 O     1 
ATOM   7719  C  CB    . GLN C  3  392 ? -21.709  -48.130  355.763 1.00 19.17  ? 392 GLN 3 CB    1 
ATOM   7720  C  CG    . GLN C  3  392 ? -21.434  -46.811  355.009 1.00 13.55  ? 392 GLN 3 CG    1 
ATOM   7721  C  CD    . GLN C  3  392 ? -22.189  -45.660  355.573 1.00 11.48  ? 392 GLN 3 CD    1 
ATOM   7722  O  OE1   . GLN C  3  392 ? -22.369  -45.579  356.787 1.00 15.60  ? 392 GLN 3 OE1   1 
ATOM   7723  N  NE2   . GLN C  3  392 ? -22.640  -44.755  354.711 1.00 7.95   ? 392 GLN 3 NE2   1 
ATOM   7724  N  N     . ALA C  3  393 ? -20.252  -50.760  357.465 1.00 22.02  ? 393 ALA 3 N     1 
ATOM   7725  C  CA    . ALA C  3  393 ? -20.611  -52.062  358.018 1.00 32.15  ? 393 ALA 3 CA    1 
ATOM   7726  C  C     . ALA C  3  393 ? -20.604  -52.054  359.556 1.00 39.14  ? 393 ALA 3 C     1 
ATOM   7727  O  O     . ALA C  3  393 ? -20.268  -51.060  360.216 1.00 38.15  ? 393 ALA 3 O     1 
ATOM   7728  C  CB    . ALA C  3  393 ? -19.673  -53.157  357.489 1.00 33.25  ? 393 ALA 3 CB    1 
ATOM   7729  N  N     . ASP C  3  394 ? -21.033  -53.190  360.122 1.00 43.99  ? 394 ASP 3 N     1 
ATOM   7730  C  CA    . ASP C  3  394 ? -21.072  -53.422  361.564 1.00 43.38  ? 394 ASP 3 CA    1 
ATOM   7731  C  C     . ASP C  3  394 ? -19.902  -54.244  362.068 1.00 37.35  ? 394 ASP 3 C     1 
ATOM   7732  O  O     . ASP C  3  394 ? -19.408  -53.997  363.173 1.00 42.24  ? 394 ASP 3 O     1 
ATOM   7733  C  CB    . ASP C  3  394 ? -22.370  -54.123  361.984 1.00 51.83  ? 394 ASP 3 CB    1 
ATOM   7734  C  CG    . ASP C  3  394 ? -23.615  -53.328  361.623 1.00 62.70  ? 394 ASP 3 CG    1 
ATOM   7735  O  OD1   . ASP C  3  394 ? -23.547  -52.077  361.548 1.00 67.55  ? 394 ASP 3 OD1   1 
ATOM   7736  O  OD2   . ASP C  3  394 ? -24.678  -53.952  361.451 1.00 66.43  ? 394 ASP 3 OD2   1 
ATOM   7737  N  N     . PHE C  3  395 ? -19.476  -55.246  361.309 1.00 25.53  ? 395 PHE 3 N     1 
ATOM   7738  C  CA    . PHE C  3  395 ? -18.498  -56.203  361.801 1.00 16.52  ? 395 PHE 3 CA    1 
ATOM   7739  C  C     . PHE C  3  395 ? -17.652  -56.697  360.635 1.00 8.10   ? 395 PHE 3 C     1 
ATOM   7740  O  O     . PHE C  3  395 ? -18.035  -56.573  359.473 1.00 9.70   ? 395 PHE 3 O     1 
ATOM   7741  C  CB    . PHE C  3  395 ? -19.205  -57.341  362.554 1.00 18.18  ? 395 PHE 3 CB    1 
ATOM   7742  C  CG    . PHE C  3  395 ? -18.281  -58.215  363.347 1.00 20.47  ? 395 PHE 3 CG    1 
ATOM   7743  C  CD1   . PHE C  3  395 ? -17.699  -57.766  364.517 1.00 20.85  ? 395 PHE 3 CD1   1 
ATOM   7744  C  CD2   . PHE C  3  395 ? -18.064  -59.538  362.960 1.00 26.74  ? 395 PHE 3 CD2   1 
ATOM   7745  C  CE1   . PHE C  3  395 ? -16.858  -58.602  365.249 1.00 22.15  ? 395 PHE 3 CE1   1 
ATOM   7746  C  CE2   . PHE C  3  395 ? -17.233  -60.374  363.692 1.00 24.16  ? 395 PHE 3 CE2   1 
ATOM   7747  C  CZ    . PHE C  3  395 ? -16.635  -59.901  364.835 1.00 23.43  ? 395 PHE 3 CZ    1 
ATOM   7748  N  N     . ALA C  3  396 ? -16.441  -57.150  360.947 1.00 8.11   ? 396 ALA 3 N     1 
ATOM   7749  C  CA    . ALA C  3  396 ? -15.560  -57.724  359.935 1.00 9.74   ? 396 ALA 3 CA    1 
ATOM   7750  C  C     . ALA C  3  396 ? -14.945  -58.993  360.503 1.00 8.13   ? 396 ALA 3 C     1 
ATOM   7751  O  O     . ALA C  3  396 ? -14.106  -58.935  361.405 1.00 11.24  ? 396 ALA 3 O     1 
ATOM   7752  C  CB    . ALA C  3  396 ? -14.478  -56.745  359.503 1.00 8.12   ? 396 ALA 3 CB    1 
ATOM   7753  N  N     . LEU C  3  397 ? -15.369  -60.138  359.989 1.00 16.04  ? 397 LEU 3 N     1 
ATOM   7754  C  CA    . LEU C  3  397 ? -14.787  -61.417  360.382 1.00 8.15   ? 397 LEU 3 CA    1 
ATOM   7755  C  C     . LEU C  3  397 ? -13.699  -61.726  359.362 1.00 9.79   ? 397 LEU 3 C     1 
ATOM   7756  O  O     . LEU C  3  397 ? -13.988  -62.155  358.241 1.00 9.11   ? 397 LEU 3 O     1 
ATOM   7757  C  CB    . LEU C  3  397 ? -15.855  -62.500  360.418 1.00 16.62  ? 397 LEU 3 CB    1 
ATOM   7758  C  CG    . LEU C  3  397 ? -15.360  -63.941  360.560 1.00 10.10  ? 397 LEU 3 CG    1 
ATOM   7759  C  CD1   . LEU C  3  397 ? -14.435  -64.139  361.760 1.00 18.23  ? 397 LEU 3 CD1   1 
ATOM   7760  C  CD2   . LEU C  3  397 ? -16.551  -64.868  360.640 1.00 10.88  ? 397 LEU 3 CD2   1 
ATOM   7761  N  N     . VAL C  3  398 ? -12.442  -61.526  359.756 1.00 9.40   ? 398 VAL 3 N     1 
ATOM   7762  C  CA    . VAL C  3  398 ? -11.311  -61.545  358.834 1.00 9.82   ? 398 VAL 3 CA    1 
ATOM   7763  C  C     . VAL C  3  398 ? -10.545  -62.844  359.052 1.00 8.19   ? 398 VAL 3 C     1 
ATOM   7764  O  O     . VAL C  3  398 ? -10.281  -63.243  360.197 1.00 8.20   ? 398 VAL 3 O     1 
ATOM   7765  C  CB    . VAL C  3  398 ? -10.410  -60.299  359.021 1.00 11.49  ? 398 VAL 3 CB    1 
ATOM   7766  C  CG1   . VAL C  3  398 ? -9.421   -60.097  357.841 1.00 13.11  ? 398 VAL 3 CG1   1 
ATOM   7767  C  CG2   . VAL C  3  398 ? -11.246  -59.036  359.232 1.00 8.16   ? 398 VAL 3 CG2   1 
ATOM   7768  N  N     . LEU C  3  399 ? -10.192  -63.500  357.952 1.00 8.19   ? 399 LEU 3 N     1 
ATOM   7769  C  CA    . LEU C  3  399 ? -9.357   -64.695  357.977 1.00 8.21   ? 399 LEU 3 CA    1 
ATOM   7770  C  C     . LEU C  3  399 ? -8.212   -64.435  357.015 1.00 8.21   ? 399 LEU 3 C     1 
ATOM   7771  O  O     . LEU C  3  399 ? -8.384   -64.523  355.795 1.00 8.20   ? 399 LEU 3 O     1 
ATOM   7772  C  CB    . LEU C  3  399 ? -10.129  -65.961  357.601 1.00 13.29  ? 399 LEU 3 CB    1 
ATOM   7773  C  CG    . LEU C  3  399 ? -11.280  -66.340  358.539 1.00 8.20   ? 399 LEU 3 CG    1 
ATOM   7774  C  CD1   . LEU C  3  399 ? -12.628  -65.809  358.086 1.00 9.82   ? 399 LEU 3 CD1   1 
ATOM   7775  C  CD2   . LEU C  3  399 ? -11.312  -67.806  358.812 1.00 8.89   ? 399 LEU 3 CD2   1 
ATOM   7776  N  N     . GLY C  3  400 ? -7.060   -64.096  357.573 1.00 9.59   ? 400 GLY 3 N     1 
ATOM   7777  C  CA    . GLY C  3  400 ? -5.917   -63.655  356.802 1.00 13.09  ? 400 GLY 3 CA    1 
ATOM   7778  C  C     . GLY C  3  400 ? -5.485   -62.249  357.186 1.00 19.74  ? 400 GLY 3 C     1 
ATOM   7779  O  O     . GLY C  3  400 ? -6.121   -61.559  357.982 1.00 21.64  ? 400 GLY 3 O     1 
ATOM   7780  N  N     . ASP C  3  401 ? -4.365   -61.840  356.593 1.00 22.07  ? 401 ASP 3 N     1 
ATOM   7781  C  CA    . ASP C  3  401 ? -3.709   -60.595  356.977 1.00 19.19  ? 401 ASP 3 CA    1 
ATOM   7782  C  C     . ASP C  3  401 ? -3.899   -59.538  355.889 1.00 30.39  ? 401 ASP 3 C     1 
ATOM   7783  O  O     . ASP C  3  401 ? -3.221   -59.596  354.851 1.00 31.51  ? 401 ASP 3 O     1 
ATOM   7784  C  CB    . ASP C  3  401 ? -2.222   -60.850  357.219 1.00 10.14  ? 401 ASP 3 CB    1 
ATOM   7785  C  CG    . ASP C  3  401 ? -1.557   -59.694  357.884 1.00 8.28   ? 401 ASP 3 CG    1 
ATOM   7786  O  OD1   . ASP C  3  401 ? -2.309   -58.789  358.280 1.00 8.27   ? 401 ASP 3 OD1   1 
ATOM   7787  O  OD2   . ASP C  3  401 ? -0.311   -59.668  357.990 1.00 9.15   ? 401 ASP 3 OD2   1 
ATOM   7788  N  N     . PRO C  3  402 ? -4.803   -58.560  356.067 1.00 24.92  ? 402 PRO 3 N     1 
ATOM   7789  C  CA    . PRO C  3  402 ? -4.927   -57.485  355.056 1.00 22.66  ? 402 PRO 3 CA    1 
ATOM   7790  C  C     . PRO C  3  402 ? -3.627   -56.765  354.758 1.00 15.38  ? 402 PRO 3 C     1 
ATOM   7791  O  O     . PRO C  3  402 ? -3.293   -56.558  353.584 1.00 9.22   ? 402 PRO 3 O     1 
ATOM   7792  C  CB    . PRO C  3  402 ? -5.932   -56.513  355.689 1.00 22.54  ? 402 PRO 3 CB    1 
ATOM   7793  C  CG    . PRO C  3  402 ? -6.610   -57.278  356.784 1.00 25.56  ? 402 PRO 3 CG    1 
ATOM   7794  C  CD    . PRO C  3  402 ? -5.963   -58.614  356.973 1.00 25.32  ? 402 PRO 3 CD    1 
ATOM   7795  N  N     . THR C  3  403 ? -2.867   -56.415  355.804 1.00 18.21  ? 403 THR 3 N     1 
ATOM   7796  C  CA    . THR C  3  403 ? -1.689   -55.567  355.649 1.00 16.88  ? 403 THR 3 CA    1 
ATOM   7797  C  C     . THR C  3  403 ? -0.722   -56.136  354.613 1.00 19.81  ? 403 THR 3 C     1 
ATOM   7798  O  O     . THR C  3  403 ? -0.083   -55.378  353.880 1.00 18.41  ? 403 THR 3 O     1 
ATOM   7799  C  CB    . THR C  3  403 ? -0.990   -55.388  357.008 1.00 12.51  ? 403 THR 3 CB    1 
ATOM   7800  O  OG1   . THR C  3  403 ? -1.907   -54.865  357.978 1.00 8.26   ? 403 THR 3 OG1   1 
ATOM   7801  C  CG2   . THR C  3  403 ? 0.151    -54.411  356.884 1.00 21.44  ? 403 THR 3 CG2   1 
ATOM   7802  N  N     . GLU C  3  404 ? -0.629   -57.466  354.511 1.00 30.37  ? 404 GLU 3 N     1 
ATOM   7803  C  CA    . GLU C  3  404 ? 0.199    -58.145  353.513 1.00 34.66  ? 404 GLU 3 CA    1 
ATOM   7804  C  C     . GLU C  3  404 ? -0.586   -58.601  352.285 1.00 41.22  ? 404 GLU 3 C     1 
ATOM   7805  O  O     . GLU C  3  404 ? -0.137   -58.371  351.157 1.00 48.10  ? 404 GLU 3 O     1 
ATOM   7806  C  CB    . GLU C  3  404 ? 0.911    -59.364  354.123 1.00 35.67  ? 404 GLU 3 CB    1 
ATOM   7807  C  CG    . GLU C  3  404 ? 1.808    -59.048  355.305 1.00 36.34  ? 404 GLU 3 CG    1 
ATOM   7808  C  CD    . GLU C  3  404 ? 2.972    -58.147  354.943 1.00 35.38  ? 404 GLU 3 CD    1 
ATOM   7809  O  OE1   . GLU C  3  404 ? 3.595    -58.341  353.877 1.00 34.27  ? 404 GLU 3 OE1   1 
ATOM   7810  O  OE2   . GLU C  3  404 ? 3.276    -57.250  355.752 1.00 34.37  ? 404 GLU 3 OE2   1 
ATOM   7811  N  N     . GLU C  3  405 ? -1.753   -59.235  352.478 1.00 39.54  ? 405 GLU 3 N     1 
ATOM   7812  C  CA    . GLU C  3  405 ? -2.485   -59.853  351.369 1.00 40.81  ? 405 GLU 3 CA    1 
ATOM   7813  C  C     . GLU C  3  405 ? -3.116   -58.809  350.448 1.00 43.33  ? 405 GLU 3 C     1 
ATOM   7814  O  O     . GLU C  3  405 ? -3.070   -58.951  349.218 1.00 54.66  ? 405 GLU 3 O     1 
ATOM   7815  C  CB    . GLU C  3  405 ? -3.559   -60.783  351.931 1.00 41.29  ? 405 GLU 3 CB    1 
ATOM   7816  C  CG    . GLU C  3  405 ? -3.008   -61.786  352.921 1.00 45.94  ? 405 GLU 3 CG    1 
ATOM   7817  C  CD    . GLU C  3  405 ? -3.925   -62.971  353.152 1.00 51.83  ? 405 GLU 3 CD    1 
ATOM   7818  O  OE1   . GLU C  3  405 ? -4.502   -63.496  352.174 1.00 51.24  ? 405 GLU 3 OE1   1 
ATOM   7819  O  OE2   . GLU C  3  405 ? -4.044   -63.395  354.320 1.00 52.04  ? 405 GLU 3 OE2   1 
ATOM   7820  N  N     . ALA C  3  406 ? -3.737   -57.773  351.013 1.00 34.36  ? 406 ALA 3 N     1 
ATOM   7821  C  CA    . ALA C  3  406 ? -4.326   -56.683  350.232 1.00 23.24  ? 406 ALA 3 CA    1 
ATOM   7822  C  C     . ALA C  3  406 ? -4.073   -55.407  351.014 1.00 28.48  ? 406 ALA 3 C     1 
ATOM   7823  O  O     . ALA C  3  406 ? -4.950   -54.920  351.738 1.00 40.06  ? 406 ALA 3 O     1 
ATOM   7824  C  CB    . ALA C  3  406 ? -5.820   -56.905  349.995 1.00 19.28  ? 406 ALA 3 CB    1 
ATOM   7825  N  N     . PRO C  3  407 ? -2.888   -54.806  350.857 1.00 18.20  ? 407 PRO 3 N     1 
ATOM   7826  C  CA    . PRO C  3  407 ? -2.402   -53.840  351.848 1.00 15.82  ? 407 PRO 3 CA    1 
ATOM   7827  C  C     . PRO C  3  407 ? -3.370   -52.744  352.253 1.00 9.83   ? 407 PRO 3 C     1 
ATOM   7828  O  O     . PRO C  3  407 ? -3.748   -52.698  353.428 1.00 8.19   ? 407 PRO 3 O     1 
ATOM   7829  C  CB    . PRO C  3  407 ? -1.168   -53.253  351.160 1.00 15.69  ? 407 PRO 3 CB    1 
ATOM   7830  C  CG    . PRO C  3  407 ? -0.650   -54.380  350.351 1.00 18.28  ? 407 PRO 3 CG    1 
ATOM   7831  C  CD    . PRO C  3  407 ? -1.886   -55.058  349.809 1.00 21.41  ? 407 PRO 3 CD    1 
ATOM   7832  N  N     . ILE C  3  408 ? -3.840   -51.911  351.316 1.00 23.20  ? 408 ILE 3 N     1 
ATOM   7833  C  CA    . ILE C  3  408 ? -4.542   -50.687  351.719 1.00 25.50  ? 408 ILE 3 CA    1 
ATOM   7834  C  C     . ILE C  3  408 ? -5.893   -50.982  352.351 1.00 30.55  ? 408 ILE 3 C     1 
ATOM   7835  O  O     . ILE C  3  408 ? -6.510   -50.069  352.918 1.00 37.93  ? 408 ILE 3 O     1 
ATOM   7836  C  CB    . ILE C  3  408 ? -4.764   -49.643  350.589 1.00 21.45  ? 408 ILE 3 CB    1 
ATOM   7837  C  CG1   . ILE C  3  408 ? -5.661   -50.178  349.455 1.00 26.76  ? 408 ILE 3 CG1   1 
ATOM   7838  C  CG2   . ILE C  3  408 ? -3.418   -49.003  350.114 1.00 22.75  ? 408 ILE 3 CG2   1 
ATOM   7839  C  CD1   . ILE C  3  408 ? -7.118   -49.627  349.485 1.00 25.65  ? 408 ILE 3 CD1   1 
ATOM   7840  N  N     . LEU C  3  409 ? -6.364   -52.229  352.277 1.00 22.81  ? 409 LEU 3 N     1 
ATOM   7841  C  CA    . LEU C  3  409 ? -7.511   -52.627  353.083 1.00 23.29  ? 409 LEU 3 CA    1 
ATOM   7842  C  C     . LEU C  3  409 ? -7.300   -52.222  354.536 1.00 19.40  ? 409 LEU 3 C     1 
ATOM   7843  O  O     . LEU C  3  409 ? -8.197   -51.645  355.166 1.00 17.33  ? 409 LEU 3 O     1 
ATOM   7844  C  CB    . LEU C  3  409 ? -7.710   -54.146  352.995 1.00 23.04  ? 409 LEU 3 CB    1 
ATOM   7845  C  CG    . LEU C  3  409 ? -8.592   -54.657  351.867 1.00 24.14  ? 409 LEU 3 CG    1 
ATOM   7846  C  CD1   . LEU C  3  409 ? -9.094   -56.068  352.152 1.00 20.59  ? 409 LEU 3 CD1   1 
ATOM   7847  C  CD2   . LEU C  3  409 ? -9.728   -53.674  351.704 1.00 27.49  ? 409 LEU 3 CD2   1 
ATOM   7848  N  N     . HIS C  3  410 ? -6.095   -52.480  355.064 1.00 8.17   ? 410 HIS 3 N     1 
ATOM   7849  C  CA    . HIS C  3  410 ? -5.700   -52.040  356.398 1.00 8.18   ? 410 HIS 3 CA    1 
ATOM   7850  C  C     . HIS C  3  410 ? -6.137   -50.618  356.655 1.00 8.18   ? 410 HIS 3 C     1 
ATOM   7851  O  O     . HIS C  3  410 ? -6.844   -50.334  357.630 1.00 8.17   ? 410 HIS 3 O     1 
ATOM   7852  C  CB    . HIS C  3  410 ? -4.173   -52.186  356.539 1.00 9.61   ? 410 HIS 3 CB    1 
ATOM   7853  C  CG    . HIS C  3  410 ? -3.572   -51.522  357.750 1.00 13.08  ? 410 HIS 3 CG    1 
ATOM   7854  N  ND1   . HIS C  3  410 ? -2.726   -52.188  358.610 1.00 12.26  ? 410 HIS 3 ND1   1 
ATOM   7855  C  CD2   . HIS C  3  410 ? -3.579   -50.232  358.166 1.00 14.47  ? 410 HIS 3 CD2   1 
ATOM   7856  C  CE1   . HIS C  3  410 ? -2.306   -51.355  359.546 1.00 17.90  ? 410 HIS 3 CE1   1 
ATOM   7857  N  NE2   . HIS C  3  410 ? -2.806   -50.162  359.296 1.00 8.24   ? 410 HIS 3 NE2   1 
ATOM   7858  N  N     . LEU C  3  411 ? -5.775   -49.723  355.736 1.00 11.51  ? 411 LEU 3 N     1 
ATOM   7859  C  CA    . LEU C  3  411 ? -6.045   -48.302  355.923 1.00 11.98  ? 411 LEU 3 CA    1 
ATOM   7860  C  C     . LEU C  3  411 ? -7.546   -48.047  356.026 1.00 12.47  ? 411 LEU 3 C     1 
ATOM   7861  O  O     . LEU C  3  411 ? -7.996   -47.258  356.866 1.00 13.67  ? 411 LEU 3 O     1 
ATOM   7862  C  CB    . LEU C  3  411 ? -5.404   -47.509  354.778 1.00 11.09  ? 411 LEU 3 CB    1 
ATOM   7863  C  CG    . LEU C  3  411 ? -3.910   -47.763  354.493 1.00 8.19   ? 411 LEU 3 CG    1 
ATOM   7864  C  CD1   . LEU C  3  411 ? -3.312   -46.669  353.621 1.00 10.07  ? 411 LEU 3 CD1   1 
ATOM   7865  C  CD2   . LEU C  3  411 ? -3.100   -47.908  355.766 1.00 8.21   ? 411 LEU 3 CD2   1 
ATOM   7866  N  N     . ARG C  3  412 ? -8.338   -48.737  355.201 1.00 17.51  ? 412 ARG 3 N     1 
ATOM   7867  C  CA    . ARG C  3  412 ? -9.788   -48.612  355.291 1.00 22.67  ? 412 ARG 3 CA    1 
ATOM   7868  C  C     . ARG C  3  412 ? -10.310  -49.228  356.586 1.00 18.76  ? 412 ARG 3 C     1 
ATOM   7869  O  O     . ARG C  3  412 ? -11.220  -48.680  357.221 1.00 24.18  ? 412 ARG 3 O     1 
ATOM   7870  C  CB    . ARG C  3  412 ? -10.443  -49.252  354.066 1.00 24.42  ? 412 ARG 3 CB    1 
ATOM   7871  C  CG    . ARG C  3  412 ? -9.902   -48.694  352.745 1.00 23.07  ? 412 ARG 3 CG    1 
ATOM   7872  C  CD    . ARG C  3  412 ? -10.046  -47.176  352.629 1.00 16.62  ? 412 ARG 3 CD    1 
ATOM   7873  N  NE    . ARG C  3  412 ? -10.397  -46.759  351.269 1.00 8.07   ? 412 ARG 3 NE    1 
ATOM   7874  C  CZ    . ARG C  3  412 ? -11.538  -46.165  350.923 1.00 8.05   ? 412 ARG 3 CZ    1 
ATOM   7875  N  NH1   . ARG C  3  412 ? -12.456  -45.895  351.841 1.00 8.05   ? 412 ARG 3 NH1   1 
ATOM   7876  N  NH2   . ARG C  3  412 ? -11.751  -45.811  349.657 1.00 8.04   ? 412 ARG 3 NH2   1 
ATOM   7877  N  N     . LEU C  3  413 ? -9.703   -50.325  357.031 1.00 14.01  ? 413 LEU 3 N     1 
ATOM   7878  C  CA    . LEU C  3  413 ? -10.034  -50.836  358.355 1.00 15.01  ? 413 LEU 3 CA    1 
ATOM   7879  C  C     . LEU C  3  413 ? -9.717   -49.803  359.419 1.00 15.25  ? 413 LEU 3 C     1 
ATOM   7880  O  O     . LEU C  3  413 ? -10.440  -49.704  360.415 1.00 19.10  ? 413 LEU 3 O     1 
ATOM   7881  C  CB    . LEU C  3  413 ? -9.303   -52.158  358.626 1.00 18.78  ? 413 LEU 3 CB    1 
ATOM   7882  C  CG    . LEU C  3  413 ? -9.892   -53.428  357.978 1.00 16.31  ? 413 LEU 3 CG    1 
ATOM   7883  C  CD1   . LEU C  3  413 ? -8.942   -54.613  358.052 1.00 12.15  ? 413 LEU 3 CD1   1 
ATOM   7884  C  CD2   . LEU C  3  413 ? -11.215  -53.774  358.656 1.00 17.43  ? 413 LEU 3 CD2   1 
ATOM   7885  N  N     . SER C  3  414 ? -8.676   -48.993  359.202 1.00 14.90  ? 414 SER 3 N     1 
ATOM   7886  C  CA    . SER C  3  414 ? -8.362   -47.938  360.158 1.00 12.12  ? 414 SER 3 CA    1 
ATOM   7887  C  C     . SER C  3  414 ? -9.490   -46.895  360.238 1.00 9.57   ? 414 SER 3 C     1 
ATOM   7888  O  O     . SER C  3  414 ? -9.769   -46.373  361.323 1.00 13.77  ? 414 SER 3 O     1 
ATOM   7889  C  CB    . SER C  3  414 ? -7.001   -47.323  359.792 1.00 19.48  ? 414 SER 3 CB    1 
ATOM   7890  O  OG    . SER C  3  414 ? -6.527   -46.363  360.723 1.00 22.68  ? 414 SER 3 OG    1 
ATOM   7891  N  N     . GLU C  3  415 ? -10.180  -46.603  359.126 1.00 9.75   ? 415 GLU 3 N     1 
ATOM   7892  C  CA    . GLU C  3  415 ? -11.374  -45.768  359.242 1.00 8.10   ? 415 GLU 3 CA    1 
ATOM   7893  C  C     . GLU C  3  415 ? -12.547  -46.556  359.809 1.00 19.84  ? 415 GLU 3 C     1 
ATOM   7894  O  O     . GLU C  3  415 ? -13.345  -46.019  360.585 1.00 8.09   ? 415 GLU 3 O     1 
ATOM   7895  C  CB    . GLU C  3  415 ? -11.773  -45.186  357.893 1.00 13.26  ? 415 GLU 3 CB    1 
ATOM   7896  C  CG    . GLU C  3  415 ? -10.724  -44.345  357.239 1.00 13.81  ? 415 GLU 3 CG    1 
ATOM   7897  C  CD    . GLU C  3  415 ? -11.339  -43.419  356.220 1.00 17.27  ? 415 GLU 3 CD    1 
ATOM   7898  O  OE1   . GLU C  3  415 ? -11.928  -43.941  355.253 1.00 19.92  ? 415 GLU 3 OE1   1 
ATOM   7899  O  OE2   . GLU C  3  415 ? -11.249  -42.182  356.386 1.00 19.61  ? 415 GLU 3 OE2   1 
ATOM   7900  N  N     . PHE C  3  416 ? -12.630  -47.842  359.433 1.00 15.21  ? 416 PHE 3 N     1 
ATOM   7901  C  CA    . PHE C  3  416 ? -13.761  -48.705  359.776 1.00 11.34  ? 416 PHE 3 CA    1 
ATOM   7902  C  C     . PHE C  3  416 ? -13.950  -48.822  361.275 1.00 8.10   ? 416 PHE 3 C     1 
ATOM   7903  O  O     . PHE C  3  416 ? -15.069  -48.697  361.782 1.00 8.08   ? 416 PHE 3 O     1 
ATOM   7904  C  CB    . PHE C  3  416 ? -13.546  -50.085  359.149 1.00 11.07  ? 416 PHE 3 CB    1 
ATOM   7905  C  CG    . PHE C  3  416 ? -14.414  -51.174  359.732 1.00 14.73  ? 416 PHE 3 CG    1 
ATOM   7906  C  CD1   . PHE C  3  416 ? -15.779  -51.197  359.528 1.00 12.03  ? 416 PHE 3 CD1   1 
ATOM   7907  C  CD2   . PHE C  3  416 ? -13.848  -52.206  360.466 1.00 17.79  ? 416 PHE 3 CD2   1 
ATOM   7908  C  CE1   . PHE C  3  416 ? -16.557  -52.213  360.072 1.00 18.73  ? 416 PHE 3 CE1   1 
ATOM   7909  C  CE2   . PHE C  3  416 ? -14.634  -53.218  361.001 1.00 8.11   ? 416 PHE 3 CE2   1 
ATOM   7910  C  CZ    . PHE C  3  416 ? -15.982  -53.209  360.802 1.00 8.09   ? 416 PHE 3 CZ    1 
ATOM   7911  N  N     . VAL C  3  417 ? -12.853  -49.066  361.996 1.00 17.62  ? 417 VAL 3 N     1 
ATOM   7912  C  CA    . VAL C  3  417 ? -12.887  -49.365  363.426 1.00 22.57  ? 417 VAL 3 CA    1 
ATOM   7913  C  C     . VAL C  3  417 ? -12.901  -48.079  364.278 1.00 22.04  ? 417 VAL 3 C     1 
ATOM   7914  O  O     . VAL C  3  417 ? -13.345  -48.109  365.433 1.00 8.13   ? 417 VAL 3 O     1 
ATOM   7915  C  CB    . VAL C  3  417 ? -11.695  -50.311  363.720 1.00 17.76  ? 417 VAL 3 CB    1 
ATOM   7916  C  CG1   . VAL C  3  417 ? -10.333  -49.547  363.872 1.00 16.17  ? 417 VAL 3 CG1   1 
ATOM   7917  C  CG2   . VAL C  3  417 ? -12.002  -51.360  364.832 1.00 16.77  ? 417 VAL 3 CG2   1 
ATOM   7918  N  N     . ARG C  3  418 ? -12.499  -46.934  363.718 1.00 8.12   ? 418 ARG 3 N     1 
ATOM   7919  C  CA    . ARG C  3  418 ? -12.578  -45.658  364.423 1.00 20.02  ? 418 ARG 3 CA    1 
ATOM   7920  C  C     . ARG C  3  418 ? -13.930  -44.975  364.241 1.00 26.58  ? 418 ARG 3 C     1 
ATOM   7921  O  O     . ARG C  3  418 ? -14.045  -43.769  364.502 1.00 23.51  ? 418 ARG 3 O     1 
ATOM   7922  C  CB    . ARG C  3  418 ? -11.461  -44.706  363.978 1.00 8.13   ? 418 ARG 3 CB    1 
ATOM   7923  C  CG    . ARG C  3  418 ? -10.053  -45.205  364.246 1.00 8.15   ? 418 ARG 3 CG    1 
ATOM   7924  C  CD    . ARG C  3  418 ? -8.970   -44.253  363.757 1.00 8.16   ? 418 ARG 3 CD    1 
ATOM   7925  N  NE    . ARG C  3  418 ? -8.822   -44.326  362.301 1.00 14.32  ? 418 ARG 3 NE    1 
ATOM   7926  C  CZ    . ARG C  3  418 ? -8.140   -43.451  361.575 1.00 8.16   ? 418 ARG 3 CZ    1 
ATOM   7927  N  NH1   . ARG C  3  418 ? -7.550   -42.450  362.177 1.00 8.17   ? 418 ARG 3 NH1   1 
ATOM   7928  N  NH2   . ARG C  3  418 ? -8.040   -43.574  360.257 1.00 8.15   ? 418 ARG 3 NH2   1 
ATOM   7929  N  N     . ASP C  3  419 ? -14.935  -45.709  363.757 1.00 25.59  ? 419 ASP 3 N     1 
ATOM   7930  C  CA    . ASP C  3  419 ? -16.285  -45.230  363.471 1.00 22.74  ? 419 ASP 3 CA    1 
ATOM   7931  C  C     . ASP C  3  419 ? -16.325  -44.204  362.353 1.00 15.20  ? 419 ASP 3 C     1 
ATOM   7932  O  O     . ASP C  3  419 ? -17.375  -43.600  362.131 1.00 15.09  ? 419 ASP 3 O     1 
ATOM   7933  C  CB    . ASP C  3  419 ? -16.986  -44.660  364.712 1.00 29.27  ? 419 ASP 3 CB    1 
ATOM   7934  C  CG    . ASP C  3  419 ? -17.853  -45.698  365.424 1.00 38.40  ? 419 ASP 3 CG    1 
ATOM   7935  O  OD1   . ASP C  3  419 ? -17.872  -46.869  364.976 1.00 43.37  ? 419 ASP 3 OD1   1 
ATOM   7936  O  OD2   . ASP C  3  419 ? -18.519  -45.349  366.429 1.00 41.06  ? 419 ASP 3 OD2   1 
ATOM   7937  N  N     . LEU C  3  420 ? -15.229  -44.002  361.624 1.00 10.75  ? 420 LEU 3 N     1 
ATOM   7938  C  CA    . LEU C  3  420 ? -15.285  -43.067  360.509 1.00 12.83  ? 420 LEU 3 CA    1 
ATOM   7939  C  C     . LEU C  3  420 ? -16.256  -43.567  359.440 1.00 15.31  ? 420 LEU 3 C     1 
ATOM   7940  O  O     . LEU C  3  420 ? -16.543  -44.759  359.332 1.00 8.04   ? 420 LEU 3 O     1 
ATOM   7941  C  CB    . LEU C  3  420 ? -13.894  -42.833  359.896 1.00 8.71   ? 420 LEU 3 CB    1 
ATOM   7942  C  CG    . LEU C  3  420 ? -12.785  -42.155  360.702 1.00 8.08   ? 420 LEU 3 CG    1 
ATOM   7943  C  CD1   . LEU C  3  420 ? -11.554  -41.901  359.849 1.00 8.10   ? 420 LEU 3 CD1   1 
ATOM   7944  C  CD2   . LEU C  3  420 ? -13.327  -40.860  361.260 1.00 8.22   ? 420 LEU 3 CD2   1 
ATOM   7945  N  N     . LYS C  3  421 ? -16.753  -42.629  358.637 1.00 19.40  ? 421 LYS 3 N     1 
ATOM   7946  C  CA    . LYS C  3  421 ? -17.772  -42.892  357.629 1.00 25.76  ? 421 LYS 3 CA    1 
ATOM   7947  C  C     . LYS C  3  421 ? -17.548  -41.958  356.448 1.00 24.10  ? 421 LYS 3 C     1 
ATOM   7948  O  O     . LYS C  3  421 ? -16.869  -40.933  356.585 1.00 28.38  ? 421 LYS 3 O     1 
ATOM   7949  C  CB    . LYS C  3  421 ? -19.182  -42.742  358.227 1.00 25.62  ? 421 LYS 3 CB    1 
ATOM   7950  C  CG    . LYS C  3  421 ? -19.690  -44.086  358.759 1.00 21.62  ? 421 LYS 3 CG    1 
ATOM   7951  C  CD    . LYS C  3  421 ? -20.334  -44.002  360.131 1.00 14.46  ? 421 LYS 3 CD    1 
ATOM   7952  C  CE    . LYS C  3  421 ? -20.318  -45.378  360.801 1.00 12.64  ? 421 LYS 3 CE    1 
ATOM   7953  N  NZ    . LYS C  3  421 ? -21.091  -45.444  362.070 1.00 8.01   ? 421 LYS 3 NZ    1 
ATOM   7954  N  N     . PRO C  3  422 ? -18.067  -42.301  355.266 1.00 26.36  ? 422 PRO 3 N     1 
ATOM   7955  C  CA    . PRO C  3  422 ? -17.799  -41.497  354.071 1.00 17.75  ? 422 PRO 3 CA    1 
ATOM   7956  C  C     . PRO C  3  422 ? -18.304  -40.081  354.260 1.00 25.55  ? 422 PRO 3 C     1 
ATOM   7957  O  O     . PRO C  3  422 ? -19.445  -39.868  354.695 1.00 26.39  ? 422 PRO 3 O     1 
ATOM   7958  C  CB    . PRO C  3  422 ? -18.580  -42.227  352.969 1.00 19.16  ? 422 PRO 3 CB    1 
ATOM   7959  C  CG    . PRO C  3  422 ? -18.636  -43.601  353.418 1.00 23.90  ? 422 PRO 3 CG    1 
ATOM   7960  C  CD    . PRO C  3  422 ? -18.812  -43.522  354.918 1.00 25.44  ? 422 PRO 3 CD    1 
ATOM   7961  N  N     . PRO C  3  423 ? -17.476  -39.089  353.973 1.00 23.01  ? 423 PRO 3 N     1 
ATOM   7962  C  CA    . PRO C  3  423 ? -17.864  -37.700  354.222 1.00 28.24  ? 423 PRO 3 CA    1 
ATOM   7963  C  C     . PRO C  3  423 ? -18.877  -37.230  353.195 1.00 27.34  ? 423 PRO 3 C     1 
ATOM   7964  O  O     . PRO C  3  423 ? -19.196  -37.924  352.224 1.00 24.31  ? 423 PRO 3 O     1 
ATOM   7965  C  CB    . PRO C  3  423 ? -16.545  -36.940  354.076 1.00 30.39  ? 423 PRO 3 CB    1 
ATOM   7966  C  CG    . PRO C  3  423 ? -15.768  -37.780  353.075 1.00 30.01  ? 423 PRO 3 CG    1 
ATOM   7967  C  CD    . PRO C  3  423 ? -16.154  -39.200  353.333 1.00 28.19  ? 423 PRO 3 CD    1 
ATOM   7968  N  N     . HIS C  3  424 ? -19.392  -36.025  353.434 1.00 34.60  ? 424 HIS 3 N     1 
ATOM   7969  C  CA    . HIS C  3  424 ? -20.240  -35.367  352.448 1.00 41.94  ? 424 HIS 3 CA    1 
ATOM   7970  C  C     . HIS C  3  424 ? -19.373  -34.702  351.386 1.00 29.33  ? 424 HIS 3 C     1 
ATOM   7971  O  O     . HIS C  3  424 ? -18.255  -34.245  351.651 1.00 25.06  ? 424 HIS 3 O     1 
ATOM   7972  C  CB    . HIS C  3  424 ? -21.177  -34.344  353.106 1.00 51.39  ? 424 HIS 3 CB    1 
ATOM   7973  C  CG    . HIS C  3  424 ? -22.050  -34.928  354.177 1.00 65.49  ? 424 HIS 3 CG    1 
ATOM   7974  N  ND1   . HIS C  3  424 ? -23.091  -35.791  353.899 1.00 63.84  ? 424 HIS 3 ND1   1 
ATOM   7975  C  CD2   . HIS C  3  424 ? -22.059  -34.747  355.519 1.00 63.69  ? 424 HIS 3 CD2   1 
ATOM   7976  C  CE1   . HIS C  3  424 ? -23.688  -36.134  355.027 1.00 68.17  ? 424 HIS 3 CE1   1 
ATOM   7977  N  NE2   . HIS C  3  424 ? -23.082  -35.512  356.024 1.00 66.69  ? 424 HIS 3 NE2   1 
ATOM   7978  N  N     . ARG C  3  425 ? -19.903  -34.673  350.167 1.00 27.31  ? 425 ARG 3 N     1 
ATOM   7979  C  CA    . ARG C  3  425 ? -19.144  -34.364  348.963 1.00 24.82  ? 425 ARG 3 CA    1 
ATOM   7980  C  C     . ARG C  3  425 ? -19.443  -32.935  348.503 1.00 31.76  ? 425 ARG 3 C     1 
ATOM   7981  O  O     . ARG C  3  425 ? -20.597  -32.589  348.203 1.00 31.87  ? 425 ARG 3 O     1 
ATOM   7982  C  CB    . ARG C  3  425 ? -19.488  -35.375  347.877 1.00 32.35  ? 425 ARG 3 CB    1 
ATOM   7983  C  CG    . ARG C  3  425 ? -18.392  -36.303  347.551 1.00 48.00  ? 425 ARG 3 CG    1 
ATOM   7984  C  CD    . ARG C  3  425 ? -17.472  -35.776  346.505 1.00 42.73  ? 425 ARG 3 CD    1 
ATOM   7985  N  NE    . ARG C  3  425 ? -16.610  -36.866  346.082 1.00 43.08  ? 425 ARG 3 NE    1 
ATOM   7986  C  CZ    . ARG C  3  425 ? -15.943  -36.893  344.938 1.00 42.55  ? 425 ARG 3 CZ    1 
ATOM   7987  N  NH1   . ARG C  3  425 ? -16.066  -35.892  344.075 1.00 39.15  ? 425 ARG 3 NH1   1 
ATOM   7988  N  NH2   . ARG C  3  425 ? -15.179  -37.940  344.647 1.00 42.81  ? 425 ARG 3 NH2   1 
ATOM   7989  N  N     . TYR C  3  426 ? -18.406  -32.106  348.478 1.00 25.11  ? 426 TYR 3 N     1 
ATOM   7990  C  CA    . TYR C  3  426 ? -18.516  -30.690  348.178 1.00 15.77  ? 426 TYR 3 CA    1 
ATOM   7991  C  C     . TYR C  3  426 ? -18.250  -30.457  346.692 1.00 11.04  ? 426 TYR 3 C     1 
ATOM   7992  O  O     . TYR C  3  426 ? -18.144  -31.390  345.892 1.00 7.89   ? 426 TYR 3 O     1 
ATOM   7993  C  CB    . TYR C  3  426 ? -17.557  -29.911  349.066 1.00 12.88  ? 426 TYR 3 CB    1 
ATOM   7994  C  CG    . TYR C  3  426 ? -17.880  -29.998  350.542 1.00 17.65  ? 426 TYR 3 CG    1 
ATOM   7995  C  CD1   . TYR C  3  426 ? -17.725  -31.183  351.244 1.00 15.69  ? 426 TYR 3 CD1   1 
ATOM   7996  C  CD2   . TYR C  3  426 ? -18.276  -28.881  351.248 1.00 12.91  ? 426 TYR 3 CD2   1 
ATOM   7997  C  CE1   . TYR C  3  426 ? -18.009  -31.253  352.597 1.00 17.45  ? 426 TYR 3 CE1   1 
ATOM   7998  C  CE2   . TYR C  3  426 ? -18.549  -28.947  352.606 1.00 14.44  ? 426 TYR 3 CE2   1 
ATOM   7999  C  CZ    . TYR C  3  426 ? -18.415  -30.130  353.275 1.00 12.71  ? 426 TYR 3 CZ    1 
ATOM   8000  O  OH    . TYR C  3  426 ? -18.682  -30.200  354.622 1.00 7.93   ? 426 TYR 3 OH    1 
ATOM   8001  N  N     . ASN C  3  427 ? -18.143  -29.191  346.300 1.00 21.27  ? 427 ASN 3 N     1 
ATOM   8002  C  CA    . ASN C  3  427 ? -17.890  -28.902  344.892 1.00 30.71  ? 427 ASN 3 CA    1 
ATOM   8003  C  C     . ASN C  3  427 ? -16.450  -29.183  344.484 1.00 39.34  ? 427 ASN 3 C     1 
ATOM   8004  O  O     . ASN C  3  427 ? -16.217  -29.697  343.384 1.00 38.08  ? 427 ASN 3 O     1 
ATOM   8005  C  CB    . ASN C  3  427 ? -18.244  -27.446  344.575 1.00 31.86  ? 427 ASN 3 CB    1 
ATOM   8006  C  CG    . ASN C  3  427 ? -19.708  -27.265  344.200 1.00 33.23  ? 427 ASN 3 CG    1 
ATOM   8007  O  OD1   . ASN C  3  427 ? -20.494  -28.224  344.181 1.00 40.28  ? 427 ASN 3 OD1   1 
ATOM   8008  N  ND2   . ASN C  3  427 ? -20.084  -26.028  343.907 1.00 28.41  ? 427 ASN 3 ND2   1 
ATOM   8009  N  N     . HIS C  3  428 ? -15.489  -28.959  345.384 1.00 39.74  ? 428 HIS 3 N     1 
ATOM   8010  C  CA    . HIS C  3  428 ? -14.081  -29.216  345.109 1.00 34.75  ? 428 HIS 3 CA    1 
ATOM   8011  C  C     . HIS C  3  428 ? -13.706  -30.673  345.382 1.00 17.07  ? 428 HIS 3 C     1 
ATOM   8012  O  O     . HIS C  3  428 ? -12.522  -30.990  345.570 1.00 10.67  ? 428 HIS 3 O     1 
ATOM   8013  C  CB    . HIS C  3  428 ? -13.195  -28.287  345.941 1.00 31.83  ? 428 HIS 3 CB    1 
ATOM   8014  C  CG    . HIS C  3  428 ? -13.515  -28.301  347.406 1.00 18.43  ? 428 HIS 3 CG    1 
ATOM   8015  N  ND1   . HIS C  3  428 ? -14.729  -27.884  347.914 1.00 28.78  ? 428 HIS 3 ND1   1 
ATOM   8016  C  CD2   . HIS C  3  428 ? -12.786  -28.722  348.469 1.00 28.56  ? 428 HIS 3 CD2   1 
ATOM   8017  C  CE1   . HIS C  3  428 ? -14.725  -28.028  349.227 1.00 7.95   ? 428 HIS 3 CE1   1 
ATOM   8018  N  NE2   . HIS C  3  428 ? -13.560  -28.539  349.588 1.00 28.65  ? 428 HIS 3 NE2   1 
ATOM   8019  N  N     . GLY C  3  429 ? -14.688  -31.565  345.416 1.00 9.52   ? 429 GLY 3 N     1 
ATOM   8020  C  CA    . GLY C  3  429 ? -14.359  -32.946  345.605 1.00 9.53   ? 429 GLY 3 CA    1 
ATOM   8021  C  C     . GLY C  3  429 ? -14.217  -33.270  347.073 1.00 16.34  ? 429 GLY 3 C     1 
ATOM   8022  O  O     . GLY C  3  429 ? -14.930  -32.710  347.912 1.00 7.95   ? 429 GLY 3 O     1 
ATOM   8023  N  N     . THR C  3  430 ? -13.253  -34.137  347.386 1.00 16.32  ? 430 THR 3 N     1 
ATOM   8024  C  CA    . THR C  3  430 ? -13.048  -34.611  348.748 1.00 12.72  ? 430 THR 3 CA    1 
ATOM   8025  C  C     . THR C  3  430 ? -12.784  -33.429  349.681 1.00 17.65  ? 430 THR 3 C     1 
ATOM   8026  O  O     . THR C  3  430 ? -11.960  -32.561  349.357 1.00 23.92  ? 430 THR 3 O     1 
ATOM   8027  C  CB    . THR C  3  430 ? -11.855  -35.574  348.757 1.00 9.61   ? 430 THR 3 CB    1 
ATOM   8028  O  OG1   . THR C  3  430 ? -12.117  -36.652  347.863 1.00 12.76  ? 430 THR 3 OG1   1 
ATOM   8029  C  CG2   . THR C  3  430 ? -11.642  -36.179  350.141 1.00 9.62   ? 430 THR 3 CG2   1 
ATOM   8030  N  N     . PRO C  3  431 ? -13.470  -33.343  350.821 1.00 13.43  ? 431 PRO 3 N     1 
ATOM   8031  C  CA    . PRO C  3  431 ? -13.341  -32.161  351.674 1.00 16.94  ? 431 PRO 3 CA    1 
ATOM   8032  C  C     . PRO C  3  431 ? -11.935  -31.959  352.234 1.00 26.06  ? 431 PRO 3 C     1 
ATOM   8033  O  O     . PRO C  3  431 ? -11.197  -32.910  352.526 1.00 20.42  ? 431 PRO 3 O     1 
ATOM   8034  C  CB    . PRO C  3  431 ? -14.355  -32.424  352.795 1.00 14.85  ? 431 PRO 3 CB    1 
ATOM   8035  C  CG    . PRO C  3  431 ? -14.594  -33.874  352.770 1.00 13.26  ? 431 PRO 3 CG    1 
ATOM   8036  C  CD    . PRO C  3  431 ? -14.497  -34.261  351.332 1.00 12.23  ? 431 PRO 3 CD    1 
ATOM   8037  N  N     . PHE C  3  432 ? -11.581  -30.669  352.377 1.00 34.88  ? 432 PHE 3 N     1 
ATOM   8038  C  CA    . PHE C  3  432 ? -10.275  -30.240  352.894 1.00 35.32  ? 432 PHE 3 CA    1 
ATOM   8039  C  C     . PHE C  3  432 ? -10.157  -30.474  354.401 1.00 38.35  ? 432 PHE 3 C     1 
ATOM   8040  O  O     . PHE C  3  432 ? -9.115   -30.940  354.884 1.00 33.65  ? 432 PHE 3 O     1 
ATOM   8041  C  CB    . PHE C  3  432 ? -10.063  -28.755  352.581 1.00 29.90  ? 432 PHE 3 CB    1 
ATOM   8042  C  CG    . PHE C  3  432 ? -9.415   -28.491  351.249 1.00 24.28  ? 432 PHE 3 CG    1 
ATOM   8043  C  CD1   . PHE C  3  432 ? -9.030   -29.529  350.428 1.00 22.30  ? 432 PHE 3 CD1   1 
ATOM   8044  C  CD2   . PHE C  3  432 ? -9.252   -27.197  350.793 1.00 22.30  ? 432 PHE 3 CD2   1 
ATOM   8045  C  CE1   . PHE C  3  432 ? -8.444   -29.273  349.198 1.00 23.77  ? 432 PHE 3 CE1   1 
ATOM   8046  C  CE2   . PHE C  3  432 ? -8.679   -26.940  349.558 1.00 24.07  ? 432 PHE 3 CE2   1 
ATOM   8047  C  CZ    . PHE C  3  432 ? -8.278   -27.985  348.761 1.00 27.24  ? 432 PHE 3 CZ    1 
ATOM   8048  N  N     . ALA C  3  433 ? -11.209  -30.153  355.160 1.00 39.70  ? 433 ALA 3 N     1 
ATOM   8049  C  CA    . ALA C  3  433 ? -11.201  -30.295  356.619 1.00 37.57  ? 433 ALA 3 CA    1 
ATOM   8050  C  C     . ALA C  3  433 ? -12.464  -31.018  357.082 1.00 31.19  ? 433 ALA 3 C     1 
ATOM   8051  O  O     . ALA C  3  433 ? -13.509  -30.390  357.282 1.00 30.39  ? 433 ALA 3 O     1 
ATOM   8052  C  CB    . ALA C  3  433 ? -11.094  -28.934  357.297 1.00 34.60  ? 433 ALA 3 CB    1 
ATOM   8053  N  N     . ASP C  3  434 ? -12.352  -32.327  357.303 1.00 27.36  ? 434 ASP 3 N     1 
ATOM   8054  C  CA    . ASP C  3  434 ? -13.446  -33.110  357.858 1.00 24.49  ? 434 ASP 3 CA    1 
ATOM   8055  C  C     . ASP C  3  434 ? -13.369  -32.985  359.378 1.00 20.03  ? 434 ASP 3 C     1 
ATOM   8056  O  O     . ASP C  3  434 ? -12.405  -33.446  360.003 1.00 14.39  ? 434 ASP 3 O     1 
ATOM   8057  C  CB    . ASP C  3  434 ? -13.336  -34.569  357.429 1.00 28.37  ? 434 ASP 3 CB    1 
ATOM   8058  C  CG    . ASP C  3  434 ? -14.671  -35.327  357.534 1.00 30.88  ? 434 ASP 3 CG    1 
ATOM   8059  O  OD1   . ASP C  3  434 ? -15.596  -34.816  358.200 1.00 33.72  ? 434 ASP 3 OD1   1 
ATOM   8060  O  OD2   . ASP C  3  434 ? -14.779  -36.469  357.024 1.00 31.12  ? 434 ASP 3 OD2   1 
ATOM   8061  N  N     . LEU C  3  435 ? -14.360  -32.310  359.971 1.00 15.20  ? 435 LEU 3 N     1 
ATOM   8062  C  CA    . LEU C  3  435 ? -14.456  -32.207  361.422 1.00 9.43   ? 435 LEU 3 CA    1 
ATOM   8063  C  C     . LEU C  3  435 ? -14.804  -33.531  362.069 1.00 16.41  ? 435 LEU 3 C     1 
ATOM   8064  O  O     . LEU C  3  435 ? -14.760  -33.632  363.298 1.00 23.67  ? 435 LEU 3 O     1 
ATOM   8065  C  CB    . LEU C  3  435 ? -15.495  -31.161  361.814 1.00 8.03   ? 435 LEU 3 CB    1 
ATOM   8066  C  CG    . LEU C  3  435 ? -15.126  -29.726  361.474 1.00 9.99   ? 435 LEU 3 CG    1 
ATOM   8067  C  CD1   . LEU C  3  435 ? -15.772  -28.828  362.497 1.00 10.08  ? 435 LEU 3 CD1   1 
ATOM   8068  C  CD2   . LEU C  3  435 ? -13.608  -29.537  361.479 1.00 11.12  ? 435 LEU 3 CD2   1 
ATOM   8069  N  N     . GLN C  3  436 ? -15.126  -34.543  361.266 1.00 15.51  ? 436 GLN 3 N     1 
ATOM   8070  C  CA    . GLN C  3  436 ? -15.360  -35.882  361.787 1.00 18.37  ? 436 GLN 3 CA    1 
ATOM   8071  C  C     . GLN C  3  436 ? -14.094  -36.487  362.400 1.00 11.59  ? 436 GLN 3 C     1 
ATOM   8072  O  O     . GLN C  3  436 ? -14.188  -37.277  363.345 1.00 11.85  ? 436 GLN 3 O     1 
ATOM   8073  C  CB    . GLN C  3  436 ? -15.908  -36.760  360.655 1.00 14.04  ? 436 GLN 3 CB    1 
ATOM   8074  C  CG    . GLN C  3  436 ? -16.107  -38.251  360.978 1.00 17.20  ? 436 GLN 3 CG    1 
ATOM   8075  C  CD    . GLN C  3  436 ? -16.400  -39.096  359.735 1.00 19.29  ? 436 GLN 3 CD    1 
ATOM   8076  O  OE1   . GLN C  3  436 ? -16.784  -40.259  359.848 1.00 15.52  ? 436 GLN 3 OE1   1 
ATOM   8077  N  NE2   . GLN C  3  436 ? -16.242  -38.502  358.547 1.00 19.57  ? 436 GLN 3 NE2   1 
ATOM   8078  N  N     . ILE C  3  437 ? -12.909  -36.087  361.941 1.00 13.94  ? 437 ILE 3 N     1 
ATOM   8079  C  CA    . ILE C  3  437 ? -11.659  -36.730  362.348 1.00 15.42  ? 437 ILE 3 CA    1 
ATOM   8080  C  C     . ILE C  3  437 ? -10.945  -35.829  363.355 1.00 16.28  ? 437 ILE 3 C     1 
ATOM   8081  O  O     . ILE C  3  437 ? -10.212  -34.918  362.972 1.00 9.75   ? 437 ILE 3 O     1 
ATOM   8082  C  CB    . ILE C  3  437 ? -10.763  -37.022  361.139 1.00 13.40  ? 437 ILE 3 CB    1 
ATOM   8083  C  CG1   . ILE C  3  437 ? -11.595  -37.583  359.985 1.00 8.09   ? 437 ILE 3 CG1   1 
ATOM   8084  C  CG2   . ILE C  3  437 ? -9.621   -38.003  361.518 1.00 19.15  ? 437 ILE 3 CG2   1 
ATOM   8085  C  CD1   . ILE C  3  437 ? -10.904  -37.538  358.646 1.00 8.09   ? 437 ILE 3 CD1   1 
ATOM   8086  N  N     . LYS C  3  438 ? -11.096  -36.121  364.647 1.00 24.41  ? 438 LYS 3 N     1 
ATOM   8087  C  CA    . LYS C  3  438 ? -10.286  -35.489  365.679 1.00 34.07  ? 438 LYS 3 CA    1 
ATOM   8088  C  C     . LYS C  3  438 ? -8.986   -36.262  365.895 1.00 43.52  ? 438 LYS 3 C     1 
ATOM   8089  O  O     . LYS C  3  438 ? -8.764   -37.343  365.337 1.00 47.15  ? 438 LYS 3 O     1 
ATOM   8090  C  CB    . LYS C  3  438 ? -11.070  -35.349  366.991 1.00 38.07  ? 438 LYS 3 CB    1 
ATOM   8091  C  CG    . LYS C  3  438 ? -12.466  -34.736  366.850 1.00 47.56  ? 438 LYS 3 CG    1 
ATOM   8092  C  CD    . LYS C  3  438 ? -12.377  -33.211  366.584 1.00 51.64  ? 438 LYS 3 CD    1 
ATOM   8093  C  CE    . LYS C  3  438 ? -13.692  -32.490  366.876 1.00 50.51  ? 438 LYS 3 CE    1 
ATOM   8094  N  NZ    . LYS C  3  438 ? -14.666  -32.688  365.767 1.00 49.22  ? 438 LYS 3 NZ    1 
ATOM   8095  N  N     . GLU C  3  439 ? -8.098   -35.674  366.691 1.00 40.67  ? 439 GLU 3 N     1 
ATOM   8096  C  CA    . GLU C  3  439 ? -6.766   -36.235  366.873 1.00 36.74  ? 439 GLU 3 CA    1 
ATOM   8097  C  C     . GLU C  3  439 ? -6.756   -37.252  368.010 1.00 26.01  ? 439 GLU 3 C     1 
ATOM   8098  O  O     . GLU C  3  439 ? -7.529   -37.144  368.967 1.00 28.66  ? 439 GLU 3 O     1 
ATOM   8099  C  CB    . GLU C  3  439 ? -5.741   -35.123  367.155 1.00 34.18  ? 439 GLU 3 CB    1 
ATOM   8100  C  CG    . GLU C  3  439 ? -4.284   -35.584  367.088 1.00 33.50  ? 439 GLU 3 CG    1 
ATOM   8101  C  CD    . GLU C  3  439 ? -3.287   -34.456  367.310 1.00 29.90  ? 439 GLU 3 CD    1 
ATOM   8102  O  OE1   . GLU C  3  439 ? -3.713   -33.325  367.618 1.00 28.75  ? 439 GLU 3 OE1   1 
ATOM   8103  O  OE2   . GLU C  3  439 ? -2.072   -34.702  367.170 1.00 29.28  ? 439 GLU 3 OE2   1 
ATOM   8104  N  N     . ARG C  3  440 ? -5.859   -38.241  367.888 1.00 23.01  ? 440 ARG 3 N     1 
ATOM   8105  C  CA    . ARG C  3  440 ? -5.642   -39.285  368.902 1.00 22.72  ? 440 ARG 3 CA    1 
ATOM   8106  C  C     . ARG C  3  440 ? -6.901   -40.128  369.098 1.00 17.72  ? 440 ARG 3 C     1 
ATOM   8107  O  O     . ARG C  3  440 ? -7.301   -40.442  370.223 1.00 13.48  ? 440 ARG 3 O     1 
ATOM   8108  C  CB    . ARG C  3  440 ? -5.201   -38.667  370.234 1.00 26.40  ? 440 ARG 3 CB    1 
ATOM   8109  C  CG    . ARG C  3  440 ? -3.932   -37.801  370.195 1.00 25.34  ? 440 ARG 3 CG    1 
ATOM   8110  C  CD    . ARG C  3  440 ? -2.664   -38.616  370.039 1.00 20.29  ? 440 ARG 3 CD    1 
ATOM   8111  N  NE    . ARG C  3  440 ? -2.554   -39.611  371.099 1.00 20.13  ? 440 ARG 3 NE    1 
ATOM   8112  C  CZ    . ARG C  3  440 ? -1.564   -40.495  371.196 1.00 21.84  ? 440 ARG 3 CZ    1 
ATOM   8113  N  NH1   . ARG C  3  440 ? -0.574   -40.505  370.309 1.00 25.06  ? 440 ARG 3 NH1   1 
ATOM   8114  N  NH2   . ARG C  3  440 ? -1.559   -41.374  372.186 1.00 20.62  ? 440 ARG 3 NH2   1 
ATOM   8115  N  N     . MET C  3  441 ? -7.509   -40.502  368.010 1.00 22.20  ? 441 MET 3 N     1 
ATOM   8116  C  CA    . MET C  3  441 ? -8.807   -41.146  368.064 1.00 18.43  ? 441 MET 3 CA    1 
ATOM   8117  C  C     . MET C  3  441 ? -8.680   -42.613  368.496 1.00 13.11  ? 441 MET 3 C     1 
ATOM   8118  O  O     . MET C  3  441 ? -7.787   -43.334  368.035 1.00 8.21   ? 441 MET 3 O     1 
ATOM   8119  C  CB    . MET C  3  441 ? -9.456   -41.059  366.695 1.00 19.68  ? 441 MET 3 CB    1 
ATOM   8120  C  CG    . MET C  3  441 ? -10.125  -39.755  366.380 1.00 9.85   ? 441 MET 3 CG    1 
ATOM   8121  S  SD    . MET C  3  441 ? -10.565  -39.796  364.630 1.00 13.10  ? 441 MET 3 SD    1 
ATOM   8122  C  CE    . MET C  3  441 ? -12.050  -40.807  364.627 1.00 8.12   ? 441 MET 3 CE    1 
ATOM   8123  N  N     . PRO C  3  442 ? -9.625   -43.102  369.290 1.00 16.31  ? 442 PRO 3 N     1 
ATOM   8124  C  CA    . PRO C  3  442 ? -9.538   -44.474  369.785 1.00 8.20   ? 442 PRO 3 CA    1 
ATOM   8125  C  C     . PRO C  3  442 ? -9.911   -45.443  368.685 1.00 10.07  ? 442 PRO 3 C     1 
ATOM   8126  O  O     . PRO C  3  442 ? -10.694  -45.125  367.790 1.00 11.81  ? 442 PRO 3 O     1 
ATOM   8127  C  CB    . PRO C  3  442 ? -10.577  -44.511  370.910 1.00 9.83   ? 442 PRO 3 CB    1 
ATOM   8128  C  CG    . PRO C  3  442 ? -11.599  -43.523  370.473 1.00 21.73  ? 442 PRO 3 CG    1 
ATOM   8129  C  CD    . PRO C  3  442 ? -10.849  -42.423  369.764 1.00 20.42  ? 442 PRO 3 CD    1 
ATOM   8130  N  N     . ARG C  3  443 ? -9.285   -46.617  368.734 1.00 17.23  ? 443 ARG 3 N     1 
ATOM   8131  C  CA    . ARG C  3  443 ? -9.509   -47.719  367.796 1.00 18.25  ? 443 ARG 3 CA    1 
ATOM   8132  C  C     . ARG C  3  443 ? -10.224  -48.813  368.568 1.00 26.60  ? 443 ARG 3 C     1 
ATOM   8133  O  O     . ARG C  3  443 ? -9.738   -49.245  369.616 1.00 33.48  ? 443 ARG 3 O     1 
ATOM   8134  C  CB    . ARG C  3  443 ? -8.182   -48.222  367.219 1.00 16.17  ? 443 ARG 3 CB    1 
ATOM   8135  C  CG    . ARG C  3  443 ? -7.200   -47.063  366.997 1.00 8.40   ? 443 ARG 3 CG    1 
ATOM   8136  C  CD    . ARG C  3  443 ? -5.912   -47.455  366.330 1.00 8.24   ? 443 ARG 3 CD    1 
ATOM   8137  N  NE    . ARG C  3  443 ? -6.003   -47.361  364.881 1.00 9.87   ? 443 ARG 3 NE    1 
ATOM   8138  C  CZ    . ARG C  3  443 ? -5.318   -46.507  364.125 1.00 8.67   ? 443 ARG 3 CZ    1 
ATOM   8139  N  NH1   . ARG C  3  443 ? -4.498   -45.616  364.669 1.00 18.00  ? 443 ARG 3 NH1   1 
ATOM   8140  N  NH2   . ARG C  3  443 ? -5.478   -46.535  362.808 1.00 8.22   ? 443 ARG 3 NH2   1 
ATOM   8141  N  N     . ARG C  3  444 ? -11.395  -49.210  368.084 1.00 19.73  ? 444 ARG 3 N     1 
ATOM   8142  C  CA    . ARG C  3  444 ? -12.283  -50.103  368.822 1.00 18.23  ? 444 ARG 3 CA    1 
ATOM   8143  C  C     . ARG C  3  444 ? -11.895  -51.583  368.698 1.00 13.71  ? 444 ARG 3 C     1 
ATOM   8144  O  O     . ARG C  3  444 ? -11.453  -52.062  367.650 1.00 10.04  ? 444 ARG 3 O     1 
ATOM   8145  C  CB    . ARG C  3  444 ? -13.710  -49.865  368.344 1.00 18.34  ? 444 ARG 3 CB    1 
ATOM   8146  C  CG    . ARG C  3  444 ? -14.203  -48.417  368.544 1.00 16.19  ? 444 ARG 3 CG    1 
ATOM   8147  C  CD    . ARG C  3  444 ? -15.597  -48.293  367.924 1.00 17.18  ? 444 ARG 3 CD    1 
ATOM   8148  N  NE    . ARG C  3  444 ? -16.411  -49.490  368.128 1.00 13.90  ? 444 ARG 3 NE    1 
ATOM   8149  C  CZ    . ARG C  3  444 ? -17.674  -49.620  367.736 1.00 13.12  ? 444 ARG 3 CZ    1 
ATOM   8150  N  NH1   . ARG C  3  444 ? -18.295  -48.639  367.099 1.00 9.70   ? 444 ARG 3 NH1   1 
ATOM   8151  N  NH2   . ARG C  3  444 ? -18.313  -50.757  367.964 1.00 17.00  ? 444 ARG 3 NH2   1 
ATOM   8152  N  N     . THR C  3  445 ? -12.081  -52.312  369.778 1.00 16.17  ? 445 THR 3 N     1 
ATOM   8153  C  CA    . THR C  3  445 ? -11.744  -53.723  369.801 1.00 24.18  ? 445 THR 3 CA    1 
ATOM   8154  C  C     . THR C  3  445 ? -12.942  -54.637  369.509 1.00 28.72  ? 445 THR 3 C     1 
ATOM   8155  O  O     . THR C  3  445 ? -12.769  -55.863  369.369 1.00 26.44  ? 445 THR 3 O     1 
ATOM   8156  C  CB    . THR C  3  445 ? -11.111  -54.034  371.158 1.00 21.26  ? 445 THR 3 CB    1 
ATOM   8157  O  OG1   . THR C  3  445 ? -12.062  -53.742  372.192 1.00 26.93  ? 445 THR 3 OG1   1 
ATOM   8158  C  CG2   . THR C  3  445 ? -9.850   -53.181  371.354 1.00 8.23   ? 445 THR 3 CG2   1 
ATOM   8159  N  N     . ASP C  3  446 ? -14.134  -54.056  369.369 1.00 34.16  ? 446 ASP 3 N     1 
ATOM   8160  C  CA    . ASP C  3  446 ? -15.384  -54.788  369.206 1.00 33.52  ? 446 ASP 3 CA    1 
ATOM   8161  C  C     . ASP C  3  446 ? -15.941  -54.763  367.787 1.00 34.07  ? 446 ASP 3 C     1 
ATOM   8162  O  O     . ASP C  3  446 ? -16.949  -55.440  367.521 1.00 30.95  ? 446 ASP 3 O     1 
ATOM   8163  C  CB    . ASP C  3  446 ? -16.428  -54.205  370.166 1.00 27.95  ? 446 ASP 3 CB    1 
ATOM   8164  C  CG    . ASP C  3  446 ? -16.824  -52.780  369.798 1.00 17.82  ? 446 ASP 3 CG    1 
ATOM   8165  O  OD1   . ASP C  3  446 ? -15.929  -51.941  369.554 1.00 14.00  ? 446 ASP 3 OD1   1 
ATOM   8166  O  OD2   . ASP C  3  446 ? -18.040  -52.494  369.774 1.00 17.17  ? 446 ASP 3 OD2   1 
ATOM   8167  N  N     . LYS C  3  447 ? -15.295  -54.043  366.863 1.00 31.07  ? 447 LYS 3 N     1 
ATOM   8168  C  CA    . LYS C  3  447 ? -15.813  -53.887  365.508 1.00 24.46  ? 447 LYS 3 CA    1 
ATOM   8169  C  C     . LYS C  3  447 ? -15.251  -54.891  364.505 1.00 31.94  ? 447 LYS 3 C     1 
ATOM   8170  O  O     . LYS C  3  447 ? -15.780  -54.982  363.391 1.00 38.20  ? 447 LYS 3 O     1 
ATOM   8171  C  CB    . LYS C  3  447 ? -15.549  -52.467  364.999 1.00 14.64  ? 447 LYS 3 CB    1 
ATOM   8172  C  CG    . LYS C  3  447 ? -16.702  -51.890  364.198 1.00 10.42  ? 447 LYS 3 CG    1 
ATOM   8173  C  CD    . LYS C  3  447 ? -16.493  -50.403  363.935 1.00 15.13  ? 447 LYS 3 CD    1 
ATOM   8174  C  CE    . LYS C  3  447 ? -17.596  -49.794  363.067 1.00 18.92  ? 447 LYS 3 CE    1 
ATOM   8175  N  NZ    . LYS C  3  447 ? -17.327  -48.349  362.799 1.00 8.06   ? 447 LYS 3 NZ    1 
ATOM   8176  N  N     . MET C  3  448 ? -14.225  -55.658  364.869 1.00 21.59  ? 448 MET 3 N     1 
ATOM   8177  C  CA    . MET C  3  448 ? -13.661  -56.643  363.958 1.00 12.51  ? 448 MET 3 CA    1 
ATOM   8178  C  C     . MET C  3  448 ? -13.089  -57.782  364.781 1.00 13.20  ? 448 MET 3 C     1 
ATOM   8179  O  O     . MET C  3  448 ? -12.715  -57.598  365.943 1.00 17.65  ? 448 MET 3 O     1 
ATOM   8180  C  CB    . MET C  3  448 ? -12.562  -56.051  363.067 1.00 9.96   ? 448 MET 3 CB    1 
ATOM   8181  C  CG    . MET C  3  448 ? -11.347  -55.543  363.815 1.00 16.08  ? 448 MET 3 CG    1 
ATOM   8182  S  SD    . MET C  3  448 ? -10.037  -54.955  362.698 1.00 20.87  ? 448 MET 3 SD    1 
ATOM   8183  C  CE    . MET C  3  448 ? -9.334   -56.479  362.110 1.00 21.59  ? 448 MET 3 CE    1 
ATOM   8184  N  N     . ALA C  3  449 ? -13.000  -58.962  364.148 1.00 17.43  ? 449 ALA 3 N     1 
ATOM   8185  C  CA    . ALA C  3  449 ? -12.408  -60.161  364.745 1.00 18.03  ? 449 ALA 3 CA    1 
ATOM   8186  C  C     . ALA C  3  449 ? -11.526  -60.832  363.707 1.00 13.40  ? 449 ALA 3 C     1 
ATOM   8187  O  O     . ALA C  3  449 ? -11.991  -61.122  362.600 1.00 12.53  ? 449 ALA 3 O     1 
ATOM   8188  C  CB    . ALA C  3  449 ? -13.463  -61.163  365.214 1.00 9.82   ? 449 ALA 3 CB    1 
ATOM   8189  N  N     . LEU C  3  450 ? -10.296  -61.158  364.096 1.00 12.46  ? 450 LEU 3 N     1 
ATOM   8190  C  CA    . LEU C  3  450 ? -9.282   -61.631  363.168 1.00 11.79  ? 450 LEU 3 CA    1 
ATOM   8191  C  C     . LEU C  3  450 ? -8.800   -63.019  363.569 1.00 13.03  ? 450 LEU 3 C     1 
ATOM   8192  O  O     . LEU C  3  450 ? -8.564   -63.302  364.751 1.00 12.47  ? 450 LEU 3 O     1 
ATOM   8193  C  CB    . LEU C  3  450 ? -8.086   -60.654  363.135 1.00 14.62  ? 450 LEU 3 CB    1 
ATOM   8194  C  CG    . LEU C  3  450 ? -7.058   -60.696  361.998 1.00 15.74  ? 450 LEU 3 CG    1 
ATOM   8195  C  CD1   . LEU C  3  450 ? -6.463   -59.315  361.694 1.00 8.23   ? 450 LEU 3 CD1   1 
ATOM   8196  C  CD2   . LEU C  3  450 ? -5.953   -61.708  362.330 1.00 8.25   ? 450 LEU 3 CD2   1 
ATOM   8197  N  N     . PHE C  3  451 ? -8.673   -63.894  362.577 1.00 12.61  ? 451 PHE 3 N     1 
ATOM   8198  C  CA    . PHE C  3  451 ? -8.103   -65.217  362.790 1.00 9.97   ? 451 PHE 3 CA    1 
ATOM   8199  C  C     . PHE C  3  451 ? -7.068   -65.456  361.703 1.00 17.98  ? 451 PHE 3 C     1 
ATOM   8200  O  O     . PHE C  3  451 ? -7.412   -65.593  360.525 1.00 29.27  ? 451 PHE 3 O     1 
ATOM   8201  C  CB    . PHE C  3  451 ? -9.182   -66.293  362.795 1.00 9.26   ? 451 PHE 3 CB    1 
ATOM   8202  C  CG    . PHE C  3  451 ? -10.041  -66.253  364.019 1.00 9.99   ? 451 PHE 3 CG    1 
ATOM   8203  C  CD1   . PHE C  3  451 ? -9.644   -66.888  365.170 1.00 10.25  ? 451 PHE 3 CD1   1 
ATOM   8204  C  CD2   . PHE C  3  451 ? -11.269  -65.627  364.008 1.00 12.81  ? 451 PHE 3 CD2   1 
ATOM   8205  C  CE1   . PHE C  3  451 ? -10.418  -66.852  366.300 1.00 8.26   ? 451 PHE 3 CE1   1 
ATOM   8206  C  CE2   . PHE C  3  451 ? -12.057  -65.605  365.146 1.00 13.99  ? 451 PHE 3 CE2   1 
ATOM   8207  C  CZ    . PHE C  3  451 ? -11.623  -66.220  366.288 1.00 8.24   ? 451 PHE 3 CZ    1 
ATOM   8208  N  N     . ALA C  3  452 ? -5.815   -65.536  362.098 1.00 19.18  ? 452 ALA 3 N     1 
ATOM   8209  C  CA    . ALA C  3  452 ? -4.716   -65.694  361.165 1.00 14.24  ? 452 ALA 3 CA    1 
ATOM   8210  C  C     . ALA C  3  452 ? -3.811   -66.791  361.691 1.00 8.50   ? 452 ALA 3 C     1 
ATOM   8211  O  O     . ALA C  3  452 ? -3.869   -67.143  362.875 1.00 8.31   ? 452 ALA 3 O     1 
ATOM   8212  C  CB    . ALA C  3  452 ? -3.925   -64.384  360.995 1.00 13.11  ? 452 ALA 3 CB    1 
ATOM   8213  N  N     . PRO C  3  453 ? -3.005   -67.402  360.821 1.00 8.31   ? 453 PRO 3 N     1 
ATOM   8214  C  CA    . PRO C  3  453 ? -1.981   -68.330  361.319 1.00 15.54  ? 453 PRO 3 CA    1 
ATOM   8215  C  C     . PRO C  3  453 ? -0.855   -67.627  362.060 1.00 9.99   ? 453 PRO 3 C     1 
ATOM   8216  O  O     . PRO C  3  453 ? -0.077   -68.299  362.747 1.00 8.36   ? 453 PRO 3 O     1 
ATOM   8217  C  CB    . PRO C  3  453 ? -1.485   -69.029  360.040 1.00 12.64  ? 453 PRO 3 CB    1 
ATOM   8218  C  CG    . PRO C  3  453 ? -1.868   -68.108  358.925 1.00 12.55  ? 453 PRO 3 CG    1 
ATOM   8219  C  CD    . PRO C  3  453 ? -3.155   -67.467  359.359 1.00 17.73  ? 453 PRO 3 CD    1 
ATOM   8220  N  N     . TYR C  3  454 ? -0.755   -66.302  361.973 1.00 11.18  ? 454 TYR 3 N     1 
ATOM   8221  C  CA    . TYR C  3  454 ? 0.245    -65.592  362.744 1.00 17.07  ? 454 TYR 3 CA    1 
ATOM   8222  C  C     . TYR C  3  454 ? -0.377   -64.313  363.311 1.00 20.44  ? 454 TYR 3 C     1 
ATOM   8223  O  O     . TYR C  3  454 ? -1.478   -63.884  362.935 1.00 8.33   ? 454 TYR 3 O     1 
ATOM   8224  C  CB    . TYR C  3  454 ? 1.485    -65.279  361.886 1.00 14.29  ? 454 TYR 3 CB    1 
ATOM   8225  C  CG    . TYR C  3  454 ? 1.249    -64.386  360.671 1.00 17.22  ? 454 TYR 3 CG    1 
ATOM   8226  C  CD1   . TYR C  3  454 ? 0.933    -64.913  359.423 1.00 15.29  ? 454 TYR 3 CD1   1 
ATOM   8227  C  CD2   . TYR C  3  454 ? 1.433    -63.004  360.762 1.00 17.06  ? 454 TYR 3 CD2   1 
ATOM   8228  C  CE1   . TYR C  3  454 ? 0.743    -64.066  358.301 1.00 16.23  ? 454 TYR 3 CE1   1 
ATOM   8229  C  CE2   . TYR C  3  454 ? 1.260    -62.168  359.658 1.00 17.86  ? 454 TYR 3 CE2   1 
ATOM   8230  C  CZ    . TYR C  3  454 ? 0.920    -62.692  358.433 1.00 17.23  ? 454 TYR 3 CZ    1 
ATOM   8231  O  OH    . TYR C  3  454 ? 0.765    -61.821  357.368 1.00 8.31   ? 454 TYR 3 OH    1 
ATOM   8232  N  N     . ARG C  3  455 ? 0.405    -63.648  364.146 1.00 28.14  ? 455 ARG 3 N     1 
ATOM   8233  C  CA    . ARG C  3  455 ? -0.055   -62.476  364.880 1.00 27.58  ? 455 ARG 3 CA    1 
ATOM   8234  C  C     . ARG C  3  455 ? 0.128    -61.239  364.001 1.00 26.68  ? 455 ARG 3 C     1 
ATOM   8235  O  O     . ARG C  3  455 ? 1.216    -60.664  363.930 1.00 24.25  ? 455 ARG 3 O     1 
ATOM   8236  C  CB    . ARG C  3  455 ? 0.694    -62.385  366.207 1.00 29.08  ? 455 ARG 3 CB    1 
ATOM   8237  C  CG    . ARG C  3  455 ? 0.145    -61.423  367.243 1.00 27.43  ? 455 ARG 3 CG    1 
ATOM   8238  C  CD    . ARG C  3  455 ? 1.284    -60.934  368.099 1.00 27.23  ? 455 ARG 3 CD    1 
ATOM   8239  N  NE    . ARG C  3  455 ? 2.339    -60.370  367.273 1.00 26.61  ? 455 ARG 3 NE    1 
ATOM   8240  C  CZ    . ARG C  3  455 ? 3.601    -60.268  367.670 1.00 21.90  ? 455 ARG 3 CZ    1 
ATOM   8241  N  NH1   . ARG C  3  455 ? 3.941    -60.695  368.876 1.00 18.93  ? 455 ARG 3 NH1   1 
ATOM   8242  N  NH2   . ARG C  3  455 ? 4.515    -59.744  366.867 1.00 21.46  ? 455 ARG 3 NH2   1 
ATOM   8243  N  N     . ALA C  3  456 ? -0.953   -60.838  363.325 1.00 24.09  ? 456 ALA 3 N     1 
ATOM   8244  C  CA    . ALA C  3  456 ? -0.933   -59.692  362.426 1.00 22.39  ? 456 ALA 3 CA    1 
ATOM   8245  C  C     . ALA C  3  456 ? -0.907   -58.383  363.208 1.00 16.17  ? 456 ALA 3 C     1 
ATOM   8246  O  O     . ALA C  3  456 ? -1.387   -58.317  364.345 1.00 8.32   ? 456 ALA 3 O     1 
ATOM   8247  C  CB    . ALA C  3  456 ? -2.156   -59.692  361.514 1.00 19.33  ? 456 ALA 3 CB    1 
ATOM   8248  N  N     . PRO C  3  457 ? -0.316   -57.329  362.604 1.00 28.91  ? 457 PRO 3 N     1 
ATOM   8249  C  CA    . PRO C  3  457 ? -0.304   -55.964  363.178 1.00 33.54  ? 457 PRO 3 CA    1 
ATOM   8250  C  C     . PRO C  3  457 ? -1.662   -55.389  363.571 1.00 34.98  ? 457 PRO 3 C     1 
ATOM   8251  O  O     . PRO C  3  457 ? -1.748   -54.397  364.315 1.00 27.70  ? 457 PRO 3 O     1 
ATOM   8252  C  CB    . PRO C  3  457 ? 0.312    -55.121  362.052 1.00 39.66  ? 457 PRO 3 CB    1 
ATOM   8253  C  CG    . PRO C  3  457 ? 0.876    -56.126  361.012 1.00 36.57  ? 457 PRO 3 CG    1 
ATOM   8254  C  CD    . PRO C  3  457 ? 0.669    -57.507  361.520 1.00 31.66  ? 457 PRO 3 CD    1 
ATOM   8255  N  N     . LEU C  3  458 ? -2.722   -55.959  363.000 1.00 36.81  ? 458 LEU 3 N     1 
ATOM   8256  C  CA    . LEU C  3  458 ? -4.080   -55.564  363.327 1.00 36.54  ? 458 LEU 3 CA    1 
ATOM   8257  C  C     . LEU C  3  458 ? -4.638   -56.303  364.538 1.00 42.79  ? 458 LEU 3 C     1 
ATOM   8258  O  O     . LEU C  3  458 ? -5.659   -55.871  365.083 1.00 37.21  ? 458 LEU 3 O     1 
ATOM   8259  C  CB    . LEU C  3  458 ? -4.998   -55.801  362.125 1.00 30.61  ? 458 LEU 3 CB    1 
ATOM   8260  C  CG    . LEU C  3  458 ? -4.566   -55.166  360.801 1.00 27.38  ? 458 LEU 3 CG    1 
ATOM   8261  C  CD1   . LEU C  3  458 ? -4.024   -56.223  359.864 1.00 30.21  ? 458 LEU 3 CD1   1 
ATOM   8262  C  CD2   . LEU C  3  458 ? -5.726   -54.428  360.151 1.00 21.75  ? 458 LEU 3 CD2   1 
ATOM   8263  N  N     . MET C  3  459 ? -4.002   -57.405  364.965 1.00 42.54  ? 459 MET 3 N     1 
ATOM   8264  C  CA    . MET C  3  459 ? -4.478   -58.132  366.140 1.00 45.77  ? 459 MET 3 CA    1 
ATOM   8265  C  C     . MET C  3  459 ? -4.502   -57.261  367.388 1.00 47.33  ? 459 MET 3 C     1 
ATOM   8266  O  O     . MET C  3  459 ? -5.195   -57.594  368.355 1.00 51.15  ? 459 MET 3 O     1 
ATOM   8267  C  CB    . MET C  3  459 ? -3.621   -59.379  366.392 1.00 46.07  ? 459 MET 3 CB    1 
ATOM   8268  C  CG    . MET C  3  459 ? -4.382   -60.694  366.180 1.00 52.64  ? 459 MET 3 CG    1 
ATOM   8269  S  SD    . MET C  3  459 ? -3.378   -62.214  366.243 1.00 61.05  ? 459 MET 3 SD    1 
ATOM   8270  C  CE    . MET C  3  459 ? -4.224   -63.282  365.080 1.00 60.06  ? 459 MET 3 CE    1 
ATOM   8271  N  N     . LYS C  3  460 ? -3.756   -56.160  367.392 1.00 46.84  ? 460 LYS 3 N     1 
ATOM   8272  C  CA    . LYS C  3  460 ? -3.862   -55.215  368.492 1.00 46.58  ? 460 LYS 3 CA    1 
ATOM   8273  C  C     . LYS C  3  460 ? -5.278   -54.660  368.604 1.00 42.18  ? 460 LYS 3 C     1 
ATOM   8274  O  O     . LYS C  3  460 ? -5.791   -54.472  369.714 1.00 44.66  ? 460 LYS 3 O     1 
ATOM   8275  C  CB    . LYS C  3  460 ? -2.847   -54.086  368.324 1.00 45.75  ? 460 LYS 3 CB    1 
ATOM   8276  C  CG    . LYS C  3  460 ? -2.789   -53.174  369.531 1.00 48.53  ? 460 LYS 3 CG    1 
ATOM   8277  C  CD    . LYS C  3  460 ? -2.420   -53.945  370.796 1.00 49.06  ? 460 LYS 3 CD    1 
ATOM   8278  C  CE    . LYS C  3  460 ? -0.918   -53.980  371.015 1.00 48.97  ? 460 LYS 3 CE    1 
ATOM   8279  N  NZ    . LYS C  3  460 ? -0.579   -54.498  372.367 1.00 50.45  ? 460 LYS 3 NZ    1 
ATOM   8280  N  N     . TRP C  3  461 ? -5.927   -54.397  367.468 1.00 36.20  ? 461 TRP 3 N     1 
ATOM   8281  C  CA    . TRP C  3  461 ? -7.246   -53.771  367.428 1.00 26.35  ? 461 TRP 3 CA    1 
ATOM   8282  C  C     . TRP C  3  461 ? -8.400   -54.754  367.301 1.00 22.95  ? 461 TRP 3 C     1 
ATOM   8283  O  O     . TRP C  3  461 ? -9.546   -54.306  367.158 1.00 26.18  ? 461 TRP 3 O     1 
ATOM   8284  C  CB    . TRP C  3  461 ? -7.333   -52.777  366.275 1.00 21.00  ? 461 TRP 3 CB    1 
ATOM   8285  C  CG    . TRP C  3  461 ? -6.164   -51.884  366.190 1.00 19.10  ? 461 TRP 3 CG    1 
ATOM   8286  C  CD1   . TRP C  3  461 ? -5.338   -51.512  367.210 1.00 10.85  ? 461 TRP 3 CD1   1 
ATOM   8287  C  CD2   . TRP C  3  461 ? -5.658   -51.263  365.009 1.00 12.90  ? 461 TRP 3 CD2   1 
ATOM   8288  N  NE1   . TRP C  3  461 ? -4.351   -50.696  366.734 1.00 18.95  ? 461 TRP 3 NE1   1 
ATOM   8289  C  CE2   . TRP C  3  461 ? -4.527   -50.523  365.386 1.00 13.08  ? 461 TRP 3 CE2   1 
ATOM   8290  C  CE3   . TRP C  3  461 ? -6.053   -51.259  363.669 1.00 10.36  ? 461 TRP 3 CE3   1 
ATOM   8291  C  CZ2   . TRP C  3  461 ? -3.786   -49.783  364.473 1.00 16.28  ? 461 TRP 3 CZ2   1 
ATOM   8292  C  CZ3   . TRP C  3  461 ? -5.322   -50.528  362.769 1.00 10.33  ? 461 TRP 3 CZ3   1 
ATOM   8293  C  CH2   . TRP C  3  461 ? -4.199   -49.798  363.171 1.00 21.09  ? 461 TRP 3 CH2   1 
ATOM   8294  N  N     . ALA C  3  462 ? -8.128   -56.067  367.287 1.00 16.83  ? 462 ALA 3 N     1 
ATOM   8295  C  CA    . ALA C  3  462 ? -9.161   -57.105  367.209 1.00 13.95  ? 462 ALA 3 CA    1 
ATOM   8296  C  C     . ALA C  3  462 ? -9.082   -57.877  368.516 1.00 16.47  ? 462 ALA 3 C     1 
ATOM   8297  O  O     . ALA C  3  462 ? -8.206   -58.730  368.684 1.00 20.29  ? 462 ALA 3 O     1 
ATOM   8298  C  CB    . ALA C  3  462 ? -8.970   -58.022  366.007 1.00 10.74  ? 462 ALA 3 CB    1 
ATOM   8299  N  N     . ALA C  3  463 ? -9.958   -57.531  369.464 1.00 10.88  ? 463 ALA 3 N     1 
ATOM   8300  C  CA    . ALA C  3  463 ? -9.990   -58.230  370.748 1.00 16.27  ? 463 ALA 3 CA    1 
ATOM   8301  C  C     . ALA C  3  463 ? -10.239  -59.731  370.563 1.00 18.91  ? 463 ALA 3 C     1 
ATOM   8302  O  O     . ALA C  3  463 ? -9.595   -60.571  371.209 1.00 17.90  ? 463 ALA 3 O     1 
ATOM   8303  C  CB    . ALA C  3  463 ? -11.051  -57.609  371.662 1.00 10.94  ? 463 ALA 3 CB    1 
ATOM   8304  N  N     . ILE C  3  464 ? -11.175  -60.090  369.697 1.00 26.59  ? 464 ILE 3 N     1 
ATOM   8305  C  CA    . ILE C  3  464 ? -11.378  -61.488  369.354 1.00 11.01  ? 464 ILE 3 CA    1 
ATOM   8306  C  C     . ILE C  3  464 ? -10.241  -61.907  368.433 1.00 11.14  ? 464 ILE 3 C     1 
ATOM   8307  O  O     . ILE C  3  464 ? -10.234  -61.547  367.249 1.00 10.99  ? 464 ILE 3 O     1 
ATOM   8308  C  CB    . ILE C  3  464 ? -12.734  -61.693  368.668 1.00 19.04  ? 464 ILE 3 CB    1 
ATOM   8309  C  CG1   . ILE C  3  464 ? -13.855  -61.265  369.593 1.00 18.59  ? 464 ILE 3 CG1   1 
ATOM   8310  C  CG2   . ILE C  3  464 ? -12.945  -63.150  368.317 1.00 16.22  ? 464 ILE 3 CG2   1 
ATOM   8311  C  CD1   . ILE C  3  464 ? -14.369  -59.887  369.257 1.00 15.26  ? 464 ILE 3 CD1   1 
ATOM   8312  N  N     . HIS C  3  465 ? -9.267   -62.654  368.948 1.00 11.43  ? 465 HIS 3 N     1 
ATOM   8313  C  CA    . HIS C  3  465 ? -8.165   -63.075  368.091 1.00 20.79  ? 465 HIS 3 CA    1 
ATOM   8314  C  C     . HIS C  3  465 ? -7.554   -64.365  368.626 1.00 19.77  ? 465 HIS 3 C     1 
ATOM   8315  O  O     . HIS C  3  465 ? -7.310   -64.506  369.828 1.00 20.91  ? 465 HIS 3 O     1 
ATOM   8316  C  CB    . HIS C  3  465 ? -7.080   -61.995  368.005 1.00 21.72  ? 465 HIS 3 CB    1 
ATOM   8317  C  CG    . HIS C  3  465 ? -6.497   -61.634  369.336 1.00 23.21  ? 465 HIS 3 CG    1 
ATOM   8318  N  ND1   . HIS C  3  465 ? -7.088   -60.714  370.175 1.00 24.80  ? 465 HIS 3 ND1   1 
ATOM   8319  C  CD2   . HIS C  3  465 ? -5.404   -62.096  369.993 1.00 27.32  ? 465 HIS 3 CD2   1 
ATOM   8320  C  CE1   . HIS C  3  465 ? -6.371   -60.604  371.279 1.00 24.38  ? 465 HIS 3 CE1   1 
ATOM   8321  N  NE2   . HIS C  3  465 ? -5.347   -61.434  371.196 1.00 23.97  ? 465 HIS 3 NE2   1 
ATOM   8322  N  N     . GLU C  3  466 ? -7.280   -65.293  367.725 1.00 19.28  ? 466 GLU 3 N     1 
ATOM   8323  C  CA    . GLU C  3  466 ? -6.716   -66.566  368.134 1.00 26.26  ? 466 GLU 3 CA    1 
ATOM   8324  C  C     . GLU C  3  466 ? -5.733   -66.981  367.055 1.00 34.49  ? 466 GLU 3 C     1 
ATOM   8325  O  O     . GLU C  3  466 ? -6.036   -66.890  365.860 1.00 37.39  ? 466 GLU 3 O     1 
ATOM   8326  C  CB    . GLU C  3  466 ? -7.807   -67.632  368.358 1.00 25.81  ? 466 GLU 3 CB    1 
ATOM   8327  C  CG    . GLU C  3  466 ? -7.305   -69.044  368.672 1.00 25.85  ? 466 GLU 3 CG    1 
ATOM   8328  C  CD    . GLU C  3  466 ? -8.049   -69.674  369.848 1.00 28.63  ? 466 GLU 3 CD    1 
ATOM   8329  O  OE1   . GLU C  3  466 ? -8.446   -68.937  370.768 1.00 29.87  ? 466 GLU 3 OE1   1 
ATOM   8330  O  OE2   . GLU C  3  466 ? -8.240   -70.904  369.862 1.00 30.29  ? 466 GLU 3 OE2   1 
ATOM   8331  N  N     . VAL C  3  467 ? -4.529   -67.346  367.470 1.00 34.01  ? 467 VAL 3 N     1 
ATOM   8332  C  CA    . VAL C  3  467 ? -3.509   -67.807  366.541 1.00 28.81  ? 467 VAL 3 CA    1 
ATOM   8333  C  C     . VAL C  3  467 ? -3.689   -69.311  366.365 1.00 28.96  ? 467 VAL 3 C     1 
ATOM   8334  O  O     . VAL C  3  467 ? -3.701   -70.068  367.344 1.00 31.18  ? 467 VAL 3 O     1 
ATOM   8335  C  CB    . VAL C  3  467 ? -2.096   -67.452  367.025 1.00 23.83  ? 467 VAL 3 CB    1 
ATOM   8336  C  CG1   . VAL C  3  467 ? -1.050   -67.992  366.049 1.00 17.64  ? 467 VAL 3 CG1   1 
ATOM   8337  C  CG2   . VAL C  3  467 ? -1.961   -65.939  367.170 1.00 26.76  ? 467 VAL 3 CG2   1 
ATOM   8338  N  N     . HIS C  3  468 ? -3.950   -69.728  365.136 1.00 24.32  ? 468 HIS 3 N     1 
ATOM   8339  C  CA    . HIS C  3  468 ? -4.015   -71.121  364.748 1.00 21.82  ? 468 HIS 3 CA    1 
ATOM   8340  C  C     . HIS C  3  468 ? -2.856   -71.428  363.804 1.00 27.85  ? 468 HIS 3 C     1 
ATOM   8341  O  O     . HIS C  3  468 ? -1.951   -70.612  363.597 1.00 30.03  ? 468 HIS 3 O     1 
ATOM   8342  C  CB    . HIS C  3  468 ? -5.332   -71.441  364.078 1.00 17.40  ? 468 HIS 3 CB    1 
ATOM   8343  C  CG    . HIS C  3  468 ? -5.494   -70.774  362.757 1.00 12.29  ? 468 HIS 3 CG    1 
ATOM   8344  N  ND1   . HIS C  3  468 ? -5.276   -71.435  361.569 1.00 12.29  ? 468 HIS 3 ND1   1 
ATOM   8345  C  CD2   . HIS C  3  468 ? -5.928   -69.537  362.430 1.00 16.06  ? 468 HIS 3 CD2   1 
ATOM   8346  C  CE1   . HIS C  3  468 ? -5.510   -70.615  360.564 1.00 15.91  ? 468 HIS 3 CE1   1 
ATOM   8347  N  NE2   . HIS C  3  468 ? -5.913   -69.458  361.058 1.00 14.59  ? 468 HIS 3 NE2   1 
ATOM   8348  N  N     . ARG C  3  469 ? -2.902   -72.606  363.209 1.00 35.63  ? 469 ARG 3 N     1 
ATOM   8349  C  CA    . ARG C  3  469 ? -1.943   -73.085  362.229 1.00 43.40  ? 469 ARG 3 CA    1 
ATOM   8350  C  C     . ARG C  3  469 ? -2.629   -73.244  360.867 1.00 54.11  ? 469 ARG 3 C     1 
ATOM   8351  O  O     . ARG C  3  469 ? -3.849   -73.086  360.754 1.00 55.70  ? 469 ARG 3 O     1 
ATOM   8352  C  CB    . ARG C  3  469 ? -1.323   -74.412  362.704 1.00 41.69  ? 469 ARG 3 CB    1 
ATOM   8353  C  CG    . ARG C  3  469 ? -2.197   -75.208  363.664 1.00 39.14  ? 469 ARG 3 CG    1 
ATOM   8354  C  CD    . ARG C  3  469 ? -1.376   -76.251  364.401 1.00 35.60  ? 469 ARG 3 CD    1 
ATOM   8355  N  NE    . ARG C  3  469 ? -2.004   -76.729  365.631 1.00 33.35  ? 469 ARG 3 NE    1 
ATOM   8356  C  CZ    . ARG C  3  469 ? -1.922   -76.101  366.801 1.00 35.02  ? 469 ARG 3 CZ    1 
ATOM   8357  N  NH1   . ARG C  3  469 ? -1.237   -74.964  366.895 1.00 39.76  ? 469 ARG 3 NH1   1 
ATOM   8358  N  NH2   . ARG C  3  469 ? -2.516   -76.605  367.880 1.00 31.07  ? 469 ARG 3 NH2   1 
ATOM   8359  N  N     . PRO C  3  470 ? -1.862   -73.466  359.794 1.00 57.75  ? 470 PRO 3 N     1 
ATOM   8360  C  CA    . PRO C  3  470 ? -2.468   -73.595  358.460 1.00 58.43  ? 470 PRO 3 CA    1 
ATOM   8361  C  C     . PRO C  3  470 ? -3.545   -74.670  358.377 1.00 54.79  ? 470 PRO 3 C     1 
ATOM   8362  O  O     . PRO C  3  470 ? -3.579   -75.635  359.147 1.00 54.80  ? 470 PRO 3 O     1 
ATOM   8363  C  CB    . PRO C  3  470 ? -1.272   -73.953  357.575 1.00 57.61  ? 470 PRO 3 CB    1 
ATOM   8364  C  CG    . PRO C  3  470 ? -0.157   -73.215  358.203 1.00 59.87  ? 470 PRO 3 CG    1 
ATOM   8365  C  CD    . PRO C  3  470 ? -0.396   -73.327  359.693 1.00 61.46  ? 470 PRO 3 CD    1 
ATOM   8366  N  N     . GLY C  3  471 ? -4.426   -74.493  357.390 1.00 51.73  ? 471 GLY 3 N     1 
ATOM   8367  C  CA    . GLY C  3  471 ? -5.516   -75.418  357.135 1.00 44.00  ? 471 GLY 3 CA    1 
ATOM   8368  C  C     . GLY C  3  471 ? -6.517   -75.544  358.258 1.00 37.74  ? 471 GLY 3 C     1 
ATOM   8369  O  O     . GLY C  3  471 ? -7.277   -76.514  358.295 1.00 41.82  ? 471 GLY 3 O     1 
ATOM   8370  N  N     . GLU C  3  472 ? -6.554   -74.582  359.176 1.00 27.96  ? 472 GLU 3 N     1 
ATOM   8371  C  CA    . GLU C  3  472 ? -7.407   -74.695  360.345 1.00 23.71  ? 472 GLU 3 CA    1 
ATOM   8372  C  C     . GLU C  3  472 ? -8.608   -73.754  360.313 1.00 26.12  ? 472 GLU 3 C     1 
ATOM   8373  O  O     . GLU C  3  472 ? -9.515   -73.911  361.142 1.00 23.47  ? 472 GLU 3 O     1 
ATOM   8374  C  CB    . GLU C  3  472 ? -6.581   -74.411  361.611 1.00 15.74  ? 472 GLU 3 CB    1 
ATOM   8375  C  CG    . GLU C  3  472 ? -7.164   -74.918  362.906 1.00 15.51  ? 472 GLU 3 CG    1 
ATOM   8376  C  CD    . GLU C  3  472 ? -6.122   -75.008  363.995 1.00 15.41  ? 472 GLU 3 CD    1 
ATOM   8377  O  OE1   . GLU C  3  472 ? -5.283   -75.923  363.934 1.00 22.49  ? 472 GLU 3 OE1   1 
ATOM   8378  O  OE2   . GLU C  3  472 ? -6.194   -74.231  364.962 1.00 17.08  ? 472 GLU 3 OE2   1 
ATOM   8379  N  N     . GLU C  3  473 ? -8.653   -72.800  359.373 1.00 28.82  ? 473 GLU 3 N     1 
ATOM   8380  C  CA    . GLU C  3  473 ? -9.813   -71.918  359.247 1.00 29.84  ? 473 GLU 3 CA    1 
ATOM   8381  C  C     . GLU C  3  473 ? -11.096  -72.711  359.132 1.00 26.87  ? 473 GLU 3 C     1 
ATOM   8382  O  O     . GLU C  3  473 ? -12.061  -72.443  359.845 1.00 23.54  ? 473 GLU 3 O     1 
ATOM   8383  C  CB    . GLU C  3  473 ? -9.690   -70.993  358.035 1.00 35.64  ? 473 GLU 3 CB    1 
ATOM   8384  C  CG    . GLU C  3  473 ? -8.572   -69.978  358.069 1.00 44.37  ? 473 GLU 3 CG    1 
ATOM   8385  C  CD    . GLU C  3  473 ? -7.292   -70.492  357.481 1.00 54.53  ? 473 GLU 3 CD    1 
ATOM   8386  O  OE1   . GLU C  3  473 ? -7.245   -71.673  357.071 1.00 58.68  ? 473 GLU 3 OE1   1 
ATOM   8387  O  OE2   . GLU C  3  473 ? -6.341   -69.692  357.403 1.00 56.41  ? 473 GLU 3 OE2   1 
ATOM   8388  N  N     . ARG C  3  474 ? -11.121  -73.681  358.212 1.00 29.52  ? 474 ARG 3 N     1 
ATOM   8389  C  CA    . ARG C  3  474 ? -12.276  -74.534  357.934 1.00 26.38  ? 474 ARG 3 CA    1 
ATOM   8390  C  C     . ARG C  3  474 ? -12.984  -74.992  359.205 1.00 29.91  ? 474 ARG 3 C     1 
ATOM   8391  O  O     . ARG C  3  474 ? -14.218  -74.998  359.265 1.00 26.34  ? 474 ARG 3 O     1 
ATOM   8392  C  CB    . ARG C  3  474 ? -11.850  -75.741  357.095 1.00 18.22  ? 474 ARG 3 CB    1 
ATOM   8393  C  CG    . ARG C  3  474 ? -10.876  -76.681  357.778 1.00 18.60  ? 474 ARG 3 CG    1 
ATOM   8394  C  CD    . ARG C  3  474 ? -10.350  -77.699  356.776 1.00 26.80  ? 474 ARG 3 CD    1 
ATOM   8395  N  NE    . ARG C  3  474 ? -11.423  -78.584  356.323 1.00 29.78  ? 474 ARG 3 NE    1 
ATOM   8396  C  CZ    . ARG C  3  474 ? -11.283  -79.539  355.411 1.00 26.72  ? 474 ARG 3 CZ    1 
ATOM   8397  N  NH1   . ARG C  3  474 ? -10.119  -79.755  354.824 1.00 26.60  ? 474 ARG 3 NH1   1 
ATOM   8398  N  NH2   . ARG C  3  474 ? -12.325  -80.280  355.088 1.00 25.67  ? 474 ARG 3 NH2   1 
ATOM   8399  N  N     . GLU C  3  475 ? -12.206  -75.319  360.241 1.00 30.70  ? 475 GLU 3 N     1 
ATOM   8400  C  CA    . GLU C  3  475 ? -12.795  -75.690  361.522 1.00 31.71  ? 475 GLU 3 CA    1 
ATOM   8401  C  C     . GLU C  3  475 ? -13.400  -74.474  362.213 1.00 27.45  ? 475 GLU 3 C     1 
ATOM   8402  O  O     . GLU C  3  475 ? -14.478  -74.568  362.809 1.00 28.50  ? 475 GLU 3 O     1 
ATOM   8403  C  CB    . GLU C  3  475 ? -11.741  -76.353  362.411 1.00 38.14  ? 475 GLU 3 CB    1 
ATOM   8404  C  CG    . GLU C  3  475 ? -11.392  -77.781  361.981 1.00 44.62  ? 475 GLU 3 CG    1 
ATOM   8405  C  CD    . GLU C  3  475 ? -9.950   -78.171  362.296 1.00 47.58  ? 475 GLU 3 CD    1 
ATOM   8406  O  OE1   . GLU C  3  475 ? -9.430   -77.789  363.369 1.00 48.22  ? 475 GLU 3 OE1   1 
ATOM   8407  O  OE2   . GLU C  3  475 ? -9.324   -78.837  361.446 1.00 48.31  ? 475 GLU 3 OE2   1 
ATOM   8408  N  N     . ILE C  3  476 ? -12.745  -73.312  362.120 1.00 23.15  ? 476 ILE 3 N     1 
ATOM   8409  C  CA    . ILE C  3  476 ? -13.353  -72.106  362.676 1.00 22.16  ? 476 ILE 3 CA    1 
ATOM   8410  C  C     . ILE C  3  476 ? -14.668  -71.818  361.972 1.00 20.88  ? 476 ILE 3 C     1 
ATOM   8411  O  O     . ILE C  3  476 ? -15.648  -71.414  362.601 1.00 17.92  ? 476 ILE 3 O     1 
ATOM   8412  C  CB    . ILE C  3  476 ? -12.403  -70.895  362.583 1.00 19.93  ? 476 ILE 3 CB    1 
ATOM   8413  C  CG1   . ILE C  3  476 ? -11.246  -71.003  363.585 1.00 19.04  ? 476 ILE 3 CG1   1 
ATOM   8414  C  CG2   . ILE C  3  476 ? -13.181  -69.585  362.793 1.00 10.88  ? 476 ILE 3 CG2   1 
ATOM   8415  C  CD1   . ILE C  3  476 ? -9.904   -71.352  362.944 1.00 16.07  ? 476 ILE 3 CD1   1 
ATOM   8416  N  N     . LEU C  3  477 ? -14.716  -72.042  360.658 1.00 22.50  ? 477 LEU 3 N     1 
ATOM   8417  C  CA    . LEU C  3  477 ? -15.924  -71.747  359.895 1.00 26.81  ? 477 LEU 3 CA    1 
ATOM   8418  C  C     . LEU C  3  477 ? -17.023  -72.761  360.188 1.00 18.91  ? 477 LEU 3 C     1 
ATOM   8419  O  O     . LEU C  3  477 ? -18.200  -72.400  360.297 1.00 25.09  ? 477 LEU 3 O     1 
ATOM   8420  C  CB    . LEU C  3  477 ? -15.612  -71.682  358.395 1.00 21.19  ? 477 LEU 3 CB    1 
ATOM   8421  C  CG    . LEU C  3  477 ? -14.854  -70.438  357.895 1.00 12.92  ? 477 LEU 3 CG    1 
ATOM   8422  C  CD1   . LEU C  3  477 ? -13.381  -70.589  358.036 1.00 10.52  ? 477 LEU 3 CD1   1 
ATOM   8423  C  CD2   . LEU C  3  477 ? -15.181  -70.113  356.478 1.00 11.21  ? 477 LEU 3 CD2   1 
ATOM   8424  N  N     . LEU C  3  478 ? -16.662  -74.029  360.341 1.00 10.56  ? 478 LEU 3 N     1 
ATOM   8425  C  CA    . LEU C  3  478 ? -17.642  -74.984  360.828 1.00 10.54  ? 478 LEU 3 CA    1 
ATOM   8426  C  C     . LEU C  3  478 ? -18.196  -74.516  362.171 1.00 13.90  ? 478 LEU 3 C     1 
ATOM   8427  O  O     . LEU C  3  478 ? -19.413  -74.519  362.382 1.00 13.87  ? 478 LEU 3 O     1 
ATOM   8428  C  CB    . LEU C  3  478 ? -17.006  -76.375  360.924 1.00 11.79  ? 478 LEU 3 CB    1 
ATOM   8429  C  CG    . LEU C  3  478 ? -17.868  -77.634  361.065 1.00 10.82  ? 478 LEU 3 CG    1 
ATOM   8430  C  CD1   . LEU C  3  478 ? -17.066  -78.830  360.612 1.00 11.05  ? 478 LEU 3 CD1   1 
ATOM   8431  C  CD2   . LEU C  3  478 ? -18.303  -77.840  362.490 1.00 25.95  ? 478 LEU 3 CD2   1 
ATOM   8432  N  N     . ALA C  3  479 ? -17.321  -74.041  363.063 1.00 15.09  ? 479 ALA 3 N     1 
ATOM   8433  C  CA    . ALA C  3  479 ? -17.758  -73.578  364.380 1.00 19.15  ? 479 ALA 3 CA    1 
ATOM   8434  C  C     . ALA C  3  479 ? -18.665  -72.346  364.283 1.00 20.08  ? 479 ALA 3 C     1 
ATOM   8435  O  O     . ALA C  3  479 ? -19.584  -72.179  365.094 1.00 23.71  ? 479 ALA 3 O     1 
ATOM   8436  C  CB    . ALA C  3  479 ? -16.536  -73.282  365.261 1.00 19.31  ? 479 ALA 3 CB    1 
ATOM   8437  N  N     . LEU C  3  480 ? -18.400  -71.460  363.318 1.00 15.16  ? 480 LEU 3 N     1 
ATOM   8438  C  CA    . LEU C  3  480 ? -19.228  -70.268  363.118 1.00 15.23  ? 480 LEU 3 CA    1 
ATOM   8439  C  C     . LEU C  3  480 ? -20.599  -70.609  362.555 1.00 23.81  ? 480 LEU 3 C     1 
ATOM   8440  O  O     . LEU C  3  480 ? -21.583  -69.922  362.850 1.00 22.37  ? 480 LEU 3 O     1 
ATOM   8441  C  CB    . LEU C  3  480 ? -18.540  -69.306  362.157 1.00 14.27  ? 480 LEU 3 CB    1 
ATOM   8442  C  CG    . LEU C  3  480 ? -17.176  -68.806  362.577 1.00 13.89  ? 480 LEU 3 CG    1 
ATOM   8443  C  CD1   . LEU C  3  480 ? -16.495  -68.212  361.370 1.00 13.54  ? 480 LEU 3 CD1   1 
ATOM   8444  C  CD2   . LEU C  3  480 ? -17.335  -67.786  363.705 1.00 16.80  ? 480 LEU 3 CD2   1 
ATOM   8445  N  N     . LEU C  3  481 ? -20.676  -71.647  361.724 1.00 25.91  ? 481 LEU 3 N     1 
ATOM   8446  C  CA    . LEU C  3  481 ? -21.965  -72.075  361.199 1.00 25.13  ? 481 LEU 3 CA    1 
ATOM   8447  C  C     . LEU C  3  481 ? -22.828  -72.656  362.315 1.00 30.41  ? 481 LEU 3 C     1 
ATOM   8448  O  O     . LEU C  3  481 ? -24.040  -72.419  362.361 1.00 36.30  ? 481 LEU 3 O     1 
ATOM   8449  C  CB    . LEU C  3  481 ? -21.734  -73.095  360.083 1.00 18.74  ? 481 LEU 3 CB    1 
ATOM   8450  C  CG    . LEU C  3  481 ? -21.129  -72.496  358.805 1.00 13.22  ? 481 LEU 3 CG    1 
ATOM   8451  C  CD1   . LEU C  3  481 ? -20.602  -73.582  357.872 1.00 12.92  ? 481 LEU 3 CD1   1 
ATOM   8452  C  CD2   . LEU C  3  481 ? -22.123  -71.606  358.085 1.00 11.67  ? 481 LEU 3 CD2   1 
ATOM   8453  N  N     . GLY C  3  482 ? -22.214  -73.380  363.245 1.00 33.90  ? 482 GLY 3 N     1 
ATOM   8454  C  CA    . GLY C  3  482 ? -22.919  -73.960  364.367 1.00 40.24  ? 482 GLY 3 CA    1 
ATOM   8455  C  C     . GLY C  3  482 ? -22.954  -75.476  364.436 1.00 46.69  ? 482 GLY 3 C     1 
ATOM   8456  O  O     . GLY C  3  482 ? -23.730  -76.020  365.235 1.00 45.37  ? 482 GLY 3 O     1 
ATOM   8457  N  N     . ASP C  3  483 ? -22.174  -76.180  363.610 1.00 53.32  ? 483 ASP 3 N     1 
ATOM   8458  C  CA    . ASP C  3  483 ? -22.157  -77.642  363.675 1.00 61.38  ? 483 ASP 3 CA    1 
ATOM   8459  C  C     . ASP C  3  483 ? -21.226  -78.196  364.751 1.00 61.74  ? 483 ASP 3 C     1 
ATOM   8460  O  O     . ASP C  3  483 ? -21.396  -79.351  365.150 1.00 61.61  ? 483 ASP 3 O     1 
ATOM   8461  C  CB    . ASP C  3  483 ? -21.788  -78.246  362.312 1.00 68.50  ? 483 ASP 3 CB    1 
ATOM   8462  C  CG    . ASP C  3  483 ? -22.848  -77.987  361.246 1.00 74.99  ? 483 ASP 3 CG    1 
ATOM   8463  O  OD1   . ASP C  3  483 ? -23.987  -77.620  361.606 1.00 77.31  ? 483 ASP 3 OD1   1 
ATOM   8464  O  OD2   . ASP C  3  483 ? -22.547  -78.151  360.044 1.00 76.76  ? 483 ASP 3 OD2   1 
ATOM   8465  N  N     . LYS C  3  484 ? -20.260  -77.413  365.239 1.00 62.88  ? 484 LYS 3 N     1 
ATOM   8466  C  CA    . LYS C  3  484 ? -19.450  -77.825  366.382 1.00 60.35  ? 484 LYS 3 CA    1 
ATOM   8467  C  C     . LYS C  3  484 ? -19.069  -76.601  367.213 1.00 51.76  ? 484 LYS 3 C     1 
ATOM   8468  O  O     . LYS C  3  484 ? -19.456  -75.465  366.906 1.00 47.51  ? 484 LYS 3 O     1 
ATOM   8469  C  CB    . LYS C  3  484 ? -18.202  -78.591  365.937 1.00 66.10  ? 484 LYS 3 CB    1 
ATOM   8470  C  CG    . LYS C  3  484 ? -18.472  -80.010  365.471 1.00 72.32  ? 484 LYS 3 CG    1 
ATOM   8471  C  CD    . LYS C  3  484 ? -17.179  -80.734  365.144 1.00 79.90  ? 484 LYS 3 CD    1 
ATOM   8472  C  CE    . LYS C  3  484 ? -16.340  -80.949  366.398 1.00 85.05  ? 484 LYS 3 CE    1 
ATOM   8473  N  NZ    . LYS C  3  484 ? -16.996  -81.875  367.366 1.00 87.14  ? 484 LYS 3 NZ    1 
ATOM   8474  N  N     . GLU C  3  485 ? -18.294  -76.852  368.274 1.00 44.28  ? 485 GLU 3 N     1 
ATOM   8475  C  CA    . GLU C  3  485 ? -17.925  -75.846  369.266 1.00 35.77  ? 485 GLU 3 CA    1 
ATOM   8476  C  C     . GLU C  3  485 ? -16.434  -75.548  369.199 1.00 26.41  ? 485 GLU 3 C     1 
ATOM   8477  O  O     . GLU C  3  485 ? -15.607  -76.452  369.355 1.00 21.62  ? 485 GLU 3 O     1 
ATOM   8478  C  CB    . GLU C  3  485 ? -18.289  -76.307  370.681 1.00 40.17  ? 485 GLU 3 CB    1 
ATOM   8479  C  CG    . GLU C  3  485 ? -18.119  -75.225  371.748 1.00 45.78  ? 485 GLU 3 CG    1 
ATOM   8480  C  CD    . GLU C  3  485 ? -18.244  -75.753  373.172 1.00 51.12  ? 485 GLU 3 CD    1 
ATOM   8481  O  OE1   . GLU C  3  485 ? -17.653  -76.805  373.487 1.00 52.57  ? 485 GLU 3 OE1   1 
ATOM   8482  O  OE2   . GLU C  3  485 ? -18.931  -75.103  373.986 1.00 53.91  ? 485 GLU 3 OE2   1 
ATOM   8483  N  N     . GLY C  3  486 ? -16.095  -74.270  369.027 1.00 26.17  ? 486 GLY 3 N     1 
ATOM   8484  C  CA    . GLY C  3  486 ? -14.720  -73.834  368.956 1.00 26.46  ? 486 GLY 3 CA    1 
ATOM   8485  C  C     . GLY C  3  486 ? -14.253  -73.241  370.275 1.00 27.99  ? 486 GLY 3 C     1 
ATOM   8486  O  O     . GLY C  3  486 ? -14.871  -73.415  371.330 1.00 28.59  ? 486 GLY 3 O     1 
ATOM   8487  N  N     . SER C  3  487 ? -13.116  -72.547  370.205 1.00 25.70  ? 487 SER 3 N     1 
ATOM   8488  C  CA    . SER C  3  487 ? -12.515  -71.958  371.388 1.00 24.38  ? 487 SER 3 CA    1 
ATOM   8489  C  C     . SER C  3  487 ? -13.324  -70.745  371.844 1.00 25.42  ? 487 SER 3 C     1 
ATOM   8490  O  O     . SER C  3  487 ? -14.306  -70.334  371.218 1.00 25.28  ? 487 SER 3 O     1 
ATOM   8491  C  CB    . SER C  3  487 ? -11.070  -71.555  371.100 1.00 21.81  ? 487 SER 3 CB    1 
ATOM   8492  O  OG    . SER C  3  487 ? -11.000  -70.308  370.421 1.00 17.57  ? 487 SER 3 OG    1 
ATOM   8493  N  N     . GLU C  3  488 ? -12.855  -70.127  372.928 1.00 29.43  ? 488 GLU 3 N     1 
ATOM   8494  C  CA    . GLU C  3  488 ? -13.499  -68.917  373.422 1.00 31.13  ? 488 GLU 3 CA    1 
ATOM   8495  C  C     . GLU C  3  488 ? -13.454  -67.819  372.371 1.00 30.85  ? 488 GLU 3 C     1 
ATOM   8496  O  O     . GLU C  3  488 ? -14.456  -67.146  372.120 1.00 30.23  ? 488 GLU 3 O     1 
ATOM   8497  C  CB    . GLU C  3  488 ? -12.835  -68.460  374.721 1.00 37.05  ? 488 GLU 3 CB    1 
ATOM   8498  C  CG    . GLU C  3  488 ? -12.653  -69.556  375.757 1.00 41.75  ? 488 GLU 3 CG    1 
ATOM   8499  C  CD    . GLU C  3  488 ? -12.460  -68.999  377.153 1.00 46.80  ? 488 GLU 3 CD    1 
ATOM   8500  O  OE1   . GLU C  3  488 ? -12.934  -67.878  377.425 1.00 47.53  ? 488 GLU 3 OE1   1 
ATOM   8501  O  OE2   . GLU C  3  488 ? -11.821  -69.677  377.980 1.00 50.89  ? 488 GLU 3 OE2   1 
ATOM   8502  N  N     . MET C  3  489 ? -12.295  -67.641  371.727 1.00 30.36  ? 489 MET 3 N     1 
ATOM   8503  C  CA    . MET C  3  489 ? -12.176  -66.622  370.687 1.00 31.74  ? 489 MET 3 CA    1 
ATOM   8504  C  C     . MET C  3  489 ? -13.120  -66.913  369.529 1.00 29.91  ? 489 MET 3 C     1 
ATOM   8505  O  O     . MET C  3  489 ? -13.761  -65.998  368.995 1.00 36.03  ? 489 MET 3 O     1 
ATOM   8506  C  CB    . MET C  3  489 ? -10.743  -66.543  370.170 1.00 35.73  ? 489 MET 3 CB    1 
ATOM   8507  C  CG    . MET C  3  489 ? -9.761   -65.906  371.120 1.00 43.39  ? 489 MET 3 CG    1 
ATOM   8508  S  SD    . MET C  3  489 ? -9.952   -64.118  371.253 1.00 52.56  ? 489 MET 3 SD    1 
ATOM   8509  C  CE    . MET C  3  489 ? -10.496  -63.964  372.955 1.00 53.44  ? 489 MET 3 CE    1 
ATOM   8510  N  N     . VAL C  3  490 ? -13.210  -68.182  369.114 1.00 21.24  ? 490 VAL 3 N     1 
ATOM   8511  C  CA    . VAL C  3  490 ? -14.069  -68.504  367.981 1.00 13.08  ? 490 VAL 3 CA    1 
ATOM   8512  C  C     . VAL C  3  490 ? -15.529  -68.356  368.371 1.00 10.92  ? 490 VAL 3 C     1 
ATOM   8513  O  O     . VAL C  3  490 ? -16.370  -68.013  367.535 1.00 10.66  ? 490 VAL 3 O     1 
ATOM   8514  C  CB    . VAL C  3  490 ? -13.786  -69.910  367.439 1.00 15.24  ? 490 VAL 3 CB    1 
ATOM   8515  C  CG1   . VAL C  3  490 ? -14.514  -70.078  366.099 1.00 17.04  ? 490 VAL 3 CG1   1 
ATOM   8516  C  CG2   . VAL C  3  490 ? -12.285  -70.196  367.347 1.00 11.54  ? 490 VAL 3 CG2   1 
ATOM   8517  N  N     . ALA C  3  491 ? -15.859  -68.613  369.638 1.00 11.02  ? 491 ALA 3 N     1 
ATOM   8518  C  CA    . ALA C  3  491 ? -17.234  -68.438  370.093 1.00 20.78  ? 491 ALA 3 CA    1 
ATOM   8519  C  C     . ALA C  3  491 ? -17.600  -66.958  370.169 1.00 18.21  ? 491 ALA 3 C     1 
ATOM   8520  O  O     . ALA C  3  491 ? -18.738  -66.580  369.881 1.00 10.38  ? 491 ALA 3 O     1 
ATOM   8521  C  CB    . ALA C  3  491 ? -17.420  -69.126  371.447 1.00 21.46  ? 491 ALA 3 CB    1 
ATOM   8522  N  N     . LYS C  3  492 ? -16.643  -66.113  370.562 1.00 19.76  ? 492 LYS 3 N     1 
ATOM   8523  C  CA    . LYS C  3  492 ? -16.836  -64.659  370.538 1.00 25.41  ? 492 LYS 3 CA    1 
ATOM   8524  C  C     . LYS C  3  492 ? -17.049  -64.135  369.122 1.00 25.74  ? 492 LYS 3 C     1 
ATOM   8525  O  O     . LYS C  3  492 ? -17.922  -63.292  368.883 1.00 26.89  ? 492 LYS 3 O     1 
ATOM   8526  C  CB    . LYS C  3  492 ? -15.625  -63.956  371.159 1.00 29.13  ? 492 LYS 3 CB    1 
ATOM   8527  C  CG    . LYS C  3  492 ? -15.484  -64.139  372.652 1.00 30.55  ? 492 LYS 3 CG    1 
ATOM   8528  C  CD    . LYS C  3  492 ? -14.077  -63.828  373.105 1.00 26.91  ? 492 LYS 3 CD    1 
ATOM   8529  C  CE    . LYS C  3  492 ? -14.098  -62.770  374.173 1.00 24.45  ? 492 LYS 3 CE    1 
ATOM   8530  N  NZ    . LYS C  3  492 ? -12.893  -61.917  374.152 1.00 23.72  ? 492 LYS 3 NZ    1 
ATOM   8531  N  N     . ALA C  3  493 ? -16.249  -64.614  368.173 1.00 19.64  ? 493 ALA 3 N     1 
ATOM   8532  C  CA    . ALA C  3  493 ? -16.452  -64.206  366.789 1.00 19.03  ? 493 ALA 3 CA    1 
ATOM   8533  C  C     . ALA C  3  493 ? -17.783  -64.734  366.254 1.00 22.80  ? 493 ALA 3 C     1 
ATOM   8534  O  O     . ALA C  3  493 ? -18.501  -64.013  365.557 1.00 27.38  ? 493 ALA 3 O     1 
ATOM   8535  C  CB    . ALA C  3  493 ? -15.284  -64.673  365.924 1.00 13.05  ? 493 ALA 3 CB    1 
ATOM   8536  N  N     . LYS C  3  494 ? -18.138  -65.981  366.593 1.00 21.00  ? 494 LYS 3 N     1 
ATOM   8537  C  CA    . LYS C  3  494 ? -19.435  -66.546  366.224 1.00 16.07  ? 494 LYS 3 CA    1 
ATOM   8538  C  C     . LYS C  3  494 ? -20.593  -65.708  366.760 1.00 15.48  ? 494 LYS 3 C     1 
ATOM   8539  O  O     . LYS C  3  494 ? -21.500  -65.341  366.014 1.00 9.43   ? 494 LYS 3 O     1 
ATOM   8540  C  CB    . LYS C  3  494 ? -19.513  -67.991  366.729 1.00 12.49  ? 494 LYS 3 CB    1 
ATOM   8541  C  CG    . LYS C  3  494 ? -20.845  -68.697  366.507 1.00 10.21  ? 494 LYS 3 CG    1 
ATOM   8542  C  CD    . LYS C  3  494 ? -20.822  -70.097  367.083 1.00 10.11  ? 494 LYS 3 CD    1 
ATOM   8543  C  CE    . LYS C  3  494 ? -22.155  -70.761  366.873 1.00 17.96  ? 494 LYS 3 CE    1 
ATOM   8544  N  NZ    . LYS C  3  494 ? -23.178  -70.003  367.637 1.00 16.64  ? 494 LYS 3 NZ    1 
ATOM   8545  N  N     . GLU C  3  495 ? -20.584  -65.408  368.057 1.00 16.48  ? 495 GLU 3 N     1 
ATOM   8546  C  CA    . GLU C  3  495 ? -21.646  -64.606  368.654 1.00 22.19  ? 495 GLU 3 CA    1 
ATOM   8547  C  C     . GLU C  3  495 ? -21.721  -63.227  368.005 1.00 22.67  ? 495 GLU 3 C     1 
ATOM   8548  O  O     . GLU C  3  495 ? -22.800  -62.768  367.610 1.00 29.88  ? 495 GLU 3 O     1 
ATOM   8549  C  CB    . GLU C  3  495 ? -21.420  -64.510  370.164 1.00 27.41  ? 495 GLU 3 CB    1 
ATOM   8550  C  CG    . GLU C  3  495 ? -22.439  -63.691  370.921 1.00 32.26  ? 495 GLU 3 CG    1 
ATOM   8551  C  CD    . GLU C  3  495 ? -21.923  -63.268  372.291 1.00 40.18  ? 495 GLU 3 CD    1 
ATOM   8552  O  OE1   .