data_6QNW
# 
_entry.id   6QNW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6QNW         
WWPDB D_1292100566 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6QNW 
_pdbx_database_status.recvd_initial_deposition_date   2019-02-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Keown, J.R.'  1 0000-0003-0159-9257 
'Fan, H.'      2 0000-0003-4337-665X 
'Grimes, J.M.' 3 0000-0001-9698-0389 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            573 
_citation.language                  ? 
_citation.page_first                287 
_citation.page_last                 290 
_citation.title                     'Structures of influenza A virus RNA polymerase offer insight into viral genome replication.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41586-019-1530-7 
_citation.pdbx_database_id_PubMed   31485076 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fan, H.'          1  ? 
primary 'Walker, A.P.'     2  ? 
primary 'Carrique, L.'     3  ? 
primary 'Keown, J.R.'      4  ? 
primary 'Serna Martin, I.' 5  ? 
primary 'Karia, D.'        6  ? 
primary 'Sharps, J.'       7  ? 
primary 'Hengrung, N.'     8  ? 
primary 'Pardon, E.'       9  ? 
primary 'Steyaert, J.'     10 ? 
primary 'Grimes, J.M.'     11 ? 
primary 'Fodor, E.'        12 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   91.502 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6QNW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     336.480 
_cell.length_a_esd                 ? 
_cell.length_b                     191.895 
_cell.length_b_esd                 ? 
_cell.length_c                     235.735 
_cell.length_c_esd                 ? 
_cell.volume                       15215902.530 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6QNW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            'C 2y' 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Polymerase acidic protein'                     83100.797 4 3.1.-.-  ? ? ? 
2 polymer man 'RNA-directed RNA polymerase catalytic subunit' 86524.086 4 2.7.7.48 ? ? ? 
3 polymer man 'Polymerase basic protein 2'                    86958.242 4 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNA-directed RNA polymerase subunit P2'                                
2 'Polymerase basic protein 1,PB1,RNA-directed RNA polymerase subunit P1' 
3 'RNA-directed RNA polymerase subunit P3'                                
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGESIVVELDDPNALLKHRFEIIE
GRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSENTHIHIFSFTGEEMATKAD
YTLDEESRARIKTRLFTIRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSCLENFRAYVDGFEPNG
YIEGKLSQMSKEVNAKIEPFLKTTPRPIRLPDGPPCFQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMRTFFGWKEP
YIVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPRTKNMKKTSQLKWALGENMAPEKVDFDNCRDVSDLKQYDSDEPEL
RSLSSWIQNEFNKACELTDSTWIELDEIGEDVAPIEYIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRSAIGQMSRP
MFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEDGSIGKVCRTL
LAKSVFNSLYASPQLEGFSAESRKLLLVVQALRDNLEPGTFDLEGLYEAIEECLINDPWVLLNASWFNSFLTHALR
;
;MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGESIVVELDDPNALLKHRFEIIE
GRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSENTHIHIFSFTGEEMATKAD
YTLDEESRARIKTRLFTIRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSCLENFRAYVDGFEPNG
YIEGKLSQMSKEVNAKIEPFLKTTPRPIRLPDGPPCFQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMRTFFGWKEP
YIVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPRTKNMKKTSQLKWALGENMAPEKVDFDNCRDVSDLKQYDSDEPEL
RSLSSWIQNEFNKACELTDSTWIELDEIGEDVAPIEYIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRSAIGQMSRP
MFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEDGSIGKVCRTL
LAKSVFNSLYASPQLEGFSAESRKLLLVVQALRDNLEPGTFDLEGLYEAIEECLINDPWVLLNASWFNSFLTHALR
;
A,D,G,J ? 
2 'polypeptide(L)' no no 
;MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPS
GYAQTDCVLEAMAFLEESHPGIFENSCLETMEVVQQTRVDRLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANES
GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRVNKRSYLIRALTLNTMTKDAERGKLKRRA
IATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLA
MITYITKNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNESTRKKIEKIRPLLIDGT
ASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKK
KSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYR
CHRGDTQIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESV
NNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVS
RARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK
;
;MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPS
GYAQTDCVLEAMAFLEESHPGIFENSCLETMEVVQQTRVDRLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANES
GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRVNKRSYLIRALTLNTMTKDAERGKLKRRA
IATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLA
MITYITKNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNESTRKKIEKIRPLLIDGT
ASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKK
KSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYR
CHRGDTQIQTRRSFELKKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESV
NNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVS
RARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK
;
B,E,H,K ? 
3 'polypeptide(L)' no no 
;MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPSLRMKWMMAMKYPITADKRITEMVPERNEQGQTLWSK
MSDAGSDRVMVSPLAVTWWNRNGPMTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW
EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRIS
SSFSFGGFTFKRTSGSSIKREEELLTGNLQTLKIRVHDGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSVAEAIIV
AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMIGVLPDMTPSTEMSMRGIRV
SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETV
KIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNV
RGSGMRILVRGNSPAFNYNKTTKRLTILGKDAGTLIEDPDEGTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGE
KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAINENLYFQ
;
;MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPSLRMKWMMAMKYPITADKRITEMVPERNEQGQTLWSK
MSDAGSDRVMVSPLAVTWWNRNGPMTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW
EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRIS
SSFSFGGFTFKRTSGSSIKREEELLTGNLQTLKIRVHDGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSVAEAIIV
AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMIGVLPDMTPSTEMSMRGIRV
SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETV
KIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNV
RGSGMRILVRGNSPAFNYNKTTKRLTILGKDAGTLIEDPDEGTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGE
KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAINENLYFQ
;
C,F,I,L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ASP n 
1 4   PHE n 
1 5   VAL n 
1 6   ARG n 
1 7   GLN n 
1 8   CYS n 
1 9   PHE n 
1 10  ASN n 
1 11  PRO n 
1 12  MET n 
1 13  ILE n 
1 14  VAL n 
1 15  GLU n 
1 16  LEU n 
1 17  ALA n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  MET n 
1 22  LYS n 
1 23  GLU n 
1 24  TYR n 
1 25  GLY n 
1 26  GLU n 
1 27  ASP n 
1 28  LEU n 
1 29  LYS n 
1 30  ILE n 
1 31  GLU n 
1 32  THR n 
1 33  ASN n 
1 34  LYS n 
1 35  PHE n 
1 36  ALA n 
1 37  ALA n 
1 38  ILE n 
1 39  CYS n 
1 40  THR n 
1 41  HIS n 
1 42  LEU n 
1 43  GLU n 
1 44  VAL n 
1 45  CYS n 
1 46  PHE n 
1 47  MET n 
1 48  TYR n 
1 49  SER n 
1 50  ASP n 
1 51  PHE n 
1 52  HIS n 
1 53  PHE n 
1 54  ILE n 
1 55  ASN n 
1 56  GLU n 
1 57  GLN n 
1 58  GLY n 
1 59  GLU n 
1 60  SER n 
1 61  ILE n 
1 62  VAL n 
1 63  VAL n 
1 64  GLU n 
1 65  LEU n 
1 66  ASP n 
1 67  ASP n 
1 68  PRO n 
1 69  ASN n 
1 70  ALA n 
1 71  LEU n 
1 72  LEU n 
1 73  LYS n 
1 74  HIS n 
1 75  ARG n 
1 76  PHE n 
1 77  GLU n 
1 78  ILE n 
1 79  ILE n 
1 80  GLU n 
1 81  GLY n 
1 82  ARG n 
1 83  ASP n 
1 84  ARG n 
1 85  THR n 
1 86  MET n 
1 87  ALA n 
1 88  TRP n 
1 89  THR n 
1 90  VAL n 
1 91  VAL n 
1 92  ASN n 
1 93  SER n 
1 94  ILE n 
1 95  CYS n 
1 96  ASN n 
1 97  THR n 
1 98  THR n 
1 99  GLY n 
1 100 ALA n 
1 101 GLU n 
1 102 LYS n 
1 103 PRO n 
1 104 LYS n 
1 105 PHE n 
1 106 LEU n 
1 107 PRO n 
1 108 ASP n 
1 109 LEU n 
1 110 TYR n 
1 111 ASP n 
1 112 TYR n 
1 113 LYS n 
1 114 GLU n 
1 115 ASN n 
1 116 ARG n 
1 117 PHE n 
1 118 ILE n 
1 119 GLU n 
1 120 ILE n 
1 121 GLY n 
1 122 VAL n 
1 123 THR n 
1 124 ARG n 
1 125 ARG n 
1 126 GLU n 
1 127 VAL n 
1 128 HIS n 
1 129 ILE n 
1 130 TYR n 
1 131 TYR n 
1 132 LEU n 
1 133 GLU n 
1 134 LYS n 
1 135 ALA n 
1 136 ASN n 
1 137 LYS n 
1 138 ILE n 
1 139 LYS n 
1 140 SER n 
1 141 GLU n 
1 142 ASN n 
1 143 THR n 
1 144 HIS n 
1 145 ILE n 
1 146 HIS n 
1 147 ILE n 
1 148 PHE n 
1 149 SER n 
1 150 PHE n 
1 151 THR n 
1 152 GLY n 
1 153 GLU n 
1 154 GLU n 
1 155 MET n 
1 156 ALA n 
1 157 THR n 
1 158 LYS n 
1 159 ALA n 
1 160 ASP n 
1 161 TYR n 
1 162 THR n 
1 163 LEU n 
1 164 ASP n 
1 165 GLU n 
1 166 GLU n 
1 167 SER n 
1 168 ARG n 
1 169 ALA n 
1 170 ARG n 
1 171 ILE n 
1 172 LYS n 
1 173 THR n 
1 174 ARG n 
1 175 LEU n 
1 176 PHE n 
1 177 THR n 
1 178 ILE n 
1 179 ARG n 
1 180 GLN n 
1 181 GLU n 
1 182 MET n 
1 183 ALA n 
1 184 ASN n 
1 185 ARG n 
1 186 GLY n 
1 187 LEU n 
1 188 TRP n 
1 189 ASP n 
1 190 SER n 
1 191 PHE n 
1 192 ARG n 
1 193 GLN n 
1 194 SER n 
1 195 GLU n 
1 196 ARG n 
1 197 GLY n 
1 198 GLU n 
1 199 GLU n 
1 200 THR n 
1 201 ILE n 
1 202 GLU n 
1 203 GLU n 
1 204 ARG n 
1 205 PHE n 
1 206 GLU n 
1 207 ILE n 
1 208 THR n 
1 209 GLY n 
1 210 THR n 
1 211 MET n 
1 212 ARG n 
1 213 ARG n 
1 214 LEU n 
1 215 ALA n 
1 216 ASP n 
1 217 GLN n 
1 218 SER n 
1 219 LEU n 
1 220 PRO n 
1 221 PRO n 
1 222 ASN n 
1 223 PHE n 
1 224 SER n 
1 225 CYS n 
1 226 LEU n 
1 227 GLU n 
1 228 ASN n 
1 229 PHE n 
1 230 ARG n 
1 231 ALA n 
1 232 TYR n 
1 233 VAL n 
1 234 ASP n 
1 235 GLY n 
1 236 PHE n 
1 237 GLU n 
1 238 PRO n 
1 239 ASN n 
1 240 GLY n 
1 241 TYR n 
1 242 ILE n 
1 243 GLU n 
1 244 GLY n 
1 245 LYS n 
1 246 LEU n 
1 247 SER n 
1 248 GLN n 
1 249 MET n 
1 250 SER n 
1 251 LYS n 
1 252 GLU n 
1 253 VAL n 
1 254 ASN n 
1 255 ALA n 
1 256 LYS n 
1 257 ILE n 
1 258 GLU n 
1 259 PRO n 
1 260 PHE n 
1 261 LEU n 
1 262 LYS n 
1 263 THR n 
1 264 THR n 
1 265 PRO n 
1 266 ARG n 
1 267 PRO n 
1 268 ILE n 
1 269 ARG n 
1 270 LEU n 
1 271 PRO n 
1 272 ASP n 
1 273 GLY n 
1 274 PRO n 
1 275 PRO n 
1 276 CYS n 
1 277 PHE n 
1 278 GLN n 
1 279 ARG n 
1 280 SER n 
1 281 LYS n 
1 282 PHE n 
1 283 LEU n 
1 284 LEU n 
1 285 MET n 
1 286 ASP n 
1 287 ALA n 
1 288 LEU n 
1 289 LYS n 
1 290 LEU n 
1 291 SER n 
1 292 ILE n 
1 293 GLU n 
1 294 ASP n 
1 295 PRO n 
1 296 SER n 
1 297 HIS n 
1 298 GLU n 
1 299 GLY n 
1 300 GLU n 
1 301 GLY n 
1 302 ILE n 
1 303 PRO n 
1 304 LEU n 
1 305 TYR n 
1 306 ASP n 
1 307 ALA n 
1 308 ILE n 
1 309 LYS n 
1 310 CYS n 
1 311 MET n 
1 312 ARG n 
1 313 THR n 
1 314 PHE n 
1 315 PHE n 
1 316 GLY n 
1 317 TRP n 
1 318 LYS n 
1 319 GLU n 
1 320 PRO n 
1 321 TYR n 
1 322 ILE n 
1 323 VAL n 
1 324 LYS n 
1 325 PRO n 
1 326 HIS n 
1 327 GLU n 
1 328 LYS n 
1 329 GLY n 
1 330 ILE n 
1 331 ASN n 
1 332 PRO n 
1 333 ASN n 
1 334 TYR n 
1 335 LEU n 
1 336 LEU n 
1 337 SER n 
1 338 TRP n 
1 339 LYS n 
1 340 GLN n 
1 341 VAL n 
1 342 LEU n 
1 343 ALA n 
1 344 GLU n 
1 345 LEU n 
1 346 GLN n 
1 347 ASP n 
1 348 ILE n 
1 349 GLU n 
1 350 ASN n 
1 351 GLU n 
1 352 GLU n 
1 353 LYS n 
1 354 ILE n 
1 355 PRO n 
1 356 ARG n 
1 357 THR n 
1 358 LYS n 
1 359 ASN n 
1 360 MET n 
1 361 LYS n 
1 362 LYS n 
1 363 THR n 
1 364 SER n 
1 365 GLN n 
1 366 LEU n 
1 367 LYS n 
1 368 TRP n 
1 369 ALA n 
1 370 LEU n 
1 371 GLY n 
1 372 GLU n 
1 373 ASN n 
1 374 MET n 
1 375 ALA n 
1 376 PRO n 
1 377 GLU n 
1 378 LYS n 
1 379 VAL n 
1 380 ASP n 
1 381 PHE n 
1 382 ASP n 
1 383 ASN n 
1 384 CYS n 
1 385 ARG n 
1 386 ASP n 
1 387 VAL n 
1 388 SER n 
1 389 ASP n 
1 390 LEU n 
1 391 LYS n 
1 392 GLN n 
1 393 TYR n 
1 394 ASP n 
1 395 SER n 
1 396 ASP n 
1 397 GLU n 
1 398 PRO n 
1 399 GLU n 
1 400 LEU n 
1 401 ARG n 
1 402 SER n 
1 403 LEU n 
1 404 SER n 
1 405 SER n 
1 406 TRP n 
1 407 ILE n 
1 408 GLN n 
1 409 ASN n 
1 410 GLU n 
1 411 PHE n 
1 412 ASN n 
1 413 LYS n 
1 414 ALA n 
1 415 CYS n 
1 416 GLU n 
1 417 LEU n 
1 418 THR n 
1 419 ASP n 
1 420 SER n 
1 421 THR n 
1 422 TRP n 
1 423 ILE n 
1 424 GLU n 
1 425 LEU n 
1 426 ASP n 
1 427 GLU n 
1 428 ILE n 
1 429 GLY n 
1 430 GLU n 
1 431 ASP n 
1 432 VAL n 
1 433 ALA n 
1 434 PRO n 
1 435 ILE n 
1 436 GLU n 
1 437 TYR n 
1 438 ILE n 
1 439 ALA n 
1 440 SER n 
1 441 MET n 
1 442 ARG n 
1 443 ARG n 
1 444 ASN n 
1 445 TYR n 
1 446 PHE n 
1 447 THR n 
1 448 ALA n 
1 449 GLU n 
1 450 VAL n 
1 451 SER n 
1 452 HIS n 
1 453 CYS n 
1 454 ARG n 
1 455 ALA n 
1 456 THR n 
1 457 GLU n 
1 458 TYR n 
1 459 ILE n 
1 460 MET n 
1 461 LYS n 
1 462 GLY n 
1 463 VAL n 
1 464 TYR n 
1 465 ILE n 
1 466 ASN n 
1 467 THR n 
1 468 ALA n 
1 469 LEU n 
1 470 LEU n 
1 471 ASN n 
1 472 ALA n 
1 473 SER n 
1 474 CYS n 
1 475 ALA n 
1 476 ALA n 
1 477 MET n 
1 478 ASP n 
1 479 ASP n 
1 480 PHE n 
1 481 GLN n 
1 482 LEU n 
1 483 ILE n 
1 484 PRO n 
1 485 MET n 
1 486 ILE n 
1 487 SER n 
1 488 LYS n 
1 489 CYS n 
1 490 ARG n 
1 491 THR n 
1 492 LYS n 
1 493 GLU n 
1 494 GLY n 
1 495 ARG n 
1 496 ARG n 
1 497 LYS n 
1 498 THR n 
1 499 ASN n 
1 500 LEU n 
1 501 TYR n 
1 502 GLY n 
1 503 PHE n 
1 504 ILE n 
1 505 ILE n 
1 506 LYS n 
1 507 GLY n 
1 508 ARG n 
1 509 SER n 
1 510 HIS n 
1 511 LEU n 
1 512 ARG n 
1 513 ASN n 
1 514 ASP n 
1 515 THR n 
1 516 ASP n 
1 517 VAL n 
1 518 VAL n 
1 519 ASN n 
1 520 PHE n 
1 521 VAL n 
1 522 SER n 
1 523 MET n 
1 524 GLU n 
1 525 PHE n 
1 526 SER n 
1 527 LEU n 
1 528 THR n 
1 529 ASP n 
1 530 PRO n 
1 531 ARG n 
1 532 LEU n 
1 533 GLU n 
1 534 PRO n 
1 535 HIS n 
1 536 LYS n 
1 537 TRP n 
1 538 GLU n 
1 539 LYS n 
1 540 TYR n 
1 541 CYS n 
1 542 VAL n 
1 543 LEU n 
1 544 GLU n 
1 545 ILE n 
1 546 GLY n 
1 547 ASP n 
1 548 MET n 
1 549 LEU n 
1 550 LEU n 
1 551 ARG n 
1 552 SER n 
1 553 ALA n 
1 554 ILE n 
1 555 GLY n 
1 556 GLN n 
1 557 MET n 
1 558 SER n 
1 559 ARG n 
1 560 PRO n 
1 561 MET n 
1 562 PHE n 
1 563 LEU n 
1 564 TYR n 
1 565 VAL n 
1 566 ARG n 
1 567 THR n 
1 568 ASN n 
1 569 GLY n 
1 570 THR n 
1 571 SER n 
1 572 LYS n 
1 573 ILE n 
1 574 LYS n 
1 575 MET n 
1 576 LYS n 
1 577 TRP n 
1 578 GLY n 
1 579 MET n 
1 580 GLU n 
1 581 MET n 
1 582 ARG n 
1 583 ARG n 
1 584 CYS n 
1 585 LEU n 
1 586 LEU n 
1 587 GLN n 
1 588 SER n 
1 589 LEU n 
1 590 GLN n 
1 591 GLN n 
1 592 ILE n 
1 593 GLU n 
1 594 SER n 
1 595 MET n 
1 596 ILE n 
1 597 GLU n 
1 598 ALA n 
1 599 GLU n 
1 600 SER n 
1 601 SER n 
1 602 VAL n 
1 603 LYS n 
1 604 GLU n 
1 605 LYS n 
1 606 ASP n 
1 607 MET n 
1 608 THR n 
1 609 LYS n 
1 610 GLU n 
1 611 PHE n 
1 612 PHE n 
1 613 GLU n 
1 614 ASN n 
1 615 LYS n 
1 616 SER n 
1 617 GLU n 
1 618 THR n 
1 619 TRP n 
1 620 PRO n 
1 621 ILE n 
1 622 GLY n 
1 623 GLU n 
1 624 SER n 
1 625 PRO n 
1 626 LYS n 
1 627 GLY n 
1 628 VAL n 
1 629 GLU n 
1 630 ASP n 
1 631 GLY n 
1 632 SER n 
1 633 ILE n 
1 634 GLY n 
1 635 LYS n 
1 636 VAL n 
1 637 CYS n 
1 638 ARG n 
1 639 THR n 
1 640 LEU n 
1 641 LEU n 
1 642 ALA n 
1 643 LYS n 
1 644 SER n 
1 645 VAL n 
1 646 PHE n 
1 647 ASN n 
1 648 SER n 
1 649 LEU n 
1 650 TYR n 
1 651 ALA n 
1 652 SER n 
1 653 PRO n 
1 654 GLN n 
1 655 LEU n 
1 656 GLU n 
1 657 GLY n 
1 658 PHE n 
1 659 SER n 
1 660 ALA n 
1 661 GLU n 
1 662 SER n 
1 663 ARG n 
1 664 LYS n 
1 665 LEU n 
1 666 LEU n 
1 667 LEU n 
1 668 VAL n 
1 669 VAL n 
1 670 GLN n 
1 671 ALA n 
1 672 LEU n 
1 673 ARG n 
1 674 ASP n 
1 675 ASN n 
1 676 LEU n 
1 677 GLU n 
1 678 PRO n 
1 679 GLY n 
1 680 THR n 
1 681 PHE n 
1 682 ASP n 
1 683 LEU n 
1 684 GLU n 
1 685 GLY n 
1 686 LEU n 
1 687 TYR n 
1 688 GLU n 
1 689 ALA n 
1 690 ILE n 
1 691 GLU n 
1 692 GLU n 
1 693 CYS n 
1 694 LEU n 
1 695 ILE n 
1 696 ASN n 
1 697 ASP n 
1 698 PRO n 
1 699 TRP n 
1 700 VAL n 
1 701 LEU n 
1 702 LEU n 
1 703 ASN n 
1 704 ALA n 
1 705 SER n 
1 706 TRP n 
1 707 PHE n 
1 708 ASN n 
1 709 SER n 
1 710 PHE n 
1 711 LEU n 
1 712 THR n 
1 713 HIS n 
1 714 ALA n 
1 715 LEU n 
1 716 ARG n 
2 1   MET n 
2 2   ASP n 
2 3   VAL n 
2 4   ASN n 
2 5   PRO n 
2 6   THR n 
2 7   LEU n 
2 8   LEU n 
2 9   PHE n 
2 10  LEU n 
2 11  LYS n 
2 12  VAL n 
2 13  PRO n 
2 14  ALA n 
2 15  GLN n 
2 16  ASN n 
2 17  ALA n 
2 18  ILE n 
2 19  SER n 
2 20  THR n 
2 21  THR n 
2 22  PHE n 
2 23  PRO n 
2 24  TYR n 
2 25  THR n 
2 26  GLY n 
2 27  ASP n 
2 28  PRO n 
2 29  PRO n 
2 30  TYR n 
2 31  SER n 
2 32  HIS n 
2 33  GLY n 
2 34  THR n 
2 35  GLY n 
2 36  THR n 
2 37  GLY n 
2 38  TYR n 
2 39  THR n 
2 40  MET n 
2 41  ASP n 
2 42  THR n 
2 43  VAL n 
2 44  ASN n 
2 45  ARG n 
2 46  THR n 
2 47  HIS n 
2 48  GLN n 
2 49  TYR n 
2 50  SER n 
2 51  GLU n 
2 52  LYS n 
2 53  GLY n 
2 54  LYS n 
2 55  TRP n 
2 56  THR n 
2 57  THR n 
2 58  ASN n 
2 59  THR n 
2 60  GLU n 
2 61  THR n 
2 62  GLY n 
2 63  ALA n 
2 64  PRO n 
2 65  GLN n 
2 66  LEU n 
2 67  ASN n 
2 68  PRO n 
2 69  ILE n 
2 70  ASP n 
2 71  GLY n 
2 72  PRO n 
2 73  LEU n 
2 74  PRO n 
2 75  GLU n 
2 76  ASP n 
2 77  ASN n 
2 78  GLU n 
2 79  PRO n 
2 80  SER n 
2 81  GLY n 
2 82  TYR n 
2 83  ALA n 
2 84  GLN n 
2 85  THR n 
2 86  ASP n 
2 87  CYS n 
2 88  VAL n 
2 89  LEU n 
2 90  GLU n 
2 91  ALA n 
2 92  MET n 
2 93  ALA n 
2 94  PHE n 
2 95  LEU n 
2 96  GLU n 
2 97  GLU n 
2 98  SER n 
2 99  HIS n 
2 100 PRO n 
2 101 GLY n 
2 102 ILE n 
2 103 PHE n 
2 104 GLU n 
2 105 ASN n 
2 106 SER n 
2 107 CYS n 
2 108 LEU n 
2 109 GLU n 
2 110 THR n 
2 111 MET n 
2 112 GLU n 
2 113 VAL n 
2 114 VAL n 
2 115 GLN n 
2 116 GLN n 
2 117 THR n 
2 118 ARG n 
2 119 VAL n 
2 120 ASP n 
2 121 ARG n 
2 122 LEU n 
2 123 THR n 
2 124 GLN n 
2 125 GLY n 
2 126 ARG n 
2 127 GLN n 
2 128 THR n 
2 129 TYR n 
2 130 ASP n 
2 131 TRP n 
2 132 THR n 
2 133 LEU n 
2 134 ASN n 
2 135 ARG n 
2 136 ASN n 
2 137 GLN n 
2 138 PRO n 
2 139 ALA n 
2 140 ALA n 
2 141 THR n 
2 142 ALA n 
2 143 LEU n 
2 144 ALA n 
2 145 ASN n 
2 146 THR n 
2 147 ILE n 
2 148 GLU n 
2 149 VAL n 
2 150 PHE n 
2 151 ARG n 
2 152 SER n 
2 153 ASN n 
2 154 GLY n 
2 155 LEU n 
2 156 THR n 
2 157 ALA n 
2 158 ASN n 
2 159 GLU n 
2 160 SER n 
2 161 GLY n 
2 162 ARG n 
2 163 LEU n 
2 164 ILE n 
2 165 ASP n 
2 166 PHE n 
2 167 LEU n 
2 168 LYS n 
2 169 ASP n 
2 170 VAL n 
2 171 MET n 
2 172 GLU n 
2 173 SER n 
2 174 MET n 
2 175 ASP n 
2 176 LYS n 
2 177 GLU n 
2 178 GLU n 
2 179 MET n 
2 180 GLU n 
2 181 ILE n 
2 182 THR n 
2 183 THR n 
2 184 HIS n 
2 185 PHE n 
2 186 GLN n 
2 187 ARG n 
2 188 LYS n 
2 189 ARG n 
2 190 ARG n 
2 191 VAL n 
2 192 ARG n 
2 193 ASP n 
2 194 ASN n 
2 195 MET n 
2 196 THR n 
2 197 LYS n 
2 198 LYS n 
2 199 MET n 
2 200 VAL n 
2 201 THR n 
2 202 GLN n 
2 203 ARG n 
2 204 THR n 
2 205 ILE n 
2 206 GLY n 
2 207 LYS n 
2 208 LYS n 
2 209 LYS n 
2 210 GLN n 
2 211 ARG n 
2 212 VAL n 
2 213 ASN n 
2 214 LYS n 
2 215 ARG n 
2 216 SER n 
2 217 TYR n 
2 218 LEU n 
2 219 ILE n 
2 220 ARG n 
2 221 ALA n 
2 222 LEU n 
2 223 THR n 
2 224 LEU n 
2 225 ASN n 
2 226 THR n 
2 227 MET n 
2 228 THR n 
2 229 LYS n 
2 230 ASP n 
2 231 ALA n 
2 232 GLU n 
2 233 ARG n 
2 234 GLY n 
2 235 LYS n 
2 236 LEU n 
2 237 LYS n 
2 238 ARG n 
2 239 ARG n 
2 240 ALA n 
2 241 ILE n 
2 242 ALA n 
2 243 THR n 
2 244 PRO n 
2 245 GLY n 
2 246 MET n 
2 247 GLN n 
2 248 ILE n 
2 249 ARG n 
2 250 GLY n 
2 251 PHE n 
2 252 VAL n 
2 253 TYR n 
2 254 PHE n 
2 255 VAL n 
2 256 GLU n 
2 257 THR n 
2 258 LEU n 
2 259 ALA n 
2 260 ARG n 
2 261 SER n 
2 262 ILE n 
2 263 CYS n 
2 264 GLU n 
2 265 LYS n 
2 266 LEU n 
2 267 GLU n 
2 268 GLN n 
2 269 SER n 
2 270 GLY n 
2 271 LEU n 
2 272 PRO n 
2 273 VAL n 
2 274 GLY n 
2 275 GLY n 
2 276 ASN n 
2 277 GLU n 
2 278 LYS n 
2 279 LYS n 
2 280 ALA n 
2 281 LYS n 
2 282 LEU n 
2 283 ALA n 
2 284 ASN n 
2 285 VAL n 
2 286 VAL n 
2 287 ARG n 
2 288 LYS n 
2 289 MET n 
2 290 MET n 
2 291 THR n 
2 292 ASN n 
2 293 SER n 
2 294 GLN n 
2 295 ASP n 
2 296 THR n 
2 297 GLU n 
2 298 LEU n 
2 299 SER n 
2 300 PHE n 
2 301 THR n 
2 302 ILE n 
2 303 THR n 
2 304 GLY n 
2 305 ASP n 
2 306 ASN n 
2 307 THR n 
2 308 LYS n 
2 309 TRP n 
2 310 ASN n 
2 311 GLU n 
2 312 ASN n 
2 313 GLN n 
2 314 ASN n 
2 315 PRO n 
2 316 ARG n 
2 317 MET n 
2 318 PHE n 
2 319 LEU n 
2 320 ALA n 
2 321 MET n 
2 322 ILE n 
2 323 THR n 
2 324 TYR n 
2 325 ILE n 
2 326 THR n 
2 327 LYS n 
2 328 ASN n 
2 329 GLN n 
2 330 PRO n 
2 331 GLU n 
2 332 TRP n 
2 333 PHE n 
2 334 ARG n 
2 335 ASN n 
2 336 VAL n 
2 337 LEU n 
2 338 SER n 
2 339 ILE n 
2 340 ALA n 
2 341 PRO n 
2 342 ILE n 
2 343 MET n 
2 344 PHE n 
2 345 SER n 
2 346 ASN n 
2 347 LYS n 
2 348 MET n 
2 349 ALA n 
2 350 ARG n 
2 351 LEU n 
2 352 GLY n 
2 353 LYS n 
2 354 GLY n 
2 355 TYR n 
2 356 MET n 
2 357 PHE n 
2 358 GLU n 
2 359 SER n 
2 360 LYS n 
2 361 SER n 
2 362 MET n 
2 363 LYS n 
2 364 LEU n 
2 365 ARG n 
2 366 THR n 
2 367 GLN n 
2 368 ILE n 
2 369 PRO n 
2 370 ALA n 
2 371 GLU n 
2 372 MET n 
2 373 LEU n 
2 374 ALA n 
2 375 SER n 
2 376 ILE n 
2 377 ASP n 
2 378 LEU n 
2 379 LYS n 
2 380 TYR n 
2 381 PHE n 
2 382 ASN n 
2 383 GLU n 
2 384 SER n 
2 385 THR n 
2 386 ARG n 
2 387 LYS n 
2 388 LYS n 
2 389 ILE n 
2 390 GLU n 
2 391 LYS n 
2 392 ILE n 
2 393 ARG n 
2 394 PRO n 
2 395 LEU n 
2 396 LEU n 
2 397 ILE n 
2 398 ASP n 
2 399 GLY n 
2 400 THR n 
2 401 ALA n 
2 402 SER n 
2 403 LEU n 
2 404 SER n 
2 405 PRO n 
2 406 GLY n 
2 407 MET n 
2 408 MET n 
2 409 MET n 
2 410 GLY n 
2 411 MET n 
2 412 PHE n 
2 413 ASN n 
2 414 MET n 
2 415 LEU n 
2 416 SER n 
2 417 THR n 
2 418 VAL n 
2 419 LEU n 
2 420 GLY n 
2 421 VAL n 
2 422 SER n 
2 423 ILE n 
2 424 LEU n 
2 425 ASN n 
2 426 LEU n 
2 427 GLY n 
2 428 GLN n 
2 429 LYS n 
2 430 ARG n 
2 431 TYR n 
2 432 THR n 
2 433 LYS n 
2 434 THR n 
2 435 THR n 
2 436 TYR n 
2 437 TRP n 
2 438 TRP n 
2 439 ASP n 
2 440 GLY n 
2 441 LEU n 
2 442 GLN n 
2 443 SER n 
2 444 SER n 
2 445 ASP n 
2 446 ASP n 
2 447 PHE n 
2 448 ALA n 
2 449 LEU n 
2 450 ILE n 
2 451 VAL n 
2 452 ASN n 
2 453 ALA n 
2 454 PRO n 
2 455 ASN n 
2 456 HIS n 
2 457 GLU n 
2 458 GLY n 
2 459 ILE n 
2 460 GLN n 
2 461 ALA n 
2 462 GLY n 
2 463 VAL n 
2 464 ASP n 
2 465 ARG n 
2 466 PHE n 
2 467 TYR n 
2 468 ARG n 
2 469 THR n 
2 470 CYS n 
2 471 LYS n 
2 472 LEU n 
2 473 VAL n 
2 474 GLY n 
2 475 ILE n 
2 476 ASN n 
2 477 MET n 
2 478 SER n 
2 479 LYS n 
2 480 LYS n 
2 481 LYS n 
2 482 SER n 
2 483 TYR n 
2 484 ILE n 
2 485 ASN n 
2 486 ARG n 
2 487 THR n 
2 488 GLY n 
2 489 THR n 
2 490 PHE n 
2 491 GLU n 
2 492 PHE n 
2 493 THR n 
2 494 SER n 
2 495 PHE n 
2 496 PHE n 
2 497 TYR n 
2 498 ARG n 
2 499 TYR n 
2 500 GLY n 
2 501 PHE n 
2 502 VAL n 
2 503 ALA n 
2 504 ASN n 
2 505 PHE n 
2 506 SER n 
2 507 MET n 
2 508 GLU n 
2 509 LEU n 
2 510 PRO n 
2 511 SER n 
2 512 PHE n 
2 513 GLY n 
2 514 VAL n 
2 515 SER n 
2 516 GLY n 
2 517 ILE n 
2 518 ASN n 
2 519 GLU n 
2 520 SER n 
2 521 ALA n 
2 522 ASP n 
2 523 MET n 
2 524 SER n 
2 525 ILE n 
2 526 GLY n 
2 527 VAL n 
2 528 THR n 
2 529 VAL n 
2 530 ILE n 
2 531 LYS n 
2 532 ASN n 
2 533 ASN n 
2 534 MET n 
2 535 ILE n 
2 536 ASN n 
2 537 ASN n 
2 538 ASP n 
2 539 LEU n 
2 540 GLY n 
2 541 PRO n 
2 542 ALA n 
2 543 THR n 
2 544 ALA n 
2 545 GLN n 
2 546 MET n 
2 547 ALA n 
2 548 LEU n 
2 549 GLN n 
2 550 LEU n 
2 551 PHE n 
2 552 ILE n 
2 553 LYS n 
2 554 ASP n 
2 555 TYR n 
2 556 ARG n 
2 557 TYR n 
2 558 THR n 
2 559 TYR n 
2 560 ARG n 
2 561 CYS n 
2 562 HIS n 
2 563 ARG n 
2 564 GLY n 
2 565 ASP n 
2 566 THR n 
2 567 GLN n 
2 568 ILE n 
2 569 GLN n 
2 570 THR n 
2 571 ARG n 
2 572 ARG n 
2 573 SER n 
2 574 PHE n 
2 575 GLU n 
2 576 LEU n 
2 577 LYS n 
2 578 LYS n 
2 579 LEU n 
2 580 TRP n 
2 581 GLU n 
2 582 GLN n 
2 583 THR n 
2 584 ARG n 
2 585 SER n 
2 586 LYS n 
2 587 ALA n 
2 588 GLY n 
2 589 LEU n 
2 590 LEU n 
2 591 VAL n 
2 592 SER n 
2 593 ASP n 
2 594 GLY n 
2 595 GLY n 
2 596 PRO n 
2 597 ASN n 
2 598 LEU n 
2 599 TYR n 
2 600 ASN n 
2 601 ILE n 
2 602 ARG n 
2 603 ASN n 
2 604 LEU n 
2 605 HIS n 
2 606 ILE n 
2 607 PRO n 
2 608 GLU n 
2 609 VAL n 
2 610 CYS n 
2 611 LEU n 
2 612 LYS n 
2 613 TRP n 
2 614 GLU n 
2 615 LEU n 
2 616 MET n 
2 617 ASP n 
2 618 GLU n 
2 619 ASP n 
2 620 TYR n 
2 621 GLN n 
2 622 GLY n 
2 623 ARG n 
2 624 LEU n 
2 625 CYS n 
2 626 ASN n 
2 627 PRO n 
2 628 LEU n 
2 629 ASN n 
2 630 PRO n 
2 631 PHE n 
2 632 VAL n 
2 633 SER n 
2 634 HIS n 
2 635 LYS n 
2 636 GLU n 
2 637 ILE n 
2 638 GLU n 
2 639 SER n 
2 640 VAL n 
2 641 ASN n 
2 642 ASN n 
2 643 ALA n 
2 644 VAL n 
2 645 VAL n 
2 646 MET n 
2 647 PRO n 
2 648 ALA n 
2 649 HIS n 
2 650 GLY n 
2 651 PRO n 
2 652 ALA n 
2 653 LYS n 
2 654 SER n 
2 655 MET n 
2 656 GLU n 
2 657 TYR n 
2 658 ASP n 
2 659 ALA n 
2 660 VAL n 
2 661 ALA n 
2 662 THR n 
2 663 THR n 
2 664 HIS n 
2 665 SER n 
2 666 TRP n 
2 667 ILE n 
2 668 PRO n 
2 669 LYS n 
2 670 ARG n 
2 671 ASN n 
2 672 ARG n 
2 673 SER n 
2 674 ILE n 
2 675 LEU n 
2 676 ASN n 
2 677 THR n 
2 678 SER n 
2 679 GLN n 
2 680 ARG n 
2 681 GLY n 
2 682 ILE n 
2 683 LEU n 
2 684 GLU n 
2 685 ASP n 
2 686 GLU n 
2 687 GLN n 
2 688 MET n 
2 689 TYR n 
2 690 GLN n 
2 691 LYS n 
2 692 CYS n 
2 693 CYS n 
2 694 ASN n 
2 695 LEU n 
2 696 PHE n 
2 697 GLU n 
2 698 LYS n 
2 699 PHE n 
2 700 PHE n 
2 701 PRO n 
2 702 SER n 
2 703 SER n 
2 704 SER n 
2 705 TYR n 
2 706 ARG n 
2 707 ARG n 
2 708 PRO n 
2 709 VAL n 
2 710 GLY n 
2 711 ILE n 
2 712 SER n 
2 713 SER n 
2 714 MET n 
2 715 VAL n 
2 716 GLU n 
2 717 ALA n 
2 718 MET n 
2 719 VAL n 
2 720 SER n 
2 721 ARG n 
2 722 ALA n 
2 723 ARG n 
2 724 ILE n 
2 725 ASP n 
2 726 ALA n 
2 727 ARG n 
2 728 ILE n 
2 729 ASP n 
2 730 PHE n 
2 731 GLU n 
2 732 SER n 
2 733 GLY n 
2 734 ARG n 
2 735 ILE n 
2 736 LYS n 
2 737 LYS n 
2 738 GLU n 
2 739 GLU n 
2 740 PHE n 
2 741 ALA n 
2 742 GLU n 
2 743 ILE n 
2 744 MET n 
2 745 LYS n 
2 746 ILE n 
2 747 CYS n 
2 748 SER n 
2 749 THR n 
2 750 ILE n 
2 751 GLU n 
2 752 GLU n 
2 753 LEU n 
2 754 ARG n 
2 755 ARG n 
2 756 GLN n 
2 757 LYS n 
3 1   MET n 
3 2   GLU n 
3 3   ARG n 
3 4   ILE n 
3 5   LYS n 
3 6   GLU n 
3 7   LEU n 
3 8   ARG n 
3 9   ASN n 
3 10  LEU n 
3 11  MET n 
3 12  SER n 
3 13  GLN n 
3 14  SER n 
3 15  ARG n 
3 16  THR n 
3 17  ARG n 
3 18  GLU n 
3 19  ILE n 
3 20  LEU n 
3 21  THR n 
3 22  LYS n 
3 23  THR n 
3 24  THR n 
3 25  VAL n 
3 26  ASP n 
3 27  HIS n 
3 28  MET n 
3 29  ALA n 
3 30  ILE n 
3 31  ILE n 
3 32  LYS n 
3 33  LYS n 
3 34  TYR n 
3 35  THR n 
3 36  SER n 
3 37  GLY n 
3 38  ARG n 
3 39  GLN n 
3 40  GLU n 
3 41  LYS n 
3 42  ASN n 
3 43  PRO n 
3 44  SER n 
3 45  LEU n 
3 46  ARG n 
3 47  MET n 
3 48  LYS n 
3 49  TRP n 
3 50  MET n 
3 51  MET n 
3 52  ALA n 
3 53  MET n 
3 54  LYS n 
3 55  TYR n 
3 56  PRO n 
3 57  ILE n 
3 58  THR n 
3 59  ALA n 
3 60  ASP n 
3 61  LYS n 
3 62  ARG n 
3 63  ILE n 
3 64  THR n 
3 65  GLU n 
3 66  MET n 
3 67  VAL n 
3 68  PRO n 
3 69  GLU n 
3 70  ARG n 
3 71  ASN n 
3 72  GLU n 
3 73  GLN n 
3 74  GLY n 
3 75  GLN n 
3 76  THR n 
3 77  LEU n 
3 78  TRP n 
3 79  SER n 
3 80  LYS n 
3 81  MET n 
3 82  SER n 
3 83  ASP n 
3 84  ALA n 
3 85  GLY n 
3 86  SER n 
3 87  ASP n 
3 88  ARG n 
3 89  VAL n 
3 90  MET n 
3 91  VAL n 
3 92  SER n 
3 93  PRO n 
3 94  LEU n 
3 95  ALA n 
3 96  VAL n 
3 97  THR n 
3 98  TRP n 
3 99  TRP n 
3 100 ASN n 
3 101 ARG n 
3 102 ASN n 
3 103 GLY n 
3 104 PRO n 
3 105 MET n 
3 106 THR n 
3 107 SER n 
3 108 THR n 
3 109 VAL n 
3 110 HIS n 
3 111 TYR n 
3 112 PRO n 
3 113 LYS n 
3 114 VAL n 
3 115 TYR n 
3 116 LYS n 
3 117 THR n 
3 118 TYR n 
3 119 PHE n 
3 120 GLU n 
3 121 LYS n 
3 122 VAL n 
3 123 GLU n 
3 124 ARG n 
3 125 LEU n 
3 126 LYS n 
3 127 HIS n 
3 128 GLY n 
3 129 THR n 
3 130 PHE n 
3 131 GLY n 
3 132 PRO n 
3 133 VAL n 
3 134 HIS n 
3 135 PHE n 
3 136 ARG n 
3 137 ASN n 
3 138 GLN n 
3 139 VAL n 
3 140 LYS n 
3 141 ILE n 
3 142 ARG n 
3 143 ARG n 
3 144 ARG n 
3 145 VAL n 
3 146 ASP n 
3 147 ILE n 
3 148 ASN n 
3 149 PRO n 
3 150 GLY n 
3 151 HIS n 
3 152 ALA n 
3 153 ASP n 
3 154 LEU n 
3 155 SER n 
3 156 ALA n 
3 157 LYS n 
3 158 GLU n 
3 159 ALA n 
3 160 GLN n 
3 161 ASP n 
3 162 VAL n 
3 163 ILE n 
3 164 MET n 
3 165 GLU n 
3 166 VAL n 
3 167 VAL n 
3 168 PHE n 
3 169 PRO n 
3 170 ASN n 
3 171 GLU n 
3 172 VAL n 
3 173 GLY n 
3 174 ALA n 
3 175 ARG n 
3 176 ILE n 
3 177 LEU n 
3 178 THR n 
3 179 SER n 
3 180 GLU n 
3 181 SER n 
3 182 GLN n 
3 183 LEU n 
3 184 THR n 
3 185 ILE n 
3 186 THR n 
3 187 LYS n 
3 188 GLU n 
3 189 LYS n 
3 190 LYS n 
3 191 GLU n 
3 192 GLU n 
3 193 LEU n 
3 194 GLN n 
3 195 ASP n 
3 196 CYS n 
3 197 LYS n 
3 198 ILE n 
3 199 SER n 
3 200 PRO n 
3 201 LEU n 
3 202 MET n 
3 203 VAL n 
3 204 ALA n 
3 205 TYR n 
3 206 MET n 
3 207 LEU n 
3 208 GLU n 
3 209 ARG n 
3 210 GLU n 
3 211 LEU n 
3 212 VAL n 
3 213 ARG n 
3 214 LYS n 
3 215 THR n 
3 216 ARG n 
3 217 PHE n 
3 218 LEU n 
3 219 PRO n 
3 220 VAL n 
3 221 ALA n 
3 222 GLY n 
3 223 GLY n 
3 224 THR n 
3 225 SER n 
3 226 SER n 
3 227 VAL n 
3 228 TYR n 
3 229 ILE n 
3 230 GLU n 
3 231 VAL n 
3 232 LEU n 
3 233 HIS n 
3 234 LEU n 
3 235 THR n 
3 236 GLN n 
3 237 GLY n 
3 238 THR n 
3 239 CYS n 
3 240 TRP n 
3 241 GLU n 
3 242 GLN n 
3 243 MET n 
3 244 TYR n 
3 245 THR n 
3 246 PRO n 
3 247 GLY n 
3 248 GLY n 
3 249 GLU n 
3 250 VAL n 
3 251 ARG n 
3 252 ASN n 
3 253 ASP n 
3 254 ASP n 
3 255 VAL n 
3 256 ASP n 
3 257 GLN n 
3 258 SER n 
3 259 LEU n 
3 260 ILE n 
3 261 ILE n 
3 262 ALA n 
3 263 ALA n 
3 264 ARG n 
3 265 ASN n 
3 266 ILE n 
3 267 VAL n 
3 268 ARG n 
3 269 ARG n 
3 270 ALA n 
3 271 ALA n 
3 272 VAL n 
3 273 SER n 
3 274 ALA n 
3 275 ASP n 
3 276 PRO n 
3 277 LEU n 
3 278 ALA n 
3 279 SER n 
3 280 LEU n 
3 281 LEU n 
3 282 GLU n 
3 283 MET n 
3 284 CYS n 
3 285 HIS n 
3 286 SER n 
3 287 THR n 
3 288 GLN n 
3 289 ILE n 
3 290 GLY n 
3 291 GLY n 
3 292 THR n 
3 293 ARG n 
3 294 MET n 
3 295 VAL n 
3 296 ASP n 
3 297 ILE n 
3 298 LEU n 
3 299 ARG n 
3 300 GLN n 
3 301 ASN n 
3 302 PRO n 
3 303 THR n 
3 304 GLU n 
3 305 GLU n 
3 306 GLN n 
3 307 ALA n 
3 308 VAL n 
3 309 ASP n 
3 310 ILE n 
3 311 CYS n 
3 312 LYS n 
3 313 ALA n 
3 314 ALA n 
3 315 MET n 
3 316 GLY n 
3 317 LEU n 
3 318 ARG n 
3 319 ILE n 
3 320 SER n 
3 321 SER n 
3 322 SER n 
3 323 PHE n 
3 324 SER n 
3 325 PHE n 
3 326 GLY n 
3 327 GLY n 
3 328 PHE n 
3 329 THR n 
3 330 PHE n 
3 331 LYS n 
3 332 ARG n 
3 333 THR n 
3 334 SER n 
3 335 GLY n 
3 336 SER n 
3 337 SER n 
3 338 ILE n 
3 339 LYS n 
3 340 ARG n 
3 341 GLU n 
3 342 GLU n 
3 343 GLU n 
3 344 LEU n 
3 345 LEU n 
3 346 THR n 
3 347 GLY n 
3 348 ASN n 
3 349 LEU n 
3 350 GLN n 
3 351 THR n 
3 352 LEU n 
3 353 LYS n 
3 354 ILE n 
3 355 ARG n 
3 356 VAL n 
3 357 HIS n 
3 358 ASP n 
3 359 GLY n 
3 360 TYR n 
3 361 GLU n 
3 362 GLU n 
3 363 PHE n 
3 364 THR n 
3 365 MET n 
3 366 VAL n 
3 367 GLY n 
3 368 LYS n 
3 369 ARG n 
3 370 ALA n 
3 371 THR n 
3 372 ALA n 
3 373 ILE n 
3 374 LEU n 
3 375 ARG n 
3 376 LYS n 
3 377 ALA n 
3 378 THR n 
3 379 ARG n 
3 380 ARG n 
3 381 LEU n 
3 382 VAL n 
3 383 GLN n 
3 384 LEU n 
3 385 ILE n 
3 386 VAL n 
3 387 SER n 
3 388 GLY n 
3 389 ARG n 
3 390 ASP n 
3 391 GLU n 
3 392 GLN n 
3 393 SER n 
3 394 VAL n 
3 395 ALA n 
3 396 GLU n 
3 397 ALA n 
3 398 ILE n 
3 399 ILE n 
3 400 VAL n 
3 401 ALA n 
3 402 MET n 
3 403 VAL n 
3 404 PHE n 
3 405 SER n 
3 406 GLN n 
3 407 GLU n 
3 408 ASP n 
3 409 CYS n 
3 410 MET n 
3 411 ILE n 
3 412 LYS n 
3 413 ALA n 
3 414 VAL n 
3 415 ARG n 
3 416 GLY n 
3 417 ASP n 
3 418 LEU n 
3 419 ASN n 
3 420 PHE n 
3 421 VAL n 
3 422 ASN n 
3 423 ARG n 
3 424 ALA n 
3 425 ASN n 
3 426 GLN n 
3 427 ARG n 
3 428 LEU n 
3 429 ASN n 
3 430 PRO n 
3 431 MET n 
3 432 HIS n 
3 433 GLN n 
3 434 LEU n 
3 435 LEU n 
3 436 ARG n 
3 437 HIS n 
3 438 PHE n 
3 439 GLN n 
3 440 LYS n 
3 441 ASP n 
3 442 ALA n 
3 443 LYS n 
3 444 VAL n 
3 445 LEU n 
3 446 PHE n 
3 447 GLN n 
3 448 ASN n 
3 449 TRP n 
3 450 GLY n 
3 451 ILE n 
3 452 GLU n 
3 453 HIS n 
3 454 ILE n 
3 455 ASP n 
3 456 ASN n 
3 457 VAL n 
3 458 MET n 
3 459 GLY n 
3 460 MET n 
3 461 ILE n 
3 462 GLY n 
3 463 VAL n 
3 464 LEU n 
3 465 PRO n 
3 466 ASP n 
3 467 MET n 
3 468 THR n 
3 469 PRO n 
3 470 SER n 
3 471 THR n 
3 472 GLU n 
3 473 MET n 
3 474 SER n 
3 475 MET n 
3 476 ARG n 
3 477 GLY n 
3 478 ILE n 
3 479 ARG n 
3 480 VAL n 
3 481 SER n 
3 482 LYS n 
3 483 MET n 
3 484 GLY n 
3 485 VAL n 
3 486 ASP n 
3 487 GLU n 
3 488 TYR n 
3 489 SER n 
3 490 SER n 
3 491 THR n 
3 492 GLU n 
3 493 ARG n 
3 494 VAL n 
3 495 VAL n 
3 496 VAL n 
3 497 SER n 
3 498 ILE n 
3 499 ASP n 
3 500 ARG n 
3 501 PHE n 
3 502 LEU n 
3 503 ARG n 
3 504 VAL n 
3 505 ARG n 
3 506 ASP n 
3 507 GLN n 
3 508 ARG n 
3 509 GLY n 
3 510 ASN n 
3 511 VAL n 
3 512 LEU n 
3 513 LEU n 
3 514 SER n 
3 515 PRO n 
3 516 GLU n 
3 517 GLU n 
3 518 VAL n 
3 519 SER n 
3 520 GLU n 
3 521 THR n 
3 522 GLN n 
3 523 GLY n 
3 524 THR n 
3 525 GLU n 
3 526 LYS n 
3 527 LEU n 
3 528 THR n 
3 529 ILE n 
3 530 THR n 
3 531 TYR n 
3 532 SER n 
3 533 SER n 
3 534 SER n 
3 535 MET n 
3 536 MET n 
3 537 TRP n 
3 538 GLU n 
3 539 ILE n 
3 540 ASN n 
3 541 GLY n 
3 542 PRO n 
3 543 GLU n 
3 544 SER n 
3 545 VAL n 
3 546 LEU n 
3 547 VAL n 
3 548 ASN n 
3 549 THR n 
3 550 TYR n 
3 551 GLN n 
3 552 TRP n 
3 553 ILE n 
3 554 ILE n 
3 555 ARG n 
3 556 ASN n 
3 557 TRP n 
3 558 GLU n 
3 559 THR n 
3 560 VAL n 
3 561 LYS n 
3 562 ILE n 
3 563 GLN n 
3 564 TRP n 
3 565 SER n 
3 566 GLN n 
3 567 ASN n 
3 568 PRO n 
3 569 THR n 
3 570 MET n 
3 571 LEU n 
3 572 TYR n 
3 573 ASN n 
3 574 LYS n 
3 575 MET n 
3 576 GLU n 
3 577 PHE n 
3 578 GLU n 
3 579 PRO n 
3 580 PHE n 
3 581 GLN n 
3 582 SER n 
3 583 LEU n 
3 584 VAL n 
3 585 PRO n 
3 586 LYS n 
3 587 ALA n 
3 588 ILE n 
3 589 ARG n 
3 590 GLY n 
3 591 GLN n 
3 592 TYR n 
3 593 SER n 
3 594 GLY n 
3 595 PHE n 
3 596 VAL n 
3 597 ARG n 
3 598 THR n 
3 599 LEU n 
3 600 PHE n 
3 601 GLN n 
3 602 GLN n 
3 603 MET n 
3 604 ARG n 
3 605 ASP n 
3 606 VAL n 
3 607 LEU n 
3 608 GLY n 
3 609 THR n 
3 610 PHE n 
3 611 ASP n 
3 612 THR n 
3 613 THR n 
3 614 GLN n 
3 615 ILE n 
3 616 ILE n 
3 617 LYS n 
3 618 LEU n 
3 619 LEU n 
3 620 PRO n 
3 621 PHE n 
3 622 ALA n 
3 623 ALA n 
3 624 ALA n 
3 625 PRO n 
3 626 PRO n 
3 627 LYS n 
3 628 GLN n 
3 629 SER n 
3 630 ARG n 
3 631 MET n 
3 632 GLN n 
3 633 PHE n 
3 634 SER n 
3 635 SER n 
3 636 LEU n 
3 637 THR n 
3 638 VAL n 
3 639 ASN n 
3 640 VAL n 
3 641 ARG n 
3 642 GLY n 
3 643 SER n 
3 644 GLY n 
3 645 MET n 
3 646 ARG n 
3 647 ILE n 
3 648 LEU n 
3 649 VAL n 
3 650 ARG n 
3 651 GLY n 
3 652 ASN n 
3 653 SER n 
3 654 PRO n 
3 655 ALA n 
3 656 PHE n 
3 657 ASN n 
3 658 TYR n 
3 659 ASN n 
3 660 LYS n 
3 661 THR n 
3 662 THR n 
3 663 LYS n 
3 664 ARG n 
3 665 LEU n 
3 666 THR n 
3 667 ILE n 
3 668 LEU n 
3 669 GLY n 
3 670 LYS n 
3 671 ASP n 
3 672 ALA n 
3 673 GLY n 
3 674 THR n 
3 675 LEU n 
3 676 ILE n 
3 677 GLU n 
3 678 ASP n 
3 679 PRO n 
3 680 ASP n 
3 681 GLU n 
3 682 GLY n 
3 683 THR n 
3 684 SER n 
3 685 GLY n 
3 686 VAL n 
3 687 GLU n 
3 688 SER n 
3 689 ALA n 
3 690 VAL n 
3 691 LEU n 
3 692 ARG n 
3 693 GLY n 
3 694 PHE n 
3 695 LEU n 
3 696 ILE n 
3 697 LEU n 
3 698 GLY n 
3 699 LYS n 
3 700 GLU n 
3 701 ASP n 
3 702 ARG n 
3 703 ARG n 
3 704 TYR n 
3 705 GLY n 
3 706 PRO n 
3 707 ALA n 
3 708 LEU n 
3 709 SER n 
3 710 ILE n 
3 711 ASN n 
3 712 GLU n 
3 713 LEU n 
3 714 SER n 
3 715 ASN n 
3 716 LEU n 
3 717 ALA n 
3 718 LYS n 
3 719 GLY n 
3 720 GLU n 
3 721 LYS n 
3 722 ALA n 
3 723 ASN n 
3 724 VAL n 
3 725 LEU n 
3 726 ILE n 
3 727 GLY n 
3 728 GLN n 
3 729 GLY n 
3 730 ASP n 
3 731 VAL n 
3 732 VAL n 
3 733 LEU n 
3 734 VAL n 
3 735 MET n 
3 736 LYS n 
3 737 ARG n 
3 738 LYS n 
3 739 ARG n 
3 740 ASP n 
3 741 SER n 
3 742 SER n 
3 743 ILE n 
3 744 LEU n 
3 745 THR n 
3 746 ASP n 
3 747 SER n 
3 748 GLN n 
3 749 THR n 
3 750 ALA n 
3 751 THR n 
3 752 LYS n 
3 753 ARG n 
3 754 ILE n 
3 755 ARG n 
3 756 MET n 
3 757 ALA n 
3 758 ILE n 
3 759 ASN n 
3 760 GLU n 
3 761 ASN n 
3 762 LEU n 
3 763 TYR n 
3 764 PHE n 
3 765 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 716 ? ? PA  ? ? ? ? ? ? 'Influenza A virus (A/Northern Territory/60/1968(H3N2))'       370128 ? 
? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 757 ? ? PB1 ? ? ? ? ? ? 'Influenza A virus (strain A/Northern Territory/60/1968 H3N2)' 384505 ? 
? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 765 ? ? PB2 ? ? ? ? ? ? 'Influenza A virus (strain A/Northern Territory/60/1968 H3N2)' 384505 ? 
? ? ? ? ? ? 'fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q1AR05_9INFA Q1AR05 ? 1 
;MEDFVRQCFNPMIVELAEKAMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGESIVVELDDPNALLKHRFEIIE
GRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSENTHIHIFSFTGEEMATKAD
YTLDEESRARIKTRLFTIRQEMANRGLWDSFRQSERGEETIEERFEITGTMRRLADQSLPPNFSCLENFRAYVDGFEPNG
YIEGKLSQMSKEVNAKIEPFLKTTPRPIRLPDGPPCFQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMRTFFGWKEP
YIVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPRTKNMKKTSQLKWALGENMAPEKVDFDNCRDVSDLKQYDSDEPEL
RSLSSWIQNEFNKACELTDSTWIELDEIGEDVAPIEYIASMRRNYFTAEVSHCRATEYIMKGVYINTALLNASCAAMDDF
QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEIGDMLLRSAIGQMSRP
MFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKSETWPIGESPKGVEDGSIGKVCRTL
LAKSVFNSLYASPQLEGFSAESRKLLLVVQALRDNLEPGTFDLEGLYEAIEECLINDPWVLLNASWFNSFLTHALR
;
1 
2 UNP RDRP_I68A6   P03432 ? 2 
;MDVNPTLLFLKVPAQNAISTTFPYTGDPPYSHGTGTGYTMDTVNRTHQYSEKGKWTTNTETGAPQLNPIDGPLPEDNEPS
GYAQTDCVLEAMAFLEESHPGIFENSCLETMEVVQQTRVDRLTQGRQTYDWTLNRNQPAATALANTIEVFRSNGLTANES
GRLIDFLKDVMESMDKEEMEITTHFQRKRRVRDNMTKKMVTQRTIGKKKQRVNKRSYLIRALTLNTMTKDAERGKLKRRA
IATPGMQIRGFVYFVETLARSICEKLEQSGLPVGGNEKKAKLANVVRKMMTNSQDTELSFTITGDNTKWNENQNPRMFLA
MITYITKNQPEWFRNVLSIAPIMFSNKMARLGKGYMFESKSMKLRTQIPAEMLASIDLKYFNESTRKKIEKIRPLLIDGT
ASLSPGMMMGMFNMLSTVLGVSILNLGQKRYTKTTYWWDGLQSSDDFALIVNAPNHEGIQAGVDRFYRTCKLVGINMSKK
KSYINRTGTFEFTSFFYRYGFVANFSMELPSFGVSGINESADMSIGVTVIKNNMINNDLGPATAQMALQLFIKDYRYTYR
CHRGDTQIQTRRSFELEKLWEQTRSKAGLLVSDGGPNLYNIRNLHIPEVCLKWELMDEDYQGRLCNPLNPFVSHKEIESV
NNAVVMPAHGPAKSMEYDAVATTHSWIPKRNRSILNTSQRGILEDEQMYQKCCNLFEKFFPSSSYRRPVGISSMVEAMVS
RARIDARIDFESGRIKKEEFAEIMKICSTIEELRRQK
;
1 
3 UNP PB2_I68A6    P03429 ? 3 
;MERIKELRNLMSQSRTREILTKTTVDHMAIIKKYTSGRQEKNPSLRMKWMMAMKYPITADKRITEMVPERNEQGQTLWSK
MSDAGSDRVMVSPLAVTWWNRNGPMTSTVHYPKVYKTYFEKVERLKHGTFGPVHFRNQVKIRRRVDINPGHADLSAKEAQ
DVIMEVVFPNEVGARILTSESQLTITKEKKEELQDCKISPLMVAYMLERELVRKTRFLPVAGGTSSVYIEVLHLTQGTCW
EQMYTPGGEVRNDDVDQSLIIAARNIVRRAAVSADPLASLLEMCHSTQIGGTRMVDILRQNPTEEQAVDICKAAMGLRIS
SSFSFGGFTFKRTSGSSIKREEELLTGNLQTLKIRVHDGYEEFTMVGKRATAILRKATRRLVQLIVSGRDEQSVAEAIIV
AMVFSQEDCMIKAVRGDLNFVNRANQRLNPMHQLLRHFQKDAKVLFQNWGIEHIDNVMGMIGVLPDMTPSTEMSMRGIRV
SKMGVDEYSSTERVVVSIDRFLRVRDQRGNVLLSPEEVSETQGTEKLTITYSSSMMWEINGPESVLVNTYQWIIRNWETV
KIQWSQNPTMLYNKMEFEPFQSLVPKAIRGQYSGFVRTLFQQMRDVLGTFDTTQIIKLLPFAAAPPKQSRMQFSSLTVNV
RGSGMRILVRGNSPAFNYNKTTKRLTILGKDAGTLIEDPDEGTSGVESAVLRGFLILGKEDRRYGPALSINELSNLAKGE
KANVLIGQGDVVLVMKRKRDSSILTDSQTATKRIRMAIN
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6QNW A 1 ? 716 ? Q1AR05 1 ? 716 ? 1 716 
2  2 6QNW B 1 ? 757 ? P03432 1 ? 757 ? 1 757 
3  3 6QNW C 1 ? 759 ? P03429 1 ? 759 ? 1 759 
4  1 6QNW D 1 ? 716 ? Q1AR05 1 ? 716 ? 1 716 
5  2 6QNW E 1 ? 757 ? P03432 1 ? 757 ? 1 757 
6  3 6QNW F 1 ? 759 ? P03429 1 ? 759 ? 1 759 
7  1 6QNW G 1 ? 716 ? Q1AR05 1 ? 716 ? 1 716 
8  2 6QNW H 1 ? 757 ? P03432 1 ? 757 ? 1 757 
9  3 6QNW I 1 ? 759 ? P03429 1 ? 759 ? 1 759 
10 1 6QNW J 1 ? 716 ? Q1AR05 1 ? 716 ? 1 716 
11 2 6QNW K 1 ? 757 ? P03432 1 ? 757 ? 1 757 
12 3 6QNW L 1 ? 759 ? P03429 1 ? 759 ? 1 759 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  6QNW LYS B 577 ? UNP P03432 GLU 577 conflict         577 1  
3  6QNW GLU C 760 ? UNP P03429 ?   ?   'expression tag' 760 2  
3  6QNW ASN C 761 ? UNP P03429 ?   ?   'expression tag' 761 3  
3  6QNW LEU C 762 ? UNP P03429 ?   ?   'expression tag' 762 4  
3  6QNW TYR C 763 ? UNP P03429 ?   ?   'expression tag' 763 5  
3  6QNW PHE C 764 ? UNP P03429 ?   ?   'expression tag' 764 6  
3  6QNW GLN C 765 ? UNP P03429 ?   ?   'expression tag' 765 7  
5  6QNW LYS E 577 ? UNP P03432 GLU 577 conflict         577 8  
6  6QNW GLU F 760 ? UNP P03429 ?   ?   'expression tag' 760 9  
6  6QNW ASN F 761 ? UNP P03429 ?   ?   'expression tag' 761 10 
6  6QNW LEU F 762 ? UNP P03429 ?   ?   'expression tag' 762 11 
6  6QNW TYR F 763 ? UNP P03429 ?   ?   'expression tag' 763 12 
6  6QNW PHE F 764 ? UNP P03429 ?   ?   'expression tag' 764 13 
6  6QNW GLN F 765 ? UNP P03429 ?   ?   'expression tag' 765 14 
8  6QNW LYS H 577 ? UNP P03432 GLU 577 conflict         577 15 
9  6QNW GLU I 760 ? UNP P03429 ?   ?   'expression tag' 760 16 
9  6QNW ASN I 761 ? UNP P03429 ?   ?   'expression tag' 761 17 
9  6QNW LEU I 762 ? UNP P03429 ?   ?   'expression tag' 762 18 
9  6QNW TYR I 763 ? UNP P03429 ?   ?   'expression tag' 763 19 
9  6QNW PHE I 764 ? UNP P03429 ?   ?   'expression tag' 764 20 
9  6QNW GLN I 765 ? UNP P03429 ?   ?   'expression tag' 765 21 
11 6QNW LYS K 577 ? UNP P03432 GLU 577 conflict         577 22 
12 6QNW GLU L 760 ? UNP P03429 ?   ?   'expression tag' 760 23 
12 6QNW ASN L 761 ? UNP P03429 ?   ?   'expression tag' 761 24 
12 6QNW LEU L 762 ? UNP P03429 ?   ?   'expression tag' 762 25 
12 6QNW TYR L 763 ? UNP P03429 ?   ?   'expression tag' 763 26 
12 6QNW PHE L 764 ? UNP P03429 ?   ?   'expression tag' 764 27 
12 6QNW GLN L 765 ? UNP P03429 ?   ?   'expression tag' 765 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6QNW 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.96 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         68.94 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '1-1.6 M K/Na phosphate' 
_exptl_crystal_grow.pdbx_pH_range   '6 - 7' 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-09-22 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.968620 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I24' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.968620 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I24 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            88.49 
_reflns.entry_id                         6QNW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.31 
_reflns.d_resolution_low                 235.654 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       123159 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  14.4 
_reflns.pdbx_Rmerge_I_obs                0.459 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            4.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.476 
_reflns.pdbx_Rpim_I_all                  0.126 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.988 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.321 
_reflns_shell.d_res_low                   3.916 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           9466 
_reflns_shell.percent_possible_all        80.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                2.243 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             13.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             2.363 
_reflns_shell.pdbx_Rpim_I_all             0.626 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.646 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               117.41 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6QNW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.31 
_refine.ls_d_res_low                             138.62 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     123065 
_refine.ls_number_reflns_R_free                  6172 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    55.08 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2377 
_refine.ls_R_factor_R_free                       0.2787 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2355 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               NONE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5D9A 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.9865 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.4971 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        67232 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               67232 
_refine_hist.d_res_high                       3.31 
_refine_hist.d_res_low                        138.62 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.0024 ? 68492 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.6182 ? 92287 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.0427 ? 10173 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.0036 ? 11874 ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 8.6606 ? 41989 ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.31  3.34   . . 2   41   0.59   . . . 0.6323 . 0.4028 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.34  3.38   . . 8   113  1.65   . . . 0.5335 . 0.3241 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.38  3.42   . . 10  212  3.02   . . . 0.3809 . 0.3454 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.42  3.47   . . 18  363  5.18   . . . 0.3452 . 0.3374 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.47  3.51   . . 26  488  6.97   . . . 0.3234 . 0.3461 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.51  3.56   . . 32  627  8.93   . . . 0.3200 . 0.3437 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.56  3.61   . . 42  765  10.88  . . . 0.4427 . 0.3334 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.61  3.67   . . 44  947  13.29  . . . 0.3893 . 0.3162 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.67  3.72   . . 61  1085 15.42  . . . 0.3466 . 0.3278 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.72  3.78   . . 61  1294 18.46  . . . 0.4035 . 0.3025 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.78  3.85   . . 77  1502 21.31  . . . 0.3138 . 0.2944 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.85  3.92   . . 98  1799 25.46  . . . 0.3526 . 0.2922 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.92  3.99   . . 123 2119 30.36  . . . 0.3410 . 0.2894 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.99  4.08   . . 119 2573 36.00  . . . 0.3350 . 0.2789 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.08  4.16   . . 164 3017 42.91  . . . 0.3029 . 0.2661 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.16  4.26   . . 200 3632 51.82  . . . 0.2826 . 0.2597 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.26  4.37   . . 263 4933 69.61  . . . 0.2929 . 0.2494 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.37  4.49   . . 337 6255 88.84  . . . 0.2944 . 0.2506 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.49  4.62   . . 373 6975 98.25  . . . 0.3166 . 0.2362 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.62  4.77   . . 361 7039 99.87  . . . 0.2824 . 0.2323 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.77  4.94   . . 372 7105 100.00 . . . 0.2753 . 0.2316 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.94  5.14   . . 387 7068 100.00 . . . 0.2972 . 0.2391 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.14  5.37   . . 361 7060 100.00 . . . 0.2956 . 0.2499 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.37  5.65   . . 375 7100 100.00 . . . 0.2938 . 0.2555 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.65  6.01   . . 368 7083 100.00 . . . 0.2834 . 0.2600 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.01  6.47   . . 381 7087 100.00 . . . 0.2827 . 0.2630 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.47  7.12   . . 373 7122 100.00 . . . 0.2973 . 0.2484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.12  8.15   . . 372 7134 100.00 . . . 0.2753 . 0.2112 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.15  10.27  . . 385 7131 99.96  . . . 0.1855 . 0.1617 . . . . . . . . . . 
'X-RAY DIFFRACTION' 10.27 138.75 . . 379 7224 99.44  . . . 0.2661 . 0.2244 . . . . . . . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.details 
1 1 ? 
2 1 ? 
3 1 ? 
4 1 ? 
1 2 ? 
2 2 ? 
3 2 ? 
4 2 ? 
1 3 ? 
2 3 ? 
3 3 ? 
4 3 ? 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 A 1   A 63  
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
1 ? ? ? ? ? ? ? ? ? 
1 1 A 73  A 372 
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
2 ? ? ? ? ? ? ? ? ? 
1 1 A 376 A 388 
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
3 ? ? ? ? ? ? ? ? ? 
1 1 A 396 A 549 
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
4 ? ? ? ? ? ? ? ? ? 
1 1 A 556 A 618 
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
5 ? ? ? ? ? ? ? ? ? 
1 1 A 632 A 713 
;(chain 'A' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
6 ? ? ? ? ? ? ? ? ? 
1 2 D 1   D 63  
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
1 ? ? ? ? ? ? ? ? ? 
1 2 D 73  D 372 
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
2 ? ? ? ? ? ? ? ? ? 
1 2 D 376 D 388 
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
3 ? ? ? ? ? ? ? ? ? 
1 2 D 396 D 549 
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
4 ? ? ? ? ? ? ? ? ? 
1 2 D 556 D 618 
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
5 ? ? ? ? ? ? ? ? ? 
1 2 D 632 D 713 
;(chain 'D' and (resid 1 through 64 or resid 73 through 389 or resid 396 through 550 or resid 556 through 714))
;
6 ? ? ? ? ? ? ? ? ? 
1 3 G 1   G 63  
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
1 ? ? ? ? ? ? ? ? ? 
1 3 G 73  G 372 
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
2 ? ? ? ? ? ? ? ? ? 
1 3 G 376 G 388 
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
3 ? ? ? ? ? ? ? ? ? 
1 3 G 396 G 549 
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
4 ? ? ? ? ? ? ? ? ? 
1 3 G 556 G 618 
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
5 ? ? ? ? ? ? ? ? ? 
1 3 G 632 G 713 
;(chain 'G' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 550 or resid 556 through 619 or resid 632 through 714))
;
6 ? ? ? ? ? ? ? ? ? 
1 4 J 1   J 63  
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
1 ? ? ? ? ? ? ? ? ? 
1 4 J 73  J 372 
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
2 ? ? ? ? ? ? ? ? ? 
1 4 J 376 J 388 
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
3 ? ? ? ? ? ? ? ? ? 
1 4 J 396 J 549 
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
4 ? ? ? ? ? ? ? ? ? 
1 4 J 556 J 618 
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
5 ? ? ? ? ? ? ? ? ? 
1 4 J 632 J 713 
;(chain 'J' and (resid 1 through 64 or resid 73 through 373 or resid 376 through 389 or resid 396 through 619 or resid 632 through 714))
;
6 ? ? ? ? ? ? ? ? ? 
2 1 B 1   B 29  
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
1 ? ? ? ? ? ? ? ? ? 
2 1 B 36  B 181 
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
2 ? ? ? ? ? ? ? ? ? 
2 1 B 213 B 222 
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
3 ? ? ? ? ? ? ? ? ? 
2 1 B 244 B 631 
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
4 ? ? ? ? ? ? ? ? ? 
2 1 B 655 B 664 
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
5 ? ? ? ? ? ? ? ? ? 
2 1 B 684 B 755 
;(chain 'B' and (resid 1 through 30 or resid 36 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
6 ? ? ? ? ? ? ? ? ? 
2 2 E 1   E 29  
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
1 ? ? ? ? ? ? ? ? ? 
2 2 E 36  E 181 
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
2 ? ? ? ? ? ? ? ? ? 
2 2 E 213 E 222 
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
3 ? ? ? ? ? ? ? ? ? 
2 2 E 244 E 631 
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
4 ? ? ? ? ? ? ? ? ? 
2 2 E 655 E 664 
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
5 ? ? ? ? ? ? ? ? ? 
2 2 E 684 E 755 
;(chain 'E' and (resid 1 through 223 or resid 244 through 665 or resid 684 through 756))
;
6 ? ? ? ? ? ? ? ? ? 
2 3 H 1   H 29  
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
1 ? ? ? ? ? ? ? ? ? 
2 3 H 36  H 181 
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
2 ? ? ? ? ? ? ? ? ? 
2 3 H 213 H 222 
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
3 ? ? ? ? ? ? ? ? ? 
2 3 H 244 H 631 
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
4 ? ? ? ? ? ? ? ? ? 
2 3 H 655 H 664 
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
5 ? ? ? ? ? ? ? ? ? 
2 3 H 684 H 755 
;(chain 'H' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 665 or resid 684 through 756))
;
6 ? ? ? ? ? ? ? ? ? 
2 4 K 1   K 29  
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
1 ? ? ? ? ? ? ? ? ? 
2 4 K 36  K 181 
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
2 ? ? ? ? ? ? ? ? ? 
2 4 K 213 K 222 
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
3 ? ? ? ? ? ? ? ? ? 
2 4 K 244 K 631 
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
4 ? ? ? ? ? ? ? ? ? 
2 4 K 655 K 664 
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
5 ? ? ? ? ? ? ? ? ? 
2 4 K 684 K 755 
;(chain 'K' and (resid 1 through 182 or resid 213 through 223 or resid 244 through 632 or resid 655 through 756))
;
6 ? ? ? ? ? ? ? ? ? 
3 1 C 1   C 78  
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
1 ? ? ? ? ? ? ? ? ? 
3 1 C 89  C 175 
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
2 ? ? ? ? ? ? ? ? ? 
3 1 C 183 C 246 
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
3 ? ? ? ? ? ? ? ? ? 
3 1 C 252 C 417 
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
4 ? ? ? ? ? ? ? ? ? 
3 1 C 430 C 674 
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
5 ? ? ? ? ? ? ? ? ? 
3 1 C 693 C 751 
;(chain 'C' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
6 ? ? ? ? ? ? ? ? ? 
3 2 F 1   F 78  
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
1 ? ? ? ? ? ? ? ? ? 
3 2 F 89  F 175 
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
2 ? ? ? ? ? ? ? ? ? 
3 2 F 183 F 246 
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
3 ? ? ? ? ? ? ? ? ? 
3 2 F 252 F 417 
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
4 ? ? ? ? ? ? ? ? ? 
3 2 F 430 F 674 
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
5 ? ? ? ? ? ? ? ? ? 
3 2 F 693 F 751 
;(chain 'F' and (resid 1 through 79 or resid 89 through 247 or resid 252 through 418 or resid 430 through 752))
;
6 ? ? ? ? ? ? ? ? ? 
3 3 I 1   I 78  
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
1 ? ? ? ? ? ? ? ? ? 
3 3 I 89  I 175 
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
2 ? ? ? ? ? ? ? ? ? 
3 3 I 183 I 246 
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
3 ? ? ? ? ? ? ? ? ? 
3 3 I 252 I 417 
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
4 ? ? ? ? ? ? ? ? ? 
3 3 I 430 I 674 
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
5 ? ? ? ? ? ? ? ? ? 
3 3 I 693 I 751 
;(chain 'I' and (resid 1 through 79 or resid 89 through 175 or resid 183 through 247 or resid 252 through 418 or resid 430 through 752))
;
6 ? ? ? ? ? ? ? ? ? 
3 4 L 1   L 78  
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
1 ? ? ? ? ? ? ? ? ? 
3 4 L 89  L 175 
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
2 ? ? ? ? ? ? ? ? ? 
3 4 L 183 L 246 
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
3 ? ? ? ? ? ? ? ? ? 
3 4 L 252 L 417 
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
4 ? ? ? ? ? ? ? ? ? 
3 4 L 430 L 674 
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
5 ? ? ? ? ? ? ? ? ? 
3 4 L 693 L 751 
;(chain 'L' and (resid 1 through 175 or resid 183 through 752))
;
6 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     6QNW 
_struct.title                        'Influenza A Polymerase Heterotrimer Human H3N2 Northern Territory 1968' 
_struct.pdbx_descriptor              
'Polymerase acidic protein (E.C.3.1.-.-), RNA-directed RNA polymerase catalytic subunit (E.C.2.7.7.48), Polymerase basic protein 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6QNW 
_struct_keywords.text            'Influenza A, RNA polymerase, Influenza polymerase, Influenza dimer, RDRP, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 1 ? 
K N N 2 ? 
L N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 MET A 1   ? ARG A 6   ? MET A 1   ARG A 6   1 ? 6  
HELX_P HELX_P2   AA2 ASN A 10  ? LYS A 22  ? ASN A 10  LYS A 22  1 ? 13 
HELX_P HELX_P3   AA3 GLU A 31  ? ASP A 50  ? GLU A 31  ASP A 50  1 ? 20 
HELX_P HELX_P4   AA4 ASP A 83  ? GLY A 99  ? ASP A 83  GLY A 99  1 ? 17 
HELX_P HELX_P5   AA5 GLU A 126 ? ILE A 138 ? GLU A 126 ILE A 138 1 ? 13 
HELX_P HELX_P6   AA6 LYS A 158 ? ASP A 160 ? LYS A 158 ASP A 160 5 ? 3  
HELX_P HELX_P7   AA7 GLU A 165 ? ARG A 185 ? GLU A 165 ARG A 185 1 ? 21 
HELX_P HELX_P8   AA8 TRP A 188 ? ARG A 192 ? TRP A 188 ARG A 192 5 ? 5  
HELX_P HELX_P9   AA9 MET A 211 ? GLN A 217 ? MET A 211 GLN A 217 1 ? 7  
HELX_P HELX_P10  AB1 CYS A 225 ? GLY A 235 ? CYS A 225 GLY A 235 1 ? 11 
HELX_P HELX_P11  AB2 GLY A 240 ? MET A 249 ? GLY A 240 MET A 249 1 ? 10 
HELX_P HELX_P12  AB3 ILE A 302 ? ARG A 312 ? ILE A 302 ARG A 312 1 ? 11 
HELX_P HELX_P13  AB4 ASN A 331 ? ASP A 347 ? ASN A 331 ASP A 347 1 ? 17 
HELX_P HELX_P14  AB5 THR A 363 ? LEU A 370 ? THR A 363 LEU A 370 1 ? 8  
HELX_P HELX_P15  AB6 SER A 405 ? CYS A 415 ? SER A 405 CYS A 415 1 ? 11 
HELX_P HELX_P16  AB7 ALA A 433 ? HIS A 452 ? ALA A 433 HIS A 452 1 ? 20 
HELX_P HELX_P17  AB8 CYS A 453 ? ALA A 476 ? CYS A 453 ALA A 476 1 ? 24 
HELX_P HELX_P18  AB9 LYS A 572 ? TRP A 577 ? LYS A 572 TRP A 577 1 ? 6  
HELX_P HELX_P19  AC1 ARG A 582 ? ALA A 598 ? ARG A 582 ALA A 598 1 ? 17 
HELX_P HELX_P20  AC2 SER A 632 ? TYR A 650 ? SER A 632 TYR A 650 1 ? 19 
HELX_P HELX_P21  AC3 SER A 652 ? ASP A 674 ? SER A 652 ASP A 674 1 ? 23 
HELX_P HELX_P22  AC4 ASP A 682 ? CYS A 693 ? ASP A 682 CYS A 693 1 ? 12 
HELX_P HELX_P23  AC5 ASP A 697 ? HIS A 713 ? ASP A 697 HIS A 713 1 ? 17 
HELX_P HELX_P24  AC6 PRO B 5   ? LYS B 11  ? PRO B 5   LYS B 11  5 ? 7  
HELX_P HELX_P25  AC7 ALA B 17  ? THR B 21  ? ALA B 17  THR B 21  5 ? 5  
HELX_P HELX_P26  AC8 GLY B 37  ? HIS B 47  ? GLY B 37  HIS B 47  1 ? 11 
HELX_P HELX_P27  AC9 GLN B 84  ? HIS B 99  ? GLN B 84  HIS B 99  1 ? 16 
HELX_P HELX_P28  AD1 GLY B 101 ? THR B 117 ? GLY B 101 THR B 117 1 ? 17 
HELX_P HELX_P29  AD2 VAL B 119 ? THR B 123 ? VAL B 119 THR B 123 5 ? 5  
HELX_P HELX_P30  AD3 PRO B 138 ? ASN B 153 ? PRO B 138 ASN B 153 1 ? 16 
HELX_P HELX_P31  AD4 ALA B 157 ? GLY B 161 ? ALA B 157 GLY B 161 5 ? 5  
HELX_P HELX_P32  AD5 ARG B 162 ? MET B 174 ? ARG B 162 MET B 174 1 ? 13 
HELX_P HELX_P33  AD6 LYS B 214 ? LEU B 222 ? LYS B 214 LEU B 222 1 ? 9  
HELX_P HELX_P34  AD7 ILE B 248 ? GLU B 264 ? ILE B 248 GLU B 264 1 ? 17 
HELX_P HELX_P35  AD8 GLY B 275 ? MET B 290 ? GLY B 275 MET B 290 1 ? 16 
HELX_P HELX_P36  AD9 TRP B 309 ? GLN B 313 ? TRP B 309 GLN B 313 5 ? 5  
HELX_P HELX_P37  AE1 ASN B 314 ? THR B 326 ? ASN B 314 THR B 326 1 ? 13 
HELX_P HELX_P38  AE2 PRO B 330 ? SER B 338 ? PRO B 330 SER B 338 1 ? 9  
HELX_P HELX_P39  AE3 SER B 338 ? ASN B 346 ? SER B 338 ASN B 346 1 ? 9  
HELX_P HELX_P40  AE4 ALA B 370 ? ALA B 374 ? ALA B 370 ALA B 374 5 ? 5  
HELX_P HELX_P41  AE5 ASN B 382 ? LYS B 391 ? ASN B 382 LYS B 391 1 ? 10 
HELX_P HELX_P42  AE6 PHE B 412 ? LEU B 426 ? PHE B 412 LEU B 426 1 ? 15 
HELX_P HELX_P43  AE7 ASN B 455 ? VAL B 473 ? ASN B 455 VAL B 473 1 ? 19 
HELX_P HELX_P44  AE8 ASN B 518 ? MET B 534 ? ASN B 518 MET B 534 1 ? 17 
HELX_P HELX_P45  AE9 GLY B 540 ? TYR B 559 ? GLY B 540 TYR B 559 1 ? 20 
HELX_P HELX_P46  AF1 ARG B 572 ? THR B 583 ? ARG B 572 THR B 583 1 ? 12 
HELX_P HELX_P47  AF2 SER B 585 ? LEU B 589 ? SER B 585 LEU B 589 5 ? 5  
HELX_P HELX_P48  AF3 LEU B 590 ? GLY B 594 ? LEU B 590 GLY B 594 5 ? 5  
HELX_P HELX_P49  AF4 ASN B 600 ? LEU B 604 ? ASN B 600 LEU B 604 5 ? 5  
HELX_P HELX_P50  AF5 PRO B 607 ? TRP B 613 ? PRO B 607 TRP B 613 1 ? 7  
HELX_P HELX_P51  AF6 ASP B 617 ? CYS B 625 ? ASP B 617 CYS B 625 1 ? 9  
HELX_P HELX_P52  AF7 GLN B 687 ? PHE B 700 ? GLN B 687 PHE B 700 1 ? 14 
HELX_P HELX_P53  AF8 PRO B 701 ? TYR B 705 ? PRO B 701 TYR B 705 5 ? 5  
HELX_P HELX_P54  AF9 SER B 713 ? SER B 732 ? SER B 713 SER B 732 1 ? 20 
HELX_P HELX_P55  AG1 LYS B 736 ? ARG B 754 ? LYS B 736 ARG B 754 1 ? 19 
HELX_P HELX_P56  AG2 GLU C 2   ? MET C 11  ? GLU C 2   MET C 11  1 ? 10 
HELX_P HELX_P57  AG3 GLN C 13  ? THR C 23  ? GLN C 13  THR C 23  1 ? 11 
HELX_P HELX_P58  AG4 HIS C 27  ? LYS C 32  ? HIS C 27  LYS C 32  1 ? 6  
HELX_P HELX_P59  AG5 ASN C 42  ? MET C 53  ? ASN C 42  MET C 53  1 ? 12 
HELX_P HELX_P60  AG6 ASP C 60  ? THR C 64  ? ASP C 60  THR C 64  5 ? 5  
HELX_P HELX_P61  AG7 PRO C 93  ? ASN C 102 ? PRO C 93  ASN C 102 1 ? 10 
HELX_P HELX_P62  AG8 SER C 107 ? TYR C 111 ? SER C 107 TYR C 111 5 ? 5  
HELX_P HELX_P63  AG9 TYR C 115 ? HIS C 127 ? TYR C 115 HIS C 127 1 ? 13 
HELX_P HELX_P64  AH1 SER C 155 ? PHE C 168 ? SER C 155 PHE C 168 1 ? 14 
HELX_P HELX_P65  AH2 PRO C 169 ? VAL C 172 ? PRO C 169 VAL C 172 5 ? 4  
HELX_P HELX_P66  AH3 THR C 184 ? LEU C 193 ? THR C 184 LEU C 193 1 ? 10 
HELX_P HELX_P67  AH4 SER C 199 ? VAL C 212 ? SER C 199 VAL C 212 1 ? 14 
HELX_P HELX_P68  AH5 SER C 225 ? VAL C 231 ? SER C 225 VAL C 231 1 ? 7  
HELX_P HELX_P69  AH6 VAL C 231 ? GLN C 236 ? VAL C 231 GLN C 236 1 ? 6  
HELX_P HELX_P70  AH7 ARG C 251 ? ASP C 254 ? ARG C 251 ASP C 254 5 ? 4  
HELX_P HELX_P71  AH8 VAL C 255 ? SER C 273 ? VAL C 255 SER C 273 1 ? 19 
HELX_P HELX_P72  AH9 ASP C 275 ? THR C 287 ? ASP C 275 THR C 287 1 ? 13 
HELX_P HELX_P73  AI1 MET C 294 ? ASN C 301 ? MET C 294 ASN C 301 1 ? 8  
HELX_P HELX_P74  AI2 GLU C 305 ? MET C 315 ? GLU C 305 MET C 315 1 ? 11 
HELX_P HELX_P75  AI3 ASP C 390 ? GLN C 406 ? ASP C 390 GLN C 406 1 ? 17 
HELX_P HELX_P76  AI4 GLU C 407 ? ALA C 413 ? GLU C 407 ALA C 413 1 ? 7  
HELX_P HELX_P77  AI5 ASN C 429 ? GLN C 439 ? ASN C 429 GLN C 439 1 ? 11 
HELX_P HELX_P78  AI6 ALA C 442 ? GLY C 450 ? ALA C 442 GLY C 450 1 ? 9  
HELX_P HELX_P79  AI7 PRO C 542 ? ASN C 556 ? PRO C 542 ASN C 556 1 ? 15 
HELX_P HELX_P80  AI8 ASN C 556 ? GLN C 566 ? ASN C 556 GLN C 566 1 ? 11 
HELX_P HELX_P81  AI9 ASN C 567 ? ASN C 573 ? ASN C 567 ASN C 573 1 ? 7  
HELX_P HELX_P82  AJ1 PHE C 577 ? SER C 582 ? PHE C 577 SER C 582 1 ? 6  
HELX_P HELX_P83  AJ2 ILE C 588 ? VAL C 606 ? ILE C 588 VAL C 606 1 ? 19 
HELX_P HELX_P84  AJ3 ASP C 611 ? LEU C 619 ? ASP C 611 LEU C 619 1 ? 9  
HELX_P HELX_P85  AJ4 PRO C 620 ? ALA C 622 ? PRO C 620 ALA C 622 5 ? 3  
HELX_P HELX_P86  AJ5 THR C 745 ? ALA C 750 ? THR C 745 ALA C 750 1 ? 6  
HELX_P HELX_P87  AJ6 THR C 751 ? ARG C 753 ? THR C 751 ARG C 753 5 ? 3  
HELX_P HELX_P88  AJ7 GLU D 2   ? PHE D 9   ? GLU D 2   PHE D 9   1 ? 8  
HELX_P HELX_P89  AJ8 ASN D 10  ? LYS D 22  ? ASN D 10  LYS D 22  1 ? 13 
HELX_P HELX_P90  AJ9 GLU D 31  ? ASP D 50  ? GLU D 31  ASP D 50  1 ? 20 
HELX_P HELX_P91  AK1 ASP D 83  ? GLY D 99  ? ASP D 83  GLY D 99  1 ? 17 
HELX_P HELX_P92  AK2 GLU D 126 ? ILE D 138 ? GLU D 126 ILE D 138 1 ? 13 
HELX_P HELX_P93  AK3 LYS D 158 ? ASP D 160 ? LYS D 158 ASP D 160 5 ? 3  
HELX_P HELX_P94  AK4 GLU D 165 ? ARG D 185 ? GLU D 165 ARG D 185 1 ? 21 
HELX_P HELX_P95  AK5 TRP D 188 ? ARG D 192 ? TRP D 188 ARG D 192 5 ? 5  
HELX_P HELX_P96  AK6 MET D 211 ? ASP D 216 ? MET D 211 ASP D 216 1 ? 6  
HELX_P HELX_P97  AK7 CYS D 225 ? GLY D 235 ? CYS D 225 GLY D 235 1 ? 11 
HELX_P HELX_P98  AK8 GLY D 240 ? MET D 249 ? GLY D 240 MET D 249 1 ? 10 
HELX_P HELX_P99  AK9 ILE D 302 ? ARG D 312 ? ILE D 302 ARG D 312 1 ? 11 
HELX_P HELX_P100 AL1 ASN D 331 ? ASP D 347 ? ASN D 331 ASP D 347 1 ? 17 
HELX_P HELX_P101 AL2 THR D 363 ? LEU D 370 ? THR D 363 LEU D 370 1 ? 8  
HELX_P HELX_P102 AL3 SER D 405 ? CYS D 415 ? SER D 405 CYS D 415 1 ? 11 
HELX_P HELX_P103 AL4 ALA D 433 ? HIS D 452 ? ALA D 433 HIS D 452 1 ? 20 
HELX_P HELX_P104 AL5 CYS D 453 ? ALA D 476 ? CYS D 453 ALA D 476 1 ? 24 
HELX_P HELX_P105 AL6 GLU D 533 ? TRP D 537 ? GLU D 533 TRP D 537 5 ? 5  
HELX_P HELX_P106 AL7 LYS D 572 ? GLU D 580 ? LYS D 572 GLU D 580 1 ? 9  
HELX_P HELX_P107 AL8 ARG D 582 ? ALA D 598 ? ARG D 582 ALA D 598 1 ? 17 
HELX_P HELX_P108 AL9 ILE D 633 ? TYR D 650 ? ILE D 633 TYR D 650 1 ? 18 
HELX_P HELX_P109 AM1 SER D 652 ? ASP D 674 ? SER D 652 ASP D 674 1 ? 23 
HELX_P HELX_P110 AM2 ASP D 682 ? CYS D 693 ? ASP D 682 CYS D 693 1 ? 12 
HELX_P HELX_P111 AM3 ASP D 697 ? HIS D 713 ? ASP D 697 HIS D 713 1 ? 17 
HELX_P HELX_P112 AM4 PRO E 5   ? LYS E 11  ? PRO E 5   LYS E 11  5 ? 7  
HELX_P HELX_P113 AM5 PRO E 13  ? THR E 21  ? PRO E 13  THR E 21  5 ? 9  
HELX_P HELX_P114 AM6 GLY E 37  ? HIS E 47  ? GLY E 37  HIS E 47  1 ? 11 
HELX_P HELX_P115 AM7 GLN E 84  ? HIS E 99  ? GLN E 84  HIS E 99  1 ? 16 
HELX_P HELX_P116 AM8 GLY E 101 ? THR E 117 ? GLY E 101 THR E 117 1 ? 17 
HELX_P HELX_P117 AM9 VAL E 119 ? GLN E 124 ? VAL E 119 GLN E 124 1 ? 6  
HELX_P HELX_P118 AN1 PRO E 138 ? ASN E 153 ? PRO E 138 ASN E 153 1 ? 16 
HELX_P HELX_P119 AN2 ALA E 157 ? GLY E 161 ? ALA E 157 GLY E 161 5 ? 5  
HELX_P HELX_P120 AN3 ARG E 162 ? MET E 174 ? ARG E 162 MET E 174 1 ? 13 
HELX_P HELX_P121 AN4 LYS E 214 ? LEU E 222 ? LYS E 214 LEU E 222 1 ? 9  
HELX_P HELX_P122 AN5 ILE E 248 ? GLU E 264 ? ILE E 248 GLU E 264 1 ? 17 
HELX_P HELX_P123 AN6 GLY E 275 ? MET E 290 ? GLY E 275 MET E 290 1 ? 16 
HELX_P HELX_P124 AN7 TRP E 309 ? GLN E 313 ? TRP E 309 GLN E 313 5 ? 5  
HELX_P HELX_P125 AN8 ASN E 314 ? THR E 326 ? ASN E 314 THR E 326 1 ? 13 
HELX_P HELX_P126 AN9 PRO E 330 ? SER E 338 ? PRO E 330 SER E 338 1 ? 9  
HELX_P HELX_P127 AO1 SER E 338 ? ASN E 346 ? SER E 338 ASN E 346 1 ? 9  
HELX_P HELX_P128 AO2 GLU E 371 ? ALA E 374 ? GLU E 371 ALA E 374 5 ? 4  
HELX_P HELX_P129 AO3 ASN E 382 ? LYS E 391 ? ASN E 382 LYS E 391 1 ? 10 
HELX_P HELX_P130 AO4 ILE E 392 ? LEU E 396 ? ILE E 392 LEU E 396 5 ? 5  
HELX_P HELX_P131 AO5 PHE E 412 ? LEU E 426 ? PHE E 412 LEU E 426 1 ? 15 
HELX_P HELX_P132 AO6 ASN E 455 ? VAL E 473 ? ASN E 455 VAL E 473 1 ? 19 
HELX_P HELX_P133 AO7 GLU E 519 ? MET E 534 ? GLU E 519 MET E 534 1 ? 16 
HELX_P HELX_P134 AO8 GLY E 540 ? TYR E 559 ? GLY E 540 TYR E 559 1 ? 20 
HELX_P HELX_P135 AO9 ARG E 572 ? THR E 583 ? ARG E 572 THR E 583 1 ? 12 
HELX_P HELX_P136 AP1 SER E 585 ? LEU E 589 ? SER E 585 LEU E 589 5 ? 5  
HELX_P HELX_P137 AP2 LEU E 590 ? GLY E 594 ? LEU E 590 GLY E 594 5 ? 5  
HELX_P HELX_P138 AP3 ASN E 600 ? LEU E 604 ? ASN E 600 LEU E 604 5 ? 5  
HELX_P HELX_P139 AP4 PRO E 607 ? TRP E 613 ? PRO E 607 TRP E 613 1 ? 7  
HELX_P HELX_P140 AP5 ASP E 617 ? CYS E 625 ? ASP E 617 CYS E 625 1 ? 9  
HELX_P HELX_P141 AP6 GLN E 687 ? PHE E 700 ? GLN E 687 PHE E 700 1 ? 14 
HELX_P HELX_P142 AP7 PRO E 701 ? TYR E 705 ? PRO E 701 TYR E 705 5 ? 5  
HELX_P HELX_P143 AP8 SER E 713 ? SER E 732 ? SER E 713 SER E 732 1 ? 20 
HELX_P HELX_P144 AP9 LYS E 736 ? ARG E 754 ? LYS E 736 ARG E 754 1 ? 19 
HELX_P HELX_P145 AQ1 GLU F 2   ? MET F 11  ? GLU F 2   MET F 11  1 ? 10 
HELX_P HELX_P146 AQ2 GLN F 13  ? THR F 23  ? GLN F 13  THR F 23  1 ? 11 
HELX_P HELX_P147 AQ3 HIS F 27  ? LYS F 32  ? HIS F 27  LYS F 32  1 ? 6  
HELX_P HELX_P148 AQ4 ASN F 42  ? MET F 53  ? ASN F 42  MET F 53  1 ? 12 
HELX_P HELX_P149 AQ5 SER F 92  ? ASN F 102 ? SER F 92  ASN F 102 1 ? 11 
HELX_P HELX_P150 AQ6 TYR F 115 ? HIS F 127 ? TYR F 115 HIS F 127 1 ? 13 
HELX_P HELX_P151 AQ7 SER F 155 ? PHE F 168 ? SER F 155 PHE F 168 1 ? 14 
HELX_P HELX_P152 AQ8 PRO F 169 ? VAL F 172 ? PRO F 169 VAL F 172 5 ? 4  
HELX_P HELX_P153 AQ9 THR F 184 ? LEU F 193 ? THR F 184 LEU F 193 1 ? 10 
HELX_P HELX_P154 AR1 SER F 199 ? VAL F 212 ? SER F 199 VAL F 212 1 ? 14 
HELX_P HELX_P155 AR2 SER F 225 ? VAL F 231 ? SER F 225 VAL F 231 1 ? 7  
HELX_P HELX_P156 AR3 VAL F 231 ? GLN F 236 ? VAL F 231 GLN F 236 1 ? 6  
HELX_P HELX_P157 AR4 VAL F 250 ? ASP F 253 ? VAL F 250 ASP F 253 5 ? 4  
HELX_P HELX_P158 AR5 ASP F 254 ? SER F 273 ? ASP F 254 SER F 273 1 ? 20 
HELX_P HELX_P159 AR6 ASP F 275 ? THR F 287 ? ASP F 275 THR F 287 1 ? 13 
HELX_P HELX_P160 AR7 MET F 294 ? ASN F 301 ? MET F 294 ASN F 301 1 ? 8  
HELX_P HELX_P161 AR8 GLU F 305 ? ALA F 314 ? GLU F 305 ALA F 314 1 ? 10 
HELX_P HELX_P162 AR9 ASP F 390 ? GLN F 406 ? ASP F 390 GLN F 406 1 ? 17 
HELX_P HELX_P163 AS1 GLU F 407 ? ALA F 413 ? GLU F 407 ALA F 413 1 ? 7  
HELX_P HELX_P164 AS2 ASN F 429 ? GLN F 439 ? ASN F 429 GLN F 439 1 ? 11 
HELX_P HELX_P165 AS3 ALA F 442 ? GLY F 450 ? ALA F 442 GLY F 450 1 ? 9  
HELX_P HELX_P166 AS4 GLY F 541 ? ASN F 556 ? GLY F 541 ASN F 556 1 ? 16 
HELX_P HELX_P167 AS5 ASN F 556 ? GLN F 566 ? ASN F 556 GLN F 566 1 ? 11 
HELX_P HELX_P168 AS6 ASN F 567 ? ASN F 573 ? ASN F 567 ASN F 573 1 ? 7  
HELX_P HELX_P169 AS7 PHE F 577 ? SER F 582 ? PHE F 577 SER F 582 1 ? 6  
HELX_P HELX_P170 AS8 ILE F 588 ? VAL F 606 ? ILE F 588 VAL F 606 1 ? 19 
HELX_P HELX_P171 AS9 ASP F 611 ? LEU F 619 ? ASP F 611 LEU F 619 1 ? 9  
HELX_P HELX_P172 AT1 PRO F 620 ? ALA F 622 ? PRO F 620 ALA F 622 5 ? 3  
HELX_P HELX_P173 AT2 ILE F 743 ? THR F 751 ? ILE F 743 THR F 751 1 ? 9  
HELX_P HELX_P174 AT3 GLU G 2   ? CYS G 8   ? GLU G 2   CYS G 8   1 ? 7  
HELX_P HELX_P175 AT4 ASN G 10  ? LYS G 22  ? ASN G 10  LYS G 22  1 ? 13 
HELX_P HELX_P176 AT5 GLU G 31  ? ASP G 50  ? GLU G 31  ASP G 50  1 ? 20 
HELX_P HELX_P177 AT6 ASP G 83  ? GLY G 99  ? ASP G 83  GLY G 99  1 ? 17 
HELX_P HELX_P178 AT7 GLU G 126 ? ILE G 138 ? GLU G 126 ILE G 138 1 ? 13 
HELX_P HELX_P179 AT8 LYS G 158 ? ASP G 160 ? LYS G 158 ASP G 160 5 ? 3  
HELX_P HELX_P180 AT9 GLU G 165 ? ARG G 185 ? GLU G 165 ARG G 185 1 ? 21 
HELX_P HELX_P181 AU1 TRP G 188 ? ARG G 192 ? TRP G 188 ARG G 192 5 ? 5  
HELX_P HELX_P182 AU2 MET G 211 ? ASP G 216 ? MET G 211 ASP G 216 1 ? 6  
HELX_P HELX_P183 AU3 CYS G 225 ? GLY G 235 ? CYS G 225 GLY G 235 1 ? 11 
HELX_P HELX_P184 AU4 GLY G 240 ? MET G 249 ? GLY G 240 MET G 249 1 ? 10 
HELX_P HELX_P185 AU5 ILE G 302 ? ARG G 312 ? ILE G 302 ARG G 312 1 ? 11 
HELX_P HELX_P186 AU6 ASN G 331 ? ASP G 347 ? ASN G 331 ASP G 347 1 ? 17 
HELX_P HELX_P187 AU7 THR G 363 ? LEU G 370 ? THR G 363 LEU G 370 1 ? 8  
HELX_P HELX_P188 AU8 SER G 405 ? CYS G 415 ? SER G 405 CYS G 415 1 ? 11 
HELX_P HELX_P189 AU9 ALA G 433 ? HIS G 452 ? ALA G 433 HIS G 452 1 ? 20 
HELX_P HELX_P190 AV1 CYS G 453 ? ALA G 476 ? CYS G 453 ALA G 476 1 ? 24 
HELX_P HELX_P191 AV2 LYS G 572 ? GLU G 580 ? LYS G 572 GLU G 580 1 ? 9  
HELX_P HELX_P192 AV3 ARG G 582 ? GLU G 599 ? ARG G 582 GLU G 599 1 ? 18 
HELX_P HELX_P193 AV4 SER G 632 ? TYR G 650 ? SER G 632 TYR G 650 1 ? 19 
HELX_P HELX_P194 AV5 SER G 652 ? ASP G 674 ? SER G 652 ASP G 674 1 ? 23 
HELX_P HELX_P195 AV6 ASP G 682 ? CYS G 693 ? ASP G 682 CYS G 693 1 ? 12 
HELX_P HELX_P196 AV7 ASP G 697 ? HIS G 713 ? ASP G 697 HIS G 713 1 ? 17 
HELX_P HELX_P197 AV8 PRO H 5   ? LYS H 11  ? PRO H 5   LYS H 11  5 ? 7  
HELX_P HELX_P198 AV9 ALA H 17  ? THR H 21  ? ALA H 17  THR H 21  5 ? 5  
HELX_P HELX_P199 AW1 GLY H 37  ? HIS H 47  ? GLY H 37  HIS H 47  1 ? 11 
HELX_P HELX_P200 AW2 GLN H 84  ? HIS H 99  ? GLN H 84  HIS H 99  1 ? 16 
HELX_P HELX_P201 AW3 GLY H 101 ? THR H 117 ? GLY H 101 THR H 117 1 ? 17 
HELX_P HELX_P202 AW4 VAL H 119 ? THR H 123 ? VAL H 119 THR H 123 5 ? 5  
HELX_P HELX_P203 AW5 PRO H 138 ? ASN H 153 ? PRO H 138 ASN H 153 1 ? 16 
HELX_P HELX_P204 AW6 ALA H 157 ? GLY H 161 ? ALA H 157 GLY H 161 5 ? 5  
HELX_P HELX_P205 AW7 ARG H 162 ? MET H 174 ? ARG H 162 MET H 174 1 ? 13 
HELX_P HELX_P206 AW8 LYS H 214 ? LEU H 222 ? LYS H 214 LEU H 222 1 ? 9  
HELX_P HELX_P207 AW9 GLN H 247 ? GLU H 264 ? GLN H 247 GLU H 264 1 ? 18 
HELX_P HELX_P208 AX1 GLY H 275 ? MET H 290 ? GLY H 275 MET H 290 1 ? 16 
HELX_P HELX_P209 AX2 TRP H 309 ? GLN H 313 ? TRP H 309 GLN H 313 5 ? 5  
HELX_P HELX_P210 AX3 ASN H 314 ? THR H 326 ? ASN H 314 THR H 326 1 ? 13 
HELX_P HELX_P211 AX4 PRO H 330 ? SER H 338 ? PRO H 330 SER H 338 1 ? 9  
HELX_P HELX_P212 AX5 SER H 338 ? ASN H 346 ? SER H 338 ASN H 346 1 ? 9  
HELX_P HELX_P213 AX6 ALA H 370 ? ALA H 374 ? ALA H 370 ALA H 374 5 ? 5  
HELX_P HELX_P214 AX7 ASN H 382 ? LYS H 391 ? ASN H 382 LYS H 391 1 ? 10 
HELX_P HELX_P215 AX8 ILE H 392 ? LEU H 396 ? ILE H 392 LEU H 396 5 ? 5  
HELX_P HELX_P216 AX9 PHE H 412 ? LEU H 426 ? PHE H 412 LEU H 426 1 ? 15 
HELX_P HELX_P217 AY1 ASN H 455 ? VAL H 473 ? ASN H 455 VAL H 473 1 ? 19 
HELX_P HELX_P218 AY2 ASN H 518 ? MET H 534 ? ASN H 518 MET H 534 1 ? 17 
HELX_P HELX_P219 AY3 GLY H 540 ? TYR H 559 ? GLY H 540 TYR H 559 1 ? 20 
HELX_P HELX_P220 AY4 ARG H 572 ? THR H 583 ? ARG H 572 THR H 583 1 ? 12 
HELX_P HELX_P221 AY5 SER H 585 ? LEU H 589 ? SER H 585 LEU H 589 5 ? 5  
HELX_P HELX_P222 AY6 LEU H 590 ? GLY H 594 ? LEU H 590 GLY H 594 5 ? 5  
HELX_P HELX_P223 AY7 ASN H 600 ? LEU H 604 ? ASN H 600 LEU H 604 5 ? 5  
HELX_P HELX_P224 AY8 PRO H 607 ? TRP H 613 ? PRO H 607 TRP H 613 1 ? 7  
HELX_P HELX_P225 AY9 ASP H 617 ? CYS H 625 ? ASP H 617 CYS H 625 1 ? 9  
HELX_P HELX_P226 AZ1 GLN H 687 ? PHE H 700 ? GLN H 687 PHE H 700 1 ? 14 
HELX_P HELX_P227 AZ2 PRO H 701 ? TYR H 705 ? PRO H 701 TYR H 705 5 ? 5  
HELX_P HELX_P228 AZ3 SER H 713 ? SER H 732 ? SER H 713 SER H 732 1 ? 20 
HELX_P HELX_P229 AZ4 LYS H 736 ? ARG H 754 ? LYS H 736 ARG H 754 1 ? 19 
HELX_P HELX_P230 AZ5 GLU I 2   ? MET I 11  ? GLU I 2   MET I 11  1 ? 10 
HELX_P HELX_P231 AZ6 GLN I 13  ? THR I 23  ? GLN I 13  THR I 23  1 ? 11 
HELX_P HELX_P232 AZ7 THR I 24  ? ASP I 26  ? THR I 24  ASP I 26  5 ? 3  
HELX_P HELX_P233 AZ8 HIS I 27  ? LYS I 32  ? HIS I 27  LYS I 32  1 ? 6  
HELX_P HELX_P234 AZ9 ASN I 42  ? MET I 53  ? ASN I 42  MET I 53  1 ? 12 
HELX_P HELX_P235 BA1 ASP I 60  ? THR I 64  ? ASP I 60  THR I 64  5 ? 5  
HELX_P HELX_P236 BA2 SER I 92  ? ASN I 102 ? SER I 92  ASN I 102 1 ? 11 
HELX_P HELX_P237 BA3 TYR I 115 ? HIS I 127 ? TYR I 115 HIS I 127 1 ? 13 
HELX_P HELX_P238 BA4 SER I 155 ? PHE I 168 ? SER I 155 PHE I 168 1 ? 14 
HELX_P HELX_P239 BA5 PRO I 169 ? VAL I 172 ? PRO I 169 VAL I 172 5 ? 4  
HELX_P HELX_P240 BA6 LEU I 183 ? LEU I 193 ? LEU I 183 LEU I 193 1 ? 11 
HELX_P HELX_P241 BA7 SER I 199 ? VAL I 212 ? SER I 199 VAL I 212 1 ? 14 
HELX_P HELX_P242 BA8 SER I 225 ? VAL I 231 ? SER I 225 VAL I 231 1 ? 7  
HELX_P HELX_P243 BA9 VAL I 231 ? GLN I 236 ? VAL I 231 GLN I 236 1 ? 6  
HELX_P HELX_P244 BB1 VAL I 255 ? SER I 273 ? VAL I 255 SER I 273 1 ? 19 
HELX_P HELX_P245 BB2 ASP I 275 ? THR I 287 ? ASP I 275 THR I 287 1 ? 13 
HELX_P HELX_P246 BB3 MET I 294 ? GLN I 300 ? MET I 294 GLN I 300 1 ? 7  
HELX_P HELX_P247 BB4 GLU I 305 ? ALA I 314 ? GLU I 305 ALA I 314 1 ? 10 
HELX_P HELX_P248 BB5 ASP I 390 ? GLN I 406 ? ASP I 390 GLN I 406 1 ? 17 
HELX_P HELX_P249 BB6 GLU I 407 ? ALA I 413 ? GLU I 407 ALA I 413 1 ? 7  
HELX_P HELX_P250 BB7 ASN I 429 ? GLN I 439 ? ASN I 429 GLN I 439 1 ? 11 
HELX_P HELX_P251 BB8 ALA I 442 ? GLY I 450 ? ALA I 442 GLY I 450 1 ? 9  
HELX_P HELX_P252 BB9 GLY I 541 ? ASN I 556 ? GLY I 541 ASN I 556 1 ? 16 
HELX_P HELX_P253 BC1 ASN I 556 ? GLN I 566 ? ASN I 556 GLN I 566 1 ? 11 
HELX_P HELX_P254 BC2 ASN I 567 ? ASN I 573 ? ASN I 567 ASN I 573 1 ? 7  
HELX_P HELX_P255 BC3 PHE I 577 ? SER I 582 ? PHE I 577 SER I 582 1 ? 6  
HELX_P HELX_P256 BC4 ILE I 588 ? VAL I 606 ? ILE I 588 VAL I 606 1 ? 19 
HELX_P HELX_P257 BC5 ASP I 611 ? LEU I 619 ? ASP I 611 LEU I 619 1 ? 9  
HELX_P HELX_P258 BC6 PRO I 620 ? ALA I 622 ? PRO I 620 ALA I 622 5 ? 3  
HELX_P HELX_P259 BC7 LEU I 744 ? ILE I 754 ? LEU I 744 ILE I 754 1 ? 11 
HELX_P HELX_P260 BC8 GLU J 2   ? PHE J 9   ? GLU J 2   PHE J 9   1 ? 8  
HELX_P HELX_P261 BC9 ASN J 10  ? LYS J 22  ? ASN J 10  LYS J 22  1 ? 13 
HELX_P HELX_P262 BD1 GLU J 31  ? ASP J 50  ? GLU J 31  ASP J 50  1 ? 20 
HELX_P HELX_P263 BD2 ASP J 83  ? GLY J 99  ? ASP J 83  GLY J 99  1 ? 17 
HELX_P HELX_P264 BD3 GLU J 126 ? ILE J 138 ? GLU J 126 ILE J 138 1 ? 13 
HELX_P HELX_P265 BD4 LYS J 158 ? ASP J 160 ? LYS J 158 ASP J 160 5 ? 3  
HELX_P HELX_P266 BD5 GLU J 165 ? ARG J 185 ? GLU J 165 ARG J 185 1 ? 21 
HELX_P HELX_P267 BD6 TRP J 188 ? GLN J 193 ? TRP J 188 GLN J 193 5 ? 6  
HELX_P HELX_P268 BD7 MET J 211 ? ASP J 216 ? MET J 211 ASP J 216 1 ? 6  
HELX_P HELX_P269 BD8 CYS J 225 ? GLY J 235 ? CYS J 225 GLY J 235 1 ? 11 
HELX_P HELX_P270 BD9 GLY J 240 ? MET J 249 ? GLY J 240 MET J 249 1 ? 10 
HELX_P HELX_P271 BE1 ILE J 302 ? ARG J 312 ? ILE J 302 ARG J 312 1 ? 11 
HELX_P HELX_P272 BE2 ASN J 331 ? ASP J 347 ? ASN J 331 ASP J 347 1 ? 17 
HELX_P HELX_P273 BE3 THR J 363 ? LEU J 370 ? THR J 363 LEU J 370 1 ? 8  
HELX_P HELX_P274 BE4 SER J 405 ? CYS J 415 ? SER J 405 CYS J 415 1 ? 11 
HELX_P HELX_P275 BE5 ALA J 433 ? HIS J 452 ? ALA J 433 HIS J 452 1 ? 20 
HELX_P HELX_P276 BE6 CYS J 453 ? ALA J 476 ? CYS J 453 ALA J 476 1 ? 24 
HELX_P HELX_P277 BE7 LYS J 572 ? TRP J 577 ? LYS J 572 TRP J 577 1 ? 6  
HELX_P HELX_P278 BE8 ARG J 582 ? ALA J 598 ? ARG J 582 ALA J 598 1 ? 17 
HELX_P HELX_P279 BE9 SER J 632 ? TYR J 650 ? SER J 632 TYR J 650 1 ? 19 
HELX_P HELX_P280 BF1 SER J 652 ? ASP J 674 ? SER J 652 ASP J 674 1 ? 23 
HELX_P HELX_P281 BF2 ASP J 682 ? CYS J 693 ? ASP J 682 CYS J 693 1 ? 12 
HELX_P HELX_P282 BF3 ASP J 697 ? HIS J 713 ? ASP J 697 HIS J 713 1 ? 17 
HELX_P HELX_P283 BF4 PRO K 5   ? LYS K 11  ? PRO K 5   LYS K 11  5 ? 7  
HELX_P HELX_P284 BF5 ALA K 17  ? THR K 21  ? ALA K 17  THR K 21  5 ? 5  
HELX_P HELX_P285 BF6 GLY K 37  ? TYR K 49  ? GLY K 37  TYR K 49  1 ? 13 
HELX_P HELX_P286 BF7 GLN K 84  ? HIS K 99  ? GLN K 84  HIS K 99  1 ? 16 
HELX_P HELX_P287 BF8 GLY K 101 ? THR K 117 ? GLY K 101 THR K 117 1 ? 17 
HELX_P HELX_P288 BF9 VAL K 119 ? THR K 123 ? VAL K 119 THR K 123 5 ? 5  
HELX_P HELX_P289 BG1 PRO K 138 ? ASN K 153 ? PRO K 138 ASN K 153 1 ? 16 
HELX_P HELX_P290 BG2 ALA K 157 ? GLY K 161 ? ALA K 157 GLY K 161 5 ? 5  
HELX_P HELX_P291 BG3 ARG K 162 ? MET K 174 ? ARG K 162 MET K 174 1 ? 13 
HELX_P HELX_P292 BG4 ASN K 213 ? LEU K 222 ? ASN K 213 LEU K 222 1 ? 10 
HELX_P HELX_P293 BG5 ILE K 248 ? GLU K 264 ? ILE K 248 GLU K 264 1 ? 17 
HELX_P HELX_P294 BG6 GLY K 275 ? MET K 290 ? GLY K 275 MET K 290 1 ? 16 
HELX_P HELX_P295 BG7 TRP K 309 ? GLN K 313 ? TRP K 309 GLN K 313 5 ? 5  
HELX_P HELX_P296 BG8 ASN K 314 ? THR K 326 ? ASN K 314 THR K 326 1 ? 13 
HELX_P HELX_P297 BG9 PRO K 330 ? SER K 338 ? PRO K 330 SER K 338 1 ? 9  
HELX_P HELX_P298 BH1 SER K 338 ? ASN K 346 ? SER K 338 ASN K 346 1 ? 9  
HELX_P HELX_P299 BH2 ALA K 370 ? ALA K 374 ? ALA K 370 ALA K 374 5 ? 5  
HELX_P HELX_P300 BH3 ASN K 382 ? LYS K 391 ? ASN K 382 LYS K 391 1 ? 10 
HELX_P HELX_P301 BH4 ILE K 392 ? LEU K 396 ? ILE K 392 LEU K 396 5 ? 5  
HELX_P HELX_P302 BH5 PHE K 412 ? LEU K 426 ? PHE K 412 LEU K 426 1 ? 15 
HELX_P HELX_P303 BH6 ASN K 455 ? VAL K 473 ? ASN K 455 VAL K 473 1 ? 19 
HELX_P HELX_P304 BH7 ASN K 518 ? MET K 534 ? ASN K 518 MET K 534 1 ? 17 
HELX_P HELX_P305 BH8 GLY K 540 ? TYR K 559 ? GLY K 540 TYR K 559 1 ? 20 
HELX_P HELX_P306 BH9 ARG K 572 ? THR K 583 ? ARG K 572 THR K 583 1 ? 12 
HELX_P HELX_P307 BI1 SER K 585 ? LEU K 589 ? SER K 585 LEU K 589 5 ? 5  
HELX_P HELX_P308 BI2 LEU K 590 ? GLY K 594 ? LEU K 590 GLY K 594 5 ? 5  
HELX_P HELX_P309 BI3 ASN K 600 ? LEU K 604 ? ASN K 600 LEU K 604 5 ? 5  
HELX_P HELX_P310 BI4 PRO K 607 ? LYS K 612 ? PRO K 607 LYS K 612 1 ? 6  
HELX_P HELX_P311 BI5 ASP K 617 ? CYS K 625 ? ASP K 617 CYS K 625 1 ? 9  
HELX_P HELX_P312 BI6 GLN K 687 ? PHE K 700 ? GLN K 687 PHE K 700 1 ? 14 
HELX_P HELX_P313 BI7 PRO K 701 ? TYR K 705 ? PRO K 701 TYR K 705 5 ? 5  
HELX_P HELX_P314 BI8 SER K 713 ? SER K 732 ? SER K 713 SER K 732 1 ? 20 
HELX_P HELX_P315 BI9 LYS K 736 ? ARG K 754 ? LYS K 736 ARG K 754 1 ? 19 
HELX_P HELX_P316 BJ1 GLU L 2   ? MET L 11  ? GLU L 2   MET L 11  1 ? 10 
HELX_P HELX_P317 BJ2 GLN L 13  ? THR L 23  ? GLN L 13  THR L 23  1 ? 11 
HELX_P HELX_P318 BJ3 THR L 24  ? ASP L 26  ? THR L 24  ASP L 26  5 ? 3  
HELX_P HELX_P319 BJ4 HIS L 27  ? LYS L 32  ? HIS L 27  LYS L 32  1 ? 6  
HELX_P HELX_P320 BJ5 ASN L 42  ? MET L 53  ? ASN L 42  MET L 53  1 ? 12 
HELX_P HELX_P321 BJ6 SER L 92  ? ASN L 102 ? SER L 92  ASN L 102 1 ? 11 
HELX_P HELX_P322 BJ7 TYR L 115 ? HIS L 127 ? TYR L 115 HIS L 127 1 ? 13 
HELX_P HELX_P323 BJ8 SER L 155 ? PHE L 168 ? SER L 155 PHE L 168 1 ? 14 
HELX_P HELX_P324 BJ9 PRO L 169 ? VAL L 172 ? PRO L 169 VAL L 172 5 ? 4  
HELX_P HELX_P325 BK1 LEU L 183 ? LEU L 193 ? LEU L 183 LEU L 193 1 ? 11 
HELX_P HELX_P326 BK2 SER L 199 ? VAL L 212 ? SER L 199 VAL L 212 1 ? 14 
HELX_P HELX_P327 BK3 SER L 225 ? VAL L 231 ? SER L 225 VAL L 231 1 ? 7  
HELX_P HELX_P328 BK4 VAL L 231 ? GLN L 236 ? VAL L 231 GLN L 236 1 ? 6  
HELX_P HELX_P329 BK5 VAL L 255 ? SER L 273 ? VAL L 255 SER L 273 1 ? 19 
HELX_P HELX_P330 BK6 ASP L 275 ? THR L 287 ? ASP L 275 THR L 287 1 ? 13 
HELX_P HELX_P331 BK7 MET L 294 ? GLN L 300 ? MET L 294 GLN L 300 1 ? 7  
HELX_P HELX_P332 BK8 GLU L 305 ? MET L 315 ? GLU L 305 MET L 315 1 ? 11 
HELX_P HELX_P333 BK9 ASP L 390 ? GLN L 406 ? ASP L 390 GLN L 406 1 ? 17 
HELX_P HELX_P334 BL1 GLU L 407 ? ALA L 413 ? GLU L 407 ALA L 413 1 ? 7  
HELX_P HELX_P335 BL2 MET L 431 ? GLN L 439 ? MET L 431 GLN L 439 1 ? 9  
HELX_P HELX_P336 BL3 ALA L 442 ? GLY L 450 ? ALA L 442 GLY L 450 1 ? 9  
HELX_P HELX_P337 BL4 SER L 533 ? TRP L 537 ? SER L 533 TRP L 537 5 ? 5  
HELX_P HELX_P338 BL5 GLY L 541 ? ASN L 556 ? GLY L 541 ASN L 556 1 ? 16 
HELX_P HELX_P339 BL6 ASN L 556 ? GLN L 566 ? ASN L 556 GLN L 566 1 ? 11 
HELX_P HELX_P340 BL7 ASN L 567 ? ASN L 573 ? ASN L 567 ASN L 573 1 ? 7  
HELX_P HELX_P341 BL8 LYS L 574 ? GLU L 576 ? LYS L 574 GLU L 576 5 ? 3  
HELX_P HELX_P342 BL9 PHE L 577 ? SER L 582 ? PHE L 577 SER L 582 1 ? 6  
HELX_P HELX_P343 BM1 ILE L 588 ? VAL L 606 ? ILE L 588 VAL L 606 1 ? 19 
HELX_P HELX_P344 BM2 ASP L 611 ? LEU L 619 ? ASP L 611 LEU L 619 1 ? 9  
HELX_P HELX_P345 BM3 PRO L 620 ? ALA L 622 ? PRO L 620 ALA L 622 5 ? 3  
HELX_P HELX_P346 BM4 THR L 745 ? ILE L 754 ? THR L 745 ILE L 754 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 7 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 4 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 3 ? 
AB8 ? 8 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 3 ? 
AC5 ? 3 ? 
AC6 ? 2 ? 
AC7 ? 5 ? 
AC8 ? 2 ? 
AC9 ? 7 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 3 ? 
AD5 ? 4 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 3 ? 
AE1 ? 7 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 3 ? 
AE8 ? 2 ? 
AE9 ? 5 ? 
AF1 ? 2 ? 
AF2 ? 7 ? 
AF3 ? 3 ? 
AF4 ? 2 ? 
AF5 ? 2 ? 
AF6 ? 2 ? 
AF7 ? 2 ? 
AF8 ? 4 ? 
AF9 ? 2 ? 
AG1 ? 3 ? 
AG2 ? 2 ? 
AG3 ? 2 ? 
AG4 ? 3 ? 
AG5 ? 7 ? 
AG6 ? 2 ? 
AG7 ? 2 ? 
AG8 ? 3 ? 
AG9 ? 2 ? 
AH1 ? 3 ? 
AH2 ? 3 ? 
AH3 ? 2 ? 
AH4 ? 5 ? 
AH5 ? 2 ? 
AH6 ? 7 ? 
AH7 ? 3 ? 
AH8 ? 2 ? 
AH9 ? 2 ? 
AI1 ? 2 ? 
AI2 ? 4 ? 
AI3 ? 2 ? 
AI4 ? 3 ? 
AI5 ? 2 ? 
AI6 ? 2 ? 
AI7 ? 3 ? 
AI8 ? 7 ? 
AI9 ? 2 ? 
AJ1 ? 2 ? 
AJ2 ? 2 ? 
AJ3 ? 2 ? 
AJ4 ? 3 ? 
AJ5 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA4 6 7 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? parallel      
AB8 6 7 ? anti-parallel 
AB8 7 8 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? parallel      
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AC9 5 6 ? anti-parallel 
AC9 6 7 ? anti-parallel 
AD1 1 2 ? parallel      
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? parallel      
AE1 5 6 ? anti-parallel 
AE1 6 7 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? parallel      
AE9 4 5 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? anti-parallel 
AF2 6 7 ? anti-parallel 
AF3 1 2 ? parallel      
AF3 2 3 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? parallel      
AG5 5 6 ? anti-parallel 
AG5 6 7 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH1 2 3 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? parallel      
AH4 4 5 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH6 4 5 ? anti-parallel 
AH6 5 6 ? anti-parallel 
AH6 6 7 ? anti-parallel 
AH7 1 2 ? parallel      
AH7 2 3 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH9 1 2 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI6 1 2 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI8 3 4 ? anti-parallel 
AI8 4 5 ? parallel      
AI8 5 6 ? anti-parallel 
AI8 6 7 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ5 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 HIS A 52  ? ILE A 54  ? HIS A 52  ILE A 54  
AA1 2 SER A 60  ? VAL A 62  ? SER A 60  VAL A 62  
AA2 1 PHE A 76  ? ILE A 78  ? PHE A 76  ILE A 78  
AA2 2 LEU A 109 ? ASP A 111 ? LEU A 109 ASP A 111 
AA2 3 PHE A 117 ? THR A 123 ? PHE A 117 THR A 123 
AA2 4 THR A 143 ? SER A 149 ? THR A 143 SER A 149 
AA2 5 GLU A 154 ? ALA A 156 ? GLU A 154 ALA A 156 
AA3 1 GLU A 258 ? PRO A 259 ? GLU A 258 PRO A 259 
AA3 2 GLY A 679 ? THR A 680 ? GLY A 679 THR A 680 
AA4 1 TRP A 317 ? ILE A 322 ? TRP A 317 ILE A 322 
AA4 2 CYS A 541 ? ASP A 547 ? CYS A 541 ASP A 547 
AA4 3 PRO A 560 ? SER A 571 ? PRO A 560 SER A 571 
AA4 4 VAL A 517 ? SER A 526 ? VAL A 517 SER A 526 
AA4 5 ARG A 496 ? LYS A 506 ? ARG A 496 LYS A 506 
AA4 6 PHE A 480 ? ARG A 490 ? PHE A 480 ARG A 490 
AA4 7 ASN A 359 ? MET A 360 ? ASN A 359 MET A 360 
AA5 1 GLU A 377 ? VAL A 379 ? GLU A 377 VAL A 379 
AA5 2 LEU B 364 ? ILE B 368 ? LEU B 364 ILE B 368 
AA5 3 TYR B 355 ? GLU B 358 ? TYR B 355 GLU B 358 
AA6 1 TRP A 619 ? GLY A 622 ? TRP A 619 GLY A 622 
AA6 2 GLU A 629 ? GLY A 631 ? GLU A 629 GLY A 631 
AA7 1 TRP B 55  ? THR B 57  ? TRP B 55  THR B 57  
AA7 2 PRO B 64  ? LEU B 66  ? PRO B 64  LEU B 66  
AA8 1 THR B 128 ? ASP B 130 ? THR B 128 ASP B 130 
AA8 2 ARG B 135 ? GLN B 137 ? ARG B 135 GLN B 137 
AA9 1 GLU B 178 ? ILE B 181 ? GLU B 178 ILE B 181 
AA9 2 GLN B 210 ? ASN B 213 ? GLN B 210 ASN B 213 
AB1 1 THR B 223 ? LEU B 224 ? THR B 223 LEU B 224 
AB1 2 MET B 348 ? ARG B 350 ? MET B 348 ARG B 350 
AB1 3 THR B 400 ? SER B 402 ? THR B 400 SER B 402 
AB2 1 TRP B 437 ? GLN B 442 ? TRP B 437 GLN B 442 
AB2 2 PHE B 447 ? ALA B 453 ? PHE B 447 ALA B 453 
AB2 3 LEU B 298 ? THR B 303 ? LEU B 298 THR B 303 
AB2 4 TYR B 483 ? ARG B 486 ? TYR B 483 ARG B 486 
AB3 1 THR B 489 ? PHE B 492 ? THR B 489 PHE B 492 
AB3 2 PHE B 495 ? ARG B 498 ? PHE B 495 ARG B 498 
AB3 3 PHE B 501 ? VAL B 502 ? PHE B 501 VAL B 502 
AB4 1 ILE C 57  ? THR C 58  ? ILE C 57  THR C 58  
AB4 2 MET C 90  ? VAL C 91  ? MET C 90  VAL C 91  
AB5 1 THR C 129 ? VAL C 133 ? THR C 129 VAL C 133 
AB5 2 GLN C 242 ? THR C 245 ? GLN C 242 THR C 245 
AB6 1 ILE C 141 ? ASP C 146 ? ILE C 141 ASP C 146 
AB6 2 THR C 215 ? VAL C 220 ? THR C 215 VAL C 220 
AB7 1 THR C 292 ? ARG C 293 ? THR C 292 ARG C 293 
AB7 2 GLN C 288 ? ILE C 289 ? GLN C 288 ILE C 289 
AB7 3 ILE C 529 ? THR C 530 ? ILE C 529 THR C 530 
AB8 1 PHE C 323 ? PHE C 325 ? PHE C 323 PHE C 325 
AB8 2 PHE C 328 ? SER C 334 ? PHE C 328 SER C 334 
AB8 3 GLU C 361 ? VAL C 366 ? GLU C 361 VAL C 366 
AB8 4 ALA C 370 ? ALA C 377 ? ALA C 370 ALA C 377 
AB8 5 ARG C 380 ? GLY C 388 ? ARG C 380 GLY C 388 
AB8 6 ILE C 478 ? SER C 481 ? ILE C 478 SER C 481 
AB8 7 MET C 460 ? VAL C 463 ? MET C 460 VAL C 463 
AB8 8 PRO C 469 ? SER C 470 ? PRO C 469 SER C 470 
AB9 1 GLU C 341 ? LEU C 345 ? GLU C 341 LEU C 345 
AB9 2 THR C 351 ? ARG C 355 ? THR C 351 ARG C 355 
AC1 1 ILE C 451 ? HIS C 453 ? ILE C 451 HIS C 453 
AC1 2 MET C 473 ? MET C 475 ? MET C 473 MET C 475 
AC2 1 SER C 497 ? ILE C 498 ? SER C 497 ILE C 498 
AC2 2 VAL C 504 ? ARG C 505 ? VAL C 504 ARG C 505 
AC2 3 VAL C 511 ? LEU C 513 ? VAL C 511 LEU C 513 
AC3 1 LEU C 636 ? VAL C 640 ? LEU C 636 VAL C 640 
AC3 2 SER C 643 ? ILE C 647 ? SER C 643 ILE C 647 
AC4 1 ASN C 657 ? TYR C 658 ? ASN C 657 TYR C 658 
AC4 2 ARG C 664 ? ILE C 667 ? ARG C 664 ILE C 667 
AC4 3 LYS C 670 ? THR C 674 ? LYS C 670 THR C 674 
AC5 1 LEU C 695 ? LYS C 699 ? LEU C 695 LYS C 699 
AC5 2 VAL C 731 ? MET C 735 ? VAL C 731 MET C 735 
AC5 3 ALA C 722 ? LEU C 725 ? ALA C 722 LEU C 725 
AC6 1 HIS D 52  ? ILE D 54  ? HIS D 52  ILE D 54  
AC6 2 SER D 60  ? VAL D 62  ? SER D 60  VAL D 62  
AC7 1 PHE D 76  ? ILE D 78  ? PHE D 76  ILE D 78  
AC7 2 LEU D 109 ? ASP D 111 ? LEU D 109 ASP D 111 
AC7 3 PHE D 117 ? THR D 123 ? PHE D 117 THR D 123 
AC7 4 HIS D 144 ? SER D 149 ? HIS D 144 SER D 149 
AC7 5 GLU D 154 ? ALA D 156 ? GLU D 154 ALA D 156 
AC8 1 GLU D 258 ? PRO D 259 ? GLU D 258 PRO D 259 
AC8 2 GLY D 679 ? THR D 680 ? GLY D 679 THR D 680 
AC9 1 TRP D 317 ? ILE D 322 ? TRP D 317 ILE D 322 
AC9 2 TYR D 540 ? ASP D 547 ? TYR D 540 ASP D 547 
AC9 3 PRO D 560 ? SER D 571 ? PRO D 560 SER D 571 
AC9 4 VAL D 517 ? SER D 526 ? VAL D 517 SER D 526 
AC9 5 ARG D 496 ? LYS D 506 ? ARG D 496 LYS D 506 
AC9 6 PHE D 480 ? ARG D 490 ? PHE D 480 ARG D 490 
AC9 7 ASN D 359 ? MET D 360 ? ASN D 359 MET D 360 
AD1 1 GLU D 377 ? LYS D 378 ? GLU D 377 LYS D 378 
AD1 2 LEU E 364 ? PRO E 369 ? LEU E 364 PRO E 369 
AD1 3 GLY E 354 ? SER E 359 ? GLY E 354 SER E 359 
AD2 1 TRP E 55  ? THR E 57  ? TRP E 55  THR E 57  
AD2 2 PRO E 64  ? LEU E 66  ? PRO E 64  LEU E 66  
AD3 1 THR E 128 ? ASP E 130 ? THR E 128 ASP E 130 
AD3 2 ARG E 135 ? GLN E 137 ? ARG E 135 GLN E 137 
AD4 1 THR E 223 ? LEU E 224 ? THR E 223 LEU E 224 
AD4 2 MET E 348 ? ALA E 349 ? MET E 348 ALA E 349 
AD4 3 ALA E 401 ? SER E 402 ? ALA E 401 SER E 402 
AD5 1 TRP E 437 ? GLN E 442 ? TRP E 437 GLN E 442 
AD5 2 PHE E 447 ? ALA E 453 ? PHE E 447 ALA E 453 
AD5 3 LEU E 298 ? GLY E 304 ? LEU E 298 GLY E 304 
AD5 4 TYR E 483 ? ARG E 486 ? TYR E 483 ARG E 486 
AD6 1 THR E 489 ? PHE E 492 ? THR E 489 PHE E 492 
AD6 2 PHE E 495 ? ARG E 498 ? PHE E 495 ARG E 498 
AD7 1 ILE F 57  ? THR F 58  ? ILE F 57  THR F 58  
AD7 2 MET F 90  ? VAL F 91  ? MET F 90  VAL F 91  
AD8 1 ILE F 141 ? ASP F 146 ? ILE F 141 ASP F 146 
AD8 2 THR F 215 ? VAL F 220 ? THR F 215 VAL F 220 
AD9 1 THR F 292 ? ARG F 293 ? THR F 292 ARG F 293 
AD9 2 GLN F 288 ? ILE F 289 ? GLN F 288 ILE F 289 
AD9 3 ILE F 529 ? THR F 530 ? ILE F 529 THR F 530 
AE1 1 THR F 329 ? SER F 334 ? THR F 329 SER F 334 
AE1 2 GLU F 361 ? VAL F 366 ? GLU F 361 VAL F 366 
AE1 3 ALA F 370 ? ALA F 377 ? ALA F 370 ALA F 377 
AE1 4 ARG F 380 ? GLY F 388 ? ARG F 380 GLY F 388 
AE1 5 ARG F 479 ? SER F 481 ? ARG F 479 SER F 481 
AE1 6 MET F 460 ? VAL F 463 ? MET F 460 VAL F 463 
AE1 7 PRO F 469 ? SER F 470 ? PRO F 469 SER F 470 
AE2 1 GLU F 341 ? LEU F 345 ? GLU F 341 LEU F 345 
AE2 2 THR F 351 ? ARG F 355 ? THR F 351 ARG F 355 
AE3 1 ILE F 451 ? HIS F 453 ? ILE F 451 HIS F 453 
AE3 2 MET F 473 ? MET F 475 ? MET F 473 MET F 475 
AE4 1 SER F 497 ? ILE F 498 ? SER F 497 ILE F 498 
AE4 2 VAL F 504 ? ARG F 505 ? VAL F 504 ARG F 505 
AE4 3 VAL F 511 ? LEU F 513 ? VAL F 511 LEU F 513 
AE5 1 LEU F 636 ? VAL F 640 ? LEU F 636 VAL F 640 
AE5 2 SER F 643 ? ILE F 647 ? SER F 643 ILE F 647 
AE6 1 ASN F 657 ? TYR F 658 ? ASN F 657 TYR F 658 
AE6 2 ARG F 664 ? ILE F 667 ? ARG F 664 ILE F 667 
AE6 3 LYS F 670 ? THR F 674 ? LYS F 670 THR F 674 
AE7 1 LEU F 695 ? LYS F 699 ? LEU F 695 LYS F 699 
AE7 2 VAL F 731 ? MET F 735 ? VAL F 731 MET F 735 
AE7 3 ALA F 722 ? LEU F 725 ? ALA F 722 LEU F 725 
AE8 1 HIS G 52  ? ILE G 54  ? HIS G 52  ILE G 54  
AE8 2 SER G 60  ? VAL G 62  ? SER G 60  VAL G 62  
AE9 1 PHE G 76  ? ILE G 78  ? PHE G 76  ILE G 78  
AE9 2 LEU G 109 ? ASP G 111 ? LEU G 109 ASP G 111 
AE9 3 PHE G 117 ? THR G 123 ? PHE G 117 THR G 123 
AE9 4 THR G 143 ? SER G 149 ? THR G 143 SER G 149 
AE9 5 GLU G 154 ? ALA G 156 ? GLU G 154 ALA G 156 
AF1 1 GLU G 258 ? PRO G 259 ? GLU G 258 PRO G 259 
AF1 2 GLY G 679 ? THR G 680 ? GLY G 679 THR G 680 
AF2 1 TYR G 321 ? LYS G 324 ? TYR G 321 LYS G 324 
AF2 2 TYR G 540 ? MET G 548 ? TYR G 540 MET G 548 
AF2 3 ARG G 559 ? SER G 571 ? ARG G 559 SER G 571 
AF2 4 VAL G 517 ? SER G 526 ? VAL G 517 SER G 526 
AF2 5 ARG G 496 ? LYS G 506 ? ARG G 496 LYS G 506 
AF2 6 PHE G 480 ? ARG G 490 ? PHE G 480 ARG G 490 
AF2 7 ASN G 359 ? MET G 360 ? ASN G 359 MET G 360 
AF3 1 GLU G 377 ? LYS G 378 ? GLU G 377 LYS G 378 
AF3 2 LEU H 364 ? ILE H 368 ? LEU H 364 ILE H 368 
AF3 3 TYR H 355 ? GLU H 358 ? TYR H 355 GLU H 358 
AF4 1 TRP G 619 ? GLY G 622 ? TRP G 619 GLY G 622 
AF4 2 GLU G 629 ? GLY G 631 ? GLU G 629 GLY G 631 
AF5 1 THR H 56  ? THR H 57  ? THR H 56  THR H 57  
AF5 2 PRO H 64  ? GLN H 65  ? PRO H 64  GLN H 65  
AF6 1 THR H 128 ? ASP H 130 ? THR H 128 ASP H 130 
AF6 2 ARG H 135 ? GLN H 137 ? ARG H 135 GLN H 137 
AF7 1 GLU H 178 ? MET H 179 ? GLU H 178 MET H 179 
AF7 2 VAL H 212 ? ASN H 213 ? VAL H 212 ASN H 213 
AF8 1 TRP H 437 ? LEU H 441 ? TRP H 437 LEU H 441 
AF8 2 ALA H 448 ? ALA H 453 ? ALA H 448 ALA H 453 
AF8 3 LEU H 298 ? THR H 303 ? LEU H 298 THR H 303 
AF8 4 TYR H 483 ? ARG H 486 ? TYR H 483 ARG H 486 
AF9 1 MET H 348 ? ARG H 350 ? MET H 348 ARG H 350 
AF9 2 THR H 400 ? SER H 402 ? THR H 400 SER H 402 
AG1 1 THR H 489 ? PHE H 492 ? THR H 489 PHE H 492 
AG1 2 PHE H 495 ? ARG H 498 ? PHE H 495 ARG H 498 
AG1 3 PHE H 501 ? VAL H 502 ? PHE H 501 VAL H 502 
AG2 1 ILE I 57  ? THR I 58  ? ILE I 57  THR I 58  
AG2 2 MET I 90  ? VAL I 91  ? MET I 90  VAL I 91  
AG3 1 ILE I 141 ? ASP I 146 ? ILE I 141 ASP I 146 
AG3 2 THR I 215 ? VAL I 220 ? THR I 215 VAL I 220 
AG4 1 THR I 292 ? ARG I 293 ? THR I 292 ARG I 293 
AG4 2 GLN I 288 ? ILE I 289 ? GLN I 288 ILE I 289 
AG4 3 ILE I 529 ? THR I 530 ? ILE I 529 THR I 530 
AG5 1 THR I 329 ? SER I 334 ? THR I 329 SER I 334 
AG5 2 GLU I 361 ? VAL I 366 ? GLU I 361 VAL I 366 
AG5 3 ALA I 370 ? ALA I 377 ? ALA I 370 ALA I 377 
AG5 4 ARG I 380 ? GLY I 388 ? ARG I 380 GLY I 388 
AG5 5 ILE I 478 ? SER I 481 ? ILE I 478 SER I 481 
AG5 6 MET I 460 ? VAL I 463 ? MET I 460 VAL I 463 
AG5 7 PRO I 469 ? SER I 470 ? PRO I 469 SER I 470 
AG6 1 GLU I 341 ? LEU I 345 ? GLU I 341 LEU I 345 
AG6 2 THR I 351 ? ARG I 355 ? THR I 351 ARG I 355 
AG7 1 ILE I 451 ? HIS I 453 ? ILE I 451 HIS I 453 
AG7 2 MET I 473 ? MET I 475 ? MET I 473 MET I 475 
AG8 1 SER I 497 ? ILE I 498 ? SER I 497 ILE I 498 
AG8 2 VAL I 504 ? ARG I 505 ? VAL I 504 ARG I 505 
AG8 3 VAL I 511 ? LEU I 513 ? VAL I 511 LEU I 513 
AG9 1 LEU I 636 ? VAL I 640 ? LEU I 636 VAL I 640 
AG9 2 SER I 643 ? ILE I 647 ? SER I 643 ILE I 647 
AH1 1 ASN I 657 ? TYR I 658 ? ASN I 657 TYR I 658 
AH1 2 ARG I 664 ? ILE I 667 ? ARG I 664 ILE I 667 
AH1 3 LYS I 670 ? THR I 674 ? LYS I 670 THR I 674 
AH2 1 LEU I 695 ? LYS I 699 ? LEU I 695 LYS I 699 
AH2 2 VAL I 731 ? MET I 735 ? VAL I 731 MET I 735 
AH2 3 ALA I 722 ? LEU I 725 ? ALA I 722 LEU I 725 
AH3 1 HIS J 52  ? ILE J 54  ? HIS J 52  ILE J 54  
AH3 2 SER J 60  ? VAL J 62  ? SER J 60  VAL J 62  
AH4 1 PHE J 76  ? ILE J 78  ? PHE J 76  ILE J 78  
AH4 2 LEU J 109 ? ASP J 111 ? LEU J 109 ASP J 111 
AH4 3 PHE J 117 ? THR J 123 ? PHE J 117 THR J 123 
AH4 4 THR J 143 ? SER J 149 ? THR J 143 SER J 149 
AH4 5 GLU J 154 ? ALA J 156 ? GLU J 154 ALA J 156 
AH5 1 GLU J 258 ? PRO J 259 ? GLU J 258 PRO J 259 
AH5 2 GLY J 679 ? THR J 680 ? GLY J 679 THR J 680 
AH6 1 TRP J 317 ? ILE J 322 ? TRP J 317 ILE J 322 
AH6 2 TYR J 540 ? ASP J 547 ? TYR J 540 ASP J 547 
AH6 3 PRO J 560 ? SER J 571 ? PRO J 560 SER J 571 
AH6 4 VAL J 517 ? SER J 526 ? VAL J 517 SER J 526 
AH6 5 ARG J 496 ? LYS J 506 ? ARG J 496 LYS J 506 
AH6 6 PHE J 480 ? ARG J 490 ? PHE J 480 ARG J 490 
AH6 7 ASN J 359 ? MET J 360 ? ASN J 359 MET J 360 
AH7 1 GLU J 377 ? VAL J 379 ? GLU J 377 VAL J 379 
AH7 2 LEU K 364 ? ILE K 368 ? LEU K 364 ILE K 368 
AH7 3 TYR K 355 ? GLU K 358 ? TYR K 355 GLU K 358 
AH8 1 TRP J 619 ? PRO J 620 ? TRP J 619 PRO J 620 
AH8 2 ASP J 630 ? GLY J 631 ? ASP J 630 GLY J 631 
AH9 1 TRP K 55  ? THR K 57  ? TRP K 55  THR K 57  
AH9 2 PRO K 64  ? LEU K 66  ? PRO K 64  LEU K 66  
AI1 1 THR K 128 ? ASP K 130 ? THR K 128 ASP K 130 
AI1 2 ARG K 135 ? GLN K 137 ? ARG K 135 GLN K 137 
AI2 1 TRP K 437 ? LEU K 441 ? TRP K 437 LEU K 441 
AI2 2 PHE K 447 ? ASN K 452 ? PHE K 447 ASN K 452 
AI2 3 SER K 299 ? GLY K 304 ? SER K 299 GLY K 304 
AI2 4 TYR K 483 ? ARG K 486 ? TYR K 483 ARG K 486 
AI3 1 MET K 348 ? ARG K 350 ? MET K 348 ARG K 350 
AI3 2 THR K 400 ? SER K 402 ? THR K 400 SER K 402 
AI4 1 THR K 489 ? PHE K 492 ? THR K 489 PHE K 492 
AI4 2 PHE K 495 ? ARG K 498 ? PHE K 495 ARG K 498 
AI4 3 PHE K 501 ? VAL K 502 ? PHE K 501 VAL K 502 
AI5 1 ILE L 57  ? THR L 58  ? ILE L 57  THR L 58  
AI5 2 MET L 90  ? VAL L 91  ? MET L 90  VAL L 91  
AI6 1 ILE L 141 ? ASP L 146 ? ILE L 141 ASP L 146 
AI6 2 THR L 215 ? VAL L 220 ? THR L 215 VAL L 220 
AI7 1 THR L 292 ? ARG L 293 ? THR L 292 ARG L 293 
AI7 2 GLN L 288 ? ILE L 289 ? GLN L 288 ILE L 289 
AI7 3 ILE L 529 ? THR L 530 ? ILE L 529 THR L 530 
AI8 1 THR L 329 ? SER L 334 ? THR L 329 SER L 334 
AI8 2 GLU L 361 ? VAL L 366 ? GLU L 361 VAL L 366 
AI8 3 ALA L 370 ? ALA L 377 ? ALA L 370 ALA L 377 
AI8 4 ARG L 380 ? GLY L 388 ? ARG L 380 GLY L 388 
AI8 5 ILE L 478 ? SER L 481 ? ILE L 478 SER L 481 
AI8 6 MET L 460 ? VAL L 463 ? MET L 460 VAL L 463 
AI8 7 PRO L 469 ? SER L 470 ? PRO L 469 SER L 470 
AI9 1 GLU L 342 ? LEU L 345 ? GLU L 342 LEU L 345 
AI9 2 THR L 351 ? ILE L 354 ? THR L 351 ILE L 354 
AJ1 1 ILE L 451 ? HIS L 453 ? ILE L 451 HIS L 453 
AJ1 2 MET L 473 ? MET L 475 ? MET L 473 MET L 475 
AJ2 1 VAL L 504 ? ARG L 505 ? VAL L 504 ARG L 505 
AJ2 2 VAL L 511 ? LEU L 513 ? VAL L 511 LEU L 513 
AJ3 1 LEU L 636 ? VAL L 640 ? LEU L 636 VAL L 640 
AJ3 2 SER L 643 ? ILE L 647 ? SER L 643 ILE L 647 
AJ4 1 ASN L 657 ? TYR L 658 ? ASN L 657 TYR L 658 
AJ4 2 ARG L 664 ? ILE L 667 ? ARG L 664 ILE L 667 
AJ4 3 LYS L 670 ? THR L 674 ? LYS L 670 THR L 674 
AJ5 1 LEU L 695 ? LYS L 699 ? LEU L 695 LYS L 699 
AJ5 2 VAL L 731 ? MET L 735 ? VAL L 731 MET L 735 
AJ5 3 ALA L 722 ? LEU L 725 ? ALA L 722 LEU L 725 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 53  ? N PHE A 53  O ILE A 61  ? O ILE A 61  
AA2 1 2 N GLU A 77  ? N GLU A 77  O TYR A 110 ? O TYR A 110 
AA2 2 3 N LEU A 109 ? N LEU A 109 O ILE A 118 ? O ILE A 118 
AA2 3 4 N GLU A 119 ? N GLU A 119 O HIS A 146 ? O HIS A 146 
AA2 4 5 N ILE A 147 ? N ILE A 147 O MET A 155 ? O MET A 155 
AA3 1 2 N GLU A 258 ? N GLU A 258 O THR A 680 ? O THR A 680 
AA4 1 2 N TYR A 321 ? N TYR A 321 O GLU A 544 ? O GLU A 544 
AA4 2 3 N GLY A 546 ? N GLY A 546 O MET A 561 ? O MET A 561 
AA4 3 4 O THR A 570 ? O THR A 570 N VAL A 518 ? N VAL A 518 
AA4 4 5 O MET A 523 ? O MET A 523 N PHE A 503 ? N PHE A 503 
AA4 5 6 O ILE A 504 ? O ILE A 504 N ILE A 483 ? N ILE A 483 
AA4 6 7 O PHE A 480 ? O PHE A 480 N MET A 360 ? N MET A 360 
AA5 1 2 N VAL A 379 ? N VAL A 379 O ARG B 365 ? O ARG B 365 
AA5 2 3 O THR B 366 ? O THR B 366 N PHE B 357 ? N PHE B 357 
AA6 1 2 N GLY A 622 ? N GLY A 622 O GLU A 629 ? O GLU A 629 
AA7 1 2 N THR B 56  ? N THR B 56  O GLN B 65  ? O GLN B 65  
AA8 1 2 N THR B 128 ? N THR B 128 O GLN B 137 ? O GLN B 137 
AA9 1 2 N ILE B 181 ? N ILE B 181 O GLN B 210 ? O GLN B 210 
AB1 1 2 N LEU B 224 ? N LEU B 224 O ARG B 350 ? O ARG B 350 
AB1 2 3 N ALA B 349 ? N ALA B 349 O ALA B 401 ? O ALA B 401 
AB2 1 2 N TRP B 437 ? N TRP B 437 O ASN B 452 ? O ASN B 452 
AB2 2 3 O VAL B 451 ? O VAL B 451 N PHE B 300 ? N PHE B 300 
AB2 3 4 N THR B 303 ? N THR B 303 O TYR B 483 ? O TYR B 483 
AB3 1 2 N PHE B 490 ? N PHE B 490 O TYR B 497 ? O TYR B 497 
AB3 2 3 N PHE B 496 ? N PHE B 496 O VAL B 502 ? O VAL B 502 
AB4 1 2 N ILE C 57  ? N ILE C 57  O VAL C 91  ? O VAL C 91  
AB5 1 2 N THR C 129 ? N THR C 129 O THR C 245 ? O THR C 245 
AB6 1 2 N VAL C 145 ? N VAL C 145 O ARG C 216 ? O ARG C 216 
AB7 1 2 O THR C 292 ? O THR C 292 N ILE C 289 ? N ILE C 289 
AB7 2 3 N GLN C 288 ? N GLN C 288 O THR C 530 ? O THR C 530 
AB8 1 2 N PHE C 325 ? N PHE C 325 O PHE C 328 ? O PHE C 328 
AB8 2 3 N THR C 333 ? N THR C 333 O GLU C 362 ? O GLU C 362 
AB8 3 4 N PHE C 363 ? N PHE C 363 O LEU C 374 ? O LEU C 374 
AB8 4 5 N ALA C 377 ? N ALA C 377 O ARG C 380 ? O ARG C 380 
AB8 5 6 N VAL C 386 ? N VAL C 386 O SER C 481 ? O SER C 481 
AB8 6 7 O VAL C 480 ? O VAL C 480 N ILE C 461 ? N ILE C 461 
AB8 7 8 N GLY C 462 ? N GLY C 462 O SER C 470 ? O SER C 470 
AB9 1 2 N GLU C 342 ? N GLU C 342 O ILE C 354 ? O ILE C 354 
AC1 1 2 N GLU C 452 ? N GLU C 452 O SER C 474 ? O SER C 474 
AC2 1 2 N SER C 497 ? N SER C 497 O ARG C 505 ? O ARG C 505 
AC2 2 3 N VAL C 504 ? N VAL C 504 O LEU C 513 ? O LEU C 513 
AC3 1 2 N VAL C 638 ? N VAL C 638 O MET C 645 ? O MET C 645 
AC4 1 2 N ASN C 657 ? N ASN C 657 O THR C 666 ? O THR C 666 
AC4 2 3 N LEU C 665 ? N LEU C 665 O ALA C 672 ? O ALA C 672 
AC5 1 2 N GLY C 698 ? N GLY C 698 O LEU C 733 ? O LEU C 733 
AC5 2 3 O VAL C 732 ? O VAL C 732 N VAL C 724 ? N VAL C 724 
AC6 1 2 N PHE D 53  ? N PHE D 53  O ILE D 61  ? O ILE D 61  
AC7 1 2 N GLU D 77  ? N GLU D 77  O TYR D 110 ? O TYR D 110 
AC7 2 3 N LEU D 109 ? N LEU D 109 O ILE D 118 ? O ILE D 118 
AC7 3 4 N GLU D 119 ? N GLU D 119 O HIS D 144 ? O HIS D 144 
AC7 4 5 N ILE D 147 ? N ILE D 147 O MET D 155 ? O MET D 155 
AC8 1 2 N GLU D 258 ? N GLU D 258 O THR D 680 ? O THR D 680 
AC9 1 2 N TYR D 321 ? N TYR D 321 O GLU D 544 ? O GLU D 544 
AC9 2 3 N CYS D 541 ? N CYS D 541 O VAL D 565 ? O VAL D 565 
AC9 3 4 O THR D 570 ? O THR D 570 N VAL D 518 ? N VAL D 518 
AC9 4 5 O PHE D 525 ? O PHE D 525 N TYR D 501 ? N TYR D 501 
AC9 5 6 O GLY D 502 ? O GLY D 502 N MET D 485 ? N MET D 485 
AC9 6 7 O PHE D 480 ? O PHE D 480 N MET D 360 ? N MET D 360 
AD1 1 2 N GLU D 377 ? N GLU D 377 O ARG E 365 ? O ARG E 365 
AD1 2 3 O THR E 366 ? O THR E 366 N PHE E 357 ? N PHE E 357 
AD2 1 2 N THR E 56  ? N THR E 56  O GLN E 65  ? O GLN E 65  
AD3 1 2 N THR E 128 ? N THR E 128 O GLN E 137 ? O GLN E 137 
AD4 1 2 N LEU E 224 ? N LEU E 224 O MET E 348 ? O MET E 348 
AD4 2 3 N ALA E 349 ? N ALA E 349 O ALA E 401 ? O ALA E 401 
AD5 1 2 N TRP E 437 ? N TRP E 437 O ASN E 452 ? O ASN E 452 
AD5 2 3 O ALA E 453 ? O ALA E 453 N LEU E 298 ? N LEU E 298 
AD5 3 4 N THR E 303 ? N THR E 303 O TYR E 483 ? O TYR E 483 
AD6 1 2 N PHE E 490 ? N PHE E 490 O TYR E 497 ? O TYR E 497 
AD7 1 2 N ILE F 57  ? N ILE F 57  O VAL F 91  ? O VAL F 91  
AD8 1 2 N ILE F 141 ? N ILE F 141 O VAL F 220 ? O VAL F 220 
AD9 1 2 O THR F 292 ? O THR F 292 N ILE F 289 ? N ILE F 289 
AD9 2 3 N GLN F 288 ? N GLN F 288 O THR F 530 ? O THR F 530 
AE1 1 2 N THR F 333 ? N THR F 333 O GLU F 362 ? O GLU F 362 
AE1 2 3 N PHE F 363 ? N PHE F 363 O LEU F 374 ? O LEU F 374 
AE1 3 4 N ARG F 375 ? N ARG F 375 O GLN F 383 ? O GLN F 383 
AE1 4 5 N VAL F 386 ? N VAL F 386 O SER F 481 ? O SER F 481 
AE1 5 6 O VAL F 480 ? O VAL F 480 N ILE F 461 ? N ILE F 461 
AE1 6 7 N GLY F 462 ? N GLY F 462 O SER F 470 ? O SER F 470 
AE2 1 2 N GLU F 342 ? N GLU F 342 O ILE F 354 ? O ILE F 354 
AE3 1 2 N GLU F 452 ? N GLU F 452 O SER F 474 ? O SER F 474 
AE4 1 2 N SER F 497 ? N SER F 497 O ARG F 505 ? O ARG F 505 
AE4 2 3 N VAL F 504 ? N VAL F 504 O LEU F 512 ? O LEU F 512 
AE5 1 2 N VAL F 640 ? N VAL F 640 O SER F 643 ? O SER F 643 
AE6 1 2 N ASN F 657 ? N ASN F 657 O THR F 666 ? O THR F 666 
AE6 2 3 N ILE F 667 ? N ILE F 667 O LYS F 670 ? O LYS F 670 
AE7 1 2 N GLY F 698 ? N GLY F 698 O LEU F 733 ? O LEU F 733 
AE7 2 3 O VAL F 732 ? O VAL F 732 N VAL F 724 ? N VAL F 724 
AE8 1 2 N PHE G 53  ? N PHE G 53  O ILE G 61  ? O ILE G 61  
AE9 1 2 N GLU G 77  ? N GLU G 77  O TYR G 110 ? O TYR G 110 
AE9 2 3 N LEU G 109 ? N LEU G 109 O ILE G 118 ? O ILE G 118 
AE9 3 4 N GLU G 119 ? N GLU G 119 O HIS G 144 ? O HIS G 144 
AE9 4 5 N ILE G 147 ? N ILE G 147 O MET G 155 ? O MET G 155 
AF1 1 2 N GLU G 258 ? N GLU G 258 O THR G 680 ? O THR G 680 
AF2 1 2 N VAL G 323 ? N VAL G 323 O VAL G 542 ? O VAL G 542 
AF2 2 3 N CYS G 541 ? N CYS G 541 O VAL G 565 ? O VAL G 565 
AF2 3 4 O THR G 570 ? O THR G 570 N VAL G 518 ? N VAL G 518 
AF2 4 5 O PHE G 525 ? O PHE G 525 N TYR G 501 ? N TYR G 501 
AF2 5 6 O GLY G 502 ? O GLY G 502 N MET G 485 ? N MET G 485 
AF2 6 7 O PHE G 480 ? O PHE G 480 N MET G 360 ? N MET G 360 
AF3 1 2 N GLU G 377 ? N GLU G 377 O ARG H 365 ? O ARG H 365 
AF3 2 3 O THR H 366 ? O THR H 366 N PHE H 357 ? N PHE H 357 
AF4 1 2 N GLY G 622 ? N GLY G 622 O GLU G 629 ? O GLU G 629 
AF5 1 2 N THR H 56  ? N THR H 56  O GLN H 65  ? O GLN H 65  
AF6 1 2 N THR H 128 ? N THR H 128 O GLN H 137 ? O GLN H 137 
AF7 1 2 N MET H 179 ? N MET H 179 O VAL H 212 ? O VAL H 212 
AF8 1 2 N TRP H 437 ? N TRP H 437 O ASN H 452 ? O ASN H 452 
AF8 2 3 O ALA H 453 ? O ALA H 453 N LEU H 298 ? N LEU H 298 
AF8 3 4 N THR H 303 ? N THR H 303 O TYR H 483 ? O TYR H 483 
AF9 1 2 N ALA H 349 ? N ALA H 349 O ALA H 401 ? O ALA H 401 
AG1 1 2 N PHE H 490 ? N PHE H 490 O TYR H 497 ? O TYR H 497 
AG1 2 3 N PHE H 496 ? N PHE H 496 O VAL H 502 ? O VAL H 502 
AG2 1 2 N ILE I 57  ? N ILE I 57  O VAL I 91  ? O VAL I 91  
AG3 1 2 N ILE I 141 ? N ILE I 141 O VAL I 220 ? O VAL I 220 
AG4 1 2 O THR I 292 ? O THR I 292 N ILE I 289 ? N ILE I 289 
AG4 2 3 N GLN I 288 ? N GLN I 288 O THR I 530 ? O THR I 530 
AG5 1 2 N THR I 333 ? N THR I 333 O GLU I 362 ? O GLU I 362 
AG5 2 3 N PHE I 363 ? N PHE I 363 O LEU I 374 ? O LEU I 374 
AG5 3 4 N ALA I 377 ? N ALA I 377 O ARG I 380 ? O ARG I 380 
AG5 4 5 N VAL I 386 ? N VAL I 386 O SER I 481 ? O SER I 481 
AG5 5 6 O VAL I 480 ? O VAL I 480 N ILE I 461 ? N ILE I 461 
AG5 6 7 N GLY I 462 ? N GLY I 462 O SER I 470 ? O SER I 470 
AG6 1 2 N GLU I 342 ? N GLU I 342 O ILE I 354 ? O ILE I 354 
AG7 1 2 N GLU I 452 ? N GLU I 452 O SER I 474 ? O SER I 474 
AG8 1 2 N SER I 497 ? N SER I 497 O ARG I 505 ? O ARG I 505 
AG8 2 3 N VAL I 504 ? N VAL I 504 O LEU I 512 ? O LEU I 512 
AG9 1 2 N VAL I 638 ? N VAL I 638 O MET I 645 ? O MET I 645 
AH1 1 2 N ASN I 657 ? N ASN I 657 O THR I 666 ? O THR I 666 
AH1 2 3 N ILE I 667 ? N ILE I 667 O LYS I 670 ? O LYS I 670 
AH2 1 2 N GLY I 698 ? N GLY I 698 O LEU I 733 ? O LEU I 733 
AH2 2 3 O VAL I 732 ? O VAL I 732 N VAL I 724 ? N VAL I 724 
AH3 1 2 N PHE J 53  ? N PHE J 53  O ILE J 61  ? O ILE J 61  
AH4 1 2 N GLU J 77  ? N GLU J 77  O TYR J 110 ? O TYR J 110 
AH4 2 3 N LEU J 109 ? N LEU J 109 O ILE J 118 ? O ILE J 118 
AH4 3 4 N GLU J 119 ? N GLU J 119 O HIS J 144 ? O HIS J 144 
AH4 4 5 N ILE J 147 ? N ILE J 147 O MET J 155 ? O MET J 155 
AH5 1 2 N GLU J 258 ? N GLU J 258 O THR J 680 ? O THR J 680 
AH6 1 2 N TYR J 321 ? N TYR J 321 O GLU J 544 ? O GLU J 544 
AH6 2 3 N CYS J 541 ? N CYS J 541 O VAL J 565 ? O VAL J 565 
AH6 3 4 O THR J 570 ? O THR J 570 N VAL J 518 ? N VAL J 518 
AH6 4 5 O PHE J 525 ? O PHE J 525 N TYR J 501 ? N TYR J 501 
AH6 5 6 O GLY J 502 ? O GLY J 502 N MET J 485 ? N MET J 485 
AH6 6 7 O PHE J 480 ? O PHE J 480 N MET J 360 ? N MET J 360 
AH7 1 2 N VAL J 379 ? N VAL J 379 O ARG K 365 ? O ARG K 365 
AH7 2 3 O THR K 366 ? O THR K 366 N PHE K 357 ? N PHE K 357 
AH8 1 2 N TRP J 619 ? N TRP J 619 O GLY J 631 ? O GLY J 631 
AH9 1 2 N THR K 56  ? N THR K 56  O GLN K 65  ? O GLN K 65  
AI1 1 2 N THR K 128 ? N THR K 128 O GLN K 137 ? O GLN K 137 
AI2 1 2 N TRP K 437 ? N TRP K 437 O ASN K 452 ? O ASN K 452 
AI2 2 3 O LEU K 449 ? O LEU K 449 N ILE K 302 ? N ILE K 302 
AI2 3 4 N THR K 303 ? N THR K 303 O TYR K 483 ? O TYR K 483 
AI3 1 2 N ALA K 349 ? N ALA K 349 O ALA K 401 ? O ALA K 401 
AI4 1 2 N PHE K 490 ? N PHE K 490 O TYR K 497 ? O TYR K 497 
AI4 2 3 N PHE K 496 ? N PHE K 496 O VAL K 502 ? O VAL K 502 
AI5 1 2 N ILE L 57  ? N ILE L 57  O VAL L 91  ? O VAL L 91  
AI6 1 2 N ILE L 141 ? N ILE L 141 O VAL L 220 ? O VAL L 220 
AI7 1 2 O THR L 292 ? O THR L 292 N ILE L 289 ? N ILE L 289 
AI7 2 3 N GLN L 288 ? N GLN L 288 O THR L 530 ? O THR L 530 
AI8 1 2 N THR L 333 ? N THR L 333 O GLU L 362 ? O GLU L 362 
AI8 2 3 N PHE L 363 ? N PHE L 363 O LEU L 374 ? O LEU L 374 
AI8 3 4 N ALA L 377 ? N ALA L 377 O ARG L 380 ? O ARG L 380 
AI8 4 5 N VAL L 386 ? N VAL L 386 O SER L 481 ? O SER L 481 
AI8 5 6 O VAL L 480 ? O VAL L 480 N ILE L 461 ? N ILE L 461 
AI8 6 7 N GLY L 462 ? N GLY L 462 O SER L 470 ? O SER L 470 
AI9 1 2 N GLU L 342 ? N GLU L 342 O ILE L 354 ? O ILE L 354 
AJ1 1 2 N GLU L 452 ? N GLU L 452 O SER L 474 ? O SER L 474 
AJ2 1 2 N VAL L 504 ? N VAL L 504 O LEU L 512 ? O LEU L 512 
AJ3 1 2 N VAL L 638 ? N VAL L 638 O MET L 645 ? O MET L 645 
AJ4 1 2 N ASN L 657 ? N ASN L 657 O THR L 666 ? O THR L 666 
AJ4 2 3 N ILE L 667 ? N ILE L 667 O LYS L 670 ? O LYS L 670 
AJ5 1 2 N GLY L 698 ? N GLY L 698 O LEU L 733 ? O LEU L 733 
AJ5 2 3 O VAL L 732 ? O VAL L 732 N VAL L 724 ? N VAL L 724 
# 
_atom_sites.entry_id                    6QNW 
_atom_sites.fract_transf_matrix[1][1]   0.002972 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000078 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005211 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004244 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
_atom_type.scat_dispersion_real 
_atom_type.scat_dispersion_imag 
_atom_type.scat_Cromer_Mann_a1 
_atom_type.scat_Cromer_Mann_a2 
_atom_type.scat_Cromer_Mann_a3 
_atom_type.scat_Cromer_Mann_a4 
_atom_type.scat_Cromer_Mann_b1 
_atom_type.scat_Cromer_Mann_b2 
_atom_type.scat_Cromer_Mann_b3 
_atom_type.scat_Cromer_Mann_b4 
_atom_type.scat_Cromer_Mann_c 
_atom_type.scat_source 
_atom_type.scat_dispersion_source 
C ? ? 3.54356 2.42580 ? ? 25.62398 1.50364  ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
N ? ? 6.96715 ?       ? ? 11.43723 ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
O ? ? 7.96527 ?       ? ? 9.05267  ?        ? ? 0.0 
;1-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
S ? ? 9.55732 6.39887 ? ? 1.23737  29.19336 ? ? 0.0 
;2-Gaussian fit: Grosse-Kunstleve RW, Sauter NK, Adams PD: Newsletter of the IUCr Commission on Crystallographic Computing 2004, 3, 22-31.
;
? 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . MET A 1 1   ? 37.96342  -1.47495  27.54947   1.000 67.29230  ? 1   MET A N   1 
ATOM 2     C CA  . MET A 1 1   ? 36.55793  -1.69394  27.22464   1.000 78.72652  ? 1   MET A CA  1 
ATOM 3     C C   . MET A 1 1   ? 35.63304  -1.04911  28.24691   1.000 85.23459  ? 1   MET A C   1 
ATOM 4     O O   . MET A 1 1   ? 34.73465  -0.28628  27.89242   1.000 82.96165  ? 1   MET A O   1 
ATOM 5     C CB  . MET A 1 1   ? 36.25638  -3.19070  27.12776   1.000 77.56889  ? 1   MET A CB  1 
ATOM 6     C CG  . MET A 1 1   ? 34.77280  -3.51366  27.05356   1.000 78.95265  ? 1   MET A CG  1 
ATOM 7     S SD  . MET A 1 1   ? 33.98490  -2.83977  25.58058   1.000 74.58232  ? 1   MET A SD  1 
ATOM 8     C CE  . MET A 1 1   ? 34.61837  -3.94757  24.32545   1.000 78.79017  ? 1   MET A CE  1 
ATOM 9     N N   . GLU A 1 2   ? 35.86137  -1.37588  29.51993   1.000 78.62368  ? 2   GLU A N   1 
ATOM 10    C CA  . GLU A 1 2   ? 34.98859  -0.89116  30.58330   1.000 82.22449  ? 2   GLU A CA  1 
ATOM 11    C C   . GLU A 1 2   ? 34.98663  0.63249   30.64103   1.000 71.83236  ? 2   GLU A C   1 
ATOM 12    O O   . GLU A 1 2   ? 33.93056  1.25561   30.80317   1.000 72.56002  ? 2   GLU A O   1 
ATOM 13    C CB  . GLU A 1 2   ? 35.43269  -1.50289  31.91159   1.000 108.65955 ? 2   GLU A CB  1 
ATOM 14    C CG  . GLU A 1 2   ? 34.56432  -1.18364  33.10534   1.000 129.46745 ? 2   GLU A CG  1 
ATOM 15    C CD  . GLU A 1 2   ? 35.03966  -1.90353  34.35218   1.000 149.04204 ? 2   GLU A CD  1 
ATOM 16    O OE1 . GLU A 1 2   ? 36.00695  -2.68923  34.25352   1.000 152.26644 ? 2   GLU A OE1 1 
ATOM 17    O OE2 . GLU A 1 2   ? 34.45189  -1.68311  35.43087   1.000 155.35865 ? 2   GLU A OE2 1 
ATOM 18    N N   . ASP A 1 3   ? 36.16385  1.24884   30.51584   1.000 94.44717  ? 3   ASP A N   1 
ATOM 19    C CA  . ASP A 1 3   ? 36.25132  2.70581   30.50316   1.000 98.27151  ? 3   ASP A CA  1 
ATOM 20    C C   . ASP A 1 3   ? 35.68792  3.29952   29.21657   1.000 81.50498  ? 3   ASP A C   1 
ATOM 21    O O   . ASP A 1 3   ? 35.10097  4.38761   29.24347   1.000 90.47845  ? 3   ASP A O   1 
ATOM 22    C CB  . ASP A 1 3   ? 37.70081  3.15003   30.69797   1.000 103.25210 ? 3   ASP A CB  1 
ATOM 23    C CG  . ASP A 1 3   ? 38.23910  2.79203   32.06537   1.000 96.03325  ? 3   ASP A CG  1 
ATOM 24    O OD1 . ASP A 1 3   ? 37.45199  2.81123   33.03284   1.000 90.02920  ? 3   ASP A OD1 1 
ATOM 25    O OD2 . ASP A 1 3   ? 39.44709  2.49768   32.17520   1.000 92.99556  ? 3   ASP A OD2 1 
ATOM 26    N N   . PHE A 1 4   ? 35.86309  2.60533   28.08760   1.000 63.80748  ? 4   PHE A N   1 
ATOM 27    C CA  . PHE A 1 4   ? 35.41503  3.12600   26.79653   1.000 74.83720  ? 4   PHE A CA  1 
ATOM 28    C C   . PHE A 1 4   ? 33.90271  3.30917   26.73750   1.000 81.03896  ? 4   PHE A C   1 
ATOM 29    O O   . PHE A 1 4   ? 33.41339  4.27600   26.14112   1.000 91.13858  ? 4   PHE A O   1 
ATOM 30    C CB  . PHE A 1 4   ? 35.87174  2.19435   25.67396   1.000 73.90632  ? 4   PHE A CB  1 
ATOM 31    C CG  . PHE A 1 4   ? 34.98986  2.23804   24.45673   1.000 71.91148  ? 4   PHE A CG  1 
ATOM 32    C CD1 . PHE A 1 4   ? 35.05472  3.30088   23.57130   1.000 73.84455  ? 4   PHE A CD1 1 
ATOM 33    C CD2 . PHE A 1 4   ? 34.08382  1.21886   24.20654   1.000 69.46421  ? 4   PHE A CD2 1 
ATOM 34    C CE1 . PHE A 1 4   ? 34.23812  3.34072   22.45479   1.000 69.58152  ? 4   PHE A CE1 1 
ATOM 35    C CE2 . PHE A 1 4   ? 33.26472  1.25509   23.09457   1.000 64.93476  ? 4   PHE A CE2 1 
ATOM 36    C CZ  . PHE A 1 4   ? 33.34142  2.31644   22.21772   1.000 63.50767  ? 4   PHE A CZ  1 
ATOM 37    N N   . VAL A 1 5   ? 33.14510  2.39164   27.34181   1.000 69.08441  ? 5   VAL A N   1 
ATOM 38    C CA  . VAL A 1 5   ? 31.68643  2.48018   27.29752   1.000 67.66893  ? 5   VAL A CA  1 
ATOM 39    C C   . VAL A 1 5   ? 31.20118  3.75083   27.97945   1.000 71.74917  ? 5   VAL A C   1 
ATOM 40    O O   . VAL A 1 5   ? 30.21905  4.36584   27.54532   1.000 84.00856  ? 5   VAL A O   1 
ATOM 41    C CB  . VAL A 1 5   ? 31.05843  1.22037   27.92656   1.000 68.13542  ? 5   VAL A CB  1 
ATOM 42    C CG1 . VAL A 1 5   ? 29.53944  1.32088   27.93516   1.000 68.55187  ? 5   VAL A CG1 1 
ATOM 43    C CG2 . VAL A 1 5   ? 31.50801  -0.02346  27.17720   1.000 65.60080  ? 5   VAL A CG2 1 
ATOM 44    N N   . ARG A 1 6   ? 31.88426  4.17577   29.04079   1.000 73.45485  ? 6   ARG A N   1 
ATOM 45    C CA  . ARG A 1 6   ? 31.50754  5.39763   29.73740   1.000 76.51645  ? 6   ARG A CA  1 
ATOM 46    C C   . ARG A 1 6   ? 31.70911  6.64665   28.88494   1.000 81.69359  ? 6   ARG A C   1 
ATOM 47    O O   . ARG A 1 6   ? 31.14669  7.69790   29.20802   1.000 79.86610  ? 6   ARG A O   1 
ATOM 48    C CB  . ARG A 1 6   ? 32.32172  5.50277   31.02621   1.000 85.88235  ? 6   ARG A CB  1 
ATOM 49    C CG  . ARG A 1 6   ? 32.13338  4.30876   31.94745   1.000 96.18770  ? 6   ARG A CG  1 
ATOM 50    C CD  . ARG A 1 6   ? 32.91570  4.46255   33.23775   1.000 101.54860 ? 6   ARG A CD  1 
ATOM 51    N NE  . ARG A 1 6   ? 32.85119  3.25460   34.05497   1.000 98.64311  ? 6   ARG A NE  1 
ATOM 52    C CZ  . ARG A 1 6   ? 31.86703  2.97717   34.90391   1.000 93.15295  ? 6   ARG A CZ  1 
ATOM 53    N NH1 . ARG A 1 6   ? 30.85702  3.82379   35.04976   1.000 92.57269  ? 6   ARG A NH1 1 
ATOM 54    N NH2 . ARG A 1 6   ? 31.89220  1.85090   35.60466   1.000 86.45260  ? 6   ARG A NH2 1 
ATOM 55    N N   . GLN A 1 7   ? 32.49207  6.55782   27.80679   1.000 69.37708  ? 7   GLN A N   1 
ATOM 56    C CA  . GLN A 1 7   ? 32.68138  7.67703   26.89023   1.000 78.46190  ? 7   GLN A CA  1 
ATOM 57    C C   . GLN A 1 7   ? 31.59119  7.76472   25.82426   1.000 97.45447  ? 7   GLN A C   1 
ATOM 58    O O   . GLN A 1 7   ? 30.96034  8.81475   25.66674   1.000 114.96104 ? 7   GLN A O   1 
ATOM 59    C CB  . GLN A 1 7   ? 34.05697  7.58493   26.22279   1.000 73.50917  ? 7   GLN A CB  1 
ATOM 60    C CG  . GLN A 1 7   ? 34.26480  8.59676   25.10675   1.000 83.10443  ? 7   GLN A CG  1 
ATOM 61    C CD  . GLN A 1 7   ? 35.56508  8.38219   24.36007   1.000 120.45135 ? 7   GLN A CD  1 
ATOM 62    O OE1 . GLN A 1 7   ? 36.30950  7.44396   24.64368   1.000 142.44960 ? 7   GLN A OE1 1 
ATOM 63    N NE2 . GLN A 1 7   ? 35.84519  9.25291   23.39757   1.000 130.10645 ? 7   GLN A NE2 1 
ATOM 64    N N   . CYS A 1 8   ? 31.35787  6.67861   25.08636   1.000 93.37905  ? 8   CYS A N   1 
ATOM 65    C CA  . CYS A 1 8   ? 30.46742  6.69857   23.93043   1.000 81.65436  ? 8   CYS A CA  1 
ATOM 66    C C   . CYS A 1 8   ? 28.99427  6.58943   24.30078   1.000 81.20478  ? 8   CYS A C   1 
ATOM 67    O O   . CYS A 1 8   ? 28.17024  6.32661   23.41864   1.000 77.47403  ? 8   CYS A O   1 
ATOM 68    C CB  . CYS A 1 8   ? 30.83562  5.57290   22.95865   1.000 83.37730  ? 8   CYS A CB  1 
ATOM 69    S SG  . CYS A 1 8   ? 32.15006  5.98828   21.78595   1.000 110.77638 ? 8   CYS A SG  1 
ATOM 70    N N   . PHE A 1 9   ? 28.64322  6.77319   25.57110   1.000 88.20378  ? 9   PHE A N   1 
ATOM 71    C CA  . PHE A 1 9   ? 27.25225  6.77456   25.99417   1.000 82.52523  ? 9   PHE A CA  1 
ATOM 72    C C   . PHE A 1 9   ? 27.04551  7.88415   27.01390   1.000 93.44246  ? 9   PHE A C   1 
ATOM 73    O O   . PHE A 1 9   ? 27.97342  8.27798   27.72541   1.000 109.94038 ? 9   PHE A O   1 
ATOM 74    C CB  . PHE A 1 9   ? 26.83375  5.41995   26.58987   1.000 82.14573  ? 9   PHE A CB  1 
ATOM 75    C CG  . PHE A 1 9   ? 26.91965  4.27213   25.61753   1.000 88.95092  ? 9   PHE A CG  1 
ATOM 76    C CD1 . PHE A 1 9   ? 25.80468  3.86432   24.90267   1.000 89.42239  ? 9   PHE A CD1 1 
ATOM 77    C CD2 . PHE A 1 9   ? 28.11531  3.60089   25.41948   1.000 87.87567  ? 9   PHE A CD2 1 
ATOM 78    C CE1 . PHE A 1 9   ? 25.88265  2.80750   24.01154   1.000 81.74566  ? 9   PHE A CE1 1 
ATOM 79    C CE2 . PHE A 1 9   ? 28.19927  2.54729   24.52796   1.000 78.56036  ? 9   PHE A CE2 1 
ATOM 80    C CZ  . PHE A 1 9   ? 27.08140  2.15031   23.82371   1.000 74.83130  ? 9   PHE A CZ  1 
ATOM 81    N N   . ASN A 1 10  ? 25.81523  8.38509   27.07451   1.000 96.01239  ? 10  ASN A N   1 
ATOM 82    C CA  . ASN A 1 10  ? 25.45973  9.39168   28.05560   1.000 113.98526 ? 10  ASN A CA  1 
ATOM 83    C C   . ASN A 1 10  ? 25.35764  8.75628   29.44216   1.000 103.79182 ? 10  ASN A C   1 
ATOM 84    O O   . ASN A 1 10  ? 25.20538  7.53860   29.56606   1.000 94.01189  ? 10  ASN A O   1 
ATOM 85    C CB  . ASN A 1 10  ? 24.14944  10.07226  27.65749   1.000 136.13994 ? 10  ASN A CB  1 
ATOM 86    C CG  . ASN A 1 10  ? 23.04909  9.08344   27.32777   1.000 156.36057 ? 10  ASN A CG  1 
ATOM 87    O OD1 . ASN A 1 10  ? 23.00050  7.98300   27.87148   1.000 156.57292 ? 10  ASN A OD1 1 
ATOM 88    N ND2 . ASN A 1 10  ? 22.15901  9.47386   26.42411   1.000 170.13187 ? 10  ASN A ND2 1 
ATOM 89    N N   . PRO A 1 11  ? 25.45638  9.56007   30.50529   1.000 107.20815 ? 11  PRO A N   1 
ATOM 90    C CA  . PRO A 1 11  ? 25.44079  8.98057   31.85884   1.000 91.53867  ? 11  PRO A CA  1 
ATOM 91    C C   . PRO A 1 11  ? 24.14354  8.27247   32.20427   1.000 97.41949  ? 11  PRO A C   1 
ATOM 92    O O   . PRO A 1 11  ? 24.15343  7.38861   33.06935   1.000 107.52497 ? 11  PRO A O   1 
ATOM 93    C CB  . PRO A 1 11  ? 25.67791  10.19599  32.76710   1.000 104.91220 ? 11  PRO A CB  1 
ATOM 94    C CG  . PRO A 1 11  ? 26.32840  11.20970  31.88498   1.000 122.77569 ? 11  PRO A CG  1 
ATOM 95    C CD  . PRO A 1 11  ? 25.72520  11.00814  30.53317   1.000 124.73709 ? 11  PRO A CD  1 
ATOM 96    N N   . MET A 1 12  ? 23.02980  8.61860   31.55379   1.000 105.66961 ? 12  MET A N   1 
ATOM 97    C CA  . MET A 1 12  ? 21.75028  8.01782   31.91743   1.000 128.00147 ? 12  MET A CA  1 
ATOM 98    C C   . MET A 1 12  ? 21.67379  6.56139   31.47353   1.000 105.93583 ? 12  MET A C   1 
ATOM 99    O O   . MET A 1 12  ? 21.21366  5.69910   32.23232   1.000 95.01056  ? 12  MET A O   1 
ATOM 100   C CB  . MET A 1 12  ? 20.60488  8.82482   31.30761   1.000 160.86689 ? 12  MET A CB  1 
ATOM 101   C CG  . MET A 1 12  ? 19.22933  8.44905   31.82542   1.000 178.54777 ? 12  MET A CG  1 
ATOM 102   S SD  . MET A 1 12  ? 18.32265  7.45670   30.62343   1.000 185.14502 ? 12  MET A SD  1 
ATOM 103   C CE  . MET A 1 12  ? 16.71399  7.35859   31.40173   1.000 180.58795 ? 12  MET A CE  1 
ATOM 104   N N   . ILE A 1 13  ? 22.12942  6.26384   30.25497   1.000 108.00003 ? 13  ILE A N   1 
ATOM 105   C CA  . ILE A 1 13  ? 22.15071  4.87859   29.79503   1.000 108.15929 ? 13  ILE A CA  1 
ATOM 106   C C   . ILE A 1 13  ? 23.14487  4.06063   30.61024   1.000 96.60726  ? 13  ILE A C   1 
ATOM 107   O O   . ILE A 1 13  ? 22.90250  2.88641   30.91312   1.000 91.59511  ? 13  ILE A O   1 
ATOM 108   C CB  . ILE A 1 13  ? 22.45983  4.82176   28.28762   1.000 106.80507 ? 13  ILE A CB  1 
ATOM 109   C CG1 . ILE A 1 13  ? 21.27340  5.35860   27.48457   1.000 90.65680  ? 13  ILE A CG1 1 
ATOM 110   C CG2 . ILE A 1 13  ? 22.79731  3.40258   27.85459   1.000 116.18210 ? 13  ILE A CG2 1 
ATOM 111   C CD1 . ILE A 1 13  ? 21.58013  5.59244   26.02388   1.000 86.68727  ? 13  ILE A CD1 1 
ATOM 112   N N   . VAL A 1 14  ? 24.26896  4.66963   30.99354   1.000 87.32761  ? 14  VAL A N   1 
ATOM 113   C CA  . VAL A 1 14  ? 25.23342  3.98639   31.85331   1.000 88.92504  ? 14  VAL A CA  1 
ATOM 114   C C   . VAL A 1 14  ? 24.60043  3.64295   33.19703   1.000 102.75399 ? 14  VAL A C   1 
ATOM 115   O O   . VAL A 1 14  ? 24.75375  2.52794   33.70963   1.000 116.90317 ? 14  VAL A O   1 
ATOM 116   C CB  . VAL A 1 14  ? 26.49834  4.84586   32.02899   1.000 94.24140  ? 14  VAL A CB  1 
ATOM 117   C CG1 . VAL A 1 14  ? 27.46641  4.17462   32.99016   1.000 87.02099  ? 14  VAL A CG1 1 
ATOM 118   C CG2 . VAL A 1 14  ? 27.16230  5.09737   30.68404   1.000 107.70133 ? 14  VAL A CG2 1 
ATOM 119   N N   . GLU A 1 15  ? 23.87820  4.59922   33.78742   1.000 102.80165 ? 15  GLU A N   1 
ATOM 120   C CA  . GLU A 1 15  ? 23.23173  4.35423   35.07339   1.000 108.00466 ? 15  GLU A CA  1 
ATOM 121   C C   . GLU A 1 15  ? 22.16180  3.27502   34.95754   1.000 112.17773 ? 15  GLU A C   1 
ATOM 122   O O   . GLU A 1 15  ? 22.03636  2.41593   35.83962   1.000 121.38528 ? 15  GLU A O   1 
ATOM 123   C CB  . GLU A 1 15  ? 22.63477  5.65290   35.61597   1.000 131.64547 ? 15  GLU A CB  1 
ATOM 124   C CG  . GLU A 1 15  ? 21.88069  5.49428   36.92699   1.000 161.08101 ? 15  GLU A CG  1 
ATOM 125   C CD  . GLU A 1 15  ? 21.25704  6.79254   37.40136   1.000 177.61768 ? 15  GLU A CD  1 
ATOM 126   O OE1 . GLU A 1 15  ? 21.52785  7.84373   36.78346   1.000 179.45878 ? 15  GLU A OE1 1 
ATOM 127   O OE2 . GLU A 1 15  ? 20.49792  6.76224   38.39316   1.000 186.35970 ? 15  GLU A OE2 1 
ATOM 128   N N   . LEU A 1 16  ? 21.38151  3.29938   33.87349   1.000 113.01355 ? 16  LEU A N   1 
ATOM 129   C CA  . LEU A 1 16  ? 20.34868  2.28346   33.69491   1.000 105.74765 ? 16  LEU A CA  1 
ATOM 130   C C   . LEU A 1 16  ? 20.95798  0.90278   33.49423   1.000 99.47329  ? 16  LEU A C   1 
ATOM 131   O O   . LEU A 1 16  ? 20.45076  -0.08543  34.03406   1.000 110.80803 ? 16  LEU A O   1 
ATOM 132   C CB  . LEU A 1 16  ? 19.44134  2.63485   32.51827   1.000 105.46679 ? 16  LEU A CB  1 
ATOM 133   C CG  . LEU A 1 16  ? 18.39310  3.72106   32.74528   1.000 121.85346 ? 16  LEU A CG  1 
ATOM 134   C CD1 . LEU A 1 16  ? 17.57417  3.91047   31.48164   1.000 143.38888 ? 16  LEU A CD1 1 
ATOM 135   C CD2 . LEU A 1 16  ? 17.50095  3.36411   33.92433   1.000 113.05518 ? 16  LEU A CD2 1 
ATOM 136   N N   . ALA A 1 17  ? 22.03976  0.80992   32.71918   1.000 86.81473  ? 17  ALA A N   1 
ATOM 137   C CA  . ALA A 1 17  ? 22.70680  -0.47508  32.53815   1.000 85.88548  ? 17  ALA A CA  1 
ATOM 138   C C   . ALA A 1 17  ? 23.32522  -0.96847  33.84036   1.000 88.58233  ? 17  ALA A C   1 
ATOM 139   O O   . ALA A 1 17  ? 23.33993  -2.17519  34.10699   1.000 89.91642  ? 17  ALA A O   1 
ATOM 140   C CB  . ALA A 1 17  ? 23.76643  -0.36701  31.44432   1.000 81.99246  ? 17  ALA A CB  1 
ATOM 141   N N   . GLU A 1 18  ? 23.83940  -0.05244  34.66521   1.000 109.46447 ? 18  GLU A N   1 
ATOM 142   C CA  . GLU A 1 18  ? 24.38932  -0.45150  35.95679   1.000 115.40345 ? 18  GLU A CA  1 
ATOM 143   C C   . GLU A 1 18  ? 23.29723  -0.96092  36.88913   1.000 117.43642 ? 18  GLU A C   1 
ATOM 144   O O   . GLU A 1 18  ? 23.50024  -1.94005  37.61710   1.000 117.69737 ? 18  GLU A O   1 
ATOM 145   C CB  . GLU A 1 18  ? 25.12978  0.72491   36.59190   1.000 124.36556 ? 18  GLU A CB  1 
ATOM 146   C CG  . GLU A 1 18  ? 25.81440  0.39640   37.90664   1.000 145.84504 ? 18  GLU A CG  1 
ATOM 147   C CD  . GLU A 1 18  ? 26.73528  1.50509   38.37783   1.000 164.68505 ? 18  GLU A CD  1 
ATOM 148   O OE1 . GLU A 1 18  ? 26.95775  2.46507   37.60967   1.000 171.13166 ? 18  GLU A OE1 1 
ATOM 149   O OE2 . GLU A 1 18  ? 27.23710  1.41550   39.51808   1.000 169.50346 ? 18  GLU A OE2 1 
ATOM 150   N N   . LYS A 1 19  ? 22.13503  -0.30441  36.88574   1.000 116.81908 ? 19  LYS A N   1 
ATOM 151   C CA  . LYS A 1 19  ? 20.99964  -0.80346  37.65662   1.000 119.21798 ? 19  LYS A CA  1 
ATOM 152   C C   . LYS A 1 19  ? 20.52624  -2.15537  37.13182   1.000 115.87151 ? 19  LYS A C   1 
ATOM 153   O O   . LYS A 1 19  ? 20.16285  -3.04170  37.91403   1.000 126.88848 ? 19  LYS A O   1 
ATOM 154   C CB  . LYS A 1 19  ? 19.86550  0.22181   37.64567   1.000 120.91737 ? 19  LYS A CB  1 
ATOM 155   C CG  . LYS A 1 19  ? 20.14870  1.44016   38.51587   1.000 120.80691 ? 19  LYS A CG  1 
ATOM 156   C CD  . LYS A 1 19  ? 18.96199  2.38618   38.58426   1.000 100.22575 ? 19  LYS A CD  1 
ATOM 157   C CE  . LYS A 1 19  ? 19.26683  3.57340   39.48637   1.000 102.76310 ? 19  LYS A CE  1 
ATOM 158   N NZ  . LYS A 1 19  ? 18.11955  4.51669   39.58907   1.000 104.83299 ? 19  LYS A NZ  1 
ATOM 159   N N   . ALA A 1 20  ? 20.52146  -2.32911  35.80711   1.000 102.93397 ? 20  ALA A N   1 
ATOM 160   C CA  . ALA A 1 20  ? 20.03377  -3.56772  35.20976   1.000 103.88825 ? 20  ALA A CA  1 
ATOM 161   C C   . ALA A 1 20  ? 20.98950  -4.72816  35.45063   1.000 117.71910 ? 20  ALA A C   1 
ATOM 162   O O   . ALA A 1 20  ? 20.55155  -5.88039  35.53628   1.000 135.71700 ? 20  ALA A O   1 
ATOM 163   C CB  . ALA A 1 20  ? 19.80385  -3.37468  33.71118   1.000 99.07744  ? 20  ALA A CB  1 
ATOM 164   N N   . MET A 1 21  ? 22.29145  -4.45532  35.54826   1.000 128.81063 ? 21  MET A N   1 
ATOM 165   C CA  . MET A 1 21  ? 23.23414  -5.52573  35.84535   1.000 114.55469 ? 21  MET A CA  1 
ATOM 166   C C   . MET A 1 21  ? 23.15109  -5.96016  37.30068   1.000 105.39128 ? 21  MET A C   1 
ATOM 167   O O   . MET A 1 21  ? 23.56446  -7.07825  37.62511   1.000 106.08299 ? 21  MET A O   1 
ATOM 168   C CB  . MET A 1 21  ? 24.66261  -5.10566  35.49485   1.000 113.19683 ? 21  MET A CB  1 
ATOM 169   C CG  . MET A 1 21  ? 24.92193  -4.98591  33.99892   1.000 107.68125 ? 21  MET A CG  1 
ATOM 170   S SD  . MET A 1 21  ? 26.66321  -4.73673  33.60256   1.000 102.26199 ? 21  MET A SD  1 
ATOM 171   C CE  . MET A 1 21  ? 27.31048  -6.38372  33.87858   1.000 106.10673 ? 21  MET A CE  1 
ATOM 172   N N   . LYS A 1 22  ? 22.62839  -5.10667  38.17957   1.000 106.34439 ? 22  LYS A N   1 
ATOM 173   C CA  . LYS A 1 22  ? 22.39295  -5.47563  39.56838   1.000 111.74420 ? 22  LYS A CA  1 
ATOM 174   C C   . LYS A 1 22  ? 21.13774  -6.32401  39.74048   1.000 115.19880 ? 22  LYS A C   1 
ATOM 175   O O   . LYS A 1 22  ? 20.69683  -6.53323  40.87546   1.000 120.16050 ? 22  LYS A O   1 
ATOM 176   C CB  . LYS A 1 22  ? 22.28274  -4.21836  40.43620   1.000 118.79822 ? 22  LYS A CB  1 
ATOM 177   C CG  . LYS A 1 22  ? 23.59935  -3.49987  40.68451   1.000 124.15603 ? 22  LYS A CG  1 
ATOM 178   C CD  . LYS A 1 22  ? 23.41330  -2.33853  41.65164   1.000 131.93224 ? 22  LYS A CD  1 
ATOM 179   C CE  . LYS A 1 22  ? 24.73033  -1.63817  41.94520   1.000 130.38603 ? 22  LYS A CE  1 
ATOM 180   N NZ  . LYS A 1 22  ? 24.55550  -0.52550  42.91976   1.000 126.12082 ? 22  LYS A NZ  1 
ATOM 181   N N   . GLU A 1 23  ? 20.55544  -6.80920  38.64199   1.000 115.21045 ? 23  GLU A N   1 
ATOM 182   C CA  . GLU A 1 23  ? 19.39160  -7.68449  38.72161   1.000 129.64084 ? 23  GLU A CA  1 
ATOM 183   C C   . GLU A 1 23  ? 19.79065  -9.10690  39.09544   1.000 131.23650 ? 23  GLU A C   1 
ATOM 184   O O   . GLU A 1 23  ? 19.23083  -9.69186  40.02937   1.000 138.04826 ? 23  GLU A O   1 
ATOM 185   C CB  . GLU A 1 23  ? 18.63419  -7.67658  37.39154   1.000 147.65369 ? 23  GLU A CB  1 
ATOM 186   C CG  . GLU A 1 23  ? 17.84047  -6.40779  37.12004   1.000 157.30289 ? 23  GLU A CG  1 
ATOM 187   C CD  . GLU A 1 23  ? 16.66686  -6.23699  38.06498   1.000 166.11541 ? 23  GLU A CD  1 
ATOM 188   O OE1 . GLU A 1 23  ? 16.17170  -7.25408  38.59601   1.000 170.60510 ? 23  GLU A OE1 1 
ATOM 189   O OE2 . GLU A 1 23  ? 16.23687  -5.08382  38.27472   1.000 167.12488 ? 23  GLU A OE2 1 
ATOM 190   N N   . TYR A 1 24  ? 20.75678  -9.67943  38.37620   1.000 130.95644 ? 24  TYR A N   1 
ATOM 191   C CA  . TYR A 1 24  ? 21.19370  -11.05235 38.59851   1.000 147.62679 ? 24  TYR A CA  1 
ATOM 192   C C   . TYR A 1 24  ? 22.61348  -11.12053 39.15524   1.000 158.19559 ? 24  TYR A C   1 
ATOM 193   O O   . TYR A 1 24  ? 23.35458  -12.06160 38.86137   1.000 172.34626 ? 24  TYR A O   1 
ATOM 194   C CB  . TYR A 1 24  ? 21.10377  -11.85200 37.29916   1.000 155.51339 ? 24  TYR A CB  1 
ATOM 195   C CG  . TYR A 1 24  ? 19.71789  -12.35479 36.96191   1.000 185.57348 ? 24  TYR A CG  1 
ATOM 196   C CD1 . TYR A 1 24  ? 18.59789  -11.87139 37.62645   1.000 206.46867 ? 24  TYR A CD1 1 
ATOM 197   C CD2 . TYR A 1 24  ? 19.52985  -13.30647 35.96846   1.000 195.20101 ? 24  TYR A CD2 1 
ATOM 198   C CE1 . TYR A 1 24  ? 17.33073  -12.32601 37.31575   1.000 213.82949 ? 24  TYR A CE1 1 
ATOM 199   C CE2 . TYR A 1 24  ? 18.26714  -13.76767 35.65069   1.000 209.62856 ? 24  TYR A CE2 1 
ATOM 200   C CZ  . TYR A 1 24  ? 17.17135  -13.27435 36.32715   1.000 208.49819 ? 24  TYR A CZ  1 
ATOM 201   O OH  . TYR A 1 24  ? 15.91207  -13.73105 36.01325   1.000 191.18704 ? 24  TYR A OH  1 
ATOM 202   N N   . GLY A 1 25  ? 23.00211  -10.13569 39.96396   1.000 155.90403 ? 25  GLY A N   1 
ATOM 203   C CA  . GLY A 1 25  ? 24.31273  -10.15720 40.58741   1.000 152.84872 ? 25  GLY A CA  1 
ATOM 204   C C   . GLY A 1 25  ? 25.46516  -10.11715 39.61294   1.000 154.53791 ? 25  GLY A C   1 
ATOM 205   O O   . GLY A 1 25  ? 26.56109  -10.57984 39.93804   1.000 118.70024 ? 25  GLY A O   1 
ATOM 206   N N   . GLU A 1 26  ? 25.24554  -9.57431  38.41872   1.000 137.10676 ? 26  GLU A N   1 
ATOM 207   C CA  . GLU A 1 26  ? 26.26454  -9.52432  37.37314   1.000 138.37813 ? 26  GLU A CA  1 
ATOM 208   C C   . GLU A 1 26  ? 27.28286  -8.44214  37.70537   1.000 130.22499 ? 26  GLU A C   1 
ATOM 209   O O   . GLU A 1 26  ? 27.00880  -7.24806  37.56550   1.000 103.74995 ? 26  GLU A O   1 
ATOM 210   C CB  . GLU A 1 26  ? 25.61631  -9.27778  36.01662   1.000 138.27694 ? 26  GLU A CB  1 
ATOM 211   C CG  . GLU A 1 26  ? 24.69353  -10.39626 35.56788   1.000 135.63168 ? 26  GLU A CG  1 
ATOM 212   C CD  . GLU A 1 26  ? 25.45269  -11.61549 35.08061   1.000 125.40545 ? 26  GLU A CD  1 
ATOM 213   O OE1 . GLU A 1 26  ? 26.59583  -11.45237 34.60376   1.000 115.40537 ? 26  GLU A OE1 1 
ATOM 214   O OE2 . GLU A 1 26  ? 24.90479  -12.73503 35.16808   1.000 128.07743 ? 26  GLU A OE2 1 
ATOM 215   N N   . ASP A 1 27  ? 28.46412  -8.85934  38.15205   1.000 139.22611 ? 27  ASP A N   1 
ATOM 216   C CA  . ASP A 1 27  ? 29.52987  -7.91421  38.45641   1.000 125.10652 ? 27  ASP A CA  1 
ATOM 217   C C   . ASP A 1 27  ? 30.11156  -7.37672  37.15336   1.000 101.04874 ? 27  ASP A C   1 
ATOM 218   O O   . ASP A 1 27  ? 30.56725  -8.15009  36.30457   1.000 97.97953  ? 27  ASP A O   1 
ATOM 219   C CB  . ASP A 1 27  ? 30.61210  -8.58824  39.29556   1.000 118.05978 ? 27  ASP A CB  1 
ATOM 220   C CG  . ASP A 1 27  ? 31.52516  -7.59029  39.97416   1.000 111.31460 ? 27  ASP A CG  1 
ATOM 221   O OD1 . ASP A 1 27  ? 31.30689  -6.37449  39.79802   1.000 112.98135 ? 27  ASP A OD1 1 
ATOM 222   O OD2 . ASP A 1 27  ? 32.46308  -8.01980  40.67726   1.000 111.65891 ? 27  ASP A OD2 1 
ATOM 223   N N   . LEU A 1 28  ? 30.09243  -6.05143  36.99219   1.000 99.15042  ? 28  LEU A N   1 
ATOM 224   C CA  . LEU A 1 28  ? 30.53500  -5.44320  35.74239   1.000 94.40448  ? 28  LEU A CA  1 
ATOM 225   C C   . LEU A 1 28  ? 32.04769  -5.49675  35.55920   1.000 98.34667  ? 28  LEU A C   1 
ATOM 226   O O   . LEU A 1 28  ? 32.52743  -5.29807  34.43815   1.000 99.15892  ? 28  LEU A O   1 
ATOM 227   C CB  . LEU A 1 28  ? 30.04641  -3.99475  35.67195   1.000 90.90154  ? 28  LEU A CB  1 
ATOM 228   C CG  . LEU A 1 28  ? 30.30093  -3.12505  36.90786   1.000 93.73162  ? 28  LEU A CG  1 
ATOM 229   C CD1 . LEU A 1 28  ? 31.63095  -2.39251  36.82088   1.000 91.93252  ? 28  LEU A CD1 1 
ATOM 230   C CD2 . LEU A 1 28  ? 29.15886  -2.14246  37.11831   1.000 97.84327  ? 28  LEU A CD2 1 
ATOM 231   N N   . LYS A 1 29  ? 32.80670  -5.75751  36.62637   1.000 99.53497  ? 29  LYS A N   1 
ATOM 232   C CA  . LYS A 1 29  ? 34.25807  -5.84993  36.49210   1.000 103.46454 ? 29  LYS A CA  1 
ATOM 233   C C   . LYS A 1 29  ? 34.67326  -7.03872  35.63369   1.000 102.61732 ? 29  LYS A C   1 
ATOM 234   O O   . LYS A 1 29  ? 35.74859  -7.01247  35.02279   1.000 101.81076 ? 29  LYS A O   1 
ATOM 235   C CB  . LYS A 1 29  ? 34.92552  -5.93444  37.86689   1.000 107.49958 ? 29  LYS A CB  1 
ATOM 236   C CG  . LYS A 1 29  ? 34.95451  -4.62724  38.65685   1.000 115.67085 ? 29  LYS A CG  1 
ATOM 237   C CD  . LYS A 1 29  ? 33.63837  -4.32906  39.35156   1.000 135.81957 ? 29  LYS A CD  1 
ATOM 238   C CE  . LYS A 1 29  ? 33.74792  -3.09177  40.22705   1.000 152.16869 ? 29  LYS A CE  1 
ATOM 239   N NZ  . LYS A 1 29  ? 32.45408  -2.76531  40.88758   1.000 157.99285 ? 29  LYS A NZ  1 
ATOM 240   N N   . ILE A 1 30  ? 33.84617  -8.08060  35.56998   1.000 99.12244  ? 30  ILE A N   1 
ATOM 241   C CA  . ILE A 1 30  ? 34.15835  -9.25593  34.76419   1.000 99.77858  ? 30  ILE A CA  1 
ATOM 242   C C   . ILE A 1 30  ? 33.39244  -9.19396  33.44905   1.000 109.54412 ? 30  ILE A C   1 
ATOM 243   O O   . ILE A 1 30  ? 33.98914  -9.23727  32.36733   1.000 116.38118 ? 30  ILE A O   1 
ATOM 244   C CB  . ILE A 1 30  ? 33.83440  -10.55383 35.52600   1.000 95.64334  ? 30  ILE A CB  1 
ATOM 245   C CG1 . ILE A 1 30  ? 34.38459  -10.48955 36.95192   1.000 99.50562  ? 30  ILE A CG1 1 
ATOM 246   C CG2 . ILE A 1 30  ? 34.39859  -11.75988 34.78670   1.000 95.22369  ? 30  ILE A CG2 1 
ATOM 247   C CD1 . ILE A 1 30  ? 35.88127  -10.30281 37.02484   1.000 98.32889  ? 30  ILE A CD1 1 
ATOM 248   N N   . GLU A 1 31  ? 32.06471  -9.09334  33.53323   1.000 100.69000 ? 31  GLU A N   1 
ATOM 249   C CA  . GLU A 1 31  ? 31.20183  -9.09289  32.35076   1.000 90.84616  ? 31  GLU A CA  1 
ATOM 250   C C   . GLU A 1 31  ? 31.19904  -7.70447  31.70784   1.000 98.15560  ? 31  GLU A C   1 
ATOM 251   O O   . GLU A 1 31  ? 30.20818  -6.97120  31.71868   1.000 122.66294 ? 31  GLU A O   1 
ATOM 252   C CB  . GLU A 1 31  ? 29.79362  -9.53873  32.71903   1.000 94.32004  ? 31  GLU A CB  1 
ATOM 253   C CG  . GLU A 1 31  ? 29.73138  -10.87526 33.43617   1.000 106.65911 ? 31  GLU A CG  1 
ATOM 254   C CD  . GLU A 1 31  ? 30.12176  -12.03366 32.53855   1.000 123.04847 ? 31  GLU A CD  1 
ATOM 255   O OE1 . GLU A 1 31  ? 29.90627  -11.93716 31.31147   1.000 126.44942 ? 31  GLU A OE1 1 
ATOM 256   O OE2 . GLU A 1 31  ? 30.64304  -13.04160 33.06031   1.000 134.93894 ? 31  GLU A OE2 1 
ATOM 257   N N   . THR A 1 32  ? 32.35015  -7.34544  31.13483   1.000 90.19539  ? 32  THR A N   1 
ATOM 258   C CA  . THR A 1 32  ? 32.45454  -6.05839  30.45500   1.000 89.97190  ? 32  THR A CA  1 
ATOM 259   C C   . THR A 1 32  ? 31.71415  -6.07975  29.12209   1.000 105.36007 ? 32  THR A C   1 
ATOM 260   O O   . THR A 1 32  ? 31.07685  -5.08885  28.73777   1.000 112.94497 ? 32  THR A O   1 
ATOM 261   C CB  . THR A 1 32  ? 33.92537  -5.69900  30.24476   1.000 83.89399  ? 32  THR A CB  1 
ATOM 262   O OG1 . THR A 1 32  ? 34.56810  -6.73835  29.49575   1.000 81.38372  ? 32  THR A OG1 1 
ATOM 263   C CG2 . THR A 1 32  ? 34.63142  -5.54666  31.58465   1.000 80.03375  ? 32  THR A CG2 1 
ATOM 264   N N   . ASN A 1 33  ? 31.77368  -7.20865  28.41135   1.000 105.00473 ? 33  ASN A N   1 
ATOM 265   C CA  . ASN A 1 33  ? 31.10447  -7.30743  27.11878   1.000 92.55854  ? 33  ASN A CA  1 
ATOM 266   C C   . ASN A 1 33  ? 29.58835  -7.30705  27.28005   1.000 94.16005  ? 33  ASN A C   1 
ATOM 267   O O   . ASN A 1 33  ? 28.87277  -6.72630  26.45520   1.000 100.37582 ? 33  ASN A O   1 
ATOM 268   C CB  . ASN A 1 33  ? 31.58659  -8.55174  26.37363   1.000 84.72328  ? 33  ASN A CB  1 
ATOM 269   C CG  . ASN A 1 33  ? 33.06404  -8.48034  26.02013   1.000 84.37283  ? 33  ASN A CG  1 
ATOM 270   O OD1 . ASN A 1 33  ? 33.85256  -9.34162  26.40683   1.000 87.04174  ? 33  ASN A OD1 1 
ATOM 271   N ND2 . ASN A 1 33  ? 33.44442  -7.44296  25.28416   1.000 83.54633  ? 33  ASN A ND2 1 
ATOM 272   N N   . LYS A 1 34  ? 29.07779  -7.95363  28.33304   1.000 89.28827  ? 34  LYS A N   1 
ATOM 273   C CA  . LYS A 1 34  ? 27.64789  -7.87074  28.61851   1.000 105.53453 ? 34  LYS A CA  1 
ATOM 274   C C   . LYS A 1 34  ? 27.23109  -6.43428  28.89953   1.000 107.59868 ? 34  LYS A C   1 
ATOM 275   O O   . LYS A 1 34  ? 26.17104  -5.98566  28.44807   1.000 119.71063 ? 34  LYS A O   1 
ATOM 276   C CB  . LYS A 1 34  ? 27.28082  -8.76130  29.80498   1.000 114.84848 ? 34  LYS A CB  1 
ATOM 277   C CG  . LYS A 1 34  ? 25.79760  -8.69669  30.14600   1.000 106.76416 ? 34  LYS A CG  1 
ATOM 278   C CD  . LYS A 1 34  ? 25.43484  -9.51112  31.37276   1.000 93.25514  ? 34  LYS A CD  1 
ATOM 279   C CE  . LYS A 1 34  ? 23.92383  -9.62172  31.50348   1.000 94.70116  ? 34  LYS A CE  1 
ATOM 280   N NZ  . LYS A 1 34  ? 23.50582  -10.54895 32.58710   1.000 98.62689  ? 34  LYS A NZ  1 
ATOM 281   N N   . PHE A 1 35  ? 28.04878  -5.70643  29.66165   1.000 86.77100  ? 35  PHE A N   1 
ATOM 282   C CA  . PHE A 1 35  ? 27.77118  -4.30221  29.94223   1.000 79.84002  ? 35  PHE A CA  1 
ATOM 283   C C   . PHE A 1 35  ? 27.69329  -3.49749  28.64909   1.000 88.16026  ? 35  PHE A C   1 
ATOM 284   O O   . PHE A 1 35  ? 26.76245  -2.70398  28.44679   1.000 112.01594 ? 35  PHE A O   1 
ATOM 285   C CB  . PHE A 1 35  ? 28.85187  -3.75172  30.87532   1.000 73.82868  ? 35  PHE A CB  1 
ATOM 286   C CG  . PHE A 1 35  ? 28.64984  -2.32062  31.27373   1.000 69.01406  ? 35  PHE A CG  1 
ATOM 287   C CD1 . PHE A 1 35  ? 27.41519  -1.87462  31.70888   1.000 77.87725  ? 35  PHE A CD1 1 
ATOM 288   C CD2 . PHE A 1 35  ? 29.70362  -1.42321  31.22685   1.000 67.54396  ? 35  PHE A CD2 1 
ATOM 289   C CE1 . PHE A 1 35  ? 27.23209  -0.55864  32.08210   1.000 97.91092  ? 35  PHE A CE1 1 
ATOM 290   C CE2 . PHE A 1 35  ? 29.52658  -0.10562  31.59787   1.000 82.66910  ? 35  PHE A CE2 1 
ATOM 291   C CZ  . PHE A 1 35  ? 28.28851  0.32730   32.02597   1.000 100.05808 ? 35  PHE A CZ  1 
ATOM 292   N N   . ALA A 1 36  ? 28.66685  -3.69907  27.75602   1.000 77.48529  ? 36  ALA A N   1 
ATOM 293   C CA  . ALA A 1 36  ? 28.65402  -3.00365  26.47191   1.000 74.84488  ? 36  ALA A CA  1 
ATOM 294   C C   . ALA A 1 36  ? 27.40516  -3.34635  25.66764   1.000 81.33838  ? 36  ALA A C   1 
ATOM 295   O O   . ALA A 1 36  ? 26.76984  -2.45827  25.08450   1.000 81.61967  ? 36  ALA A O   1 
ATOM 296   C CB  . ALA A 1 36  ? 29.91425  -3.34353  25.67824   1.000 72.57303  ? 36  ALA A CB  1 
ATOM 297   N N   . ALA A 1 37  ? 27.04180  -4.63136  25.62043   1.000 86.33757  ? 37  ALA A N   1 
ATOM 298   C CA  . ALA A 1 37  ? 25.88271  -5.04882  24.83698   1.000 85.90300  ? 37  ALA A CA  1 
ATOM 299   C C   . ALA A 1 37  ? 24.59684  -4.45396  25.39509   1.000 99.32840  ? 37  ALA A C   1 
ATOM 300   O O   . ALA A 1 37  ? 23.71051  -4.04685  24.63461   1.000 117.99486 ? 37  ALA A O   1 
ATOM 301   C CB  . ALA A 1 37  ? 25.79630  -6.57408  24.79547   1.000 69.93513  ? 37  ALA A CB  1 
ATOM 302   N N   . ILE A 1 38  ? 24.47989  -4.38725  26.72254   1.000 87.38362  ? 38  ILE A N   1 
ATOM 303   C CA  . ILE A 1 38  ? 23.27634  -3.83112  27.33180   1.000 75.63851  ? 38  ILE A CA  1 
ATOM 304   C C   . ILE A 1 38  ? 23.18805  -2.33297  27.06483   1.000 74.25853  ? 38  ILE A C   1 
ATOM 305   O O   . ILE A 1 38  ? 22.10859  -1.80531  26.76213   1.000 81.57539  ? 38  ILE A O   1 
ATOM 306   C CB  . ILE A 1 38  ? 23.24601  -4.15202  28.83800   1.000 78.73109  ? 38  ILE A CB  1 
ATOM 307   C CG1 . ILE A 1 38  ? 23.06113  -5.65461  29.05715   1.000 84.79640  ? 38  ILE A CG1 1 
ATOM 308   C CG2 . ILE A 1 38  ? 22.14199  -3.37778  29.53985   1.000 80.95584  ? 38  ILE A CG2 1 
ATOM 309   C CD1 . ILE A 1 38  ? 23.04850  -6.05837  30.51246   1.000 104.61524 ? 38  ILE A CD1 1 
ATOM 310   N N   . CYS A 1 39  ? 24.31875  -1.62449  27.15558   1.000 72.62183  ? 39  CYS A N   1 
ATOM 311   C CA  . CYS A 1 39  ? 24.31518  -0.20185  26.82281   1.000 78.39294  ? 39  CYS A CA  1 
ATOM 312   C C   . CYS A 1 39  ? 23.91978  0.02136   25.36688   1.000 99.69173  ? 39  CYS A C   1 
ATOM 313   O O   . CYS A 1 39  ? 23.14854  0.94102   25.05389   1.000 105.51005 ? 39  CYS A O   1 
ATOM 314   C CB  . CYS A 1 39  ? 25.68877  0.40717   27.10265   1.000 74.00101  ? 39  CYS A CB  1 
ATOM 315   S SG  . CYS A 1 39  ? 25.99940  0.79368   28.83850   1.000 81.46527  ? 39  CYS A SG  1 
ATOM 316   N N   . THR A 1 40  ? 24.43575  -0.81777  24.46436   1.000 97.93450  ? 40  THR A N   1 
ATOM 317   C CA  . THR A 1 40  ? 24.07505  -0.71878  23.05323   1.000 91.84610  ? 40  THR A CA  1 
ATOM 318   C C   . THR A 1 40  ? 22.57970  -0.93465  22.85282   1.000 62.93632  ? 40  THR A C   1 
ATOM 319   O O   . THR A 1 40  ? 21.92304  -0.17979  22.12503   1.000 62.85913  ? 40  THR A O   1 
ATOM 320   C CB  . THR A 1 40  ? 24.87813  -1.73187  22.23621   1.000 98.66497  ? 40  THR A CB  1 
ATOM 321   O OG1 . THR A 1 40  ? 26.27940  -1.47717  22.39655   1.000 105.01040 ? 40  THR A OG1 1 
ATOM 322   C CG2 . THR A 1 40  ? 24.51460  -1.63569  20.76229   1.000 94.40623  ? 40  THR A CG2 1 
ATOM 323   N N   . HIS A 1 41  ? 22.02962  -1.97851  23.48030   1.000 67.55731  ? 41  HIS A N   1 
ATOM 324   C CA  . HIS A 1 41  ? 20.59974  -2.25169  23.36709   1.000 69.57354  ? 41  HIS A CA  1 
ATOM 325   C C   . HIS A 1 41  ? 19.77330  -1.07327  23.86625   1.000 76.86735  ? 41  HIS A C   1 
ATOM 326   O O   . HIS A 1 41  ? 18.77737  -0.69090  23.23731   1.000 102.95658 ? 41  HIS A O   1 
ATOM 327   C CB  . HIS A 1 41  ? 20.24878  -3.52364  24.13998   1.000 71.89230  ? 41  HIS A CB  1 
ATOM 328   C CG  . HIS A 1 41  ? 18.90958  -4.09546  23.79213   1.000 78.69659  ? 41  HIS A CG  1 
ATOM 329   N ND1 . HIS A 1 41  ? 17.73278  -3.61238  24.32275   1.000 82.65647  ? 41  HIS A ND1 1 
ATOM 330   C CD2 . HIS A 1 41  ? 18.56081  -5.11023  22.96624   1.000 79.75099  ? 41  HIS A CD2 1 
ATOM 331   C CE1 . HIS A 1 41  ? 16.71699  -4.30573  23.84006   1.000 86.04478  ? 41  HIS A CE1 1 
ATOM 332   N NE2 . HIS A 1 41  ? 17.19215  -5.21976  23.01346   1.000 85.24252  ? 41  HIS A NE2 1 
ATOM 333   N N   . LEU A 1 42  ? 20.17852  -0.47768  24.99123   1.000 73.25472  ? 42  LEU A N   1 
ATOM 334   C CA  . LEU A 1 42  ? 19.42408  0.64284   25.54406   1.000 81.43521  ? 42  LEU A CA  1 
ATOM 335   C C   . LEU A 1 42  ? 19.46411  1.85162   24.61685   1.000 81.38721  ? 42  LEU A C   1 
ATOM 336   O O   . LEU A 1 42  ? 18.43424  2.50277   24.39240   1.000 86.21779  ? 42  LEU A O   1 
ATOM 337   C CB  . LEU A 1 42  ? 19.96129  1.01030   26.92706   1.000 76.12106  ? 42  LEU A CB  1 
ATOM 338   C CG  . LEU A 1 42  ? 19.68283  0.00020   28.04112   1.000 78.60844  ? 42  LEU A CG  1 
ATOM 339   C CD1 . LEU A 1 42  ? 20.27738  0.46619   29.36219   1.000 80.11327  ? 42  LEU A CD1 1 
ATOM 340   C CD2 . LEU A 1 42  ? 18.18781  -0.23993  28.17587   1.000 81.13863  ? 42  LEU A CD2 1 
ATOM 341   N N   . GLU A 1 43  ? 20.63713  2.16497   24.05817   1.000 88.79660  ? 43  GLU A N   1 
ATOM 342   C CA  . GLU A 1 43  ? 20.71315  3.31888   23.16585   1.000 93.06008  ? 43  GLU A CA  1 
ATOM 343   C C   . GLU A 1 43  ? 19.94075  3.07366   21.87484   1.000 77.39417  ? 43  GLU A C   1 
ATOM 344   O O   . GLU A 1 43  ? 19.32307  3.99888   21.33037   1.000 79.73366  ? 43  GLU A O   1 
ATOM 345   C CB  . GLU A 1 43  ? 22.16809  3.66732   22.85413   1.000 103.34773 ? 43  GLU A CB  1 
ATOM 346   C CG  . GLU A 1 43  ? 22.34162  5.09052   22.33562   1.000 106.93431 ? 43  GLU A CG  1 
ATOM 347   C CD  . GLU A 1 43  ? 23.76996  5.40996   21.94221   1.000 113.02189 ? 43  GLU A CD  1 
ATOM 348   O OE1 . GLU A 1 43  ? 24.56073  4.46455   21.74607   1.000 110.92809 ? 43  GLU A OE1 1 
ATOM 349   O OE2 . GLU A 1 43  ? 24.10192  6.60882   21.82773   1.000 123.23388 ? 43  GLU A OE2 1 
ATOM 350   N N   . VAL A 1 44  ? 19.95028  1.83359   21.37722   1.000 74.01094  ? 44  VAL A N   1 
ATOM 351   C CA  . VAL A 1 44  ? 19.16094  1.50524   20.19216   1.000 73.36171  ? 44  VAL A CA  1 
ATOM 352   C C   . VAL A 1 44  ? 17.67733  1.69879   20.47459   1.000 77.65669  ? 44  VAL A C   1 
ATOM 353   O O   . VAL A 1 44  ? 16.95579  2.32038   19.68703   1.000 81.60664  ? 44  VAL A O   1 
ATOM 354   C CB  . VAL A 1 44  ? 19.46478  0.07273   19.71735   1.000 75.79902  ? 44  VAL A CB  1 
ATOM 355   C CG1 . VAL A 1 44  ? 18.42482  -0.38308  18.70385   1.000 71.56376  ? 44  VAL A CG1 1 
ATOM 356   C CG2 . VAL A 1 44  ? 20.85419  0.00393   19.10791   1.000 97.28665  ? 44  VAL A CG2 1 
ATOM 357   N N   . CYS A 1 45  ? 17.20295  1.17894   21.61099   1.000 73.76413  ? 45  CYS A N   1 
ATOM 358   C CA  . CYS A 1 45  ? 15.80213  1.36545   21.98317   1.000 76.34268  ? 45  CYS A CA  1 
ATOM 359   C C   . CYS A 1 45  ? 15.44582  2.84441   22.08617   1.000 79.23186  ? 45  CYS A C   1 
ATOM 360   O O   . CYS A 1 45  ? 14.38312  3.27050   21.61350   1.000 80.56850  ? 45  CYS A O   1 
ATOM 361   C CB  . CYS A 1 45  ? 15.50556  0.64789   23.29882   1.000 78.26371  ? 45  CYS A CB  1 
ATOM 362   S SG  . CYS A 1 45  ? 15.63656  -1.15064  23.21416   1.000 86.66581  ? 45  CYS A SG  1 
ATOM 363   N N   . PHE A 1 46  ? 16.31727  3.64226   22.70800   1.000 98.52028  ? 46  PHE A N   1 
ATOM 364   C CA  . PHE A 1 46  ? 16.01694  5.06038   22.89022   1.000 116.30481 ? 46  PHE A CA  1 
ATOM 365   C C   . PHE A 1 46  ? 15.94146  5.78886   21.55223   1.000 104.67770 ? 46  PHE A C   1 
ATOM 366   O O   . PHE A 1 46  ? 14.96596  6.49841   21.27896   1.000 99.57438  ? 46  PHE A O   1 
ATOM 367   C CB  . PHE A 1 46  ? 17.05218  5.70554   23.81022   1.000 131.48643 ? 46  PHE A CB  1 
ATOM 368   C CG  . PHE A 1 46  ? 16.80633  5.44400   25.26826   1.000 128.56845 ? 46  PHE A CG  1 
ATOM 369   C CD1 . PHE A 1 46  ? 15.66057  4.78181   25.67848   1.000 115.96223 ? 46  PHE A CD1 1 
ATOM 370   C CD2 . PHE A 1 46  ? 17.71317  5.86003   26.22792   1.000 131.81603 ? 46  PHE A CD2 1 
ATOM 371   C CE1 . PHE A 1 46  ? 15.42432  4.53764   27.01665   1.000 111.94316 ? 46  PHE A CE1 1 
ATOM 372   C CE2 . PHE A 1 46  ? 17.48253  5.61831   27.57015   1.000 124.87420 ? 46  PHE A CE2 1 
ATOM 373   C CZ  . PHE A 1 46  ? 16.33599  4.95591   27.96420   1.000 115.90598 ? 46  PHE A CZ  1 
ATOM 374   N N   . MET A 1 47  ? 16.96303  5.63398   20.70357   1.000 91.74506  ? 47  MET A N   1 
ATOM 375   C CA  . MET A 1 47  ? 16.91202  6.25427   19.38176   1.000 86.40041  ? 47  MET A CA  1 
ATOM 376   C C   . MET A 1 47  ? 15.80088  5.67220   18.51526   1.000 79.39762  ? 47  MET A C   1 
ATOM 377   O O   . MET A 1 47  ? 15.42916  6.28089   17.50597   1.000 87.21082  ? 47  MET A O   1 
ATOM 378   C CB  . MET A 1 47  ? 18.25948  6.10338   18.67409   1.000 108.89115 ? 47  MET A CB  1 
ATOM 379   C CG  . MET A 1 47  ? 19.37692  6.94516   19.26976   1.000 128.41512 ? 47  MET A CG  1 
ATOM 380   S SD  . MET A 1 47  ? 20.88842  6.84825   18.29355   1.000 125.65186 ? 47  MET A SD  1 
ATOM 381   C CE  . MET A 1 47  ? 21.29390  5.11625   18.49406   1.000 113.24882 ? 47  MET A CE  1 
ATOM 382   N N   . TYR A 1 48  ? 15.26419  4.51097   18.89092   1.000 77.49522  ? 48  TYR A N   1 
ATOM 383   C CA  . TYR A 1 48  ? 14.15669  3.89664   18.17047   1.000 81.03276  ? 48  TYR A CA  1 
ATOM 384   C C   . TYR A 1 48  ? 12.82236  4.52842   18.55541   1.000 87.15037  ? 48  TYR A C   1 
ATOM 385   O O   . TYR A 1 48  ? 11.97332  4.76903   17.68970   1.000 108.09843 ? 48  TYR A O   1 
ATOM 386   C CB  . TYR A 1 48  ? 14.16403  2.39100   18.45033   1.000 92.22688  ? 48  TYR A CB  1 
ATOM 387   C CG  . TYR A 1 48  ? 13.30776  1.52814   17.54972   1.000 92.44208  ? 48  TYR A CG  1 
ATOM 388   C CD1 . TYR A 1 48  ? 12.74249  2.02823   16.38790   1.000 77.59451  ? 48  TYR A CD1 1 
ATOM 389   C CD2 . TYR A 1 48  ? 13.10125  0.18936   17.85097   1.000 104.34927 ? 48  TYR A CD2 1 
ATOM 390   C CE1 . TYR A 1 48  ? 11.96955  1.22227   15.57293   1.000 79.00251  ? 48  TYR A CE1 1 
ATOM 391   C CE2 . TYR A 1 48  ? 12.33775  -0.62078  17.03971   1.000 95.55938  ? 48  TYR A CE2 1 
ATOM 392   C CZ  . TYR A 1 48  ? 11.77477  -0.09958  15.89970   1.000 88.24374  ? 48  TYR A CZ  1 
ATOM 393   O OH  . TYR A 1 48  ? 11.01047  -0.90520  15.08735   1.000 100.01823 ? 48  TYR A OH  1 
ATOM 394   N N   . SER A 1 49  ? 12.63000  4.81523   19.84516   1.000 86.49238  ? 49  SER A N   1 
ATOM 395   C CA  . SER A 1 49  ? 11.35823  5.34381   20.32882   1.000 110.20427 ? 49  SER A CA  1 
ATOM 396   C C   . SER A 1 49  ? 11.21632  6.85358   20.16144   1.000 108.05431 ? 49  SER A C   1 
ATOM 397   O O   . SER A 1 49  ? 10.08654  7.35433   20.16033   1.000 118.43264 ? 49  SER A O   1 
ATOM 398   C CB  . SER A 1 49  ? 11.17131  4.98339   21.80540   1.000 129.35475 ? 49  SER A CB  1 
ATOM 399   O OG  . SER A 1 49  ? 12.10984  5.66186   22.62403   1.000 131.64357 ? 49  SER A OG  1 
ATOM 400   N N   . ASP A 1 50  ? 12.31747  7.58714   20.02361   1.000 112.28981 ? 50  ASP A N   1 
ATOM 401   C CA  . ASP A 1 50  ? 12.24542  9.04049   19.96047   1.000 115.81608 ? 50  ASP A CA  1 
ATOM 402   C C   . ASP A 1 50  ? 11.60826  9.50834   18.65185   1.000 120.79987 ? 50  ASP A C   1 
ATOM 403   O O   . ASP A 1 50  ? 11.59631  8.79663   17.64303   1.000 117.60693 ? 50  ASP A O   1 
ATOM 404   C CB  . ASP A 1 50  ? 13.64034  9.65283   20.10257   1.000 116.88242 ? 50  ASP A CB  1 
ATOM 405   C CG  . ASP A 1 50  ? 14.14675  9.63301   21.53268   1.000 122.67797 ? 50  ASP A CG  1 
ATOM 406   O OD1 . ASP A 1 50  ? 13.31088  9.64368   22.45980   1.000 124.18457 ? 50  ASP A OD1 1 
ATOM 407   O OD2 . ASP A 1 50  ? 15.38065  9.61481   21.73046   1.000 121.17846 ? 50  ASP A OD2 1 
ATOM 408   N N   . PHE A 1 51  ? 11.05718  10.72624  18.69003   1.000 122.42776 ? 51  PHE A N   1 
ATOM 409   C CA  . PHE A 1 51  ? 10.62482  11.47496  17.50867   1.000 132.71397 ? 51  PHE A CA  1 
ATOM 410   C C   . PHE A 1 51  ? 9.43847   10.86328  16.77390   1.000 113.52217 ? 51  PHE A C   1 
ATOM 411   O O   . PHE A 1 51  ? 9.21805   11.18379  15.60315   1.000 110.59453 ? 51  PHE A O   1 
ATOM 412   C CB  . PHE A 1 51  ? 11.77603  11.67102  16.51443   1.000 154.13361 ? 51  PHE A CB  1 
ATOM 413   C CG  . PHE A 1 51  ? 12.83757  12.61675  16.98382   1.000 157.99414 ? 51  PHE A CG  1 
ATOM 414   C CD1 . PHE A 1 51  ? 12.54068  13.60462  17.90418   1.000 161.49223 ? 51  PHE A CD1 1 
ATOM 415   C CD2 . PHE A 1 51  ? 14.12910  12.52946  16.49290   1.000 152.88451 ? 51  PHE A CD2 1 
ATOM 416   C CE1 . PHE A 1 51  ? 13.50644  14.49059  18.32133   1.000 161.08359 ? 51  PHE A CE1 1 
ATOM 417   C CE2 . PHE A 1 51  ? 15.10618  13.40899  16.91663   1.000 148.90332 ? 51  PHE A CE2 1 
ATOM 418   C CZ  . PHE A 1 51  ? 14.79391  14.39016  17.83386   1.000 154.73898 ? 51  PHE A CZ  1 
ATOM 419   N N   . HIS A 1 52  ? 8.65506   9.98918   17.39894   1.000 105.78251 ? 52  HIS A N   1 
ATOM 420   C CA  . HIS A 1 52  ? 7.53891   9.35020   16.70653   1.000 105.22943 ? 52  HIS A CA  1 
ATOM 421   C C   . HIS A 1 52  ? 6.24927   9.59205   17.47798   1.000 113.40793 ? 52  HIS A C   1 
ATOM 422   O O   . HIS A 1 52  ? 6.07226   9.06217   18.57820   1.000 131.30603 ? 52  HIS A O   1 
ATOM 423   C CB  . HIS A 1 52  ? 7.80240   7.85848   16.52814   1.000 105.12529 ? 52  HIS A CB  1 
ATOM 424   C CG  . HIS A 1 52  ? 8.94518   7.56279   15.61126   1.000 124.33260 ? 52  HIS A CG  1 
ATOM 425   N ND1 . HIS A 1 52  ? 10.21732  7.30118   16.07161   1.000 126.71737 ? 52  HIS A ND1 1 
ATOM 426   C CD2 . HIS A 1 52  ? 9.01843   7.52760   14.26019   1.000 128.80236 ? 52  HIS A CD2 1 
ATOM 427   C CE1 . HIS A 1 52  ? 11.02032  7.09384   15.04366   1.000 124.63071 ? 52  HIS A CE1 1 
ATOM 428   N NE2 . HIS A 1 52  ? 10.31873  7.23100   13.93308   1.000 127.45599 ? 52  HIS A NE2 1 
ATOM 429   N N   . PHE A 1 53  ? 5.35358   10.39275  16.90426   1.000 109.64512 ? 53  PHE A N   1 
ATOM 430   C CA  . PHE A 1 53  ? 4.05537   10.67625  17.50088   1.000 109.74828 ? 53  PHE A CA  1 
ATOM 431   C C   . PHE A 1 53  ? 2.95684   10.15709  16.57687   1.000 128.60103 ? 53  PHE A C   1 
ATOM 432   O O   . PHE A 1 53  ? 3.20850   9.78527   15.42927   1.000 144.81883 ? 53  PHE A O   1 
ATOM 433   C CB  . PHE A 1 53  ? 3.87044   12.17884  17.77548   1.000 104.27165 ? 53  PHE A CB  1 
ATOM 434   C CG  . PHE A 1 53  ? 4.74464   12.72265  18.88859   1.000 109.84996 ? 53  PHE A CG  1 
ATOM 435   C CD1 . PHE A 1 53  ? 5.63949   11.90964  19.56569   1.000 109.81413 ? 53  PHE A CD1 1 
ATOM 436   C CD2 . PHE A 1 53  ? 4.63383   14.04687  19.28212   1.000 122.89481 ? 53  PHE A CD2 1 
ATOM 437   C CE1 . PHE A 1 53  ? 6.42681   12.40765  20.58751   1.000 113.28293 ? 53  PHE A CE1 1 
ATOM 438   C CE2 . PHE A 1 53  ? 5.41787   14.55185  20.30770   1.000 134.78643 ? 53  PHE A CE2 1 
ATOM 439   C CZ  . PHE A 1 53  ? 6.31463   13.72955  20.96028   1.000 128.05411 ? 53  PHE A CZ  1 
ATOM 440   N N   . ILE A 1 54  ? 1.72264   10.14092  17.07937   1.000 121.75564 ? 54  ILE A N   1 
ATOM 441   C CA  . ILE A 1 54  ? 0.56550   9.66352   16.32450   1.000 124.90404 ? 54  ILE A CA  1 
ATOM 442   C C   . ILE A 1 54  ? -0.37720  10.83654  16.07914   1.000 119.55758 ? 54  ILE A C   1 
ATOM 443   O O   . ILE A 1 54  ? -0.86008  11.46206  17.02906   1.000 125.74865 ? 54  ILE A O   1 
ATOM 444   C CB  . ILE A 1 54  ? -0.15457  8.52411   17.06174   1.000 129.90273 ? 54  ILE A CB  1 
ATOM 445   C CG1 . ILE A 1 54  ? 0.65306   7.22763   16.96440   1.000 138.01506 ? 54  ILE A CG1 1 
ATOM 446   C CG2 . ILE A 1 54  ? -1.55213  8.31992   16.49647   1.000 130.76542 ? 54  ILE A CG2 1 
ATOM 447   C CD1 . ILE A 1 54  ? 0.70511   6.63717   15.57120   1.000 155.51370 ? 54  ILE A CD1 1 
ATOM 448   N N   . ASN A 1 55  ? -0.68461  11.09622  14.80923   1.000 108.88914 ? 55  ASN A N   1 
ATOM 449   C CA  . ASN A 1 55  ? -1.50877  12.23525  14.42413   1.000 112.48269 ? 55  ASN A CA  1 
ATOM 450   C C   . ASN A 1 55  ? -2.96241  12.01837  14.85291   1.000 115.68464 ? 55  ASN A C   1 
ATOM 451   O O   . ASN A 1 55  ? -3.30847  11.03061  15.50756   1.000 115.21329 ? 55  ASN A O   1 
ATOM 452   C CB  . ASN A 1 55  ? -1.40799  12.47465  12.91965   1.000 133.13671 ? 55  ASN A CB  1 
ATOM 453   C CG  . ASN A 1 55  ? -1.63709  13.92611  12.54402   1.000 153.69157 ? 55  ASN A CG  1 
ATOM 454   O OD1 . ASN A 1 55  ? -1.82255  14.78175  13.40982   1.000 160.03637 ? 55  ASN A OD1 1 
ATOM 455   N ND2 . ASN A 1 55  ? -1.62409  14.21080  11.24715   1.000 160.60037 ? 55  ASN A ND2 1 
ATOM 456   N N   . GLU A 1 56  ? -3.82680  12.97566  14.48965   1.000 120.35698 ? 56  GLU A N   1 
ATOM 457   C CA  . GLU A 1 56  ? -5.23532  12.87640  14.86410   1.000 123.76908 ? 56  GLU A CA  1 
ATOM 458   C C   . GLU A 1 56  ? -5.88720  11.63778  14.27042   1.000 124.10671 ? 56  GLU A C   1 
ATOM 459   O O   . GLU A 1 56  ? -6.80348  11.07011  14.87389   1.000 125.77775 ? 56  GLU A O   1 
ATOM 460   C CB  . GLU A 1 56  ? -6.00845  14.11066  14.39360   1.000 127.81821 ? 56  GLU A CB  1 
ATOM 461   C CG  . GLU A 1 56  ? -5.60148  15.42329  15.02578   1.000 128.73161 ? 56  GLU A CG  1 
ATOM 462   C CD  . GLU A 1 56  ? -4.71761  16.25307  14.11000   1.000 128.33327 ? 56  GLU A CD  1 
ATOM 463   O OE1 . GLU A 1 56  ? -4.74930  16.01850  12.88247   1.000 128.60383 ? 56  GLU A OE1 1 
ATOM 464   O OE2 . GLU A 1 56  ? -3.99601  17.14081  14.61105   1.000 128.09423 ? 56  GLU A OE2 1 
ATOM 465   N N   . GLN A 1 57  ? -5.44095  11.21560  13.09431   1.000 134.26758 ? 57  GLN A N   1 
ATOM 466   C CA  . GLN A 1 57  ? -5.86532  9.97452   12.47423   1.000 141.38954 ? 57  GLN A CA  1 
ATOM 467   C C   . GLN A 1 57  ? -4.85216  8.87500   12.79563   1.000 136.86253 ? 57  GLN A C   1 
ATOM 468   O O   . GLN A 1 57  ? -3.94869  9.05015   13.61899   1.000 120.66454 ? 57  GLN A O   1 
ATOM 469   C CB  . GLN A 1 57  ? -6.06337  10.17597  10.97039   1.000 124.58340 ? 57  GLN A CB  1 
ATOM 470   C CG  . GLN A 1 57  ? -7.27571  11.02955  10.60925   1.000 129.17398 ? 57  GLN A CG  1 
ATOM 471   C CD  . GLN A 1 57  ? -7.04540  12.51405  10.82621   1.000 130.18188 ? 57  GLN A CD  1 
ATOM 472   O OE1 . GLN A 1 57  ? -7.74424  13.15339  11.61271   1.000 132.38600 ? 57  GLN A OE1 1 
ATOM 473   N NE2 . GLN A 1 57  ? -6.06476  13.07085  10.12436   1.000 128.91364 ? 57  GLN A NE2 1 
ATOM 474   N N   . GLY A 1 58  ? -4.99598  7.72695   12.13912   1.000 136.69466 ? 58  GLY A N   1 
ATOM 475   C CA  . GLY A 1 58  ? -4.16024  6.57998   12.43389   1.000 135.74008 ? 58  GLY A CA  1 
ATOM 476   C C   . GLY A 1 58  ? -2.87988  6.50609   11.62745   1.000 144.44408 ? 58  GLY A C   1 
ATOM 477   O O   . GLY A 1 58  ? -2.66513  5.54571   10.88153   1.000 155.99230 ? 58  GLY A O   1 
ATOM 478   N N   . GLU A 1 59  ? -2.02057  7.51434   11.76462   1.000 145.34017 ? 59  GLU A N   1 
ATOM 479   C CA  . GLU A 1 59  ? -0.72432  7.51874   11.10166   1.000 144.65332 ? 59  GLU A CA  1 
ATOM 480   C C   . GLU A 1 59  ? 0.31489   8.13750   12.02659   1.000 128.56987 ? 59  GLU A C   1 
ATOM 481   O O   . GLU A 1 59  ? -0.01170  8.85802   12.97288   1.000 137.95777 ? 59  GLU A O   1 
ATOM 482   C CB  . GLU A 1 59  ? -0.76777  8.26314   9.75659    1.000 152.87907 ? 59  GLU A CB  1 
ATOM 483   C CG  . GLU A 1 59  ? -0.62610  9.77454   9.84761    1.000 149.53851 ? 59  GLU A CG  1 
ATOM 484   C CD  . GLU A 1 59  ? -1.93907  10.47119  10.15800   1.000 140.14046 ? 59  GLU A CD  1 
ATOM 485   O OE1 . GLU A 1 59  ? -2.85969  9.81724   10.69170   1.000 133.53321 ? 59  GLU A OE1 1 
ATOM 486   O OE2 . GLU A 1 59  ? -2.05412  11.67741  9.85555    1.000 137.76028 ? 59  GLU A OE2 1 
ATOM 487   N N   . SER A 1 60  ? 1.57809   7.84275   11.73677   1.000 117.35055 ? 60  SER A N   1 
ATOM 488   C CA  . SER A 1 60  ? 2.70639   8.29936   12.53431   1.000 113.37989 ? 60  SER A CA  1 
ATOM 489   C C   . SER A 1 60  ? 3.41295   9.47217   11.86548   1.000 123.42370 ? 60  SER A C   1 
ATOM 490   O O   . SER A 1 60  ? 3.46356   9.57466   10.63695   1.000 162.34987 ? 60  SER A O   1 
ATOM 491   C CB  . SER A 1 60  ? 3.70332   7.16283   12.76307   1.000 108.90489 ? 60  SER A CB  1 
ATOM 492   O OG  . SER A 1 60  ? 4.37330   6.82769   11.56120   1.000 106.66811 ? 60  SER A OG  1 
ATOM 493   N N   . ILE A 1 61  ? 3.95842   10.36331  12.69621   1.000 107.63268 ? 61  ILE A N   1 
ATOM 494   C CA  . ILE A 1 61  ? 4.67863   11.54494  12.23660   1.000 107.89276 ? 61  ILE A CA  1 
ATOM 495   C C   . ILE A 1 61  ? 5.92142   11.74182  13.09716   1.000 105.12296 ? 61  ILE A C   1 
ATOM 496   O O   . ILE A 1 61  ? 6.08580   11.12319  14.15243   1.000 103.49047 ? 61  ILE A O   1 
ATOM 497   C CB  . ILE A 1 61  ? 3.80519   12.81734  12.28006   1.000 111.64588 ? 61  ILE A CB  1 
ATOM 498   C CG1 . ILE A 1 61  ? 3.16553   12.97656  13.66241   1.000 112.55950 ? 61  ILE A CG1 1 
ATOM 499   C CG2 . ILE A 1 61  ? 2.74509   12.77610  11.19264   1.000 114.64139 ? 61  ILE A CG2 1 
ATOM 500   C CD1 . ILE A 1 61  ? 2.31654   14.22383  13.81171   1.000 116.44459 ? 61  ILE A CD1 1 
ATOM 501   N N   . VAL A 1 62  ? 6.78606   12.64775  12.63927   1.000 127.01199 ? 62  VAL A N   1 
ATOM 502   C CA  . VAL A 1 62  ? 8.02959   12.98896  13.31912   1.000 124.41648 ? 62  VAL A CA  1 
ATOM 503   C C   . VAL A 1 62  ? 7.86835   14.36158  13.95690   1.000 129.66631 ? 62  VAL A C   1 
ATOM 504   O O   . VAL A 1 62  ? 7.10725   15.20846  13.47501   1.000 128.54843 ? 62  VAL A O   1 
ATOM 505   C CB  . VAL A 1 62  ? 9.23821   12.95959  12.35941   1.000 112.93529 ? 62  VAL A CB  1 
ATOM 506   C CG1 . VAL A 1 62  ? 9.44950   11.55341  11.82020   1.000 110.05032 ? 62  VAL A CG1 1 
ATOM 507   C CG2 . VAL A 1 62  ? 9.03707   13.94529  11.21800   1.000 114.82696 ? 62  VAL A CG2 1 
ATOM 508   N N   . VAL A 1 63  ? 8.59389   14.58067  15.05592   1.000 121.31710 ? 63  VAL A N   1 
ATOM 509   C CA  . VAL A 1 63  ? 8.48132   15.80707  15.83526   1.000 135.59993 ? 63  VAL A CA  1 
ATOM 510   C C   . VAL A 1 63  ? 9.84900   16.24516  16.33927   1.000 142.25763 ? 63  VAL A C   1 
ATOM 511   O O   . VAL A 1 63  ? 10.81326  15.47826  16.34653   1.000 123.04607 ? 63  VAL A O   1 
ATOM 512   C CB  . VAL A 1 63  ? 7.52048   15.63765  17.03044   1.000 141.09441 ? 63  VAL A CB  1 
ATOM 513   C CG1 . VAL A 1 63  ? 6.07713   15.61994  16.55482   1.000 145.30599 ? 63  VAL A CG1 1 
ATOM 514   C CG2 . VAL A 1 63  ? 7.85785   14.36330  17.78765   1.000 137.14118 ? 63  VAL A CG2 1 
ATOM 515   N N   . GLU A 1 64  ? 9.92189   17.51098  16.74584   1.000 164.18318 ? 64  GLU A N   1 
ATOM 516   C CA  . GLU A 1 64  ? 11.13964  18.11315  17.26417   1.000 172.42520 ? 64  GLU A CA  1 
ATOM 517   C C   . GLU A 1 64  ? 10.88940  18.61313  18.68177   1.000 184.29407 ? 64  GLU A C   1 
ATOM 518   O O   . GLU A 1 64  ? 9.78323   19.05117  19.01571   1.000 185.96070 ? 64  GLU A O   1 
ATOM 519   C CB  . GLU A 1 64  ? 11.62176  19.27002  16.37480   1.000 165.62827 ? 64  GLU A CB  1 
ATOM 520   C CG  . GLU A 1 64  ? 10.81822  20.55682  16.51387   1.000 168.52473 ? 64  GLU A CG  1 
ATOM 521   C CD  . GLU A 1 64  ? 9.72935   20.68968  15.46743   1.000 169.77043 ? 64  GLU A CD  1 
ATOM 522   O OE1 . GLU A 1 64  ? 8.87875   19.78006  15.36755   1.000 170.62900 ? 64  GLU A OE1 1 
ATOM 523   O OE2 . GLU A 1 64  ? 9.72551   21.70702  14.74304   1.000 168.01299 ? 64  GLU A OE2 1 
ATOM 524   N N   . LEU A 1 65  ? 11.92534  18.52878  19.51461   1.000 185.92809 ? 65  LEU A N   1 
ATOM 525   C CA  . LEU A 1 65  ? 11.86695  18.97896  20.90737   1.000 171.56469 ? 65  LEU A CA  1 
ATOM 526   C C   . LEU A 1 65  ? 10.69125  18.36641  21.66777   1.000 171.96473 ? 65  LEU A C   1 
ATOM 527   O O   . LEU A 1 65  ? 10.51587  18.60934  22.86228   1.000 167.84696 ? 65  LEU A O   1 
ATOM 528   C CB  . LEU A 1 65  ? 11.79228  20.50812  20.97202   1.000 150.40196 ? 65  LEU A CB  1 
ATOM 529   C CG  . LEU A 1 65  ? 12.43427  21.17075  22.19364   1.000 128.86725 ? 65  LEU A CG  1 
ATOM 530   C CD1 . LEU A 1 65  ? 13.89758  20.77732  22.30666   1.000 121.66262 ? 65  LEU A CD1 1 
ATOM 531   C CD2 . LEU A 1 65  ? 12.28933  22.68391  22.12714   1.000 127.13066 ? 65  LEU A CD2 1 
ATOM 532   N N   . ALA A 1 70  ? 1.85263   19.63499  19.88579   1.000 141.41401 ? 70  ALA A N   1 
ATOM 533   C CA  . ALA A 1 70  ? 2.33915   20.02975  21.20220   1.000 140.61683 ? 70  ALA A CA  1 
ATOM 534   C C   . ALA A 1 70  ? 1.81646   19.09034  22.28489   1.000 163.55287 ? 70  ALA A C   1 
ATOM 535   O O   . ALA A 1 70  ? 2.31746   19.08438  23.40868   1.000 171.49502 ? 70  ALA A O   1 
ATOM 536   C CB  . ALA A 1 70  ? 1.93841   21.46569  21.50597   1.000 130.82251 ? 70  ALA A CB  1 
ATOM 537   N N   . LEU A 1 71  ? 0.80232   18.29833  21.94001   1.000 180.94683 ? 71  LEU A N   1 
ATOM 538   C CA  . LEU A 1 71  ? 0.18748   17.35143  22.86847   1.000 158.50153 ? 71  LEU A CA  1 
ATOM 539   C C   . LEU A 1 71  ? -0.04063  16.04851  22.11723   1.000 148.80426 ? 71  LEU A C   1 
ATOM 540   O O   . LEU A 1 71  ? -0.90913  15.99190  21.24131   1.000 143.86864 ? 71  LEU A O   1 
ATOM 541   C CB  . LEU A 1 71  ? -1.13426  17.88950  23.41921   1.000 148.65995 ? 71  LEU A CB  1 
ATOM 542   C CG  . LEU A 1 71  ? -1.12409  18.78612  24.66040   1.000 150.89943 ? 71  LEU A CG  1 
ATOM 543   C CD1 . LEU A 1 71  ? -0.27972  18.17213  25.76748   1.000 146.66791 ? 71  LEU A CD1 1 
ATOM 544   C CD2 . LEU A 1 71  ? -0.66211  20.19976  24.33158   1.000 155.99823 ? 71  LEU A CD2 1 
ATOM 545   N N   . LEU A 1 72  ? 0.71446   15.00347  22.45634   1.000 136.17402 ? 72  LEU A N   1 
ATOM 546   C CA  . LEU A 1 72  ? 0.60040   13.76831  21.68967   1.000 134.59005 ? 72  LEU A CA  1 
ATOM 547   C C   . LEU A 1 72  ? 1.27082   12.61512  22.42614   1.000 134.24951 ? 72  LEU A C   1 
ATOM 548   O O   . LEU A 1 72  ? 2.04977   12.81571  23.36308   1.000 141.84019 ? 72  LEU A O   1 
ATOM 549   C CB  . LEU A 1 72  ? 1.20833   13.93634  20.29442   1.000 133.86547 ? 72  LEU A CB  1 
ATOM 550   C CG  . LEU A 1 72  ? 0.41058   13.30834  19.15705   1.000 129.62813 ? 72  LEU A CG  1 
ATOM 551   C CD1 . LEU A 1 72  ? -1.08404  13.37321  19.45177   1.000 121.05621 ? 72  LEU A CD1 1 
ATOM 552   C CD2 . LEU A 1 72  ? 0.72814   14.02028  17.85273   1.000 135.45508 ? 72  LEU A CD2 1 
ATOM 553   N N   . LYS A 1 73  ? 0.94705   11.40161  21.97814   1.000 132.80834 ? 73  LYS A N   1 
ATOM 554   C CA  . LYS A 1 73  ? 1.53431   10.16461  22.47891   1.000 125.65430 ? 73  LYS A CA  1 
ATOM 555   C C   . LYS A 1 73  ? 2.88512   9.92998   21.80363   1.000 118.17555 ? 73  LYS A C   1 
ATOM 556   O O   . LYS A 1 73  ? 3.43237   10.80972  21.13551   1.000 113.79864 ? 73  LYS A O   1 
ATOM 557   C CB  . LYS A 1 73  ? 0.58553   8.99541   22.22533   1.000 130.51991 ? 73  LYS A CB  1 
ATOM 558   C CG  . LYS A 1 73  ? -0.48662  8.77641   23.27989   1.000 130.56422 ? 73  LYS A CG  1 
ATOM 559   C CD  . LYS A 1 73  ? -0.71468  7.28787   23.50460   1.000 126.14376 ? 73  LYS A CD  1 
ATOM 560   C CE  . LYS A 1 73  ? -1.42992  7.01456   24.81602   1.000 127.36720 ? 73  LYS A CE  1 
ATOM 561   N NZ  . LYS A 1 73  ? -0.62020  7.43171   25.99090   1.000 130.82573 ? 73  LYS A NZ  1 
ATOM 562   N N   . HIS A 1 74  ? 3.44057   8.72766   21.97242   1.000 120.65969 ? 74  HIS A N   1 
ATOM 563   C CA  . HIS A 1 74  ? 4.76869   8.39734   21.46834   1.000 132.74560 ? 74  HIS A CA  1 
ATOM 564   C C   . HIS A 1 74  ? 4.78592   7.17240   20.56375   1.000 146.42408 ? 74  HIS A C   1 
ATOM 565   O O   . HIS A 1 74  ? 5.85677   6.81873   20.05363   1.000 166.22224 ? 74  HIS A O   1 
ATOM 566   C CB  . HIS A 1 74  ? 5.76146   8.18558   22.62082   1.000 120.23549 ? 74  HIS A CB  1 
ATOM 567   C CG  . HIS A 1 74  ? 6.02175   9.41486   23.43415   1.000 121.19729 ? 74  HIS A CG  1 
ATOM 568   N ND1 . HIS A 1 74  ? 5.03981   10.06366  24.15138   1.000 127.53961 ? 74  HIS A ND1 1 
ATOM 569   C CD2 . HIS A 1 74  ? 7.16069   10.11957  23.63412   1.000 120.98324 ? 74  HIS A CD2 1 
ATOM 570   C CE1 . HIS A 1 74  ? 5.56384   11.11139  24.76304   1.000 129.13712 ? 74  HIS A CE1 1 
ATOM 571   N NE2 . HIS A 1 74  ? 6.84942   11.16784  24.46518   1.000 122.67081 ? 74  HIS A NE2 1 
ATOM 572   N N   . ARG A 1 75  ? 3.65275   6.48440   20.39663   1.000 126.55479 ? 75  ARG A N   1 
ATOM 573   C CA  . ARG A 1 75  ? 3.52174   5.33638   19.50000   1.000 117.62198 ? 75  ARG A CA  1 
ATOM 574   C C   . ARG A 1 75  ? 4.36483   4.15424   19.98122   1.000 115.55728 ? 75  ARG A C   1 
ATOM 575   O O   . ARG A 1 75  ? 4.24001   3.03873   19.46503   1.000 115.22254 ? 75  ARG A O   1 
ATOM 576   C CB  . ARG A 1 75  ? 3.88172   5.75733   18.06234   1.000 111.93935 ? 75  ARG A CB  1 
ATOM 577   C CG  . ARG A 1 75  ? 4.16285   4.63546   17.06640   1.000 111.08381 ? 75  ARG A CG  1 
ATOM 578   C CD  . ARG A 1 75  ? 4.36890   5.16890   15.66257   1.000 102.64717 ? 75  ARG A CD  1 
ATOM 579   N NE  . ARG A 1 75  ? 3.94295   4.20781   14.64784   1.000 103.44475 ? 75  ARG A NE  1 
ATOM 580   C CZ  . ARG A 1 75  ? 4.77295   3.46132   13.92556   1.000 101.57572 ? 75  ARG A CZ  1 
ATOM 581   N NH1 . ARG A 1 75  ? 6.08252   3.56721   14.09678   1.000 98.62947  ? 75  ARG A NH1 1 
ATOM 582   N NH2 . ARG A 1 75  ? 4.29331   2.61359   13.02562   1.000 102.90599 ? 75  ARG A NH2 1 
ATOM 583   N N   . PHE A 1 76  ? 5.15982   4.35876   21.02852   1.000 120.36118 ? 76  PHE A N   1 
ATOM 584   C CA  . PHE A 1 76  ? 6.06894   3.32450   21.49889   1.000 121.66526 ? 76  PHE A CA  1 
ATOM 585   C C   . PHE A 1 76  ? 6.23556   3.44851   23.00353   1.000 108.58435 ? 76  PHE A C   1 
ATOM 586   O O   . PHE A 1 76  ? 6.59873   4.51686   23.50443   1.000 108.52905 ? 76  PHE A O   1 
ATOM 587   C CB  . PHE A 1 76  ? 7.43672   3.44041   20.81601   1.000 129.78904 ? 76  PHE A CB  1 
ATOM 588   C CG  . PHE A 1 76  ? 7.43215   3.04616   19.36886   1.000 132.69187 ? 76  PHE A CG  1 
ATOM 589   C CD1 . PHE A 1 76  ? 7.18177   1.73833   18.99121   1.000 133.26494 ? 76  PHE A CD1 1 
ATOM 590   C CD2 . PHE A 1 76  ? 7.69493   3.98417   18.38469   1.000 130.91304 ? 76  PHE A CD2 1 
ATOM 591   C CE1 . PHE A 1 76  ? 7.18368   1.37451   17.65625   1.000 129.44146 ? 76  PHE A CE1 1 
ATOM 592   C CE2 . PHE A 1 76  ? 7.69885   3.62811   17.05111   1.000 130.10118 ? 76  PHE A CE2 1 
ATOM 593   C CZ  . PHE A 1 76  ? 7.44363   2.32214   16.68555   1.000 127.08151 ? 76  PHE A CZ  1 
ATOM 594   N N   . GLU A 1 77  ? 5.97092   2.35615   23.71175   1.000 105.27120 ? 77  GLU A N   1 
ATOM 595   C CA  . GLU A 1 77  ? 6.21185   2.26377   25.14484   1.000 104.37067 ? 77  GLU A CA  1 
ATOM 596   C C   . GLU A 1 77  ? 7.50201   1.48563   25.37098   1.000 108.97445 ? 77  GLU A C   1 
ATOM 597   O O   . GLU A 1 77  ? 7.61897   0.33377   24.93766   1.000 112.01904 ? 77  GLU A O   1 
ATOM 598   C CB  . GLU A 1 77  ? 5.03772   1.58889   25.85542   1.000 108.07501 ? 77  GLU A CB  1 
ATOM 599   C CG  . GLU A 1 77  ? 3.72738   2.36508   25.77726   1.000 114.91210 ? 77  GLU A CG  1 
ATOM 600   C CD  . GLU A 1 77  ? 3.78246   3.71800   26.47019   1.000 111.45621 ? 77  GLU A CD  1 
ATOM 601   O OE1 . GLU A 1 77  ? 4.70853   3.95431   27.27634   1.000 110.60050 ? 77  GLU A OE1 1 
ATOM 602   O OE2 . GLU A 1 77  ? 2.89377   4.55437   26.20044   1.000 117.40201 ? 77  GLU A OE2 1 
ATOM 603   N N   . ILE A 1 78  ? 8.45751   2.10749   26.05484   1.000 114.78059 ? 78  ILE A N   1 
ATOM 604   C CA  . ILE A 1 78  ? 9.75956   1.49151   26.28840   1.000 123.36074 ? 78  ILE A CA  1 
ATOM 605   C C   . ILE A 1 78  ? 9.61616   0.43076   27.37122   1.000 118.67856 ? 78  ILE A C   1 
ATOM 606   O O   . ILE A 1 78  ? 9.09756   0.70229   28.46061   1.000 116.43904 ? 78  ILE A O   1 
ATOM 607   C CB  . ILE A 1 78  ? 10.80403  2.54962   26.68074   1.000 134.45856 ? 78  ILE A CB  1 
ATOM 608   C CG1 . ILE A 1 78  ? 11.00136  3.56787   25.55322   1.000 152.45681 ? 78  ILE A CG1 1 
ATOM 609   C CG2 . ILE A 1 78  ? 12.12605  1.88820   27.02930   1.000 123.66958 ? 78  ILE A CG2 1 
ATOM 610   C CD1 . ILE A 1 78  ? 10.11766  4.79732   25.65970   1.000 165.37583 ? 78  ILE A CD1 1 
ATOM 611   N N   . ILE A 1 79  ? 10.07652  -0.78290  27.07417   1.000 102.21332 ? 79  ILE A N   1 
ATOM 612   C CA  . ILE A 1 79  ? 9.92539   -1.91897  27.96876   1.000 104.80263 ? 79  ILE A CA  1 
ATOM 613   C C   . ILE A 1 79  ? 11.26548  -2.39808  28.51527   1.000 113.17189 ? 79  ILE A C   1 
ATOM 614   O O   . ILE A 1 79  ? 11.35565  -2.78650  29.68195   1.000 142.05282 ? 79  ILE A O   1 
ATOM 615   C CB  . ILE A 1 79  ? 9.18101   -3.07006  27.25662   1.000 106.12467 ? 79  ILE A CB  1 
ATOM 616   C CG1 . ILE A 1 79  ? 7.92877   -2.54663  26.55036   1.000 107.15918 ? 79  ILE A CG1 1 
ATOM 617   C CG2 . ILE A 1 79  ? 8.81565   -4.16537  28.24367   1.000 109.77776 ? 79  ILE A CG2 1 
ATOM 618   C CD1 . ILE A 1 79  ? 6.89790   -1.95553  27.48470   1.000 110.40104 ? 79  ILE A CD1 1 
ATOM 619   N N   . GLU A 1 80  ? 12.31756  -2.38015  27.69228   1.000 113.40494 ? 80  GLU A N   1 
ATOM 620   C CA  . GLU A 1 80  ? 13.59403  -2.95106  28.11598   1.000 122.56950 ? 80  GLU A CA  1 
ATOM 621   C C   . GLU A 1 80  ? 14.23224  -2.14419  29.24191   1.000 133.29124 ? 80  GLU A C   1 
ATOM 622   O O   . GLU A 1 80  ? 14.82988  -2.71768  30.16059   1.000 144.90639 ? 80  GLU A O   1 
ATOM 623   C CB  . GLU A 1 80  ? 14.54549  -3.05320  26.92327   1.000 119.49570 ? 80  GLU A CB  1 
ATOM 624   C CG  . GLU A 1 80  ? 15.93903  -3.55983  27.27564   1.000 132.81433 ? 80  GLU A CG  1 
ATOM 625   C CD  . GLU A 1 80  ? 15.93653  -4.98833  27.79673   1.000 159.24297 ? 80  GLU A CD  1 
ATOM 626   O OE1 . GLU A 1 80  ? 14.98702  -5.74118  27.48959   1.000 171.47958 ? 80  GLU A OE1 1 
ATOM 627   O OE2 . GLU A 1 80  ? 16.88839  -5.35799  28.51696   1.000 164.42433 ? 80  GLU A OE2 1 
ATOM 628   N N   . GLY A 1 81  ? 14.11073  -0.82057  29.19794   1.000 121.52605 ? 81  GLY A N   1 
ATOM 629   C CA  . GLY A 1 81  ? 14.78606  0.02926   30.15740   1.000 115.85214 ? 81  GLY A CA  1 
ATOM 630   C C   . GLY A 1 81  ? 14.18662  0.07920   31.54286   1.000 109.65594 ? 81  GLY A C   1 
ATOM 631   O O   . GLY A 1 81  ? 14.72196  0.77464   32.41066   1.000 110.46635 ? 81  GLY A O   1 
ATOM 632   N N   . ARG A 1 82  ? 13.09051  -0.63166  31.78147   1.000 117.46580 ? 82  ARG A N   1 
ATOM 633   C CA  . ARG A 1 82  ? 12.37956  -0.57985  33.04944   1.000 132.25391 ? 82  ARG A CA  1 
ATOM 634   C C   . ARG A 1 82  ? 12.72204  -1.78982  33.91417   1.000 138.47405 ? 82  ARG A C   1 
ATOM 635   O O   . ARG A 1 82  ? 13.41731  -2.71670  33.49210   1.000 136.24866 ? 82  ARG A O   1 
ATOM 636   C CB  . ARG A 1 82  ? 10.87082  -0.49679  32.80263   1.000 133.72613 ? 82  ARG A CB  1 
ATOM 637   C CG  . ARG A 1 82  ? 10.49510  0.64648   31.87993   1.000 129.14140 ? 82  ARG A CG  1 
ATOM 638   C CD  . ARG A 1 82  ? 8.99952   0.77612   31.68272   1.000 130.40709 ? 82  ARG A CD  1 
ATOM 639   N NE  . ARG A 1 82  ? 8.70081   1.74182   30.62937   1.000 141.64668 ? 82  ARG A NE  1 
ATOM 640   C CZ  . ARG A 1 82  ? 8.62270   3.05503   30.81824   1.000 158.20060 ? 82  ARG A CZ  1 
ATOM 641   N NH1 . ARG A 1 82  ? 8.81882   3.56576   32.02537   1.000 165.70023 ? 82  ARG A NH1 1 
ATOM 642   N NH2 . ARG A 1 82  ? 8.35035   3.85846   29.79883   1.000 162.02541 ? 82  ARG A NH2 1 
ATOM 643   N N   . ASP A 1 83  ? 12.22506  -1.76521  35.14801   1.000 139.82963 ? 83  ASP A N   1 
ATOM 644   C CA  . ASP A 1 83  ? 12.36557  -2.90882  36.03437   1.000 151.17857 ? 83  ASP A CA  1 
ATOM 645   C C   . ASP A 1 83  ? 11.51896  -4.07824  35.53129   1.000 162.91958 ? 83  ASP A C   1 
ATOM 646   O O   . ASP A 1 83  ? 10.56513  -3.90729  34.76837   1.000 174.94329 ? 83  ASP A O   1 
ATOM 647   C CB  . ASP A 1 83  ? 11.96252  -2.52443  37.46048   1.000 166.54170 ? 83  ASP A CB  1 
ATOM 648   C CG  . ASP A 1 83  ? 12.24108  -3.62404  38.46791   1.000 183.64111 ? 83  ASP A CG  1 
ATOM 649   O OD1 . ASP A 1 83  ? 13.42820  -3.93576  38.70132   1.000 191.57272 ? 83  ASP A OD1 1 
ATOM 650   O OD2 . ASP A 1 83  ? 11.27000  -4.17624  39.02694   1.000 185.16460 ? 83  ASP A OD2 1 
ATOM 651   N N   . ARG A 1 84  ? 11.89363  -5.28390  35.96817   1.000 152.99554 ? 84  ARG A N   1 
ATOM 652   C CA  . ARG A 1 84  ? 11.20071  -6.49758  35.54124   1.000 148.45713 ? 84  ARG A CA  1 
ATOM 653   C C   . ARG A 1 84  ? 9.71064   -6.43700  35.86400   1.000 143.64085 ? 84  ARG A C   1 
ATOM 654   O O   . ARG A 1 84  ? 8.85974   -6.64011  34.98582   1.000 153.29995 ? 84  ARG A O   1 
ATOM 655   C CB  . ARG A 1 84  ? 11.84216  -7.71513  36.20716   1.000 150.86643 ? 84  ARG A CB  1 
ATOM 656   C CG  . ARG A 1 84  ? 11.31086  -9.05093  35.72450   1.000 153.32774 ? 84  ARG A CG  1 
ATOM 657   C CD  . ARG A 1 84  ? 11.87076  -9.41711  34.36416   1.000 152.34197 ? 84  ARG A CD  1 
ATOM 658   N NE  . ARG A 1 84  ? 11.40801  -10.73157 33.92977   1.000 169.11491 ? 84  ARG A NE  1 
ATOM 659   C CZ  . ARG A 1 84  ? 12.05443  -11.86819 34.16958   1.000 187.88088 ? 84  ARG A CZ  1 
ATOM 660   N NH1 . ARG A 1 84  ? 13.19594  -11.85496 34.84350   1.000 197.54752 ? 84  ARG A NH1 1 
ATOM 661   N NH2 . ARG A 1 84  ? 11.55819  -13.01883 33.73597   1.000 190.02935 ? 84  ARG A NH2 1 
ATOM 662   N N   . THR A 1 85  ? 9.37780   -6.15380  37.12583   1.000 142.45038 ? 85  THR A N   1 
ATOM 663   C CA  . THR A 1 85  ? 7.98238   -6.17082  37.55292   1.000 148.19958 ? 85  THR A CA  1 
ATOM 664   C C   . THR A 1 85  ? 7.17456   -5.09424  36.83933   1.000 158.06494 ? 85  THR A C   1 
ATOM 665   O O   . THR A 1 85  ? 6.06234   -5.35013  36.36352   1.000 162.47691 ? 85  THR A O   1 
ATOM 666   C CB  . THR A 1 85  ? 7.89681   -5.99361  39.06956   1.000 155.25025 ? 85  THR A CB  1 
ATOM 667   O OG1 . THR A 1 85  ? 8.73214   -6.96363  39.71371   1.000 168.69873 ? 85  THR A OG1 1 
ATOM 668   C CG2 . THR A 1 85  ? 6.46329   -6.17549  39.54543   1.000 154.89941 ? 85  THR A CG2 1 
ATOM 669   N N   . MET A 1 86  ? 7.72150   -3.87892  36.75489   1.000 151.91455 ? 86  MET A N   1 
ATOM 670   C CA  . MET A 1 86  ? 7.01667   -2.79586  36.07665   1.000 155.38487 ? 86  MET A CA  1 
ATOM 671   C C   . MET A 1 86  ? 6.83936   -3.09829  34.59354   1.000 164.27693 ? 86  MET A C   1 
ATOM 672   O O   . MET A 1 86  ? 5.79263   -2.79040  34.00994   1.000 170.66315 ? 86  MET A O   1 
ATOM 673   C CB  . MET A 1 86  ? 7.76361   -1.47742  36.27747   1.000 146.22020 ? 86  MET A CB  1 
ATOM 674   C CG  . MET A 1 86  ? 8.10920   -1.18428  37.72990   1.000 156.88564 ? 86  MET A CG  1 
ATOM 675   S SD  . MET A 1 86  ? 9.09308   0.31170   37.93643   1.000 165.02544 ? 86  MET A SD  1 
ATOM 676   C CE  . MET A 1 86  ? 7.85372   1.56994   37.64157   1.000 161.00860 ? 86  MET A CE  1 
ATOM 677   N N   . ALA A 1 87  ? 7.85369   -3.69916  33.96611   1.000 161.99062 ? 87  ALA A N   1 
ATOM 678   C CA  . ALA A 1 87  ? 7.74926   -4.04884  32.55283   1.000 155.51006 ? 87  ALA A CA  1 
ATOM 679   C C   . ALA A 1 87  ? 6.64452   -5.07151  32.32276   1.000 136.75263 ? 87  ALA A C   1 
ATOM 680   O O   . ALA A 1 87  ? 5.82507   -4.92253  31.40727   1.000 128.39038 ? 87  ALA A O   1 
ATOM 681   C CB  . ALA A 1 87  ? 9.08810   -4.57879  32.03909   1.000 159.77754 ? 87  ALA A CB  1 
ATOM 682   N N   . TRP A 1 88  ? 6.60437   -6.12188  33.14813   1.000 128.04652 ? 88  TRP A N   1 
ATOM 683   C CA  . TRP A 1 88  ? 5.54660   -7.11738  32.99905   1.000 141.60035 ? 88  TRP A CA  1 
ATOM 684   C C   . TRP A 1 88  ? 4.17630   -6.51573  33.28517   1.000 143.10920 ? 88  TRP A C   1 
ATOM 685   O O   . TRP A 1 88  ? 3.18664   -6.87360  32.63452   1.000 152.55781 ? 88  TRP A O   1 
ATOM 686   C CB  . TRP A 1 88  ? 5.80769   -8.31850  33.90764   1.000 160.37516 ? 88  TRP A CB  1 
ATOM 687   C CG  . TRP A 1 88  ? 6.69985   -9.34858  33.28822   1.000 156.74089 ? 88  TRP A CG  1 
ATOM 688   C CD1 . TRP A 1 88  ? 7.97649   -9.65919  33.65381   1.000 161.00643 ? 88  TRP A CD1 1 
ATOM 689   C CD2 . TRP A 1 88  ? 6.38173   -10.19752 32.17835   1.000 140.23354 ? 88  TRP A CD2 1 
ATOM 690   N NE1 . TRP A 1 88  ? 8.47013   -10.65613 32.84613   1.000 154.76961 ? 88  TRP A NE1 1 
ATOM 691   C CE2 . TRP A 1 88  ? 7.51066   -11.00202 31.93062   1.000 138.28675 ? 88  TRP A CE2 1 
ATOM 692   C CE3 . TRP A 1 88  ? 5.24999   -10.35631 31.37255   1.000 136.02924 ? 88  TRP A CE3 1 
ATOM 693   C CZ2 . TRP A 1 88  ? 7.54107   -11.95148 30.91049   1.000 129.87878 ? 88  TRP A CZ2 1 
ATOM 694   C CZ3 . TRP A 1 88  ? 5.28203   -11.29889 30.36100   1.000 127.38561 ? 88  TRP A CZ3 1 
ATOM 695   C CH2 . TRP A 1 88  ? 6.41922   -12.08405 30.13893   1.000 120.94071 ? 88  TRP A CH2 1 
ATOM 696   N N   . THR A 1 89  ? 4.10041   -5.58603  34.24148   1.000 152.92813 ? 89  THR A N   1 
ATOM 697   C CA  . THR A 1 89  ? 2.83044   -4.92728  34.53060   1.000 155.90732 ? 89  THR A CA  1 
ATOM 698   C C   . THR A 1 89  ? 2.34776   -4.11466  33.33496   1.000 144.84705 ? 89  THR A C   1 
ATOM 699   O O   . THR A 1 89  ? 1.17003   -4.18097  32.96493   1.000 141.52533 ? 89  THR A O   1 
ATOM 700   C CB  . THR A 1 89  ? 2.97339   -4.03409  35.76475   1.000 165.02485 ? 89  THR A CB  1 
ATOM 701   O OG1 . THR A 1 89  ? 3.37805   -4.82673  36.88854   1.000 164.57122 ? 89  THR A OG1 1 
ATOM 702   C CG2 . THR A 1 89  ? 1.65288   -3.34748  36.08750   1.000 179.36036 ? 89  THR A CG2 1 
ATOM 703   N N   . VAL A 1 90  ? 3.24941   -3.35332  32.70882   1.000 136.69455 ? 90  VAL A N   1 
ATOM 704   C CA  . VAL A 1 90  ? 2.88089   -2.56704  31.53200   1.000 138.85060 ? 90  VAL A CA  1 
ATOM 705   C C   . VAL A 1 90  ? 2.45864   -3.47926  30.38525   1.000 143.18180 ? 90  VAL A C   1 
ATOM 706   O O   . VAL A 1 90  ? 1.49095   -3.19199  29.66477   1.000 134.99037 ? 90  VAL A O   1 
ATOM 707   C CB  . VAL A 1 90  ? 4.04187   -1.64042  31.12327   1.000 140.27569 ? 90  VAL A CB  1 
ATOM 708   C CG1 . VAL A 1 90  ? 3.74945   -0.96889  29.78806   1.000 140.46399 ? 90  VAL A CG1 1 
ATOM 709   C CG2 . VAL A 1 90  ? 4.29041   -0.59643  32.20028   1.000 148.72557 ? 90  VAL A CG2 1 
ATOM 710   N N   . VAL A 1 91  ? 3.18008   -4.58725  30.19127   1.000 129.68114 ? 91  VAL A N   1 
ATOM 711   C CA  . VAL A 1 91  ? 2.84377   -5.51515  29.11232   1.000 140.86456 ? 91  VAL A CA  1 
ATOM 712   C C   . VAL A 1 91  ? 1.45608   -6.10511  29.33349   1.000 171.58052 ? 91  VAL A C   1 
ATOM 713   O O   . VAL A 1 91  ? 0.62823   -6.15626  28.41447   1.000 188.80055 ? 91  VAL A O   1 
ATOM 714   C CB  . VAL A 1 91  ? 3.91398   -6.61502  28.99268   1.000 117.65176 ? 91  VAL A CB  1 
ATOM 715   C CG1 . VAL A 1 91  ? 3.43001   -7.72698  28.07628   1.000 113.98264 ? 91  VAL A CG1 1 
ATOM 716   C CG2 . VAL A 1 91  ? 5.21554   -6.02900  28.47186   1.000 117.38792 ? 91  VAL A CG2 1 
ATOM 717   N N   . ASN A 1 92  ? 1.17556   -6.54799  30.56195   1.000 173.82130 ? 92  ASN A N   1 
ATOM 718   C CA  . ASN A 1 92  ? -0.13709  -7.11229  30.85471   1.000 153.79813 ? 92  ASN A CA  1 
ATOM 719   C C   . ASN A 1 92  ? -1.23076  -6.06209  30.71737   1.000 143.07087 ? 92  ASN A C   1 
ATOM 720   O O   . ASN A 1 92  ? -2.33721  -6.36921  30.25939   1.000 150.90659 ? 92  ASN A O   1 
ATOM 721   C CB  . ASN A 1 92  ? -0.14539  -7.72164  32.25655   1.000 141.99479 ? 92  ASN A CB  1 
ATOM 722   C CG  . ASN A 1 92  ? 0.77590   -8.91763  32.37458   1.000 136.86680 ? 92  ASN A CG  1 
ATOM 723   O OD1 . ASN A 1 92  ? 0.95379   -9.67124  31.41826   1.000 131.22660 ? 92  ASN A OD1 1 
ATOM 724   N ND2 . ASN A 1 92  ? 1.36803   -9.09786  33.54911   1.000 134.35785 ? 92  ASN A ND2 1 
ATOM 725   N N   . SER A 1 93  ? -0.93049  -4.81375  31.08244   1.000 148.47276 ? 93  SER A N   1 
ATOM 726   C CA  . SER A 1 93  ? -1.90948  -3.74125  30.94941   1.000 142.33987 ? 93  SER A CA  1 
ATOM 727   C C   . SER A 1 93  ? -2.27250  -3.50576  29.48858   1.000 140.44510 ? 93  SER A C   1 
ATOM 728   O O   . SER A 1 93  ? -3.45580  -3.46886  29.12842   1.000 154.80263 ? 93  SER A O   1 
ATOM 729   C CB  . SER A 1 93  ? -1.36512  -2.46074  31.58422   1.000 129.38699 ? 93  SER A CB  1 
ATOM 730   O OG  . SER A 1 93  ? -2.28095  -1.38853  31.45247   1.000 130.41671 ? 93  SER A OG  1 
ATOM 731   N N   . ILE A 1 94  ? -1.26427  -3.35347  28.62570   1.000 126.95833 ? 94  ILE A N   1 
ATOM 732   C CA  . ILE A 1 94  ? -1.56427  -3.09094  27.22009   1.000 146.19480 ? 94  ILE A CA  1 
ATOM 733   C C   . ILE A 1 94  ? -2.17391  -4.31699  26.54781   1.000 167.67939 ? 94  ILE A C   1 
ATOM 734   O O   . ILE A 1 94  ? -2.94636  -4.18386  25.58888   1.000 187.26047 ? 94  ILE A O   1 
ATOM 735   C CB  . ILE A 1 94  ? -0.30887  -2.60289  26.47129   1.000 149.02871 ? 94  ILE A CB  1 
ATOM 736   C CG1 . ILE A 1 94  ? 0.81889   -3.63135  26.56311   1.000 132.09157 ? 94  ILE A CG1 1 
ATOM 737   C CG2 . ILE A 1 94  ? 0.14322   -1.25350  27.01252   1.000 161.11347 ? 94  ILE A CG2 1 
ATOM 738   C CD1 . ILE A 1 94  ? 2.13594   -3.14532  25.99717   1.000 112.40092 ? 94  ILE A CD1 1 
ATOM 739   N N   . CYS A 1 95  ? -1.88560  -5.52102  27.05337   1.000 135.08780 ? 95  CYS A N   1 
ATOM 740   C CA  . CYS A 1 95  ? -2.49637  -6.71393  26.47462   1.000 137.85387 ? 95  CYS A CA  1 
ATOM 741   C C   . CYS A 1 95  ? -3.96499  -6.83070  26.86179   1.000 149.32989 ? 95  CYS A C   1 
ATOM 742   O O   . CYS A 1 95  ? -4.80320  -7.19585  26.02922   1.000 161.30021 ? 95  CYS A O   1 
ATOM 743   C CB  . CYS A 1 95  ? -1.72398  -7.96057  26.90002   1.000 138.65674 ? 95  CYS A CB  1 
ATOM 744   S SG  . CYS A 1 95  ? -0.19896  -8.21917  25.97196   1.000 133.46755 ? 95  CYS A SG  1 
ATOM 745   N N   . ASN A 1 96  ? -4.29858  -6.53104  28.11913   1.000 153.86178 ? 96  ASN A N   1 
ATOM 746   C CA  . ASN A 1 96  ? -5.70306  -6.50317  28.51328   1.000 142.94170 ? 96  ASN A CA  1 
ATOM 747   C C   . ASN A 1 96  ? -6.44483  -5.35444  27.84419   1.000 138.41458 ? 96  ASN A C   1 
ATOM 748   O O   . ASN A 1 96  ? -7.66108  -5.43919  27.63910   1.000 141.92553 ? 96  ASN A O   1 
ATOM 749   C CB  . ASN A 1 96  ? -5.82538  -6.41308  30.03362   1.000 142.47891 ? 96  ASN A CB  1 
ATOM 750   C CG  . ASN A 1 96  ? -5.50395  -7.72503  30.71999   1.000 145.46725 ? 96  ASN A CG  1 
ATOM 751   O OD1 . ASN A 1 96  ? -4.46700  -7.86443  31.36742   1.000 144.08369 ? 96  ASN A OD1 1 
ATOM 752   N ND2 . ASN A 1 96  ? -6.39875  -8.69693  30.58337   1.000 149.94403 ? 96  ASN A ND2 1 
ATOM 753   N N   . THR A 1 97  ? -5.73561  -4.27761  27.49963   1.000 162.67601 ? 97  THR A N   1 
ATOM 754   C CA  . THR A 1 97  ? -6.37648  -3.16314  26.80956   1.000 159.10590 ? 97  THR A CA  1 
ATOM 755   C C   . THR A 1 97  ? -6.68808  -3.51572  25.35907   1.000 153.32715 ? 97  THR A C   1 
ATOM 756   O O   . THR A 1 97  ? -7.80863  -3.29474  24.88468   1.000 157.37205 ? 97  THR A O   1 
ATOM 757   C CB  . THR A 1 97  ? -5.48892  -1.92047  26.88125   1.000 148.34110 ? 97  THR A CB  1 
ATOM 758   O OG1 . THR A 1 97  ? -5.20550  -1.61131  28.25161   1.000 152.30865 ? 97  THR A OG1 1 
ATOM 759   C CG2 . THR A 1 97  ? -6.18218  -0.73440  26.22864   1.000 139.18105 ? 97  THR A CG2 1 
ATOM 760   N N   . THR A 1 98  ? -5.71206  -4.07019  24.63772   1.000 141.09271 ? 98  THR A N   1 
ATOM 761   C CA  . THR A 1 98  ? -5.87599  -4.33879  23.21453   1.000 140.29967 ? 98  THR A CA  1 
ATOM 762   C C   . THR A 1 98  ? -6.32346  -5.76327  22.90808   1.000 153.85637 ? 98  THR A C   1 
ATOM 763   O O   . THR A 1 98  ? -6.64958  -6.05424  21.75218   1.000 163.29280 ? 98  THR A O   1 
ATOM 764   C CB  . THR A 1 98  ? -4.56941  -4.05019  22.46376   1.000 134.97302 ? 98  THR A CB  1 
ATOM 765   O OG1 . THR A 1 98  ? -3.54527  -4.94275  22.91902   1.000 133.71131 ? 98  THR A OG1 1 
ATOM 766   C CG2 . THR A 1 98  ? -4.12696  -2.61336  22.69844   1.000 132.18240 ? 98  THR A CG2 1 
ATOM 767   N N   . GLY A 1 99  ? -6.34793  -6.65142  23.89918   1.000 143.42022 ? 99  GLY A N   1 
ATOM 768   C CA  . GLY A 1 99  ? -6.84511  -7.99454  23.67349   1.000 147.23248 ? 99  GLY A CA  1 
ATOM 769   C C   . GLY A 1 99  ? -5.92198  -8.90105  22.89326   1.000 145.36000 ? 99  GLY A C   1 
ATOM 770   O O   . GLY A 1 99  ? -6.38108  -9.89703  22.32874   1.000 154.99818 ? 99  GLY A O   1 
ATOM 771   N N   . ALA A 1 100 ? -4.63201  -8.58687  22.84117   1.000 157.54844 ? 100 ALA A N   1 
ATOM 772   C CA  . ALA A 1 100 ? -3.65326  -9.40057  22.13530   1.000 152.63707 ? 100 ALA A CA  1 
ATOM 773   C C   . ALA A 1 100 ? -2.97930  -10.36126 23.10574   1.000 162.74300 ? 100 ALA A C   1 
ATOM 774   O O   . ALA A 1 100 ? -2.64864  -9.98742  24.23511   1.000 158.91717 ? 100 ALA A O   1 
ATOM 775   C CB  . ALA A 1 100 ? -2.60348  -8.52434  21.44896   1.000 131.16613 ? 100 ALA A CB  1 
ATOM 776   N N   . GLU A 1 101 ? -2.79180  -11.60400 22.66295   1.000 173.26951 ? 101 GLU A N   1 
ATOM 777   C CA  . GLU A 1 101 ? -2.13907  -12.60628 23.49540   1.000 170.57280 ? 101 GLU A CA  1 
ATOM 778   C C   . GLU A 1 101 ? -0.72108  -12.16947 23.83865   1.000 153.30688 ? 101 GLU A C   1 
ATOM 779   O O   . GLU A 1 101 ? 0.08064   -11.86327 22.95135   1.000 147.10864 ? 101 GLU A O   1 
ATOM 780   C CB  . GLU A 1 101 ? -2.11254  -13.95509 22.77421   1.000 173.57362 ? 101 GLU A CB  1 
ATOM 781   C CG  . GLU A 1 101 ? -3.45594  -14.66464 22.69478   1.000 176.23037 ? 101 GLU A CG  1 
ATOM 782   C CD  . GLU A 1 101 ? -3.87954  -15.27193 24.01884   1.000 173.72910 ? 101 GLU A CD  1 
ATOM 783   O OE1 . GLU A 1 101 ? -3.00302  -15.50828 24.87704   1.000 172.62863 ? 101 GLU A OE1 1 
ATOM 784   O OE2 . GLU A 1 101 ? -5.09050  -15.51819 24.19940   1.000 174.54007 ? 101 GLU A OE2 1 
ATOM 785   N N   . LYS A 1 102 ? -0.41631  -12.13817 25.13175   1.000 135.24993 ? 102 LYS A N   1 
ATOM 786   C CA  . LYS A 1 102 ? 0.90502   -11.71512 25.56531   1.000 130.84616 ? 102 LYS A CA  1 
ATOM 787   C C   . LYS A 1 102 ? 1.93884   -12.78122 25.20723   1.000 130.19027 ? 102 LYS A C   1 
ATOM 788   O O   . LYS A 1 102 ? 1.68229   -13.97901 25.36946   1.000 134.35780 ? 102 LYS A O   1 
ATOM 789   C CB  . LYS A 1 102 ? 0.92302   -11.43449 27.07066   1.000 132.54049 ? 102 LYS A CB  1 
ATOM 790   C CG  . LYS A 1 102 ? 0.73321   -12.65055 27.96287   1.000 137.73265 ? 102 LYS A CG  1 
ATOM 791   C CD  . LYS A 1 102 ? 0.79121   -12.26429 29.43208   1.000 139.43050 ? 102 LYS A CD  1 
ATOM 792   C CE  . LYS A 1 102 ? 0.70495   -13.48681 30.33069   1.000 158.30440 ? 102 LYS A CE  1 
ATOM 793   N NZ  . LYS A 1 102 ? 1.90473   -14.35866 30.19155   1.000 156.61772 ? 102 LYS A NZ  1 
ATOM 794   N N   . PRO A 1 103 ? 3.09834   -12.38528 24.69076   1.000 126.36957 ? 103 PRO A N   1 
ATOM 795   C CA  . PRO A 1 103 ? 4.13947   -13.37267 24.39520   1.000 142.35534 ? 103 PRO A CA  1 
ATOM 796   C C   . PRO A 1 103 ? 4.75867   -13.91472 25.67266   1.000 152.68215 ? 103 PRO A C   1 
ATOM 797   O O   . PRO A 1 103 ? 4.83899   -13.22890 26.69485   1.000 154.54148 ? 103 PRO A O   1 
ATOM 798   C CB  . PRO A 1 103 ? 5.16075   -12.57931 23.57267   1.000 139.93992 ? 103 PRO A CB  1 
ATOM 799   C CG  . PRO A 1 103 ? 4.95510   -11.16158 23.98934   1.000 132.94896 ? 103 PRO A CG  1 
ATOM 800   C CD  . PRO A 1 103 ? 3.48996   -11.02258 24.29160   1.000 119.79408 ? 103 PRO A CD  1 
ATOM 801   N N   . LYS A 1 104 ? 5.20406   -15.17070 25.59999   1.000 150.90880 ? 104 LYS A N   1 
ATOM 802   C CA  . LYS A 1 104 ? 5.85861   -15.79712 26.74195   1.000 141.38154 ? 104 LYS A CA  1 
ATOM 803   C C   . LYS A 1 104 ? 7.23389   -15.20360 27.01695   1.000 133.84879 ? 104 LYS A C   1 
ATOM 804   O O   . LYS A 1 104 ? 7.71743   -15.28783 28.15080   1.000 139.23977 ? 104 LYS A O   1 
ATOM 805   C CB  . LYS A 1 104 ? 5.97344   -17.30629 26.51131   1.000 138.59734 ? 104 LYS A CB  1 
ATOM 806   C CG  . LYS A 1 104 ? 6.42489   -18.10100 27.72754   1.000 140.69850 ? 104 LYS A CG  1 
ATOM 807   C CD  . LYS A 1 104 ? 5.45243   -17.94139 28.88464   1.000 144.95686 ? 104 LYS A CD  1 
ATOM 808   C CE  . LYS A 1 104 ? 5.87243   -18.78478 30.07823   1.000 149.34992 ? 104 LYS A CE  1 
ATOM 809   N NZ  . LYS A 1 104 ? 4.95202   -18.61325 31.23670   1.000 153.82533 ? 104 LYS A NZ  1 
ATOM 810   N N   . PHE A 1 105 ? 7.86419   -14.59675 26.01751   1.000 125.30189 ? 105 PHE A N   1 
ATOM 811   C CA  . PHE A 1 105 ? 9.17431   -13.98296 26.17476   1.000 142.30859 ? 105 PHE A CA  1 
ATOM 812   C C   . PHE A 1 105 ? 9.01943   -12.47319 26.30108   1.000 141.46779 ? 105 PHE A C   1 
ATOM 813   O O   . PHE A 1 105 ? 8.16729   -11.86993 25.64305   1.000 135.47498 ? 105 PHE A O   1 
ATOM 814   C CB  . PHE A 1 105 ? 10.09397  -14.32876 25.00014   1.000 154.18419 ? 105 PHE A CB  1 
ATOM 815   C CG  . PHE A 1 105 ? 10.61115  -15.74387 25.02628   1.000 145.27892 ? 105 PHE A CG  1 
ATOM 816   C CD1 . PHE A 1 105 ? 9.76286   -16.80820 25.29019   1.000 153.23789 ? 105 PHE A CD1 1 
ATOM 817   C CD2 . PHE A 1 105 ? 11.95168  -16.00604 24.80509   1.000 119.90170 ? 105 PHE A CD2 1 
ATOM 818   C CE1 . PHE A 1 105 ? 10.23703  -18.10394 25.31804   1.000 153.37253 ? 105 PHE A CE1 1 
ATOM 819   C CE2 . PHE A 1 105 ? 12.43212  -17.30083 24.83676   1.000 123.91721 ? 105 PHE A CE2 1 
ATOM 820   C CZ  . PHE A 1 105 ? 11.57327  -18.35091 25.09097   1.000 145.42756 ? 105 PHE A CZ  1 
ATOM 821   N N   . LEU A 1 106 ? 9.84437   -11.87085 27.14877   1.000 151.77953 ? 106 LEU A N   1 
ATOM 822   C CA  . LEU A 1 106 ? 9.70714   -10.45144 27.46245   1.000 140.63252 ? 106 LEU A CA  1 
ATOM 823   C C   . LEU A 1 106 ? 10.09448  -9.60050  26.25879   1.000 138.28689 ? 106 LEU A C   1 
ATOM 824   O O   . LEU A 1 106 ? 11.25755  -9.63519  25.83517   1.000 141.11898 ? 106 LEU A O   1 
ATOM 825   C CB  . LEU A 1 106 ? 10.58012  -10.10635 28.66862   1.000 132.34892 ? 106 LEU A CB  1 
ATOM 826   C CG  . LEU A 1 106 ? 10.19117  -8.91750  29.55081   1.000 125.71745 ? 106 LEU A CG  1 
ATOM 827   C CD1 . LEU A 1 106 ? 10.70927  -9.12705  30.95617   1.000 129.09584 ? 106 LEU A CD1 1 
ATOM 828   C CD2 . LEU A 1 106 ? 10.72885  -7.61331  28.99088   1.000 113.72149 ? 106 LEU A CD2 1 
ATOM 829   N N   . PRO A 1 107 ? 9.17407   -8.83250  25.68334   1.000 125.72244 ? 107 PRO A N   1 
ATOM 830   C CA  . PRO A 1 107 ? 9.50943   -8.00217  24.52380   1.000 129.67372 ? 107 PRO A CA  1 
ATOM 831   C C   . PRO A 1 107 ? 10.22172  -6.72019  24.93767   1.000 124.02419 ? 107 PRO A C   1 
ATOM 832   O O   . PRO A 1 107 ? 10.34304  -6.38893  26.11687   1.000 113.00175 ? 107 PRO A O   1 
ATOM 833   C CB  . PRO A 1 107 ? 8.14026   -7.70429  23.90754   1.000 134.30839 ? 107 PRO A CB  1 
ATOM 834   C CG  . PRO A 1 107 ? 7.22490   -7.68027  25.08309   1.000 114.55941 ? 107 PRO A CG  1 
ATOM 835   C CD  . PRO A 1 107 ? 7.75077   -8.71771  26.04904   1.000 116.63779 ? 107 PRO A CD  1 
ATOM 836   N N   . ASP A 1 108 ? 10.69380  -5.99089  23.92488   1.000 112.68007 ? 108 ASP A N   1 
ATOM 837   C CA  . ASP A 1 108 ? 11.42268  -4.74976  24.14094   1.000 112.60950 ? 108 ASP A CA  1 
ATOM 838   C C   . ASP A 1 108 ? 10.61268  -3.50155  23.82484   1.000 113.17841 ? 108 ASP A C   1 
ATOM 839   O O   . ASP A 1 108 ? 10.97906  -2.41662  24.28778   1.000 108.13376 ? 108 ASP A O   1 
ATOM 840   C CB  . ASP A 1 108 ? 12.70556  -4.72709  23.29612   1.000 103.67675 ? 108 ASP A CB  1 
ATOM 841   C CG  . ASP A 1 108 ? 13.68075  -5.82014  23.68430   1.000 106.88986 ? 108 ASP A CG  1 
ATOM 842   O OD1 . ASP A 1 108 ? 13.71694  -6.19468  24.87533   1.000 116.78818 ? 108 ASP A OD1 1 
ATOM 843   O OD2 . ASP A 1 108 ? 14.41385  -6.30243  22.79528   1.000 106.50311 ? 108 ASP A OD2 1 
ATOM 844   N N   . LEU A 1 109 ? 9.52799   -3.62482  23.06240   1.000 117.34244 ? 109 LEU A N   1 
ATOM 845   C CA  . LEU A 1 109 ? 8.78502   -2.45846  22.60851   1.000 111.65732 ? 109 LEU A CA  1 
ATOM 846   C C   . LEU A 1 109 ? 7.42544   -2.90807  22.09143   1.000 109.90006 ? 109 LEU A C   1 
ATOM 847   O O   . LEU A 1 109 ? 7.26167   -4.05025  21.65426   1.000 111.88133 ? 109 LEU A O   1 
ATOM 848   C CB  . LEU A 1 109 ? 9.56646   -1.71575  21.51840   1.000 108.88038 ? 109 LEU A CB  1 
ATOM 849   C CG  . LEU A 1 109 ? 9.31888   -0.22941  21.26731   1.000 113.64331 ? 109 LEU A CG  1 
ATOM 850   C CD1 . LEU A 1 109 ? 9.71610   0.59010   22.48354   1.000 126.04713 ? 109 LEU A CD1 1 
ATOM 851   C CD2 . LEU A 1 109 ? 10.10696  0.21677   20.04532   1.000 88.85579  ? 109 LEU A CD2 1 
ATOM 852   N N   . TYR A 1 110 ? 6.45188   -2.00119  22.15382   1.000 121.12992 ? 110 TYR A N   1 
ATOM 853   C CA  . TYR A 1 110 ? 5.12216   -2.24091  21.60628   1.000 112.73572 ? 110 TYR A CA  1 
ATOM 854   C C   . TYR A 1 110 ? 4.75037   -1.10701  20.66375   1.000 106.49918 ? 110 TYR A C   1 
ATOM 855   O O   . TYR A 1 110 ? 4.85291   0.06812   21.02960   1.000 97.98319  ? 110 TYR A O   1 
ATOM 856   C CB  . TYR A 1 110 ? 4.06942   -2.37340  22.71050   1.000 116.54394 ? 110 TYR A CB  1 
ATOM 857   C CG  . TYR A 1 110 ? 2.66293   -2.53303  22.17678   1.000 127.55076 ? 110 TYR A CG  1 
ATOM 858   C CD1 . TYR A 1 110 ? 2.26675   -3.70828  21.55092   1.000 126.78092 ? 110 TYR A CD1 1 
ATOM 859   C CD2 . TYR A 1 110 ? 1.73271   -1.50863  22.29531   1.000 136.00543 ? 110 TYR A CD2 1 
ATOM 860   C CE1 . TYR A 1 110 ? 0.98335   -3.85862  21.05873   1.000 128.00123 ? 110 TYR A CE1 1 
ATOM 861   C CE2 . TYR A 1 110 ? 0.44642   -1.65027  21.80771   1.000 130.57379 ? 110 TYR A CE2 1 
ATOM 862   C CZ  . TYR A 1 110 ? 0.07787   -2.82725  21.19045   1.000 126.62934 ? 110 TYR A CZ  1 
ATOM 863   O OH  . TYR A 1 110 ? -1.19974  -2.97575  20.70240   1.000 114.70274 ? 110 TYR A OH  1 
ATOM 864   N N   . ASP A 1 111 ? 4.31842   -1.46324  19.45791   1.000 115.01070 ? 111 ASP A N   1 
ATOM 865   C CA  . ASP A 1 111 ? 3.92436   -0.48780  18.45296   1.000 113.65000 ? 111 ASP A CA  1 
ATOM 866   C C   . ASP A 1 111 ? 2.43486   -0.19487  18.56874   1.000 116.59453 ? 111 ASP A C   1 
ATOM 867   O O   . ASP A 1 111 ? 1.62808   -1.09632  18.81442   1.000 123.15124 ? 111 ASP A O   1 
ATOM 868   C CB  . ASP A 1 111 ? 4.25251   -0.99775  17.04871   1.000 114.52548 ? 111 ASP A CB  1 
ATOM 869   C CG  . ASP A 1 111 ? 4.10195   0.07447   15.98231   1.000 115.50720 ? 111 ASP A CG  1 
ATOM 870   O OD1 . ASP A 1 111 ? 3.63222   1.18753   16.30033   1.000 119.08265 ? 111 ASP A OD1 1 
ATOM 871   O OD2 . ASP A 1 111 ? 4.45377   -0.20042  14.81631   1.000 114.51969 ? 111 ASP A OD2 1 
ATOM 872   N N   . TYR A 1 112 ? 2.07794   1.07657   18.39007   1.000 105.17767 ? 112 TYR A N   1 
ATOM 873   C CA  . TYR A 1 112 ? 0.68962   1.50875   18.49325   1.000 110.55471 ? 112 TYR A CA  1 
ATOM 874   C C   . TYR A 1 112 ? -0.03319  1.47028   17.15119   1.000 111.86795 ? 112 TYR A C   1 
ATOM 875   O O   . TYR A 1 112 ? -1.22246  1.13697   17.10006   1.000 127.55919 ? 112 TYR A O   1 
ATOM 876   C CB  . TYR A 1 112 ? 0.62136   2.92104   19.08208   1.000 114.04513 ? 112 TYR A CB  1 
ATOM 877   C CG  . TYR A 1 112 ? 0.57760   2.95151   20.59416   1.000 121.19895 ? 112 TYR A CG  1 
ATOM 878   C CD1 . TYR A 1 112 ? 0.27529   1.80847   21.32271   1.000 124.02177 ? 112 TYR A CD1 1 
ATOM 879   C CD2 . TYR A 1 112 ? 0.83478   4.12376   21.29294   1.000 105.86580 ? 112 TYR A CD2 1 
ATOM 880   C CE1 . TYR A 1 112 ? 0.23425   1.83177   22.70508   1.000 113.97841 ? 112 TYR A CE1 1 
ATOM 881   C CE2 . TYR A 1 112 ? 0.79713   4.15708   22.67353   1.000 107.08793 ? 112 TYR A CE2 1 
ATOM 882   C CZ  . TYR A 1 112 ? 0.49558   3.00944   23.37455   1.000 108.55802 ? 112 TYR A CZ  1 
ATOM 883   O OH  . TYR A 1 112 ? 0.45675   3.04304   24.74949   1.000 118.07330 ? 112 TYR A OH  1 
ATOM 884   N N   . LYS A 1 113 ? 0.65959   1.80791   16.06160   1.000 103.01923 ? 113 LYS A N   1 
ATOM 885   C CA  . LYS A 1 113 ? 0.02074   1.82649   14.74876   1.000 116.84997 ? 113 LYS A CA  1 
ATOM 886   C C   . LYS A 1 113 ? -0.33210  0.41796   14.28399   1.000 134.59274 ? 113 LYS A C   1 
ATOM 887   O O   . LYS A 1 113 ? -1.48974  0.12819   13.95981   1.000 152.99085 ? 113 LYS A O   1 
ATOM 888   C CB  . LYS A 1 113 ? 0.93439   2.51569   13.73287   1.000 114.11720 ? 113 LYS A CB  1 
ATOM 889   C CG  . LYS A 1 113 ? 0.41611   2.47627   12.30177   1.000 122.41033 ? 113 LYS A CG  1 
ATOM 890   C CD  . LYS A 1 113 ? 1.24461   3.36600   11.38638   1.000 123.16602 ? 113 LYS A CD  1 
ATOM 891   C CE  . LYS A 1 113 ? 0.84487   3.19156   9.92944    1.000 113.95814 ? 113 LYS A CE  1 
ATOM 892   N NZ  . LYS A 1 113 ? -0.53165  3.69015   9.65797    1.000 114.09574 ? 113 LYS A NZ  1 
ATOM 893   N N   . GLU A 1 114 ? 0.65585   -0.47463  14.24657   1.000 120.37733 ? 114 GLU A N   1 
ATOM 894   C CA  . GLU A 1 114 ? 0.45067   -1.82994  13.75316   1.000 137.26993 ? 114 GLU A CA  1 
ATOM 895   C C   . GLU A 1 114 ? -0.06083  -2.78940  14.82030   1.000 131.00820 ? 114 GLU A C   1 
ATOM 896   O O   . GLU A 1 114 ? -0.37224  -3.93968  14.49182   1.000 129.25797 ? 114 GLU A O   1 
ATOM 897   C CB  . GLU A 1 114 ? 1.75306   -2.37782  13.15753   1.000 151.06960 ? 114 GLU A CB  1 
ATOM 898   C CG  . GLU A 1 114 ? 1.55198   -3.34312  11.99672   1.000 158.49114 ? 114 GLU A CG  1 
ATOM 899   C CD  . GLU A 1 114 ? 1.12712   -2.64622  10.71883   1.000 158.65156 ? 114 GLU A CD  1 
ATOM 900   O OE1 . GLU A 1 114 ? 1.41701   -1.44046  10.57181   1.000 154.20246 ? 114 GLU A OE1 1 
ATOM 901   O OE2 . GLU A 1 114 ? 0.50342   -3.30527  9.86014    1.000 159.84167 ? 114 GLU A OE2 1 
ATOM 902   N N   . ASN A 1 115 ? -0.15447  -2.34768  16.07726   1.000 146.72964 ? 115 ASN A N   1 
ATOM 903   C CA  . ASN A 1 115 ? -0.63481  -3.18463  17.18013   1.000 130.92357 ? 115 ASN A CA  1 
ATOM 904   C C   . ASN A 1 115 ? 0.21021   -4.44956  17.32485   1.000 131.47460 ? 115 ASN A C   1 
ATOM 905   O O   . ASN A 1 115 ? -0.30579  -5.54023  17.57653   1.000 133.43719 ? 115 ASN A O   1 
ATOM 906   C CB  . ASN A 1 115 ? -2.11573  -3.53265  17.00850   1.000 121.15261 ? 115 ASN A CB  1 
ATOM 907   C CG  . ASN A 1 115 ? -3.01150  -2.31027  17.06174   1.000 122.39381 ? 115 ASN A CG  1 
ATOM 908   O OD1 . ASN A 1 115 ? -3.66985  -1.96550  16.08021   1.000 123.79965 ? 115 ASN A OD1 1 
ATOM 909   N ND2 . ASN A 1 115 ? -3.03760  -1.64527  18.21090   1.000 122.18516 ? 115 ASN A ND2 1 
ATOM 910   N N   . ARG A 1 116 ? 1.52165   -4.29929  17.16596   1.000 128.97596 ? 116 ARG A N   1 
ATOM 911   C CA  . ARG A 1 116 ? 2.46317   -5.40453  17.22652   1.000 132.79912 ? 116 ARG A CA  1 
ATOM 912   C C   . ARG A 1 116 ? 3.45357   -5.18257  18.36173   1.000 136.35447 ? 116 ARG A C   1 
ATOM 913   O O   . ARG A 1 116 ? 3.69579   -4.05179  18.79167   1.000 134.99765 ? 116 ARG A O   1 
ATOM 914   C CB  . ARG A 1 116 ? 3.22968   -5.54641  15.90435   1.000 126.66670 ? 116 ARG A CB  1 
ATOM 915   C CG  . ARG A 1 116 ? 3.92772   -4.25819  15.49039   1.000 111.21789 ? 116 ARG A CG  1 
ATOM 916   C CD  . ARG A 1 116 ? 4.80190   -4.42279  14.25885   1.000 100.66262 ? 116 ARG A CD  1 
ATOM 917   N NE  . ARG A 1 116 ? 4.10671   -5.06553  13.14981   1.000 105.01602 ? 116 ARG A NE  1 
ATOM 918   C CZ  . ARG A 1 116 ? 4.59208   -5.14091  11.91492   1.000 112.54192 ? 116 ARG A CZ  1 
ATOM 919   N NH1 . ARG A 1 116 ? 5.77197   -4.60637  11.63271   1.000 98.75719  ? 116 ARG A NH1 1 
ATOM 920   N NH2 . ARG A 1 116 ? 3.89655   -5.74321  10.96048   1.000 138.76551 ? 116 ARG A NH2 1 
ATOM 921   N N   . PHE A 1 117 ? 4.03217   -6.28085  18.84097   1.000 140.29288 ? 117 PHE A N   1 
ATOM 922   C CA  . PHE A 1 117 ? 5.10806   -6.23581  19.82380   1.000 121.03846 ? 117 PHE A CA  1 
ATOM 923   C C   . PHE A 1 117 ? 6.42604   -6.35150  19.07081   1.000 116.42632 ? 117 PHE A C   1 
ATOM 924   O O   . PHE A 1 117 ? 6.78035   -7.43246  18.59544   1.000 101.88056 ? 117 PHE A O   1 
ATOM 925   C CB  . PHE A 1 117 ? 4.97228   -7.35715  20.85147   1.000 113.30296 ? 117 PHE A CB  1 
ATOM 926   C CG  . PHE A 1 117 ? 4.07587   -7.02170  22.00640   1.000 113.22443 ? 117 PHE A CG  1 
ATOM 927   C CD1 . PHE A 1 117 ? 4.53313   -6.22056  23.03920   1.000 112.56519 ? 117 PHE A CD1 1 
ATOM 928   C CD2 . PHE A 1 117 ? 2.78510   -7.52037  22.07145   1.000 116.81029 ? 117 PHE A CD2 1 
ATOM 929   C CE1 . PHE A 1 117 ? 3.71806   -5.91093  24.10933   1.000 123.67660 ? 117 PHE A CE1 1 
ATOM 930   C CE2 . PHE A 1 117 ? 1.96360   -7.21479  23.14175   1.000 127.70059 ? 117 PHE A CE2 1 
ATOM 931   C CZ  . PHE A 1 117 ? 2.43235   -6.40844  24.16184   1.000 132.91729 ? 117 PHE A CZ  1 
ATOM 932   N N   . ILE A 1 118 ? 7.14907   -5.24430  18.95987   1.000 104.38144 ? 118 ILE A N   1 
ATOM 933   C CA  . ILE A 1 118 ? 8.42391   -5.22703  18.25409   1.000 97.74430  ? 118 ILE A CA  1 
ATOM 934   C C   . ILE A 1 118 ? 9.52522   -5.50445  19.26479   1.000 97.23161  ? 118 ILE A C   1 
ATOM 935   O O   . ILE A 1 118 ? 9.64463   -4.80040  20.27296   1.000 96.65134  ? 118 ILE A O   1 
ATOM 936   C CB  . ILE A 1 118 ? 8.65319   -3.88707  17.54190   1.000 95.49539  ? 118 ILE A CB  1 
ATOM 937   C CG1 . ILE A 1 118 ? 7.62278   -3.69507  16.43028   1.000 108.82453 ? 118 ILE A CG1 1 
ATOM 938   C CG2 . ILE A 1 118 ? 10.06964  -3.81817  16.98487   1.000 94.48548  ? 118 ILE A CG2 1 
ATOM 939   C CD1 . ILE A 1 118 ? 7.74665   -2.37494  15.71323   1.000 109.97195 ? 118 ILE A CD1 1 
ATOM 940   N N   . GLU A 1 119 ? 10.33292  -6.52592  18.99736   1.000 91.13030  ? 119 GLU A N   1 
ATOM 941   C CA  . GLU A 1 119 ? 11.46966  -6.84910  19.84726   1.000 95.98202  ? 119 GLU A CA  1 
ATOM 942   C C   . GLU A 1 119 ? 12.75216  -6.70747  19.04043   1.000 99.80704  ? 119 GLU A C   1 
ATOM 943   O O   . GLU A 1 119 ? 12.82452  -7.14853  17.88785   1.000 104.85963 ? 119 GLU A O   1 
ATOM 944   C CB  . GLU A 1 119 ? 11.34597  -8.25911  20.44132   1.000 94.61639  ? 119 GLU A CB  1 
ATOM 945   C CG  . GLU A 1 119 ? 11.23846  -9.38317  19.42708   1.000 132.10416 ? 119 GLU A CG  1 
ATOM 946   C CD  . GLU A 1 119 ? 12.56208  -10.08755 19.20295   1.000 171.10348 ? 119 GLU A CD  1 
ATOM 947   O OE1 . GLU A 1 119 ? 13.54462  -9.74635  19.89530   1.000 181.36926 ? 119 GLU A OE1 1 
ATOM 948   O OE2 . GLU A 1 119 ? 12.61917  -10.98733 18.33919   1.000 188.88765 ? 119 GLU A OE2 1 
ATOM 949   N N   . ILE A 1 120 ? 13.76474  -6.10142  19.65907   1.000 106.27066 ? 120 ILE A N   1 
ATOM 950   C CA  . ILE A 1 120 ? 14.96727  -5.65164  18.96841   1.000 86.87904  ? 120 ILE A CA  1 
ATOM 951   C C   . ILE A 1 120 ? 16.13695  -6.53735  19.36892   1.000 106.08532 ? 120 ILE A C   1 
ATOM 952   O O   . ILE A 1 120 ? 16.30459  -6.87414  20.54725   1.000 133.71214 ? 120 ILE A O   1 
ATOM 953   C CB  . ILE A 1 120 ? 15.27830  -4.17727  19.29346   1.000 74.90751  ? 120 ILE A CB  1 
ATOM 954   C CG1 . ILE A 1 120 ? 14.00594  -3.33152  19.22700   1.000 74.62659  ? 120 ILE A CG1 1 
ATOM 955   C CG2 . ILE A 1 120 ? 16.33290  -3.63312  18.34115   1.000 75.49003  ? 120 ILE A CG2 1 
ATOM 956   C CD1 . ILE A 1 120 ? 14.01365  -2.14431  20.17287   1.000 75.24685  ? 120 ILE A CD1 1 
ATOM 957   N N   . GLY A 1 121 ? 16.94995  -6.90213  18.38303   1.000 94.49681  ? 121 GLY A N   1 
ATOM 958   C CA  . GLY A 1 121 ? 18.16193  -7.65975  18.62753   1.000 98.67485  ? 121 GLY A CA  1 
ATOM 959   C C   . GLY A 1 121 ? 19.35154  -7.11552  17.86413   1.000 87.87089  ? 121 GLY A C   1 
ATOM 960   O O   . GLY A 1 121 ? 19.33150  -7.07525  16.63236   1.000 89.85349  ? 121 GLY A O   1 
ATOM 961   N N   . VAL A 1 122 ? 20.39382  -6.69529  18.57368   1.000 76.33503  ? 122 VAL A N   1 
ATOM 962   C CA  . VAL A 1 122 ? 21.59903  -6.14521  17.96143   1.000 73.55069  ? 122 VAL A CA  1 
ATOM 963   C C   . VAL A 1 122 ? 22.68608  -7.20219  18.07863   1.000 83.55790  ? 122 VAL A C   1 
ATOM 964   O O   . VAL A 1 122 ? 23.14890  -7.50920  19.18435   1.000 89.08305  ? 122 VAL A O   1 
ATOM 965   C CB  . VAL A 1 122 ? 22.02993  -4.82790  18.62019   1.000 71.96787  ? 122 VAL A CB  1 
ATOM 966   C CG1 . VAL A 1 122 ? 23.30564  -4.30586  17.97583   1.000 69.43522  ? 122 VAL A CG1 1 
ATOM 967   C CG2 . VAL A 1 122 ? 20.91717  -3.79546  18.51756   1.000 72.69671  ? 122 VAL A CG2 1 
ATOM 968   N N   . THR A 1 123 ? 23.09931  -7.76035  16.94364   1.000 102.11998 ? 123 THR A N   1 
ATOM 969   C CA  . THR A 1 123 ? 24.04053  -8.87098  16.94424   1.000 101.21182 ? 123 THR A CA  1 
ATOM 970   C C   . THR A 1 123 ? 25.33184  -8.49396  16.22960   1.000 86.84559  ? 123 THR A C   1 
ATOM 971   O O   . THR A 1 123 ? 25.38098  -7.55037  15.43571   1.000 86.95245  ? 123 THR A O   1 
ATOM 972   C CB  . THR A 1 123 ? 23.43646  -10.12088 16.28516   1.000 106.45485 ? 123 THR A CB  1 
ATOM 973   O OG1 . THR A 1 123 ? 24.36274  -11.21055 16.38444   1.000 86.54271  ? 123 THR A OG1 1 
ATOM 974   C CG2 . THR A 1 123 ? 23.12954  -9.85860  14.81832   1.000 112.48986 ? 123 THR A CG2 1 
ATOM 975   N N   . ARG A 1 124 ? 26.38477  -9.25671  16.52763   1.000 78.50803  ? 124 ARG A N   1 
ATOM 976   C CA  . ARG A 1 124 ? 27.67292  -9.09160  15.86659   1.000 86.65055  ? 124 ARG A CA  1 
ATOM 977   C C   . ARG A 1 124 ? 27.83380  -10.00783 14.66227   1.000 95.36831  ? 124 ARG A C   1 
ATOM 978   O O   . ARG A 1 124 ? 28.49848  -9.62927  13.69006   1.000 99.15709  ? 124 ARG A O   1 
ATOM 979   C CB  . ARG A 1 124 ? 28.81730  -9.34981  16.85335   1.000 106.74963 ? 124 ARG A CB  1 
ATOM 980   C CG  . ARG A 1 124 ? 29.15304  -8.17693  17.76631   1.000 124.75711 ? 124 ARG A CG  1 
ATOM 981   C CD  . ARG A 1 124 ? 28.27570  -8.13304  19.01005   1.000 123.60617 ? 124 ARG A CD  1 
ATOM 982   N NE  . ARG A 1 124 ? 28.92219  -7.41389  20.10570   1.000 110.88822 ? 124 ARG A NE  1 
ATOM 983   C CZ  . ARG A 1 124 ? 28.37109  -7.20696  21.29790   1.000 90.70010  ? 124 ARG A CZ  1 
ATOM 984   N NH1 . ARG A 1 124 ? 27.14978  -7.65396  21.55684   1.000 87.04495  ? 124 ARG A NH1 1 
ATOM 985   N NH2 . ARG A 1 124 ? 29.03701  -6.53854  22.22932   1.000 82.79315  ? 124 ARG A NH2 1 
ATOM 986   N N   . ARG A 1 125 ? 27.24754  -11.20064 14.70454   1.000 102.41546 ? 125 ARG A N   1 
ATOM 987   C CA  . ARG A 1 125 ? 27.36934  -12.16283 13.61778   1.000 114.99357 ? 125 ARG A CA  1 
ATOM 988   C C   . ARG A 1 125 ? 26.32331  -11.86404 12.54103   1.000 122.77461 ? 125 ARG A C   1 
ATOM 989   O O   . ARG A 1 125 ? 25.69143  -10.80393 12.52777   1.000 130.52065 ? 125 ARG A O   1 
ATOM 990   C CB  . ARG A 1 125 ? 27.26818  -13.58503 14.16312   1.000 113.41260 ? 125 ARG A CB  1 
ATOM 991   C CG  . ARG A 1 125 ? 26.02166  -13.86496 14.98282   1.000 117.27666 ? 125 ARG A CG  1 
ATOM 992   C CD  . ARG A 1 125 ? 26.05087  -15.28111 15.53271   1.000 123.92765 ? 125 ARG A CD  1 
ATOM 993   N NE  . ARG A 1 125 ? 24.93297  -15.54378 16.43270   1.000 118.79838 ? 125 ARG A NE  1 
ATOM 994   C CZ  . ARG A 1 125 ? 24.73192  -16.70032 17.05543   1.000 108.00814 ? 125 ARG A CZ  1 
ATOM 995   N NH1 . ARG A 1 125 ? 25.57704  -17.70723 16.87974   1.000 99.97117  ? 125 ARG A NH1 1 
ATOM 996   N NH2 . ARG A 1 125 ? 23.68630  -16.84972 17.85602   1.000 106.86835 ? 125 ARG A NH2 1 
ATOM 997   N N   . GLU A 1 126 ? 26.14198  -12.80459 11.61487   1.000 107.49753 ? 126 GLU A N   1 
ATOM 998   C CA  . GLU A 1 126 ? 25.17027  -12.64125 10.53911   1.000 96.41641  ? 126 GLU A CA  1 
ATOM 999   C C   . GLU A 1 126 ? 23.75699  -12.48760 11.08923   1.000 100.90298 ? 126 GLU A C   1 
ATOM 1000  O O   . GLU A 1 126 ? 23.34017  -13.22704 11.98572   1.000 105.96600 ? 126 GLU A O   1 
ATOM 1001  C CB  . GLU A 1 126 ? 25.23849  -13.83656 9.58830    1.000 121.53839 ? 126 GLU A CB  1 
ATOM 1002  C CG  . GLU A 1 126 ? 24.39360  -13.68321 8.33346    1.000 157.53302 ? 126 GLU A CG  1 
ATOM 1003  C CD  . GLU A 1 126 ? 25.01419  -12.73812 7.32295    1.000 176.71233 ? 126 GLU A CD  1 
ATOM 1004  O OE1 . GLU A 1 126 ? 26.24872  -12.55121 7.36181    1.000 178.52235 ? 126 GLU A OE1 1 
ATOM 1005  O OE2 . GLU A 1 126 ? 24.26706  -12.18417 6.48822    1.000 182.71534 ? 126 GLU A OE2 1 
ATOM 1006  N N   . VAL A 1 127 ? 23.01873  -11.51625 10.54336   1.000 107.49890 ? 127 VAL A N   1 
ATOM 1007  C CA  . VAL A 1 127 ? 21.66106  -11.25396 11.00723   1.000 103.50368 ? 127 VAL A CA  1 
ATOM 1008  C C   . VAL A 1 127 ? 20.69973  -12.36890 10.62041   1.000 116.79958 ? 127 VAL A C   1 
ATOM 1009  O O   . VAL A 1 127 ? 19.66186  -12.53713 11.27144   1.000 120.16004 ? 127 VAL A O   1 
ATOM 1010  C CB  . VAL A 1 127 ? 21.15220  -9.90587  10.46404   1.000 90.50738  ? 127 VAL A CB  1 
ATOM 1011  C CG1 . VAL A 1 127 ? 21.99729  -8.76868  10.99943   1.000 101.26364 ? 127 VAL A CG1 1 
ATOM 1012  C CG2 . VAL A 1 127 ? 21.15391  -9.90870  8.94276    1.000 84.67261  ? 127 VAL A CG2 1 
ATOM 1013  N N   . HIS A 1 128 ? 21.01444  -13.13887 9.57505    1.000 119.56683 ? 128 HIS A N   1 
ATOM 1014  C CA  . HIS A 1 128 ? 20.13606  -14.23403 9.17634    1.000 132.62686 ? 128 HIS A CA  1 
ATOM 1015  C C   . HIS A 1 128 ? 20.06179  -15.29423 10.26560   1.000 126.99030 ? 128 HIS A C   1 
ATOM 1016  O O   . HIS A 1 128 ? 18.97851  -15.80286 10.57750   1.000 124.05664 ? 128 HIS A O   1 
ATOM 1017  C CB  . HIS A 1 128 ? 20.61861  -14.84830 7.86239    1.000 151.99983 ? 128 HIS A CB  1 
ATOM 1018  C CG  . HIS A 1 128 ? 20.59600  -13.89840 6.70597    1.000 171.31110 ? 128 HIS A CG  1 
ATOM 1019  N ND1 . HIS A 1 128 ? 21.59697  -12.97880 6.47800    1.000 172.29384 ? 128 HIS A ND1 1 
ATOM 1020  C CD2 . HIS A 1 128 ? 19.69446  -13.72759 5.71025    1.000 179.41758 ? 128 HIS A CD2 1 
ATOM 1021  C CE1 . HIS A 1 128 ? 21.31242  -12.28138 5.39268    1.000 173.49142 ? 128 HIS A CE1 1 
ATOM 1022  N NE2 . HIS A 1 128 ? 20.16331  -12.71604 4.90766    1.000 178.73820 ? 128 HIS A NE2 1 
ATOM 1023  N N   . ILE A 1 129 ? 21.20564  -15.63210 10.86270   1.000 124.64471 ? 129 ILE A N   1 
ATOM 1024  C CA  . ILE A 1 129 ? 21.22690  -16.64309 11.91315   1.000 122.53770 ? 129 ILE A CA  1 
ATOM 1025  C C   . ILE A 1 129 ? 20.49347  -16.14292 13.15058   1.000 126.96262 ? 129 ILE A C   1 
ATOM 1026  O O   . ILE A 1 129 ? 19.75534  -16.89590 13.79595   1.000 139.17671 ? 129 ILE A O   1 
ATOM 1027  C CB  . ILE A 1 129 ? 22.67702  -17.04459 12.23604   1.000 112.81588 ? 129 ILE A CB  1 
ATOM 1028  C CG1 . ILE A 1 129 ? 23.41486  -17.44368 10.95657   1.000 117.25867 ? 129 ILE A CG1 1 
ATOM 1029  C CG2 . ILE A 1 129 ? 22.70245  -18.17790 13.24899   1.000 108.75204 ? 129 ILE A CG2 1 
ATOM 1030  C CD1 . ILE A 1 129 ? 22.74043  -18.55899 10.18696   1.000 120.56995 ? 129 ILE A CD1 1 
ATOM 1031  N N   . TYR A 1 130 ? 20.67939  -14.86752 13.50135   1.000 124.63165 ? 130 TYR A N   1 
ATOM 1032  C CA  . TYR A 1 130 ? 19.98095  -14.31444 14.65770   1.000 106.13585 ? 130 TYR A CA  1 
ATOM 1033  C C   . TYR A 1 130 ? 18.47326  -14.28985 14.43081   1.000 106.80264 ? 130 TYR A C   1 
ATOM 1034  O O   . TYR A 1 130 ? 17.69445  -14.57895 15.34862   1.000 110.94060 ? 130 TYR A O   1 
ATOM 1035  C CB  . TYR A 1 130 ? 20.50764  -12.91096 14.96613   1.000 91.95403  ? 130 TYR A CB  1 
ATOM 1036  C CG  . TYR A 1 130 ? 20.42658  -12.52321 16.42878   1.000 90.75761  ? 130 TYR A CG  1 
ATOM 1037  C CD1 . TYR A 1 130 ? 21.30341  -13.06038 17.36116   1.000 96.24970  ? 130 TYR A CD1 1 
ATOM 1038  C CD2 . TYR A 1 130 ? 19.47855  -11.61331 16.87440   1.000 91.66521  ? 130 TYR A CD2 1 
ATOM 1039  C CE1 . TYR A 1 130 ? 21.23099  -12.70592 18.69694   1.000 103.38471 ? 130 TYR A CE1 1 
ATOM 1040  C CE2 . TYR A 1 130 ? 19.39793  -11.25329 18.20438   1.000 95.35514  ? 130 TYR A CE2 1 
ATOM 1041  C CZ  . TYR A 1 130 ? 20.27603  -11.80143 19.11188   1.000 105.05665 ? 130 TYR A CZ  1 
ATOM 1042  O OH  . TYR A 1 130 ? 20.19827  -11.44366 20.43850   1.000 117.15730 ? 130 TYR A OH  1 
ATOM 1043  N N   . TYR A 1 131 ? 18.03958  -13.97263 13.20708   1.000 110.26562 ? 131 TYR A N   1 
ATOM 1044  C CA  . TYR A 1 131 ? 16.60755  -13.96973 12.92681   1.000 111.60466 ? 131 TYR A CA  1 
ATOM 1045  C C   . TYR A 1 131 ? 16.04227  -15.38314 12.92975   1.000 123.11306 ? 131 TYR A C   1 
ATOM 1046  O O   . TYR A 1 131 ? 14.92551  -15.60523 13.40558   1.000 125.82035 ? 131 TYR A O   1 
ATOM 1047  C CB  . TYR A 1 131 ? 16.31636  -13.27652 11.59725   1.000 110.02503 ? 131 TYR A CB  1 
ATOM 1048  C CG  . TYR A 1 131 ? 14.84394  -13.26894 11.25338   1.000 117.66686 ? 131 TYR A CG  1 
ATOM 1049  C CD1 . TYR A 1 131 ? 13.95846  -12.44547 11.93836   1.000 116.33493 ? 131 TYR A CD1 1 
ATOM 1050  C CD2 . TYR A 1 131 ? 14.33615  -14.09145 10.25768   1.000 129.17999 ? 131 TYR A CD2 1 
ATOM 1051  C CE1 . TYR A 1 131 ? 12.61097  -12.43571 11.63622   1.000 120.13811 ? 131 TYR A CE1 1 
ATOM 1052  C CE2 . TYR A 1 131 ? 12.98839  -14.08864 9.94801    1.000 133.19496 ? 131 TYR A CE2 1 
ATOM 1053  C CZ  . TYR A 1 131 ? 12.13126  -13.25906 10.64031   1.000 124.01204 ? 131 TYR A CZ  1 
ATOM 1054  O OH  . TYR A 1 131 ? 10.79001  -13.25386 10.33461   1.000 124.52595 ? 131 TYR A OH  1 
ATOM 1055  N N   . LEU A 1 132 ? 16.79593  -16.35295 12.40718   1.000 117.28462 ? 132 LEU A N   1 
ATOM 1056  C CA  . LEU A 1 132 ? 16.34083  -17.73828 12.45817   1.000 127.77525 ? 132 LEU A CA  1 
ATOM 1057  C C   . LEU A 1 132 ? 16.25401  -18.23616 13.89529   1.000 130.64592 ? 132 LEU A C   1 
ATOM 1058  O O   . LEU A 1 132 ? 15.34677  -19.00172 14.23994   1.000 156.25608 ? 132 LEU A O   1 
ATOM 1059  C CB  . LEU A 1 132 ? 17.26558  -18.63204 11.63265   1.000 132.39073 ? 132 LEU A CB  1 
ATOM 1060  C CG  . LEU A 1 132 ? 17.10739  -18.52947 10.11448   1.000 128.30328 ? 132 LEU A CG  1 
ATOM 1061  C CD1 . LEU A 1 132 ? 18.13031  -19.40358 9.40475    1.000 136.02253 ? 132 LEU A CD1 1 
ATOM 1062  C CD2 . LEU A 1 132 ? 15.69167  -18.90457 9.69712    1.000 110.57929 ? 132 LEU A CD2 1 
ATOM 1063  N N   . GLU A 1 133 ? 17.18495  -17.80889 14.75024   1.000 119.41768 ? 133 GLU A N   1 
ATOM 1064  C CA  . GLU A 1 133 ? 17.12591  -18.18928 16.15800   1.000 112.73864 ? 133 GLU A CA  1 
ATOM 1065  C C   . GLU A 1 133 ? 15.91024  -17.57241 16.83926   1.000 109.69733 ? 133 GLU A C   1 
ATOM 1066  O O   . GLU A 1 133 ? 15.17901  -18.25661 17.56529   1.000 121.52232 ? 133 GLU A O   1 
ATOM 1067  C CB  . GLU A 1 133 ? 18.41639  -17.77745 16.86720   1.000 106.89109 ? 133 GLU A CB  1 
ATOM 1068  C CG  . GLU A 1 133 ? 19.62814  -18.60914 16.47482   1.000 109.73843 ? 133 GLU A CG  1 
ATOM 1069  C CD  . GLU A 1 133 ? 20.84227  -18.32096 17.33585   1.000 128.75225 ? 133 GLU A CD  1 
ATOM 1070  O OE1 . GLU A 1 133 ? 20.77328  -17.40118 18.17779   1.000 139.88359 ? 133 GLU A OE1 1 
ATOM 1071  O OE2 . GLU A 1 133 ? 21.86754  -19.01459 17.16936   1.000 138.88957 ? 133 GLU A OE2 1 
ATOM 1072  N N   . LYS A 1 134 ? 15.66982  -16.27923 16.60643   1.000 109.08561 ? 134 LYS A N   1 
ATOM 1073  C CA  . LYS A 1 134 ? 14.49559  -15.63018 17.17962   1.000 121.66399 ? 134 LYS A CA  1 
ATOM 1074  C C   . LYS A 1 134 ? 13.19308  -16.17807 16.60729   1.000 142.07799 ? 134 LYS A C   1 
ATOM 1075  O O   . LYS A 1 134 ? 12.15280  -16.08606 17.26740   1.000 155.18753 ? 134 LYS A O   1 
ATOM 1076  C CB  . LYS A 1 134 ? 14.56385  -14.11928 16.94913   1.000 119.48507 ? 134 LYS A CB  1 
ATOM 1077  C CG  . LYS A 1 134 ? 15.65580  -13.40424 17.73332   1.000 109.04802 ? 134 LYS A CG  1 
ATOM 1078  C CD  . LYS A 1 134 ? 15.41631  -13.47893 19.23497   1.000 110.91544 ? 134 LYS A CD  1 
ATOM 1079  C CE  . LYS A 1 134 ? 16.45303  -12.66469 19.99893   1.000 111.00596 ? 134 LYS A CE  1 
ATOM 1080  N NZ  . LYS A 1 134 ? 16.22847  -12.69539 21.47181   1.000 112.98921 ? 134 LYS A NZ  1 
ATOM 1081  N N   . ALA A 1 135 ? 13.22782  -16.74475 15.39896   1.000 126.62070 ? 135 ALA A N   1 
ATOM 1082  C CA  . ALA A 1 135 ? 12.03627  -17.34357 14.80835   1.000 129.72329 ? 135 ALA A CA  1 
ATOM 1083  C C   . ALA A 1 135 ? 11.76630  -18.72790 15.38414   1.000 148.18637 ? 135 ALA A C   1 
ATOM 1084  O O   . ALA A 1 135 ? 10.63744  -19.03180 15.78041   1.000 165.25880 ? 135 ALA A O   1 
ATOM 1085  C CB  . ALA A 1 135 ? 12.18276  -17.41082 13.28727   1.000 117.96058 ? 135 ALA A CB  1 
ATOM 1086  N N   . ASN A 1 136 ? 12.79077  -19.58237 15.44116   1.000 153.72530 ? 136 ASN A N   1 
ATOM 1087  C CA  . ASN A 1 136 ? 12.62880  -20.88113 16.08313   1.000 145.86616 ? 136 ASN A CA  1 
ATOM 1088  C C   . ASN A 1 136 ? 12.32803  -20.73537 17.56653   1.000 130.46849 ? 136 ASN A C   1 
ATOM 1089  O O   . ASN A 1 136 ? 11.79746  -21.66808 18.18001   1.000 127.31860 ? 136 ASN A O   1 
ATOM 1090  C CB  . ASN A 1 136 ? 13.88362  -21.73156 15.88158   1.000 147.32091 ? 136 ASN A CB  1 
ATOM 1091  C CG  . ASN A 1 136 ? 14.01178  -22.25139 14.46448   1.000 148.39096 ? 136 ASN A CG  1 
ATOM 1092  O OD1 . ASN A 1 136 ? 13.01793  -22.59899 13.82697   1.000 161.85524 ? 136 ASN A OD1 1 
ATOM 1093  N ND2 . ASN A 1 136 ? 15.24025  -22.30652 13.96264   1.000 132.41156 ? 136 ASN A ND2 1 
ATOM 1094  N N   . LYS A 1 137 ? 12.65723  -19.58386 18.14892   1.000 147.88333 ? 137 LYS A N   1 
ATOM 1095  C CA  . LYS A 1 137 ? 12.33478  -19.26442 19.53096   1.000 157.18529 ? 137 LYS A CA  1 
ATOM 1096  C C   . LYS A 1 137 ? 10.94817  -18.64129 19.65699   1.000 176.69135 ? 137 LYS A C   1 
ATOM 1097  O O   . LYS A 1 137 ? 10.21484  -18.94498 20.60385   1.000 183.56499 ? 137 LYS A O   1 
ATOM 1098  C CB  . LYS A 1 137 ? 13.40153  -18.32172 20.09329   1.000 147.94451 ? 137 LYS A CB  1 
ATOM 1099  C CG  . LYS A 1 137 ? 13.35923  -18.10164 21.58850   1.000 136.77439 ? 137 LYS A CG  1 
ATOM 1100  C CD  . LYS A 1 137 ? 14.34919  -17.01557 21.97912   1.000 130.30714 ? 137 LYS A CD  1 
ATOM 1101  C CE  . LYS A 1 137 ? 15.77952  -17.46294 21.72346   1.000 128.23747 ? 137 LYS A CE  1 
ATOM 1102  N NZ  . LYS A 1 137 ? 16.77483  -16.43568 22.13634   1.000 120.24216 ? 137 LYS A NZ  1 
ATOM 1103  N N   . ILE A 1 138 ? 10.57879  -17.77541 18.71379   1.000 179.34374 ? 138 ILE A N   1 
ATOM 1104  C CA  . ILE A 1 138 ? 9.27880   -17.10592 18.68919   1.000 165.78343 ? 138 ILE A CA  1 
ATOM 1105  C C   . ILE A 1 138 ? 8.69678   -17.31362 17.29523   1.000 162.46672 ? 138 ILE A C   1 
ATOM 1106  O O   . ILE A 1 138 ? 9.13000   -16.66948 16.33295   1.000 175.66294 ? 138 ILE A O   1 
ATOM 1107  C CB  . ILE A 1 138 ? 9.37917   -15.61377 19.03025   1.000 151.73530 ? 138 ILE A CB  1 
ATOM 1108  C CG1 . ILE A 1 138 ? 9.80757   -15.41716 20.48762   1.000 167.44000 ? 138 ILE A CG1 1 
ATOM 1109  C CG2 . ILE A 1 138 ? 8.06449   -14.90321 18.74284   1.000 134.49329 ? 138 ILE A CG2 1 
ATOM 1110  C CD1 . ILE A 1 138 ? 11.29444  -15.21524 20.66741   1.000 173.72896 ? 138 ILE A CD1 1 
ATOM 1111  N N   . LYS A 1 139 ? 7.72385   -18.21606 17.17501   1.000 156.41578 ? 139 LYS A N   1 
ATOM 1112  C CA  . LYS A 1 139 ? 7.09253   -18.48802 15.89136   1.000 160.03966 ? 139 LYS A CA  1 
ATOM 1113  C C   . LYS A 1 139 ? 5.59365   -18.65970 16.08953   1.000 199.74892 ? 139 LYS A C   1 
ATOM 1114  O O   . LYS A 1 139 ? 5.12289   -18.98123 17.18335   1.000 218.09761 ? 139 LYS A O   1 
ATOM 1115  C CB  . LYS A 1 139 ? 7.68891   -19.73841 15.22559   1.000 143.12446 ? 139 LYS A CB  1 
ATOM 1116  C CG  . LYS A 1 139 ? 7.53846   -19.79119 13.70945   1.000 140.47645 ? 139 LYS A CG  1 
ATOM 1117  C CD  . LYS A 1 139 ? 6.40112   -20.70297 13.27840   1.000 162.62584 ? 139 LYS A CD  1 
ATOM 1118  C CE  . LYS A 1 139 ? 6.33337   -20.81797 11.76274   1.000 169.41179 ? 139 LYS A CE  1 
ATOM 1119  N NZ  . LYS A 1 139 ? 7.56580   -21.43161 11.19274   1.000 166.52052 ? 139 LYS A NZ  1 
ATOM 1120  N N   . SER A 1 140 ? 4.84834   -18.42712 15.00823   1.000 189.06989 ? 140 SER A N   1 
ATOM 1121  C CA  . SER A 1 140 ? 3.39947   -18.59926 14.91791   1.000 185.18843 ? 140 SER A CA  1 
ATOM 1122  C C   . SER A 1 140 ? 2.61855   -17.63341 15.80104   1.000 191.84416 ? 140 SER A C   1 
ATOM 1123  O O   . SER A 1 140 ? 1.39292   -17.76500 15.91035   1.000 180.70625 ? 140 SER A O   1 
ATOM 1124  C CB  . SER A 1 140 ? 2.97189   -20.03842 15.23668   1.000 168.83925 ? 140 SER A CB  1 
ATOM 1125  O OG  . SER A 1 140 ? 3.14803   -20.34044 16.60962   1.000 163.11700 ? 140 SER A OG  1 
ATOM 1126  N N   . GLU A 1 141 ? 3.27949   -16.66573 16.43246   1.000 193.24725 ? 141 GLU A N   1 
ATOM 1127  C CA  . GLU A 1 141 ? 2.59726   -15.64454 17.21157   1.000 179.24578 ? 141 GLU A CA  1 
ATOM 1128  C C   . GLU A 1 141 ? 2.93642   -14.26457 16.66519   1.000 156.90863 ? 141 GLU A C   1 
ATOM 1129  O O   . GLU A 1 141 ? 4.03089   -14.03502 16.14045   1.000 154.83433 ? 141 GLU A O   1 
ATOM 1130  C CB  . GLU A 1 141 ? 2.96484   -15.72066 18.70175   1.000 174.01761 ? 141 GLU A CB  1 
ATOM 1131  C CG  . GLU A 1 141 ? 4.41941   -15.41725 19.02099   1.000 160.45229 ? 141 GLU A CG  1 
ATOM 1132  C CD  . GLU A 1 141 ? 4.75109   -15.65142 20.48349   1.000 160.65689 ? 141 GLU A CD  1 
ATOM 1133  O OE1 . GLU A 1 141 ? 3.92484   -16.26410 21.19093   1.000 170.67095 ? 141 GLU A OE1 1 
ATOM 1134  O OE2 . GLU A 1 141 ? 5.83034   -15.21260 20.93169   1.000 155.88723 ? 141 GLU A OE2 1 
ATOM 1135  N N   . ASN A 1 142 ? 1.97720   -13.34597 16.78633   1.000 153.58681 ? 142 ASN A N   1 
ATOM 1136  C CA  . ASN A 1 142 ? 2.11050   -11.99733 16.23763   1.000 138.86387 ? 142 ASN A CA  1 
ATOM 1137  C C   . ASN A 1 142 ? 3.06167   -11.19190 17.11913   1.000 131.27296 ? 142 ASN A C   1 
ATOM 1138  O O   . ASN A 1 142 ? 2.65834   -10.39035 17.96543   1.000 131.68760 ? 142 ASN A O   1 
ATOM 1139  C CB  . ASN A 1 142 ? 0.74603   -11.32765 16.13210   1.000 133.30297 ? 142 ASN A CB  1 
ATOM 1140  C CG  . ASN A 1 142 ? -0.05619  -11.82620 14.94781   1.000 137.91789 ? 142 ASN A CG  1 
ATOM 1141  O OD1 . ASN A 1 142 ? 0.49204   -12.08706 13.87704   1.000 140.90330 ? 142 ASN A OD1 1 
ATOM 1142  N ND2 . ASN A 1 142 ? -1.36337  -11.96325 15.13493   1.000 129.52647 ? 142 ASN A ND2 1 
ATOM 1143  N N   . THR A 1 143 ? 4.35808   -11.41326 16.90784   1.000 124.82797 ? 143 THR A N   1 
ATOM 1144  C CA  . THR A 1 143 ? 5.40863   -10.66586 17.59537   1.000 118.30573 ? 143 THR A CA  1 
ATOM 1145  C C   . THR A 1 143 ? 6.47576   -10.31435 16.56921   1.000 109.59337 ? 143 THR A C   1 
ATOM 1146  O O   . THR A 1 143 ? 7.18986   -11.19883 16.08673   1.000 109.57481 ? 143 THR A O   1 
ATOM 1147  C CB  . THR A 1 143 ? 6.00604   -11.46743 18.75229   1.000 118.05508 ? 143 THR A CB  1 
ATOM 1148  O OG1 . THR A 1 143 ? 4.96174   -11.86951 19.64778   1.000 127.41185 ? 143 THR A OG1 1 
ATOM 1149  C CG2 . THR A 1 143 ? 7.02001   -10.62589 19.51261   1.000 110.34662 ? 143 THR A CG2 1 
ATOM 1150  N N   . HIS A 1 144 ? 6.58222   -9.03141  16.23635   1.000 104.18183 ? 144 HIS A N   1 
ATOM 1151  C CA  . HIS A 1 144 ? 7.49140   -8.59401  15.18921   1.000 101.97822 ? 144 HIS A CA  1 
ATOM 1152  C C   . HIS A 1 144 ? 8.93061   -8.57074  15.68931   1.000 101.16111 ? 144 HIS A C   1 
ATOM 1153  O O   . HIS A 1 144 ? 9.21030   -8.18261  16.82991   1.000 99.10356  ? 144 HIS A O   1 
ATOM 1154  C CB  . HIS A 1 144 ? 7.09162   -7.20967  14.67860   1.000 109.72353 ? 144 HIS A CB  1 
ATOM 1155  C CG  . HIS A 1 144 ? 7.58381   -6.91163  13.29640   1.000 113.72071 ? 144 HIS A CG  1 
ATOM 1156  N ND1 . HIS A 1 144 ? 7.01224   -7.46159  12.16925   1.000 116.75424 ? 144 HIS A ND1 1 
ATOM 1157  C CD2 . HIS A 1 144 ? 8.58968   -6.11764  12.85872   1.000 109.70926 ? 144 HIS A CD2 1 
ATOM 1158  C CE1 . HIS A 1 144 ? 7.64801   -7.02363  11.09729   1.000 115.32243 ? 144 HIS A CE1 1 
ATOM 1159  N NE2 . HIS A 1 144 ? 8.60844   -6.20530  11.48791   1.000 107.51894 ? 144 HIS A NE2 1 
ATOM 1160  N N   . ILE A 1 145 ? 9.84252   -8.98645  14.81590   1.000 97.77114  ? 145 ILE A N   1 
ATOM 1161  C CA  . ILE A 1 145 ? 11.26567  -9.08096  15.11240   1.000 94.84674  ? 145 ILE A CA  1 
ATOM 1162  C C   . ILE A 1 145 ? 11.97926  -7.99643  14.32123   1.000 91.57455  ? 145 ILE A C   1 
ATOM 1163  O O   . ILE A 1 145 ? 11.71048  -7.81647  13.12785   1.000 92.01085  ? 145 ILE A O   1 
ATOM 1164  C CB  . ILE A 1 145 ? 11.82532  -10.46985 14.75752   1.000 96.13745  ? 145 ILE A CB  1 
ATOM 1165  C CG1 . ILE A 1 145 ? 11.01306  -11.56884 15.44562   1.000 100.17942 ? 145 ILE A CG1 1 
ATOM 1166  C CG2 . ILE A 1 145 ? 13.29667  -10.56499 15.13623   1.000 93.26609  ? 145 ILE A CG2 1 
ATOM 1167  C CD1 . ILE A 1 145 ? 11.44600  -12.97365 15.07824   1.000 102.27428 ? 145 ILE A CD1 1 
ATOM 1168  N N   . HIS A 1 146 ? 12.88015  -7.27025  14.97973   1.000 99.21155  ? 146 HIS A N   1 
ATOM 1169  C CA  . HIS A 1 146 ? 13.68794  -6.25163  14.32222   1.000 100.32276 ? 146 HIS A CA  1 
ATOM 1170  C C   . HIS A 1 146 ? 15.12580  -6.45382  14.76701   1.000 100.29735 ? 146 HIS A C   1 
ATOM 1171  O O   . HIS A 1 146 ? 15.42548  -6.37076  15.96275   1.000 105.46630 ? 146 HIS A O   1 
ATOM 1172  C CB  . HIS A 1 146 ? 13.20139  -4.84278  14.67209   1.000 95.38961  ? 146 HIS A CB  1 
ATOM 1173  C CG  . HIS A 1 146 ? 13.45873  -3.83262  13.59915   1.000 91.00224  ? 146 HIS A CG  1 
ATOM 1174  N ND1 . HIS A 1 146 ? 12.51828  -3.50074  12.64772   1.000 96.85963  ? 146 HIS A ND1 1 
ATOM 1175  C CD2 . HIS A 1 146 ? 14.55380  -3.08784  13.32136   1.000 89.33321  ? 146 HIS A CD2 1 
ATOM 1176  C CE1 . HIS A 1 146 ? 13.02143  -2.58988  11.83384   1.000 95.82216  ? 146 HIS A CE1 1 
ATOM 1177  N NE2 . HIS A 1 146 ? 14.25568  -2.32252  12.22044   1.000 89.63619  ? 146 HIS A NE2 1 
ATOM 1178  N N   . ILE A 1 147 ? 16.01161  -6.72465  13.81330   1.000 80.55139  ? 147 ILE A N   1 
ATOM 1179  C CA  . ILE A 1 147 ? 17.37646  -7.12323  14.11697   1.000 78.57494  ? 147 ILE A CA  1 
ATOM 1180  C C   . ILE A 1 147 ? 18.33495  -6.18823  13.39842   1.000 82.38164  ? 147 ILE A C   1 
ATOM 1181  O O   . ILE A 1 147 ? 18.23475  -5.99942  12.17889   1.000 101.92400 ? 147 ILE A O   1 
ATOM 1182  C CB  . ILE A 1 147 ? 17.62647  -8.58687  13.71649   1.000 80.18132  ? 147 ILE A CB  1 
ATOM 1183  C CG1 . ILE A 1 147 ? 16.87665  -9.50290  14.68030   1.000 82.95618  ? 147 ILE A CG1 1 
ATOM 1184  C CG2 . ILE A 1 147 ? 19.11331  -8.90328  13.72637   1.000 78.07276  ? 147 ILE A CG2 1 
ATOM 1185  C CD1 . ILE A 1 147 ? 17.18327  -10.94436 14.50033   1.000 84.93058  ? 147 ILE A CD1 1 
ATOM 1186  N N   . PHE A 1 148 ? 19.26131  -5.61589  14.15829   1.000 83.46156  ? 148 PHE A N   1 
ATOM 1187  C CA  . PHE A 1 148 ? 20.30993  -4.74431  13.66062   1.000 79.15095  ? 148 PHE A CA  1 
ATOM 1188  C C   . PHE A 1 148 ? 21.67507  -5.39424  13.85291   1.000 88.61970  ? 148 PHE A C   1 
ATOM 1189  O O   . PHE A 1 148 ? 21.86316  -6.28528  14.69170   1.000 115.88936 ? 148 PHE A O   1 
ATOM 1190  C CB  . PHE A 1 148 ? 20.27837  -3.38789  14.37443   1.000 70.93785  ? 148 PHE A CB  1 
ATOM 1191  C CG  . PHE A 1 148 ? 19.11918  -2.51798  13.98057   1.000 76.02981  ? 148 PHE A CG  1 
ATOM 1192  C CD1 . PHE A 1 148 ? 18.59839  -2.57016  12.69855   1.000 76.27899  ? 148 PHE A CD1 1 
ATOM 1193  C CD2 . PHE A 1 148 ? 18.55052  -1.64612  14.89530   1.000 79.25593  ? 148 PHE A CD2 1 
ATOM 1194  C CE1 . PHE A 1 148 ? 17.53374  -1.76794  12.33548   1.000 75.32452  ? 148 PHE A CE1 1 
ATOM 1195  C CE2 . PHE A 1 148 ? 17.48474  -0.84167  14.53833   1.000 80.50168  ? 148 PHE A CE2 1 
ATOM 1196  C CZ  . PHE A 1 148 ? 16.97741  -0.90161  13.25608   1.000 77.10065  ? 148 PHE A CZ  1 
ATOM 1197  N N   . SER A 1 149 ? 22.63032  -4.93016  13.05419   1.000 66.14005  ? 149 SER A N   1 
ATOM 1198  C CA  . SER A 1 149 ? 24.01743  -5.35238  13.14028   1.000 68.20164  ? 149 SER A CA  1 
ATOM 1199  C C   . SER A 1 149 ? 24.91032  -4.12332  13.06362   1.000 70.81078  ? 149 SER A C   1 
ATOM 1200  O O   . SER A 1 149 ? 24.46299  -3.01787  12.74615   1.000 62.49038  ? 149 SER A O   1 
ATOM 1201  C CB  . SER A 1 149 ? 24.37855  -6.34692  12.02868   1.000 82.99694  ? 149 SER A CB  1 
ATOM 1202  O OG  . SER A 1 149 ? 24.34147  -5.72775  10.75464   1.000 108.08547 ? 149 SER A OG  1 
ATOM 1203  N N   . PHE A 1 150 ? 26.19106  -4.32858  13.36041   1.000 78.80185  ? 150 PHE A N   1 
ATOM 1204  C CA  . PHE A 1 150 ? 27.15723  -3.24199  13.29688   1.000 77.13066  ? 150 PHE A CA  1 
ATOM 1205  C C   . PHE A 1 150 ? 27.65057  -2.98580  11.87963   1.000 73.12704  ? 150 PHE A C   1 
ATOM 1206  O O   . PHE A 1 150 ? 28.20493  -1.91387  11.61432   1.000 58.73096  ? 150 PHE A O   1 
ATOM 1207  C CB  . PHE A 1 150 ? 28.33203  -3.54176  14.22839   1.000 69.97380  ? 150 PHE A CB  1 
ATOM 1208  C CG  . PHE A 1 150 ? 27.92872  -3.70673  15.66629   1.000 62.16435  ? 150 PHE A CG  1 
ATOM 1209  C CD1 . PHE A 1 150 ? 27.68750  -2.59997  16.46457   1.000 62.62609  ? 150 PHE A CD1 1 
ATOM 1210  C CD2 . PHE A 1 150 ? 27.77290  -4.96811  16.21467   1.000 60.27612  ? 150 PHE A CD2 1 
ATOM 1211  C CE1 . PHE A 1 150 ? 27.30934  -2.75032  17.78650   1.000 59.99407  ? 150 PHE A CE1 1 
ATOM 1212  C CE2 . PHE A 1 150 ? 27.39404  -5.12319  17.53369   1.000 61.26948  ? 150 PHE A CE2 1 
ATOM 1213  C CZ  . PHE A 1 150 ? 27.16312  -4.01400  18.32082   1.000 61.09858  ? 150 PHE A CZ  1 
ATOM 1214  N N   . THR A 1 151 ? 27.46287  -3.94069  10.96899   1.000 85.93636  ? 151 THR A N   1 
ATOM 1215  C CA  . THR A 1 151 ? 27.85822  -3.76086  9.57893    1.000 95.42764  ? 151 THR A CA  1 
ATOM 1216  C C   . THR A 1 151 ? 26.88948  -2.88721  8.79424    1.000 74.60454  ? 151 THR A C   1 
ATOM 1217  O O   . THR A 1 151 ? 27.22655  -2.46221  7.68400    1.000 76.42287  ? 151 THR A O   1 
ATOM 1218  C CB  . THR A 1 151 ? 27.97905  -5.11874  8.88518    1.000 118.56562 ? 151 THR A CB  1 
ATOM 1219  O OG1 . THR A 1 151 ? 26.68580  -5.73080  8.80712    1.000 132.03602 ? 151 THR A OG1 1 
ATOM 1220  C CG2 . THR A 1 151 ? 28.90931  -6.02726  9.66475    1.000 116.25590 ? 151 THR A CG2 1 
ATOM 1221  N N   . GLY A 1 152 ? 25.70519  -2.61247  9.33567    1.000 75.66962  ? 152 GLY A N   1 
ATOM 1222  C CA  . GLY A 1 152 ? 24.69478  -1.83357  8.65071    1.000 69.13702  ? 152 GLY A CA  1 
ATOM 1223  C C   . GLY A 1 152 ? 23.50604  -2.63028  8.16155    1.000 73.84070  ? 152 GLY A C   1 
ATOM 1224  O O   . GLY A 1 152 ? 22.53523  -2.02730  7.68696    1.000 72.93472  ? 152 GLY A O   1 
ATOM 1225  N N   . GLU A 1 153 ? 23.54277  -3.95677  8.25680    1.000 87.69472  ? 153 GLU A N   1 
ATOM 1226  C CA  . GLU A 1 153 ? 22.41140  -4.75933  7.82151    1.000 83.30274  ? 153 GLU A CA  1 
ATOM 1227  C C   . GLU A 1 153 ? 21.25441  -4.64043  8.80965    1.000 74.48721  ? 153 GLU A C   1 
ATOM 1228  O O   . GLU A 1 153 ? 21.42591  -4.28250  9.97816    1.000 72.51650  ? 153 GLU A O   1 
ATOM 1229  C CB  . GLU A 1 153 ? 22.81144  -6.22573  7.65342    1.000 98.91043  ? 153 GLU A CB  1 
ATOM 1230  C CG  . GLU A 1 153 ? 23.95013  -6.45498  6.67349    1.000 112.21309 ? 153 GLU A CG  1 
ATOM 1231  C CD  . GLU A 1 153 ? 24.21641  -7.92738  6.43069    1.000 119.04176 ? 153 GLU A CD  1 
ATOM 1232  O OE1 . GLU A 1 153 ? 23.38529  -8.75875  6.85230    1.000 116.50378 ? 153 GLU A OE1 1 
ATOM 1233  O OE2 . GLU A 1 153 ? 25.25363  -8.25399  5.81742    1.000 125.35461 ? 153 GLU A OE2 1 
ATOM 1234  N N   . GLU A 1 154 ? 20.05917  -4.95295  8.31725    1.000 70.80315  ? 154 GLU A N   1 
ATOM 1235  C CA  . GLU A 1 154 ? 18.83070  -4.80236  9.08404    1.000 87.43538  ? 154 GLU A CA  1 
ATOM 1236  C C   . GLU A 1 154 ? 17.81694  -5.81443  8.57342    1.000 102.08094 ? 154 GLU A C   1 
ATOM 1237  O O   . GLU A 1 154 ? 17.65042  -5.96521  7.35881    1.000 116.50297 ? 154 GLU A O   1 
ATOM 1238  C CB  . GLU A 1 154 ? 18.29401  -3.37391  8.95269    1.000 98.34952  ? 154 GLU A CB  1 
ATOM 1239  C CG  . GLU A 1 154 ? 16.80645  -3.22671  9.16707    1.000 108.56042 ? 154 GLU A CG  1 
ATOM 1240  C CD  . GLU A 1 154 ? 16.27779  -1.93131  8.59033    1.000 108.13556 ? 154 GLU A CD  1 
ATOM 1241  O OE1 . GLU A 1 154 ? 17.09458  -1.10951  8.12221    1.000 94.71962  ? 154 GLU A OE1 1 
ATOM 1242  O OE2 . GLU A 1 154 ? 15.04622  -1.74436  8.58566    1.000 114.28714 ? 154 GLU A OE2 1 
ATOM 1243  N N   . MET A 1 155 ? 17.14145  -6.50269  9.49359    1.000 114.61755 ? 155 MET A N   1 
ATOM 1244  C CA  . MET A 1 155 ? 16.19025  -7.54340  9.11188    1.000 113.94484 ? 155 MET A CA  1 
ATOM 1245  C C   . MET A 1 155 ? 14.96127  -7.49441  10.00574   1.000 113.09846 ? 155 MET A C   1 
ATOM 1246  O O   . MET A 1 155 ? 15.07254  -7.60987  11.22963   1.000 122.93486 ? 155 MET A O   1 
ATOM 1247  C CB  . MET A 1 155 ? 16.83326  -8.93240  9.17001    1.000 108.17432 ? 155 MET A CB  1 
ATOM 1248  C CG  . MET A 1 155 ? 16.03467  -10.00054 8.43412    1.000 109.29092 ? 155 MET A CG  1 
ATOM 1249  S SD  . MET A 1 155 ? 16.89295  -11.58116 8.30393    1.000 108.99643 ? 155 MET A SD  1 
ATOM 1250  C CE  . MET A 1 155 ? 15.76389  -12.49543 7.25493    1.000 100.34263 ? 155 MET A CE  1 
ATOM 1251  N N   . ALA A 1 156 ? 13.79674  -7.31666  9.39440    1.000 109.31972 ? 156 ALA A N   1 
ATOM 1252  C CA  . ALA A 1 156 ? 12.51907  -7.41095  10.08180   1.000 120.14170 ? 156 ALA A CA  1 
ATOM 1253  C C   . ALA A 1 156 ? 11.76753  -8.64559  9.59887    1.000 108.66529 ? 156 ALA A C   1 
ATOM 1254  O O   . ALA A 1 156 ? 12.18646  -9.33419  8.66494    1.000 108.53214 ? 156 ALA A O   1 
ATOM 1255  C CB  . ALA A 1 156 ? 11.68085  -6.14743  9.86109    1.000 148.19206 ? 156 ALA A CB  1 
ATOM 1256  N N   . THR A 1 157 ? 10.64130  -8.92211  10.25034   1.000 109.42396 ? 157 THR A N   1 
ATOM 1257  C CA  . THR A 1 157 ? 9.84210   -10.09788 9.92631    1.000 126.09261 ? 157 THR A CA  1 
ATOM 1258  C C   . THR A 1 157 ? 9.05216   -9.84669  8.64656    1.000 151.37582 ? 157 THR A C   1 
ATOM 1259  O O   . THR A 1 157 ? 8.18331   -8.96818  8.60879    1.000 161.03430 ? 157 THR A O   1 
ATOM 1260  C CB  . THR A 1 157 ? 8.90422   -10.44577 11.08036   1.000 116.10760 ? 157 THR A CB  1 
ATOM 1261  O OG1 . THR A 1 157 ? 9.67570   -10.82682 12.22664   1.000 115.26618 ? 157 THR A OG1 1 
ATOM 1262  C CG2 . THR A 1 157 ? 7.98346   -11.59439 10.69172   1.000 110.41310 ? 157 THR A CG2 1 
ATOM 1263  N N   . LYS A 1 158 ? 9.36380   -10.61593 7.60071    1.000 154.91335 ? 158 LYS A N   1 
ATOM 1264  C CA  . LYS A 1 158 ? 8.64402   -10.57100 6.32579    1.000 158.46337 ? 158 LYS A CA  1 
ATOM 1265  C C   . LYS A 1 158 ? 8.71774   -9.18216  5.68966    1.000 148.06936 ? 158 LYS A C   1 
ATOM 1266  O O   . LYS A 1 158 ? 7.71158   -8.61287  5.26040    1.000 144.33089 ? 158 LYS A O   1 
ATOM 1267  C CB  . LYS A 1 158 ? 7.19180   -11.02493 6.49905    1.000 156.48302 ? 158 LYS A CB  1 
ATOM 1268  C CG  . LYS A 1 158 ? 7.05162   -12.46646 6.96345    1.000 155.20119 ? 158 LYS A CG  1 
ATOM 1269  C CD  . LYS A 1 158 ? 7.66255   -13.42847 5.95462    1.000 154.33448 ? 158 LYS A CD  1 
ATOM 1270  C CE  . LYS A 1 158 ? 7.72291   -14.84780 6.49905    1.000 149.53190 ? 158 LYS A CE  1 
ATOM 1271  N NZ  . LYS A 1 158 ? 8.74940   -14.99058 7.56954    1.000 144.08807 ? 158 LYS A NZ  1 
ATOM 1272  N N   . ALA A 1 159 ? 9.93486   -8.63709  5.64005    1.000 131.76996 ? 159 ALA A N   1 
ATOM 1273  C CA  . ALA A 1 159 ? 10.25328  -7.38686  4.94954    1.000 115.62145 ? 159 ALA A CA  1 
ATOM 1274  C C   . ALA A 1 159 ? 9.43772   -6.19957  5.45409    1.000 118.63504 ? 159 ALA A C   1 
ATOM 1275  O O   . ALA A 1 159 ? 9.33271   -5.18086  4.76372    1.000 137.40865 ? 159 ALA A O   1 
ATOM 1276  C CB  . ALA A 1 159 ? 10.08071  -7.53264  3.43277    1.000 101.96551 ? 159 ALA A CB  1 
ATOM 1277  N N   . ASP A 1 160 ? 8.85174   -6.29990  6.64744    1.000 121.03101 ? 160 ASP A N   1 
ATOM 1278  C CA  . ASP A 1 160 ? 8.06460   -5.20733  7.21831    1.000 119.10499 ? 160 ASP A CA  1 
ATOM 1279  C C   . ASP A 1 160 ? 8.93079   -4.45633  8.22688    1.000 121.37878 ? 160 ASP A C   1 
ATOM 1280  O O   . ASP A 1 160 ? 8.79177   -4.59939  9.44245    1.000 121.47000 ? 160 ASP A O   1 
ATOM 1281  C CB  . ASP A 1 160 ? 6.78053   -5.74071  7.84929    1.000 117.86372 ? 160 ASP A CB  1 
ATOM 1282  C CG  . ASP A 1 160 ? 5.73667   -4.65691  8.05250    1.000 119.19958 ? 160 ASP A CG  1 
ATOM 1283  O OD1 . ASP A 1 160 ? 6.06069   -3.47055  7.83227    1.000 110.72388 ? 160 ASP A OD1 1 
ATOM 1284  O OD2 . ASP A 1 160 ? 4.59428   -4.98885  8.43390    1.000 132.92291 ? 160 ASP A OD2 1 
ATOM 1285  N N   . TYR A 1 161 ? 9.84581   -3.64398  7.69800    1.000 109.36666 ? 161 TYR A N   1 
ATOM 1286  C CA  . TYR A 1 161 ? 10.67111  -2.75842  8.51876    1.000 113.69604 ? 161 TYR A CA  1 
ATOM 1287  C C   . TYR A 1 161 ? 9.77458   -1.65324  9.05922    1.000 127.57049 ? 161 TYR A C   1 
ATOM 1288  O O   . TYR A 1 161 ? 9.41661   -0.71539  8.34220    1.000 142.32829 ? 161 TYR A O   1 
ATOM 1289  C CB  . TYR A 1 161 ? 11.83111  -2.19766  7.70173    1.000 104.41294 ? 161 TYR A CB  1 
ATOM 1290  C CG  . TYR A 1 161 ? 12.61018  -3.25523  6.94970    1.000 102.83597 ? 161 TYR A CG  1 
ATOM 1291  C CD1 . TYR A 1 161 ? 13.42484  -4.15781  7.62170    1.000 105.51886 ? 161 TYR A CD1 1 
ATOM 1292  C CD2 . TYR A 1 161 ? 12.53023  -3.35100  5.56774    1.000 103.40495 ? 161 TYR A CD2 1 
ATOM 1293  C CE1 . TYR A 1 161 ? 14.13724  -5.12543  6.93875    1.000 101.77723 ? 161 TYR A CE1 1 
ATOM 1294  C CE2 . TYR A 1 161 ? 13.23836  -4.31389  4.87620    1.000 104.29199 ? 161 TYR A CE2 1 
ATOM 1295  C CZ  . TYR A 1 161 ? 14.04042  -5.19859  5.56603    1.000 101.35157 ? 161 TYR A CZ  1 
ATOM 1296  O OH  . TYR A 1 161 ? 14.74686  -6.15867  4.87808    1.000 100.35994 ? 161 TYR A OH  1 
ATOM 1297  N N   . THR A 1 162 ? 9.40811   -1.76565  10.33491   1.000 136.21719 ? 162 THR A N   1 
ATOM 1298  C CA  . THR A 1 162 ? 8.30548   -0.99260  10.89119   1.000 126.90325 ? 162 THR A CA  1 
ATOM 1299  C C   . THR A 1 162 ? 8.72962   0.41631   11.28512   1.000 112.04223 ? 162 THR A C   1 
ATOM 1300  O O   . THR A 1 162 ? 8.41009   0.87784   12.38691   1.000 110.39569 ? 162 THR A O   1 
ATOM 1301  C CB  . THR A 1 162 ? 7.72092   -1.71070  12.11162   1.000 123.43331 ? 162 THR A CB  1 
ATOM 1302  O OG1 . THR A 1 162 ? 7.79504   -3.12836  11.91730   1.000 120.41415 ? 162 THR A OG1 1 
ATOM 1303  C CG2 . THR A 1 162 ? 6.25040   -1.32430  12.29597   1.000 128.93508 ? 162 THR A CG2 1 
ATOM 1304  N N   . LEU A 1 163 ? 9.46809   1.10561   10.41927   1.000 97.61218  ? 163 LEU A N   1 
ATOM 1305  C CA  . LEU A 1 163 ? 9.92146   2.46079   10.71176   1.000 102.65081 ? 163 LEU A CA  1 
ATOM 1306  C C   . LEU A 1 163 ? 9.94373   3.28585   9.43312    1.000 113.73329 ? 163 LEU A C   1 
ATOM 1307  O O   . LEU A 1 163 ? 9.52149   2.83923   8.36307    1.000 126.09119 ? 163 LEU A O   1 
ATOM 1308  C CB  . LEU A 1 163 ? 11.31241  2.48998   11.35542   1.000 112.27232 ? 163 LEU A CB  1 
ATOM 1309  C CG  . LEU A 1 163 ? 11.40892  3.03537   12.77462   1.000 130.68821 ? 163 LEU A CG  1 
ATOM 1310  C CD1 . LEU A 1 163 ? 12.86935  3.31299   13.14934   1.000 148.47616 ? 163 LEU A CD1 1 
ATOM 1311  C CD2 . LEU A 1 163 ? 10.55593  4.27355   12.89803   1.000 125.70890 ? 163 LEU A CD2 1 
ATOM 1312  N N   . ASP A 1 164 ? 10.44857  4.51044   9.57490    1.000 104.88073 ? 164 ASP A N   1 
ATOM 1313  C CA  . ASP A 1 164 ? 10.74268  5.40354   8.46934    1.000 108.19542 ? 164 ASP A CA  1 
ATOM 1314  C C   . ASP A 1 164 ? 12.05048  4.95063   7.81630    1.000 99.81147  ? 164 ASP A C   1 
ATOM 1315  O O   . ASP A 1 164 ? 12.66329  3.96090   8.22333    1.000 98.64980  ? 164 ASP A O   1 
ATOM 1316  C CB  . ASP A 1 164 ? 10.80800  6.84595   8.98044    1.000 121.97572 ? 164 ASP A CB  1 
ATOM 1317  C CG  . ASP A 1 164 ? 10.89508  7.87698   7.86276    1.000 146.87440 ? 164 ASP A CG  1 
ATOM 1318  O OD1 . ASP A 1 164 ? 10.83696  7.49239   6.67489    1.000 163.55148 ? 164 ASP A OD1 1 
ATOM 1319  O OD2 . ASP A 1 164 ? 11.02317  9.08083   8.17832    1.000 150.73522 ? 164 ASP A OD2 1 
ATOM 1320  N N   . GLU A 1 165 ? 12.49897  5.68189   6.79603    1.000 103.19865 ? 165 GLU A N   1 
ATOM 1321  C CA  . GLU A 1 165 ? 13.76974  5.35115   6.15883    1.000 109.16693 ? 165 GLU A CA  1 
ATOM 1322  C C   . GLU A 1 165 ? 14.95193  5.95743   6.90876    1.000 108.00303 ? 165 GLU A C   1 
ATOM 1323  O O   . GLU A 1 165 ? 15.93756  5.26765   7.19243    1.000 110.63026 ? 165 GLU A O   1 
ATOM 1324  C CB  . GLU A 1 165 ? 13.76736  5.81791   4.70167    1.000 111.43166 ? 165 GLU A CB  1 
ATOM 1325  C CG  . GLU A 1 165 ? 15.05031  5.49255   3.94613    1.000 111.75318 ? 165 GLU A CG  1 
ATOM 1326  C CD  . GLU A 1 165 ? 15.24847  4.00157   3.75262    1.000 117.36076 ? 165 GLU A CD  1 
ATOM 1327  O OE1 . GLU A 1 165 ? 14.24148  3.26423   3.76032    1.000 123.99424 ? 165 GLU A OE1 1 
ATOM 1328  O OE2 . GLU A 1 165 ? 16.41009  3.56445   3.60008    1.000 114.78670 ? 165 GLU A OE2 1 
ATOM 1329  N N   . GLU A 1 166 ? 14.86885  7.24595   7.24156    1.000 97.92182  ? 166 GLU A N   1 
ATOM 1330  C CA  . GLU A 1 166 ? 15.98732  7.92123   7.89459    1.000 90.76686  ? 166 GLU A CA  1 
ATOM 1331  C C   . GLU A 1 166 ? 16.11650  7.51686   9.35785    1.000 98.65769  ? 166 GLU A C   1 
ATOM 1332  O O   . GLU A 1 166 ? 17.23320  7.42315   9.88287    1.000 88.55241  ? 166 GLU A O   1 
ATOM 1333  C CB  . GLU A 1 166 ? 15.83277  9.42995   7.76314    1.000 87.29266  ? 166 GLU A CB  1 
ATOM 1334  C CG  . GLU A 1 166 ? 16.90947  10.23434  8.45863    1.000 97.15941  ? 166 GLU A CG  1 
ATOM 1335  C CD  . GLU A 1 166 ? 16.82991  11.68248  8.06097    1.000 101.98483 ? 166 GLU A CD  1 
ATOM 1336  O OE1 . GLU A 1 166 ? 16.01414  11.97439  7.16629    1.000 100.68869 ? 166 GLU A OE1 1 
ATOM 1337  O OE2 . GLU A 1 166 ? 17.56173  12.52153  8.62477    1.000 100.21975 ? 166 GLU A OE2 1 
ATOM 1338  N N   . SER A 1 167 ? 14.98753  7.31286   10.04325   1.000 120.52340 ? 167 SER A N   1 
ATOM 1339  C CA  . SER A 1 167 ? 15.03321  6.96459   11.46116   1.000 108.32122 ? 167 SER A CA  1 
ATOM 1340  C C   . SER A 1 167 ? 15.77840  5.65652   11.69858   1.000 91.60175  ? 167 SER A C   1 
ATOM 1341  O O   . SER A 1 167 ? 16.33293  5.44822   12.78370   1.000 90.51016  ? 167 SER A O   1 
ATOM 1342  C CB  . SER A 1 167 ? 13.61505  6.87772   12.02695   1.000 98.71963  ? 167 SER A CB  1 
ATOM 1343  O OG  . SER A 1 167 ? 12.91181  8.09266   11.83455   1.000 103.02468 ? 167 SER A OG  1 
ATOM 1344  N N   . ARG A 1 168 ? 15.79555  4.76347   10.70762   1.000 74.45588  ? 168 ARG A N   1 
ATOM 1345  C CA  . ARG A 1 168 ? 16.53515  3.51226   10.83821   1.000 79.08236  ? 168 ARG A CA  1 
ATOM 1346  C C   . ARG A 1 168 ? 18.00056  3.69597   10.46816   1.000 88.80191  ? 168 ARG A C   1 
ATOM 1347  O O   . ARG A 1 168 ? 18.88849  3.09869   11.09306   1.000 105.82926 ? 168 ARG A O   1 
ATOM 1348  C CB  . ARG A 1 168 ? 15.91290  2.43671   9.94765    1.000 92.68205  ? 168 ARG A CB  1 
ATOM 1349  C CG  . ARG A 1 168 ? 14.63025  1.84059   10.47514   1.000 105.33177 ? 168 ARG A CG  1 
ATOM 1350  C CD  . ARG A 1 168 ? 13.96106  0.97429   9.42440    1.000 99.71682  ? 168 ARG A CD  1 
ATOM 1351  N NE  . ARG A 1 168 ? 13.50089  1.74703   8.27444    1.000 103.13500 ? 168 ARG A NE  1 
ATOM 1352  C CZ  . ARG A 1 168 ? 13.53007  1.30775   7.01999    1.000 104.05276 ? 168 ARG A CZ  1 
ATOM 1353  N NH1 . ARG A 1 168 ? 14.00399  0.09956   6.74936    1.000 102.76138 ? 168 ARG A NH1 1 
ATOM 1354  N NH2 . ARG A 1 168 ? 13.08822  2.07817   6.03528    1.000 107.70385 ? 168 ARG A NH2 1 
ATOM 1355  N N   . ALA A 1 169 ? 18.26459  4.51706   9.45011    1.000 74.41579  ? 169 ALA A N   1 
ATOM 1356  C CA  . ALA A 1 169 ? 19.63736  4.75533   9.02916    1.000 72.93535  ? 169 ALA A CA  1 
ATOM 1357  C C   . ALA A 1 169 ? 20.42886  5.53533   10.06950   1.000 71.56308  ? 169 ALA A C   1 
ATOM 1358  O O   . ALA A 1 169 ? 21.64711  5.36286   10.16435   1.000 78.89286  ? 169 ALA A O   1 
ATOM 1359  C CB  . ALA A 1 169 ? 19.64388  5.48240   7.68651    1.000 91.73905  ? 169 ALA A CB  1 
ATOM 1360  N N   . ARG A 1 170 ? 19.76373  6.36584   10.87684   1.000 70.21023  ? 170 ARG A N   1 
ATOM 1361  C CA  . ARG A 1 170 ? 20.46449  7.02482   11.97607   1.000 69.26027  ? 170 ARG A CA  1 
ATOM 1362  C C   . ARG A 1 170 ? 21.00982  6.00316   12.96990   1.000 67.14500  ? 170 ARG A C   1 
ATOM 1363  O O   . ARG A 1 170 ? 22.16820  6.09338   13.40138   1.000 65.61311  ? 170 ARG A O   1 
ATOM 1364  C CB  . ARG A 1 170 ? 19.52935  8.01583   12.67264   1.000 71.24917  ? 170 ARG A CB  1 
ATOM 1365  C CG  . ARG A 1 170 ? 20.09543  8.61491   13.95137   1.000 70.76523  ? 170 ARG A CG  1 
ATOM 1366  C CD  . ARG A 1 170 ? 19.30689  9.83428   14.42792   1.000 73.29287  ? 170 ARG A CD  1 
ATOM 1367  N NE  . ARG A 1 170 ? 19.42291  10.98035  13.52778   1.000 81.78803  ? 170 ARG A NE  1 
ATOM 1368  C CZ  . ARG A 1 170 ? 18.47215  11.37557  12.68652   1.000 92.19086  ? 170 ARG A CZ  1 
ATOM 1369  N NH1 . ARG A 1 170 ? 18.66842  12.43164  11.90743   1.000 95.13372  ? 170 ARG A NH1 1 
ATOM 1370  N NH2 . ARG A 1 170 ? 17.32152  10.71925  12.62797   1.000 104.55269 ? 170 ARG A NH2 1 
ATOM 1371  N N   . ILE A 1 171 ? 20.20119  4.99602   13.30790   1.000 69.12961  ? 171 ILE A N   1 
ATOM 1372  C CA  . ILE A 1 171 ? 20.64092  3.95472   14.23212   1.000 73.27091  ? 171 ILE A CA  1 
ATOM 1373  C C   . ILE A 1 171 ? 21.72956  3.09813   13.59890   1.000 67.96136  ? 171 ILE A C   1 
ATOM 1374  O O   . ILE A 1 171 ? 22.71798  2.74146   14.25432   1.000 64.28987  ? 171 ILE A O   1 
ATOM 1375  C CB  . ILE A 1 171 ? 19.44060  3.10570   14.68728   1.000 86.25571  ? 171 ILE A CB  1 
ATOM 1376  C CG1 . ILE A 1 171 ? 18.38788  3.99143   15.35505   1.000 111.67147 ? 171 ILE A CG1 1 
ATOM 1377  C CG2 . ILE A 1 171 ? 19.89246  2.00194   15.63343   1.000 68.47111  ? 171 ILE A CG2 1 
ATOM 1378  C CD1 . ILE A 1 171 ? 17.14045  3.25062   15.76880   1.000 121.89375 ? 171 ILE A CD1 1 
ATOM 1379  N N   . LYS A 1 172 ? 21.55166  2.72664   12.32753   1.000 74.63164  ? 172 LYS A N   1 
ATOM 1380  C CA  . LYS A 1 172 ? 22.57879  1.94846   11.63851   1.000 67.83990  ? 172 LYS A CA  1 
ATOM 1381  C C   . LYS A 1 172 ? 23.91008  2.69646   11.60163   1.000 67.27161  ? 172 LYS A C   1 
ATOM 1382  O O   . LYS A 1 172 ? 24.97588  2.09645   11.79661   1.000 60.37943  ? 172 LYS A O   1 
ATOM 1383  C CB  . LYS A 1 172 ? 22.10924  1.58728   10.22811   1.000 64.40709  ? 172 LYS A CB  1 
ATOM 1384  C CG  . LYS A 1 172 ? 20.86988  0.69962   10.20962   1.000 65.99703  ? 172 LYS A CG  1 
ATOM 1385  C CD  . LYS A 1 172 ? 20.50427  0.24387   8.80243    1.000 69.11147  ? 172 LYS A CD  1 
ATOM 1386  C CE  . LYS A 1 172 ? 19.81903  1.34272   8.00649    1.000 69.86596  ? 172 LYS A CE  1 
ATOM 1387  N NZ  . LYS A 1 172 ? 19.20698  0.81761   6.75336    1.000 71.63947  ? 172 LYS A NZ  1 
ATOM 1388  N N   . THR A 1 173 ? 23.86831  4.01317   11.37818   1.000 58.11297  ? 173 THR A N   1 
ATOM 1389  C CA  . THR A 1 173 ? 25.09464  4.80273   11.34515   1.000 57.28596  ? 173 THR A CA  1 
ATOM 1390  C C   . THR A 1 173 ? 25.73339  4.88465   12.72543   1.000 56.02378  ? 173 THR A C   1 
ATOM 1391  O O   . THR A 1 173 ? 26.95963  4.78000   12.85216   1.000 59.71044  ? 173 THR A O   1 
ATOM 1392  C CB  . THR A 1 173 ? 24.80317  6.20129   10.80060   1.000 59.17251  ? 173 THR A CB  1 
ATOM 1393  O OG1 . THR A 1 173 ? 24.31436  6.09836   9.45763    1.000 60.61134  ? 173 THR A OG1 1 
ATOM 1394  C CG2 . THR A 1 173 ? 26.06037  7.05927   10.81517   1.000 58.76979  ? 173 THR A CG2 1 
ATOM 1395  N N   . ARG A 1 174 ? 24.92231  5.08386   13.77020   1.000 60.06605  ? 174 ARG A N   1 
ATOM 1396  C CA  . ARG A 1 174 ? 25.45952  5.05438   15.12886   1.000 60.26373  ? 174 ARG A CA  1 
ATOM 1397  C C   . ARG A 1 174 ? 26.15054  3.72806   15.42221   1.000 58.14770  ? 174 ARG A C   1 
ATOM 1398  O O   . ARG A 1 174 ? 27.24093  3.70118   16.00880   1.000 68.53678  ? 174 ARG A O   1 
ATOM 1399  C CB  . ARG A 1 174 ? 24.35207  5.31647   16.14885   1.000 58.59850  ? 174 ARG A CB  1 
ATOM 1400  C CG  . ARG A 1 174 ? 24.82185  5.17883   17.58797   1.000 58.25616  ? 174 ARG A CG  1 
ATOM 1401  C CD  . ARG A 1 174 ? 25.79396  6.28602   17.95190   1.000 71.85140  ? 174 ARG A CD  1 
ATOM 1402  N NE  . ARG A 1 174 ? 26.32853  6.12290   19.29971   1.000 86.57636  ? 174 ARG A NE  1 
ATOM 1403  C CZ  . ARG A 1 174 ? 27.26687  6.90144   19.82703   1.000 107.19914 ? 174 ARG A CZ  1 
ATOM 1404  N NH1 . ARG A 1 174 ? 27.77554  7.89970   19.11796   1.000 118.62638 ? 174 ARG A NH1 1 
ATOM 1405  N NH2 . ARG A 1 174 ? 27.69825  6.68208   21.06146   1.000 107.90414 ? 174 ARG A NH2 1 
ATOM 1406  N N   . LEU A 1 175 ? 25.53517  2.61736   15.01147   1.000 53.49800  ? 175 LEU A N   1 
ATOM 1407  C CA  . LEU A 1 175 ? 26.12398  1.30682   15.27149   1.000 52.46067  ? 175 LEU A CA  1 
ATOM 1408  C C   . LEU A 1 175 ? 27.43029  1.12670   14.50671   1.000 64.01142  ? 175 LEU A C   1 
ATOM 1409  O O   . LEU A 1 175 ? 28.40330  0.58864   15.04801   1.000 90.50964  ? 175 LEU A O   1 
ATOM 1410  C CB  . LEU A 1 175 ? 25.12706  0.20573   14.91587   1.000 53.46831  ? 175 LEU A CB  1 
ATOM 1411  C CG  . LEU A 1 175 ? 23.90675  0.13067   15.83587   1.000 54.98991  ? 175 LEU A CG  1 
ATOM 1412  C CD1 . LEU A 1 175 ? 22.97752  -1.00312  15.42869   1.000 65.55540  ? 175 LEU A CD1 1 
ATOM 1413  C CD2 . LEU A 1 175 ? 24.33972  -0.01776  17.28619   1.000 54.77873  ? 175 LEU A CD2 1 
ATOM 1414  N N   . PHE A 1 176 ? 27.47619  1.57940   13.25128   1.000 64.21209  ? 176 PHE A N   1 
ATOM 1415  C CA  . PHE A 1 176 ? 28.71033  1.47238   12.47679   1.000 56.95604  ? 176 PHE A CA  1 
ATOM 1416  C C   . PHE A 1 176 ? 29.82261  2.31756   13.09377   1.000 56.96419  ? 176 PHE A C   1 
ATOM 1417  O O   . PHE A 1 176 ? 30.98651  1.89283   13.14470   1.000 57.24208  ? 176 PHE A O   1 
ATOM 1418  C CB  . PHE A 1 176 ? 28.45043  1.88543   11.02717   1.000 59.24209  ? 176 PHE A CB  1 
ATOM 1419  C CG  . PHE A 1 176 ? 29.61028  1.63791   10.10514   1.000 53.95498  ? 176 PHE A CG  1 
ATOM 1420  C CD1 . PHE A 1 176 ? 29.81822  0.38437   9.55422    1.000 54.27684  ? 176 PHE A CD1 1 
ATOM 1421  C CD2 . PHE A 1 176 ? 30.48497  2.66075   9.77930    1.000 56.42852  ? 176 PHE A CD2 1 
ATOM 1422  C CE1 . PHE A 1 176 ? 30.88175  0.15295   8.70298    1.000 59.86128  ? 176 PHE A CE1 1 
ATOM 1423  C CE2 . PHE A 1 176 ? 31.55094  2.43527   8.92830    1.000 72.65711  ? 176 PHE A CE2 1 
ATOM 1424  C CZ  . PHE A 1 176 ? 31.74897  1.17946   8.38958    1.000 63.66931  ? 176 PHE A CZ  1 
ATOM 1425  N N   . THR A 1 177 ? 29.48231  3.51797   13.57262   1.000 53.36252  ? 177 THR A N   1 
ATOM 1426  C CA  . THR A 1 177 ? 30.48000  4.36955   14.21423   1.000 53.02248  ? 177 THR A CA  1 
ATOM 1427  C C   . THR A 1 177 ? 31.00146  3.73836   15.49979   1.000 52.10224  ? 177 THR A C   1 
ATOM 1428  O O   . THR A 1 177 ? 32.20628  3.78402   15.77787   1.000 51.27012  ? 177 THR A O   1 
ATOM 1429  C CB  . THR A 1 177 ? 29.89108  5.74990   14.50353   1.000 54.66367  ? 177 THR A CB  1 
ATOM 1430  O OG1 . THR A 1 177 ? 28.65221  5.60390   15.20771   1.000 55.50465  ? 177 THR A OG1 1 
ATOM 1431  C CG2 . THR A 1 177 ? 29.64102  6.50243   13.20760   1.000 64.97411  ? 177 THR A CG2 1 
ATOM 1432  N N   . ILE A 1 178 ? 30.10738  3.15114   16.30135   1.000 57.19654  ? 178 ILE A N   1 
ATOM 1433  C CA  . ILE A 1 178 ? 30.53887  2.45901   17.51502   1.000 56.80596  ? 178 ILE A CA  1 
ATOM 1434  C C   . ILE A 1 178 ? 31.44175  1.28462   17.16000   1.000 55.54944  ? 178 ILE A C   1 
ATOM 1435  O O   . ILE A 1 178 ? 32.43501  1.00659   17.85120   1.000 54.97387  ? 178 ILE A O   1 
ATOM 1436  C CB  . ILE A 1 178 ? 29.31663  2.01157   18.33883   1.000 57.99900  ? 178 ILE A CB  1 
ATOM 1437  C CG1 . ILE A 1 178 ? 28.58496  3.22738   18.90835   1.000 74.59357  ? 178 ILE A CG1 1 
ATOM 1438  C CG2 . ILE A 1 178 ? 29.73029  1.07281   19.46101   1.000 57.99670  ? 178 ILE A CG2 1 
ATOM 1439  C CD1 . ILE A 1 178 ? 27.25004  2.89243   19.52979   1.000 82.81347  ? 178 ILE A CD1 1 
ATOM 1440  N N   . ARG A 1 179 ? 31.11674  0.58354   16.07034   1.000 61.95988  ? 179 ARG A N   1 
ATOM 1441  C CA  . ARG A 1 179 ? 31.95668  -0.52017  15.62447   1.000 66.05326  ? 179 ARG A CA  1 
ATOM 1442  C C   . ARG A 1 179 ? 33.36035  -0.03242  15.30193   1.000 70.66317  ? 179 ARG A C   1 
ATOM 1443  O O   . ARG A 1 179 ? 34.34856  -0.62240  15.74613   1.000 79.15558  ? 179 ARG A O   1 
ATOM 1444  C CB  . ARG A 1 179 ? 31.34848  -1.19999  14.39865   1.000 68.02142  ? 179 ARG A CB  1 
ATOM 1445  C CG  . ARG A 1 179 ? 32.16533  -2.39496  13.93295   1.000 58.50965  ? 179 ARG A CG  1 
ATOM 1446  C CD  . ARG A 1 179 ? 32.04727  -2.64156  12.44235   1.000 64.65030  ? 179 ARG A CD  1 
ATOM 1447  N NE  . ARG A 1 179 ? 33.03351  -1.86346  11.69703   1.000 67.30258  ? 179 ARG A NE  1 
ATOM 1448  C CZ  . ARG A 1 179 ? 34.30356  -2.22310  11.53680   1.000 61.15489  ? 179 ARG A CZ  1 
ATOM 1449  N NH1 . ARG A 1 179 ? 34.75077  -3.35055  12.07294   1.000 47.96272  ? 179 ARG A NH1 1 
ATOM 1450  N NH2 . ARG A 1 179 ? 35.13068  -1.45276  10.84488   1.000 74.33241  ? 179 ARG A NH2 1 
ATOM 1451  N N   . GLN A 1 180 ? 33.46751  1.05161   14.52791   1.000 70.79333  ? 180 GLN A N   1 
ATOM 1452  C CA  . GLN A 1 180 ? 34.79175  1.56529   14.18310   1.000 68.58178  ? 180 GLN A CA  1 
ATOM 1453  C C   . GLN A 1 180 ? 35.54443  2.04579   15.41950   1.000 66.24867  ? 180 GLN A C   1 
ATOM 1454  O O   . GLN A 1 180 ? 36.76043  1.83703   15.53730   1.000 81.70384  ? 180 GLN A O   1 
ATOM 1455  C CB  . GLN A 1 180 ? 34.68604  2.70403   13.16934   1.000 72.68950  ? 180 GLN A CB  1 
ATOM 1456  C CG  . GLN A 1 180 ? 36.03386  3.36084   12.87782   1.000 88.54478  ? 180 GLN A CG  1 
ATOM 1457  C CD  . GLN A 1 180 ? 35.91250  4.64131   12.08163   1.000 100.45473 ? 180 GLN A CD  1 
ATOM 1458  O OE1 . GLN A 1 180 ? 34.86469  4.93094   11.51140   1.000 108.95321 ? 180 GLN A OE1 1 
ATOM 1459  N NE2 . GLN A 1 180 ? 36.98785  5.42089   12.04473   1.000 95.51345  ? 180 GLN A NE2 1 
ATOM 1460  N N   . GLU A 1 181 ? 34.83821  2.68731   16.35431   1.000 65.15881  ? 181 GLU A N   1 
ATOM 1461  C CA  . GLU A 1 181 ? 35.48132  3.16102   17.57658   1.000 71.94897  ? 181 GLU A CA  1 
ATOM 1462  C C   . GLU A 1 181 ? 36.08660  2.01182   18.36962   1.000 60.47878  ? 181 GLU A C   1 
ATOM 1463  O O   . GLU A 1 181 ? 37.27361  2.03915   18.71362   1.000 58.14451  ? 181 GLU A O   1 
ATOM 1464  C CB  . GLU A 1 181 ? 34.48619  3.93810   18.43506   1.000 111.47148 ? 181 GLU A CB  1 
ATOM 1465  C CG  . GLU A 1 181 ? 34.43649  5.41691   18.12168   1.000 124.42377 ? 181 GLU A CG  1 
ATOM 1466  C CD  . GLU A 1 181 ? 35.66947  6.15378   18.61658   1.000 124.12440 ? 181 GLU A CD  1 
ATOM 1467  O OE1 . GLU A 1 181 ? 36.26331  5.71109   19.62312   1.000 122.09036 ? 181 GLU A OE1 1 
ATOM 1468  O OE2 . GLU A 1 181 ? 36.04444  7.17378   18.00074   1.000 124.73891 ? 181 GLU A OE2 1 
ATOM 1469  N N   . MET A 1 182 ? 35.28797  0.99337   18.68400   1.000 61.85160  ? 182 MET A N   1 
ATOM 1470  C CA  . MET A 1 182 ? 35.87936  -0.12570  19.40894   1.000 68.25048  ? 182 MET A CA  1 
ATOM 1471  C C   . MET A 1 182 ? 36.78870  -0.97984  18.53112   1.000 70.08677  ? 182 MET A C   1 
ATOM 1472  O O   . MET A 1 182 ? 37.50789  -1.83075  19.06115   1.000 92.26499  ? 182 MET A O   1 
ATOM 1473  C CB  . MET A 1 182 ? 34.79733  -0.97635  20.07686   1.000 76.31538  ? 182 MET A CB  1 
ATOM 1474  C CG  . MET A 1 182 ? 33.80338  -1.64476  19.16012   1.000 89.66208  ? 182 MET A CG  1 
ATOM 1475  S SD  . MET A 1 182 ? 32.75558  -2.73807  20.14036   1.000 95.54003  ? 182 MET A SD  1 
ATOM 1476  C CE  . MET A 1 182 ? 31.93725  -1.55129  21.20631   1.000 81.81798  ? 182 MET A CE  1 
ATOM 1477  N N   . ALA A 1 183 ? 36.78653  -0.77032  17.21475   1.000 60.25000  ? 183 ALA A N   1 
ATOM 1478  C CA  . ALA A 1 183 ? 37.71511  -1.47933  16.34236   1.000 60.95955  ? 183 ALA A CA  1 
ATOM 1479  C C   . ALA A 1 183 ? 39.12032  -0.89384  16.43217   1.000 69.85280  ? 183 ALA A C   1 
ATOM 1480  O O   . ALA A 1 183 ? 40.08021  -1.60456  16.74900   1.000 78.89821  ? 183 ALA A O   1 
ATOM 1481  C CB  . ALA A 1 183 ? 37.20675  -1.44536  14.89873   1.000 71.18835  ? 183 ALA A CB  1 
ATOM 1482  N N   . ASN A 1 184 ? 39.26308  0.40568   16.15399   1.000 68.00006  ? 184 ASN A N   1 
ATOM 1483  C CA  . ASN A 1 184 ? 40.59821  0.99751   16.16704   1.000 75.05300  ? 184 ASN A CA  1 
ATOM 1484  C C   . ASN A 1 184 ? 41.18598  1.11794   17.56878   1.000 64.47445  ? 184 ASN A C   1 
ATOM 1485  O O   . ASN A 1 184 ? 42.37827  1.41655   17.69647   1.000 85.28458  ? 184 ASN A O   1 
ATOM 1486  C CB  . ASN A 1 184 ? 40.58940  2.36859   15.47710   1.000 100.95996 ? 184 ASN A CB  1 
ATOM 1487  C CG  . ASN A 1 184 ? 39.76867  3.41176   16.22135   1.000 113.36970 ? 184 ASN A CG  1 
ATOM 1488  O OD1 . ASN A 1 184 ? 39.24164  3.16301   17.30319   1.000 122.59865 ? 184 ASN A OD1 1 
ATOM 1489  N ND2 . ASN A 1 184 ? 39.66467  4.59809   15.63439   1.000 105.01760 ? 184 ASN A ND2 1 
ATOM 1490  N N   . ARG A 1 185 ? 40.39001  0.89647   18.61108   1.000 83.06312  ? 185 ARG A N   1 
ATOM 1491  C CA  . ARG A 1 185 ? 40.89589  0.79474   19.97270   1.000 78.35861  ? 185 ARG A CA  1 
ATOM 1492  C C   . ARG A 1 185 ? 41.32696  -0.61963  20.33659   1.000 81.62375  ? 185 ARG A C   1 
ATOM 1493  O O   . ARG A 1 185 ? 41.72579  -0.85377  21.48252   1.000 81.54073  ? 185 ARG A O   1 
ATOM 1494  C CB  . ARG A 1 185 ? 39.84310  1.28498   20.97414   1.000 76.09219  ? 185 ARG A CB  1 
ATOM 1495  C CG  . ARG A 1 185 ? 39.63289  2.79137   20.97753   1.000 76.04880  ? 185 ARG A CG  1 
ATOM 1496  C CD  . ARG A 1 185 ? 38.54775  3.19291   21.96505   1.000 78.98246  ? 185 ARG A CD  1 
ATOM 1497  N NE  . ARG A 1 185 ? 38.49721  4.63873   22.16600   1.000 96.55599  ? 185 ARG A NE  1 
ATOM 1498  C CZ  . ARG A 1 185 ? 39.05930  5.26933   23.19224   1.000 114.75137 ? 185 ARG A CZ  1 
ATOM 1499  N NH1 . ARG A 1 185 ? 39.71563  4.58099   24.11594   1.000 131.04663 ? 185 ARG A NH1 1 
ATOM 1500  N NH2 . ARG A 1 185 ? 38.96594  6.58761   23.29714   1.000 109.11809 ? 185 ARG A NH2 1 
ATOM 1501  N N   . GLY A 1 186 ? 41.25290  -1.56407  19.40037   1.000 89.97610  ? 186 GLY A N   1 
ATOM 1502  C CA  . GLY A 1 186 ? 41.56477  -2.94218  19.71635   1.000 95.44197  ? 186 GLY A CA  1 
ATOM 1503  C C   . GLY A 1 186 ? 40.53501  -3.62613  20.58106   1.000 88.98988  ? 186 GLY A C   1 
ATOM 1504  O O   . GLY A 1 186 ? 40.81930  -4.68931  21.14117   1.000 89.34702  ? 186 GLY A O   1 
ATOM 1505  N N   . LEU A 1 187 ? 39.34484  -3.04372  20.70672   1.000 75.83968  ? 187 LEU A N   1 
ATOM 1506  C CA  . LEU A 1 187 ? 38.27704  -3.55452  21.56189   1.000 80.31499  ? 187 LEU A CA  1 
ATOM 1507  C C   . LEU A 1 187 ? 37.19796  -4.26409  20.75774   1.000 77.48009  ? 187 LEU A C   1 
ATOM 1508  O O   . LEU A 1 187 ? 36.00729  -4.15913  21.06639   1.000 89.46561  ? 187 LEU A O   1 
ATOM 1509  C CB  . LEU A 1 187 ? 37.67356  -2.41523  22.37518   1.000 107.17627 ? 187 LEU A CB  1 
ATOM 1510  C CG  . LEU A 1 187 ? 38.56830  -1.86119  23.48170   1.000 130.91960 ? 187 LEU A CG  1 
ATOM 1511  C CD1 . LEU A 1 187 ? 37.97508  -0.58831  24.06782   1.000 134.50493 ? 187 LEU A CD1 1 
ATOM 1512  C CD2 . LEU A 1 187 ? 38.78708  -2.90965  24.55603   1.000 142.47268 ? 187 LEU A CD2 1 
ATOM 1513  N N   . TRP A 1 188 ? 37.58951  -4.99619  19.71348   1.000 81.60676  ? 188 TRP A N   1 
ATOM 1514  C CA  . TRP A 1 188 ? 36.65759  -5.81300  18.94777   1.000 79.82018  ? 188 TRP A CA  1 
ATOM 1515  C C   . TRP A 1 188 ? 36.60637  -7.24185  19.46625   1.000 80.18757  ? 188 TRP A C   1 
ATOM 1516  O O   . TRP A 1 188 ? 36.42417  -8.19037  18.69030   1.000 81.52279  ? 188 TRP A O   1 
ATOM 1517  C CB  . TRP A 1 188 ? 37.02141  -5.77531  17.46181   1.000 82.19331  ? 188 TRP A CB  1 
ATOM 1518  C CG  . TRP A 1 188 ? 35.93079  -6.26970  16.55245   1.000 106.43031 ? 188 TRP A CG  1 
ATOM 1519  C CD1 . TRP A 1 188 ? 36.00467  -7.31021  15.67238   1.000 120.69460 ? 188 TRP A CD1 1 
ATOM 1520  C CD2 . TRP A 1 188 ? 34.59454  -5.75864  16.45757   1.000 99.54442  ? 188 TRP A CD2 1 
ATOM 1521  N NE1 . TRP A 1 188 ? 34.80339  -7.46834  15.02322   1.000 112.46418 ? 188 TRP A NE1 1 
ATOM 1522  C CE2 . TRP A 1 188 ? 33.92076  -6.52910  15.48948   1.000 94.78103  ? 188 TRP A CE2 1 
ATOM 1523  C CE3 . TRP A 1 188 ? 33.90604  -4.72069  17.09193   1.000 99.20346  ? 188 TRP A CE3 1 
ATOM 1524  C CZ2 . TRP A 1 188 ? 32.59256  -6.29457  15.14199   1.000 88.77717  ? 188 TRP A CZ2 1 
ATOM 1525  C CZ3 . TRP A 1 188 ? 32.58805  -4.49038  16.74671   1.000 86.39360  ? 188 TRP A CZ3 1 
ATOM 1526  C CH2 . TRP A 1 188 ? 31.94458  -5.27445  15.78189   1.000 88.55463  ? 188 TRP A CH2 1 
ATOM 1527  N N   . ASP A 1 189 ? 36.78027  -7.40912  20.77820   1.000 91.92442  ? 189 ASP A N   1 
ATOM 1528  C CA  . ASP A 1 189 ? 36.70315  -8.72706  21.39288   1.000 95.90851  ? 189 ASP A CA  1 
ATOM 1529  C C   . ASP A 1 189 ? 35.27714  -9.26038  21.39955   1.000 98.70984  ? 189 ASP A C   1 
ATOM 1530  O O   . ASP A 1 189 ? 35.05815  -10.45710 21.18173   1.000 106.59614 ? 189 ASP A O   1 
ATOM 1531  C CB  . ASP A 1 189 ? 37.26353  -8.66425  22.81431   1.000 111.96942 ? 189 ASP A CB  1 
ATOM 1532  C CG  . ASP A 1 189 ? 36.47402  -7.73516  23.72141   1.000 124.61563 ? 189 ASP A CG  1 
ATOM 1533  O OD1 . ASP A 1 189 ? 35.53513  -7.06535  23.24048   1.000 129.62873 ? 189 ASP A OD1 1 
ATOM 1534  O OD2 . ASP A 1 189 ? 36.79380  -7.67946  24.92659   1.000 131.68832 ? 189 ASP A OD2 1 
ATOM 1535  N N   . SER A 1 190 ? 34.29415  -8.38370  21.61753   1.000 103.76157 ? 190 SER A N   1 
ATOM 1536  C CA  . SER A 1 190 ? 32.91985  -8.80058  21.87740   1.000 95.48206  ? 190 SER A CA  1 
ATOM 1537  C C   . SER A 1 190 ? 32.30222  -9.53941  20.69459   1.000 101.56520 ? 190 SER A C   1 
ATOM 1538  O O   . SER A 1 190 ? 31.16094  -10.00544 20.77271   1.000 99.52517  ? 190 SER A O   1 
ATOM 1539  C CB  . SER A 1 190 ? 32.06806  -7.58603  22.24708   1.000 87.78358  ? 190 SER A CB  1 
ATOM 1540  O OG  . SER A 1 190 ? 32.00740  -6.66302  21.17544   1.000 86.19038  ? 190 SER A OG  1 
ATOM 1541  N N   . PHE A 1 191 ? 33.04618  -9.64259  19.59223   1.000 92.73781  ? 191 PHE A N   1 
ATOM 1542  C CA  . PHE A 1 191 ? 32.63776  -10.50811 18.49342   1.000 108.70515 ? 191 PHE A CA  1 
ATOM 1543  C C   . PHE A 1 191 ? 32.59456  -11.96744 18.93302   1.000 124.54817 ? 191 PHE A C   1 
ATOM 1544  O O   . PHE A 1 191 ? 31.82897  -12.76415 18.37759   1.000 134.76696 ? 191 PHE A O   1 
ATOM 1545  C CB  . PHE A 1 191 ? 33.58960  -10.31131 17.31128   1.000 113.92186 ? 191 PHE A CB  1 
ATOM 1546  C CG  . PHE A 1 191 ? 33.44417  -11.33691 16.22587   1.000 101.77046 ? 191 PHE A CG  1 
ATOM 1547  C CD1 . PHE A 1 191 ? 32.37822  -11.28643 15.34333   1.000 99.61014  ? 191 PHE A CD1 1 
ATOM 1548  C CD2 . PHE A 1 191 ? 34.38733  -12.34028 16.07549   1.000 87.68189  ? 191 PHE A CD2 1 
ATOM 1549  C CE1 . PHE A 1 191 ? 32.24851  -12.22530 14.33919   1.000 97.62055  ? 191 PHE A CE1 1 
ATOM 1550  C CE2 . PHE A 1 191 ? 34.26344  -13.28204 15.07453   1.000 88.36180  ? 191 PHE A CE2 1 
ATOM 1551  C CZ  . PHE A 1 191 ? 33.19267  -13.22469 14.20468   1.000 91.00917  ? 191 PHE A CZ  1 
ATOM 1552  N N   . ARG A 1 192 ? 33.39836  -12.32955 19.93493   1.000 150.66884 ? 192 ARG A N   1 
ATOM 1553  C CA  . ARG A 1 192 ? 33.45973  -13.68768 20.45955   1.000 125.98463 ? 192 ARG A CA  1 
ATOM 1554  C C   . ARG A 1 192 ? 32.52073  -13.93265 21.63465   1.000 109.08698 ? 192 ARG A C   1 
ATOM 1555  O O   . ARG A 1 192 ? 32.34096  -15.09035 22.02727   1.000 107.79707 ? 192 ARG A O   1 
ATOM 1556  C CB  . ARG A 1 192 ? 34.89262  -14.01652 20.89158   1.000 107.92084 ? 192 ARG A CB  1 
ATOM 1557  C CG  . ARG A 1 192 ? 35.87571  -14.14832 19.74379   1.000 106.71302 ? 192 ARG A CG  1 
ATOM 1558  C CD  . ARG A 1 192 ? 35.57244  -15.37974 18.91003   1.000 114.12115 ? 192 ARG A CD  1 
ATOM 1559  N NE  . ARG A 1 192 ? 35.63034  -16.60084 19.70920   1.000 121.86063 ? 192 ARG A NE  1 
ATOM 1560  C CZ  . ARG A 1 192 ? 35.18944  -17.78489 19.29688   1.000 130.01956 ? 192 ARG A CZ  1 
ATOM 1561  N NH1 . ARG A 1 192 ? 34.65636  -17.91131 18.08967   1.000 142.31277 ? 192 ARG A NH1 1 
ATOM 1562  N NH2 . ARG A 1 192 ? 35.28082  -18.84307 20.09104   1.000 119.30547 ? 192 ARG A NH2 1 
ATOM 1563  N N   . GLN A 1 193 ? 31.92306  -12.88792 22.20722   1.000 84.13713  ? 193 GLN A N   1 
ATOM 1564  C CA  . GLN A 1 193 ? 31.03922  -13.03540 23.35946   1.000 93.37674  ? 193 GLN A CA  1 
ATOM 1565  C C   . GLN A 1 193 ? 29.57268  -13.11548 22.95907   1.000 96.89145  ? 193 GLN A C   1 
ATOM 1566  O O   . GLN A 1 193 ? 28.86369  -14.03426 23.37974   1.000 112.94355 ? 193 GLN A O   1 
ATOM 1567  C CB  . GLN A 1 193 ? 31.24318  -11.87462 24.34259   1.000 110.87137 ? 193 GLN A CB  1 
ATOM 1568  C CG  . GLN A 1 193 ? 32.50157  -11.95790 25.19891   1.000 132.95165 ? 193 GLN A CG  1 
ATOM 1569  C CD  . GLN A 1 193 ? 33.77963  -11.77993 24.40742   1.000 155.75371 ? 193 GLN A CD  1 
ATOM 1570  O OE1 . GLN A 1 193 ? 33.75143  -11.56099 23.20055   1.000 150.47118 ? 193 GLN A OE1 1 
ATOM 1571  N NE2 . GLN A 1 193 ? 34.91134  -11.85461 25.09227   1.000 175.98301 ? 193 GLN A NE2 1 
ATOM 1572  N N   . SER A 1 194 ? 29.10162  -12.16500 22.15298   1.000 96.03263  ? 194 SER A N   1 
ATOM 1573  C CA  . SER A 1 194 ? 27.73051  -12.18886 21.65964   1.000 98.34640  ? 194 SER A CA  1 
ATOM 1574  C C   . SER A 1 194 ? 27.49878  -13.26256 20.60720   1.000 111.28376 ? 194 SER A C   1 
ATOM 1575  O O   . SER A 1 194 ? 26.37548  -13.37479 20.10284   1.000 117.93534 ? 194 SER A O   1 
ATOM 1576  C CB  . SER A 1 194 ? 27.35469  -10.82134 21.09250   1.000 98.33516  ? 194 SER A CB  1 
ATOM 1577  O OG  . SER A 1 194 ? 26.03546  -10.82529 20.57570   1.000 100.68247 ? 194 SER A OG  1 
ATOM 1578  N N   . GLU A 1 195 ? 28.51965  -14.04242 20.26334   1.000 114.32738 ? 195 GLU A N   1 
ATOM 1579  C CA  . GLU A 1 195 ? 28.39517  -15.11705 19.27990   1.000 132.78960 ? 195 GLU A CA  1 
ATOM 1580  C C   . GLU A 1 195 ? 27.92920  -16.41082 19.94039   1.000 148.00133 ? 195 GLU A C   1 
ATOM 1581  O O   . GLU A 1 195 ? 28.51002  -17.48040 19.76239   1.000 176.33517 ? 195 GLU A O   1 
ATOM 1582  C CB  . GLU A 1 195 ? 29.72980  -15.31058 18.56932   1.000 116.04679 ? 195 GLU A CB  1 
ATOM 1583  C CG  . GLU A 1 195 ? 29.65024  -16.01337 17.22525   1.000 112.69422 ? 195 GLU A CG  1 
ATOM 1584  C CD  . GLU A 1 195 ? 31.02214  -16.32043 16.65712   1.000 122.89456 ? 195 GLU A CD  1 
ATOM 1585  O OE1 . GLU A 1 195 ? 32.02539  -16.07269 17.35880   1.000 122.22731 ? 195 GLU A OE1 1 
ATOM 1586  O OE2 . GLU A 1 195 ? 31.09928  -16.80625 15.50968   1.000 136.11007 ? 195 GLU A OE2 1 
ATOM 1587  N N   . ARG A 1 196 ? 26.85727  -16.30573 20.72647   1.000 135.53507 ? 196 ARG A N   1 
ATOM 1588  C CA  . ARG A 1 196 ? 26.30836  -17.45065 21.43716   1.000 110.99569 ? 196 ARG A CA  1 
ATOM 1589  C C   . ARG A 1 196 ? 24.78758  -17.46209 21.47274   1.000 109.59182 ? 196 ARG A C   1 
ATOM 1590  O O   . ARG A 1 196 ? 24.21284  -18.34162 22.12162   1.000 116.49160 ? 196 ARG A O   1 
ATOM 1591  C CB  . ARG A 1 196 ? 26.84299  -17.49449 22.88000   1.000 100.83479 ? 196 ARG A CB  1 
ATOM 1592  C CG  . ARG A 1 196 ? 28.35099  -17.65672 22.99317   1.000 103.51021 ? 196 ARG A CG  1 
ATOM 1593  C CD  . ARG A 1 196 ? 28.79797  -19.06510 22.64573   1.000 113.08523 ? 196 ARG A CD  1 
ATOM 1594  N NE  . ARG A 1 196 ? 30.20380  -19.27961 22.97498   1.000 117.16501 ? 196 ARG A NE  1 
ATOM 1595  C CZ  . ARG A 1 196 ? 31.20465  -19.10854 22.11761   1.000 110.21969 ? 196 ARG A CZ  1 
ATOM 1596  N NH1 . ARG A 1 196 ? 30.95585  -18.71763 20.87503   1.000 98.62104  ? 196 ARG A NH1 1 
ATOM 1597  N NH2 . ARG A 1 196 ? 32.45497  -19.32644 22.50154   1.000 113.17986 ? 196 ARG A NH2 1 
ATOM 1598  N N   . GLY A 1 197 ? 24.12006  -16.52317 20.80558   1.000 114.19779 ? 197 GLY A N   1 
ATOM 1599  C CA  . GLY A 1 197 ? 22.69527  -16.32163 20.98256   1.000 113.71160 ? 197 GLY A CA  1 
ATOM 1600  C C   . GLY A 1 197 ? 22.42741  -15.53437 22.24838   1.000 116.81430 ? 197 GLY A C   1 
ATOM 1601  O O   . GLY A 1 197 ? 21.78924  -14.47785 22.21251   1.000 114.12467 ? 197 GLY A O   1 
ATOM 1602  N N   . GLU A 1 198 ? 22.91166  -16.04700 23.37737   1.000 122.05881 ? 198 GLU A N   1 
ATOM 1603  C CA  . GLU A 1 198 ? 22.94299  -15.29244 24.62472   1.000 127.91072 ? 198 GLU A CA  1 
ATOM 1604  C C   . GLU A 1 198 ? 24.19202  -14.41752 24.60569   1.000 109.08237 ? 198 GLU A C   1 
ATOM 1605  O O   . GLU A 1 198 ? 25.31546  -14.92604 24.67584   1.000 103.42091 ? 198 GLU A O   1 
ATOM 1606  C CB  . GLU A 1 198 ? 22.92928  -16.23575 25.82299   1.000 145.93309 ? 198 GLU A CB  1 
ATOM 1607  C CG  . GLU A 1 198 ? 22.55856  -15.56070 27.12884   1.000 159.13728 ? 198 GLU A CG  1 
ATOM 1608  C CD  . GLU A 1 198 ? 22.85882  -16.42225 28.33693   1.000 170.38939 ? 198 GLU A CD  1 
ATOM 1609  O OE1 . GLU A 1 198 ? 23.41016  -17.52772 28.15613   1.000 174.64786 ? 198 GLU A OE1 1 
ATOM 1610  O OE2 . GLU A 1 198 ? 22.54207  -15.99490 29.46732   1.000 175.14836 ? 198 GLU A OE2 1 
ATOM 1611  N N   . GLU A 1 199 ? 24.00047  -13.10271 24.51273   1.000 119.06882 ? 199 GLU A N   1 
ATOM 1612  C CA  . GLU A 1 199 ? 25.06620  -12.15694 24.19895   1.000 137.09549 ? 199 GLU A CA  1 
ATOM 1613  C C   . GLU A 1 199 ? 25.93532  -11.78397 25.40009   1.000 119.02087 ? 199 GLU A C   1 
ATOM 1614  O O   . GLU A 1 199 ? 26.66920  -10.78982 25.31849   1.000 105.65527 ? 199 GLU A O   1 
ATOM 1615  C CB  . GLU A 1 199 ? 24.46464  -10.88675 23.59041   1.000 162.85567 ? 199 GLU A CB  1 
ATOM 1616  C CG  . GLU A 1 199 ? 23.60307  -10.08198 24.56103   1.000 162.62196 ? 199 GLU A CG  1 
ATOM 1617  C CD  . GLU A 1 199 ? 22.15799  -10.54401 24.59673   1.000 155.41105 ? 199 GLU A CD  1 
ATOM 1618  O OE1 . GLU A 1 199 ? 21.87992  -11.67595 24.14686   1.000 154.88673 ? 199 GLU A OE1 1 
ATOM 1619  O OE2 . GLU A 1 199 ? 21.30050  -9.77475  25.08099   1.000 150.10576 ? 199 GLU A OE2 1 
ATOM 1620  N N   . THR A 1 200 ? 25.89620  -12.53859 26.49638   1.000 108.53431 ? 200 THR A N   1 
ATOM 1621  C CA  . THR A 1 200 ? 26.54443  -12.10854 27.73118   1.000 126.61598 ? 200 THR A CA  1 
ATOM 1622  C C   . THR A 1 200 ? 27.85124  -12.82767 28.04071   1.000 130.44943 ? 200 THR A C   1 
ATOM 1623  O O   . THR A 1 200 ? 28.77860  -12.19458 28.55481   1.000 136.94099 ? 200 THR A O   1 
ATOM 1624  C CB  . THR A 1 200 ? 25.59735  -12.29015 28.92089   1.000 133.35796 ? 200 THR A CB  1 
ATOM 1625  O OG1 . THR A 1 200 ? 26.33570  -12.14975 30.14049   1.000 141.48380 ? 200 THR A OG1 1 
ATOM 1626  C CG2 . THR A 1 200 ? 24.94964  -13.65939 28.88668   1.000 123.55868 ? 200 THR A CG2 1 
ATOM 1627  N N   . ILE A 1 201 ? 27.95294  -14.12792 27.74747   1.000 125.61534 ? 201 ILE A N   1 
ATOM 1628  C CA  . ILE A 1 201 ? 29.01037  -14.94072 28.34023   1.000 125.56363 ? 201 ILE A CA  1 
ATOM 1629  C C   . ILE A 1 201 ? 30.38090  -14.44034 27.90138   1.000 106.60632 ? 201 ILE A C   1 
ATOM 1630  O O   . ILE A 1 201 ? 30.56674  -13.96998 26.77118   1.000 100.93958 ? 201 ILE A O   1 
ATOM 1631  C CB  . ILE A 1 201 ? 28.81891  -16.42804 27.99619   1.000 136.50703 ? 201 ILE A CB  1 
ATOM 1632  C CG1 . ILE A 1 201 ? 29.23084  -16.72703 26.55371   1.000 129.36452 ? 201 ILE A CG1 1 
ATOM 1633  C CG2 . ILE A 1 201 ? 27.37265  -16.84509 28.23091   1.000 151.12639 ? 201 ILE A CG2 1 
ATOM 1634  C CD1 . ILE A 1 201 ? 29.49751  -18.19847 26.29987   1.000 127.08007 ? 201 ILE A CD1 1 
ATOM 1635  N N   . GLU A 1 202 ? 31.34703  -14.52009 28.81390   1.000 115.30698 ? 202 GLU A N   1 
ATOM 1636  C CA  . GLU A 1 202 ? 32.72200  -14.15141 28.52547   1.000 115.33618 ? 202 GLU A CA  1 
ATOM 1637  C C   . GLU A 1 202 ? 33.49122  -15.38004 28.04169   1.000 107.29211 ? 202 GLU A C   1 
ATOM 1638  O O   . GLU A 1 202 ? 32.93711  -16.47157 27.89014   1.000 113.07430 ? 202 GLU A O   1 
ATOM 1639  C CB  . GLU A 1 202 ? 33.38159  -13.54453 29.76422   1.000 122.55727 ? 202 GLU A CB  1 
ATOM 1640  C CG  . GLU A 1 202 ? 32.96863  -12.11263 30.07082   1.000 118.64272 ? 202 GLU A CG  1 
ATOM 1641  C CD  . GLU A 1 202 ? 33.57447  -11.10880 29.11388   1.000 116.90947 ? 202 GLU A CD  1 
ATOM 1642  O OE1 . GLU A 1 202 ? 34.60121  -11.43437 28.48229   1.000 113.68110 ? 202 GLU A OE1 1 
ATOM 1643  O OE2 . GLU A 1 202 ? 33.02633  -9.99242  28.99823   1.000 122.43640 ? 202 GLU A OE2 1 
ATOM 1644  N N   . GLU A 1 203 ? 34.78819  -15.20366 27.79428   1.000 95.14160  ? 203 GLU A N   1 
ATOM 1645  C CA  . GLU A 1 203 ? 35.61328  -16.29679 27.29268   1.000 107.67657 ? 203 GLU A CA  1 
ATOM 1646  C C   . GLU A 1 203 ? 35.79169  -17.36176 28.36749   1.000 100.96811 ? 203 GLU A C   1 
ATOM 1647  O O   . GLU A 1 203 ? 36.26646  -17.06724 29.46918   1.000 94.16395  ? 203 GLU A O   1 
ATOM 1648  C CB  . GLU A 1 203 ? 36.97897  -15.78436 26.83684   1.000 115.62165 ? 203 GLU A CB  1 
ATOM 1649  C CG  . GLU A 1 203 ? 36.94551  -14.59406 25.89853   1.000 112.40248 ? 203 GLU A CG  1 
ATOM 1650  C CD  . GLU A 1 203 ? 37.11167  -13.27547 26.62744   1.000 114.74050 ? 203 GLU A CD  1 
ATOM 1651  O OE1 . GLU A 1 203 ? 37.23298  -13.28750 27.87069   1.000 123.66639 ? 203 GLU A OE1 1 
ATOM 1652  O OE2 . GLU A 1 203 ? 37.11911  -12.22378 25.95439   1.000 113.32983 ? 203 GLU A OE2 1 
ATOM 1653  N N   . ARG A 1 204 ? 35.40522  -18.59441 28.05197   1.000 99.17160  ? 204 ARG A N   1 
ATOM 1654  C CA  . ARG A 1 204 ? 35.71506  -19.74955 28.88411   1.000 106.30160 ? 204 ARG A CA  1 
ATOM 1655  C C   . ARG A 1 204 ? 36.93774  -20.45520 28.31437   1.000 95.17251  ? 204 ARG A C   1 
ATOM 1656  O O   . ARG A 1 204 ? 37.01239  -20.70181 27.10628   1.000 94.67266  ? 204 ARG A O   1 
ATOM 1657  C CB  . ARG A 1 204 ? 34.53403  -20.71602 28.97152   1.000 125.92993 ? 204 ARG A CB  1 
ATOM 1658  C CG  . ARG A 1 204 ? 33.31450  -20.15249 29.67828   1.000 137.96376 ? 204 ARG A CG  1 
ATOM 1659  C CD  . ARG A 1 204 ? 33.65952  -19.76107 31.10862   1.000 154.27807 ? 204 ARG A CD  1 
ATOM 1660  N NE  . ARG A 1 204 ? 34.21840  -20.87765 31.86548   1.000 170.22585 ? 204 ARG A NE  1 
ATOM 1661  C CZ  . ARG A 1 204 ? 33.49812  -21.76529 32.54252   1.000 184.47262 ? 204 ARG A CZ  1 
ATOM 1662  N NH1 . ARG A 1 204 ? 32.17575  -21.67582 32.56276   1.000 195.48436 ? 204 ARG A NH1 1 
ATOM 1663  N NH2 . ARG A 1 204 ? 34.10216  -22.74725 33.19977   1.000 182.80163 ? 204 ARG A NH2 1 
ATOM 1664  N N   . PHE A 1 205 ? 37.89197  -20.77277 29.18442   1.000 87.20671  ? 205 PHE A N   1 
ATOM 1665  C CA  . PHE A 1 205 ? 39.13685  -21.42702 28.79705   1.000 86.97088  ? 205 PHE A CA  1 
ATOM 1666  C C   . PHE A 1 205 ? 39.16401  -22.81403 29.42622   1.000 94.45653  ? 205 PHE A C   1 
ATOM 1667  O O   . PHE A 1 205 ? 39.28958  -22.94658 30.64853   1.000 87.72111  ? 205 PHE A O   1 
ATOM 1668  C CB  . PHE A 1 205 ? 40.34593  -20.60030 29.22053   1.000 88.23215  ? 205 PHE A CB  1 
ATOM 1669  C CG  . PHE A 1 205 ? 41.60018  -20.94118 28.47212   1.000 83.86380  ? 205 PHE A CG  1 
ATOM 1670  C CD1 . PHE A 1 205 ? 41.77655  -20.51517 27.16687   1.000 83.23722  ? 205 PHE A CD1 1 
ATOM 1671  C CD2 . PHE A 1 205 ? 42.60509  -21.67943 29.07270   1.000 89.56398  ? 205 PHE A CD2 1 
ATOM 1672  C CE1 . PHE A 1 205 ? 42.92920  -20.82106 26.47284   1.000 82.52847  ? 205 PHE A CE1 1 
ATOM 1673  C CE2 . PHE A 1 205 ? 43.76169  -21.98824 28.38306   1.000 82.40236  ? 205 PHE A CE2 1 
ATOM 1674  C CZ  . PHE A 1 205 ? 43.92332  -21.55599 27.08139   1.000 82.07996  ? 205 PHE A CZ  1 
ATOM 1675  N N   . GLU A 1 206 ? 39.04225  -23.83730 28.59043   1.000 114.29674 ? 206 GLU A N   1 
ATOM 1676  C CA  . GLU A 1 206 ? 38.95934  -25.21638 29.03767   1.000 125.08543 ? 206 GLU A CA  1 
ATOM 1677  C C   . GLU A 1 206 ? 40.35043  -25.81014 29.23491   1.000 112.80749 ? 206 GLU A C   1 
ATOM 1678  O O   . GLU A 1 206 ? 41.34826  -25.32353 28.69662   1.000 121.27540 ? 206 GLU A O   1 
ATOM 1679  C CB  . GLU A 1 206 ? 38.18911  -26.05358 28.01461   1.000 143.21763 ? 206 GLU A CB  1 
ATOM 1680  C CG  . GLU A 1 206 ? 39.01332  -26.42086 26.77617   1.000 143.49992 ? 206 GLU A CG  1 
ATOM 1681  C CD  . GLU A 1 206 ? 39.16047  -25.28237 25.77534   1.000 113.19887 ? 206 GLU A CD  1 
ATOM 1682  O OE1 . GLU A 1 206 ? 38.75242  -24.14354 26.08562   1.000 103.52828 ? 206 GLU A OE1 1 
ATOM 1683  O OE2 . GLU A 1 206 ? 39.69887  -25.52743 24.67401   1.000 90.79305  ? 206 GLU A OE2 1 
ATOM 1684  N N   . ILE A 1 207 ? 40.40047  -26.87503 30.03228   1.000 90.67994  ? 207 ILE A N   1 
ATOM 1685  C CA  . ILE A 1 207 ? 41.60946  -27.65961 30.26153   1.000 89.76956  ? 207 ILE A CA  1 
ATOM 1686  C C   . ILE A 1 207 ? 41.20251  -29.11682 30.07200   1.000 92.14356  ? 207 ILE A C   1 
ATOM 1687  O O   . ILE A 1 207 ? 40.70474  -29.75317 31.00754   1.000 93.43785  ? 207 ILE A O   1 
ATOM 1688  C CB  . ILE A 1 207 ? 42.21182  -27.42279 31.65246   1.000 88.70973  ? 207 ILE A CB  1 
ATOM 1689  C CG1 . ILE A 1 207 ? 42.49678  -25.93403 31.86868   1.000 86.53810  ? 207 ILE A CG1 1 
ATOM 1690  C CG2 . ILE A 1 207 ? 43.49305  -28.22414 31.80785   1.000 88.44379  ? 207 ILE A CG2 1 
ATOM 1691  C CD1 . ILE A 1 207 ? 43.06745  -25.61832 33.23320   1.000 85.55651  ? 207 ILE A CD1 1 
ATOM 1692  N N   . THR A 1 208 ? 41.40738  -29.64574 28.86667   1.000 90.15414  ? 208 THR A N   1 
ATOM 1693  C CA  . THR A 1 208 ? 40.98071  -30.99044 28.51198   1.000 103.41640 ? 208 THR A CA  1 
ATOM 1694  C C   . THR A 1 208 ? 42.09805  -31.97341 28.87646   1.000 109.12444 ? 208 THR A C   1 
ATOM 1695  O O   . THR A 1 208 ? 43.05144  -31.62479 29.57787   1.000 107.63130 ? 208 THR A O   1 
ATOM 1696  C CB  . THR A 1 208 ? 40.61626  -31.04519 27.02830   1.000 127.77308 ? 208 THR A CB  1 
ATOM 1697  O OG1 . THR A 1 208 ? 40.01040  -29.80417 26.64988   1.000 153.82217 ? 208 THR A OG1 1 
ATOM 1698  C CG2 . THR A 1 208 ? 39.59997  -32.15154 26.75904   1.000 126.26302 ? 208 THR A CG2 1 
ATOM 1699  N N   . GLY A 1 209 ? 41.98990  -33.22144 28.41807   1.000 119.09453 ? 209 GLY A N   1 
ATOM 1700  C CA  . GLY A 1 209 ? 43.00514  -34.20886 28.72118   1.000 124.16658 ? 209 GLY A CA  1 
ATOM 1701  C C   . GLY A 1 209 ? 44.34676  -33.87861 28.09643   1.000 128.84065 ? 209 GLY A C   1 
ATOM 1702  O O   . GLY A 1 209 ? 44.46884  -33.03742 27.20194   1.000 127.66912 ? 209 GLY A O   1 
ATOM 1703  N N   . THR A 1 210 ? 45.37910  -34.56592 28.60538   1.000 128.18651 ? 210 THR A N   1 
ATOM 1704  C CA  . THR A 1 210 ? 46.77649  -34.37826 28.21688   1.000 117.08112 ? 210 THR A CA  1 
ATOM 1705  C C   . THR A 1 210 ? 47.24337  -32.98859 28.62807   1.000 101.71689 ? 210 THR A C   1 
ATOM 1706  O O   . THR A 1 210 ? 48.42433  -32.64259 28.49406   1.000 97.72904  ? 210 THR A O   1 
ATOM 1707  C CB  . THR A 1 210 ? 46.95823  -34.61021 26.71321   1.000 127.88308 ? 210 THR A CB  1 
ATOM 1708  O OG1 . THR A 1 210 ? 46.33760  -33.54204 25.98479   1.000 140.57895 ? 210 THR A OG1 1 
ATOM 1709  C CG2 . THR A 1 210 ? 46.35775  -35.95843 26.30075   1.000 135.54542 ? 210 THR A CG2 1 
ATOM 1710  N N   . MET A 1 211 ? 46.32286  -32.19855 29.15878   1.000 95.96232  ? 211 MET A N   1 
ATOM 1711  C CA  . MET A 1 211 ? 46.63972  -30.91878 29.76561   1.000 87.20814  ? 211 MET A CA  1 
ATOM 1712  C C   . MET A 1 211 ? 46.20078  -30.88125 31.21818   1.000 87.54470  ? 211 MET A C   1 
ATOM 1713  O O   . MET A 1 211 ? 46.97743  -30.47349 32.09236   1.000 86.27175  ? 211 MET A O   1 
ATOM 1714  C CB  . MET A 1 211 ? 45.97638  -29.78682 28.97530   1.000 86.38647  ? 211 MET A CB  1 
ATOM 1715  C CG  . MET A 1 211 ? 46.43716  -28.41025 29.39178   1.000 84.09302  ? 211 MET A CG  1 
ATOM 1716  S SD  . MET A 1 211 ? 48.20294  -28.17489 29.08555   1.000 82.13510  ? 211 MET A SD  1 
ATOM 1717  C CE  . MET A 1 211 ? 48.56610  -26.74052 30.09406   1.000 79.96854  ? 211 MET A CE  1 
ATOM 1718  N N   . ARG A 1 212 ? 44.96111  -31.29185 31.49320   1.000 87.92006  ? 212 ARG A N   1 
ATOM 1719  C CA  . ARG A 1 212 ? 44.53428  -31.53182 32.86572   1.000 88.71042  ? 212 ARG A CA  1 
ATOM 1720  C C   . ARG A 1 212 ? 45.36307  -32.63390 33.50732   1.000 89.54949  ? 212 ARG A C   1 
ATOM 1721  O O   . ARG A 1 212 ? 45.59470  -32.61909 34.72253   1.000 89.45690  ? 212 ARG A O   1 
ATOM 1722  C CB  . ARG A 1 212 ? 43.05114  -31.90185 32.88709   1.000 90.71561  ? 212 ARG A CB  1 
ATOM 1723  C CG  . ARG A 1 212 ? 42.46730  -32.10592 34.26663   1.000 91.67589  ? 212 ARG A CG  1 
ATOM 1724  C CD  . ARG A 1 212 ? 42.42715  -30.80773 35.03738   1.000 89.91370  ? 212 ARG A CD  1 
ATOM 1725  N NE  . ARG A 1 212 ? 41.59458  -29.80742 34.37745   1.000 89.28681  ? 212 ARG A NE  1 
ATOM 1726  C CZ  . ARG A 1 212 ? 40.42182  -29.39045 34.84235   1.000 89.93165  ? 212 ARG A CZ  1 
ATOM 1727  N NH1 . ARG A 1 212 ? 39.93783  -29.89244 35.97048   1.000 91.21639  ? 212 ARG A NH1 1 
ATOM 1728  N NH2 . ARG A 1 212 ? 39.73052  -28.47457 34.17791   1.000 89.37606  ? 212 ARG A NH2 1 
ATOM 1729  N N   . ARG A 1 213 ? 45.81746  -33.59457 32.70073   1.000 109.19663 ? 213 ARG A N   1 
ATOM 1730  C CA  . ARG A 1 213 ? 46.68045  -34.65782 33.19653   1.000 108.33790 ? 213 ARG A CA  1 
ATOM 1731  C C   . ARG A 1 213 ? 48.02275  -34.11352 33.66852   1.000 103.85358 ? 213 ARG A C   1 
ATOM 1732  O O   . ARG A 1 213 ? 48.60509  -34.64454 34.62061   1.000 103.19633 ? 213 ARG A O   1 
ATOM 1733  C CB  . ARG A 1 213 ? 46.87108  -35.70627 32.10181   1.000 102.06240 ? 213 ARG A CB  1 
ATOM 1734  C CG  . ARG A 1 213 ? 45.55827  -36.20225 31.50345   1.000 100.43729 ? 213 ARG A CG  1 
ATOM 1735  C CD  . ARG A 1 213 ? 45.79485  -37.22268 30.40407   1.000 104.39859 ? 213 ARG A CD  1 
ATOM 1736  N NE  . ARG A 1 213 ? 44.56971  -37.57042 29.68885   1.000 108.86080 ? 213 ARG A NE  1 
ATOM 1737  C CZ  . ARG A 1 213 ? 43.90502  -38.71041 29.84787   1.000 113.82336 ? 213 ARG A CZ  1 
ATOM 1738  N NH1 . ARG A 1 213 ? 42.79968  -38.93736 29.15044   1.000 115.44896 ? 213 ARG A NH1 1 
ATOM 1739  N NH2 . ARG A 1 213 ? 44.34640  -39.62561 30.69962   1.000 115.66017 ? 213 ARG A NH2 1 
ATOM 1740  N N   . LEU A 1 214 ? 48.52927  -33.06246 33.01868   1.000 91.11236  ? 214 LEU A N   1 
ATOM 1741  C CA  . LEU A 1 214 ? 49.74198  -32.40769 33.49333   1.000 89.17223  ? 214 LEU A CA  1 
ATOM 1742  C C   . LEU A 1 214 ? 49.46035  -31.46930 34.65841   1.000 88.28533  ? 214 LEU A C   1 
ATOM 1743  O O   . LEU A 1 214 ? 50.33882  -31.25334 35.50135   1.000 96.16880  ? 214 LEU A O   1 
ATOM 1744  C CB  . LEU A 1 214 ? 50.41021  -31.63478 32.35435   1.000 87.35064  ? 214 LEU A CB  1 
ATOM 1745  C CG  . LEU A 1 214 ? 50.97862  -32.45242 31.19377   1.000 87.89780  ? 214 LEU A CG  1 
ATOM 1746  C CD1 . LEU A 1 214 ? 51.50540  -31.53525 30.10160   1.000 86.09715  ? 214 LEU A CD1 1 
ATOM 1747  C CD2 . LEU A 1 214 ? 52.07291  -33.38677 31.68519   1.000 88.35777  ? 214 LEU A CD2 1 
ATOM 1748  N N   . ALA A 1 215 ? 48.25459  -30.90053 34.71792   1.000 85.82079  ? 215 ALA A N   1 
ATOM 1749  C CA  . ALA A 1 215 ? 47.88708  -30.05695 35.85014   1.000 85.19239  ? 215 ALA A CA  1 
ATOM 1750  C C   . ALA A 1 215 ? 47.79556  -30.86079 37.14053   1.000 86.70207  ? 215 ALA A C   1 
ATOM 1751  O O   . ALA A 1 215 ? 48.28733  -30.42452 38.18816   1.000 92.76988  ? 215 ALA A O   1 
ATOM 1752  C CB  . ALA A 1 215 ? 46.55992  -29.35549 35.56542   1.000 85.32746  ? 215 ALA A CB  1 
ATOM 1753  N N   . ASP A 1 216 ? 47.17079  -32.03743 37.08414   1.000 88.81619  ? 216 ASP A N   1 
ATOM 1754  C CA  . ASP A 1 216 ? 47.07460  -32.89577 38.25818   1.000 90.50574  ? 216 ASP A CA  1 
ATOM 1755  C C   . ASP A 1 216 ? 48.41877  -33.46767 38.69131   1.000 90.39746  ? 216 ASP A C   1 
ATOM 1756  O O   . ASP A 1 216 ? 48.55018  -33.89481 39.84296   1.000 91.38568  ? 216 ASP A O   1 
ATOM 1757  C CB  . ASP A 1 216 ? 46.08951  -34.03219 37.98618   1.000 92.98848  ? 216 ASP A CB  1 
ATOM 1758  C CG  . ASP A 1 216 ? 44.65769  -33.54850 37.89318   1.000 96.75225  ? 216 ASP A CG  1 
ATOM 1759  O OD1 . ASP A 1 216 ? 44.32869  -32.54594 38.56067   1.000 94.71235  ? 216 ASP A OD1 1 
ATOM 1760  O OD2 . ASP A 1 216 ? 43.86303  -34.16600 37.15243   1.000 96.45196  ? 216 ASP A OD2 1 
ATOM 1761  N N   . GLN A 1 217 ? 49.41480  -33.48629 37.80826   1.000 92.32312  ? 217 GLN A N   1 
ATOM 1762  C CA  . GLN A 1 217 ? 50.74706  -33.96329 38.15160   1.000 92.50376  ? 217 GLN A CA  1 
ATOM 1763  C C   . GLN A 1 217 ? 51.70577  -32.83155 38.50906   1.000 93.57668  ? 217 GLN A C   1 
ATOM 1764  O O   . GLN A 1 217 ? 52.90279  -33.07810 38.68990   1.000 99.73096  ? 217 GLN A O   1 
ATOM 1765  C CB  . GLN A 1 217 ? 51.31421  -34.80292 37.00442   1.000 94.76913  ? 217 GLN A CB  1 
ATOM 1766  C CG  . GLN A 1 217 ? 52.28700  -35.88249 37.45582   1.000 108.57546 ? 217 GLN A CG  1 
ATOM 1767  C CD  . GLN A 1 217 ? 52.41763  -37.00900 36.45297   1.000 115.04501 ? 217 GLN A CD  1 
ATOM 1768  O OE1 . GLN A 1 217 ? 51.92236  -36.91614 35.32984   1.000 118.53130 ? 217 GLN A OE1 1 
ATOM 1769  N NE2 . GLN A 1 217 ? 53.07175  -38.09029 36.86073   1.000 115.54015 ? 217 GLN A NE2 1 
ATOM 1770  N N   . SER A 1 218 ? 51.20838  -31.59948 38.61712   1.000 92.37824  ? 218 SER A N   1 
ATOM 1771  C CA  . SER A 1 218 ? 52.03087  -30.45066 38.96801   1.000 88.42509  ? 218 SER A CA  1 
ATOM 1772  C C   . SER A 1 218 ? 51.82861  -29.97051 40.39846   1.000 92.20720  ? 218 SER A C   1 
ATOM 1773  O O   . SER A 1 218 ? 52.58800  -29.11051 40.85701   1.000 92.42731  ? 218 SER A O   1 
ATOM 1774  C CB  . SER A 1 218 ? 51.75183  -29.28746 38.00387   1.000 87.30365  ? 218 SER A CB  1 
ATOM 1775  O OG  . SER A 1 218 ? 52.33519  -28.08285 38.46872   1.000 102.88393 ? 218 SER A OG  1 
ATOM 1776  N N   . LEU A 1 219 ? 50.84030  -30.49799 41.10959   1.000 89.08536  ? 219 LEU A N   1 
ATOM 1777  C CA  . LEU A 1 219 ? 50.53737  -30.06934 42.46426   1.000 88.81903  ? 219 LEU A CA  1 
ATOM 1778  C C   . LEU A 1 219 ? 51.51073  -30.66988 43.48098   1.000 81.96876  ? 219 LEU A C   1 
ATOM 1779  O O   . LEU A 1 219 ? 52.22481  -31.63109 43.18330   1.000 88.47565  ? 219 LEU A O   1 
ATOM 1780  C CB  . LEU A 1 219 ? 49.09359  -30.44281 42.80024   1.000 104.33412 ? 219 LEU A CB  1 
ATOM 1781  C CG  . LEU A 1 219 ? 48.55263  -31.80169 42.33623   1.000 121.40579 ? 219 LEU A CG  1 
ATOM 1782  C CD1 . LEU A 1 219 ? 49.21328  -32.97801 43.04439   1.000 131.55837 ? 219 LEU A CD1 1 
ATOM 1783  C CD2 . LEU A 1 219 ? 47.04129  -31.85727 42.49757   1.000 125.69578 ? 219 LEU A CD2 1 
ATOM 1784  N N   . PRO A 1 220 ? 51.56585  -30.10671 44.68752   1.000 86.83118  ? 220 PRO A N   1 
ATOM 1785  C CA  . PRO A 1 220 ? 52.42032  -30.66948 45.74406   1.000 85.70891  ? 220 PRO A CA  1 
ATOM 1786  C C   . PRO A 1 220 ? 51.99588  -32.07911 46.11394   1.000 91.60730  ? 220 PRO A C   1 
ATOM 1787  O O   . PRO A 1 220 ? 50.84716  -32.47659 45.86663   1.000 112.01626 ? 220 PRO A O   1 
ATOM 1788  C CB  . PRO A 1 220 ? 52.21226  -29.69877 46.92035   1.000 97.53833  ? 220 PRO A CB  1 
ATOM 1789  C CG  . PRO A 1 220 ? 50.99431  -28.90126 46.57318   1.000 99.60915  ? 220 PRO A CG  1 
ATOM 1790  C CD  . PRO A 1 220 ? 51.00478  -28.80562 45.08664   1.000 82.93183  ? 220 PRO A CD  1 
ATOM 1791  N N   . PRO A 1 221 ? 52.89868  -32.87117 46.71909   1.000 92.34968  ? 221 PRO A N   1 
ATOM 1792  C CA  . PRO A 1 221 ? 52.57110  -34.27183 47.02515   1.000 94.92559  ? 221 PRO A CA  1 
ATOM 1793  C C   . PRO A 1 221 ? 51.59925  -34.41578 48.18498   1.000 109.18179 ? 221 PRO A C   1 
ATOM 1794  O O   . PRO A 1 221 ? 51.86797  -35.14590 49.14437   1.000 115.34039 ? 221 PRO A O   1 
ATOM 1795  C CB  . PRO A 1 221 ? 53.93600  -34.88896 47.36915   1.000 97.00913  ? 221 PRO A CB  1 
ATOM 1796  C CG  . PRO A 1 221 ? 54.95841  -33.89493 46.89889   1.000 114.66759 ? 221 PRO A CG  1 
ATOM 1797  C CD  . PRO A 1 221 ? 54.30306  -32.56277 47.02661   1.000 99.50983  ? 221 PRO A CD  1 
ATOM 1798  N N   . ASN A 1 222 ? 50.46531  -33.72128 48.10433   1.000 108.29928 ? 222 ASN A N   1 
ATOM 1799  C CA  . ASN A 1 222 ? 49.40268  -33.85059 49.08728   1.000 127.53070 ? 222 ASN A CA  1 
ATOM 1800  C C   . ASN A 1 222 ? 48.02571  -33.96883 48.45183   1.000 132.77760 ? 222 ASN A C   1 
ATOM 1801  O O   . ASN A 1 222 ? 47.04357  -34.16597 49.17577   1.000 158.53541 ? 222 ASN A O   1 
ATOM 1802  C CB  . ASN A 1 222 ? 49.41198  -32.65402 50.05253   1.000 135.25692 ? 222 ASN A CB  1 
ATOM 1803  C CG  . ASN A 1 222 ? 50.52089  -32.74185 51.08444   1.000 147.12393 ? 222 ASN A CG  1 
ATOM 1804  O OD1 . ASN A 1 222 ? 50.82304  -33.81835 51.59906   1.000 165.00707 ? 222 ASN A OD1 1 
ATOM 1805  N ND2 . ASN A 1 222 ? 51.12986  -31.60293 51.39651   1.000 138.23331 ? 222 ASN A ND2 1 
ATOM 1806  N N   . PHE A 1 223 ? 47.92461  -33.85525 47.12984   1.000 97.83871  ? 223 PHE A N   1 
ATOM 1807  C CA  . PHE A 1 223 ? 46.65054  -33.85521 46.43050   1.000 92.44629  ? 223 PHE A CA  1 
ATOM 1808  C C   . PHE A 1 223 ? 46.72576  -34.78652 45.22823   1.000 113.53878 ? 223 PHE A C   1 
ATOM 1809  O O   . PHE A 1 223 ? 47.79910  -35.25383 44.83701   1.000 112.53754 ? 223 PHE A O   1 
ATOM 1810  C CB  . PHE A 1 223 ? 46.26780  -32.43832 45.98107   1.000 90.25018  ? 223 PHE A CB  1 
ATOM 1811  C CG  . PHE A 1 223 ? 46.49721  -31.38867 47.02943   1.000 89.18393  ? 223 PHE A CG  1 
ATOM 1812  C CD1 . PHE A 1 223 ? 45.52540  -31.10983 47.97513   1.000 126.70903 ? 223 PHE A CD1 1 
ATOM 1813  C CD2 . PHE A 1 223 ? 47.68870  -30.68369 47.07222   1.000 87.33873  ? 223 PHE A CD2 1 
ATOM 1814  C CE1 . PHE A 1 223 ? 45.73674  -30.14475 48.94254   1.000 125.42492 ? 223 PHE A CE1 1 
ATOM 1815  C CE2 . PHE A 1 223 ? 47.90606  -29.71985 48.03717   1.000 115.00108 ? 223 PHE A CE2 1 
ATOM 1816  C CZ  . PHE A 1 223 ? 46.92939  -29.44878 48.97245   1.000 122.24813 ? 223 PHE A CZ  1 
ATOM 1817  N N   . SER A 1 224 ? 45.56280  -35.05652 44.64604   1.000 130.98277 ? 224 SER A N   1 
ATOM 1818  C CA  . SER A 1 224 ? 45.45311  -35.81950 43.40942   1.000 124.33980 ? 224 SER A CA  1 
ATOM 1819  C C   . SER A 1 224 ? 44.86241  -35.00329 42.27315   1.000 119.53393 ? 224 SER A C   1 
ATOM 1820  O O   . SER A 1 224 ? 45.35753  -35.07302 41.14532   1.000 144.94263 ? 224 SER A O   1 
ATOM 1821  C CB  . SER A 1 224 ? 44.59973  -37.07655 43.63605   1.000 111.47365 ? 224 SER A CB  1 
ATOM 1822  O OG  . SER A 1 224 ? 45.22667  -37.96413 44.54567   1.000 98.96485  ? 224 SER A OG  1 
ATOM 1823  N N   . CYS A 1 225 ? 43.81805  -34.22730 42.54387   1.000 97.67405  ? 225 CYS A N   1 
ATOM 1824  C CA  . CYS A 1 225 ? 43.24119  -33.30113 41.58233   1.000 104.22396 ? 225 CYS A CA  1 
ATOM 1825  C C   . CYS A 1 225 ? 43.59886  -31.87620 41.98298   1.000 97.49453  ? 225 CYS A C   1 
ATOM 1826  O O   . CYS A 1 225 ? 43.64193  -31.55078 43.17390   1.000 115.79757 ? 225 CYS A O   1 
ATOM 1827  C CB  . CYS A 1 225 ? 41.72105  -33.46225 41.50274   1.000 148.69798 ? 225 CYS A CB  1 
ATOM 1828  S SG  . CYS A 1 225 ? 40.92491  -32.40280 40.27489   1.000 189.06331 ? 225 CYS A SG  1 
ATOM 1829  N N   . LEU A 1 226 ? 43.86072  -31.02665 40.98734   1.000 102.37534 ? 226 LEU A N   1 
ATOM 1830  C CA  . LEU A 1 226 ? 44.20737  -29.64192 41.28386   1.000 95.95645  ? 226 LEU A CA  1 
ATOM 1831  C C   . LEU A 1 226 ? 43.01552  -28.84910 41.80003   1.000 94.83580  ? 226 LEU A C   1 
ATOM 1832  O O   . LEU A 1 226 ? 43.20937  -27.78079 42.38608   1.000 93.04377  ? 226 LEU A O   1 
ATOM 1833  C CB  . LEU A 1 226 ? 44.77103  -28.93865 40.04823   1.000 90.89315  ? 226 LEU A CB  1 
ATOM 1834  C CG  . LEU A 1 226 ? 43.75218  -28.41935 39.03063   1.000 90.47444  ? 226 LEU A CG  1 
ATOM 1835  C CD1 . LEU A 1 226 ? 44.39990  -27.40873 38.09487   1.000 86.49574  ? 226 LEU A CD1 1 
ATOM 1836  C CD2 . LEU A 1 226 ? 43.10765  -29.54658 38.25001   1.000 98.59235  ? 226 LEU A CD2 1 
ATOM 1837  N N   . GLU A 1 227 ? 41.78993  -29.33212 41.57819   1.000 88.99414  ? 227 GLU A N   1 
ATOM 1838  C CA  . GLU A 1 227 ? 40.62027  -28.64093 42.10761   1.000 90.53900  ? 227 GLU A CA  1 
ATOM 1839  C C   . GLU A 1 227 ? 40.61582  -28.65761 43.63055   1.000 89.89540  ? 227 GLU A C   1 
ATOM 1840  O O   . GLU A 1 227 ? 40.27124  -27.65490 44.26885   1.000 90.95383  ? 227 GLU A O   1 
ATOM 1841  C CB  . GLU A 1 227 ? 39.34178  -29.27200 41.55633   1.000 116.69697 ? 227 GLU A CB  1 
ATOM 1842  C CG  . GLU A 1 227 ? 39.14615  -29.05803 40.06394   1.000 129.87960 ? 227 GLU A CG  1 
ATOM 1843  C CD  . GLU A 1 227 ? 38.78546  -27.62580 39.72148   1.000 137.22247 ? 227 GLU A CD  1 
ATOM 1844  O OE1 . GLU A 1 227 ? 38.16119  -26.94940 40.56636   1.000 145.22687 ? 227 GLU A OE1 1 
ATOM 1845  O OE2 . GLU A 1 227 ? 39.12873  -27.17593 38.60788   1.000 134.56311 ? 227 GLU A OE2 1 
ATOM 1846  N N   . ASN A 1 228 ? 40.99244  -29.79039 44.23057   1.000 88.60978  ? 228 ASN A N   1 
ATOM 1847  C CA  . ASN A 1 228 ? 41.16361  -29.83801 45.67880   1.000 106.70531 ? 228 ASN A CA  1 
ATOM 1848  C C   . ASN A 1 228 ? 42.20450  -28.82493 46.13253   1.000 107.69801 ? 228 ASN A C   1 
ATOM 1849  O O   . ASN A 1 228 ? 42.01639  -28.13576 47.14203   1.000 106.36617 ? 228 ASN A O   1 
ATOM 1850  C CB  . ASN A 1 228 ? 41.56608  -31.24596 46.11655   1.000 114.63489 ? 228 ASN A CB  1 
ATOM 1851  C CG  . ASN A 1 228 ? 40.52037  -32.28435 45.77213   1.000 114.84447 ? 228 ASN A CG  1 
ATOM 1852  O OD1 . ASN A 1 228 ? 40.65557  -33.01455 44.79059   1.000 110.47312 ? 228 ASN A OD1 1 
ATOM 1853  N ND2 . ASN A 1 228 ? 39.47000  -32.35879 46.58148   1.000 115.32609 ? 228 ASN A ND2 1 
ATOM 1854  N N   . PHE A 1 229 ? 43.30475  -28.71198 45.38449   1.000 110.73547 ? 229 PHE A N   1 
ATOM 1855  C CA  . PHE A 1 229 ? 44.34945  -27.75508 45.73011   1.000 92.21885  ? 229 PHE A CA  1 
ATOM 1856  C C   . PHE A 1 229 ? 43.83323  -26.32436 45.66712   1.000 82.74002  ? 229 PHE A C   1 
ATOM 1857  O O   . PHE A 1 229 ? 44.12461  -25.51357 46.55173   1.000 82.42479  ? 229 PHE A O   1 
ATOM 1858  C CB  . PHE A 1 229 ? 45.54944  -27.92701 44.79944   1.000 89.94522  ? 229 PHE A CB  1 
ATOM 1859  C CG  . PHE A 1 229 ? 46.61343  -26.88610 44.98989   1.000 95.28979  ? 229 PHE A CG  1 
ATOM 1860  C CD1 . PHE A 1 229 ? 47.47947  -26.95328 46.06720   1.000 102.76068 ? 229 PHE A CD1 1 
ATOM 1861  C CD2 . PHE A 1 229 ? 46.74616  -25.83872 44.09283   1.000 91.25365  ? 229 PHE A CD2 1 
ATOM 1862  C CE1 . PHE A 1 229 ? 48.45728  -25.99547 46.24763   1.000 103.39395 ? 229 PHE A CE1 1 
ATOM 1863  C CE2 . PHE A 1 229 ? 47.72173  -24.87833 44.26754   1.000 90.92416  ? 229 PHE A CE2 1 
ATOM 1864  C CZ  . PHE A 1 229 ? 48.57813  -24.95761 45.34559   1.000 100.49114 ? 229 PHE A CZ  1 
ATOM 1865  N N   . ARG A 1 230 ? 43.07867  -25.98871 44.61924   1.000 87.23448  ? 230 ARG A N   1 
ATOM 1866  C CA  . ARG A 1 230 ? 42.58377  -24.62376 44.48485   1.000 87.03855  ? 230 ARG A CA  1 
ATOM 1867  C C   . ARG A 1 230 ? 41.52617  -24.30465 45.53193   1.000 90.80143  ? 230 ARG A C   1 
ATOM 1868  O O   . ARG A 1 230 ? 41.45554  -23.16677 46.00751   1.000 90.05792  ? 230 ARG A O   1 
ATOM 1869  C CB  . ARG A 1 230 ? 42.03907  -24.38898 43.07563   1.000 86.74481  ? 230 ARG A CB  1 
ATOM 1870  C CG  . ARG A 1 230 ? 43.10374  -24.49543 41.99522   1.000 87.87451  ? 230 ARG A CG  1 
ATOM 1871  C CD  . ARG A 1 230 ? 42.71867  -23.74563 40.73130   1.000 84.41132  ? 230 ARG A CD  1 
ATOM 1872  N NE  . ARG A 1 230 ? 41.50018  -24.26228 40.12212   1.000 89.69525  ? 230 ARG A NE  1 
ATOM 1873  C CZ  . ARG A 1 230 ? 40.98367  -23.80345 38.98730   1.000 92.79912  ? 230 ARG A CZ  1 
ATOM 1874  N NH1 . ARG A 1 230 ? 41.58104  -22.81455 38.33520   1.000 87.19692  ? 230 ARG A NH1 1 
ATOM 1875  N NH2 . ARG A 1 230 ? 39.86822  -24.33304 38.50447   1.000 102.90734 ? 230 ARG A NH2 1 
ATOM 1876  N N   . ALA A 1 231 ? 40.69966  -25.28489 45.90424   1.000 85.01566  ? 231 ALA A N   1 
ATOM 1877  C CA  . ALA A 1 231 ? 39.75123  -25.06831 46.99205   1.000 98.43459  ? 231 ALA A CA  1 
ATOM 1878  C C   . ALA A 1 231 ? 40.47422  -24.89670 48.32267   1.000 112.84786 ? 231 ALA A C   1 
ATOM 1879  O O   . ALA A 1 231 ? 40.03684  -24.11961 49.17943   1.000 116.60217 ? 231 ALA A O   1 
ATOM 1880  C CB  . ALA A 1 231 ? 38.75705  -26.22588 47.06324   1.000 104.82108 ? 231 ALA A CB  1 
ATOM 1881  N N   . TYR A 1 232 ? 41.58197  -25.61790 48.51160   1.000 115.55635 ? 232 TYR A N   1 
ATOM 1882  C CA  . TYR A 1 232 ? 42.38661  -25.46253 49.71920   1.000 104.62717 ? 232 TYR A CA  1 
ATOM 1883  C C   . TYR A 1 232 ? 43.05390  -24.09303 49.76492   1.000 82.46566  ? 232 TYR A C   1 
ATOM 1884  O O   . TYR A 1 232 ? 43.15782  -23.48045 50.83352   1.000 82.38852  ? 232 TYR A O   1 
ATOM 1885  C CB  . TYR A 1 232 ? 43.42093  -26.58763 49.78495   1.000 101.76684 ? 232 TYR A CB  1 
ATOM 1886  C CG  . TYR A 1 232 ? 44.61654  -26.32447 50.67162   1.000 90.66845  ? 232 TYR A CG  1 
ATOM 1887  C CD1 . TYR A 1 232 ? 44.48983  -26.28753 52.05384   1.000 86.05583  ? 232 TYR A CD1 1 
ATOM 1888  C CD2 . TYR A 1 232 ? 45.87993  -26.14177 50.12417   1.000 83.42145  ? 232 TYR A CD2 1 
ATOM 1889  C CE1 . TYR A 1 232 ? 45.58614  -26.05797 52.86542   1.000 85.73040  ? 232 TYR A CE1 1 
ATOM 1890  C CE2 . TYR A 1 232 ? 46.98080  -25.91262 50.92600   1.000 83.04504  ? 232 TYR A CE2 1 
ATOM 1891  C CZ  . TYR A 1 232 ? 46.82882  -25.87173 52.29584   1.000 84.22890  ? 232 TYR A CZ  1 
ATOM 1892  O OH  . TYR A 1 232 ? 47.92332  -25.64385 53.09864   1.000 84.00298  ? 232 TYR A OH  1 
ATOM 1893  N N   . VAL A 1 233 ? 43.52177  -23.60387 48.61623   1.000 84.10510  ? 233 VAL A N   1 
ATOM 1894  C CA  . VAL A 1 233 ? 44.15426  -22.28925 48.56737   1.000 82.03911  ? 233 VAL A CA  1 
ATOM 1895  C C   . VAL A 1 233 ? 43.11795  -21.18866 48.76872   1.000 81.62242  ? 233 VAL A C   1 
ATOM 1896  O O   . VAL A 1 233 ? 43.39414  -20.16823 49.41223   1.000 80.69060  ? 233 VAL A O   1 
ATOM 1897  C CB  . VAL A 1 233 ? 44.92193  -22.11758 47.24366   1.000 80.47120  ? 233 VAL A CB  1 
ATOM 1898  C CG1 . VAL A 1 233 ? 45.46892  -20.71383 47.12657   1.000 78.42638  ? 233 VAL A CG1 1 
ATOM 1899  C CG2 . VAL A 1 233 ? 46.05519  -23.12308 47.15578   1.000 80.81588  ? 233 VAL A CG2 1 
ATOM 1900  N N   . ASP A 1 234 ? 41.90959  -21.37839 48.22947   1.000 97.43600  ? 234 ASP A N   1 
ATOM 1901  C CA  . ASP A 1 234 ? 40.85656  -20.37791 48.38381   1.000 107.14120 ? 234 ASP A CA  1 
ATOM 1902  C C   . ASP A 1 234 ? 40.54891  -20.13560 49.85532   1.000 95.19710  ? 234 ASP A C   1 
ATOM 1903  O O   . ASP A 1 234 ? 40.52263  -18.98898 50.31674   1.000 99.84180  ? 234 ASP A O   1 
ATOM 1904  C CB  . ASP A 1 234 ? 39.59953  -20.81460 47.63047   1.000 123.01508 ? 234 ASP A CB  1 
ATOM 1905  C CG  . ASP A 1 234 ? 39.72715  -20.63471 46.13028   1.000 120.08515 ? 234 ASP A CG  1 
ATOM 1906  O OD1 . ASP A 1 234 ? 40.45921  -19.71791 45.70122   1.000 110.84723 ? 234 ASP A OD1 1 
ATOM 1907  O OD2 . ASP A 1 234 ? 39.09494  -21.40894 45.38068   1.000 117.84380 ? 234 ASP A OD2 1 
ATOM 1908  N N   . GLY A 1 235 ? 40.31781  -21.20533 50.60982   1.000 92.95487  ? 235 GLY A N   1 
ATOM 1909  C CA  . GLY A 1 235 ? 40.14013  -21.06601 52.03907   1.000 94.71888  ? 235 GLY A CA  1 
ATOM 1910  C C   . GLY A 1 235 ? 41.43753  -21.36081 52.75886   1.000 92.69809  ? 235 GLY A C   1 
ATOM 1911  O O   . GLY A 1 235 ? 41.77492  -22.52344 52.99972   1.000 104.86108 ? 235 GLY A O   1 
ATOM 1912  N N   . PHE A 1 236 ? 42.16383  -20.30893 53.12702   1.000 83.76699  ? 236 PHE A N   1 
ATOM 1913  C CA  . PHE A 1 236 ? 43.45299  -20.43935 53.78533   1.000 83.62168  ? 236 PHE A CA  1 
ATOM 1914  C C   . PHE A 1 236 ? 43.45199  -19.61802 55.06427   1.000 90.52925  ? 236 PHE A C   1 
ATOM 1915  O O   . PHE A 1 236 ? 42.83278  -18.55309 55.13792   1.000 86.86101  ? 236 PHE A O   1 
ATOM 1916  C CB  . PHE A 1 236 ? 44.59786  -19.98689 52.86606   1.000 81.63269  ? 236 PHE A CB  1 
ATOM 1917  C CG  . PHE A 1 236 ? 45.96217  -20.38527 53.35331   1.000 97.44820  ? 236 PHE A CG  1 
ATOM 1918  C CD1 . PHE A 1 236 ? 46.43570  -21.67176 53.15432   1.000 98.74748  ? 236 PHE A CD1 1 
ATOM 1919  C CD2 . PHE A 1 236 ? 46.77423  -19.47129 54.00479   1.000 103.27368 ? 236 PHE A CD2 1 
ATOM 1920  C CE1 . PHE A 1 236 ? 47.69217  -22.04031 53.60121   1.000 94.79251  ? 236 PHE A CE1 1 
ATOM 1921  C CE2 . PHE A 1 236 ? 48.03153  -19.83374 54.45329   1.000 92.51252  ? 236 PHE A CE2 1 
ATOM 1922  C CZ  . PHE A 1 236 ? 48.49026  -21.11978 54.25199   1.000 88.36809  ? 236 PHE A CZ  1 
ATOM 1923  N N   . GLU A 1 237 ? 44.15393  -20.12265 56.07061   1.000 91.09257  ? 237 GLU A N   1 
ATOM 1924  C CA  . GLU A 1 237 ? 44.16918  -19.50087 57.39360   1.000 122.05425 ? 237 GLU A CA  1 
ATOM 1925  C C   . GLU A 1 237 ? 45.59465  -19.17745 57.81250   1.000 114.49589 ? 237 GLU A C   1 
ATOM 1926  O O   . GLU A 1 237 ? 46.36694  -20.10181 58.13220   1.000 129.33122 ? 237 GLU A O   1 
ATOM 1927  C CB  . GLU A 1 237 ? 43.51410  -20.42138 58.42452   1.000 150.46368 ? 237 GLU A CB  1 
ATOM 1928  C CG  . GLU A 1 237 ? 42.37808  -21.27872 57.88072   1.000 160.03985 ? 237 GLU A CG  1 
ATOM 1929  C CD  . GLU A 1 237 ? 42.86197  -22.58839 57.28094   1.000 163.76152 ? 237 GLU A CD  1 
ATOM 1930  O OE1 . GLU A 1 237 ? 44.08619  -22.83879 57.29537   1.000 167.40049 ? 237 GLU A OE1 1 
ATOM 1931  O OE2 . GLU A 1 237 ? 42.01598  -23.36640 56.79272   1.000 161.05948 ? 237 GLU A OE2 1 
ATOM 1932  N N   . PRO A 1 238 ? 45.99955  -17.90634 57.82684   1.000 94.80807  ? 238 PRO A N   1 
ATOM 1933  C CA  . PRO A 1 238 ? 47.32513  -17.56694 58.36040   1.000 101.97638 ? 238 PRO A CA  1 
ATOM 1934  C C   . PRO A 1 238 ? 47.36121  -17.70564 59.87340   1.000 131.47678 ? 238 PRO A C   1 
ATOM 1935  O O   . PRO A 1 238 ? 47.37768  -16.70511 60.59723   1.000 152.83158 ? 238 PRO A O   1 
ATOM 1936  C CB  . PRO A 1 238 ? 47.52488  -16.10956 57.92036   1.000 88.08235  ? 238 PRO A CB  1 
ATOM 1937  C CG  . PRO A 1 238 ? 46.52023  -15.88776 56.82886   1.000 87.22004  ? 238 PRO A CG  1 
ATOM 1938  C CD  . PRO A 1 238 ? 45.35405  -16.75153 57.18393   1.000 89.02636  ? 238 PRO A CD  1 
ATOM 1939  N N   . ASN A 1 239 ? 47.37677  -18.94472 60.36005   1.000 149.18904 ? 239 ASN A N   1 
ATOM 1940  C CA  . ASN A 1 239 ? 47.34070  -19.21718 61.79075   1.000 149.35940 ? 239 ASN A CA  1 
ATOM 1941  C C   . ASN A 1 239 ? 48.71413  -19.12357 62.44260   1.000 152.48004 ? 239 ASN A C   1 
ATOM 1942  O O   . ASN A 1 239 ? 48.82468  -19.35103 63.65236   1.000 166.56998 ? 239 ASN A O   1 
ATOM 1943  C CB  . ASN A 1 239 ? 46.73966  -20.60549 62.03829   1.000 135.61840 ? 239 ASN A CB  1 
ATOM 1944  C CG  . ASN A 1 239 ? 46.11521  -20.74243 63.41880   1.000 124.10014 ? 239 ASN A CG  1 
ATOM 1945  O OD1 . ASN A 1 239 ? 45.17700  -21.51664 63.60889   1.000 118.31380 ? 239 ASN A OD1 1 
ATOM 1946  N ND2 . ASN A 1 239 ? 46.62864  -19.99047 64.38572   1.000 123.21269 ? 239 ASN A ND2 1 
ATOM 1947  N N   . GLY A 1 240 ? 49.75375  -18.79849 61.68076   1.000 127.88821 ? 240 GLY A N   1 
ATOM 1948  C CA  . GLY A 1 240 ? 51.08868  -18.69823 62.23258   1.000 112.40719 ? 240 GLY A CA  1 
ATOM 1949  C C   . GLY A 1 240 ? 51.93063  -19.91530 61.91908   1.000 115.24954 ? 240 GLY A C   1 
ATOM 1950  O O   . GLY A 1 240 ? 52.68952  -20.39248 62.76841   1.000 118.58740 ? 240 GLY A O   1 
ATOM 1951  N N   . TYR A 1 241 ? 51.79841  -20.43049 60.69400   1.000 121.51929 ? 241 TYR A N   1 
ATOM 1952  C CA  . TYR A 1 241 ? 52.58648  -21.58997 60.29064   1.000 113.60951 ? 241 TYR A CA  1 
ATOM 1953  C C   . TYR A 1 241 ? 54.06592  -21.24574 60.19153   1.000 112.50036 ? 241 TYR A C   1 
ATOM 1954  O O   . TYR A 1 241 ? 54.91857  -22.13103 60.32765   1.000 130.60184 ? 241 TYR A O   1 
ATOM 1955  C CB  . TYR A 1 241 ? 52.08820  -22.13038 58.94871   1.000 100.06543 ? 241 TYR A CB  1 
ATOM 1956  C CG  . TYR A 1 241 ? 50.62992  -22.54414 58.91699   1.000 103.37470 ? 241 TYR A CG  1 
ATOM 1957  C CD1 . TYR A 1 241 ? 49.91761  -22.77727 60.08729   1.000 118.57019 ? 241 TYR A CD1 1 
ATOM 1958  C CD2 . TYR A 1 241 ? 49.96354  -22.69086 57.70777   1.000 95.27799  ? 241 TYR A CD2 1 
ATOM 1959  C CE1 . TYR A 1 241 ? 48.58512  -23.15183 60.05028   1.000 117.59697 ? 241 TYR A CE1 1 
ATOM 1960  C CE2 . TYR A 1 241 ? 48.63516  -23.06441 57.66100   1.000 96.14852  ? 241 TYR A CE2 1 
ATOM 1961  C CZ  . TYR A 1 241 ? 47.95016  -23.29339 58.83363   1.000 103.68749 ? 241 TYR A CZ  1 
ATOM 1962  O OH  . TYR A 1 241 ? 46.62600  -23.66529 58.78737   1.000 109.71130 ? 241 TYR A OH  1 
ATOM 1963  N N   . ILE A 1 242 ? 54.38350  -19.97289 59.94076   1.000 89.01333  ? 242 ILE A N   1 
ATOM 1964  C CA  . ILE A 1 242 ? 55.77741  -19.54707 59.84306   1.000 103.00546 ? 242 ILE A CA  1 
ATOM 1965  C C   . ILE A 1 242 ? 56.50841  -19.81908 61.15177   1.000 132.59611 ? 242 ILE A C   1 
ATOM 1966  O O   . ILE A 1 242 ? 57.61605  -20.36842 61.16253   1.000 160.22163 ? 242 ILE A O   1 
ATOM 1967  C CB  . ILE A 1 242 ? 55.85695  -18.06251 59.44605   1.000 93.02080  ? 242 ILE A CB  1 
ATOM 1968  C CG1 . ILE A 1 242 ? 55.37228  -17.87359 58.00680   1.000 81.76539  ? 242 ILE A CG1 1 
ATOM 1969  C CG2 . ILE A 1 242 ? 57.27679  -17.53903 59.60787   1.000 81.79217  ? 242 ILE A CG2 1 
ATOM 1970  C CD1 . ILE A 1 242 ? 56.29669  -18.46766 56.96590   1.000 79.75701  ? 242 ILE A CD1 1 
ATOM 1971  N N   . GLU A 1 243 ? 55.89833  -19.43683 62.27697   1.000 114.20623 ? 243 GLU A N   1 
ATOM 1972  C CA  . GLU A 1 243 ? 56.55606  -19.62069 63.56644   1.000 111.37726 ? 243 GLU A CA  1 
ATOM 1973  C C   . GLU A 1 243 ? 56.70680  -21.09901 63.90055   1.000 113.15106 ? 243 GLU A C   1 
ATOM 1974  O O   . GLU A 1 243 ? 57.71392  -21.50770 64.48917   1.000 89.15852  ? 243 GLU A O   1 
ATOM 1975  C CB  . GLU A 1 243 ? 55.78261  -18.89231 64.66599   1.000 109.33580 ? 243 GLU A CB  1 
ATOM 1976  C CG  . GLU A 1 243 ? 56.60221  -18.61804 65.92084   1.000 113.42494 ? 243 GLU A CG  1 
ATOM 1977  C CD  . GLU A 1 243 ? 57.75927  -17.66572 65.67659   1.000 114.63907 ? 243 GLU A CD  1 
ATOM 1978  O OE1 . GLU A 1 243 ? 57.68251  -16.85463 64.73006   1.000 114.70644 ? 243 GLU A OE1 1 
ATOM 1979  O OE2 . GLU A 1 243 ? 58.75121  -17.73213 66.43360   1.000 116.26668 ? 243 GLU A OE2 1 
ATOM 1980  N N   . GLY A 1 244 ? 55.72796  -21.91872 63.51524   1.000 92.78325  ? 244 GLY A N   1 
ATOM 1981  C CA  . GLY A 1 244 ? 55.85312  -23.35132 63.73307   1.000 94.81309  ? 244 GLY A CA  1 
ATOM 1982  C C   . GLY A 1 244 ? 56.97990  -23.95965 62.91906   1.000 94.14940  ? 244 GLY A C   1 
ATOM 1983  O O   . GLY A 1 244 ? 57.78171  -24.74534 63.43348   1.000 95.74144  ? 244 GLY A O   1 
ATOM 1984  N N   . LYS A 1 245 ? 57.05244  -23.60802 61.63192   1.000 127.10882 ? 245 LYS A N   1 
ATOM 1985  C CA  . LYS A 1 245 ? 58.13357  -24.10812 60.78824   1.000 116.93332 ? 245 LYS A CA  1 
ATOM 1986  C C   . LYS A 1 245 ? 59.49318  -23.60257 61.25486   1.000 86.63540  ? 245 LYS A C   1 
ATOM 1987  O O   . LYS A 1 245 ? 60.50512  -24.28818 61.07069   1.000 87.04762  ? 245 LYS A O   1 
ATOM 1988  C CB  . LYS A 1 245 ? 57.89290  -23.71089 59.33142   1.000 97.66610  ? 245 LYS A CB  1 
ATOM 1989  C CG  . LYS A 1 245 ? 57.26915  -24.80359 58.47407   1.000 85.69796  ? 245 LYS A CG  1 
ATOM 1990  C CD  . LYS A 1 245 ? 55.90048  -25.21417 58.99205   1.000 86.45258  ? 245 LYS A CD  1 
ATOM 1991  C CE  . LYS A 1 245 ? 55.34336  -26.38875 58.20432   1.000 87.16558  ? 245 LYS A CE  1 
ATOM 1992  N NZ  . LYS A 1 245 ? 55.12472  -26.04578 56.77216   1.000 85.05936  ? 245 LYS A NZ  1 
ATOM 1993  N N   . LEU A 1 246 ? 59.54044  -22.41288 61.85934   1.000 86.55059  ? 246 LEU A N   1 
ATOM 1994  C CA  . LEU A 1 246 ? 60.79562  -21.92792 62.42457   1.000 86.63216  ? 246 LEU A CA  1 
ATOM 1995  C C   . LEU A 1 246 ? 61.17050  -22.71075 63.67556   1.000 97.90139  ? 246 LEU A C   1 
ATOM 1996  O O   . LEU A 1 246 ? 62.34310  -23.04829 63.87611   1.000 104.31087 ? 246 LEU A O   1 
ATOM 1997  C CB  . LEU A 1 246 ? 60.69527  -20.43507 62.73497   1.000 85.41824  ? 246 LEU A CB  1 
ATOM 1998  C CG  . LEU A 1 246 ? 60.69482  -19.48967 61.53303   1.000 82.64088  ? 246 LEU A CG  1 
ATOM 1999  C CD1 . LEU A 1 246 ? 60.47847  -18.05196 61.97964   1.000 81.80479  ? 246 LEU A CD1 1 
ATOM 2000  C CD2 . LEU A 1 246 ? 61.98947  -19.62456 60.75080   1.000 81.52855  ? 246 LEU A CD2 1 
ATOM 2001  N N   . SER A 1 247 ? 60.18867  -22.99867 64.53296   1.000 94.04390  ? 247 SER A N   1 
ATOM 2002  C CA  . SER A 1 247 ? 60.45100  -23.80307 65.72064   1.000 105.71644 ? 247 SER A CA  1 
ATOM 2003  C C   . SER A 1 247 ? 60.86846  -25.22100 65.35384   1.000 115.58753 ? 247 SER A C   1 
ATOM 2004  O O   . SER A 1 247 ? 61.59001  -25.87306 66.11739   1.000 128.32058 ? 247 SER A O   1 
ATOM 2005  C CB  . SER A 1 247 ? 59.21240  -23.82853 66.61710   1.000 95.13180  ? 247 SER A CB  1 
ATOM 2006  O OG  . SER A 1 247 ? 59.41918  -24.64519 67.75572   1.000 98.04682  ? 247 SER A OG  1 
ATOM 2007  N N   . GLN A 1 248 ? 60.42318  -25.71603 64.19602   1.000 119.87514 ? 248 GLN A N   1 
ATOM 2008  C CA  . GLN A 1 248 ? 60.79586  -27.05926 63.76430   1.000 107.69062 ? 248 GLN A CA  1 
ATOM 2009  C C   . GLN A 1 248 ? 62.16144  -27.10633 63.08902   1.000 100.44444 ? 248 GLN A C   1 
ATOM 2010  O O   . GLN A 1 248 ? 62.82867  -28.14600 63.12993   1.000 104.54037 ? 248 GLN A O   1 
ATOM 2011  C CB  . GLN A 1 248 ? 59.73952  -27.61254 62.80791   1.000 101.22762 ? 248 GLN A CB  1 
ATOM 2012  C CG  . GLN A 1 248 ? 58.55983  -28.27778 63.49047   1.000 109.85749 ? 248 GLN A CG  1 
ATOM 2013  C CD  . GLN A 1 248 ? 57.58273  -28.87343 62.49807   1.000 114.35214 ? 248 GLN A CD  1 
ATOM 2014  O OE1 . GLN A 1 248 ? 57.62338  -28.56170 61.30782   1.000 98.16976  ? 248 GLN A OE1 1 
ATOM 2015  N NE2 . GLN A 1 248 ? 56.69817  -29.73722 62.98259   1.000 134.00561 ? 248 GLN A NE2 1 
ATOM 2016  N N   . MET A 1 249 ? 62.59316  -26.01048 62.47138   1.000 96.60964  ? 249 MET A N   1 
ATOM 2017  C CA  . MET A 1 249 ? 63.83593  -26.02195 61.71265   1.000 89.78642  ? 249 MET A CA  1 
ATOM 2018  C C   . MET A 1 249 ? 65.04043  -26.07773 62.64619   1.000 91.22164  ? 249 MET A C   1 
ATOM 2019  O O   . MET A 1 249 ? 65.01284  -25.56014 63.76601   1.000 92.34211  ? 249 MET A O   1 
ATOM 2020  C CB  . MET A 1 249 ? 63.92221  -24.79467 60.80455   1.000 95.36996  ? 249 MET A CB  1 
ATOM 2021  C CG  . MET A 1 249 ? 65.08592  -24.83375 59.82497   1.000 86.70329  ? 249 MET A CG  1 
ATOM 2022  S SD  . MET A 1 249 ? 65.31434  -23.29326 58.92089   1.000 84.37179  ? 249 MET A SD  1 
ATOM 2023  C CE  . MET A 1 249 ? 63.78046  -23.21154 58.00472   1.000 81.05467  ? 249 MET A CE  1 
ATOM 2024  N N   . SER A 1 250 ? 66.10690  -26.71910 62.17196   1.000 93.37275  ? 250 SER A N   1 
ATOM 2025  C CA  . SER A 1 250 ? 67.32356  -26.81907 62.96339   1.000 94.75449  ? 250 SER A CA  1 
ATOM 2026  C C   . SER A 1 250 ? 67.92592  -25.43711 63.18382   1.000 93.35992  ? 250 SER A C   1 
ATOM 2027  O O   . SER A 1 250 ? 67.76481  -24.52391 62.36944   1.000 90.91569  ? 250 SER A O   1 
ATOM 2028  C CB  . SER A 1 250 ? 68.33950  -27.72779 62.26915   1.000 94.84127  ? 250 SER A CB  1 
ATOM 2029  O OG  . SER A 1 250 ? 67.84856  -29.05164 62.15267   1.000 96.44008  ? 250 SER A OG  1 
ATOM 2030  N N   . LYS A 1 251 ? 68.62914  -25.29046 64.30362   1.000 92.96026  ? 251 LYS A N   1 
ATOM 2031  C CA  . LYS A 1 251 ? 69.25262  -24.02204 64.65349   1.000 92.04849  ? 251 LYS A CA  1 
ATOM 2032  C C   . LYS A 1 251 ? 70.57040  -23.78909 63.92679   1.000 90.66975  ? 251 LYS A C   1 
ATOM 2033  O O   . LYS A 1 251 ? 71.15388  -22.70921 64.06732   1.000 89.72351  ? 251 LYS A O   1 
ATOM 2034  C CB  . LYS A 1 251 ? 69.46600  -23.94879 66.16854   1.000 94.61769  ? 251 LYS A CB  1 
ATOM 2035  C CG  . LYS A 1 251 ? 68.31087  -23.29676 66.92382   1.000 109.98945 ? 251 LYS A CG  1 
ATOM 2036  C CD  . LYS A 1 251 ? 67.02188  -24.09887 66.76932   1.000 95.62357  ? 251 LYS A CD  1 
ATOM 2037  C CE  . LYS A 1 251 ? 65.84437  -23.41994 67.44982   1.000 95.91520  ? 251 LYS A CE  1 
ATOM 2038  N NZ  . LYS A 1 251 ? 66.03960  -23.30212 68.92044   1.000 161.54278 ? 251 LYS A NZ  1 
ATOM 2039  N N   . GLU A 1 252 ? 71.05085  -24.77011 63.15924   1.000 95.64150  ? 252 GLU A N   1 
ATOM 2040  C CA  . GLU A 1 252 ? 72.27240  -24.57703 62.38640   1.000 94.26037  ? 252 GLU A CA  1 
ATOM 2041  C C   . GLU A 1 252 ? 72.04719  -23.64390 61.20456   1.000 91.20968  ? 252 GLU A C   1 
ATOM 2042  O O   . GLU A 1 252 ? 72.99171  -22.99653 60.73833   1.000 93.35139  ? 252 GLU A O   1 
ATOM 2043  C CB  . GLU A 1 252 ? 72.80831  -25.92300 61.89954   1.000 105.59630 ? 252 GLU A CB  1 
ATOM 2044  C CG  . GLU A 1 252 ? 73.35527  -26.81308 63.00090   1.000 125.46963 ? 252 GLU A CG  1 
ATOM 2045  C CD  . GLU A 1 252 ? 74.12531  -28.00023 62.45731   1.000 143.56487 ? 252 GLU A CD  1 
ATOM 2046  O OE1 . GLU A 1 252 ? 74.19511  -28.14753 61.21857   1.000 145.95906 ? 252 GLU A OE1 1 
ATOM 2047  O OE2 . GLU A 1 252 ? 74.66125  -28.78516 63.26801   1.000 153.18501 ? 252 GLU A OE2 1 
ATOM 2048  N N   . VAL A 1 253 ? 70.81318  -23.55916 60.71086   1.000 100.05495 ? 253 VAL A N   1 
ATOM 2049  C CA  . VAL A 1 253 ? 70.47797  -22.68997 59.58465   1.000 102.42516 ? 253 VAL A CA  1 
ATOM 2050  C C   . VAL A 1 253 ? 70.41454  -21.26134 60.11759   1.000 96.49821  ? 253 VAL A C   1 
ATOM 2051  O O   . VAL A 1 253 ? 69.40471  -20.84138 60.68377   1.000 86.59595  ? 253 VAL A O   1 
ATOM 2052  C CB  . VAL A 1 253 ? 69.16360  -23.10273 58.91884   1.000 84.98492  ? 253 VAL A CB  1 
ATOM 2053  C CG1 . VAL A 1 253 ? 68.86186  -22.20500 57.72685   1.000 82.27263  ? 253 VAL A CG1 1 
ATOM 2054  C CG2 . VAL A 1 253 ? 69.21182  -24.56588 58.50251   1.000 86.08168  ? 253 VAL A CG2 1 
ATOM 2055  N N   . ASN A 1 254 ? 71.50216  -20.51272 59.94703   1.000 95.23678  ? 254 ASN A N   1 
ATOM 2056  C CA  . ASN A 1 254 ? 71.56204  -19.14268 60.43122   1.000 93.26827  ? 254 ASN A CA  1 
ATOM 2057  C C   . ASN A 1 254 ? 72.59855  -18.36534 59.63285   1.000 92.36220  ? 254 ASN A C   1 
ATOM 2058  O O   . ASN A 1 254 ? 73.53550  -18.94160 59.07373   1.000 90.66070  ? 254 ASN A O   1 
ATOM 2059  C CB  . ASN A 1 254 ? 71.88111  -19.08903 61.93264   1.000 93.38014  ? 254 ASN A CB  1 
ATOM 2060  C CG  . ASN A 1 254 ? 73.12028  -19.88907 62.30483   1.000 95.12681  ? 254 ASN A CG  1 
ATOM 2061  O OD1 . ASN A 1 254 ? 73.92737  -20.25491 61.45119   1.000 99.87372  ? 254 ASN A OD1 1 
ATOM 2062  N ND2 . ASN A 1 254 ? 73.27781  -20.15533 63.59512   1.000 88.46334  ? 254 ASN A ND2 1 
ATOM 2063  N N   . ALA A 1 255 ? 72.40186  -17.05129 59.56970   1.000 82.06315  ? 255 ALA A N   1 
ATOM 2064  C CA  . ALA A 1 255 ? 73.39309  -16.14478 58.99800   1.000 80.53013  ? 255 ALA A CA  1 
ATOM 2065  C C   . ALA A 1 255 ? 74.19779  -15.50586 60.12966   1.000 81.82837  ? 255 ALA A C   1 
ATOM 2066  O O   . ALA A 1 255 ? 74.04580  -14.33111 60.46521   1.000 81.34693  ? 255 ALA A O   1 
ATOM 2067  C CB  . ALA A 1 255 ? 72.70987  -15.09961 58.12200   1.000 78.27288  ? 255 ALA A CB  1 
ATOM 2068  N N   . LYS A 1 256 ? 75.07058  -16.32065 60.72229   1.000 100.96220 ? 256 LYS A N   1 
ATOM 2069  C CA  . LYS A 1 256 ? 75.89374  -15.88294 61.84731   1.000 105.43551 ? 256 LYS A CA  1 
ATOM 2070  C C   . LYS A 1 256 ? 76.91508  -14.85497 61.37617   1.000 111.16604 ? 256 LYS A C   1 
ATOM 2071  O O   . LYS A 1 256 ? 77.80351  -15.16914 60.57713   1.000 126.22462 ? 256 LYS A O   1 
ATOM 2072  C CB  . LYS A 1 256 ? 76.58629  -17.07929 62.49311   1.000 94.60327  ? 256 LYS A CB  1 
ATOM 2073  C CG  . LYS A 1 256 ? 77.40616  -16.72272 63.72459   1.000 88.56341  ? 256 LYS A CG  1 
ATOM 2074  C CD  . LYS A 1 256 ? 78.06064  -17.95152 64.33352   1.000 96.04337  ? 256 LYS A CD  1 
ATOM 2075  C CE  . LYS A 1 256 ? 77.03479  -18.84558 65.00872   1.000 110.87175 ? 256 LYS A CE  1 
ATOM 2076  N NZ  . LYS A 1 256 ? 77.67721  -19.98775 65.71488   1.000 124.55597 ? 256 LYS A NZ  1 
ATOM 2077  N N   . ILE A 1 257 ? 76.78673  -13.62357 61.86658   1.000 86.09585  ? 257 ILE A N   1 
ATOM 2078  C CA  . ILE A 1 257 ? 77.68411  -12.54976 61.45733   1.000 83.10936  ? 257 ILE A CA  1 
ATOM 2079  C C   . ILE A 1 257 ? 79.04944  -12.77305 62.09773   1.000 84.76057  ? 257 ILE A C   1 
ATOM 2080  O O   . ILE A 1 257 ? 79.16942  -12.85579 63.32580   1.000 86.96637  ? 257 ILE A O   1 
ATOM 2081  C CB  . ILE A 1 257 ? 77.11169  -11.17752 61.84054   1.000 82.59810  ? 257 ILE A CB  1 
ATOM 2082  C CG1 . ILE A 1 257 ? 75.97787  -10.76620 60.89547   1.000 80.49120  ? 257 ILE A CG1 1 
ATOM 2083  C CG2 . ILE A 1 257 ? 78.20608  -10.12062 61.82744   1.000 82.20712  ? 257 ILE A CG2 1 
ATOM 2084  C CD1 . ILE A 1 257 ? 74.61004  -11.30825 61.27364   1.000 116.16529 ? 257 ILE A CD1 1 
ATOM 2085  N N   . GLU A 1 258 ? 80.08745  -12.87756 61.26755   1.000 93.95709  ? 258 GLU A N   1 
ATOM 2086  C CA  . GLU A 1 258 ? 81.45480  -12.94540 61.76454   1.000 79.28306  ? 258 GLU A CA  1 
ATOM 2087  C C   . GLU A 1 258 ? 82.10004  -11.57681 61.62293   1.000 78.33037  ? 258 GLU A C   1 
ATOM 2088  O O   . GLU A 1 258 ? 82.24451  -11.08778 60.49092   1.000 76.15795  ? 258 GLU A O   1 
ATOM 2089  C CB  . GLU A 1 258 ? 82.26764  -14.00863 61.03094   1.000 99.15169  ? 258 GLU A CB  1 
ATOM 2090  C CG  . GLU A 1 258 ? 82.01636  -14.12873 59.54152   1.000 97.37054  ? 258 GLU A CG  1 
ATOM 2091  C CD  . GLU A 1 258 ? 82.84287  -15.23724 58.91528   1.000 85.86337  ? 258 GLU A CD  1 
ATOM 2092  O OE1 . GLU A 1 258 ? 83.24462  -16.16450 59.65024   1.000 80.92594  ? 258 GLU A OE1 1 
ATOM 2093  O OE2 . GLU A 1 258 ? 83.09423  -15.18228 57.69324   1.000 75.64513  ? 258 GLU A OE2 1 
ATOM 2094  N N   . PRO A 1 259 ? 82.47324  -10.91814 62.72160   1.000 79.94634  ? 259 PRO A N   1 
ATOM 2095  C CA  . PRO A 1 259 ? 82.96195  -9.53618  62.63546   1.000 79.13738  ? 259 PRO A CA  1 
ATOM 2096  C C   . PRO A 1 259 ? 84.19361  -9.40112  61.75060   1.000 78.06826  ? 259 PRO A C   1 
ATOM 2097  O O   . PRO A 1 259 ? 84.92187  -10.36030 61.48500   1.000 78.51908  ? 259 PRO A O   1 
ATOM 2098  C CB  . PRO A 1 259 ? 83.28479  -9.18209  64.09313   1.000 81.67050  ? 259 PRO A CB  1 
ATOM 2099  C CG  . PRO A 1 259 ? 82.45317  -10.12000 64.90225   1.000 83.34053  ? 259 PRO A CG  1 
ATOM 2100  C CD  . PRO A 1 259 ? 82.40717  -11.39383 64.11297   1.000 82.71762  ? 259 PRO A CD  1 
ATOM 2101  N N   . PHE A 1 260 ? 84.41463  -8.16828  61.29272   1.000 101.40659 ? 260 PHE A N   1 
ATOM 2102  C CA  . PHE A 1 260 ? 85.44389  -7.82894  60.30960   1.000 88.17521  ? 260 PHE A CA  1 
ATOM 2103  C C   . PHE A 1 260 ? 86.26303  -6.66025  60.85740   1.000 97.37453  ? 260 PHE A C   1 
ATOM 2104  O O   . PHE A 1 260 ? 85.89096  -5.49690  60.68672   1.000 101.25682 ? 260 PHE A O   1 
ATOM 2105  C CB  . PHE A 1 260 ? 84.78098  -7.50236  58.96268   1.000 75.90518  ? 260 PHE A CB  1 
ATOM 2106  C CG  . PHE A 1 260 ? 85.72682  -7.46247  57.78675   1.000 74.42201  ? 260 PHE A CG  1 
ATOM 2107  C CD1 . PHE A 1 260 ? 87.08105  -7.24109  57.95160   1.000 77.30787  ? 260 PHE A CD1 1 
ATOM 2108  C CD2 . PHE A 1 260 ? 85.24800  -7.67220  56.50651   1.000 76.04477  ? 260 PHE A CD2 1 
ATOM 2109  C CE1 . PHE A 1 260 ? 87.92666  -7.20686  56.86549   1.000 77.27226  ? 260 PHE A CE1 1 
ATOM 2110  C CE2 . PHE A 1 260 ? 86.09451  -7.64300  55.41520   1.000 71.03031  ? 260 PHE A CE2 1 
ATOM 2111  C CZ  . PHE A 1 260 ? 87.43525  -7.41052  55.59600   1.000 71.76532  ? 260 PHE A CZ  1 
ATOM 2112  N N   . LEU A 1 261 ? 87.37893  -6.97418  61.50911   1.000 85.48943  ? 261 LEU A N   1 
ATOM 2113  C CA  . LEU A 1 261 ? 88.34103  -5.97783  61.95718   1.000 86.35141  ? 261 LEU A CA  1 
ATOM 2114  C C   . LEU A 1 261 ? 89.58348  -6.04950  61.07548   1.000 95.52254  ? 261 LEU A C   1 
ATOM 2115  O O   . LEU A 1 261 ? 89.72514  -6.94175  60.23705   1.000 102.57842 ? 261 LEU A O   1 
ATOM 2116  C CB  . LEU A 1 261 ? 88.70391  -6.19108  63.43392   1.000 89.34446  ? 261 LEU A CB  1 
ATOM 2117  C CG  . LEU A 1 261 ? 89.31391  -5.00452  64.18999   1.000 105.14142 ? 261 LEU A CG  1 
ATOM 2118  C CD1 . LEU A 1 261 ? 88.32611  -3.84883  64.26831   1.000 111.08207 ? 261 LEU A CD1 1 
ATOM 2119  C CD2 . LEU A 1 261 ? 89.78922  -5.41123  65.57348   1.000 98.50227  ? 261 LEU A CD2 1 
ATOM 2120  N N   . LYS A 1 262 ? 90.49610  -5.09525  61.27685   1.000 89.36163  ? 262 LYS A N   1 
ATOM 2121  C CA  . LYS A 1 262 ? 91.67383  -4.95718  60.42467   1.000 88.52268  ? 262 LYS A CA  1 
ATOM 2122  C C   . LYS A 1 262 ? 92.65324  -6.11980  60.54530   1.000 89.82428  ? 262 LYS A C   1 
ATOM 2123  O O   . LYS A 1 262 ? 93.67132  -6.11459  59.84511   1.000 89.23263  ? 262 LYS A O   1 
ATOM 2124  C CB  . LYS A 1 262 ? 92.39360  -3.64512  60.74292   1.000 89.07683  ? 262 LYS A CB  1 
ATOM 2125  C CG  . LYS A 1 262 ? 92.89222  -3.53988  62.17532   1.000 91.97555  ? 262 LYS A CG  1 
ATOM 2126  C CD  . LYS A 1 262 ? 93.57434  -2.20381  62.42295   1.000 92.49732  ? 262 LYS A CD  1 
ATOM 2127  C CE  . LYS A 1 262 ? 94.09121  -2.10133  63.84898   1.000 105.91083 ? 262 LYS A CE  1 
ATOM 2128  N NZ  . LYS A 1 262 ? 94.78904  -0.80890  64.09727   1.000 113.32346 ? 262 LYS A NZ  1 
ATOM 2129  N N   . THR A 1 263 ? 92.38544  -7.10336  61.40288   1.000 105.01729 ? 263 THR A N   1 
ATOM 2130  C CA  . THR A 1 263 ? 93.24420  -8.27587  61.51486   1.000 99.38910  ? 263 THR A CA  1 
ATOM 2131  C C   . THR A 1 263 ? 92.80716  -9.40899  60.59805   1.000 91.23099  ? 263 THR A C   1 
ATOM 2132  O O   . THR A 1 263 ? 93.64670  -10.20736 60.16499   1.000 89.46631  ? 263 THR A O   1 
ATOM 2133  C CB  . THR A 1 263 ? 93.27624  -8.77700  62.96149   1.000 98.85184  ? 263 THR A CB  1 
ATOM 2134  O OG1 . THR A 1 263 ? 91.94063  -9.04196  63.40896   1.000 107.07424 ? 263 THR A OG1 1 
ATOM 2135  C CG2 . THR A 1 263 ? 93.91767  -7.74052  63.87102   1.000 95.34110  ? 263 THR A CG2 1 
ATOM 2136  N N   . THR A 1 264 ? 91.51399  -9.49379  60.29587   1.000 120.22788 ? 264 THR A N   1 
ATOM 2137  C CA  . THR A 1 264 ? 90.94872  -10.56038 59.47757   1.000 103.49804 ? 264 THR A CA  1 
ATOM 2138  C C   . THR A 1 264 ? 91.36148  -10.52194 58.00417   1.000 99.23331  ? 264 THR A C   1 
ATOM 2139  O O   . THR A 1 264 ? 91.48200  -11.59375 57.39695   1.000 106.91266 ? 264 THR A O   1 
ATOM 2140  C CB  . THR A 1 264 ? 89.42162  -10.53860 59.58083   1.000 88.69728  ? 264 THR A CB  1 
ATOM 2141  O OG1 . THR A 1 264 ? 88.94596  -9.20198  59.38743   1.000 90.75317  ? 264 THR A OG1 1 
ATOM 2142  C CG2 . THR A 1 264 ? 88.97203  -11.04052 60.94544   1.000 86.93947  ? 264 THR A CG2 1 
ATOM 2143  N N   . PRO A 1 265 ? 91.57252  -9.33932  57.36093   1.000 97.66846  ? 265 PRO A N   1 
ATOM 2144  C CA  . PRO A 1 265 ? 91.96412  -9.37253  55.94335   1.000 103.49789 ? 265 PRO A CA  1 
ATOM 2145  C C   . PRO A 1 265 ? 93.32728  -10.00947 55.74235   1.000 135.00325 ? 265 PRO A C   1 
ATOM 2146  O O   . PRO A 1 265 ? 94.34505  -9.46133  56.17557   1.000 145.51927 ? 265 PRO A O   1 
ATOM 2147  C CB  . PRO A 1 265 ? 91.98794  -7.89345  55.53377   1.000 90.04532  ? 265 PRO A CB  1 
ATOM 2148  C CG  . PRO A 1 265 ? 91.22275  -7.19057  56.55032   1.000 98.05579  ? 265 PRO A CG  1 
ATOM 2149  C CD  . PRO A 1 265 ? 91.38761  -7.95125  57.81878   1.000 94.79542  ? 265 PRO A CD  1 
ATOM 2150  N N   . ARG A 1 266 ? 93.36032  -11.15672 55.08819   1.000 131.91945 ? 266 ARG A N   1 
ATOM 2151  C CA  . ARG A 1 266 ? 94.64433  -11.74116 54.75570   1.000 109.74580 ? 266 ARG A CA  1 
ATOM 2152  C C   . ARG A 1 266 ? 94.92630  -11.57000 53.26850   1.000 83.86128  ? 266 ARG A C   1 
ATOM 2153  O O   . ARG A 1 266 ? 94.00264  -11.66400 52.45279   1.000 81.80977  ? 266 ARG A O   1 
ATOM 2154  C CB  . ARG A 1 266 ? 94.69392  -13.22671 55.13229   1.000 120.25531 ? 266 ARG A CB  1 
ATOM 2155  C CG  . ARG A 1 266 ? 94.58089  -13.45008 56.63359   1.000 146.71390 ? 266 ARG A CG  1 
ATOM 2156  C CD  . ARG A 1 266 ? 94.74671  -14.90601 57.02704   1.000 170.44110 ? 266 ARG A CD  1 
ATOM 2157  N NE  . ARG A 1 266 ? 94.66233  -15.07211 58.47598   1.000 179.99949 ? 266 ARG A NE  1 
ATOM 2158  C CZ  . ARG A 1 266 ? 94.76546  -16.23794 59.10526   1.000 177.13989 ? 266 ARG A CZ  1 
ATOM 2159  N NH1 . ARG A 1 266 ? 94.67575  -16.28948 60.42737   1.000 173.19916 ? 266 ARG A NH1 1 
ATOM 2160  N NH2 . ARG A 1 266 ? 94.96554  -17.35151 58.41445   1.000 176.83250 ? 266 ARG A NH2 1 
ATOM 2161  N N   . PRO A 1 267 ? 96.17684  -11.29930 52.88984   1.000 76.91264  ? 267 PRO A N   1 
ATOM 2162  C CA  . PRO A 1 267 ? 96.47165  -10.99953 51.48353   1.000 74.77436  ? 267 PRO A CA  1 
ATOM 2163  C C   . PRO A 1 267 ? 96.07898  -12.14406 50.56115   1.000 77.88039  ? 267 PRO A C   1 
ATOM 2164  O O   . PRO A 1 267 ? 96.07322  -13.31509 50.94770   1.000 76.92162  ? 267 PRO A O   1 
ATOM 2165  C CB  . PRO A 1 267 ? 97.98793  -10.76636 51.47837   1.000 75.53027  ? 267 PRO A CB  1 
ATOM 2166  C CG  . PRO A 1 267 ? 98.48618  -11.43726 52.71991   1.000 78.11360  ? 267 PRO A CG  1 
ATOM 2167  C CD  . PRO A 1 267 ? 97.38867  -11.27547 53.72546   1.000 78.94504  ? 267 PRO A CD  1 
ATOM 2168  N N   . ILE A 1 268 ? 95.74417  -11.78093 49.32294   1.000 65.54772  ? 268 ILE A N   1 
ATOM 2169  C CA  . ILE A 1 268 ? 95.22072  -12.74270 48.36137   1.000 64.50206  ? 268 ILE A CA  1 
ATOM 2170  C C   . ILE A 1 268 ? 96.30507  -13.74204 47.98463   1.000 65.11229  ? 268 ILE A C   1 
ATOM 2171  O O   . ILE A 1 268 ? 97.44479  -13.36536 47.68142   1.000 65.05140  ? 268 ILE A O   1 
ATOM 2172  C CB  . ILE A 1 268 ? 94.68053  -12.01663 47.12075   1.000 62.19400  ? 268 ILE A CB  1 
ATOM 2173  C CG1 . ILE A 1 268 ? 93.58271  -11.02739 47.51775   1.000 61.68526  ? 268 ILE A CG1 1 
ATOM 2174  C CG2 . ILE A 1 268 ? 94.15481  -13.01640 46.10524   1.000 83.88764  ? 268 ILE A CG2 1 
ATOM 2175  C CD1 . ILE A 1 268 ? 93.03605  -10.22078 46.36109   1.000 59.58780  ? 268 ILE A CD1 1 
ATOM 2176  N N   . ARG A 1 269 ? 95.95227  -15.02373 48.00231   1.000 68.96913  ? 269 ARG A N   1 
ATOM 2177  C CA  . ARG A 1 269 ? 96.87392  -16.06820 47.58555   1.000 69.54832  ? 269 ARG A CA  1 
ATOM 2178  C C   . ARG A 1 269 ? 97.12561  -15.98971 46.08344   1.000 67.60409  ? 269 ARG A C   1 
ATOM 2179  O O   . ARG A 1 269 ? 96.24305  -15.63337 45.29860   1.000 65.95210  ? 269 ARG A O   1 
ATOM 2180  C CB  . ARG A 1 269 ? 96.31844  -17.44475 47.94659   1.000 93.52853  ? 269 ARG A CB  1 
ATOM 2181  C CG  . ARG A 1 269 ? 96.02558  -17.64068 49.42350   1.000 106.56988 ? 269 ARG A CG  1 
ATOM 2182  C CD  . ARG A 1 269 ? 95.19181  -18.89114 49.63959   1.000 130.17168 ? 269 ARG A CD  1 
ATOM 2183  N NE  . ARG A 1 269 ? 95.82663  -20.07031 49.05985   1.000 156.76618 ? 269 ARG A NE  1 
ATOM 2184  C CZ  . ARG A 1 269 ? 95.23892  -21.25704 48.95216   1.000 168.35737 ? 269 ARG A CZ  1 
ATOM 2185  N NH1 . ARG A 1 269 ? 93.99773  -21.42477 49.38654   1.000 167.31863 ? 269 ARG A NH1 1 
ATOM 2186  N NH2 . ARG A 1 269 ? 95.89084  -22.27622 48.40830   1.000 174.92041 ? 269 ARG A NH2 1 
ATOM 2187  N N   . LEU A 1 270 ? 98.35131  -16.32225 45.68542   1.000 66.04652  ? 270 LEU A N   1 
ATOM 2188  C CA  . LEU A 1 270 ? 98.75019  -16.23781 44.29158   1.000 64.39087  ? 270 LEU A CA  1 
ATOM 2189  C C   . LEU A 1 270 ? 99.28463  -17.58730 43.83104   1.000 64.99421  ? 270 LEU A C   1 
ATOM 2190  O O   . LEU A 1 270 ? 99.98236  -18.27132 44.58916   1.000 75.49072  ? 270 LEU A O   1 
ATOM 2191  C CB  . LEU A 1 270 ? 99.81647  -15.14903 44.09372   1.000 82.45762  ? 270 LEU A CB  1 
ATOM 2192  C CG  . LEU A 1 270 ? 99.90058  -14.48606 42.71716   1.000 79.84435  ? 270 LEU A CG  1 
ATOM 2193  C CD1 . LEU A 1 270 ? 98.69345  -13.59100 42.48247   1.000 60.54412  ? 270 LEU A CD1 1 
ATOM 2194  C CD2 . LEU A 1 270 ? 101.19041 -13.69169 42.58066   1.000 79.86819  ? 270 LEU A CD2 1 
ATOM 2195  N N   . PRO A 1 271 ? 98.97141  -17.99944 42.60414   1.000 62.28977  ? 271 PRO A N   1 
ATOM 2196  C CA  . PRO A 1 271 ? 99.43449  -19.30638 42.12417   1.000 62.88779  ? 271 PRO A CA  1 
ATOM 2197  C C   . PRO A 1 271 ? 100.94416 -19.35339 41.94960   1.000 63.41408  ? 271 PRO A C   1 
ATOM 2198  O O   . PRO A 1 271 ? 101.59779 -18.34323 41.67835   1.000 62.66492  ? 271 PRO A O   1 
ATOM 2199  C CB  . PRO A 1 271 ? 98.72003  -19.46607 40.77566   1.000 61.13163  ? 271 PRO A CB  1 
ATOM 2200  C CG  . PRO A 1 271 ? 97.57672  -18.50856 40.82709   1.000 60.01388  ? 271 PRO A CG  1 
ATOM 2201  C CD  . PRO A 1 271 ? 98.05243  -17.35757 41.65098   1.000 60.31561  ? 271 PRO A CD  1 
ATOM 2202  N N   . ASP A 1 272 ? 101.49491 -20.55411 42.11967   1.000 66.37377  ? 272 ASP A N   1 
ATOM 2203  C CA  . ASP A 1 272 ? 102.91257 -20.81894 41.91962   1.000 71.16626  ? 272 ASP A CA  1 
ATOM 2204  C C   . ASP A 1 272 ? 103.08083 -21.88144 40.84326   1.000 66.77280  ? 272 ASP A C   1 
ATOM 2205  O O   . ASP A 1 272 ? 102.30968 -22.84434 40.78259   1.000 67.03547  ? 272 ASP A O   1 
ATOM 2206  C CB  . ASP A 1 272 ? 103.58773 -21.28306 43.21652   1.000 82.33161  ? 272 ASP A CB  1 
ATOM 2207  C CG  . ASP A 1 272 ? 104.02030 -20.12732 44.09602   1.000 101.80343 ? 272 ASP A CG  1 
ATOM 2208  O OD1 . ASP A 1 272 ? 104.35267 -19.05426 43.54930   1.000 109.22639 ? 272 ASP A OD1 1 
ATOM 2209  O OD2 . ASP A 1 272 ? 104.02928 -20.29358 45.33425   1.000 107.61644 ? 272 ASP A OD2 1 
ATOM 2210  N N   . GLY A 1 273 ? 104.08984 -21.70205 39.99492   1.000 82.16047  ? 273 GLY A N   1 
ATOM 2211  C CA  . GLY A 1 273 ? 104.35528 -22.63276 38.92464   1.000 87.36501  ? 273 GLY A CA  1 
ATOM 2212  C C   . GLY A 1 273 ? 105.24584 -22.04258 37.85060   1.000 84.68319  ? 273 GLY A C   1 
ATOM 2213  O O   . GLY A 1 273 ? 106.12810 -21.22321 38.12266   1.000 102.28884 ? 273 GLY A O   1 
ATOM 2214  N N   . PRO A 1 274 ? 105.03302 -22.45725 36.59973   1.000 83.65218  ? 274 PRO A N   1 
ATOM 2215  C CA  . PRO A 1 274 ? 105.82586 -21.90442 35.50622   1.000 80.38174  ? 274 PRO A CA  1 
ATOM 2216  C C   . PRO A 1 274 ? 105.50236 -20.43156 35.29680   1.000 73.79126  ? 274 PRO A C   1 
ATOM 2217  O O   . PRO A 1 274 ? 104.37365 -19.98972 35.56205   1.000 74.10264  ? 274 PRO A O   1 
ATOM 2218  C CB  . PRO A 1 274 ? 105.40002 -22.75086 34.29390   1.000 94.68653  ? 274 PRO A CB  1 
ATOM 2219  C CG  . PRO A 1 274 ? 104.04554 -23.25772 34.64841   1.000 95.07909  ? 274 PRO A CG  1 
ATOM 2220  C CD  . PRO A 1 274 ? 104.08112 -23.48039 36.13274   1.000 86.82393  ? 274 PRO A CD  1 
ATOM 2221  N N   . PRO A 1 275 ? 106.47111 -19.64084 34.83850   1.000 78.83931  ? 275 PRO A N   1 
ATOM 2222  C CA  . PRO A 1 275 ? 106.20287 -18.21701 34.60197   1.000 82.18992  ? 275 PRO A CA  1 
ATOM 2223  C C   . PRO A 1 275 ? 105.12660 -18.02297 33.54584   1.000 63.11715  ? 275 PRO A C   1 
ATOM 2224  O O   . PRO A 1 275 ? 105.02026 -18.78514 32.58138   1.000 64.79145  ? 275 PRO A O   1 
ATOM 2225  C CB  . PRO A 1 275 ? 107.55564 -17.67426 34.12483   1.000 107.90275 ? 275 PRO A CB  1 
ATOM 2226  C CG  . PRO A 1 275 ? 108.55945 -18.65352 34.62729   1.000 113.64655 ? 275 PRO A CG  1 
ATOM 2227  C CD  . PRO A 1 275 ? 107.87678 -19.98654 34.58126   1.000 100.35376 ? 275 PRO A CD  1 
ATOM 2228  N N   . CYS A 1 276 ? 104.32037 -16.98415 33.74230   1.000 59.99096  ? 276 CYS A N   1 
ATOM 2229  C CA  . CYS A 1 276 ? 103.24166 -16.67766 32.81481   1.000 65.18795  ? 276 CYS A CA  1 
ATOM 2230  C C   . CYS A 1 276 ? 103.80214 -16.05011 31.54513   1.000 70.75622  ? 276 CYS A C   1 
ATOM 2231  O O   . CYS A 1 276 ? 104.63359 -15.13896 31.60295   1.000 73.43369  ? 276 CYS A O   1 
ATOM 2232  C CB  . CYS A 1 276 ? 102.22258 -15.74525 33.46995   1.000 62.80059  ? 276 CYS A CB  1 
ATOM 2233  S SG  . CYS A 1 276 ? 102.90362 -14.18476 34.08156   1.000 80.61999  ? 276 CYS A SG  1 
ATOM 2234  N N   . PHE A 1 277 ? 103.34450 -16.54629 30.39953   1.000 67.49412  ? 277 PHE A N   1 
ATOM 2235  C CA  . PHE A 1 277 ? 103.75546 -16.04429 29.09995   1.000 57.06755  ? 277 PHE A CA  1 
ATOM 2236  C C   . PHE A 1 277 ? 102.86177 -14.87965 28.67928   1.000 54.49777  ? 277 PHE A C   1 
ATOM 2237  O O   . PHE A 1 277 ? 101.95207 -14.46747 29.40145   1.000 59.10375  ? 277 PHE A O   1 
ATOM 2238  C CB  . PHE A 1 277 ? 103.71655 -17.16845 28.06471   1.000 71.39600  ? 277 PHE A CB  1 
ATOM 2239  C CG  . PHE A 1 277 ? 102.34432 -17.75946 27.85536   1.000 96.91839  ? 277 PHE A CG  1 
ATOM 2240  C CD1 . PHE A 1 277 ? 101.79367 -18.62704 28.78732   1.000 99.53352  ? 277 PHE A CD1 1 
ATOM 2241  C CD2 . PHE A 1 277 ? 101.60723 -17.44800 26.72411   1.000 125.24645 ? 277 PHE A CD2 1 
ATOM 2242  C CE1 . PHE A 1 277 ? 100.53629 -19.16861 28.59684   1.000 115.11688 ? 277 PHE A CE1 1 
ATOM 2243  C CE2 . PHE A 1 277 ? 100.34809 -17.98842 26.52793   1.000 141.41454 ? 277 PHE A CE2 1 
ATOM 2244  C CZ  . PHE A 1 277 ? 99.81309  -18.84979 27.46638   1.000 135.80944 ? 277 PHE A CZ  1 
ATOM 2245  N N   . GLN A 1 278 ? 103.11722 -14.34159 27.49061   1.000 53.12036  ? 278 GLN A N   1 
ATOM 2246  C CA  . GLN A 1 278 ? 102.32863 -13.24681 26.94300   1.000 52.02867  ? 278 GLN A CA  1 
ATOM 2247  C C   . GLN A 1 278 ? 101.48305 -13.76516 25.78997   1.000 51.38408  ? 278 GLN A C   1 
ATOM 2248  O O   . GLN A 1 278 ? 102.00901 -14.37871 24.85560   1.000 51.34440  ? 278 GLN A O   1 
ATOM 2249  C CB  . GLN A 1 278 ? 103.22081 -12.09827 26.46889   1.000 51.56408  ? 278 GLN A CB  1 
ATOM 2250  C CG  . GLN A 1 278 ? 102.44894 -10.82351 26.15979   1.000 50.66579  ? 278 GLN A CG  1 
ATOM 2251  C CD  . GLN A 1 278 ? 103.28933 -9.78309  25.44812   1.000 107.35213 ? 278 GLN A CD  1 
ATOM 2252  O OE1 . GLN A 1 278 ? 104.28080 -10.10867 24.79564   1.000 116.13873 ? 278 GLN A OE1 1 
ATOM 2253  N NE2 . GLN A 1 278 ? 102.89614 -8.52073  25.57137   1.000 99.34495  ? 278 GLN A NE2 1 
ATOM 2254  N N   . ARG A 1 279 ? 100.17598 -13.51405 25.85661   1.000 71.37052  ? 279 ARG A N   1 
ATOM 2255  C CA  . ARG A 1 279 ? 99.25482  -13.92987 24.80713   1.000 92.37724  ? 279 ARG A CA  1 
ATOM 2256  C C   . ARG A 1 279 ? 98.55441  -12.75454 24.13739   1.000 82.11321  ? 279 ARG A C   1 
ATOM 2257  O O   . ARG A 1 279 ? 97.55697  -12.96239 23.43597   1.000 87.47606  ? 279 ARG A O   1 
ATOM 2258  C CB  . ARG A 1 279 ? 98.22502  -14.91911 25.36862   1.000 105.17124 ? 279 ARG A CB  1 
ATOM 2259  C CG  . ARG A 1 279 ? 97.42580  -14.41392 26.56897   1.000 90.64883  ? 279 ARG A CG  1 
ATOM 2260  C CD  . ARG A 1 279 ? 96.12417  -13.74405 26.15695   1.000 79.43601  ? 279 ARG A CD  1 
ATOM 2261  N NE  . ARG A 1 279 ? 95.12320  -13.78497 27.21693   1.000 58.31545  ? 279 ARG A NE  1 
ATOM 2262  C CZ  . ARG A 1 279 ? 94.14907  -14.68532 27.28211   1.000 72.78559  ? 279 ARG A CZ  1 
ATOM 2263  N NH1 . ARG A 1 279 ? 93.27757  -14.65219 28.27998   1.000 83.07770  ? 279 ARG A NH1 1 
ATOM 2264  N NH2 . ARG A 1 279 ? 94.04621  -15.61881 26.34563   1.000 80.27599  ? 279 ARG A NH2 1 
ATOM 2265  N N   . SER A 1 280 ? 99.04497  -11.53154 24.33398   1.000 69.03833  ? 280 SER A N   1 
ATOM 2266  C CA  . SER A 1 280 ? 98.47881  -10.38181 23.64147   1.000 60.37277  ? 280 SER A CA  1 
ATOM 2267  C C   . SER A 1 280 ? 98.58431  -10.57128 22.13378   1.000 80.32648  ? 280 SER A C   1 
ATOM 2268  O O   . SER A 1 280 ? 99.56393  -11.12592 21.62807   1.000 98.47505  ? 280 SER A O   1 
ATOM 2269  C CB  . SER A 1 280 ? 99.19281  -9.09725  24.06494   1.000 51.76661  ? 280 SER A CB  1 
ATOM 2270  O OG  . SER A 1 280 ? 100.58582 -9.18241  23.82227   1.000 65.00315  ? 280 SER A OG  1 
ATOM 2271  N N   . LYS A 1 281 ? 97.55884  -10.11039 21.41456   1.000 71.24435  ? 281 LYS A N   1 
ATOM 2272  C CA  . LYS A 1 281 ? 97.48645  -10.35089 19.97739   1.000 62.90178  ? 281 LYS A CA  1 
ATOM 2273  C C   . LYS A 1 281 ? 98.65474  -9.73028  19.22164   1.000 67.77479  ? 281 LYS A C   1 
ATOM 2274  O O   . LYS A 1 281 ? 98.98274  -10.19472 18.12379   1.000 62.88222  ? 281 LYS A O   1 
ATOM 2275  C CB  . LYS A 1 281 ? 96.15994  -9.83034  19.42246   1.000 50.36529  ? 281 LYS A CB  1 
ATOM 2276  C CG  . LYS A 1 281 ? 94.93441  -10.46286 20.06681   1.000 51.50162  ? 281 LYS A CG  1 
ATOM 2277  C CD  . LYS A 1 281 ? 94.92827  -11.97413 19.88204   1.000 59.18446  ? 281 LYS A CD  1 
ATOM 2278  C CE  . LYS A 1 281 ? 93.70733  -12.60834 20.53075   1.000 78.37388  ? 281 LYS A CE  1 
ATOM 2279  N NZ  . LYS A 1 281 ? 93.75051  -14.09574 20.46335   1.000 96.42277  ? 281 LYS A NZ  1 
ATOM 2280  N N   . PHE A 1 282 ? 99.28983  -8.70090  19.77825   1.000 64.30558  ? 282 PHE A N   1 
ATOM 2281  C CA  . PHE A 1 282 ? 100.43133 -8.07032  19.13256   1.000 63.91630  ? 282 PHE A CA  1 
ATOM 2282  C C   . PHE A 1 282 ? 101.36823 -7.51536  20.19579   1.000 55.03312  ? 282 PHE A C   1 
ATOM 2283  O O   . PHE A 1 282 ? 100.98962 -7.33746  21.35674   1.000 50.67575  ? 282 PHE A O   1 
ATOM 2284  C CB  . PHE A 1 282 ? 100.00267 -6.96011  18.15806   1.000 64.32810  ? 282 PHE A CB  1 
ATOM 2285  C CG  . PHE A 1 282 ? 99.02027  -5.97375  18.73676   1.000 61.75159  ? 282 PHE A CG  1 
ATOM 2286  C CD1 . PHE A 1 282 ? 97.68195  -6.30270  18.89234   1.000 66.02859  ? 282 PHE A CD1 1 
ATOM 2287  C CD2 . PHE A 1 282 ? 99.44109  -4.71452  19.12768   1.000 62.96821  ? 282 PHE A CD2 1 
ATOM 2288  C CE1 . PHE A 1 282 ? 96.78589  -5.39166  19.42320   1.000 72.39389  ? 282 PHE A CE1 1 
ATOM 2289  C CE2 . PHE A 1 282 ? 98.55083  -3.80103  19.65819   1.000 63.82420  ? 282 PHE A CE2 1 
ATOM 2290  C CZ  . PHE A 1 282 ? 97.22241  -4.13974  19.80675   1.000 66.54024  ? 282 PHE A CZ  1 
ATOM 2291  N N   . LEU A 1 283 ? 102.60459 -7.24714  19.77938   1.000 66.29643  ? 283 LEU A N   1 
ATOM 2292  C CA  . LEU A 1 283 ? 103.61910 -6.73471  20.69130   1.000 61.74104  ? 283 LEU A CA  1 
ATOM 2293  C C   . LEU A 1 283 ? 103.27492 -5.31184  21.11129   1.000 58.52270  ? 283 LEU A C   1 
ATOM 2294  O O   . LEU A 1 283 ? 102.94345 -4.46936  20.27131   1.000 71.69053  ? 283 LEU A O   1 
ATOM 2295  C CB  . LEU A 1 283 ? 104.99395 -6.76971  20.02493   1.000 53.41726  ? 283 LEU A CB  1 
ATOM 2296  C CG  . LEU A 1 283 ? 105.52551 -8.13946  19.59816   1.000 44.25318  ? 283 LEU A CG  1 
ATOM 2297  C CD1 . LEU A 1 283 ? 106.87309 -7.99843  18.90735   1.000 45.06826  ? 283 LEU A CD1 1 
ATOM 2298  C CD2 . LEU A 1 283 ? 105.62469 -9.07808  20.78846   1.000 50.04369  ? 283 LEU A CD2 1 
ATOM 2299  N N   . LEU A 1 284 ? 103.34847 -5.04231  22.41547   1.000 56.65364  ? 284 LEU A N   1 
ATOM 2300  C CA  . LEU A 1 284 ? 102.96901 -3.73896  22.95178   1.000 56.03977  ? 284 LEU A CA  1 
ATOM 2301  C C   . LEU A 1 284 ? 104.16298 -2.80285  23.11570   1.000 57.02026  ? 284 LEU A C   1 
ATOM 2302  O O   . LEU A 1 284 ? 104.22190 -1.75188  22.47081   1.000 65.26906  ? 284 LEU A O   1 
ATOM 2303  C CB  . LEU A 1 284 ? 102.24540 -3.92587  24.29103   1.000 63.04394  ? 284 LEU A CB  1 
ATOM 2304  C CG  . LEU A 1 284 ? 101.19516 -5.03613  24.29093   1.000 60.52112  ? 284 LEU A CG  1 
ATOM 2305  C CD1 . LEU A 1 284 ? 100.58866 -5.22119  25.67326   1.000 53.23720  ? 284 LEU A CD1 1 
ATOM 2306  C CD2 . LEU A 1 284 ? 100.12435 -4.73494  23.26028   1.000 58.51524  ? 284 LEU A CD2 1 
ATOM 2307  N N   . MET A 1 285 ? 105.12604 -3.16745  23.96354   1.000 53.82210  ? 285 MET A N   1 
ATOM 2308  C CA  . MET A 1 285 ? 106.28222 -2.31232  24.19985   1.000 54.45098  ? 285 MET A CA  1 
ATOM 2309  C C   . MET A 1 285 ? 107.49190 -2.68444  23.35649   1.000 64.88627  ? 285 MET A C   1 
ATOM 2310  O O   . MET A 1 285 ? 108.37060 -1.83816  23.15719   1.000 74.96006  ? 285 MET A O   1 
ATOM 2311  C CB  . MET A 1 285 ? 106.68112 -2.33602  25.68271   1.000 51.64188  ? 285 MET A CB  1 
ATOM 2312  C CG  . MET A 1 285 ? 107.39716 -3.59969  26.13455   1.000 55.02944  ? 285 MET A CG  1 
ATOM 2313  S SD  . MET A 1 285 ? 107.73000 -3.59371  27.90793   1.000 80.42241  ? 285 MET A SD  1 
ATOM 2314  C CE  . MET A 1 285 ? 108.62712 -5.13262  28.09229   1.000 73.02001  ? 285 MET A CE  1 
ATOM 2315  N N   . ASP A 1 286 ? 107.55838 -3.91862  22.86086   1.000 48.69178  ? 286 ASP A N   1 
ATOM 2316  C CA  . ASP A 1 286 ? 108.71942 -4.38508  22.11651   1.000 47.52310  ? 286 ASP A CA  1 
ATOM 2317  C C   . ASP A 1 286 ? 108.62206 -4.13811  20.61815   1.000 52.60790  ? 286 ASP A C   1 
ATOM 2318  O O   . ASP A 1 286 ? 109.64395 -4.22231  19.92945   1.000 83.01715  ? 286 ASP A O   1 
ATOM 2319  C CB  . ASP A 1 286 ? 108.93626 -5.87771  22.37959   1.000 47.87392  ? 286 ASP A CB  1 
ATOM 2320  C CG  . ASP A 1 286 ? 109.13376 -6.18147  23.85110   1.000 65.06171  ? 286 ASP A CG  1 
ATOM 2321  O OD1 . ASP A 1 286 ? 109.96176 -5.50251  24.49258   1.000 77.39099  ? 286 ASP A OD1 1 
ATOM 2322  O OD2 . ASP A 1 286 ? 108.44823 -7.08198  24.37390   1.000 76.93248  ? 286 ASP A OD2 1 
ATOM 2323  N N   . ALA A 1 287 ? 107.43420 -3.83705  20.09872   1.000 51.58575  ? 287 ALA A N   1 
ATOM 2324  C CA  . ALA A 1 287 ? 107.29134 -3.56887  18.67476   1.000 51.11824  ? 287 ALA A CA  1 
ATOM 2325  C C   . ALA A 1 287 ? 108.05409 -2.30618  18.28684   1.000 66.29315  ? 287 ALA A C   1 
ATOM 2326  O O   . ALA A 1 287 ? 108.22808 -1.38617  19.09050   1.000 76.13735  ? 287 ALA A O   1 
ATOM 2327  C CB  . ALA A 1 287 ? 105.81657 -3.42935  18.30147   1.000 50.53879  ? 287 ALA A CB  1 
ATOM 2328  N N   . LEU A 1 288 ? 108.51089 -2.26807  17.03638   1.000 60.46283  ? 288 LEU A N   1 
ATOM 2329  C CA  . LEU A 1 288 ? 109.32951 -1.17372  16.52871   1.000 65.11563  ? 288 LEU A CA  1 
ATOM 2330  C C   . LEU A 1 288 ? 108.67141 -0.54857  15.30773   1.000 63.68301  ? 288 LEU A C   1 
ATOM 2331  O O   . LEU A 1 288 ? 108.22987 -1.25968  14.39930   1.000 62.16451  ? 288 LEU A O   1 
ATOM 2332  C CB  . LEU A 1 288 ? 110.74338 -1.64833  16.19081   1.000 78.18431  ? 288 LEU A CB  1 
ATOM 2333  C CG  . LEU A 1 288 ? 111.77791 -1.23292  17.23761   1.000 124.73077 ? 288 LEU A CG  1 
ATOM 2334  C CD1 . LEU A 1 288 ? 111.83596 0.28195   17.35777   1.000 143.49079 ? 288 LEU A CD1 1 
ATOM 2335  C CD2 . LEU A 1 288 ? 111.47163 -1.86342  18.58923   1.000 136.91841 ? 288 LEU A CD2 1 
ATOM 2336  N N   . LYS A 1 289 ? 108.62172 0.78017   15.29081   1.000 78.13152  ? 289 LYS A N   1 
ATOM 2337  C CA  . LYS A 1 289 ? 107.99098 1.52782   14.21362   1.000 92.36896  ? 289 LYS A CA  1 
ATOM 2338  C C   . LYS A 1 289 ? 108.93777 1.71710   13.03127   1.000 77.49676  ? 289 LYS A C   1 
ATOM 2339  O O   . LYS A 1 289 ? 110.16092 1.78233   13.18690   1.000 65.28558  ? 289 LYS A O   1 
ATOM 2340  C CB  . LYS A 1 289 ? 107.52471 2.89028   14.72921   1.000 104.42867 ? 289 LYS A CB  1 
ATOM 2341  C CG  . LYS A 1 289 ? 106.54680 2.80248   15.89191   1.000 97.50436  ? 289 LYS A CG  1 
ATOM 2342  C CD  . LYS A 1 289 ? 106.17155 4.17941   16.42034   1.000 90.41881  ? 289 LYS A CD  1 
ATOM 2343  C CE  . LYS A 1 289 ? 107.20441 4.70169   17.41110   1.000 78.96454  ? 289 LYS A CE  1 
ATOM 2344  N NZ  . LYS A 1 289 ? 107.06627 4.07371   18.75729   1.000 65.26457  ? 289 LYS A NZ  1 
ATOM 2345  N N   . LEU A 1 290 ? 108.35136 1.79427   11.83576   1.000 59.89219  ? 290 LEU A N   1 
ATOM 2346  C CA  . LEU A 1 290 ? 109.07769 2.04826   10.58983   1.000 52.27727  ? 290 LEU A CA  1 
ATOM 2347  C C   . LEU A 1 290 ? 108.39475 3.21521   9.87888    1.000 52.44883  ? 290 LEU A C   1 
ATOM 2348  O O   . LEU A 1 290 ? 107.38952 3.02931   9.18564    1.000 52.24618  ? 290 LEU A O   1 
ATOM 2349  C CB  . LEU A 1 290 ? 109.12389 0.80427   9.70770    1.000 52.12293  ? 290 LEU A CB  1 
ATOM 2350  C CG  . LEU A 1 290 ? 110.33220 -0.12217  9.87167    1.000 52.29647  ? 290 LEU A CG  1 
ATOM 2351  C CD1 . LEU A 1 290 ? 110.36879 -1.16153  8.76174    1.000 52.27602  ? 290 LEU A CD1 1 
ATOM 2352  C CD2 . LEU A 1 290 ? 111.62530 0.67649   9.89583    1.000 52.84697  ? 290 LEU A CD2 1 
ATOM 2353  N N   . SER A 1 291 ? 108.94360 4.41369   10.05731   1.000 59.22174  ? 291 SER A N   1 
ATOM 2354  C CA  . SER A 1 291 ? 108.27881 5.64344   9.65007    1.000 75.78091  ? 291 SER A CA  1 
ATOM 2355  C C   . SER A 1 291 ? 108.51058 5.94213   8.17183    1.000 69.37000  ? 291 SER A C   1 
ATOM 2356  O O   . SER A 1 291 ? 109.51734 5.53034   7.58549    1.000 67.14015  ? 291 SER A O   1 
ATOM 2357  C CB  . SER A 1 291 ? 108.78751 6.81054   10.49226   1.000 98.70976  ? 291 SER A CB  1 
ATOM 2358  O OG  . SER A 1 291 ? 108.69819 6.50239   11.87082   1.000 105.14197 ? 291 SER A OG  1 
ATOM 2359  N N   . ILE A 1 292 ? 107.56332 6.66581   7.56293    1.000 73.15476  ? 292 ILE A N   1 
ATOM 2360  C CA  . ILE A 1 292 ? 107.78459 7.16900   6.21079    1.000 74.58939  ? 292 ILE A CA  1 
ATOM 2361  C C   . ILE A 1 292 ? 107.49207 8.66015   6.13032    1.000 79.48932  ? 292 ILE A C   1 
ATOM 2362  O O   . ILE A 1 292 ? 107.79383 9.29076   5.11120    1.000 90.29036  ? 292 ILE A O   1 
ATOM 2363  C CB  . ILE A 1 292 ? 106.88702 6.46048   5.18016    1.000 73.07333  ? 292 ILE A CB  1 
ATOM 2364  C CG1 . ILE A 1 292 ? 106.57758 5.02666   5.57309    1.000 82.37676  ? 292 ILE A CG1 1 
ATOM 2365  C CG2 . ILE A 1 292 ? 107.55249 6.45552   3.80702    1.000 81.90894  ? 292 ILE A CG2 1 
ATOM 2366  C CD1 . ILE A 1 292 ? 105.47334 4.45780   4.71136    1.000 99.63038  ? 292 ILE A CD1 1 
ATOM 2367  N N   . GLU A 1 293 ? 106.98349 9.24546   7.22151    1.000 70.20472  ? 293 GLU A N   1 
ATOM 2368  C CA  . GLU A 1 293 ? 106.59131 10.65220  7.24361    1.000 98.88865  ? 293 GLU A CA  1 
ATOM 2369  C C   . GLU A 1 293 ? 106.06703 11.11249  5.88266    1.000 86.91504  ? 293 GLU A C   1 
ATOM 2370  O O   . GLU A 1 293 ? 106.64163 12.01636  5.26790    1.000 62.24015  ? 293 GLU A O   1 
ATOM 2371  C CB  . GLU A 1 293 ? 107.77982 11.49752  7.69592    1.000 133.58318 ? 293 GLU A CB  1 
ATOM 2372  C CG  . GLU A 1 293 ? 107.97193 11.44565  9.19384    1.000 152.26359 ? 293 GLU A CG  1 
ATOM 2373  C CD  . GLU A 1 293 ? 109.39787 11.71198  9.62138    1.000 165.26099 ? 293 GLU A CD  1 
ATOM 2374  O OE1 . GLU A 1 293 ? 109.62234 11.87270  10.83796   1.000 166.05176 ? 293 GLU A OE1 1 
ATOM 2375  O OE2 . GLU A 1 293 ? 110.29302 11.76597  8.75112    1.000 171.24634 ? 293 GLU A OE2 1 
ATOM 2376  N N   . ASP A 1 294 ? 104.97760 10.49719  5.41415    1.000 103.43388 ? 294 ASP A N   1 
ATOM 2377  C CA  . ASP A 1 294 ? 104.44182 10.70463  4.06909    1.000 123.04922 ? 294 ASP A CA  1 
ATOM 2378  C C   . ASP A 1 294 ? 103.01345 11.23466  4.09961    1.000 118.77976 ? 294 ASP A C   1 
ATOM 2379  O O   . ASP A 1 294 ? 102.12336 10.56382  4.65261    1.000 113.35298 ? 294 ASP A O   1 
ATOM 2380  C CB  . ASP A 1 294 ? 104.48811 9.37732   3.29350    1.000 136.95154 ? 294 ASP A CB  1 
ATOM 2381  C CG  . ASP A 1 294 ? 103.57862 9.37086   2.07022    1.000 130.71576 ? 294 ASP A CG  1 
ATOM 2382  O OD1 . ASP A 1 294 ? 104.08055 9.61697   0.94728    1.000 130.68591 ? 294 ASP A OD1 1 
ATOM 2383  O OD2 . ASP A 1 294 ? 102.37087 9.08409   2.22461    1.000 120.70645 ? 294 ASP A OD2 1 
ATOM 2384  N N   . PRO A 1 295 ? 102.73275 12.42613  3.55509    1.000 127.22087 ? 295 PRO A N   1 
ATOM 2385  C CA  . PRO A 1 295 ? 101.32624 12.87289  3.40975    1.000 133.58261 ? 295 PRO A CA  1 
ATOM 2386  C C   . PRO A 1 295 ? 100.66283 12.44032  2.09810    1.000 156.99002 ? 295 PRO A C   1 
ATOM 2387  O O   . PRO A 1 295 ? 100.55287 13.19677  1.12489    1.000 167.87784 ? 295 PRO A O   1 
ATOM 2388  C CB  . PRO A 1 295 ? 101.44383 14.39764  3.51392    1.000 106.25881 ? 295 PRO A CB  1 
ATOM 2389  C CG  . PRO A 1 295 ? 102.93471 14.72160  3.51698    1.000 96.14258  ? 295 PRO A CG  1 
ATOM 2390  C CD  . PRO A 1 295 ? 103.67763 13.47646  3.15551    1.000 111.51613 ? 295 PRO A CD  1 
ATOM 2391  N N   . SER A 1 296 ? 100.20043 11.18284  2.05269    1.000 175.02498 ? 296 SER A N   1 
ATOM 2392  C CA  . SER A 1 296 ? 99.29273  10.74204  0.99704    1.000 166.01746 ? 296 SER A CA  1 
ATOM 2393  C C   . SER A 1 296 ? 97.83640  10.95134  1.40530    1.000 156.30907 ? 296 SER A C   1 
ATOM 2394  O O   . SER A 1 296 ? 96.93082  10.83842  0.56418    1.000 132.30118 ? 296 SER A O   1 
ATOM 2395  C CB  . SER A 1 296 ? 99.54919  9.27575   0.64321    1.000 157.64447 ? 296 SER A CB  1 
ATOM 2396  O OG  . SER A 1 296 ? 98.61100  8.86294   -0.32719   1.000 145.07340 ? 296 SER A OG  1 
ATOM 2397  N N   . HIS A 1 297 ? 97.63361  11.27232  2.68571    1.000 169.08471 ? 297 HIS A N   1 
ATOM 2398  C CA  . HIS A 1 297 ? 96.51992  11.87957  3.41180    1.000 165.26125 ? 297 HIS A CA  1 
ATOM 2399  C C   . HIS A 1 297 ? 95.28224  11.07742  3.80516    1.000 174.90341 ? 297 HIS A C   1 
ATOM 2400  O O   . HIS A 1 297 ? 94.41280  11.68302  4.44015    1.000 176.62820 ? 297 HIS A O   1 
ATOM 2401  C CB  . HIS A 1 297 ? 95.96116  13.10901  2.69072    1.000 147.61057 ? 297 HIS A CB  1 
ATOM 2402  C CG  . HIS A 1 297 ? 96.90600  14.25341  2.63405    1.000 125.56444 ? 297 HIS A CG  1 
ATOM 2403  N ND1 . HIS A 1 297 ? 97.51461  14.64977  1.46549    1.000 122.27511 ? 297 HIS A ND1 1 
ATOM 2404  C CD2 . HIS A 1 297 ? 97.32883  15.10714  3.59371    1.000 116.40120 ? 297 HIS A CD2 1 
ATOM 2405  C CE1 . HIS A 1 297 ? 98.25450  15.71598  1.70219    1.000 119.18619 ? 297 HIS A CE1 1 
ATOM 2406  N NE2 . HIS A 1 297 ? 98.16261  16.01133  2.98630    1.000 119.34693 ? 297 HIS A NE2 1 
ATOM 2407  N N   . GLU A 1 298 ? 95.03190  9.85371   3.34701    1.000 138.45958 ? 298 GLU A N   1 
ATOM 2408  C CA  . GLU A 1 298 ? 94.81993  8.75624   4.29485    1.000 140.81014 ? 298 GLU A CA  1 
ATOM 2409  C C   . GLU A 1 298 ? 93.67812  7.83875   3.84705    1.000 143.42638 ? 298 GLU A C   1 
ATOM 2410  O O   . GLU A 1 298 ? 93.09794  8.03281   2.77235    1.000 159.92030 ? 298 GLU A O   1 
ATOM 2411  C CB  . GLU A 1 298 ? 94.69362  9.23698   5.74893    1.000 140.37691 ? 298 GLU A CB  1 
ATOM 2412  C CG  . GLU A 1 298 ? 93.32938  9.53523   6.27510    1.000 140.19179 ? 298 GLU A CG  1 
ATOM 2413  C CD  . GLU A 1 298 ? 93.34587  9.65733   7.79279    1.000 127.21252 ? 298 GLU A CD  1 
ATOM 2414  O OE1 . GLU A 1 298 ? 92.39661  9.17704   8.44486    1.000 121.25467 ? 298 GLU A OE1 1 
ATOM 2415  O OE2 . GLU A 1 298 ? 94.31710  10.21227  8.34775    1.000 117.60953 ? 298 GLU A OE2 1 
ATOM 2416  N N   . GLY A 1 299 ? 93.37097  6.80089   4.61973    1.000 136.00863 ? 299 GLY A N   1 
ATOM 2417  C CA  . GLY A 1 299 ? 92.05681  6.18414   4.47422    1.000 122.73086 ? 299 GLY A CA  1 
ATOM 2418  C C   . GLY A 1 299 ? 91.78192  5.42872   3.18714    1.000 129.43683 ? 299 GLY A C   1 
ATOM 2419  O O   . GLY A 1 299 ? 91.69806  4.19914   3.22398    1.000 123.38134 ? 299 GLY A O   1 
ATOM 2420  N N   . GLU A 1 300 ? 91.60410  6.12754   2.05291    1.000 132.83211 ? 300 GLU A N   1 
ATOM 2421  C CA  . GLU A 1 300 ? 91.50364  5.40900   0.78627    1.000 134.15689 ? 300 GLU A CA  1 
ATOM 2422  C C   . GLU A 1 300 ? 92.89054  5.02688   0.29975    1.000 129.46010 ? 300 GLU A C   1 
ATOM 2423  O O   . GLU A 1 300 ? 93.02359  4.21476   -0.62539   1.000 135.17340 ? 300 GLU A O   1 
ATOM 2424  C CB  . GLU A 1 300 ? 90.75974  6.22984   -0.27976   1.000 130.77787 ? 300 GLU A CB  1 
ATOM 2425  C CG  . GLU A 1 300 ? 91.30290  7.62672   -0.49926   1.000 129.74390 ? 300 GLU A CG  1 
ATOM 2426  C CD  . GLU A 1 300 ? 92.08431  7.74084   -1.79016   1.000 123.20594 ? 300 GLU A CD  1 
ATOM 2427  O OE1 . GLU A 1 300 ? 92.26517  8.86963   -2.29484   1.000 117.27047 ? 300 GLU A OE1 1 
ATOM 2428  O OE2 . GLU A 1 300 ? 92.49618  6.68719   -2.31517   1.000 121.65025 ? 300 GLU A OE2 1 
ATOM 2429  N N   . GLY A 1 301 ? 93.91664  5.61215   0.91553    1.000 129.48790 ? 301 GLY A N   1 
ATOM 2430  C CA  . GLY A 1 301 ? 95.29849  5.30354   0.64072    1.000 116.48930 ? 301 GLY A CA  1 
ATOM 2431  C C   . GLY A 1 301 ? 95.48150  3.80777   0.75070    1.000 109.38896 ? 301 GLY A C   1 
ATOM 2432  O O   . GLY A 1 301 ? 94.99702  3.18934   1.70423    1.000 122.00113 ? 301 GLY A O   1 
ATOM 2433  N N   . ILE A 1 302 ? 96.18158  3.21037   -0.20329   1.000 84.01334  ? 302 ILE A N   1 
ATOM 2434  C CA  . ILE A 1 302 ? 96.29243  1.75721   -0.24063   1.000 69.31766  ? 302 ILE A CA  1 
ATOM 2435  C C   . ILE A 1 302 ? 97.39402  1.34812   0.73237    1.000 95.89725  ? 302 ILE A C   1 
ATOM 2436  O O   . ILE A 1 302 ? 98.54231  1.79830   0.60561    1.000 131.69426 ? 302 ILE A O   1 
ATOM 2437  C CB  . ILE A 1 302 ? 96.55323  1.27172   -1.67703   1.000 54.26097  ? 302 ILE A CB  1 
ATOM 2438  C CG1 . ILE A 1 302 ? 96.79107  -0.24038  -1.72672   1.000 63.48255  ? 302 ILE A CG1 1 
ATOM 2439  C CG2 . ILE A 1 302 ? 97.66554  2.08014   -2.32677   1.000 54.77071  ? 302 ILE A CG2 1 
ATOM 2440  C CD1 . ILE A 1 302 ? 95.55297  -1.04054  -1.42120   1.000 71.04737  ? 302 ILE A CD1 1 
ATOM 2441  N N   . PRO A 1 303 ? 97.08492  0.51194   1.73035    1.000 77.34672  ? 303 PRO A N   1 
ATOM 2442  C CA  . PRO A 1 303 ? 98.07517  0.20221   2.77482    1.000 61.16662  ? 303 PRO A CA  1 
ATOM 2443  C C   . PRO A 1 303 ? 99.18378  -0.73594  2.33271    1.000 52.67409  ? 303 PRO A C   1 
ATOM 2444  O O   . PRO A 1 303 ? 100.17384 -0.87404  3.06274    1.000 52.21530  ? 303 PRO A O   1 
ATOM 2445  C CB  . PRO A 1 303 ? 97.22414  -0.43509  3.88000    1.000 52.00407  ? 303 PRO A CB  1 
ATOM 2446  C CG  . PRO A 1 303 ? 96.08408  -1.05884  3.14664    1.000 52.46319  ? 303 PRO A CG  1 
ATOM 2447  C CD  . PRO A 1 303 ? 95.78771  -0.13810  1.98963    1.000 60.72286  ? 303 PRO A CD  1 
ATOM 2448  N N   . LEU A 1 304 ? 99.06140  -1.38805  1.17685    1.000 46.73488  ? 304 LEU A N   1 
ATOM 2449  C CA  . LEU A 1 304 ? 100.10936 -2.31298  0.76234    1.000 46.81938  ? 304 LEU A CA  1 
ATOM 2450  C C   . LEU A 1 304 ? 101.34429 -1.56280  0.28309    1.000 47.10691  ? 304 LEU A C   1 
ATOM 2451  O O   . LEU A 1 304 ? 102.47388 -1.93375  0.62236    1.000 74.15062  ? 304 LEU A O   1 
ATOM 2452  C CB  . LEU A 1 304 ? 99.59200  -3.25574  -0.32401   1.000 47.49391  ? 304 LEU A CB  1 
ATOM 2453  C CG  . LEU A 1 304 ? 100.53175 -4.43036  -0.61364   1.000 47.55287  ? 304 LEU A CG  1 
ATOM 2454  C CD1 . LEU A 1 304 ? 99.75241  -5.71063  -0.80642   1.000 47.78163  ? 304 LEU A CD1 1 
ATOM 2455  C CD2 . LEU A 1 304 ? 101.40225 -4.15881  -1.83284   1.000 48.28862  ? 304 LEU A CD2 1 
ATOM 2456  N N   . TYR A 1 305 ? 101.15455 -0.49863  -0.49631   1.000 45.95673  ? 305 TYR A N   1 
ATOM 2457  C CA  . TYR A 1 305 ? 102.30636 0.22589   -1.02080   1.000 54.65663  ? 305 TYR A CA  1 
ATOM 2458  C C   . TYR A 1 305 ? 102.96530 1.08517   0.04991    1.000 62.41606  ? 305 TYR A C   1 
ATOM 2459  O O   . TYR A 1 305 ? 104.17718 1.32194   -0.01069   1.000 82.36853  ? 305 TYR A O   1 
ATOM 2460  C CB  . TYR A 1 305 ? 101.90207 1.08532   -2.22295   1.000 77.68782  ? 305 TYR A CB  1 
ATOM 2461  C CG  . TYR A 1 305 ? 101.04804 0.37697   -3.26046   1.000 99.50468  ? 305 TYR A CG  1 
ATOM 2462  C CD1 . TYR A 1 305 ? 101.02448 -1.01217  -3.35493   1.000 101.94275 ? 305 TYR A CD1 1 
ATOM 2463  C CD2 . TYR A 1 305 ? 100.28747 1.10230   -4.16437   1.000 106.86491 ? 305 TYR A CD2 1 
ATOM 2464  C CE1 . TYR A 1 305 ? 100.24417 -1.65144  -4.29195   1.000 96.87459  ? 305 TYR A CE1 1 
ATOM 2465  C CE2 . TYR A 1 305 ? 99.50805  0.47092   -5.10880   1.000 107.28718 ? 305 TYR A CE2 1 
ATOM 2466  C CZ  . TYR A 1 305 ? 99.49215  -0.90514  -5.17164   1.000 98.43299  ? 305 TYR A CZ  1 
ATOM 2467  O OH  . TYR A 1 305 ? 98.71756  -1.53525  -6.11705   1.000 93.15161  ? 305 TYR A OH  1 
ATOM 2468  N N   . ASP A 1 306 ? 102.19438 1.55438   1.03418    1.000 63.56995  ? 306 ASP A N   1 
ATOM 2469  C CA  . ASP A 1 306 ? 102.79909 2.24267   2.17045    1.000 76.73270  ? 306 ASP A CA  1 
ATOM 2470  C C   . ASP A 1 306 ? 103.71377 1.30741   2.95499    1.000 54.47833  ? 306 ASP A C   1 
ATOM 2471  O O   . ASP A 1 306 ? 104.77731 1.71756   3.43343    1.000 81.59367  ? 306 ASP A O   1 
ATOM 2472  C CB  . ASP A 1 306 ? 101.71257 2.83630   3.06742    1.000 99.29793  ? 306 ASP A CB  1 
ATOM 2473  C CG  . ASP A 1 306 ? 100.87139 3.87531   2.34584    1.000 105.85393 ? 306 ASP A CG  1 
ATOM 2474  O OD1 . ASP A 1 306 ? 101.37980 4.48464   1.38101    1.000 106.05097 ? 306 ASP A OD1 1 
ATOM 2475  O OD2 . ASP A 1 306 ? 99.70806  4.08942   2.74597    1.000 101.48745 ? 306 ASP A OD2 1 
ATOM 2476  N N   . ALA A 1 307 ? 103.34489 0.03102   3.05878    1.000 44.01443  ? 307 ALA A N   1 
ATOM 2477  C CA  . ALA A 1 307 ? 104.20252 -0.91437  3.76816    1.000 43.60167  ? 307 ALA A CA  1 
ATOM 2478  C C   . ALA A 1 307 ? 105.47509 -1.20969  2.97894    1.000 44.00293  ? 307 ALA A C   1 
ATOM 2479  O O   . ALA A 1 307 ? 106.56376 -1.34214  3.55796    1.000 59.86434  ? 307 ALA A O   1 
ATOM 2480  C CB  . ALA A 1 307 ? 103.43195 -2.20082  4.06150    1.000 43.29457  ? 307 ALA A CB  1 
ATOM 2481  N N   . ILE A 1 308 ? 105.36931 -1.30577  1.65253    1.000 44.60378  ? 308 ILE A N   1 
ATOM 2482  C CA  . ILE A 1 308 ? 106.57512 -1.57114  0.87812    1.000 48.75521  ? 308 ILE A CA  1 
ATOM 2483  C C   . ILE A 1 308 ? 107.47633 -0.34263  0.85739    1.000 94.49396  ? 308 ILE A C   1 
ATOM 2484  O O   . ILE A 1 308 ? 108.70268 -0.47409  0.80182    1.000 135.21709 ? 308 ILE A O   1 
ATOM 2485  C CB  . ILE A 1 308 ? 106.23519 -2.07277  -0.54068   1.000 45.72032  ? 308 ILE A CB  1 
ATOM 2486  C CG1 . ILE A 1 308 ? 105.68403 -0.95237  -1.42122   1.000 55.86756  ? 308 ILE A CG1 1 
ATOM 2487  C CG2 . ILE A 1 308 ? 105.26309 -3.24442  -0.47104   1.000 45.53328  ? 308 ILE A CG2 1 
ATOM 2488  C CD1 . ILE A 1 308 ? 106.68401 -0.41841  -2.42765   1.000 71.27316  ? 308 ILE A CD1 1 
ATOM 2489  N N   . LYS A 1 309 ? 106.91088 0.86670   0.91634    1.000 106.38502 ? 309 LYS A N   1 
ATOM 2490  C CA  . LYS A 1 309 ? 107.78977 2.02165   1.05450    1.000 74.05154  ? 309 LYS A CA  1 
ATOM 2491  C C   . LYS A 1 309 ? 108.26213 2.22512   2.48981    1.000 64.70782  ? 309 LYS A C   1 
ATOM 2492  O O   . LYS A 1 309 ? 109.15502 3.04746   2.71594    1.000 65.75557  ? 309 LYS A O   1 
ATOM 2493  C CB  . LYS A 1 309 ? 107.12014 3.29472   0.52416    1.000 57.63381  ? 309 LYS A CB  1 
ATOM 2494  C CG  . LYS A 1 309 ? 105.87306 3.73106   1.24632    1.000 59.48738  ? 309 LYS A CG  1 
ATOM 2495  C CD  . LYS A 1 309 ? 105.25191 4.93247   0.55290    1.000 63.15931  ? 309 LYS A CD  1 
ATOM 2496  C CE  . LYS A 1 309 ? 104.85602 4.59551   -0.87642   1.000 63.52245  ? 309 LYS A CE  1 
ATOM 2497  N NZ  . LYS A 1 309 ? 104.20631 5.74226   -1.56961   1.000 77.92832  ? 309 LYS A NZ  1 
ATOM 2498  N N   . CYS A 1 310 ? 107.68191 1.51163   3.46160    1.000 68.42361  ? 310 CYS A N   1 
ATOM 2499  C CA  . CYS A 1 310 ? 108.36271 1.33622   4.74330    1.000 75.71789  ? 310 CYS A CA  1 
ATOM 2500  C C   . CYS A 1 310 ? 109.60215 0.47130   4.56826    1.000 68.99727  ? 310 CYS A C   1 
ATOM 2501  O O   . CYS A 1 310 ? 110.68462 0.80238   5.06619    1.000 67.28197  ? 310 CYS A O   1 
ATOM 2502  C CB  . CYS A 1 310 ? 107.43849 0.68916   5.77682    1.000 84.96903  ? 310 CYS A CB  1 
ATOM 2503  S SG  . CYS A 1 310 ? 106.07925 1.66862   6.40095    1.000 82.78720  ? 310 CYS A SG  1 
ATOM 2504  N N   . MET A 1 311 ? 109.45012 -0.65564  3.86787    1.000 54.35337  ? 311 MET A N   1 
ATOM 2505  C CA  . MET A 1 311 ? 110.59229 -1.53576  3.62035    1.000 83.76496  ? 311 MET A CA  1 
ATOM 2506  C C   . MET A 1 311 ? 111.67998 -0.84277  2.80583    1.000 93.61481  ? 311 MET A C   1 
ATOM 2507  O O   . MET A 1 311 ? 112.86937 -1.13160  2.98383    1.000 85.90986  ? 311 MET A O   1 
ATOM 2508  C CB  . MET A 1 311 ? 110.13873 -2.80899  2.90395    1.000 88.91694  ? 311 MET A CB  1 
ATOM 2509  C CG  . MET A 1 311 ? 109.10966 -3.63325  3.65507    1.000 71.21581  ? 311 MET A CG  1 
ATOM 2510  S SD  . MET A 1 311 ? 109.71618 -4.10187  5.28627    1.000 45.96397  ? 311 MET A SD  1 
ATOM 2511  C CE  . MET A 1 311 ? 108.41877 -5.20174  5.84017    1.000 43.97465  ? 311 MET A CE  1 
ATOM 2512  N N   . ARG A 1 312 ? 111.29226 0.06414   1.90811    1.000 102.54914 ? 312 ARG A N   1 
ATOM 2513  C CA  . ARG A 1 312 ? 112.25502 0.78924   1.08591    1.000 98.79208  ? 312 ARG A CA  1 
ATOM 2514  C C   . ARG A 1 312 ? 113.15884 1.70125   1.90748    1.000 112.50367 ? 312 ARG A C   1 
ATOM 2515  O O   . ARG A 1 312 ? 114.21954 2.10369   1.41871    1.000 153.89076 ? 312 ARG A O   1 
ATOM 2516  C CB  . ARG A 1 312 ? 111.52238 1.61164   0.02271    1.000 78.24124  ? 312 ARG A CB  1 
ATOM 2517  C CG  . ARG A 1 312 ? 110.92115 0.78972   -1.10641   1.000 69.75481  ? 312 ARG A CG  1 
ATOM 2518  C CD  . ARG A 1 312 ? 111.99066 0.06104   -1.90100   1.000 75.99751  ? 312 ARG A CD  1 
ATOM 2519  N NE  . ARG A 1 312 ? 111.43708 -1.06731  -2.64387   1.000 108.63699 ? 312 ARG A NE  1 
ATOM 2520  C CZ  . ARG A 1 312 ? 110.82043 -0.96319  -3.81667   1.000 137.02351 ? 312 ARG A CZ  1 
ATOM 2521  N NH1 . ARG A 1 312 ? 110.67475 0.22295   -4.39231   1.000 151.93071 ? 312 ARG A NH1 1 
ATOM 2522  N NH2 . ARG A 1 312 ? 110.34773 -2.04749  -4.41565   1.000 138.40865 ? 312 ARG A NH2 1 
ATOM 2523  N N   . THR A 1 313 ? 112.77051 2.03193   3.13648    1.000 85.35054  ? 313 THR A N   1 
ATOM 2524  C CA  . THR A 1 313 ? 113.53675 2.94255   3.97655    1.000 73.28624  ? 313 THR A CA  1 
ATOM 2525  C C   . THR A 1 313 ? 114.51841 2.23083   4.89791    1.000 63.52162  ? 313 THR A C   1 
ATOM 2526  O O   . THR A 1 313 ? 115.23728 2.90189   5.64538    1.000 74.88325  ? 313 THR A O   1 
ATOM 2527  C CB  . THR A 1 313 ? 112.59515 3.81032   4.81901    1.000 90.23568  ? 313 THR A CB  1 
ATOM 2528  O OG1 . THR A 1 313 ? 111.81891 2.97378   5.68604    1.000 90.74665  ? 313 THR A OG1 1 
ATOM 2529  C CG2 . THR A 1 313 ? 111.66555 4.61663   3.92412    1.000 105.51220 ? 313 THR A CG2 1 
ATOM 2530  N N   . PHE A 1 314 ? 114.57614 0.90272   4.86681    1.000 59.09547  ? 314 PHE A N   1 
ATOM 2531  C CA  . PHE A 1 314 ? 115.48462 0.15000   5.71832    1.000 64.13088  ? 314 PHE A CA  1 
ATOM 2532  C C   . PHE A 1 314 ? 116.45209 -0.66897  4.87707    1.000 59.33859  ? 314 PHE A C   1 
ATOM 2533  O O   . PHE A 1 314 ? 116.07992 -1.21599  3.83388    1.000 55.92516  ? 314 PHE A O   1 
ATOM 2534  C CB  . PHE A 1 314 ? 114.72614 -0.78208  6.66802    1.000 81.15272  ? 314 PHE A CB  1 
ATOM 2535  C CG  . PHE A 1 314 ? 115.62654 -1.63747  7.51200    1.000 72.89051  ? 314 PHE A CG  1 
ATOM 2536  C CD1 . PHE A 1 314 ? 116.29032 -1.10074  8.59877    1.000 61.72798  ? 314 PHE A CD1 1 
ATOM 2537  C CD2 . PHE A 1 314 ? 115.83050 -2.97073  7.20311    1.000 68.02988  ? 314 PHE A CD2 1 
ATOM 2538  C CE1 . PHE A 1 314 ? 117.12581 -1.88061  9.36763    1.000 58.85462  ? 314 PHE A CE1 1 
ATOM 2539  C CE2 . PHE A 1 314 ? 116.66736 -3.75614  7.96997    1.000 65.32420  ? 314 PHE A CE2 1 
ATOM 2540  C CZ  . PHE A 1 314 ? 117.31509 -3.20940  9.05503    1.000 60.42126  ? 314 PHE A CZ  1 
ATOM 2541  N N   . PHE A 1 315 ? 117.69744 -0.74272  5.34253    1.000 66.32931  ? 315 PHE A N   1 
ATOM 2542  C CA  . PHE A 1 315 ? 118.72155 -1.58492  4.74532    1.000 58.22839  ? 315 PHE A CA  1 
ATOM 2543  C C   . PHE A 1 315 ? 119.47656 -2.29967  5.85480    1.000 62.78677  ? 315 PHE A C   1 
ATOM 2544  O O   . PHE A 1 315 ? 119.59481 -1.79402  6.97397    1.000 75.13531  ? 315 PHE A O   1 
ATOM 2545  C CB  . PHE A 1 315 ? 119.68622 -0.77302  3.87415    1.000 58.61762  ? 315 PHE A CB  1 
ATOM 2546  C CG  . PHE A 1 315 ? 119.00331 0.01577   2.79843    1.000 73.55947  ? 315 PHE A CG  1 
ATOM 2547  C CD1 . PHE A 1 315 ? 118.58492 -0.60047  1.63081    1.000 81.57621  ? 315 PHE A CD1 1 
ATOM 2548  C CD2 . PHE A 1 315 ? 118.75485 1.36663   2.96422    1.000 85.25503  ? 315 PHE A CD2 1 
ATOM 2549  C CE1 . PHE A 1 315 ? 117.94990 0.12051   0.64039    1.000 89.10421  ? 315 PHE A CE1 1 
ATOM 2550  C CE2 . PHE A 1 315 ? 118.11598 2.09181   1.97931    1.000 92.36195  ? 315 PHE A CE2 1 
ATOM 2551  C CZ  . PHE A 1 315 ? 117.71454 1.46836   0.81472    1.000 95.34143  ? 315 PHE A CZ  1 
ATOM 2552  N N   . GLY A 1 316 ? 119.98769 -3.48166  5.53135    1.000 64.82379  ? 316 GLY A N   1 
ATOM 2553  C CA  . GLY A 1 316 ? 120.66112 -4.30421  6.51367    1.000 64.35374  ? 316 GLY A CA  1 
ATOM 2554  C C   . GLY A 1 316 ? 119.86203 -5.54257  6.85818    1.000 63.88975  ? 316 GLY A C   1 
ATOM 2555  O O   . GLY A 1 316 ? 119.88275 -6.01058  8.00046    1.000 64.93413  ? 316 GLY A O   1 
ATOM 2556  N N   . TRP A 1 317 ? 119.13967 -6.07306  5.87505    1.000 57.61664  ? 317 TRP A N   1 
ATOM 2557  C CA  . TRP A 1 317 ? 118.39683 -7.31896  6.04507    1.000 56.83369  ? 317 TRP A CA  1 
ATOM 2558  C C   . TRP A 1 317 ? 119.38898 -8.47478  6.05567    1.000 57.27956  ? 317 TRP A C   1 
ATOM 2559  O O   . TRP A 1 317 ? 119.83498 -8.94028  5.00526    1.000 59.85380  ? 317 TRP A O   1 
ATOM 2560  C CB  . TRP A 1 317 ? 117.36217 -7.48613  4.93830    1.000 53.24496  ? 317 TRP A CB  1 
ATOM 2561  C CG  . TRP A 1 317 ? 116.33513 -6.39433  4.88860    1.000 53.52885  ? 317 TRP A CG  1 
ATOM 2562  C CD1 . TRP A 1 317 ? 116.35861 -5.28217  4.09882    1.000 53.22409  ? 317 TRP A CD1 1 
ATOM 2563  C CD2 . TRP A 1 317 ? 115.12601 -6.31641  5.65476    1.000 56.11489  ? 317 TRP A CD2 1 
ATOM 2564  N NE1 . TRP A 1 317 ? 115.24137 -4.51523  4.32701    1.000 50.70137  ? 317 TRP A NE1 1 
ATOM 2565  C CE2 . TRP A 1 317 ? 114.46715 -5.13000  5.27558    1.000 49.95439  ? 317 TRP A CE2 1 
ATOM 2566  C CE3 . TRP A 1 317 ? 114.53687 -7.13474  6.62360    1.000 56.25620  ? 317 TRP A CE3 1 
ATOM 2567  C CZ2 . TRP A 1 317 ? 113.25251 -4.73880  5.83516    1.000 49.50688  ? 317 TRP A CZ2 1 
ATOM 2568  C CZ3 . TRP A 1 317 ? 113.32939 -6.74558  7.17593    1.000 49.34740  ? 317 TRP A CZ3 1 
ATOM 2569  C CH2 . TRP A 1 317 ? 112.70089 -5.55850  6.78037    1.000 49.18488  ? 317 TRP A CH2 1 
ATOM 2570  N N   . LYS A 1 318 ? 119.74319 -8.93691  7.25022    1.000 71.22443  ? 318 LYS A N   1 
ATOM 2571  C CA  . LYS A 1 318 ? 120.63704 -10.07378 7.39947    1.000 69.25034  ? 318 LYS A CA  1 
ATOM 2572  C C   . LYS A 1 318 ? 119.95458 -11.35625 6.92720    1.000 67.36785  ? 318 LYS A C   1 
ATOM 2573  O O   . LYS A 1 318 ? 118.72585 -11.44849 6.85685    1.000 69.78239  ? 318 LYS A O   1 
ATOM 2574  C CB  . LYS A 1 318 ? 121.06731 -10.21726 8.86043    1.000 73.52179  ? 318 LYS A CB  1 
ATOM 2575  C CG  . LYS A 1 318 ? 122.25233 -11.14120 9.10338    1.000 79.02525  ? 318 LYS A CG  1 
ATOM 2576  C CD  . LYS A 1 318 ? 122.40339 -11.44349 10.58572   1.000 79.74100  ? 318 LYS A CD  1 
ATOM 2577  C CE  . LYS A 1 318 ? 122.51130 -10.16616 11.40410   1.000 74.89286  ? 318 LYS A CE  1 
ATOM 2578  N NZ  . LYS A 1 318 ? 122.68232 -10.44915 12.85632   1.000 72.31493  ? 318 LYS A NZ  1 
ATOM 2579  N N   . GLU A 1 319 ? 120.76980 -12.34953 6.58516    1.000 50.75899  ? 319 GLU A N   1 
ATOM 2580  C CA  . GLU A 1 319 ? 120.23603 -13.67991 6.33628    1.000 50.85241  ? 319 GLU A CA  1 
ATOM 2581  C C   . GLU A 1 319 ? 119.58664 -14.20244 7.61374    1.000 50.75073  ? 319 GLU A C   1 
ATOM 2582  O O   . GLU A 1 319 ? 120.20258 -14.13569 8.68795    1.000 57.54103  ? 319 GLU A O   1 
ATOM 2583  C CB  . GLU A 1 319 ? 121.34916 -14.62452 5.88220    1.000 64.63934  ? 319 GLU A CB  1 
ATOM 2584  C CG  . GLU A 1 319 ? 120.90617 -16.06187 5.65361    1.000 81.53689  ? 319 GLU A CG  1 
ATOM 2585  C CD  . GLU A 1 319 ? 120.18152 -16.25829 4.34067    1.000 86.52539  ? 319 GLU A CD  1 
ATOM 2586  O OE1 . GLU A 1 319 ? 120.41206 -15.46780 3.40452    1.000 95.53669  ? 319 GLU A OE1 1 
ATOM 2587  O OE2 . GLU A 1 319 ? 119.37541 -17.20847 4.24768    1.000 87.70148  ? 319 GLU A OE2 1 
ATOM 2588  N N   . PRO A 1 320 ? 118.35094 -14.70431 7.55197    1.000 48.89769  ? 320 PRO A N   1 
ATOM 2589  C CA  . PRO A 1 320 ? 117.64220 -15.04747 8.79278    1.000 48.79300  ? 320 PRO A CA  1 
ATOM 2590  C C   . PRO A 1 320 ? 118.30521 -16.18377 9.55492    1.000 62.26369  ? 320 PRO A C   1 
ATOM 2591  O O   . PRO A 1 320 ? 118.24988 -17.33796 9.12059    1.000 70.69577  ? 320 PRO A O   1 
ATOM 2592  C CB  . PRO A 1 320 ? 116.24316 -15.44571 8.29960    1.000 48.41595  ? 320 PRO A CB  1 
ATOM 2593  C CG  . PRO A 1 320 ? 116.10853 -14.80138 6.95471    1.000 48.16769  ? 320 PRO A CG  1 
ATOM 2594  C CD  . PRO A 1 320 ? 117.48453 -14.80477 6.36695    1.000 48.63899  ? 320 PRO A CD  1 
ATOM 2595  N N   . TYR A 1 321 ? 118.92910 -15.87973 10.69097   1.000 78.28037  ? 321 TYR A N   1 
ATOM 2596  C CA  . TYR A 1 321 ? 119.48772 -16.90396 11.56723   1.000 69.81229  ? 321 TYR A CA  1 
ATOM 2597  C C   . TYR A 1 321 ? 118.60748 -16.94964 12.81374   1.000 57.82412  ? 321 TYR A C   1 
ATOM 2598  O O   . TYR A 1 321 ? 118.61212 -16.01879 13.62736   1.000 75.88864  ? 321 TYR A O   1 
ATOM 2599  C CB  . TYR A 1 321 ? 120.97946 -16.67474 11.85159   1.000 77.92245  ? 321 TYR A CB  1 
ATOM 2600  C CG  . TYR A 1 321 ? 121.39378 -15.90249 13.08559   1.000 101.87992 ? 321 TYR A CG  1 
ATOM 2601  C CD1 . TYR A 1 321 ? 121.48135 -16.52707 14.32575   1.000 115.53497 ? 321 TYR A CD1 1 
ATOM 2602  C CD2 . TYR A 1 321 ? 121.77347 -14.57171 12.99590   1.000 111.40767 ? 321 TYR A CD2 1 
ATOM 2603  C CE1 . TYR A 1 321 ? 121.88135 -15.83143 15.44957   1.000 110.99118 ? 321 TYR A CE1 1 
ATOM 2604  C CE2 . TYR A 1 321 ? 122.18322 -13.87257 14.10876   1.000 109.23772 ? 321 TYR A CE2 1 
ATOM 2605  C CZ  . TYR A 1 321 ? 122.23391 -14.50279 15.33482   1.000 88.50817  ? 321 TYR A CZ  1 
ATOM 2606  O OH  . TYR A 1 321 ? 122.64057 -13.79630 16.44487   1.000 51.07572  ? 321 TYR A OH  1 
ATOM 2607  N N   . ILE A 1 322 ? 117.79633 -18.00509 12.91353   1.000 60.79350  ? 322 ILE A N   1 
ATOM 2608  C CA  . ILE A 1 322 ? 116.70754 -18.05367 13.88138   1.000 58.42221  ? 322 ILE A CA  1 
ATOM 2609  C C   . ILE A 1 322 ? 117.28128 -18.27936 15.27277   1.000 56.89104  ? 322 ILE A C   1 
ATOM 2610  O O   . ILE A 1 322 ? 118.27536 -18.99850 15.44621   1.000 54.30586  ? 322 ILE A O   1 
ATOM 2611  C CB  . ILE A 1 322 ? 115.71646 -19.16545 13.48832   1.000 58.09347  ? 322 ILE A CB  1 
ATOM 2612  C CG1 . ILE A 1 322 ? 114.72388 -19.46942 14.61400   1.000 52.78737  ? 322 ILE A CG1 1 
ATOM 2613  C CG2 . ILE A 1 322 ? 116.46571 -20.42717 13.09532   1.000 58.11466  ? 322 ILE A CG2 1 
ATOM 2614  C CD1 . ILE A 1 322 ? 113.64643 -20.46298 14.22617   1.000 67.48596  ? 322 ILE A CD1 1 
ATOM 2615  N N   . VAL A 1 323 ? 116.66100 -17.66409 16.28037   1.000 51.86334  ? 323 VAL A N   1 
ATOM 2616  C CA  . VAL A 1 323 ? 117.21828 -17.74538 17.62366   1.000 52.70568  ? 323 VAL A CA  1 
ATOM 2617  C C   . VAL A 1 323 ? 116.32899 -18.58110 18.53182   1.000 71.59286  ? 323 VAL A C   1 
ATOM 2618  O O   . VAL A 1 323 ? 116.65382 -19.73244 18.84063   1.000 82.27697  ? 323 VAL A O   1 
ATOM 2619  C CB  . VAL A 1 323 ? 117.40709 -16.33921 18.22020   1.000 52.42172  ? 323 VAL A CB  1 
ATOM 2620  C CG1 . VAL A 1 323 ? 118.36917 -16.39195 19.38443   1.000 53.51646  ? 323 VAL A CG1 1 
ATOM 2621  C CG2 . VAL A 1 323 ? 117.87609 -15.35676 17.15801   1.000 51.79107  ? 323 VAL A CG2 1 
ATOM 2622  N N   . LYS A 1 324 ? 115.20441 -18.01820 18.96843   1.000 62.35952  ? 324 LYS A N   1 
ATOM 2623  C CA  . LYS A 1 324 ? 114.37085 -18.70267 19.94628   1.000 50.53287  ? 324 LYS A CA  1 
ATOM 2624  C C   . LYS A 1 324 ? 113.31170 -19.52638 19.22644   1.000 72.54596  ? 324 LYS A C   1 
ATOM 2625  O O   . LYS A 1 324 ? 112.50150 -18.95494 18.48556   1.000 111.29030 ? 324 LYS A O   1 
ATOM 2626  C CB  . LYS A 1 324 ? 113.72047 -17.71050 20.89448   1.000 50.19411  ? 324 LYS A CB  1 
ATOM 2627  C CG  . LYS A 1 324 ? 113.09697 -18.37024 22.10441   1.000 50.91703  ? 324 LYS A CG  1 
ATOM 2628  C CD  . LYS A 1 324 ? 111.59092 -18.35432 22.07018   1.000 50.22795  ? 324 LYS A CD  1 
ATOM 2629  C CE  . LYS A 1 324 ? 111.04820 -19.19671 23.20706   1.000 51.12247  ? 324 LYS A CE  1 
ATOM 2630  N NZ  . LYS A 1 324 ? 111.29850 -20.64677 22.99310   1.000 69.42431  ? 324 LYS A NZ  1 
ATOM 2631  N N   . PRO A 1 325 ? 113.27343 -20.83986 19.40507   1.000 64.07063  ? 325 PRO A N   1 
ATOM 2632  C CA  . PRO A 1 325 ? 112.25879 -21.66271 18.74109   1.000 76.04653  ? 325 PRO A CA  1 
ATOM 2633  C C   . PRO A 1 325 ? 110.95623 -21.66566 19.53660   1.000 84.07890  ? 325 PRO A C   1 
ATOM 2634  O O   . PRO A 1 325 ? 110.84477 -21.06205 20.60003   1.000 96.78944  ? 325 PRO A O   1 
ATOM 2635  C CB  . PRO A 1 325 ? 112.90776 -23.04573 18.71242   1.000 64.69550  ? 325 PRO A CB  1 
ATOM 2636  C CG  . PRO A 1 325 ? 113.73948 -23.06983 19.94773   1.000 54.28481  ? 325 PRO A CG  1 
ATOM 2637  C CD  . PRO A 1 325 ? 114.25702 -21.66165 20.13341   1.000 53.64715  ? 325 PRO A CD  1 
ATOM 2638  N N   . HIS A 1 326 ? 109.96164 -22.37137 18.99749   1.000 75.41247  ? 326 HIS A N   1 
ATOM 2639  C CA  . HIS A 1 326 ? 108.68337 -22.53668 19.67791   1.000 76.37999  ? 326 HIS A CA  1 
ATOM 2640  C C   . HIS A 1 326 ? 108.70246 -23.68817 20.67436   1.000 82.37053  ? 326 HIS A C   1 
ATOM 2641  O O   . HIS A 1 326 ? 107.75441 -23.82441 21.45642   1.000 83.11820  ? 326 HIS A O   1 
ATOM 2642  C CB  . HIS A 1 326 ? 107.56535 -22.75390 18.65356   1.000 83.36243  ? 326 HIS A CB  1 
ATOM 2643  C CG  . HIS A 1 326 ? 106.20327 -22.38733 19.15684   1.000 87.57016  ? 326 HIS A CG  1 
ATOM 2644  N ND1 . HIS A 1 326 ? 105.47674 -23.19766 20.00281   1.000 91.74769  ? 326 HIS A ND1 1 
ATOM 2645  C CD2 . HIS A 1 326 ? 105.43626 -21.29401 18.93345   1.000 86.24401  ? 326 HIS A CD2 1 
ATOM 2646  C CE1 . HIS A 1 326 ? 104.32072 -22.62001 20.27774   1.000 92.12667  ? 326 HIS A CE1 1 
ATOM 2647  N NE2 . HIS A 1 326 ? 104.27112 -21.46390 19.64105   1.000 87.18450  ? 326 HIS A NE2 1 
ATOM 2648  N N   . GLU A 1 327 ? 109.74066 -24.52802 20.62464   1.000 79.89603  ? 327 GLU A N   1 
ATOM 2649  C CA  . GLU A 1 327 ? 109.98417 -25.65389 21.52372   1.000 110.55794 ? 327 GLU A CA  1 
ATOM 2650  C C   . GLU A 1 327 ? 109.03418 -26.81731 21.26459   1.000 116.64936 ? 327 GLU A C   1 
ATOM 2651  O O   . GLU A 1 327 ? 109.24470 -27.91489 21.78954   1.000 118.01480 ? 327 GLU A O   1 
ATOM 2652  C CB  . GLU A 1 327 ? 109.87547 -25.21888 22.98969   1.000 125.40237 ? 327 GLU A CB  1 
ATOM 2653  C CG  . GLU A 1 327 ? 111.03920 -24.38703 23.49811   1.000 125.37341 ? 327 GLU A CG  1 
ATOM 2654  C CD  . GLU A 1 327 ? 110.85457 -23.96344 24.94298   1.000 117.86357 ? 327 GLU A CD  1 
ATOM 2655  O OE1 . GLU A 1 327 ? 109.77551 -24.23914 25.50948   1.000 112.11096 ? 327 GLU A OE1 1 
ATOM 2656  O OE2 . GLU A 1 327 ? 111.78664 -23.35728 25.51227   1.000 116.67479 ? 327 GLU A OE2 1 
ATOM 2657  N N   . LYS A 1 328 ? 108.01256 -26.59990 20.43373   1.000 113.17220 ? 328 LYS A N   1 
ATOM 2658  C CA  . LYS A 1 328 ? 107.06954 -27.65444 20.05509   1.000 122.69261 ? 328 LYS A CA  1 
ATOM 2659  C C   . LYS A 1 328 ? 106.50880 -27.29109 18.68279   1.000 112.64226 ? 328 LYS A C   1 
ATOM 2660  O O   . LYS A 1 328 ? 105.58427 -26.47903 18.58435   1.000 93.41137  ? 328 LYS A O   1 
ATOM 2661  C CB  . LYS A 1 328 ? 105.95783 -27.82389 21.08441   1.000 138.84489 ? 328 LYS A CB  1 
ATOM 2662  C CG  . LYS A 1 328 ? 106.35087 -28.63631 22.31068   1.000 148.51853 ? 328 LYS A CG  1 
ATOM 2663  C CD  . LYS A 1 328 ? 106.78239 -30.04379 21.91763   1.000 139.71694 ? 328 LYS A CD  1 
ATOM 2664  C CE  . LYS A 1 328 ? 107.27844 -30.83515 23.11842   1.000 127.41644 ? 328 LYS A CE  1 
ATOM 2665  N NZ  . LYS A 1 328 ? 107.86505 -32.14438 22.71621   1.000 113.18836 ? 328 LYS A NZ  1 
ATOM 2666  N N   . GLY A 1 329 ? 107.06920 -27.89091 17.63612   1.000 113.94038 ? 329 GLY A N   1 
ATOM 2667  C CA  . GLY A 1 329 ? 106.60324 -27.62540 16.28972   1.000 115.55929 ? 329 GLY A CA  1 
ATOM 2668  C C   . GLY A 1 329 ? 107.72362 -27.39635 15.29788   1.000 109.37557 ? 329 GLY A C   1 
ATOM 2669  O O   . GLY A 1 329 ? 108.89148 -27.28245 15.68275   1.000 101.78915 ? 329 GLY A O   1 
ATOM 2670  N N   . ILE A 1 330 ? 107.37723 -27.32363 14.01341   1.000 105.53928 ? 330 ILE A N   1 
ATOM 2671  C CA  . ILE A 1 330 ? 108.36348 -27.12985 12.95689   1.000 98.45046  ? 330 ILE A CA  1 
ATOM 2672  C C   . ILE A 1 330 ? 108.84406 -25.68563 12.97303   1.000 100.29859 ? 330 ILE A C   1 
ATOM 2673  O O   . ILE A 1 330 ? 108.13030 -24.77493 12.53651   1.000 141.14703 ? 330 ILE A O   1 
ATOM 2674  C CB  . ILE A 1 330 ? 107.78165 -27.49643 11.58061   1.000 98.98387  ? 330 ILE A CB  1 
ATOM 2675  C CG1 . ILE A 1 330 ? 107.09578 -28.86122 11.63920   1.000 85.80074  ? 330 ILE A CG1 1 
ATOM 2676  C CG2 . ILE A 1 330 ? 108.88196 -27.50671 10.53119   1.000 117.34139 ? 330 ILE A CG2 1 
ATOM 2677  C CD1 . ILE A 1 330 ? 106.35558 -29.22161 10.37205   1.000 80.01479  ? 330 ILE A CD1 1 
ATOM 2678  N N   . ASN A 1 331 ? 110.05614 -25.46977 13.47340   1.000 90.89007  ? 331 ASN A N   1 
ATOM 2679  C CA  . ASN A 1 331 ? 110.63179 -24.13533 13.59660   1.000 72.83338  ? 331 ASN A CA  1 
ATOM 2680  C C   . ASN A 1 331 ? 111.09485 -23.54692 12.26248   1.000 72.87139  ? 331 ASN A C   1 
ATOM 2681  O O   . ASN A 1 331 ? 110.81609 -22.36957 11.99943   1.000 81.70314  ? 331 ASN A O   1 
ATOM 2682  C CB  . ASN A 1 331 ? 111.78824 -24.15226 14.59919   1.000 68.76597  ? 331 ASN A CB  1 
ATOM 2683  C CG  . ASN A 1 331 ? 111.35515 -24.61540 15.97502   1.000 84.20636  ? 331 ASN A CG  1 
ATOM 2684  O OD1 . ASN A 1 331 ? 110.40212 -24.08581 16.54690   1.000 72.07614  ? 331 ASN A OD1 1 
ATOM 2685  N ND2 . ASN A 1 331 ? 112.05630 -25.60507 16.51693   1.000 108.22516 ? 331 ASN A ND2 1 
ATOM 2686  N N   . PRO A 1 332 ? 111.79897 -24.29261 11.39815   1.000 71.50391  ? 332 PRO A N   1 
ATOM 2687  C CA  . PRO A 1 332 ? 112.27523 -23.67823 10.14506   1.000 69.01580  ? 332 PRO A CA  1 
ATOM 2688  C C   . PRO A 1 332 ? 111.16265 -23.20152 9.22794    1.000 65.98089  ? 332 PRO A C   1 
ATOM 2689  O O   . PRO A 1 332 ? 111.42021 -22.35278 8.36356    1.000 76.06224  ? 332 PRO A O   1 
ATOM 2690  C CB  . PRO A 1 332 ? 113.09518 -24.79954 9.48979    1.000 72.05901  ? 332 PRO A CB  1 
ATOM 2691  C CG  . PRO A 1 332 ? 112.58711 -26.05226 10.10845   1.000 73.53798  ? 332 PRO A CG  1 
ATOM 2692  C CD  . PRO A 1 332 ? 112.29095 -25.67722 11.52318   1.000 77.89539  ? 332 PRO A CD  1 
ATOM 2693  N N   . ASN A 1 333 ? 109.93908 -23.71653 9.38102    1.000 60.25673  ? 333 ASN A N   1 
ATOM 2694  C CA  . ASN A 1 333 ? 108.83412 -23.22656 8.56389    1.000 67.12988  ? 333 ASN A CA  1 
ATOM 2695  C C   . ASN A 1 333 ? 108.56772 -21.74595 8.80576    1.000 78.46237  ? 333 ASN A C   1 
ATOM 2696  O O   . ASN A 1 333 ? 108.11623 -21.04675 7.89618    1.000 90.31772  ? 333 ASN A O   1 
ATOM 2697  C CB  . ASN A 1 333 ? 107.56952 -24.04750 8.81969    1.000 60.40080  ? 333 ASN A CB  1 
ATOM 2698  C CG  . ASN A 1 333 ? 107.52694 -25.32196 7.99713    1.000 61.59376  ? 333 ASN A CG  1 
ATOM 2699  O OD1 . ASN A 1 333 ? 108.19897 -25.43463 6.97178    1.000 62.78784  ? 333 ASN A OD1 1 
ATOM 2700  N ND2 . ASN A 1 333 ? 106.71858 -26.28164 8.43220    1.000 66.14527  ? 333 ASN A ND2 1 
ATOM 2701  N N   . TYR A 1 334 ? 108.85945 -21.24273 10.00779   1.000 50.00005  ? 334 TYR A N   1 
ATOM 2702  C CA  . TYR A 1 334 ? 108.65088 -19.82293 10.28535   1.000 46.82476  ? 334 TYR A CA  1 
ATOM 2703  C C   . TYR A 1 334 ? 109.59404 -18.95314 9.45896    1.000 52.42224  ? 334 TYR A C   1 
ATOM 2704  O O   . TYR A 1 334 ? 109.16282 -17.99125 8.80720    1.000 72.23091  ? 334 TYR A O   1 
ATOM 2705  C CB  . TYR A 1 334 ? 108.82686 -19.55023 11.77896   1.000 46.77139  ? 334 TYR A CB  1 
ATOM 2706  C CG  . TYR A 1 334 ? 107.71878 -20.12138 12.63139   1.000 46.95988  ? 334 TYR A CG  1 
ATOM 2707  C CD1 . TYR A 1 334 ? 106.45020 -19.56123 12.61363   1.000 46.41523  ? 334 TYR A CD1 1 
ATOM 2708  C CD2 . TYR A 1 334 ? 107.93879 -21.22009 13.45121   1.000 56.96043  ? 334 TYR A CD2 1 
ATOM 2709  C CE1 . TYR A 1 334 ? 105.43092 -20.07484 13.38769   1.000 46.62792  ? 334 TYR A CE1 1 
ATOM 2710  C CE2 . TYR A 1 334 ? 106.92315 -21.74284 14.23118   1.000 70.14007  ? 334 TYR A CE2 1 
ATOM 2711  C CZ  . TYR A 1 334 ? 105.67096 -21.16559 14.19474   1.000 55.81803  ? 334 TYR A CZ  1 
ATOM 2712  O OH  . TYR A 1 334 ? 104.65409 -21.67888 14.96752   1.000 55.75350  ? 334 TYR A OH  1 
ATOM 2713  N N   . LEU A 1 335 ? 110.88975 -19.27480 9.47100    1.000 46.94757  ? 335 LEU A N   1 
ATOM 2714  C CA  . LEU A 1 335 ? 111.83071 -18.49596 8.67541    1.000 46.76059  ? 335 LEU A CA  1 
ATOM 2715  C C   . LEU A 1 335 ? 111.60223 -18.71200 7.18528    1.000 52.25591  ? 335 LEU A C   1 
ATOM 2716  O O   . LEU A 1 335 ? 111.82675 -17.79509 6.38694    1.000 80.30937  ? 335 LEU A O   1 
ATOM 2717  C CB  . LEU A 1 335 ? 113.27039 -18.84186 9.06479    1.000 47.28236  ? 335 LEU A CB  1 
ATOM 2718  C CG  . LEU A 1 335 ? 113.86448 -20.20567 8.70254    1.000 63.01095  ? 335 LEU A CG  1 
ATOM 2719  C CD1 . LEU A 1 335 ? 114.68317 -20.12324 7.42070    1.000 79.54159  ? 335 LEU A CD1 1 
ATOM 2720  C CD2 . LEU A 1 335 ? 114.71107 -20.73742 9.84607    1.000 74.94546  ? 335 LEU A CD2 1 
ATOM 2721  N N   . LEU A 1 336 ? 111.12835 -19.89888 6.79448    1.000 47.43715  ? 336 LEU A N   1 
ATOM 2722  C CA  . LEU A 1 336 ? 110.74949 -20.11159 5.40066    1.000 47.66639  ? 336 LEU A CA  1 
ATOM 2723  C C   . LEU A 1 336 ? 109.57127 -19.22798 5.00783    1.000 47.12517  ? 336 LEU A C   1 
ATOM 2724  O O   . LEU A 1 336 ? 109.54826 -18.66627 3.90779    1.000 47.08954  ? 336 LEU A O   1 
ATOM 2725  C CB  . LEU A 1 336 ? 110.42239 -21.58500 5.15911    1.000 48.48613  ? 336 LEU A CB  1 
ATOM 2726  C CG  . LEU A 1 336 ? 111.52562 -22.40812 4.49146    1.000 49.23248  ? 336 LEU A CG  1 
ATOM 2727  C CD1 . LEU A 1 336 ? 112.73761 -22.52416 5.39765    1.000 49.36135  ? 336 LEU A CD1 1 
ATOM 2728  C CD2 . LEU A 1 336 ? 111.01261 -23.78410 4.10003    1.000 50.10882  ? 336 LEU A CD2 1 
ATOM 2729  N N   . SER A 1 337 ? 108.58721 -19.08408 5.89885    1.000 47.88156  ? 337 SER A N   1 
ATOM 2730  C CA  . SER A 1 337 ? 107.45432 -18.20565 5.62580    1.000 47.39049  ? 337 SER A CA  1 
ATOM 2731  C C   . SER A 1 337 ? 107.89282 -16.74934 5.54191    1.000 46.78560  ? 337 SER A C   1 
ATOM 2732  O O   . SER A 1 337 ? 107.37858 -15.98595 4.71791    1.000 54.85387  ? 337 SER A O   1 
ATOM 2733  C CB  . SER A 1 337 ? 106.38302 -18.38261 6.70289    1.000 47.18517  ? 337 SER A CB  1 
ATOM 2734  O OG  . SER A 1 337 ? 105.92724 -19.72378 6.76232    1.000 47.84916  ? 337 SER A OG  1 
ATOM 2735  N N   . TRP A 1 338 ? 108.84578 -16.34533 6.38307    1.000 47.17533  ? 338 TRP A N   1 
ATOM 2736  C CA  . TRP A 1 338 ? 109.34988 -14.97546 6.30598    1.000 46.56377  ? 338 TRP A CA  1 
ATOM 2737  C C   . TRP A 1 338 ? 110.10281 -14.73034 4.99962    1.000 54.97089  ? 338 TRP A C   1 
ATOM 2738  O O   . TRP A 1 338 ? 109.95029 -13.67132 4.36847    1.000 69.07530  ? 338 TRP A O   1 
ATOM 2739  C CB  . TRP A 1 338 ? 110.24645 -14.67347 7.50342    1.000 46.37968  ? 338 TRP A CB  1 
ATOM 2740  C CG  . TRP A 1 338 ? 111.00516 -13.40624 7.33250    1.000 46.44591  ? 338 TRP A CG  1 
ATOM 2741  C CD1 . TRP A 1 338 ? 112.34575 -13.27509 7.13632    1.000 47.51155  ? 338 TRP A CD1 1 
ATOM 2742  C CD2 . TRP A 1 338 ? 110.46320 -12.08025 7.31082    1.000 47.54004  ? 338 TRP A CD2 1 
ATOM 2743  N NE1 . TRP A 1 338 ? 112.67362 -11.95049 7.00143    1.000 47.40608  ? 338 TRP A NE1 1 
ATOM 2744  C CE2 . TRP A 1 338 ? 111.53808 -11.19495 7.11182    1.000 47.59626  ? 338 TRP A CE2 1 
ATOM 2745  C CE3 . TRP A 1 338 ? 109.17405 -11.55630 7.44632    1.000 51.22035  ? 338 TRP A CE3 1 
ATOM 2746  C CZ2 . TRP A 1 338 ? 111.36740 -9.81522  7.04559    1.000 55.71052  ? 338 TRP A CZ2 1 
ATOM 2747  C CZ3 . TRP A 1 338 ? 109.00615 -10.18603 7.38308    1.000 59.72848  ? 338 TRP A CZ3 1 
ATOM 2748  C CH2 . TRP A 1 338 ? 110.09652 -9.33110  7.18321    1.000 63.12504  ? 338 TRP A CH2 1 
ATOM 2749  N N   . LYS A 1 339 ? 110.93545 -15.69037 4.58938    1.000 45.85055  ? 339 LYS A N   1 
ATOM 2750  C CA  . LYS A 1 339 ? 111.60870 -15.58351 3.29990    1.000 46.21889  ? 339 LYS A CA  1 
ATOM 2751  C C   . LYS A 1 339 ? 110.59693 -15.52551 2.16410    1.000 46.39052  ? 339 LYS A C   1 
ATOM 2752  O O   . LYS A 1 339 ? 110.78962 -14.79398 1.18638    1.000 53.64535  ? 339 LYS A O   1 
ATOM 2753  C CB  . LYS A 1 339 ? 112.56889 -16.75703 3.10969    1.000 47.88964  ? 339 LYS A CB  1 
ATOM 2754  C CG  . LYS A 1 339 ? 113.78199 -16.72198 4.02553    1.000 61.20716  ? 339 LYS A CG  1 
ATOM 2755  C CD  . LYS A 1 339 ? 114.75458 -17.84295 3.69718    1.000 75.09178  ? 339 LYS A CD  1 
ATOM 2756  C CE  . LYS A 1 339 ? 115.95805 -17.81763 4.62470    1.000 91.93068  ? 339 LYS A CE  1 
ATOM 2757  N NZ  . LYS A 1 339 ? 116.92479 -18.90395 4.30680    1.000 100.99690 ? 339 LYS A NZ  1 
ATOM 2758  N N   . GLN A 1 340 ? 109.51096 -16.29418 2.27757    1.000 51.35578  ? 340 GLN A N   1 
ATOM 2759  C CA  . GLN A 1 340 ? 108.43881 -16.22056 1.29163    1.000 51.11327  ? 340 GLN A CA  1 
ATOM 2760  C C   . GLN A 1 340 ? 107.80312 -14.83704 1.27435    1.000 49.81611  ? 340 GLN A C   1 
ATOM 2761  O O   . GLN A 1 340 ? 107.44727 -14.32456 0.20921    1.000 54.13934  ? 340 GLN A O   1 
ATOM 2762  C CB  . GLN A 1 340 ? 107.38622 -17.29136 1.57818    1.000 51.49095  ? 340 GLN A CB  1 
ATOM 2763  C CG  . GLN A 1 340 ? 106.15256 -17.19382 0.69704    1.000 51.16690  ? 340 GLN A CG  1 
ATOM 2764  C CD  . GLN A 1 340 ? 105.16437 -18.31275 0.94863    1.000 58.95570  ? 340 GLN A CD  1 
ATOM 2765  O OE1 . GLN A 1 340 ? 105.43919 -19.24110 1.70906    1.000 55.97282  ? 340 GLN A OE1 1 
ATOM 2766  N NE2 . GLN A 1 340 ? 104.00252 -18.22903 0.31078    1.000 69.58272  ? 340 GLN A NE2 1 
ATOM 2767  N N   . VAL A 1 341 ? 107.63952 -14.22403 2.44801    1.000 46.10418  ? 341 VAL A N   1 
ATOM 2768  C CA  . VAL A 1 341 ? 107.09890 -12.86695 2.51224    1.000 45.64487  ? 341 VAL A CA  1 
ATOM 2769  C C   . VAL A 1 341 ? 107.98723 -11.90901 1.72954    1.000 45.75656  ? 341 VAL A C   1 
ATOM 2770  O O   . VAL A 1 341 ? 107.51423 -11.14924 0.87423    1.000 51.58401  ? 341 VAL A O   1 
ATOM 2771  C CB  . VAL A 1 341 ? 106.94412 -12.41753 3.97674    1.000 45.00865  ? 341 VAL A CB  1 
ATOM 2772  C CG1 . VAL A 1 341 ? 106.76763 -10.90856 4.05503    1.000 44.60498  ? 341 VAL A CG1 1 
ATOM 2773  C CG2 . VAL A 1 341 ? 105.77008 -13.12547 4.62820    1.000 44.93244  ? 341 VAL A CG2 1 
ATOM 2774  N N   . LEU A 1 342 ? 109.29324 -11.94059 2.00753    1.000 46.20899  ? 342 LEU A N   1 
ATOM 2775  C CA  . LEU A 1 342 ? 110.21585 -11.04972 1.30235    1.000 46.38734  ? 342 LEU A CA  1 
ATOM 2776  C C   . LEU A 1 342 ? 110.22574 -11.32617 -0.19912   1.000 47.06506  ? 342 LEU A C   1 
ATOM 2777  O O   . LEU A 1 342 ? 110.27949 -10.39215 -1.01302   1.000 47.28903  ? 342 LEU A O   1 
ATOM 2778  C CB  . LEU A 1 342 ? 111.62428 -11.17250 1.88149    1.000 46.39028  ? 342 LEU A CB  1 
ATOM 2779  C CG  . LEU A 1 342 ? 111.84887 -10.44784 3.20899    1.000 45.88456  ? 342 LEU A CG  1 
ATOM 2780  C CD1 . LEU A 1 342 ? 113.29465 -10.57709 3.66055    1.000 46.07968  ? 342 LEU A CD1 1 
ATOM 2781  C CD2 . LEU A 1 342 ? 111.45378 -8.98523  3.08136    1.000 45.64120  ? 342 LEU A CD2 1 
ATOM 2782  N N   . ALA A 1 343 ? 110.15893 -12.60129 -0.58601   1.000 49.56287  ? 343 ALA A N   1 
ATOM 2783  C CA  . ALA A 1 343 ? 110.18243 -12.95014 -2.00251   1.000 50.33382  ? 343 ALA A CA  1 
ATOM 2784  C C   . ALA A 1 343 ? 108.93187 -12.44899 -2.71302   1.000 50.55520  ? 343 ALA A C   1 
ATOM 2785  O O   . ALA A 1 343 ? 109.02097 -11.82639 -3.77581   1.000 51.05083  ? 343 ALA A O   1 
ATOM 2786  C CB  . ALA A 1 343 ? 110.33119 -14.46201 -2.16784   1.000 50.82675  ? 343 ALA A CB  1 
ATOM 2787  N N   . GLU A 1 344 ? 107.75379 -12.72877 -2.14952   1.000 47.46184  ? 344 GLU A N   1 
ATOM 2788  C CA  . GLU A 1 344 ? 106.51165 -12.24022 -2.73721   1.000 59.90559  ? 344 GLU A CA  1 
ATOM 2789  C C   . GLU A 1 344 ? 106.46553 -10.71826 -2.76787   1.000 54.15641  ? 344 GLU A C   1 
ATOM 2790  O O   . GLU A 1 344 ? 105.83851 -10.13748 -3.66091   1.000 57.81904  ? 344 GLU A O   1 
ATOM 2791  C CB  . GLU A 1 344 ? 105.31068 -12.79063 -1.96674   1.000 85.77133  ? 344 GLU A CB  1 
ATOM 2792  C CG  . GLU A 1 344 ? 105.21321 -14.31097 -1.94301   1.000 99.65585  ? 344 GLU A CG  1 
ATOM 2793  C CD  . GLU A 1 344 ? 104.65817 -14.89060 -3.22810   1.000 102.82948 ? 344 GLU A CD  1 
ATOM 2794  O OE1 . GLU A 1 344 ? 103.75056 -14.26772 -3.81844   1.000 104.15889 ? 344 GLU A OE1 1 
ATOM 2795  O OE2 . GLU A 1 344 ? 105.12345 -15.97471 -3.64152   1.000 97.59341  ? 344 GLU A OE2 1 
ATOM 2796  N N   . LEU A 1 345 ? 107.11976 -10.05451 -1.81056   1.000 46.57248  ? 345 LEU A N   1 
ATOM 2797  C CA  . LEU A 1 345 ? 107.20486 -8.59812  -1.85888   1.000 46.41913  ? 345 LEU A CA  1 
ATOM 2798  C C   . LEU A 1 345 ? 108.03755 -8.13830  -3.04789   1.000 47.09992  ? 345 LEU A C   1 
ATOM 2799  O O   . LEU A 1 345 ? 107.59296 -7.30389  -3.84472   1.000 47.55902  ? 345 LEU A O   1 
ATOM 2800  C CB  . LEU A 1 345 ? 107.78769 -8.05611  -0.55591   1.000 45.67652  ? 345 LEU A CB  1 
ATOM 2801  C CG  . LEU A 1 345 ? 106.83426 -7.95107  0.63188    1.000 45.03113  ? 345 LEU A CG  1 
ATOM 2802  C CD1 . LEU A 1 345 ? 107.58252 -7.43553  1.84737    1.000 44.48751  ? 345 LEU A CD1 1 
ATOM 2803  C CD2 . LEU A 1 345 ? 105.66023 -7.04698  0.29427    1.000 45.09369  ? 345 LEU A CD2 1 
ATOM 2804  N N   . GLN A 1 346 ? 109.25264 -8.66973  -3.18392   1.000 47.25588  ? 346 GLN A N   1 
ATOM 2805  C CA  . GLN A 1 346 ? 110.11509 -8.25794  -4.28856   1.000 55.02165  ? 346 GLN A CA  1 
ATOM 2806  C C   . GLN A 1 346 ? 109.63763 -8.77246  -5.64185   1.000 66.11648  ? 346 GLN A C   1 
ATOM 2807  O O   . GLN A 1 346 ? 110.15207 -8.32130  -6.67092   1.000 72.66330  ? 346 GLN A O   1 
ATOM 2808  C CB  . GLN A 1 346 ? 111.56030 -8.70623  -4.04977   1.000 71.01355  ? 346 GLN A CB  1 
ATOM 2809  C CG  . GLN A 1 346 ? 112.37436 -7.84022  -3.08627   1.000 78.96776  ? 346 GLN A CG  1 
ATOM 2810  C CD  . GLN A 1 346 ? 111.57296 -7.27913  -1.93002   1.000 97.68795  ? 346 GLN A CD  1 
ATOM 2811  O OE1 . GLN A 1 346 ? 111.34793 -6.07114  -1.84672   1.000 104.70133 ? 346 GLN A OE1 1 
ATOM 2812  N NE2 . GLN A 1 346 ? 111.15982 -8.14907  -1.01625   1.000 106.60433 ? 346 GLN A NE2 1 
ATOM 2813  N N   . ASP A 1 347 ? 108.66563 -9.68817  -5.67054   1.000 75.56969  ? 347 ASP A N   1 
ATOM 2814  C CA  . ASP A 1 347 ? 108.18943 -10.29086 -6.91113   1.000 64.87921  ? 347 ASP A CA  1 
ATOM 2815  C C   . ASP A 1 347 ? 106.96551 -9.58518  -7.48625   1.000 75.75135  ? 347 ASP A C   1 
ATOM 2816  O O   . ASP A 1 347 ? 106.15115 -10.22311 -8.16724   1.000 86.73773  ? 347 ASP A O   1 
ATOM 2817  C CB  . ASP A 1 347 ? 107.88876 -11.77370 -6.68947   1.000 56.84652  ? 347 ASP A CB  1 
ATOM 2818  C CG  . ASP A 1 347 ? 109.14273 -12.62551 -6.66259   1.000 65.03050  ? 347 ASP A CG  1 
ATOM 2819  O OD1 . ASP A 1 347 ? 110.11597 -12.27881 -7.36453   1.000 67.48229  ? 347 ASP A OD1 1 
ATOM 2820  O OD2 . ASP A 1 347 ? 109.15356 -13.64501 -5.94145   1.000 66.69958  ? 347 ASP A OD2 1 
ATOM 2821  N N   . ILE A 1 348 ? 106.80786 -8.28933  -7.22760   1.000 83.32870  ? 348 ILE A N   1 
ATOM 2822  C CA  . ILE A 1 348 ? 105.69109 -7.54426  -7.79808   1.000 77.60077  ? 348 ILE A CA  1 
ATOM 2823  C C   . ILE A 1 348 ? 106.04510 -6.96373  -9.16734   1.000 80.37498  ? 348 ILE A C   1 
ATOM 2824  O O   . ILE A 1 348 ? 105.16501 -6.81253  -10.02185  1.000 82.00917  ? 348 ILE A O   1 
ATOM 2825  C CB  . ILE A 1 348 ? 105.23485 -6.44104  -6.82495   1.000 53.99439  ? 348 ILE A CB  1 
ATOM 2826  C CG1 . ILE A 1 348 ? 104.82914 -7.05087  -5.48102   1.000 52.50029  ? 348 ILE A CG1 1 
ATOM 2827  C CG2 . ILE A 1 348 ? 104.07015 -5.65070  -7.40197   1.000 64.71176  ? 348 ILE A CG2 1 
ATOM 2828  C CD1 . ILE A 1 348 ? 104.39935 -6.03242  -4.44513   1.000 51.73189  ? 348 ILE A CD1 1 
ATOM 2829  N N   . GLU A 1 349 ? 107.32303 -6.66148  -9.40736   1.000 76.17169  ? 349 GLU A N   1 
ATOM 2830  C CA  . GLU A 1 349 ? 107.74721 -6.08960  -10.68030  1.000 72.99756  ? 349 GLU A CA  1 
ATOM 2831  C C   . GLU A 1 349 ? 107.58028 -7.04715  -11.85391  1.000 83.38444  ? 349 GLU A C   1 
ATOM 2832  O O   . GLU A 1 349 ? 107.73905 -6.62037  -13.00245  1.000 90.55473  ? 349 GLU A O   1 
ATOM 2833  C CB  . GLU A 1 349 ? 109.20405 -5.62854  -10.58314  1.000 84.64636  ? 349 GLU A CB  1 
ATOM 2834  C CG  . GLU A 1 349 ? 109.39218 -4.29674  -9.85863   1.000 119.76818 ? 349 GLU A CG  1 
ATOM 2835  C CD  . GLU A 1 349 ? 109.25504 -4.40530  -8.34604   1.000 158.06513 ? 349 GLU A CD  1 
ATOM 2836  O OE1 . GLU A 1 349 ? 108.83624 -5.47200  -7.84764   1.000 168.95948 ? 349 GLU A OE1 1 
ATOM 2837  O OE2 . GLU A 1 349 ? 109.55909 -3.41184  -7.65193   1.000 173.85642 ? 349 GLU A OE2 1 
ATOM 2838  N N   . ASN A 1 350 ? 107.26794 -8.31679  -11.60390  1.000 82.04073  ? 350 ASN A N   1 
ATOM 2839  C CA  . ASN A 1 350 ? 106.98651 -9.25684  -12.67935  1.000 102.89419 ? 350 ASN A CA  1 
ATOM 2840  C C   . ASN A 1 350 ? 105.50402 -9.33369  -13.01301  1.000 112.65740 ? 350 ASN A C   1 
ATOM 2841  O O   . ASN A 1 350 ? 105.14640 -9.87756  -14.06353  1.000 119.12115 ? 350 ASN A O   1 
ATOM 2842  C CB  . ASN A 1 350 ? 107.49078 -10.65746 -12.31527  1.000 109.29569 ? 350 ASN A CB  1 
ATOM 2843  C CG  . ASN A 1 350 ? 108.94940 -10.66758 -11.91145  1.000 122.90908 ? 350 ASN A CG  1 
ATOM 2844  O OD1 . ASN A 1 350 ? 109.73861 -9.83944  -12.36544  1.000 144.10445 ? 350 ASN A OD1 1 
ATOM 2845  N ND2 . ASN A 1 350 ? 109.31683 -11.61178 -11.05324  1.000 114.90707 ? 350 ASN A ND2 1 
ATOM 2846  N N   . GLU A 1 351 ? 104.63998 -8.80568  -12.14552  1.000 111.36734 ? 351 GLU A N   1 
ATOM 2847  C CA  . GLU A 1 351 ? 103.20089 -8.92427  -12.33044  1.000 107.30438 ? 351 GLU A CA  1 
ATOM 2848  C C   . GLU A 1 351 ? 102.65808 -7.94402  -13.36309  1.000 95.54823  ? 351 GLU A C   1 
ATOM 2849  O O   . GLU A 1 351 ? 101.55316 -8.15742  -13.87539  1.000 110.39935 ? 351 GLU A O   1 
ATOM 2850  C CB  . GLU A 1 351 ? 102.50201 -8.72077  -10.98286  1.000 112.41858 ? 351 GLU A CB  1 
ATOM 2851  C CG  . GLU A 1 351 ? 101.13645 -9.37224  -10.85465  1.000 114.30666 ? 351 GLU A CG  1 
ATOM 2852  C CD  . GLU A 1 351 ? 100.74620 -9.59491  -9.40411   1.000 97.68717  ? 351 GLU A CD  1 
ATOM 2853  O OE1 . GLU A 1 351 ? 101.56041 -9.26398  -8.51576   1.000 87.54615  ? 351 GLU A OE1 1 
ATOM 2854  O OE2 . GLU A 1 351 ? 99.63208  -10.09907 -9.15055   1.000 90.66604  ? 351 GLU A OE2 1 
ATOM 2855  N N   . GLU A 1 352 ? 103.39331 -6.86386  -13.64644  1.000 65.02122  ? 352 GLU A N   1 
ATOM 2856  C CA  . GLU A 1 352 ? 103.06520 -5.87751  -14.67484  1.000 65.43130  ? 352 GLU A CA  1 
ATOM 2857  C C   . GLU A 1 352 ? 101.81462 -5.07740  -14.31542  1.000 65.38519  ? 352 GLU A C   1 
ATOM 2858  O O   . GLU A 1 352 ? 101.47146 -4.10808  -15.00000  1.000 66.39843  ? 352 GLU A O   1 
ATOM 2859  C CB  . GLU A 1 352 ? 102.89900 -6.56537  -16.03659  1.000 99.01366  ? 352 GLU A CB  1 
ATOM 2860  C CG  . GLU A 1 352 ? 102.90097 -5.63208  -17.23822  1.000 127.23490 ? 352 GLU A CG  1 
ATOM 2861  C CD  . GLU A 1 352 ? 103.02302 -6.38090  -18.54926  1.000 132.07026 ? 352 GLU A CD  1 
ATOM 2862  O OE1 . GLU A 1 352 ? 103.38976 -7.57424  -18.51776  1.000 128.12683 ? 352 GLU A OE1 1 
ATOM 2863  O OE2 . GLU A 1 352 ? 102.75309 -5.77851  -19.60948  1.000 132.32207 ? 352 GLU A OE2 1 
ATOM 2864  N N   . LYS A 1 353 ? 101.14790 -5.45561  -13.22660  1.000 64.32807  ? 353 LYS A N   1 
ATOM 2865  C CA  . LYS A 1 353 ? 99.99311  -4.72617  -12.71067  1.000 64.09992  ? 353 LYS A CA  1 
ATOM 2866  C C   . LYS A 1 353 ? 99.96862  -4.89756  -11.20029  1.000 62.39658  ? 353 LYS A C   1 
ATOM 2867  O O   . LYS A 1 353 ? 99.86907  -6.02692  -10.71074  1.000 61.86374  ? 353 LYS A O   1 
ATOM 2868  C CB  . LYS A 1 353 ? 98.68676  -5.22738  -13.33503  1.000 65.21883  ? 353 LYS A CB  1 
ATOM 2869  C CG  . LYS A 1 353 ? 98.35409  -4.60390  -14.68303  1.000 67.03088  ? 353 LYS A CG  1 
ATOM 2870  C CD  . LYS A 1 353 ? 96.91773  -4.88904  -15.08597  1.000 68.07357  ? 353 LYS A CD  1 
ATOM 2871  C CE  . LYS A 1 353 ? 96.54105  -4.14169  -16.35240  1.000 87.17678  ? 353 LYS A CE  1 
ATOM 2872  N NZ  . LYS A 1 353 ? 95.10998  -4.35375  -16.69782  1.000 76.08086  ? 353 LYS A NZ  1 
ATOM 2873  N N   . ILE A 1 354 ? 100.05563 -3.79514  -10.46903  1.000 60.09365  ? 354 ILE A N   1 
ATOM 2874  C CA  . ILE A 1 354 ? 100.20022 -3.86919  -9.01355   1.000 75.60298  ? 354 ILE A CA  1 
ATOM 2875  C C   . ILE A 1 354 ? 98.84754  -4.23825  -8.40600   1.000 76.45698  ? 354 ILE A C   1 
ATOM 2876  O O   . ILE A 1 354 ? 97.82914  -3.62686  -8.76611   1.000 71.28248  ? 354 ILE A O   1 
ATOM 2877  C CB  . ILE A 1 354 ? 100.71798 -2.54470  -8.46555   1.000 73.70617  ? 354 ILE A CB  1 
ATOM 2878  C CG1 . ILE A 1 354 ? 101.66401 -1.90242  -9.48342   1.000 58.93747  ? 354 ILE A CG1 1 
ATOM 2879  C CG2 . ILE A 1 354 ? 101.49818 -2.77821  -7.18852   1.000 83.80268  ? 354 ILE A CG2 1 
ATOM 2880  C CD1 . ILE A 1 354 ? 102.36146 -0.65147  -8.98771   1.000 68.56473  ? 354 ILE A CD1 1 
ATOM 2881  N N   . PRO A 1 355 ? 98.79439  -5.21198  -7.48995   1.000 57.40220  ? 355 PRO A N   1 
ATOM 2882  C CA  . PRO A 1 355 ? 97.51651  -5.85179  -7.13901   1.000 85.51063  ? 355 PRO A CA  1 
ATOM 2883  C C   . PRO A 1 355 ? 96.68380  -5.22088  -6.03050   1.000 78.25443  ? 355 PRO A C   1 
ATOM 2884  O O   . PRO A 1 355 ? 95.53254  -5.64742  -5.85701   1.000 69.82850  ? 355 PRO A O   1 
ATOM 2885  C CB  . PRO A 1 355 ? 97.96240  -7.26597  -6.69878   1.000 92.85103  ? 355 PRO A CB  1 
ATOM 2886  C CG  . PRO A 1 355 ? 99.43569  -7.36579  -7.04200   1.000 58.46386  ? 355 PRO A CG  1 
ATOM 2887  C CD  . PRO A 1 355 ? 99.93743  -5.97009  -6.96350   1.000 56.64956  ? 355 PRO A CD  1 
ATOM 2888  N N   . ARG A 1 356 ? 97.23066  -4.27565  -5.25878   1.000 71.23942  ? 356 ARG A N   1 
ATOM 2889  C CA  . ARG A 1 356 ? 96.57669  -3.64868  -4.10635   1.000 71.68532  ? 356 ARG A CA  1 
ATOM 2890  C C   . ARG A 1 356 ? 96.48015  -4.59152  -2.90904   1.000 77.60756  ? 356 ARG A C   1 
ATOM 2891  O O   . ARG A 1 356 ? 96.18316  -4.15135  -1.79434   1.000 77.20127  ? 356 ARG A O   1 
ATOM 2892  C CB  . ARG A 1 356 ? 95.16327  -3.15654  -4.44793   1.000 71.18738  ? 356 ARG A CB  1 
ATOM 2893  C CG  . ARG A 1 356 ? 95.03774  -2.19281  -5.61230   1.000 79.96666  ? 356 ARG A CG  1 
ATOM 2894  C CD  . ARG A 1 356 ? 93.55922  -1.96384  -5.92345   1.000 55.86542  ? 356 ARG A CD  1 
ATOM 2895  N NE  . ARG A 1 356 ? 93.34881  -1.14904  -7.11692   1.000 57.23636  ? 356 ARG A NE  1 
ATOM 2896  C CZ  . ARG A 1 356 ? 92.98493  0.12938   -7.09386   1.000 57.52695  ? 356 ARG A CZ  1 
ATOM 2897  N NH1 . ARG A 1 356 ? 92.78063  0.73968   -5.93428   1.000 56.50410  ? 356 ARG A NH1 1 
ATOM 2898  N NH2 . ARG A 1 356 ? 92.81831  0.79590   -8.22903   1.000 58.93791  ? 356 ARG A NH2 1 
ATOM 2899  N N   . THR A 1 357 ? 96.77880  -5.87279  -3.12084   1.000 84.64857  ? 357 THR A N   1 
ATOM 2900  C CA  . THR A 1 357 ? 96.65606  -6.91359  -2.09891   1.000 75.81101  ? 357 THR A CA  1 
ATOM 2901  C C   . THR A 1 357 ? 97.47021  -8.10627  -2.56637   1.000 56.55189  ? 357 THR A C   1 
ATOM 2902  O O   . THR A 1 357 ? 97.22337  -8.62669  -3.65869   1.000 58.72903  ? 357 THR A O   1 
ATOM 2903  C CB  . THR A 1 357 ? 95.19096  -7.33459  -1.87086   1.000 79.92352  ? 357 THR A CB  1 
ATOM 2904  O OG1 . THR A 1 357 ? 94.48343  -7.33416  -3.11910   1.000 81.16794  ? 357 THR A OG1 1 
ATOM 2905  C CG2 . THR A 1 357 ? 94.47942  -6.45328  -0.84227   1.000 82.15673  ? 357 THR A CG2 1 
ATOM 2906  N N   . LYS A 1 358 ? 98.42776  -8.54291  -1.74957   1.000 49.98263  ? 358 LYS A N   1 
ATOM 2907  C CA  . LYS A 1 358 ? 99.28703  -9.67071  -2.09300   1.000 62.08620  ? 358 LYS A CA  1 
ATOM 2908  C C   . LYS A 1 358 ? 98.70055  -10.94045 -1.48871   1.000 61.25133  ? 358 LYS A C   1 
ATOM 2909  O O   . LYS A 1 358 ? 98.66058  -11.09551 -0.26300   1.000 48.68700  ? 358 LYS A O   1 
ATOM 2910  C CB  . LYS A 1 358 ? 100.72195 -9.44875  -1.62209   1.000 67.62222  ? 358 LYS A CB  1 
ATOM 2911  C CG  . LYS A 1 358 ? 101.69099 -10.38366 -2.31879   1.000 64.90009  ? 358 LYS A CG  1 
ATOM 2912  C CD  . LYS A 1 358 ? 101.51850 -10.25702 -3.82613   1.000 59.10110  ? 358 LYS A CD  1 
ATOM 2913  C CE  . LYS A 1 358 ? 102.39927 -11.22575 -4.59497   1.000 60.52954  ? 358 LYS A CE  1 
ATOM 2914  N NZ  . LYS A 1 358 ? 102.15182 -11.15697 -6.06700   1.000 65.21580  ? 358 LYS A NZ  1 
ATOM 2915  N N   . ASN A 1 359 ? 98.24954  -11.84186 -2.35445   1.000 58.62824  ? 359 ASN A N   1 
ATOM 2916  C CA  . ASN A 1 359 ? 97.71227  -13.13338 -1.94374   1.000 72.42102  ? 359 ASN A CA  1 
ATOM 2917  C C   . ASN A 1 359 ? 98.84430  -14.15466 -1.93645   1.000 70.66137  ? 359 ASN A C   1 
ATOM 2918  O O   . ASN A 1 359 ? 99.35180  -14.53772 -2.99563   1.000 78.07145  ? 359 ASN A O   1 
ATOM 2919  C CB  . ASN A 1 359 ? 96.57982  -13.55560 -2.87507   1.000 89.44421  ? 359 ASN A CB  1 
ATOM 2920  C CG  . ASN A 1 359 ? 95.49368  -12.50209 -2.97745   1.000 95.48393  ? 359 ASN A CG  1 
ATOM 2921  O OD1 . ASN A 1 359 ? 95.19079  -11.81188 -2.00367   1.000 76.38880  ? 359 ASN A OD1 1 
ATOM 2922  N ND2 . ASN A 1 359 ? 94.90148  -12.37259 -4.15951   1.000 111.43446 ? 359 ASN A ND2 1 
ATOM 2923  N N   . MET A 1 360 ? 99.24305  -14.58622 -0.74307   1.000 80.95382  ? 360 MET A N   1 
ATOM 2924  C CA  . MET A 1 360 ? 100.35622 -15.51523 -0.60746   1.000 59.04244  ? 360 MET A CA  1 
ATOM 2925  C C   . MET A 1 360 ? 100.03701 -16.86328 -1.24624   1.000 56.38151  ? 360 MET A C   1 
ATOM 2926  O O   . MET A 1 360 ? 98.88487  -17.30350 -1.29029   1.000 63.27451  ? 360 MET A O   1 
ATOM 2927  C CB  . MET A 1 360 ? 100.70771 -15.70672 0.86601    1.000 58.55246  ? 360 MET A CB  1 
ATOM 2928  C CG  . MET A 1 360 ? 101.33534 -14.49124 1.51856    1.000 61.67684  ? 360 MET A CG  1 
ATOM 2929  S SD  . MET A 1 360 ? 102.79318 -13.93708 0.61874    1.000 77.24224  ? 360 MET A SD  1 
ATOM 2930  C CE  . MET A 1 360 ? 103.36537 -12.61498 1.67986    1.000 78.29354  ? 360 MET A CE  1 
ATOM 2931  N N   . LYS A 1 361 ? 101.08223 -17.51624 -1.74851   1.000 55.16240  ? 361 LYS A N   1 
ATOM 2932  C CA  . LYS A 1 361 ? 100.94874 -18.85196 -2.30983   1.000 56.16776  ? 361 LYS A CA  1 
ATOM 2933  C C   . LYS A 1 361 ? 100.56264 -19.86139 -1.23385   1.000 56.10402  ? 361 LYS A C   1 
ATOM 2934  O O   . LYS A 1 361 ? 100.91511 -19.72226 -0.05947   1.000 55.30813  ? 361 LYS A O   1 
ATOM 2935  C CB  . LYS A 1 361 ? 102.25144 -19.28623 -2.98223   1.000 56.58170  ? 361 LYS A CB  1 
ATOM 2936  C CG  . LYS A 1 361 ? 102.57447 -18.55356 -4.27472   1.000 74.18234  ? 361 LYS A CG  1 
ATOM 2937  C CD  . LYS A 1 361 ? 103.84565 -19.10595 -4.90357   1.000 104.62279 ? 361 LYS A CD  1 
ATOM 2938  C CE  . LYS A 1 361 ? 103.66324 -20.55349 -5.33686   1.000 99.98254  ? 361 LYS A CE  1 
ATOM 2939  N NZ  . LYS A 1 361 ? 102.70966 -20.67423 -6.47316   1.000 85.52990  ? 361 LYS A NZ  1 
ATOM 2940  N N   . LYS A 1 362 ? 99.82138  -20.88885 -1.65198   1.000 83.04468  ? 362 LYS A N   1 
ATOM 2941  C CA  . LYS A 1 362 ? 99.40902  -21.97490 -0.76321   1.000 73.03927  ? 362 LYS A CA  1 
ATOM 2942  C C   . LYS A 1 362 ? 100.58289 -22.92884 -0.52182   1.000 66.12215  ? 362 LYS A C   1 
ATOM 2943  O O   . LYS A 1 362 ? 100.54555 -24.11478 -0.84868   1.000 67.35765  ? 362 LYS A O   1 
ATOM 2944  C CB  . LYS A 1 362 ? 98.21369  -22.71513 -1.35277   1.000 72.61100  ? 362 LYS A CB  1 
ATOM 2945  C CG  . LYS A 1 362 ? 96.84390  -22.13944 -1.00397   1.000 59.19399  ? 362 LYS A CG  1 
ATOM 2946  C CD  . LYS A 1 362 ? 96.58399  -20.80953 -1.69801   1.000 56.08931  ? 362 LYS A CD  1 
ATOM 2947  C CE  . LYS A 1 362 ? 95.20264  -20.27129 -1.35733   1.000 52.16291  ? 362 LYS A CE  1 
ATOM 2948  N NZ  . LYS A 1 362 ? 94.12093  -21.22107 -1.74568   1.000 53.34882  ? 362 LYS A NZ  1 
ATOM 2949  N N   . THR A 1 363 ? 101.64166 -22.38364 0.07069    1.000 66.38276  ? 363 THR A N   1 
ATOM 2950  C CA  . THR A 1 363 ? 102.85883 -23.14994 0.28118    1.000 73.56496  ? 363 THR A CA  1 
ATOM 2951  C C   . THR A 1 363 ? 102.71793 -24.07622 1.48587    1.000 67.94962  ? 363 THR A C   1 
ATOM 2952  O O   . THR A 1 363 ? 101.82602 -23.92285 2.32553    1.000 67.63417  ? 363 THR A O   1 
ATOM 2953  C CB  . THR A 1 363 ? 104.05993 -22.22299 0.47480    1.000 73.40426  ? 363 THR A CB  1 
ATOM 2954  O OG1 . THR A 1 363 ? 103.80562 -21.32518 1.56152    1.000 67.82411  ? 363 THR A OG1 1 
ATOM 2955  C CG2 . THR A 1 363 ? 104.32301 -21.41976 -0.79119   1.000 79.24969  ? 363 THR A CG2 1 
ATOM 2956  N N   . SER A 1 364 ? 103.62335 -25.05514 1.55606    1.000 72.37887  ? 364 SER A N   1 
ATOM 2957  C CA  . SER A 1 364 ? 103.57873 -26.04160 2.63094    1.000 73.22269  ? 364 SER A CA  1 
ATOM 2958  C C   . SER A 1 364 ? 103.82575 -25.38894 3.98493    1.000 77.24247  ? 364 SER A C   1 
ATOM 2959  O O   . SER A 1 364 ? 103.10540 -25.65122 4.95660    1.000 93.56347  ? 364 SER A O   1 
ATOM 2960  C CB  . SER A 1 364 ? 104.60626 -27.14335 2.36793    1.000 90.60499  ? 364 SER A CB  1 
ATOM 2961  O OG  . SER A 1 364 ? 104.35397 -27.79402 1.13476    1.000 110.46328 ? 364 SER A OG  1 
ATOM 2962  N N   . GLN A 1 365 ? 104.85208 -24.53826 4.06808    1.000 74.79806  ? 365 GLN A N   1 
ATOM 2963  C CA  . GLN A 1 365 ? 105.15445 -23.86210 5.32487    1.000 67.21430  ? 365 GLN A CA  1 
ATOM 2964  C C   . GLN A 1 365 ? 103.99271 -22.98452 5.76311    1.000 61.39344  ? 365 GLN A C   1 
ATOM 2965  O O   . GLN A 1 365 ? 103.69239 -22.88553 6.95771    1.000 58.68626  ? 365 GLN A O   1 
ATOM 2966  C CB  . GLN A 1 365 ? 106.42255 -23.02290 5.17958    1.000 65.04556  ? 365 GLN A CB  1 
ATOM 2967  C CG  . GLN A 1 365 ? 107.41807 -23.57722 4.18124    1.000 72.32349  ? 365 GLN A CG  1 
ATOM 2968  C CD  . GLN A 1 365 ? 107.19466 -23.02920 2.78177    1.000 76.39978  ? 365 GLN A CD  1 
ATOM 2969  O OE1 . GLN A 1 365 ? 106.59638 -21.96649 2.60737    1.000 65.89783  ? 365 GLN A OE1 1 
ATOM 2970  N NE2 . GLN A 1 365 ? 107.67069 -23.75669 1.77700    1.000 93.71311  ? 365 GLN A NE2 1 
ATOM 2971  N N   . LEU A 1 366 ? 103.32196 -22.34265 4.80438    1.000 59.35662  ? 366 LEU A N   1 
ATOM 2972  C CA  . LEU A 1 366 ? 102.20428 -21.46808 5.13004    1.000 55.31582  ? 366 LEU A CA  1 
ATOM 2973  C C   . LEU A 1 366 ? 100.93503 -22.25365 5.42975    1.000 72.28984  ? 366 LEU A C   1 
ATOM 2974  O O   . LEU A 1 366 ? 100.12887 -21.82048 6.26025    1.000 70.22059  ? 366 LEU A O   1 
ATOM 2975  C CB  . LEU A 1 366 ? 101.96501 -20.48231 3.98868    1.000 50.68832  ? 366 LEU A CB  1 
ATOM 2976  C CG  . LEU A 1 366 ? 101.44096 -19.11817 4.42308    1.000 48.27205  ? 366 LEU A CG  1 
ATOM 2977  C CD1 . LEU A 1 366 ? 102.42446 -18.46616 5.37573    1.000 47.57084  ? 366 LEU A CD1 1 
ATOM 2978  C CD2 . LEU A 1 366 ? 101.21754 -18.24712 3.21171    1.000 60.92558  ? 366 LEU A CD2 1 
ATOM 2979  N N   . LYS A 1 367 ? 100.73117 -23.39258 4.76059    1.000 74.92292  ? 367 LYS A N   1 
ATOM 2980  C CA  . LYS A 1 367 ? 99.62451  -24.26677 5.13284    1.000 62.37934  ? 367 LYS A CA  1 
ATOM 2981  C C   . LYS A 1 367 ? 99.80561  -24.80987 6.54204    1.000 68.00896  ? 367 LYS A C   1 
ATOM 2982  O O   . LYS A 1 367 ? 98.82157  -24.99504 7.26753    1.000 78.72775  ? 367 LYS A O   1 
ATOM 2983  C CB  . LYS A 1 367 ? 99.49063  -25.42304 4.14013    1.000 58.65469  ? 367 LYS A CB  1 
ATOM 2984  C CG  . LYS A 1 367 ? 98.81630  -25.06359 2.82743    1.000 59.82554  ? 367 LYS A CG  1 
ATOM 2985  C CD  . LYS A 1 367 ? 98.65662  -26.29743 1.95135    1.000 65.40963  ? 367 LYS A CD  1 
ATOM 2986  C CE  . LYS A 1 367 ? 97.95745  -25.97179 0.64205    1.000 68.20281  ? 367 LYS A CE  1 
ATOM 2987  N NZ  . LYS A 1 367 ? 97.82590  -27.17437 -0.22762   1.000 72.53866  ? 367 LYS A NZ  1 
ATOM 2988  N N   . TRP A 1 368 ? 101.05113 -25.07273 6.94570    1.000 69.62964  ? 368 TRP A N   1 
ATOM 2989  C CA  . TRP A 1 368 ? 101.30725 -25.56409 8.29531    1.000 68.44205  ? 368 TRP A CA  1 
ATOM 2990  C C   . TRP A 1 368 ? 101.18573 -24.45745 9.33731    1.000 63.87008  ? 368 TRP A C   1 
ATOM 2991  O O   . TRP A 1 368 ? 100.59515 -24.66986 10.40243   1.000 81.12553  ? 368 TRP A O   1 
ATOM 2992  C CB  . TRP A 1 368 ? 102.69436 -26.19988 8.37004    1.000 71.22594  ? 368 TRP A CB  1 
ATOM 2993  C CG  . TRP A 1 368 ? 103.03472 -26.68932 9.74069    1.000 82.21254  ? 368 TRP A CG  1 
ATOM 2994  C CD1 . TRP A 1 368 ? 102.80011 -27.93317 10.24780   1.000 92.65710  ? 368 TRP A CD1 1 
ATOM 2995  C CD2 . TRP A 1 368 ? 103.64949 -25.93608 10.79335   1.000 80.43737  ? 368 TRP A CD2 1 
ATOM 2996  N NE1 . TRP A 1 368 ? 103.24190 -28.00583 11.54662   1.000 85.10659  ? 368 TRP A NE1 1 
ATOM 2997  C CE2 . TRP A 1 368 ? 103.76588 -26.79188 11.90567   1.000 78.15542  ? 368 TRP A CE2 1 
ATOM 2998  C CE3 . TRP A 1 368 ? 104.11669 -24.62274 10.90093   1.000 89.65903  ? 368 TRP A CE3 1 
ATOM 2999  C CZ2 . TRP A 1 368 ? 104.33001 -26.37778 13.10958   1.000 86.85873  ? 368 TRP A CZ2 1 
ATOM 3000  C CZ3 . TRP A 1 368 ? 104.67503 -24.21340 12.09658   1.000 99.71179  ? 368 TRP A CZ3 1 
ATOM 3001  C CH2 . TRP A 1 368 ? 104.77768 -25.08798 13.18498   1.000 99.80159  ? 368 TRP A CH2 1 
ATOM 3002  N N   . ALA A 1 369 ? 101.74486 -23.27630 9.05449    1.000 54.04139  ? 369 ALA A N   1 
ATOM 3003  C CA  . ALA A 1 369 ? 101.70423 -22.17800 10.01393   1.000 53.17522  ? 369 ALA A CA  1 
ATOM 3004  C C   . ALA A 1 369 ? 100.28550 -21.70005 10.28504   1.000 52.84437  ? 369 ALA A C   1 
ATOM 3005  O O   . ALA A 1 369 ? 100.03305 -21.09659 11.33310   1.000 74.76989  ? 369 ALA A O   1 
ATOM 3006  C CB  . ALA A 1 369 ? 102.56217 -21.01397 9.51654    1.000 52.47137  ? 369 ALA A CB  1 
ATOM 3007  N N   . LEU A 1 370 ? 99.35703  -21.95803 9.37105    1.000 50.55357  ? 370 LEU A N   1 
ATOM 3008  C CA  . LEU A 1 370 ? 97.95499  -21.62970 9.56546    1.000 50.40346  ? 370 LEU A CA  1 
ATOM 3009  C C   . LEU A 1 370 ? 97.13363  -22.84253 9.97067    1.000 59.77025  ? 370 LEU A C   1 
ATOM 3010  O O   . LEU A 1 370 ? 95.92432  -22.71363 10.18639   1.000 64.21596  ? 370 LEU A O   1 
ATOM 3011  C CB  . LEU A 1 370 ? 97.37854  -21.00700 8.29093    1.000 50.30689  ? 370 LEU A CB  1 
ATOM 3012  C CG  . LEU A 1 370 ? 98.07132  -19.72042 7.84075    1.000 49.54027  ? 370 LEU A CG  1 
ATOM 3013  C CD1 . LEU A 1 370 ? 97.68173  -19.36228 6.41841    1.000 49.77734  ? 370 LEU A CD1 1 
ATOM 3014  C CD2 . LEU A 1 370 ? 97.73642  -18.58466 8.79141    1.000 48.69065  ? 370 LEU A CD2 1 
ATOM 3015  N N   . GLY A 1 371 ? 97.76172  -24.01123 10.07971   1.000 83.89714  ? 371 GLY A N   1 
ATOM 3016  C CA  . GLY A 1 371 ? 97.06241  -25.19711 10.52945   1.000 107.13624 ? 371 GLY A CA  1 
ATOM 3017  C C   . GLY A 1 371 ? 96.03609  -25.71096 9.54905    1.000 109.49777 ? 371 GLY A C   1 
ATOM 3018  O O   . GLY A 1 371 ? 95.06977  -26.36122 9.95906    1.000 111.34331 ? 371 GLY A O   1 
ATOM 3019  N N   . GLU A 1 372 ? 96.21897  -25.44374 8.25570    1.000 118.66945 ? 372 GLU A N   1 
ATOM 3020  C CA  . GLU A 1 372 ? 95.23012  -25.86377 7.27596    1.000 113.14374 ? 372 GLU A CA  1 
ATOM 3021  C C   . GLU A 1 372 ? 95.49308  -27.26185 6.73279    1.000 125.45783 ? 372 GLU A C   1 
ATOM 3022  O O   . GLU A 1 372 ? 94.57502  -27.86675 6.16515    1.000 146.22182 ? 372 GLU A O   1 
ATOM 3023  C CB  . GLU A 1 372 ? 95.17776  -24.84439 6.12990    1.000 95.05587  ? 372 GLU A CB  1 
ATOM 3024  C CG  . GLU A 1 372 ? 94.10953  -25.10372 5.07879    1.000 96.29469  ? 372 GLU A CG  1 
ATOM 3025  C CD  . GLU A 1 372 ? 93.70358  -23.84472 4.34320    1.000 97.25604  ? 372 GLU A CD  1 
ATOM 3026  O OE1 . GLU A 1 372 ? 94.27000  -22.77456 4.64568    1.000 96.37754  ? 372 GLU A OE1 1 
ATOM 3027  O OE2 . GLU A 1 372 ? 92.82324  -23.92517 3.46172    1.000 104.45184 ? 372 GLU A OE2 1 
ATOM 3028  N N   . ASN A 1 373 ? 96.71937  -27.77461 6.86373    1.000 122.26940 ? 373 ASN A N   1 
ATOM 3029  C CA  . ASN A 1 373 ? 96.99507  -29.18533 6.60882    1.000 118.77091 ? 373 ASN A CA  1 
ATOM 3030  C C   . ASN A 1 373 ? 95.86959  -30.04349 7.17090    1.000 121.81871 ? 373 ASN A C   1 
ATOM 3031  O O   . ASN A 1 373 ? 95.44720  -29.85394 8.31473    1.000 119.51891 ? 373 ASN A O   1 
ATOM 3032  C CB  . ASN A 1 373 ? 98.33756  -29.58810 7.22378    1.000 109.63408 ? 373 ASN A CB  1 
ATOM 3033  C CG  . ASN A 1 373 ? 99.47082  -29.56564 6.21194    1.000 105.55886 ? 373 ASN A CG  1 
ATOM 3034  O OD1 . ASN A 1 373 ? 99.24852  -29.72351 5.01053    1.000 100.62133 ? 373 ASN A OD1 1 
ATOM 3035  N ND2 . ASN A 1 373 ? 100.69304 -29.37137 6.69414    1.000 106.65358 ? 373 ASN A ND2 1 
ATOM 3036  N N   . MET A 1 374 ? 95.38060  -30.98002 6.35978    1.000 128.59734 ? 374 MET A N   1 
ATOM 3037  C CA  . MET A 1 374 ? 94.11667  -31.64351 6.66218    1.000 148.86067 ? 374 MET A CA  1 
ATOM 3038  C C   . MET A 1 374 ? 94.15633  -32.31585 8.02907    1.000 156.41650 ? 374 MET A C   1 
ATOM 3039  O O   . MET A 1 374 ? 95.00614  -33.17196 8.29352    1.000 168.91691 ? 374 MET A O   1 
ATOM 3040  C CB  . MET A 1 374 ? 93.77423  -32.65862 5.57420    1.000 158.61916 ? 374 MET A CB  1 
ATOM 3041  C CG  . MET A 1 374 ? 92.27591  -32.88000 5.42448    1.000 156.12514 ? 374 MET A CG  1 
ATOM 3042  S SD  . MET A 1 374 ? 91.82338  -34.03739 4.12069    1.000 143.83866 ? 374 MET A SD  1 
ATOM 3043  C CE  . MET A 1 374 ? 90.03712  -33.90957 4.17628    1.000 131.35892 ? 374 MET A CE  1 
ATOM 3044  N N   . ALA A 1 375 ? 93.22856  -31.91004 8.89254    1.000 149.92886 ? 375 ALA A N   1 
ATOM 3045  C CA  . ALA A 1 375 ? 93.06896  -32.37487 10.26292   1.000 150.75514 ? 375 ALA A CA  1 
ATOM 3046  C C   . ALA A 1 375 ? 92.25352  -33.66732 10.26328   1.000 171.97744 ? 375 ALA A C   1 
ATOM 3047  O O   . ALA A 1 375 ? 91.87459  -34.14208 9.18464    1.000 194.30707 ? 375 ALA A O   1 
ATOM 3048  C CB  . ALA A 1 375 ? 92.40265  -31.26940 11.09059   1.000 135.30174 ? 375 ALA A CB  1 
ATOM 3049  N N   . PRO A 1 376 ? 91.99289  -34.29724 11.44094   1.000 180.51191 ? 376 PRO A N   1 
ATOM 3050  C CA  . PRO A 1 376 ? 91.02604  -35.40635 11.49123   1.000 161.85585 ? 376 PRO A CA  1 
ATOM 3051  C C   . PRO A 1 376 ? 89.77274  -35.17564 10.65643   1.000 155.92056 ? 376 PRO A C   1 
ATOM 3052  O O   . PRO A 1 376 ? 89.08568  -34.16013 10.80750   1.000 157.99430 ? 376 PRO A O   1 
ATOM 3053  C CB  . PRO A 1 376 ? 90.70179  -35.51645 12.99160   1.000 156.36163 ? 376 PRO A CB  1 
ATOM 3054  C CG  . PRO A 1 376 ? 91.39441  -34.34359 13.65795   1.000 157.87957 ? 376 PRO A CG  1 
ATOM 3055  C CD  . PRO A 1 376 ? 92.56177  -34.05642 12.77775   1.000 170.75842 ? 376 PRO A CD  1 
ATOM 3056  N N   . GLU A 1 377 ? 89.47060  -36.12400 9.77270    1.000 130.65396 ? 377 GLU A N   1 
ATOM 3057  C CA  . GLU A 1 377 ? 88.40393  -35.95272 8.79846    1.000 145.44372 ? 377 GLU A CA  1 
ATOM 3058  C C   . GLU A 1 377 ? 87.03764  -36.16650 9.43702    1.000 165.16505 ? 377 GLU A C   1 
ATOM 3059  O O   . GLU A 1 377 ? 86.87503  -36.96189 10.36753   1.000 180.46606 ? 377 GLU A O   1 
ATOM 3060  C CB  . GLU A 1 377 ? 88.57173  -36.93738 7.63688    1.000 145.21283 ? 377 GLU A CB  1 
ATOM 3061  C CG  . GLU A 1 377 ? 88.42165  -38.40241 8.04647    1.000 147.99103 ? 377 GLU A CG  1 
ATOM 3062  C CD  . GLU A 1 377 ? 88.68161  -39.37229 6.90908    1.000 143.91102 ? 377 GLU A CD  1 
ATOM 3063  O OE1 . GLU A 1 377 ? 88.48400  -38.98510 5.73910    1.000 137.77020 ? 377 GLU A OE1 1 
ATOM 3064  O OE2 . GLU A 1 377 ? 89.07155  -40.52692 7.18622    1.000 144.14230 ? 377 GLU A OE2 1 
ATOM 3065  N N   . LYS A 1 378 ? 86.05126  -35.42769 8.93293    1.000 158.75263 ? 378 LYS A N   1 
ATOM 3066  C CA  . LYS A 1 378 ? 84.68848  -35.55149 9.42976    1.000 143.12962 ? 378 LYS A CA  1 
ATOM 3067  C C   . LYS A 1 378 ? 84.11335  -36.89575 9.00512    1.000 146.02943 ? 378 LYS A C   1 
ATOM 3068  O O   . LYS A 1 378 ? 83.95767  -37.16485 7.80944    1.000 146.88176 ? 378 LYS A O   1 
ATOM 3069  C CB  . LYS A 1 378 ? 83.82602  -34.40627 8.90579    1.000 122.95082 ? 378 LYS A CB  1 
ATOM 3070  C CG  . LYS A 1 378 ? 82.35574  -34.52069 9.27255    1.000 109.15613 ? 378 LYS A CG  1 
ATOM 3071  C CD  . LYS A 1 378 ? 81.53358  -33.42713 8.61166    1.000 99.70458  ? 378 LYS A CD  1 
ATOM 3072  C CE  . LYS A 1 378 ? 80.04999  -33.62181 8.87777    1.000 96.62464  ? 378 LYS A CE  1 
ATOM 3073  N NZ  . LYS A 1 378 ? 79.21562  -32.59889 8.19009    1.000 94.16910  ? 378 LYS A NZ  1 
ATOM 3074  N N   . VAL A 1 379 ? 83.80227  -37.73951 9.98401    1.000 149.53308 ? 379 VAL A N   1 
ATOM 3075  C CA  . VAL A 1 379 ? 83.17762  -39.02888 9.75796    1.000 160.09563 ? 379 VAL A CA  1 
ATOM 3076  C C   . VAL A 1 379 ? 81.94679  -39.13043 10.65102   1.000 164.98152 ? 379 VAL A C   1 
ATOM 3077  O O   . VAL A 1 379 ? 81.64358  -38.22863 11.43112   1.000 173.98172 ? 379 VAL A O   1 
ATOM 3078  C CB  . VAL A 1 379 ? 84.14472  -40.20149 10.02273   1.000 161.67566 ? 379 VAL A CB  1 
ATOM 3079  C CG1 . VAL A 1 379 ? 85.31405  -40.15929 9.05152    1.000 165.13551 ? 379 VAL A CG1 1 
ATOM 3080  C CG2 . VAL A 1 379 ? 84.63506  -40.16618 11.46211   1.000 153.27731 ? 379 VAL A CG2 1 
ATOM 3081  N N   . ASP A 1 380 ? 81.23681  -40.24430 10.52560   1.000 171.59762 ? 380 ASP A N   1 
ATOM 3082  C CA  . ASP A 1 380 ? 80.10338  -40.53574 11.38395   1.000 163.68534 ? 380 ASP A CA  1 
ATOM 3083  C C   . ASP A 1 380 ? 80.48588  -41.66506 12.32824   1.000 149.53102 ? 380 ASP A C   1 
ATOM 3084  O O   . ASP A 1 380 ? 81.38707  -42.45875 12.04597   1.000 145.08383 ? 380 ASP A O   1 
ATOM 3085  C CB  . ASP A 1 380 ? 78.87065  -40.92709 10.56150   1.000 174.93915 ? 380 ASP A CB  1 
ATOM 3086  C CG  . ASP A 1 380 ? 78.40543  -39.81513 9.64266    1.000 180.46201 ? 380 ASP A CG  1 
ATOM 3087  O OD1 . ASP A 1 380 ? 78.61058  -38.63250 9.98716    1.000 181.23792 ? 380 ASP A OD1 1 
ATOM 3088  O OD2 . ASP A 1 380 ? 77.83410  -40.12374 8.57530    1.000 179.67307 ? 380 ASP A OD2 1 
ATOM 3089  N N   . PHE A 1 381 ? 79.77778  -41.74395 13.45404   1.000 148.88726 ? 381 PHE A N   1 
ATOM 3090  C CA  . PHE A 1 381 ? 80.08313  -42.78414 14.42633   1.000 156.12443 ? 381 PHE A CA  1 
ATOM 3091  C C   . PHE A 1 381 ? 79.68936  -44.17456 13.94574   1.000 156.87792 ? 381 PHE A C   1 
ATOM 3092  O O   . PHE A 1 381 ? 80.05449  -45.15839 14.59641   1.000 156.85142 ? 381 PHE A O   1 
ATOM 3093  C CB  . PHE A 1 381 ? 79.39571  -42.48070 15.75949   1.000 166.96871 ? 381 PHE A CB  1 
ATOM 3094  C CG  . PHE A 1 381 ? 79.98314  -43.22642 16.92586   1.000 174.77264 ? 381 PHE A CG  1 
ATOM 3095  C CD1 . PHE A 1 381 ? 81.35521  -43.27719 17.11003   1.000 176.68924 ? 381 PHE A CD1 1 
ATOM 3096  C CD2 . PHE A 1 381 ? 79.16664  -43.88140 17.83269   1.000 169.43229 ? 381 PHE A CD2 1 
ATOM 3097  C CE1 . PHE A 1 381 ? 81.90255  -43.96172 18.17880   1.000 165.77256 ? 381 PHE A CE1 1 
ATOM 3098  C CE2 . PHE A 1 381 ? 79.70861  -44.56871 18.90446   1.000 161.87144 ? 381 PHE A CE2 1 
ATOM 3099  C CZ  . PHE A 1 381 ? 81.07868  -44.60860 19.07648   1.000 156.27553 ? 381 PHE A CZ  1 
ATOM 3100  N N   . ASP A 1 382 ? 78.96590  -44.28237 12.82814   1.000 159.06139 ? 382 ASP A N   1 
ATOM 3101  C CA  . ASP A 1 382 ? 78.52191  -45.59155 12.36234   1.000 163.22171 ? 382 ASP A CA  1 
ATOM 3102  C C   . ASP A 1 382 ? 79.66981  -46.42538 11.80442   1.000 163.19943 ? 382 ASP A C   1 
ATOM 3103  O O   . ASP A 1 382 ? 79.59262  -47.65927 11.80955   1.000 156.19094 ? 382 ASP A O   1 
ATOM 3104  C CB  . ASP A 1 382 ? 77.43117  -45.42091 11.30455   1.000 168.09878 ? 382 ASP A CB  1 
ATOM 3105  C CG  . ASP A 1 382 ? 76.13810  -44.87961 11.88346   1.000 175.96157 ? 382 ASP A CG  1 
ATOM 3106  O OD1 . ASP A 1 382 ? 75.80449  -45.24030 13.03125   1.000 181.03942 ? 382 ASP A OD1 1 
ATOM 3107  O OD2 . ASP A 1 382 ? 75.45513  -44.09414 11.19152   1.000 177.11939 ? 382 ASP A OD2 1 
ATOM 3108  N N   . ASN A 1 383 ? 80.73839  -45.78332 11.32819   1.000 162.36005 ? 383 ASN A N   1 
ATOM 3109  C CA  . ASN A 1 383 ? 81.87984  -46.49821 10.77307   1.000 160.05257 ? 383 ASN A CA  1 
ATOM 3110  C C   . ASN A 1 383 ? 83.14351  -46.38007 11.61313   1.000 153.31449 ? 383 ASN A C   1 
ATOM 3111  O O   . ASN A 1 383 ? 84.08089  -47.15744 11.40135   1.000 139.81373 ? 383 ASN A O   1 
ATOM 3112  C CB  . ASN A 1 383 ? 82.15836  -46.02543 9.33874    1.000 166.95860 ? 383 ASN A CB  1 
ATOM 3113  C CG  . ASN A 1 383 ? 81.06195  -46.43645 8.37092    1.000 172.67699 ? 383 ASN A CG  1 
ATOM 3114  O OD1 . ASN A 1 383 ? 80.06092  -45.73757 8.20814    1.000 177.05199 ? 383 ASN A OD1 1 
ATOM 3115  N ND2 . ASN A 1 383 ? 81.24528  -47.58422 7.72799    1.000 169.43961 ? 383 ASN A ND2 1 
ATOM 3116  N N   . CYS A 1 384 ? 83.19604  -45.44564 12.55663   1.000 167.98165 ? 384 CYS A N   1 
ATOM 3117  C CA  . CYS A 1 384 ? 84.30836  -45.33007 13.49304   1.000 170.86224 ? 384 CYS A CA  1 
ATOM 3118  C C   . CYS A 1 384 ? 83.83006  -45.74192 14.88030   1.000 169.07798 ? 384 CYS A C   1 
ATOM 3119  O O   . CYS A 1 384 ? 84.20231  -45.15705 15.89972   1.000 157.44936 ? 384 CYS A O   1 
ATOM 3120  C CB  . CYS A 1 384 ? 84.88273  -43.91653 13.49736   1.000 160.62710 ? 384 CYS A CB  1 
ATOM 3121  S SG  . CYS A 1 384 ? 83.73035  -42.65081 14.05050   1.000 152.33495 ? 384 CYS A SG  1 
ATOM 3122  N N   . ARG A 1 385 ? 82.97852  -46.77054 14.89812   1.000 159.57589 ? 385 ARG A N   1 
ATOM 3123  C CA  . ARG A 1 385 ? 82.38031  -47.26349 16.13340   1.000 172.66581 ? 385 ARG A CA  1 
ATOM 3124  C C   . ARG A 1 385 ? 83.43640  -47.66272 17.15567   1.000 190.65629 ? 385 ARG A C   1 
ATOM 3125  O O   . ARG A 1 385 ? 83.27296  -47.41076 18.35553   1.000 202.11543 ? 385 ARG A O   1 
ATOM 3126  C CB  . ARG A 1 385 ? 81.45658  -48.44269 15.82191   1.000 165.31532 ? 385 ARG A CB  1 
ATOM 3127  C CG  . ARG A 1 385 ? 79.98449  -48.06937 15.74012   1.000 148.48634 ? 385 ARG A CG  1 
ATOM 3128  C CD  . ARG A 1 385 ? 79.12678  -49.24392 15.29613   1.000 131.87641 ? 385 ARG A CD  1 
ATOM 3129  N NE  . ARG A 1 385 ? 77.85999  -48.80310 14.71493   1.000 124.72409 ? 385 ARG A NE  1 
ATOM 3130  C CZ  . ARG A 1 385 ? 76.80036  -48.42017 15.42180   1.000 126.53485 ? 385 ARG A CZ  1 
ATOM 3131  N NH1 . ARG A 1 385 ? 76.84361  -48.42441 16.74741   1.000 124.28269 ? 385 ARG A NH1 1 
ATOM 3132  N NH2 . ARG A 1 385 ? 75.69331  -48.03380 14.80164   1.000 127.69587 ? 385 ARG A NH2 1 
ATOM 3133  N N   . ASP A 1 386 ? 84.53197  -48.27500 16.70353   1.000 195.35452 ? 386 ASP A N   1 
ATOM 3134  C CA  . ASP A 1 386 ? 85.56198  -48.76168 17.61219   1.000 180.97078 ? 386 ASP A CA  1 
ATOM 3135  C C   . ASP A 1 386 ? 86.95342  -48.50830 17.05379   1.000 167.79947 ? 386 ASP A C   1 
ATOM 3136  O O   . ASP A 1 386 ? 87.26627  -48.92009 15.93255   1.000 166.29932 ? 386 ASP A O   1 
ATOM 3137  C CB  . ASP A 1 386 ? 85.39785  -50.26578 17.86934   1.000 177.27929 ? 386 ASP A CB  1 
ATOM 3138  C CG  . ASP A 1 386 ? 83.96968  -50.65472 18.18155   1.000 171.69953 ? 386 ASP A CG  1 
ATOM 3139  O OD1 . ASP A 1 386 ? 83.41175  -51.49943 17.44905   1.000 164.80540 ? 386 ASP A OD1 1 
ATOM 3140  O OD2 . ASP A 1 386 ? 83.40350  -50.11204 19.15200   1.000 173.72974 ? 386 ASP A OD2 1 
ATOM 3141  N N   . VAL A 1 387 ? 87.77251  -47.81661 17.84582   1.000 170.64788 ? 387 VAL A N   1 
ATOM 3142  C CA  . VAL A 1 387 ? 89.20502  -47.66383 17.62047   1.000 184.43209 ? 387 VAL A CA  1 
ATOM 3143  C C   . VAL A 1 387 ? 89.86849  -47.67863 18.98978   1.000 199.51766 ? 387 VAL A C   1 
ATOM 3144  O O   . VAL A 1 387 ? 89.26310  -47.28989 19.99338   1.000 200.23810 ? 387 VAL A O   1 
ATOM 3145  C CB  . VAL A 1 387 ? 89.57364  -46.38490 16.83625   1.000 177.34117 ? 387 VAL A CB  1 
ATOM 3146  C CG1 . VAL A 1 387 ? 89.40492  -46.60704 15.34397   1.000 173.89513 ? 387 VAL A CG1 1 
ATOM 3147  C CG2 . VAL A 1 387 ? 88.72156  -45.22526 17.28730   1.000 172.23236 ? 387 VAL A CG2 1 
ATOM 3148  N N   . SER A 1 388 ? 91.12021  -48.14321 19.03038   1.000 205.17507 ? 388 SER A N   1 
ATOM 3149  C CA  . SER A 1 388 ? 91.77548  -48.37457 20.31566   1.000 191.09271 ? 388 SER A CA  1 
ATOM 3150  C C   . SER A 1 388 ? 91.89497  -47.08836 21.12530   1.000 163.18309 ? 388 SER A C   1 
ATOM 3151  O O   . SER A 1 388 ? 91.71017  -47.09906 22.34801   1.000 133.79088 ? 388 SER A O   1 
ATOM 3152  C CB  . SER A 1 388 ? 93.15239  -49.00111 20.09519   1.000 187.44982 ? 388 SER A CB  1 
ATOM 3153  O OG  . SER A 1 388 ? 93.84715  -48.35142 19.04502   1.000 175.60416 ? 388 SER A OG  1 
ATOM 3154  N N   . ASP A 1 389 ? 92.20295  -45.97338 20.46827   1.000 163.71280 ? 389 ASP A N   1 
ATOM 3155  C CA  . ASP A 1 389 ? 92.36555  -44.68254 21.13527   1.000 171.71160 ? 389 ASP A CA  1 
ATOM 3156  C C   . ASP A 1 389 ? 91.30910  -43.72477 20.58834   1.000 191.73818 ? 389 ASP A C   1 
ATOM 3157  O O   . ASP A 1 389 ? 91.56078  -42.99306 19.62807   1.000 195.73175 ? 389 ASP A O   1 
ATOM 3158  C CB  . ASP A 1 389 ? 93.77809  -44.13242 20.94209   1.000 160.87298 ? 389 ASP A CB  1 
ATOM 3159  C CG  . ASP A 1 389 ? 94.09012  -42.99098 21.88925   1.000 148.47491 ? 389 ASP A CG  1 
ATOM 3160  O OD1 . ASP A 1 389 ? 94.66086  -43.25426 22.96839   1.000 141.24683 ? 389 ASP A OD1 1 
ATOM 3161  O OD2 . ASP A 1 389 ? 93.76229  -41.83227 21.55735   1.000 142.19239 ? 389 ASP A OD2 1 
ATOM 3162  N N   . LEU A 1 390 ? 90.12461  -43.73071 21.20110   1.000 193.29367 ? 390 LEU A N   1 
ATOM 3163  C CA  . LEU A 1 390 ? 89.06733  -42.80418 20.81203   1.000 179.55273 ? 390 LEU A CA  1 
ATOM 3164  C C   . LEU A 1 390 ? 88.65737  -41.94831 22.00411   1.000 182.73229 ? 390 LEU A C   1 
ATOM 3165  O O   . LEU A 1 390 ? 87.46502  -41.77110 22.27269   1.000 173.25937 ? 390 LEU A O   1 
ATOM 3166  C CB  . LEU A 1 390 ? 87.85775  -43.55482 20.24652   1.000 156.23346 ? 390 LEU A CB  1 
ATOM 3167  C CG  . LEU A 1 390 ? 86.87924  -42.72904 19.39930   1.000 139.34456 ? 390 LEU A CG  1 
ATOM 3168  C CD1 . LEU A 1 390 ? 87.62562  -41.88503 18.37341   1.000 135.38823 ? 390 LEU A CD1 1 
ATOM 3169  C CD2 . LEU A 1 390 ? 85.83928  -43.61174 18.72407   1.000 139.22271 ? 390 LEU A CD2 1 
ATOM 3170  N N   . LYS A 1 391 ? 89.63807  -41.42692 22.73531   1.000 177.86461 ? 391 LYS A N   1 
ATOM 3171  C CA  . LYS A 1 391 ? 89.34754  -40.55957 23.86405   1.000 175.68693 ? 391 LYS A CA  1 
ATOM 3172  C C   . LYS A 1 391 ? 88.93861  -39.17203 23.37236   1.000 156.60835 ? 391 LYS A C   1 
ATOM 3173  O O   . LYS A 1 391 ? 88.87136  -38.89827 22.17055   1.000 170.92568 ? 391 LYS A O   1 
ATOM 3174  C CB  . LYS A 1 391 ? 90.54868  -40.48463 24.80349   1.000 176.27901 ? 391 LYS A CB  1 
ATOM 3175  C CG  . LYS A 1 391 ? 90.83062  -41.77750 25.55091   1.000 161.59397 ? 391 LYS A CG  1 
ATOM 3176  C CD  . LYS A 1 391 ? 91.60435  -41.50875 26.82971   1.000 139.70132 ? 391 LYS A CD  1 
ATOM 3177  C CE  . LYS A 1 391 ? 90.66384  -41.39094 28.01917   1.000 123.08126 ? 391 LYS A CE  1 
ATOM 3178  N NZ  . LYS A 1 391 ? 91.21388  -40.50884 29.08567   1.000 110.79156 ? 391 LYS A NZ  1 
ATOM 3179  N N   . GLN A 1 392 ? 88.66193  -38.28266 24.31887   1.000 139.08899 ? 392 GLN A N   1 
ATOM 3180  C CA  . GLN A 1 392 ? 88.19510  -36.94146 23.99694   1.000 127.37610 ? 392 GLN A CA  1 
ATOM 3181  C C   . GLN A 1 392 ? 89.33209  -35.92856 24.06741   1.000 118.31541 ? 392 GLN A C   1 
ATOM 3182  O O   . GLN A 1 392 ? 89.10074  -34.72029 24.03876   1.000 112.72036 ? 392 GLN A O   1 
ATOM 3183  C CB  . GLN A 1 392 ? 87.06499  -36.53547 24.94368   1.000 127.80416 ? 392 GLN A CB  1 
ATOM 3184  C CG  . GLN A 1 392 ? 85.94306  -37.55719 25.03061   1.000 142.26697 ? 392 GLN A CG  1 
ATOM 3185  C CD  . GLN A 1 392 ? 84.96169  -37.25308 26.14394   1.000 163.44989 ? 392 GLN A CD  1 
ATOM 3186  O OE1 . GLN A 1 392 ? 83.75141  -37.40112 25.97695   1.000 160.92276 ? 392 GLN A OE1 1 
ATOM 3187  N NE2 . GLN A 1 392 ? 85.47985  -36.83156 27.29117   1.000 179.97788 ? 392 GLN A NE2 1 
ATOM 3188  N N   . ASP A 1 396 ? 90.31863  -30.17039 28.78702   1.000 144.77789 ? 396 ASP A N   1 
ATOM 3189  C CA  . ASP A 1 396 ? 91.50767  -30.30565 29.61758   1.000 156.15073 ? 396 ASP A CA  1 
ATOM 3190  C C   . ASP A 1 396 ? 91.72459  -29.03355 30.43132   1.000 171.92492 ? 396 ASP A C   1 
ATOM 3191  O O   . ASP A 1 396 ? 91.86693  -27.94695 29.87171   1.000 165.08572 ? 396 ASP A O   1 
ATOM 3192  C CB  . ASP A 1 396 ? 92.73160  -30.60464 28.74971   1.000 150.28788 ? 396 ASP A CB  1 
ATOM 3193  C CG  . ASP A 1 396 ? 92.58240  -31.88784 27.95527   1.000 142.79709 ? 396 ASP A CG  1 
ATOM 3194  O OD1 . ASP A 1 396 ? 91.87549  -32.80386 28.42649   1.000 137.16495 ? 396 ASP A OD1 1 
ATOM 3195  O OD2 . ASP A 1 396 ? 93.16589  -31.97619 26.85490   1.000 139.59030 ? 396 ASP A OD2 1 
ATOM 3196  N N   . GLU A 1 397 ? 91.74226  -29.17431 31.75392   1.000 162.50998 ? 397 GLU A N   1 
ATOM 3197  C CA  . GLU A 1 397 ? 91.89219  -28.01756 32.62024   1.000 150.93622 ? 397 GLU A CA  1 
ATOM 3198  C C   . GLU A 1 397 ? 93.29095  -27.41116 32.49740   1.000 138.57804 ? 397 GLU A C   1 
ATOM 3199  O O   . GLU A 1 397 ? 94.27499  -28.12787 32.29509   1.000 150.69120 ? 397 GLU A O   1 
ATOM 3200  C CB  . GLU A 1 397 ? 91.60713  -28.40083 34.06923   1.000 150.97766 ? 397 GLU A CB  1 
ATOM 3201  C CG  . GLU A 1 397 ? 90.23719  -29.02965 34.26615   1.000 160.58450 ? 397 GLU A CG  1 
ATOM 3202  C CD  . GLU A 1 397 ? 89.11897  -28.17212 33.69775   1.000 174.53666 ? 397 GLU A CD  1 
ATOM 3203  O OE1 . GLU A 1 397 ? 89.14005  -26.94184 33.91614   1.000 178.41364 ? 397 GLU A OE1 1 
ATOM 3204  O OE2 . GLU A 1 397 ? 88.22063  -28.72746 33.03009   1.000 184.79734 ? 397 GLU A OE2 1 
ATOM 3205  N N   . PRO A 1 398 ? 93.40068  -26.09040 32.62279   1.000 126.52283 ? 398 PRO A N   1 
ATOM 3206  C CA  . PRO A 1 398 ? 94.69205  -25.42295 32.42691   1.000 123.06884 ? 398 PRO A CA  1 
ATOM 3207  C C   . PRO A 1 398 ? 95.63876  -25.67661 33.58984   1.000 112.65465 ? 398 PRO A C   1 
ATOM 3208  O O   . PRO A 1 398 ? 95.25625  -26.15031 34.66125   1.000 109.95304 ? 398 PRO A O   1 
ATOM 3209  C CB  . PRO A 1 398 ? 94.31241  -23.94353 32.33314   1.000 124.16155 ? 398 PRO A CB  1 
ATOM 3210  C CG  . PRO A 1 398 ? 93.06441  -23.84079 33.14001   1.000 117.73490 ? 398 PRO A CG  1 
ATOM 3211  C CD  . PRO A 1 398 ? 92.32043  -25.12591 32.89379   1.000 111.67285 ? 398 PRO A CD  1 
ATOM 3212  N N   . GLU A 1 399 ? 96.90460  -25.34596 33.35707   1.000 101.64421 ? 399 GLU A N   1 
ATOM 3213  C CA  . GLU A 1 399 ? 97.93230  -25.49005 34.37470   1.000 96.34081  ? 399 GLU A CA  1 
ATOM 3214  C C   . GLU A 1 399 ? 98.09110  -24.17365 35.12283   1.000 90.25513  ? 399 GLU A C   1 
ATOM 3215  O O   . GLU A 1 399 ? 97.78304  -23.09845 34.59986   1.000 101.63758 ? 399 GLU A O   1 
ATOM 3216  C CB  . GLU A 1 399 ? 99.27088  -25.90160 33.75587   1.000 98.94064  ? 399 GLU A CB  1 
ATOM 3217  C CG  . GLU A 1 399 ? 99.90864  -24.83659 32.87497   1.000 99.88417  ? 399 GLU A CG  1 
ATOM 3218  C CD  . GLU A 1 399 ? 101.24789 -25.27126 32.30770   1.000 105.11374 ? 399 GLU A CD  1 
ATOM 3219  O OE1 . GLU A 1 399 ? 101.75439 -26.33572 32.72088   1.000 115.04606 ? 399 GLU A OE1 1 
ATOM 3220  O OE2 . GLU A 1 399 ? 101.79766 -24.54477 31.45297   1.000 97.61728  ? 399 GLU A OE2 1 
ATOM 3221  N N   . LEU A 1 400 ? 98.57377  -24.26553 36.35771   1.000 78.78831  ? 400 LEU A N   1 
ATOM 3222  C CA  . LEU A 1 400 ? 98.73679  -23.08319 37.19348   1.000 92.24694  ? 400 LEU A CA  1 
ATOM 3223  C C   . LEU A 1 400 ? 100.06692 -22.41314 36.87386   1.000 85.45672  ? 400 LEU A C   1 
ATOM 3224  O O   . LEU A 1 400 ? 101.13277 -22.99000 37.11473   1.000 78.26463  ? 400 LEU A O   1 
ATOM 3225  C CB  . LEU A 1 400 ? 98.66853  -23.46181 38.67178   1.000 109.40858 ? 400 LEU A CB  1 
ATOM 3226  C CG  . LEU A 1 400 ? 97.43107  -24.22143 39.15225   1.000 100.09194 ? 400 LEU A CG  1 
ATOM 3227  C CD1 . LEU A 1 400 ? 97.60440  -24.65363 40.59877   1.000 108.09507 ? 400 LEU A CD1 1 
ATOM 3228  C CD2 . LEU A 1 400 ? 96.18233  -23.37706 38.99552   1.000 84.87427  ? 400 LEU A CD2 1 
ATOM 3229  N N   . ARG A 1 401 ? 100.00420 -21.19581 36.34179   1.000 77.95771  ? 401 ARG A N   1 
ATOM 3230  C CA  . ARG A 1 401 ? 101.18622 -20.41191 36.01800   1.000 84.47148  ? 401 ARG A CA  1 
ATOM 3231  C C   . ARG A 1 401 ? 101.29383 -19.22579 36.96703   1.000 86.57808  ? 401 ARG A C   1 
ATOM 3232  O O   . ARG A 1 401 ? 100.30333 -18.53789 37.23351   1.000 84.81121  ? 401 ARG A O   1 
ATOM 3233  C CB  . ARG A 1 401 ? 101.14346 -19.92310 34.56632   1.000 92.33285  ? 401 ARG A CB  1 
ATOM 3234  C CG  . ARG A 1 401 ? 101.07395 -21.04546 33.53778   1.000 86.12682  ? 401 ARG A CG  1 
ATOM 3235  C CD  . ARG A 1 401 ? 101.13835 -20.50839 32.11434   1.000 85.01674  ? 401 ARG A CD  1 
ATOM 3236  N NE  . ARG A 1 401 ? 100.99277 -21.56771 31.11816   1.000 97.16484  ? 401 ARG A NE  1 
ATOM 3237  C CZ  . ARG A 1 401 ? 99.84312  -21.89117 30.53408   1.000 100.10740 ? 401 ARG A CZ  1 
ATOM 3238  N NH1 . ARG A 1 401 ? 98.73563  -21.23227 30.84072   1.000 93.26620  ? 401 ARG A NH1 1 
ATOM 3239  N NH2 . ARG A 1 401 ? 99.79976  -22.86860 29.63867   1.000 107.28821 ? 401 ARG A NH2 1 
ATOM 3240  N N   . SER A 1 402 ? 102.49825 -18.98739 37.47166   1.000 83.20856  ? 402 SER A N   1 
ATOM 3241  C CA  . SER A 1 402 ? 102.72230 -17.92950 38.44376   1.000 82.79281  ? 402 SER A CA  1 
ATOM 3242  C C   . SER A 1 402 ? 103.00793 -16.60123 37.74942   1.000 66.35660  ? 402 SER A C   1 
ATOM 3243  O O   . SER A 1 402 ? 103.32168 -16.54500 36.55778   1.000 60.34631  ? 402 SER A O   1 
ATOM 3244  C CB  . SER A 1 402 ? 103.87810 -18.29379 39.37518   1.000 64.38289  ? 402 SER A CB  1 
ATOM 3245  O OG  . SER A 1 402 ? 105.09524 -18.38937 38.65836   1.000 66.70018  ? 402 SER A OG  1 
ATOM 3246  N N   . LEU A 1 403 ? 102.89098 -15.52317 38.52003   1.000 66.72829  ? 403 LEU A N   1 
ATOM 3247  C CA  . LEU A 1 403 ? 103.11123 -14.18784 37.98638   1.000 63.11084  ? 403 LEU A CA  1 
ATOM 3248  C C   . LEU A 1 403 ? 104.58530 -13.97590 37.66127   1.000 69.75708  ? 403 LEU A C   1 
ATOM 3249  O O   . LEU A 1 403 ? 105.47753 -14.50036 38.33372   1.000 85.09532  ? 403 LEU A O   1 
ATOM 3250  C CB  . LEU A 1 403 ? 102.62855 -13.13022 38.98334   1.000 59.97150  ? 403 LEU A CB  1 
ATOM 3251  C CG  . LEU A 1 403 ? 102.93461 -11.65613 38.69499   1.000 59.11469  ? 403 LEU A CG  1 
ATOM 3252  C CD1 . LEU A 1 403 ? 101.73562 -10.78266 38.99917   1.000 58.45020  ? 403 LEU A CD1 1 
ATOM 3253  C CD2 . LEU A 1 403 ? 104.13800 -11.18575 39.50084   1.000 60.43005  ? 403 LEU A CD2 1 
ATOM 3254  N N   . SER A 1 404 ? 104.83446 -13.19430 36.61598   1.000 66.07277  ? 404 SER A N   1 
ATOM 3255  C CA  . SER A 1 404 ? 106.18066 -12.83829 36.19997   1.000 81.14677  ? 404 SER A CA  1 
ATOM 3256  C C   . SER A 1 404 ? 106.37804 -11.33357 36.33448   1.000 68.80927  ? 404 SER A C   1 
ATOM 3257  O O   . SER A 1 404 ? 105.43279 -10.57206 36.55736   1.000 58.75878  ? 404 SER A O   1 
ATOM 3258  C CB  . SER A 1 404 ? 106.45036 -13.29212 34.76044   1.000 99.74673  ? 404 SER A CB  1 
ATOM 3259  O OG  . SER A 1 404 ? 106.40993 -14.70425 34.65768   1.000 111.15341 ? 404 SER A OG  1 
ATOM 3260  N N   . SER A 1 405 ? 107.63261 -10.90964 36.19029   1.000 67.18874  ? 405 SER A N   1 
ATOM 3261  C CA  . SER A 1 405 ? 108.00634 -9.51984  36.41696   1.000 72.27350  ? 405 SER A CA  1 
ATOM 3262  C C   . SER A 1 405 ? 107.77078 -8.61988  35.21069   1.000 75.45706  ? 405 SER A C   1 
ATOM 3263  O O   . SER A 1 405 ? 107.82445 -7.39444  35.35920   1.000 80.51490  ? 405 SER A O   1 
ATOM 3264  C CB  . SER A 1 405 ? 109.47906 -9.44011  36.82875   1.000 76.35622  ? 405 SER A CB  1 
ATOM 3265  O OG  . SER A 1 405 ? 109.74008 -10.25565 37.95858   1.000 72.02726  ? 405 SER A OG  1 
ATOM 3266  N N   . TRP A 1 406 ? 107.51235 -9.18392  34.03017   1.000 77.62509  ? 406 TRP A N   1 
ATOM 3267  C CA  . TRP A 1 406 ? 107.45463 -8.37648  32.81757   1.000 78.22479  ? 406 TRP A CA  1 
ATOM 3268  C C   . TRP A 1 406 ? 106.13521 -7.63606  32.64110   1.000 66.70955  ? 406 TRP A C   1 
ATOM 3269  O O   . TRP A 1 406 ? 106.11069 -6.61295  31.95023   1.000 60.23373  ? 406 TRP A O   1 
ATOM 3270  C CB  . TRP A 1 406 ? 107.70365 -9.25317  31.58715   1.000 81.77688  ? 406 TRP A CB  1 
ATOM 3271  C CG  . TRP A 1 406 ? 106.70271 -10.35609 31.43087   1.000 62.41218  ? 406 TRP A CG  1 
ATOM 3272  C CD1 . TRP A 1 406 ? 106.82138 -11.63671 31.87971   1.000 53.50608  ? 406 TRP A CD1 1 
ATOM 3273  C CD2 . TRP A 1 406 ? 105.42633 -10.27428 30.78329   1.000 58.98527  ? 406 TRP A CD2 1 
ATOM 3274  N NE1 . TRP A 1 406 ? 105.69911 -12.35956 31.55426   1.000 55.68002  ? 406 TRP A NE1 1 
ATOM 3275  C CE2 . TRP A 1 406 ? 104.82756 -11.54565 30.87991   1.000 64.98229  ? 406 TRP A CE2 1 
ATOM 3276  C CE3 . TRP A 1 406 ? 104.73318 -9.25014  30.13052   1.000 54.36234  ? 406 TRP A CE3 1 
ATOM 3277  C CZ2 . TRP A 1 406 ? 103.56932 -11.82017 30.34933   1.000 76.23171  ? 406 TRP A CZ2 1 
ATOM 3278  C CZ3 . TRP A 1 406 ? 103.48462 -9.52381  29.60599   1.000 61.55346  ? 406 TRP A CZ3 1 
ATOM 3279  C CH2 . TRP A 1 406 ? 102.91514 -10.79811 29.71885   1.000 77.67471  ? 406 TRP A CH2 1 
ATOM 3280  N N   . ILE A 1 407 ? 105.04192 -8.12002  33.23592   1.000 61.42708  ? 407 ILE A N   1 
ATOM 3281  C CA  . ILE A 1 407 ? 103.75366 -7.46400  33.02559   1.000 50.92826  ? 407 ILE A CA  1 
ATOM 3282  C C   . ILE A 1 407 ? 103.71494 -6.11106  33.72961   1.000 48.39535  ? 407 ILE A C   1 
ATOM 3283  O O   . ILE A 1 407 ? 103.12039 -5.14985  33.21847   1.000 49.03053  ? 407 ILE A O   1 
ATOM 3284  C CB  . ILE A 1 407 ? 102.60342 -8.39019  33.47237   1.000 48.09576  ? 407 ILE A CB  1 
ATOM 3285  C CG1 . ILE A 1 407 ? 101.24499 -7.77214  33.13205   1.000 45.75004  ? 407 ILE A CG1 1 
ATOM 3286  C CG2 . ILE A 1 407 ? 102.70728 -8.72353  34.95797   1.000 48.43205  ? 407 ILE A CG2 1 
ATOM 3287  C CD1 . ILE A 1 407 ? 101.02741 -7.55097  31.65058   1.000 44.46492  ? 407 ILE A CD1 1 
ATOM 3288  N N   . GLN A 1 408 ? 104.36951 -5.99795  34.88807   1.000 48.01161  ? 408 GLN A N   1 
ATOM 3289  C CA  . GLN A 1 408 ? 104.43759 -4.71112  35.57045   1.000 51.07049  ? 408 GLN A CA  1 
ATOM 3290  C C   . GLN A 1 408 ? 105.24553 -3.70547  34.76124   1.000 59.07128  ? 408 GLN A C   1 
ATOM 3291  O O   . GLN A 1 408 ? 104.87558 -2.53039  34.67857   1.000 48.09554  ? 408 GLN A O   1 
ATOM 3292  C CB  . GLN A 1 408 ? 105.03286 -4.88301  36.96794   1.000 67.09902  ? 408 GLN A CB  1 
ATOM 3293  C CG  . GLN A 1 408 ? 105.09220 -3.59598  37.77741   1.000 78.63865  ? 408 GLN A CG  1 
ATOM 3294  C CD  . GLN A 1 408 ? 103.71892 -3.03375  38.08763   1.000 73.04468  ? 408 GLN A CD  1 
ATOM 3295  O OE1 . GLN A 1 408 ? 102.85445 -3.72974  38.61871   1.000 59.09189  ? 408 GLN A OE1 1 
ATOM 3296  N NE2 . GLN A 1 408 ? 103.50973 -1.76690  37.74987   1.000 76.38901  ? 408 GLN A NE2 1 
ATOM 3297  N N   . ASN A 1 409 ? 106.34955 -4.14739  34.15325   1.000 54.86813  ? 409 ASN A N   1 
ATOM 3298  C CA  . ASN A 1 409 ? 107.12186 -3.25764  33.29068   1.000 74.73979  ? 409 ASN A CA  1 
ATOM 3299  C C   . ASN A 1 409 ? 106.33226 -2.87921  32.04307   1.000 97.15710  ? 409 ASN A C   1 
ATOM 3300  O O   . ASN A 1 409 ? 106.42592 -1.74331  31.56263   1.000 139.03872 ? 409 ASN A O   1 
ATOM 3301  C CB  . ASN A 1 409 ? 108.44922 -3.91431  32.91401   1.000 68.49271  ? 409 ASN A CB  1 
ATOM 3302  C CG  . ASN A 1 409 ? 109.38170 -4.06434  34.10117   1.000 89.61818  ? 409 ASN A CG  1 
ATOM 3303  O OD1 . ASN A 1 409 ? 109.70435 -5.17798  34.51515   1.000 116.77061 ? 409 ASN A OD1 1 
ATOM 3304  N ND2 . ASN A 1 409 ? 109.81764 -2.93910  34.65776   1.000 75.29292  ? 409 ASN A ND2 1 
ATOM 3305  N N   . GLU A 1 410 ? 105.55033 -3.81907  31.50684   1.000 80.58604  ? 410 GLU A N   1 
ATOM 3306  C CA  . GLU A 1 410 ? 104.68057 -3.51519  30.37544   1.000 58.44454  ? 410 GLU A CA  1 
ATOM 3307  C C   . GLU A 1 410 ? 103.69929 -2.40603  30.73377   1.000 57.96222  ? 410 GLU A C   1 
ATOM 3308  O O   . GLU A 1 410 ? 103.51699 -1.44659  29.97384   1.000 55.55008  ? 410 GLU A O   1 
ATOM 3309  C CB  . GLU A 1 410 ? 103.93060 -4.77945  29.95022   1.000 49.80024  ? 410 GLU A CB  1 
ATOM 3310  C CG  . GLU A 1 410 ? 103.38551 -4.76829  28.53089   1.000 43.07763  ? 410 GLU A CG  1 
ATOM 3311  C CD  . GLU A 1 410 ? 104.42005 -5.17906  27.50129   1.000 56.61441  ? 410 GLU A CD  1 
ATOM 3312  O OE1 . GLU A 1 410 ? 105.18556 -6.12889  27.76898   1.000 65.78567  ? 410 GLU A OE1 1 
ATOM 3313  O OE2 . GLU A 1 410 ? 104.45987 -4.56063  26.41895   1.000 59.93898  ? 410 GLU A OE2 1 
ATOM 3314  N N   . PHE A 1 411 ? 103.07224 -2.51292  31.90825   1.000 59.77687  ? 411 PHE A N   1 
ATOM 3315  C CA  . PHE A 1 411 ? 102.14898 -1.46987  32.34703   1.000 55.40159  ? 411 PHE A CA  1 
ATOM 3316  C C   . PHE A 1 411 ? 102.87063 -0.14990  32.59321   1.000 59.46695  ? 411 PHE A C   1 
ATOM 3317  O O   . PHE A 1 411 ? 102.36206 0.91749   32.23036   1.000 59.36922  ? 411 PHE A O   1 
ATOM 3318  C CB  . PHE A 1 411 ? 101.41318 -1.90373  33.61122   1.000 46.14535  ? 411 PHE A CB  1 
ATOM 3319  C CG  . PHE A 1 411 ? 100.31479 -0.96553  34.01427   1.000 49.49880  ? 411 PHE A CG  1 
ATOM 3320  C CD1 . PHE A 1 411 ? 99.48990  -0.39338  33.06085   1.000 58.68930  ? 411 PHE A CD1 1 
ATOM 3321  C CD2 . PHE A 1 411 ? 100.13136 -0.62522  35.34063   1.000 57.49964  ? 411 PHE A CD2 1 
ATOM 3322  C CE1 . PHE A 1 411 ? 98.48291  0.47708   33.42931   1.000 58.66548  ? 411 PHE A CE1 1 
ATOM 3323  C CE2 . PHE A 1 411 ? 99.12747  0.24302   35.71521   1.000 73.58299  ? 411 PHE A CE2 1 
ATOM 3324  C CZ  . PHE A 1 411 ? 98.30349  0.79725   34.75818   1.000 69.11093  ? 411 PHE A CZ  1 
ATOM 3325  N N   . ASN A 1 412 ? 104.04711 -0.20040  33.22442   1.000 49.45624  ? 412 ASN A N   1 
ATOM 3326  C CA  . ASN A 1 412 ? 104.80958 1.01808   33.47870   1.000 55.16543  ? 412 ASN A CA  1 
ATOM 3327  C C   . ASN A 1 412 ? 105.14051 1.73758   32.17952   1.000 55.80008  ? 412 ASN A C   1 
ATOM 3328  O O   . ASN A 1 412 ? 105.04689 2.96808   32.09884   1.000 55.31777  ? 412 ASN A O   1 
ATOM 3329  C CB  . ASN A 1 412 ? 106.08997 0.68731   34.24687   1.000 78.41957  ? 412 ASN A CB  1 
ATOM 3330  C CG  . ASN A 1 412 ? 105.81732 0.19091   35.65335   1.000 82.83468  ? 412 ASN A CG  1 
ATOM 3331  O OD1 . ASN A 1 412 ? 104.99644 0.75408   36.37589   1.000 89.85705  ? 412 ASN A OD1 1 
ATOM 3332  N ND2 . ASN A 1 412 ? 106.51087 -0.86969  36.05000   1.000 82.79054  ? 412 ASN A ND2 1 
ATOM 3333  N N   . LYS A 1 413 ? 105.52409 0.98340   31.14852   1.000 69.75734  ? 413 LYS A N   1 
ATOM 3334  C CA  . LYS A 1 413 ? 105.78584 1.58743   29.84885   1.000 71.42247  ? 413 LYS A CA  1 
ATOM 3335  C C   . LYS A 1 413 ? 104.50099 2.09103   29.20280   1.000 51.67389  ? 413 LYS A C   1 
ATOM 3336  O O   . LYS A 1 413 ? 104.52453 3.08839   28.47257   1.000 38.98224  ? 413 LYS A O   1 
ATOM 3337  C CB  . LYS A 1 413 ? 106.48942 0.57702   28.94175   1.000 81.64508  ? 413 LYS A CB  1 
ATOM 3338  C CG  . LYS A 1 413 ? 106.85522 1.11122   27.56867   1.000 89.81097  ? 413 LYS A CG  1 
ATOM 3339  C CD  . LYS A 1 413 ? 107.91151 2.20128   27.66978   1.000 102.60485 ? 413 LYS A CD  1 
ATOM 3340  C CE  . LYS A 1 413 ? 109.25150 1.62436   28.10649   1.000 107.63905 ? 413 LYS A CE  1 
ATOM 3341  N NZ  . LYS A 1 413 ? 110.33921 2.64061   28.06270   1.000 106.80130 ? 413 LYS A NZ  1 
ATOM 3342  N N   . ALA A 1 414 ? 103.37293 1.43014   29.47572   1.000 57.59611  ? 414 ALA A N   1 
ATOM 3343  C CA  . ALA A 1 414 ? 102.09331 1.85916   28.92332   1.000 50.73662  ? 414 ALA A CA  1 
ATOM 3344  C C   . ALA A 1 414 ? 101.63649 3.20668   29.47060   1.000 49.12249  ? 414 ALA A C   1 
ATOM 3345  O O   . ALA A 1 414 ? 100.83746 3.88544   28.81679   1.000 45.82966  ? 414 ALA A O   1 
ATOM 3346  C CB  . ALA A 1 414 ? 101.02272 0.80021   29.19237   1.000 51.45671  ? 414 ALA A CB  1 
ATOM 3347  N N   . CYS A 1 415 ? 102.11552 3.60794   30.64750   1.000 60.92949  ? 415 CYS A N   1 
ATOM 3348  C CA  . CYS A 1 415 ? 101.74773 4.89061   31.23460   1.000 58.73467  ? 415 CYS A CA  1 
ATOM 3349  C C   . CYS A 1 415 ? 102.66270 6.03423   30.81410   1.000 44.76698  ? 415 CYS A C   1 
ATOM 3350  O O   . CYS A 1 415 ? 102.36230 7.19140   31.12708   1.000 44.18883  ? 415 CYS A O   1 
ATOM 3351  C CB  . CYS A 1 415 ? 101.74527 4.78823   32.76418   1.000 65.73883  ? 415 CYS A CB  1 
ATOM 3352  S SG  . CYS A 1 415 ? 100.65721 3.50288   33.42257   1.000 61.60341  ? 415 CYS A SG  1 
ATOM 3353  N N   . GLU A 1 416 ? 103.75934 5.74479   30.12051   1.000 40.74070  ? 416 GLU A N   1 
ATOM 3354  C CA  . GLU A 1 416 ? 104.72535 6.76398   29.74409   1.000 56.23885  ? 416 GLU A CA  1 
ATOM 3355  C C   . GLU A 1 416 ? 104.19602 7.61350   28.58770   1.000 40.96198  ? 416 GLU A C   1 
ATOM 3356  O O   . GLU A 1 416 ? 103.29886 7.21103   27.84264   1.000 39.61460  ? 416 GLU A O   1 
ATOM 3357  C CB  . GLU A 1 416 ? 106.06022 6.11172   29.37093   1.000 92.26212  ? 416 GLU A CB  1 
ATOM 3358  C CG  . GLU A 1 416 ? 107.23201 7.07613   29.23289   1.000 111.68956 ? 416 GLU A CG  1 
ATOM 3359  C CD  . GLU A 1 416 ? 108.56157 6.36504   29.07796   1.000 116.92597 ? 416 GLU A CD  1 
ATOM 3360  O OE1 . GLU A 1 416 ? 108.63776 5.16367   29.40956   1.000 123.08543 ? 416 GLU A OE1 1 
ATOM 3361  O OE2 . GLU A 1 416 ? 109.53171 7.00976   28.62737   1.000 113.64212 ? 416 GLU A OE2 1 
ATOM 3362  N N   . LEU A 1 417 ? 104.76783 8.80752   28.44996   1.000 45.78858  ? 417 LEU A N   1 
ATOM 3363  C CA  . LEU A 1 417 ? 104.42642 9.73008   27.37804   1.000 46.01440  ? 417 LEU A CA  1 
ATOM 3364  C C   . LEU A 1 417 ? 105.29408 9.45065   26.15565   1.000 71.01715  ? 417 LEU A C   1 
ATOM 3365  O O   . LEU A 1 417 ? 106.40568 8.92732   26.26747   1.000 91.98713  ? 417 LEU A O   1 
ATOM 3366  C CB  . LEU A 1 417 ? 104.61834 11.17661  27.83853   1.000 53.15113  ? 417 LEU A CB  1 
ATOM 3367  C CG  . LEU A 1 417 ? 103.64427 12.23569  27.32224   1.000 70.15648  ? 417 LEU A CG  1 
ATOM 3368  C CD1 . LEU A 1 417 ? 102.26489 12.03115  27.92857   1.000 56.69433  ? 417 LEU A CD1 1 
ATOM 3369  C CD2 . LEU A 1 417 ? 104.16654 13.63269  27.62570   1.000 89.25309  ? 417 LEU A CD2 1 
ATOM 3370  N N   . THR A 1 418 ? 104.77695 9.80482   24.98303   1.000 86.51699  ? 418 THR A N   1 
ATOM 3371  C CA  . THR A 1 418 ? 105.44620 9.52136   23.71934   1.000 88.95853  ? 418 THR A CA  1 
ATOM 3372  C C   . THR A 1 418 ? 105.71663 10.81752  22.95451   1.000 97.81000  ? 418 THR A C   1 
ATOM 3373  O O   . THR A 1 418 ? 105.49039 11.92415  23.45313   1.000 85.36767  ? 418 THR A O   1 
ATOM 3374  C CB  . THR A 1 418 ? 104.61454 8.55210   22.87436   1.000 62.68396  ? 418 THR A CB  1 
ATOM 3375  O OG1 . THR A 1 418 ? 103.36596 9.16642   22.53005   1.000 45.80736  ? 418 THR A OG1 1 
ATOM 3376  C CG2 . THR A 1 418 ? 104.34718 7.26766   23.64201   1.000 48.31904  ? 418 THR A CG2 1 
ATOM 3377  N N   . ASP A 1 419 ? 106.21288 10.66188  21.72646   1.000 98.08202  ? 419 ASP A N   1 
ATOM 3378  C CA  . ASP A 1 419 ? 106.59616 11.78921  20.88757   1.000 87.48107  ? 419 ASP A CA  1 
ATOM 3379  C C   . ASP A 1 419 ? 105.44688 12.30928  20.03582   1.000 64.62096  ? 419 ASP A C   1 
ATOM 3380  O O   . ASP A 1 419 ? 105.40664 13.50663  19.73032   1.000 63.25765  ? 419 ASP A O   1 
ATOM 3381  C CB  . ASP A 1 419 ? 107.75837 11.39163  19.97284   1.000 111.84819 ? 419 ASP A CB  1 
ATOM 3382  C CG  . ASP A 1 419 ? 108.85583 10.65127  20.71137   1.000 134.72272 ? 419 ASP A CG  1 
ATOM 3383  O OD1 . ASP A 1 419 ? 109.07505 10.94336  21.90615   1.000 137.07751 ? 419 ASP A OD1 1 
ATOM 3384  O OD2 . ASP A 1 419 ? 109.49665 9.77286   20.09593   1.000 144.28752 ? 419 ASP A OD2 1 
ATOM 3385  N N   . SER A 1 420 ? 104.51581 11.44106  19.64456   1.000 56.14171  ? 420 SER A N   1 
ATOM 3386  C CA  . SER A 1 420 ? 103.45138 11.79584  18.72057   1.000 69.29960  ? 420 SER A CA  1 
ATOM 3387  C C   . SER A 1 420 ? 102.14944 12.05499  19.47977   1.000 67.28972  ? 420 SER A C   1 
ATOM 3388  O O   . SER A 1 420 ? 102.09746 12.00922  20.71057   1.000 90.51788  ? 420 SER A O   1 
ATOM 3389  C CB  . SER A 1 420 ? 103.27885 10.69730  17.66963   1.000 98.63273  ? 420 SER A CB  1 
ATOM 3390  O OG  . SER A 1 420 ? 104.48084 10.49624  16.94412   1.000 111.71314 ? 420 SER A OG  1 
ATOM 3391  N N   . THR A 1 421 ? 101.07648 12.30443  18.72701   1.000 59.53574  ? 421 THR A N   1 
ATOM 3392  C CA  . THR A 1 421 ? 99.78911  12.71563  19.28365   1.000 60.93350  ? 421 THR A CA  1 
ATOM 3393  C C   . THR A 1 421 ? 98.73008  11.62255  19.26440   1.000 87.12272  ? 421 THR A C   1 
ATOM 3394  O O   . THR A 1 421 ? 97.99646  11.47205  20.24321   1.000 115.19563 ? 421 THR A O   1 
ATOM 3395  C CB  . THR A 1 421 ? 99.25950  13.94124  18.52922   1.000 51.95808  ? 421 THR A CB  1 
ATOM 3396  O OG1 . THR A 1 421 ? 99.26887  13.67762  17.12132   1.000 65.94037  ? 421 THR A OG1 1 
ATOM 3397  C CG2 . THR A 1 421 ? 100.13184 15.15706  18.81194   1.000 47.22670  ? 421 THR A CG2 1 
ATOM 3398  N N   . TRP A 1 422 ? 98.60968  10.87587  18.16572   1.000 73.25603  ? 422 TRP A N   1 
ATOM 3399  C CA  . TRP A 1 422 ? 97.81832  9.65025   18.05296   1.000 51.88050  ? 422 TRP A CA  1 
ATOM 3400  C C   . TRP A 1 422 ? 96.30654  9.84754   18.11433   1.000 49.04959  ? 422 TRP A C   1 
ATOM 3401  O O   . TRP A 1 422 ? 95.57649  8.85322   18.20548   1.000 52.94128  ? 422 TRP A O   1 
ATOM 3402  C CB  . TRP A 1 422 ? 98.21169  8.62235   19.12222   1.000 45.68138  ? 422 TRP A CB  1 
ATOM 3403  C CG  . TRP A 1 422 ? 99.66965  8.31833   19.15967   1.000 49.68589  ? 422 TRP A CG  1 
ATOM 3404  C CD1 . TRP A 1 422 ? 100.60786 8.88533   19.97196   1.000 54.59574  ? 422 TRP A CD1 1 
ATOM 3405  C CD2 . TRP A 1 422 ? 100.36138 7.36254   18.35098   1.000 53.38939  ? 422 TRP A CD2 1 
ATOM 3406  N NE1 . TRP A 1 422 ? 101.84463 8.34481   19.71282   1.000 62.97950  ? 422 TRP A NE1 1 
ATOM 3407  C CE2 . TRP A 1 422 ? 101.71922 7.40658   18.72159   1.000 71.43504  ? 422 TRP A CE2 1 
ATOM 3408  C CE3 . TRP A 1 422 ? 99.96405  6.47517   17.34647   1.000 55.74818  ? 422 TRP A CE3 1 
ATOM 3409  C CZ2 . TRP A 1 422 ? 102.68178 6.59732   18.12260   1.000 93.03690  ? 422 TRP A CZ2 1 
ATOM 3410  C CZ3 . TRP A 1 422 ? 100.92063 5.67327   16.75292   1.000 49.91832  ? 422 TRP A CZ3 1 
ATOM 3411  C CH2 . TRP A 1 422 ? 102.26347 5.74052   17.14163   1.000 77.72479  ? 422 TRP A CH2 1 
ATOM 3412  N N   . ILE A 1 423 ? 95.80059  11.07842  18.06783   1.000 45.74402  ? 423 ILE A N   1 
ATOM 3413  C CA  . ILE A 1 423 ? 94.35747  11.30828  18.05012   1.000 50.82590  ? 423 ILE A CA  1 
ATOM 3414  C C   . ILE A 1 423 ? 94.02776  12.41839  17.06188   1.000 89.86365  ? 423 ILE A C   1 
ATOM 3415  O O   . ILE A 1 423 ? 94.76111  13.40613  16.94768   1.000 113.85393 ? 423 ILE A O   1 
ATOM 3416  C CB  . ILE A 1 423 ? 93.79000  11.63109  19.45654   1.000 45.87545  ? 423 ILE A CB  1 
ATOM 3417  C CG1 . ILE A 1 423 ? 94.49784  12.82090  20.11989   1.000 47.76751  ? 423 ILE A CG1 1 
ATOM 3418  C CG2 . ILE A 1 423 ? 93.78402  10.40148  20.34950   1.000 45.22987  ? 423 ILE A CG2 1 
ATOM 3419  C CD1 . ILE A 1 423 ? 93.84507  14.16502  19.86762   1.000 47.87015  ? 423 ILE A CD1 1 
ATOM 3420  N N   . GLU A 1 424 ? 92.92678  12.24218  16.33539   1.000 79.45507  ? 424 GLU A N   1 
ATOM 3421  C CA  . GLU A 1 424 ? 92.30090  13.30984  15.55937   1.000 99.58158  ? 424 GLU A CA  1 
ATOM 3422  C C   . GLU A 1 424 ? 90.89383  13.48049  16.12920   1.000 119.99681 ? 424 GLU A C   1 
ATOM 3423  O O   . GLU A 1 424 ? 89.92113  12.90880  15.63128   1.000 156.80729 ? 424 GLU A O   1 
ATOM 3424  C CB  . GLU A 1 424 ? 92.30343  13.00004  14.04002   1.000 104.96103 ? 424 GLU A CB  1 
ATOM 3425  C CG  . GLU A 1 424 ? 91.75033  11.63495  13.64080   1.000 102.55071 ? 424 GLU A CG  1 
ATOM 3426  C CD  . GLU A 1 424 ? 92.83309  10.61420  13.34522   1.000 101.77193 ? 424 GLU A CD  1 
ATOM 3427  O OE1 . GLU A 1 424 ? 94.01798  10.89948  13.62027   1.000 104.98605 ? 424 GLU A OE1 1 
ATOM 3428  O OE2 . GLU A 1 424 ? 92.49686  9.52224   12.83831   1.000 95.14536  ? 424 GLU A OE2 1 
ATOM 3429  N N   . LEU A 1 425 ? 90.78981  14.27257  17.19072   1.000 104.96779 ? 425 LEU A N   1 
ATOM 3430  C CA  . LEU A 1 425 ? 89.52958  14.46310  17.89589   1.000 73.82613  ? 425 LEU A CA  1 
ATOM 3431  C C   . LEU A 1 425 ? 88.79330  15.63544  17.25821   1.000 86.98814  ? 425 LEU A C   1 
ATOM 3432  O O   . LEU A 1 425 ? 89.28400  16.76918  17.28543   1.000 108.71883 ? 425 LEU A O   1 
ATOM 3433  C CB  . LEU A 1 425 ? 89.78331  14.70518  19.38376   1.000 48.42947  ? 425 LEU A CB  1 
ATOM 3434  C CG  . LEU A 1 425 ? 88.81191  14.04914  20.36516   1.000 41.64349  ? 425 LEU A CG  1 
ATOM 3435  C CD1 . LEU A 1 425 ? 88.81846  12.54296  20.17598   1.000 39.43591  ? 425 LEU A CD1 1 
ATOM 3436  C CD2 . LEU A 1 425 ? 89.17310  14.40422  21.79996   1.000 44.81757  ? 425 LEU A CD2 1 
ATOM 3437  N N   . ASP A 1 426 ? 87.62342  15.36145  16.68455   1.000 75.94664  ? 426 ASP A N   1 
ATOM 3438  C CA  . ASP A 1 426 ? 86.91884  16.34830  15.87826   1.000 77.81828  ? 426 ASP A CA  1 
ATOM 3439  C C   . ASP A 1 426 ? 86.42618  17.50502  16.74804   1.000 70.99449  ? 426 ASP A C   1 
ATOM 3440  O O   . ASP A 1 426 ? 86.64281  17.55148  17.96085   1.000 67.29780  ? 426 ASP A O   1 
ATOM 3441  C CB  . ASP A 1 426 ? 85.76203  15.69535  15.12832   1.000 74.28708  ? 426 ASP A CB  1 
ATOM 3442  C CG  . ASP A 1 426 ? 86.22698  14.91479  13.92014   1.000 63.93867  ? 426 ASP A CG  1 
ATOM 3443  O OD1 . ASP A 1 426 ? 87.44592  14.90610  13.65298   1.000 62.68760  ? 426 ASP A OD1 1 
ATOM 3444  O OD2 . ASP A 1 426 ? 85.37426  14.33421  13.22091   1.000 59.73316  ? 426 ASP A OD2 1 
ATOM 3445  N N   . GLU A 1 427 ? 85.76624  18.46386  16.10893   1.000 56.69163  ? 427 GLU A N   1 
ATOM 3446  C CA  . GLU A 1 427 ? 85.42394  19.71092  16.77170   1.000 52.62442  ? 427 GLU A CA  1 
ATOM 3447  C C   . GLU A 1 427 ? 84.05230  19.63356  17.43381   1.000 49.46492  ? 427 GLU A C   1 
ATOM 3448  O O   . GLU A 1 427 ? 83.23699  18.75344  17.14756   1.000 48.40422  ? 427 GLU A O   1 
ATOM 3449  C CB  . GLU A 1 427 ? 85.44987  20.87551  15.78065   1.000 55.01924  ? 427 GLU A CB  1 
ATOM 3450  C CG  . GLU A 1 427 ? 84.24985  20.94047  14.84482   1.000 54.73276  ? 427 GLU A CG  1 
ATOM 3451  C CD  . GLU A 1 427 ? 84.40958  20.07613  13.61119   1.000 51.00252  ? 427 GLU A CD  1 
ATOM 3452  O OE1 . GLU A 1 427 ? 85.36399  19.27216  13.55892   1.000 49.72147  ? 427 GLU A OE1 1 
ATOM 3453  O OE2 . GLU A 1 427 ? 83.58232  20.21191  12.68561   1.000 51.20430  ? 427 GLU A OE2 1 
ATOM 3454  N N   . ILE A 1 428 ? 83.81022  20.58711  18.33169   1.000 47.76859  ? 428 ILE A N   1 
ATOM 3455  C CA  . ILE A 1 428 ? 82.52391  20.77942  18.98561   1.000 48.39792  ? 428 ILE A CA  1 
ATOM 3456  C C   . ILE A 1 428 ? 82.20214  22.26649  18.94138   1.000 50.20660  ? 428 ILE A C   1 
ATOM 3457  O O   . ILE A 1 428 ? 83.09598  23.11551  19.01665   1.000 50.95963  ? 428 ILE A O   1 
ATOM 3458  C CB  . ILE A 1 428 ? 82.52768  20.24831  20.44039   1.000 47.94541  ? 428 ILE A CB  1 
ATOM 3459  C CG1 . ILE A 1 428 ? 82.78265  18.74015  20.45703   1.000 46.28792  ? 428 ILE A CG1 1 
ATOM 3460  C CG2 . ILE A 1 428 ? 81.21430  20.55323  21.14766   1.000 48.81676  ? 428 ILE A CG2 1 
ATOM 3461  C CD1 . ILE A 1 428 ? 82.82047  18.14045  21.84620   1.000 45.88705  ? 428 ILE A CD1 1 
ATOM 3462  N N   . GLY A 1 429 ? 80.91576  22.57935  18.80053   1.000 52.46992  ? 429 GLY A N   1 
ATOM 3463  C CA  . GLY A 1 429 ? 80.46956  23.94767  18.62644   1.000 60.48507  ? 429 GLY A CA  1 
ATOM 3464  C C   . GLY A 1 429 ? 80.81166  24.90418  19.74960   1.000 58.97906  ? 429 GLY A C   1 
ATOM 3465  O O   . GLY A 1 429 ? 81.40493  24.51637  20.76121   1.000 54.88127  ? 429 GLY A O   1 
ATOM 3466  N N   . GLU A 1 430 ? 80.43389  26.16747  19.56400   1.000 65.15268  ? 430 GLU A N   1 
ATOM 3467  C CA  . GLU A 1 430 ? 80.71551  27.21461  20.53622   1.000 77.67969  ? 430 GLU A CA  1 
ATOM 3468  C C   . GLU A 1 430 ? 80.13459  26.86231  21.90203   1.000 81.48468  ? 430 GLU A C   1 
ATOM 3469  O O   . GLU A 1 430 ? 79.11441  26.17581  22.01136   1.000 77.77238  ? 430 GLU A O   1 
ATOM 3470  C CB  . GLU A 1 430 ? 80.13500  28.54350  20.05015   1.000 92.55909  ? 430 GLU A CB  1 
ATOM 3471  C CG  . GLU A 1 430 ? 80.58019  28.93733  18.64965   1.000 98.93763  ? 430 GLU A CG  1 
ATOM 3472  C CD  . GLU A 1 430 ? 79.76466  30.08151  18.07742   1.000 115.87082 ? 430 GLU A CD  1 
ATOM 3473  O OE1 . GLU A 1 430 ? 78.80782  30.52455  18.74691   1.000 123.22527 ? 430 GLU A OE1 1 
ATOM 3474  O OE2 . GLU A 1 430 ? 80.07653  30.53398  16.95548   1.000 121.36597 ? 430 GLU A OE2 1 
ATOM 3475  N N   . ASP A 1 431 ? 80.79691  27.33945  22.95368   1.000 87.40656  ? 431 ASP A N   1 
ATOM 3476  C CA  . ASP A 1 431 ? 80.37028  27.10335  24.32913   1.000 83.77165  ? 431 ASP A CA  1 
ATOM 3477  C C   . ASP A 1 431 ? 79.75114  28.39426  24.85162   1.000 89.35988  ? 431 ASP A C   1 
ATOM 3478  O O   . ASP A 1 431 ? 80.46224  29.36208  25.13740   1.000 101.84278 ? 431 ASP A O   1 
ATOM 3479  C CB  . ASP A 1 431 ? 81.54130  26.65948  25.20328   1.000 76.67139  ? 431 ASP A CB  1 
ATOM 3480  C CG  . ASP A 1 431 ? 82.14392  25.34387  24.75032   1.000 76.82491  ? 431 ASP A CG  1 
ATOM 3481  O OD1 . ASP A 1 431 ? 81.43102  24.55015  24.10044   1.000 76.14657  ? 431 ASP A OD1 1 
ATOM 3482  O OD2 . ASP A 1 431 ? 83.33651  25.10820  25.03912   1.000 76.74587  ? 431 ASP A OD2 1 
ATOM 3483  N N   . VAL A 1 432 ? 78.42498  28.40235  24.97254   1.000 69.43733  ? 432 VAL A N   1 
ATOM 3484  C CA  . VAL A 1 432 ? 77.68164  29.55841  25.46113   1.000 63.25398  ? 432 VAL A CA  1 
ATOM 3485  C C   . VAL A 1 432 ? 76.85124  29.18804  26.68834   1.000 61.46820  ? 432 VAL A C   1 
ATOM 3486  O O   . VAL A 1 432 ? 75.73913  29.69055  26.88302   1.000 72.18580  ? 432 VAL A O   1 
ATOM 3487  C CB  . VAL A 1 432 ? 76.82460  30.17099  24.33294   1.000 62.27729  ? 432 VAL A CB  1 
ATOM 3488  C CG1 . VAL A 1 432 ? 77.65784  30.33653  23.07511   1.000 61.82899  ? 432 VAL A CG1 1 
ATOM 3489  C CG2 . VAL A 1 432 ? 75.64923  29.26315  23.99082   1.000 61.40618  ? 432 VAL A CG2 1 
ATOM 3490  N N   . ALA A 1 433 ? 77.42237  28.36678  27.56750   1.000 64.11917  ? 433 ALA A N   1 
ATOM 3491  C CA  . ALA A 1 433 ? 76.71924  27.93797  28.76815   1.000 64.31699  ? 433 ALA A CA  1 
ATOM 3492  C C   . ALA A 1 433 ? 77.74312  27.51302  29.80644   1.000 65.49151  ? 433 ALA A C   1 
ATOM 3493  O O   . ALA A 1 433 ? 78.80868  27.00049  29.44573   1.000 88.47382  ? 433 ALA A O   1 
ATOM 3494  C CB  . ALA A 1 433 ? 75.75570  26.78224  28.46288   1.000 63.47709  ? 433 ALA A CB  1 
ATOM 3495  N N   . PRO A 1 434 ? 77.45270  27.70840  31.09699   1.000 73.23211  ? 434 PRO A N   1 
ATOM 3496  C CA  . PRO A 1 434 ? 78.45288  27.37460  32.12714   1.000 74.96427  ? 434 PRO A CA  1 
ATOM 3497  C C   . PRO A 1 434 ? 78.77568  25.89198  32.20826   1.000 73.17048  ? 434 PRO A C   1 
ATOM 3498  O O   . PRO A 1 434 ? 79.95221  25.52777  32.34564   1.000 76.42674  ? 434 PRO A O   1 
ATOM 3499  C CB  . PRO A 1 434 ? 77.80623  27.89203  33.42134   1.000 79.32723  ? 434 PRO A CB  1 
ATOM 3500  C CG  . PRO A 1 434 ? 76.77152  28.88030  32.97544   1.000 77.14008  ? 434 PRO A CG  1 
ATOM 3501  C CD  . PRO A 1 434 ? 76.27138  28.37961  31.66120   1.000 72.61387  ? 434 PRO A CD  1 
ATOM 3502  N N   . ILE A 1 435 ? 77.76825  25.01916  32.12338   1.000 69.50221  ? 435 ILE A N   1 
ATOM 3503  C CA  . ILE A 1 435 ? 78.05213  23.58823  32.15236   1.000 66.95461  ? 435 ILE A CA  1 
ATOM 3504  C C   . ILE A 1 435 ? 78.80773  23.17864  30.89715   1.000 74.48281  ? 435 ILE A C   1 
ATOM 3505  O O   . ILE A 1 435 ? 79.64425  22.26768  30.93484   1.000 68.53634  ? 435 ILE A O   1 
ATOM 3506  C CB  . ILE A 1 435 ? 76.75027  22.78331  32.32917   1.000 66.30852  ? 435 ILE A CB  1 
ATOM 3507  C CG1 . ILE A 1 435 ? 76.11988  23.08573  33.68838   1.000 79.56142  ? 435 ILE A CG1 1 
ATOM 3508  C CG2 . ILE A 1 435 ? 77.01182  21.28998  32.20437   1.000 60.09607  ? 435 ILE A CG2 1 
ATOM 3509  C CD1 . ILE A 1 435 ? 76.89335  22.49527  34.84965   1.000 87.39372  ? 435 ILE A CD1 1 
ATOM 3510  N N   . GLU A 1 436 ? 78.56258  23.86236  29.77868   1.000 68.16492  ? 436 GLU A N   1 
ATOM 3511  C CA  . GLU A 1 436 ? 79.34413  23.59739  28.57741   1.000 75.27593  ? 436 GLU A CA  1 
ATOM 3512  C C   . GLU A 1 436 ? 80.79750  24.00753  28.77810   1.000 96.36873  ? 436 GLU A C   1 
ATOM 3513  O O   . GLU A 1 436 ? 81.71327  23.29377  28.35342   1.000 117.72653 ? 436 GLU A O   1 
ATOM 3514  C CB  . GLU A 1 436 ? 78.72994  24.32970  27.38542   1.000 65.69273  ? 436 GLU A CB  1 
ATOM 3515  C CG  . GLU A 1 436 ? 77.46655  23.67762  26.85073   1.000 53.14183  ? 436 GLU A CG  1 
ATOM 3516  C CD  . GLU A 1 436 ? 76.84495  24.45512  25.70778   1.000 59.77089  ? 436 GLU A CD  1 
ATOM 3517  O OE1 . GLU A 1 436 ? 77.15397  25.65683  25.56353   1.000 74.37444  ? 436 GLU A OE1 1 
ATOM 3518  O OE2 . GLU A 1 436 ? 76.04836  23.86247  24.95131   1.000 57.93981  ? 436 GLU A OE2 1 
ATOM 3519  N N   . TYR A 1 437 ? 81.02612  25.13895  29.45298   1.000 85.39101  ? 437 TYR A N   1 
ATOM 3520  C CA  . TYR A 1 437 ? 82.38723  25.54384  29.79286   1.000 81.47018  ? 437 TYR A CA  1 
ATOM 3521  C C   . TYR A 1 437 ? 83.07216  24.50310  30.67003   1.000 79.38867  ? 437 TYR A C   1 
ATOM 3522  O O   . TYR A 1 437 ? 84.23763  24.15856  30.44171   1.000 102.01322 ? 437 TYR A O   1 
ATOM 3523  C CB  . TYR A 1 437 ? 82.37577  26.89868  30.50505   1.000 90.45710  ? 437 TYR A CB  1 
ATOM 3524  C CG  . TYR A 1 437 ? 82.31910  28.10944  29.59745   1.000 88.93214  ? 437 TYR A CG  1 
ATOM 3525  C CD1 . TYR A 1 437 ? 82.70358  28.02845  28.26561   1.000 78.80952  ? 437 TYR A CD1 1 
ATOM 3526  C CD2 . TYR A 1 437 ? 81.88564  29.33946  30.08087   1.000 84.16076  ? 437 TYR A CD2 1 
ATOM 3527  C CE1 . TYR A 1 437 ? 82.65408  29.13863  27.43904   1.000 69.45636  ? 437 TYR A CE1 1 
ATOM 3528  C CE2 . TYR A 1 437 ? 81.83171  30.45307  29.26301   1.000 74.81557  ? 437 TYR A CE2 1 
ATOM 3529  C CZ  . TYR A 1 437 ? 82.21664  30.34717  27.94280   1.000 66.57125  ? 437 TYR A CZ  1 
ATOM 3530  O OH  . TYR A 1 437 ? 82.16564  31.45224  27.12308   1.000 62.76641  ? 437 TYR A OH  1 
ATOM 3531  N N   . ILE A 1 438 ? 82.36455  23.99164  31.67961   1.000 68.19429  ? 438 ILE A N   1 
ATOM 3532  C CA  . ILE A 1 438 ? 82.96072  23.01001  32.58464   1.000 60.72640  ? 438 ILE A CA  1 
ATOM 3533  C C   . ILE A 1 438 ? 83.28230  21.71657  31.84197   1.000 65.68891  ? 438 ILE A C   1 
ATOM 3534  O O   . ILE A 1 438 ? 84.36854  21.14104  31.99876   1.000 69.74321  ? 438 ILE A O   1 
ATOM 3535  C CB  . ILE A 1 438 ? 82.02990  22.75463  33.78304   1.000 61.38729  ? 438 ILE A CB  1 
ATOM 3536  C CG1 . ILE A 1 438 ? 81.83021  24.04204  34.58351   1.000 63.66457  ? 438 ILE A CG1 1 
ATOM 3537  C CG2 . ILE A 1 438 ? 82.59535  21.65571  34.67141   1.000 60.58545  ? 438 ILE A CG2 1 
ATOM 3538  C CD1 . ILE A 1 438 ? 80.97101  23.86562  35.81365   1.000 64.54691  ? 438 ILE A CD1 1 
ATOM 3539  N N   . ALA A 1 439 ? 82.33808  21.23635  31.02758   1.000 60.28236  ? 439 ALA A N   1 
ATOM 3540  C CA  . ALA A 1 439 ? 82.56411  20.01487  30.26286   1.000 63.58100  ? 439 ALA A CA  1 
ATOM 3541  C C   . ALA A 1 439 ? 83.73434  20.17573  29.30299   1.000 65.57361  ? 439 ALA A C   1 
ATOM 3542  O O   . ALA A 1 439 ? 84.54640  19.25619  29.14255   1.000 59.39959  ? 439 ALA A O   1 
ATOM 3543  C CB  . ALA A 1 439 ? 81.29368  19.62763  29.50670   1.000 71.80577  ? 439 ALA A CB  1 
ATOM 3544  N N   . SER A 1 440 ? 83.84269  21.34118  28.65991   1.000 76.37202  ? 440 SER A N   1 
ATOM 3545  C CA  . SER A 1 440 ? 84.96403  21.58217  27.76119   1.000 73.28865  ? 440 SER A CA  1 
ATOM 3546  C C   . SER A 1 440 ? 86.28107  21.60642  28.52528   1.000 74.42279  ? 440 SER A C   1 
ATOM 3547  O O   . SER A 1 440 ? 87.26911  21.01421  28.07954   1.000 89.85694  ? 440 SER A O   1 
ATOM 3548  C CB  . SER A 1 440 ? 84.75718  22.88880  26.99565   1.000 73.20756  ? 440 SER A CB  1 
ATOM 3549  O OG  . SER A 1 440 ? 84.91715  24.00833  27.84797   1.000 91.10043  ? 440 SER A OG  1 
ATOM 3550  N N   . MET A 1 441 ? 86.31983  22.29058  29.67540   1.000 76.24561  ? 441 MET A N   1 
ATOM 3551  C CA  . MET A 1 441 ? 87.56090  22.36776  30.44028   1.000 67.40268  ? 441 MET A CA  1 
ATOM 3552  C C   . MET A 1 441 ? 87.97527  21.00245  30.97159   1.000 58.09187  ? 441 MET A C   1 
ATOM 3553  O O   . MET A 1 441 ? 89.17079  20.74435  31.15142   1.000 66.45616  ? 441 MET A O   1 
ATOM 3554  C CB  . MET A 1 441 ? 87.41399  23.35874  31.59824   1.000 71.97912  ? 441 MET A CB  1 
ATOM 3555  C CG  . MET A 1 441 ? 88.67313  23.51179  32.44576   1.000 87.32403  ? 441 MET A CG  1 
ATOM 3556  S SD  . MET A 1 441 ? 88.63931  24.93565  33.54856   1.000 103.21365 ? 441 MET A SD  1 
ATOM 3557  C CE  . MET A 1 441 ? 87.52300  24.34705  34.82012   1.000 103.25278 ? 441 MET A CE  1 
ATOM 3558  N N   . ARG A 1 442 ? 87.01508  20.10887  31.20627   1.000 52.64663  ? 442 ARG A N   1 
ATOM 3559  C CA  . ARG A 1 442 ? 87.37961  18.75555  31.61097   1.000 51.42886  ? 442 ARG A CA  1 
ATOM 3560  C C   . ARG A 1 442 ? 87.90089  17.95108  30.42476   1.000 49.85930  ? 442 ARG A C   1 
ATOM 3561  O O   . ARG A 1 442 ? 88.98939  17.35978  30.48808   1.000 49.36896  ? 442 ARG A O   1 
ATOM 3562  C CB  . ARG A 1 442 ? 86.17441  18.05334  32.24231   1.000 51.11156  ? 442 ARG A CB  1 
ATOM 3563  C CG  . ARG A 1 442 ? 85.75757  18.60712  33.59471   1.000 52.64119  ? 442 ARG A CG  1 
ATOM 3564  C CD  . ARG A 1 442 ? 84.59866  17.81528  34.18585   1.000 52.31961  ? 442 ARG A CD  1 
ATOM 3565  N NE  . ARG A 1 442 ? 84.11983  18.40197  35.43471   1.000 53.91597  ? 442 ARG A NE  1 
ATOM 3566  C CZ  . ARG A 1 442 ? 83.01215  18.02285  36.06388   1.000 54.15209  ? 442 ARG A CZ  1 
ATOM 3567  N NH1 . ARG A 1 442 ? 82.25887  17.05501  35.56107   1.000 52.91616  ? 442 ARG A NH1 1 
ATOM 3568  N NH2 . ARG A 1 442 ? 82.65493  18.61382  37.19567   1.000 55.75127  ? 442 ARG A NH2 1 
ATOM 3569  N N   . ARG A 1 443 ? 87.14425  17.94880  29.32276   1.000 58.59985  ? 443 ARG A N   1 
ATOM 3570  C CA  . ARG A 1 443 ? 87.47831  17.10112  28.18401   1.000 53.87231  ? 443 ARG A CA  1 
ATOM 3571  C C   . ARG A 1 443 ? 88.78124  17.52640  27.51444   1.000 69.71836  ? 443 ARG A C   1 
ATOM 3572  O O   . ARG A 1 443 ? 89.55683  16.66989  27.08073   1.000 90.63524  ? 443 ARG A O   1 
ATOM 3573  C CB  . ARG A 1 443 ? 86.31858  17.08435  27.18290   1.000 43.49876  ? 443 ARG A CB  1 
ATOM 3574  C CG  . ARG A 1 443 ? 86.31267  18.22693  26.18446   1.000 45.61645  ? 443 ARG A CG  1 
ATOM 3575  C CD  . ARG A 1 443 ? 85.58898  17.86386  24.90180   1.000 47.15639  ? 443 ARG A CD  1 
ATOM 3576  N NE  . ARG A 1 443 ? 84.93816  19.03305  24.31614   1.000 63.23829  ? 443 ARG A NE  1 
ATOM 3577  C CZ  . ARG A 1 443 ? 85.57259  19.99184  23.64669   1.000 89.27719  ? 443 ARG A CZ  1 
ATOM 3578  N NH1 . ARG A 1 443 ? 84.89181  21.01798  23.15354   1.000 80.76760  ? 443 ARG A NH1 1 
ATOM 3579  N NH2 . ARG A 1 443 ? 86.88536  19.92871  23.46896   1.000 109.23761 ? 443 ARG A NH2 1 
ATOM 3580  N N   . ASN A 1 444 ? 89.06193  18.83166  27.43357   1.000 49.41427  ? 444 ASN A N   1 
ATOM 3581  C CA  . ASN A 1 444 ? 90.26011  19.24816  26.70900   1.000 59.22440  ? 444 ASN A CA  1 
ATOM 3582  C C   . ASN A 1 444 ? 91.52189  19.03794  27.53696   1.000 75.55041  ? 444 ASN A C   1 
ATOM 3583  O O   . ASN A 1 444 ? 92.56669  18.66737  26.99204   1.000 115.81375 ? 444 ASN A O   1 
ATOM 3584  C CB  . ASN A 1 444 ? 90.14063  20.70899  26.26112   1.000 70.97047  ? 444 ASN A CB  1 
ATOM 3585  C CG  . ASN A 1 444 ? 89.98937  21.68050  27.42235   1.000 103.10729 ? 444 ASN A CG  1 
ATOM 3586  O OD1 . ASN A 1 444 ? 90.14769  21.31801  28.58780   1.000 124.29634 ? 444 ASN A OD1 1 
ATOM 3587  N ND2 . ASN A 1 444 ? 89.67542  22.92961  27.10082   1.000 110.15855 ? 444 ASN A ND2 1 
ATOM 3588  N N   . TYR A 1 445 ? 91.44254  19.24506  28.85323   1.000 77.16877  ? 445 TYR A N   1 
ATOM 3589  C CA  . TYR A 1 445 ? 92.56749  18.89273  29.71291   1.000 68.74128  ? 445 TYR A CA  1 
ATOM 3590  C C   . TYR A 1 445 ? 92.83022  17.39285  29.67723   1.000 64.07360  ? 445 TYR A C   1 
ATOM 3591  O O   . TYR A 1 445 ? 93.98864  16.95897  29.60964   1.000 80.14472  ? 445 TYR A O   1 
ATOM 3592  C CB  . TYR A 1 445 ? 92.31466  19.36434  31.14431   1.000 67.02688  ? 445 TYR A CB  1 
ATOM 3593  C CG  . TYR A 1 445 ? 92.62918  20.82501  31.38957   1.000 76.98177  ? 445 TYR A CG  1 
ATOM 3594  C CD1 . TYR A 1 445 ? 93.26694  21.59364  30.42381   1.000 88.49544  ? 445 TYR A CD1 1 
ATOM 3595  C CD2 . TYR A 1 445 ? 92.29953  21.43118  32.59566   1.000 80.15016  ? 445 TYR A CD2 1 
ATOM 3596  C CE1 . TYR A 1 445 ? 93.55922  22.92785  30.65170   1.000 100.92675 ? 445 TYR A CE1 1 
ATOM 3597  C CE2 . TYR A 1 445 ? 92.58700  22.76082  32.83307   1.000 76.76046  ? 445 TYR A CE2 1 
ATOM 3598  C CZ  . TYR A 1 445 ? 93.21663  23.50528  31.85866   1.000 89.53346  ? 445 TYR A CZ  1 
ATOM 3599  O OH  . TYR A 1 445 ? 93.50443  24.83089  32.09270   1.000 81.22994  ? 445 TYR A OH  1 
ATOM 3600  N N   . PHE A 1 446 ? 91.76662  16.58194  29.71709   1.000 53.85510  ? 446 PHE A N   1 
ATOM 3601  C CA  . PHE A 1 446 ? 91.94752  15.13771  29.60574   1.000 51.22427  ? 446 PHE A CA  1 
ATOM 3602  C C   . PHE A 1 446 ? 92.58227  14.76140  28.27172   1.000 72.65854  ? 446 PHE A C   1 
ATOM 3603  O O   . PHE A 1 446 ? 93.50120  13.93511  28.22342   1.000 101.56545 ? 446 PHE A O   1 
ATOM 3604  C CB  . PHE A 1 446 ? 90.60471  14.42965  29.78231   1.000 59.80161  ? 446 PHE A CB  1 
ATOM 3605  C CG  . PHE A 1 446 ? 90.69421  12.93202  29.71816   1.000 48.98007  ? 446 PHE A CG  1 
ATOM 3606  C CD1 . PHE A 1 446 ? 91.12548  12.20404  30.81469   1.000 47.84145  ? 446 PHE A CD1 1 
ATOM 3607  C CD2 . PHE A 1 446 ? 90.34074  12.25157  28.56469   1.000 44.28589  ? 446 PHE A CD2 1 
ATOM 3608  C CE1 . PHE A 1 446 ? 91.20603  10.82608  30.76097   1.000 49.58298  ? 446 PHE A CE1 1 
ATOM 3609  C CE2 . PHE A 1 446 ? 90.41948  10.87377  28.50395   1.000 45.11897  ? 446 PHE A CE2 1 
ATOM 3610  C CZ  . PHE A 1 446 ? 90.85262  10.16004  29.60384   1.000 49.78368  ? 446 PHE A CZ  1 
ATOM 3611  N N   . THR A 1 447 ? 92.10201  15.35801  27.17781   1.000 75.75312  ? 447 THR A N   1 
ATOM 3612  C CA  . THR A 1 447 ? 92.65476  15.06828  25.85974   1.000 72.32425  ? 447 THR A CA  1 
ATOM 3613  C C   . THR A 1 447 ? 94.12174  15.46702  25.77520   1.000 43.12293  ? 447 THR A C   1 
ATOM 3614  O O   . THR A 1 447 ? 94.93165  14.75364  25.17461   1.000 40.93476  ? 447 THR A O   1 
ATOM 3615  C CB  . THR A 1 447 ? 91.83994  15.78865  24.78369   1.000 85.40365  ? 447 THR A CB  1 
ATOM 3616  O OG1 . THR A 1 447 ? 90.46731  15.38487  24.86955   1.000 57.86417  ? 447 THR A OG1 1 
ATOM 3617  C CG2 . THR A 1 447 ? 92.37016  15.46102  23.39757   1.000 113.09018 ? 447 THR A CG2 1 
ATOM 3618  N N   . ALA A 1 448 ? 94.48502  16.60050  26.37705   1.000 48.66292  ? 448 ALA A N   1 
ATOM 3619  C CA  . ALA A 1 448 ? 95.87468  17.04033  26.33860   1.000 49.54880  ? 448 ALA A CA  1 
ATOM 3620  C C   . ALA A 1 448 ? 96.77015  16.11372  27.14984   1.000 49.42726  ? 448 ALA A C   1 
ATOM 3621  O O   . ALA A 1 448 ? 97.87748  15.77598  26.71541   1.000 49.36386  ? 448 ALA A O   1 
ATOM 3622  C CB  . ALA A 1 448 ? 95.98538  18.47812  26.84350   1.000 66.36428  ? 448 ALA A CB  1 
ATOM 3623  N N   . GLU A 1 449 ? 96.30961  15.68792  28.32779   1.000 50.74513  ? 449 GLU A N   1 
ATOM 3624  C CA  . GLU A 1 449 ? 97.12016  14.81406  29.16780   1.000 64.07155  ? 449 GLU A CA  1 
ATOM 3625  C C   . GLU A 1 449 ? 97.16043  13.37371  28.66713   1.000 50.45808  ? 449 GLU A C   1 
ATOM 3626  O O   . GLU A 1 449 ? 98.06367  12.62382  29.05449   1.000 44.11874  ? 449 GLU A O   1 
ATOM 3627  C CB  . GLU A 1 449 ? 96.59293  14.83410  30.60565   1.000 82.59528  ? 449 GLU A CB  1 
ATOM 3628  C CG  . GLU A 1 449 ? 96.80135  16.15011  31.34376   1.000 92.54626  ? 449 GLU A CG  1 
ATOM 3629  C CD  . GLU A 1 449 ? 98.25361  16.40840  31.69397   1.000 96.61554  ? 449 GLU A CD  1 
ATOM 3630  O OE1 . GLU A 1 449 ? 99.01981  15.43232  31.83265   1.000 101.44396 ? 449 GLU A OE1 1 
ATOM 3631  O OE2 . GLU A 1 449 ? 98.62672  17.59243  31.83581   1.000 94.43341  ? 449 GLU A OE2 1 
ATOM 3632  N N   . VAL A 1 450 ? 96.21520  12.97468  27.81609   1.000 56.55629  ? 450 VAL A N   1 
ATOM 3633  C CA  . VAL A 1 450 ? 96.09645  11.58914  27.39239   1.000 45.06193  ? 450 VAL A CA  1 
ATOM 3634  C C   . VAL A 1 450 ? 96.56312  11.35219  25.95604   1.000 46.35299  ? 450 VAL A C   1 
ATOM 3635  O O   . VAL A 1 450 ? 97.01421  10.24306  25.64357   1.000 47.58910  ? 450 VAL A O   1 
ATOM 3636  C CB  . VAL A 1 450 ? 94.63579  11.12159  27.58667   1.000 44.34309  ? 450 VAL A CB  1 
ATOM 3637  C CG1 . VAL A 1 450 ? 94.32025  9.87700   26.78487   1.000 43.02777  ? 450 VAL A CG1 1 
ATOM 3638  C CG2 . VAL A 1 450 ? 94.36605  10.87054  29.06293   1.000 50.04014  ? 450 VAL A CG2 1 
ATOM 3639  N N   . SER A 1 451 ? 96.52444  12.37028  25.09223   1.000 51.51410  ? 451 SER A N   1 
ATOM 3640  C CA  . SER A 1 451 ? 96.75065  12.16802  23.66287   1.000 46.59921  ? 451 SER A CA  1 
ATOM 3641  C C   . SER A 1 451 ? 98.10543  11.52220  23.39297   1.000 53.84240  ? 451 SER A C   1 
ATOM 3642  O O   . SER A 1 451 ? 98.18688  10.45345  22.77753   1.000 70.54897  ? 451 SER A O   1 
ATOM 3643  C CB  . SER A 1 451 ? 96.63068  13.50351  22.92689   1.000 43.67654  ? 451 SER A CB  1 
ATOM 3644  O OG  . SER A 1 451 ? 97.61563  14.41983  23.36952   1.000 46.06465  ? 451 SER A OG  1 
ATOM 3645  N N   . HIS A 1 452 ? 99.18036  12.14712  23.86060   1.000 42.21184  ? 452 HIS A N   1 
ATOM 3646  C CA  . HIS A 1 452 ? 100.51915 11.62937  23.57705   1.000 42.40168  ? 452 HIS A CA  1 
ATOM 3647  C C   . HIS A 1 452 ? 100.85366 10.34689  24.34873   1.000 46.16697  ? 452 HIS A C   1 
ATOM 3648  O O   . HIS A 1 452 ? 102.00859 9.91288   24.27175   1.000 51.65625  ? 452 HIS A O   1 
ATOM 3649  C CB  . HIS A 1 452 ? 101.56987 12.69894  23.88251   1.000 63.52902  ? 452 HIS A CB  1 
ATOM 3650  C CG  . HIS A 1 452 ? 101.31877 14.01142  23.20623   1.000 83.30961  ? 452 HIS A CG  1 
ATOM 3651  N ND1 . HIS A 1 452 ? 100.40020 14.92687  23.67287   1.000 92.51815  ? 452 HIS A ND1 1 
ATOM 3652  C CD2 . HIS A 1 452 ? 101.88182 14.57039  22.10864   1.000 90.01999  ? 452 HIS A CD2 1 
ATOM 3653  C CE1 . HIS A 1 452 ? 100.40023 15.98788  22.88554   1.000 95.97926  ? 452 HIS A CE1 1 
ATOM 3654  N NE2 . HIS A 1 452 ? 101.29019 15.79669  21.92848   1.000 89.42300  ? 452 HIS A NE2 1 
ATOM 3655  N N   . CYS A 1 453 ? 99.92985  9.71640   25.06852   1.000 45.58286  ? 453 CYS A N   1 
ATOM 3656  C CA  . CYS A 1 453 ? 100.26478 8.54801   25.86916   1.000 49.85027  ? 453 CYS A CA  1 
ATOM 3657  C C   . CYS A 1 453 ? 100.45392 7.31646   24.98855   1.000 47.00650  ? 453 CYS A C   1 
ATOM 3658  O O   . CYS A 1 453 ? 99.88334  7.20710   23.89970   1.000 63.06361  ? 453 CYS A O   1 
ATOM 3659  C CB  . CYS A 1 453 ? 99.17940  8.28362   26.91328   1.000 56.21562  ? 453 CYS A CB  1 
ATOM 3660  S SG  . CYS A 1 453 ? 99.51992  6.88731   28.00824   1.000 59.84824  ? 453 CYS A SG  1 
ATOM 3661  N N   . ARG A 1 454 ? 101.27114 6.38067   25.48009   1.000 49.32147  ? 454 ARG A N   1 
ATOM 3662  C CA  . ARG A 1 454 ? 101.52686 5.14341   24.74804   1.000 42.46671  ? 454 ARG A CA  1 
ATOM 3663  C C   . ARG A 1 454 ? 100.27383 4.28245   24.63295   1.000 45.20723  ? 454 ARG A C   1 
ATOM 3664  O O   . ARG A 1 454 ? 100.10790 3.55610   23.64361   1.000 47.10591  ? 454 ARG A O   1 
ATOM 3665  C CB  . ARG A 1 454 ? 102.64710 4.36263   25.43710   1.000 44.06774  ? 454 ARG A CB  1 
ATOM 3666  C CG  . ARG A 1 454 ? 103.12548 3.13383   24.68634   1.000 45.02953  ? 454 ARG A CG  1 
ATOM 3667  C CD  . ARG A 1 454 ? 104.07139 3.52457   23.56666   1.000 52.29985  ? 454 ARG A CD  1 
ATOM 3668  N NE  . ARG A 1 454 ? 105.37237 3.94455   24.08178   1.000 43.84640  ? 454 ARG A NE  1 
ATOM 3669  C CZ  . ARG A 1 454 ? 106.36339 4.40458   23.32507   1.000 56.08086  ? 454 ARG A CZ  1 
ATOM 3670  N NH1 . ARG A 1 454 ? 106.20544 4.50744   22.01225   1.000 53.31199  ? 454 ARG A NH1 1 
ATOM 3671  N NH2 . ARG A 1 454 ? 107.51319 4.76267   23.88055   1.000 89.01172  ? 454 ARG A NH2 1 
ATOM 3672  N N   . ALA A 1 455 ? 99.38312  4.35030   25.62618   1.000 42.83750  ? 455 ALA A N   1 
ATOM 3673  C CA  . ALA A 1 455 ? 98.13037  3.60803   25.54582   1.000 41.39773  ? 455 ALA A CA  1 
ATOM 3674  C C   . ALA A 1 455 ? 97.27443  4.08322   24.38001   1.000 57.19533  ? 455 ALA A C   1 
ATOM 3675  O O   . ALA A 1 455 ? 96.51332  3.29592   23.80723   1.000 62.73653  ? 455 ALA A O   1 
ATOM 3676  C CB  . ALA A 1 455 ? 97.36018  3.72703   26.86087   1.000 41.75051  ? 455 ALA A CB  1 
ATOM 3677  N N   . THR A 1 456 ? 97.38730  5.35921   24.00654   1.000 57.97860  ? 456 THR A N   1 
ATOM 3678  C CA  . THR A 1 456 ? 96.68059  5.83778   22.82319   1.000 61.55634  ? 456 THR A CA  1 
ATOM 3679  C C   . THR A 1 456 ? 97.24116  5.19975   21.55711   1.000 60.40417  ? 456 THR A C   1 
ATOM 3680  O O   . THR A 1 456 ? 96.48413  4.83610   20.64426   1.000 60.73210  ? 456 THR A O   1 
ATOM 3681  C CB  . THR A 1 456 ? 96.77123  7.36006   22.74093   1.000 57.04986  ? 456 THR A CB  1 
ATOM 3682  O OG1 . THR A 1 456 ? 96.43874  7.92884   24.01385   1.000 36.62382  ? 456 THR A OG1 1 
ATOM 3683  C CG2 . THR A 1 456 ? 95.80712  7.88227   21.69925   1.000 58.78965  ? 456 THR A CG2 1 
ATOM 3684  N N   . GLU A 1 457 ? 98.56870  5.05979   21.48517   1.000 48.73583  ? 457 GLU A N   1 
ATOM 3685  C CA  . GLU A 1 457 ? 99.17432  4.31306   20.38971   1.000 46.42981  ? 457 GLU A CA  1 
ATOM 3686  C C   . GLU A 1 457 ? 98.66424  2.88041   20.36531   1.000 64.63386  ? 457 GLU A C   1 
ATOM 3687  O O   . GLU A 1 457 ? 98.38784  2.33212   19.29433   1.000 69.43799  ? 457 GLU A O   1 
ATOM 3688  C CB  . GLU A 1 457 ? 100.69879 4.33475   20.50861   1.000 36.95142  ? 457 GLU A CB  1 
ATOM 3689  C CG  . GLU A 1 457 ? 101.39814 3.37990   19.55199   1.000 49.23654  ? 457 GLU A CG  1 
ATOM 3690  C CD  . GLU A 1 457 ? 102.90908 3.49024   19.60195   1.000 88.55748  ? 457 GLU A CD  1 
ATOM 3691  O OE1 . GLU A 1 457 ? 103.42345 4.37901   20.31291   1.000 107.42527 ? 457 GLU A OE1 1 
ATOM 3692  O OE2 . GLU A 1 457 ? 103.58363 2.68216   18.92948   1.000 96.70466  ? 457 GLU A OE2 1 
ATOM 3693  N N   . TYR A 1 458 ? 98.51372  2.26581   21.54109   1.000 64.48279  ? 458 TYR A N   1 
ATOM 3694  C CA  . TYR A 1 458 ? 97.97486  0.90935   21.60352   1.000 55.33856  ? 458 TYR A CA  1 
ATOM 3695  C C   . TYR A 1 458 ? 96.55126  0.85620   21.05871   1.000 48.85183  ? 458 TYR A C   1 
ATOM 3696  O O   . TYR A 1 458 ? 96.20159  -0.05134  20.29135   1.000 64.06561  ? 458 TYR A O   1 
ATOM 3697  C CB  . TYR A 1 458 ? 98.01042  0.39817   23.04450   1.000 61.94582  ? 458 TYR A CB  1 
ATOM 3698  C CG  . TYR A 1 458 ? 99.40090  0.20910   23.60985   1.000 66.14183  ? 458 TYR A CG  1 
ATOM 3699  C CD1 . TYR A 1 458 ? 100.51334 0.17281   22.78033   1.000 64.26397  ? 458 TYR A CD1 1 
ATOM 3700  C CD2 . TYR A 1 458 ? 99.59954  0.06686   24.97706   1.000 67.98577  ? 458 TYR A CD2 1 
ATOM 3701  C CE1 . TYR A 1 458 ? 101.78333 0.00120   23.29653   1.000 56.42813  ? 458 TYR A CE1 1 
ATOM 3702  C CE2 . TYR A 1 458 ? 100.86567 -0.10619  25.50219   1.000 52.85482  ? 458 TYR A CE2 1 
ATOM 3703  C CZ  . TYR A 1 458 ? 101.95378 -0.13870  24.65785   1.000 39.43026  ? 458 TYR A CZ  1 
ATOM 3704  O OH  . TYR A 1 458 ? 103.21666 -0.31034  25.17693   1.000 35.65900  ? 458 TYR A OH  1 
ATOM 3705  N N   . ILE A 1 459 ? 95.71556  1.82049   21.45288   1.000 59.71590  ? 459 ILE A N   1 
ATOM 3706  C CA  . ILE A 1 459 ? 94.33148  1.85956   20.98216   1.000 62.64196  ? 459 ILE A CA  1 
ATOM 3707  C C   . ILE A 1 459 ? 94.28944  1.95791   19.46370   1.000 70.55352  ? 459 ILE A C   1 
ATOM 3708  O O   . ILE A 1 459 ? 93.61629  1.16763   18.78897   1.000 75.33560  ? 459 ILE A O   1 
ATOM 3709  C CB  . ILE A 1 459 ? 93.57069  3.03158   21.62881   1.000 54.37388  ? 459 ILE A CB  1 
ATOM 3710  C CG1 . ILE A 1 459 ? 93.36403  2.79909   23.12316   1.000 53.26094  ? 459 ILE A CG1 1 
ATOM 3711  C CG2 . ILE A 1 459 ? 92.22992  3.24040   20.93911   1.000 38.97244  ? 459 ILE A CG2 1 
ATOM 3712  C CD1 . ILE A 1 459 ? 92.64078  3.93905   23.81169   1.000 38.19533  ? 459 ILE A CD1 1 
ATOM 3713  N N   . MET A 1 460 ? 95.00339  2.94033   18.90629   1.000 72.82368  ? 460 MET A N   1 
ATOM 3714  C CA  . MET A 1 460 ? 94.98073  3.14026   17.45963   1.000 65.00254  ? 460 MET A CA  1 
ATOM 3715  C C   . MET A 1 460 ? 95.56579  1.94253   16.72082   1.000 49.08470  ? 460 MET A C   1 
ATOM 3716  O O   . MET A 1 460 ? 95.06833  1.55778   15.65415   1.000 47.58336  ? 460 MET A O   1 
ATOM 3717  C CB  . MET A 1 460 ? 95.72775  4.42110   17.09371   1.000 63.81977  ? 460 MET A CB  1 
ATOM 3718  C CG  . MET A 1 460 ? 95.09818  5.67234   17.67518   1.000 66.35707  ? 460 MET A CG  1 
ATOM 3719  S SD  . MET A 1 460 ? 93.35761  5.82799   17.22877   1.000 66.62654  ? 460 MET A SD  1 
ATOM 3720  C CE  . MET A 1 460 ? 93.48544  6.14198   15.47046   1.000 91.62811  ? 460 MET A CE  1 
ATOM 3721  N N   . LYS A 1 461 ? 96.62636  1.34465   17.26889   1.000 47.60794  ? 461 LYS A N   1 
ATOM 3722  C CA  . LYS A 1 461 ? 97.22880  0.16764   16.65631   1.000 52.72910  ? 461 LYS A CA  1 
ATOM 3723  C C   . LYS A 1 461 ? 96.22765  -0.97496  16.57697   1.000 45.17183  ? 461 LYS A C   1 
ATOM 3724  O O   . LYS A 1 461 ? 96.02916  -1.56860  15.51032   1.000 46.66149  ? 461 LYS A O   1 
ATOM 3725  C CB  . LYS A 1 461 ? 98.46541  -0.24670  17.45512   1.000 48.25620  ? 461 LYS A CB  1 
ATOM 3726  C CG  . LYS A 1 461 ? 99.32364  -1.31485  16.80434   1.000 46.00734  ? 461 LYS A CG  1 
ATOM 3727  C CD  . LYS A 1 461 ? 100.55592 -1.59410  17.64957   1.000 47.41485  ? 461 LYS A CD  1 
ATOM 3728  C CE  . LYS A 1 461 ? 101.38057 -2.73292  17.07900   1.000 51.57052  ? 461 LYS A CE  1 
ATOM 3729  N NZ  . LYS A 1 461 ? 102.55533 -3.03601  17.94058   1.000 60.87999  ? 461 LYS A NZ  1 
ATOM 3730  N N   . GLY A 1 462 ? 95.58676  -1.29768  17.70269   1.000 39.88864  ? 462 GLY A N   1 
ATOM 3731  C CA  . GLY A 1 462 ? 94.59065  -2.35526  17.69237   1.000 37.96005  ? 462 GLY A CA  1 
ATOM 3732  C C   . GLY A 1 462 ? 93.44817  -2.06378  16.73949   1.000 48.94206  ? 462 GLY A C   1 
ATOM 3733  O O   . GLY A 1 462 ? 92.98596  -2.95397  16.01790   1.000 54.60288  ? 462 GLY A O   1 
ATOM 3734  N N   . VAL A 1 463 ? 92.98702  -0.80879  16.71339   1.000 43.98174  ? 463 VAL A N   1 
ATOM 3735  C CA  . VAL A 1 463 ? 91.89541  -0.43048  15.81775   1.000 36.80161  ? 463 VAL A CA  1 
ATOM 3736  C C   . VAL A 1 463 ? 92.28030  -0.68630  14.36668   1.000 43.92287  ? 463 VAL A C   1 
ATOM 3737  O O   . VAL A 1 463 ? 91.55358  -1.35772  13.62477   1.000 44.21018  ? 463 VAL A O   1 
ATOM 3738  C CB  . VAL A 1 463 ? 91.49783  1.03917   16.04144   1.000 36.91775  ? 463 VAL A CB  1 
ATOM 3739  C CG1 . VAL A 1 463 ? 90.62244  1.52327   14.89906   1.000 37.08899  ? 463 VAL A CG1 1 
ATOM 3740  C CG2 . VAL A 1 463 ? 90.76751  1.19303   17.36445   1.000 40.34188  ? 463 VAL A CG2 1 
ATOM 3741  N N   . TYR A 1 464 ? 93.43123  -0.15712  13.94082   1.000 48.72916  ? 464 TYR A N   1 
ATOM 3742  C CA  . TYR A 1 464 ? 93.85488  -0.33423  12.55304   1.000 38.85242  ? 464 TYR A CA  1 
ATOM 3743  C C   . TYR A 1 464 ? 94.04828  -1.80687  12.20852   1.000 44.58451  ? 464 TYR A C   1 
ATOM 3744  O O   . TYR A 1 464 ? 93.62187  -2.26016  11.13712   1.000 52.00629  ? 464 TYR A O   1 
ATOM 3745  C CB  . TYR A 1 464 ? 95.13556  0.45461   12.27962   1.000 42.14405  ? 464 TYR A CB  1 
ATOM 3746  C CG  . TYR A 1 464 ? 94.90071  1.89434   11.87622   1.000 58.99931  ? 464 TYR A CG  1 
ATOM 3747  C CD1 . TYR A 1 464 ? 93.62658  2.44670   11.90103   1.000 84.00936  ? 464 TYR A CD1 1 
ATOM 3748  C CD2 . TYR A 1 464 ? 95.95345  2.69657   11.45651   1.000 59.94700  ? 464 TYR A CD2 1 
ATOM 3749  C CE1 . TYR A 1 464 ? 93.41044  3.76154   11.52807   1.000 93.35231  ? 464 TYR A CE1 1 
ATOM 3750  C CE2 . TYR A 1 464 ? 95.74786  4.00999   11.08170   1.000 61.49996  ? 464 TYR A CE2 1 
ATOM 3751  C CZ  . TYR A 1 464 ? 94.47562  4.53784   11.11928   1.000 74.90478  ? 464 TYR A CZ  1 
ATOM 3752  O OH  . TYR A 1 464 ? 94.26952  5.84625   10.74594   1.000 61.76529  ? 464 TYR A OH  1 
ATOM 3753  N N   . ILE A 1 465 ? 94.69471  -2.57032  13.09580   1.000 54.55371  ? 465 ILE A N   1 
ATOM 3754  C CA  . ILE A 1 465 ? 94.98153  -3.97168  12.78927   1.000 51.47883  ? 465 ILE A CA  1 
ATOM 3755  C C   . ILE A 1 465 ? 93.68736  -4.76000  12.63738   1.000 51.33388  ? 465 ILE A C   1 
ATOM 3756  O O   . ILE A 1 465 ? 93.50227  -5.50338  11.66350   1.000 43.53266  ? 465 ILE A O   1 
ATOM 3757  C CB  . ILE A 1 465 ? 95.89531  -4.59414  13.86124   1.000 54.63809  ? 465 ILE A CB  1 
ATOM 3758  C CG1 . ILE A 1 465 ? 97.22268  -3.84089  13.95394   1.000 55.81176  ? 465 ILE A CG1 1 
ATOM 3759  C CG2 . ILE A 1 465 ? 96.13734  -6.06309  13.55462   1.000 60.98737  ? 465 ILE A CG2 1 
ATOM 3760  C CD1 . ILE A 1 465 ? 97.73419  -3.34158  12.63517   1.000 52.59606  ? 465 ILE A CD1 1 
ATOM 3761  N N   . ASN A 1 466 ? 92.77807  -4.62326  13.60722   1.000 55.38066  ? 466 ASN A N   1 
ATOM 3762  C CA  . ASN A 1 466 ? 91.52887  -5.37147  13.54698   1.000 48.26490  ? 466 ASN A CA  1 
ATOM 3763  C C   . ASN A 1 466 ? 90.68288  -4.93080  12.35993   1.000 50.10681  ? 466 ASN A C   1 
ATOM 3764  O O   . ASN A 1 466 ? 90.02494  -5.75964  11.72092   1.000 67.17538  ? 466 ASN A O   1 
ATOM 3765  C CB  . ASN A 1 466 ? 90.75467  -5.21110  14.85473   1.000 46.88410  ? 466 ASN A CB  1 
ATOM 3766  C CG  . ASN A 1 466 ? 91.38631  -5.97202  16.00422   1.000 55.99640  ? 466 ASN A CG  1 
ATOM 3767  O OD1 . ASN A 1 466 ? 91.61653  -7.17883  15.91680   1.000 58.14875  ? 466 ASN A OD1 1 
ATOM 3768  N ND2 . ASN A 1 466 ? 91.67543  -5.26515  17.09048   1.000 64.34828  ? 466 ASN A ND2 1 
ATOM 3769  N N   . THR A 1 467 ? 90.69924  -3.63368  12.03521   1.000 44.83220  ? 467 THR A N   1 
ATOM 3770  C CA  . THR A 1 467 ? 89.95116  -3.15362  10.87888   1.000 43.62499  ? 467 THR A CA  1 
ATOM 3771  C C   . THR A 1 467 ? 90.46880  -3.78974  9.59675    1.000 50.15967  ? 467 THR A C   1 
ATOM 3772  O O   . THR A 1 467 ? 89.68888  -4.30699  8.78892    1.000 59.72660  ? 467 THR A O   1 
ATOM 3773  C CB  . THR A 1 467 ? 90.03170  -1.62759  10.79569   1.000 44.52126  ? 467 THR A CB  1 
ATOM 3774  O OG1 . THR A 1 467 ? 89.52683  -1.05390  12.00755   1.000 60.10607  ? 467 THR A OG1 1 
ATOM 3775  C CG2 . THR A 1 467 ? 89.21516  -1.10893  9.61901    1.000 60.60520  ? 467 THR A CG2 1 
ATOM 3776  N N   . ALA A 1 468 ? 91.78918  -3.76625  9.39602    1.000 48.54501  ? 468 ALA A N   1 
ATOM 3777  C CA  . ALA A 1 468 ? 92.35870  -4.36476  8.19235    1.000 56.68214  ? 468 ALA A CA  1 
ATOM 3778  C C   . ALA A 1 468 ? 92.06720  -5.85884  8.11882    1.000 79.28232  ? 468 ALA A C   1 
ATOM 3779  O O   . ALA A 1 468 ? 91.69757  -6.37620  7.05610    1.000 96.43331  ? 468 ALA A O   1 
ATOM 3780  C CB  . ALA A 1 468 ? 93.86408  -4.10823  8.13961    1.000 53.83161  ? 468 ALA A CB  1 
ATOM 3781  N N   . LEU A 1 469 ? 92.21047  -6.56812  9.24046    1.000 73.80141  ? 469 LEU A N   1 
ATOM 3782  C CA  . LEU A 1 469 ? 92.00808  -8.01290  9.21621    1.000 72.32617  ? 469 LEU A CA  1 
ATOM 3783  C C   . LEU A 1 469 ? 90.54962  -8.36026  8.93480    1.000 98.74135  ? 469 LEU A C   1 
ATOM 3784  O O   . LEU A 1 469 ? 90.26309  -9.25576  8.13156    1.000 113.01029 ? 469 LEU A O   1 
ATOM 3785  C CB  . LEU A 1 469 ? 92.47715  -8.62634  10.53612   1.000 48.54747  ? 469 LEU A CB  1 
ATOM 3786  C CG  . LEU A 1 469 ? 92.97657  -10.07613 10.51971   1.000 46.34693  ? 469 LEU A CG  1 
ATOM 3787  C CD1 . LEU A 1 469 ? 93.75734  -10.38726 11.78984   1.000 44.32171  ? 469 LEU A CD1 1 
ATOM 3788  C CD2 . LEU A 1 469 ? 91.84621  -11.07581 10.32747   1.000 48.75457  ? 469 LEU A CD2 1 
ATOM 3789  N N   . LEU A 1 470 ? 89.61262  -7.66368  9.58158    1.000 82.85192  ? 470 LEU A N   1 
ATOM 3790  C CA  . LEU A 1 470 ? 88.19949  -7.93852  9.34805    1.000 87.78208  ? 470 LEU A CA  1 
ATOM 3791  C C   . LEU A 1 470 ? 87.78565  -7.55351  7.93214    1.000 71.79140  ? 470 LEU A C   1 
ATOM 3792  O O   . LEU A 1 470 ? 86.96050  -8.23811  7.31554    1.000 69.82491  ? 470 LEU A O   1 
ATOM 3793  C CB  . LEU A 1 470 ? 87.34806  -7.20846  10.38591   1.000 92.00573  ? 470 LEU A CB  1 
ATOM 3794  C CG  . LEU A 1 470 ? 85.83061  -7.32823  10.24494   1.000 90.27884  ? 470 LEU A CG  1 
ATOM 3795  C CD1 . LEU A 1 470 ? 85.39067  -8.78799  10.21530   1.000 94.24565  ? 470 LEU A CD1 1 
ATOM 3796  C CD2 . LEU A 1 470 ? 85.15143  -6.59022  11.38109   1.000 85.17883  ? 470 LEU A CD2 1 
ATOM 3797  N N   . ASN A 1 471 ? 88.34512  -6.46479  7.39616    1.000 64.34490  ? 471 ASN A N   1 
ATOM 3798  C CA  . ASN A 1 471 ? 88.03103  -6.07987  6.02521    1.000 62.06649  ? 471 ASN A CA  1 
ATOM 3799  C C   . ASN A 1 471 ? 88.56897  -7.10113  5.03182    1.000 60.59199  ? 471 ASN A C   1 
ATOM 3800  O O   . ASN A 1 471 ? 87.93829  -7.36616  4.00142    1.000 75.11558  ? 471 ASN A O   1 
ATOM 3801  C CB  . ASN A 1 471 ? 88.59568  -4.69066  5.73344    1.000 76.86664  ? 471 ASN A CB  1 
ATOM 3802  C CG  . ASN A 1 471 ? 87.78740  -3.93998  4.69808    1.000 91.55482  ? 471 ASN A CG  1 
ATOM 3803  O OD1 . ASN A 1 471 ? 86.77188  -4.43381  4.21015    1.000 102.86193 ? 471 ASN A OD1 1 
ATOM 3804  N ND2 . ASN A 1 471 ? 88.22963  -2.73400  4.36263    1.000 95.35754  ? 471 ASN A ND2 1 
ATOM 3805  N N   . ALA A 1 472 ? 89.72978  -7.69077  5.32656    1.000 67.00200  ? 472 ALA A N   1 
ATOM 3806  C CA  . ALA A 1 472 ? 90.27001  -8.72067  4.44862    1.000 72.14122  ? 472 ALA A CA  1 
ATOM 3807  C C   . ALA A 1 472 ? 89.53083  -10.04316 4.59958    1.000 57.11219  ? 472 ALA A C   1 
ATOM 3808  O O   . ALA A 1 472 ? 89.46208  -10.82126 3.64290    1.000 60.02120  ? 472 ALA A O   1 
ATOM 3809  C CB  . ALA A 1 472 ? 91.76226  -8.91680  4.72069    1.000 83.96688  ? 472 ALA A CB  1 
ATOM 3810  N N   . SER A 1 473 ? 88.95911  -10.30584 5.76981    1.000 51.58682  ? 473 SER A N   1 
ATOM 3811  C CA  . SER A 1 473 ? 88.21373  -11.54760 5.96949    1.000 62.30012  ? 473 SER A CA  1 
ATOM 3812  C C   . SER A 1 473 ? 86.87896  -11.57486 5.23148    1.000 74.06768  ? 473 SER A C   1 
ATOM 3813  O O   . SER A 1 473 ? 86.11475  -12.53235 5.41660    1.000 75.41448  ? 473 SER A O   1 
ATOM 3814  C CB  . SER A 1 473 ? 87.98786  -11.78735 7.46289    1.000 66.67037  ? 473 SER A CB  1 
ATOM 3815  O OG  . SER A 1 473 ? 89.21968  -11.95083 8.14355    1.000 61.10645  ? 473 SER A OG  1 
ATOM 3816  N N   . CYS A 1 474 ? 86.56948  -10.57157 4.41304    1.000 54.17797  ? 474 CYS A N   1 
ATOM 3817  C CA  . CYS A 1 474 ? 85.35275  -10.55019 3.61320    1.000 88.36210  ? 474 CYS A CA  1 
ATOM 3818  C C   . CYS A 1 474 ? 85.62617  -10.78477 2.13540    1.000 90.14704  ? 474 CYS A C   1 
ATOM 3819  O O   . CYS A 1 474 ? 84.94247  -11.59251 1.49910    1.000 119.18414 ? 474 CYS A O   1 
ATOM 3820  C CB  . CYS A 1 474 ? 84.61895  -9.21463  3.80485    1.000 146.12855 ? 474 CYS A CB  1 
ATOM 3821  S SG  . CYS A 1 474 ? 83.02125  -9.11134  2.96418    1.000 203.55881 ? 474 CYS A SG  1 
ATOM 3822  N N   . ALA A 1 475 ? 86.61870  -10.09607 1.56917    1.000 77.83663  ? 475 ALA A N   1 
ATOM 3823  C CA  . ALA A 1 475 ? 86.95090  -10.24678 0.15864    1.000 64.14340  ? 475 ALA A CA  1 
ATOM 3824  C C   . ALA A 1 475 ? 88.03185  -11.28800 -0.09857   1.000 63.25463  ? 475 ALA A C   1 
ATOM 3825  O O   . ALA A 1 475 ? 88.12427  -11.79730 -1.22142   1.000 72.01889  ? 475 ALA A O   1 
ATOM 3826  C CB  . ALA A 1 475 ? 87.39504  -8.90264  -0.42607   1.000 65.89697  ? 475 ALA A CB  1 
ATOM 3827  N N   . ALA A 1 476 ? 88.84418  -11.61861 0.90389    1.000 53.71136  ? 476 ALA A N   1 
ATOM 3828  C CA  . ALA A 1 476 ? 89.89706  -12.62548 0.77375    1.000 82.60785  ? 476 ALA A CA  1 
ATOM 3829  C C   . ALA A 1 476 ? 89.48346  -13.93828 1.42076    1.000 68.48669  ? 476 ALA A C   1 
ATOM 3830  O O   . ALA A 1 476 ? 90.28725  -14.63073 2.05333    1.000 66.35916  ? 476 ALA A O   1 
ATOM 3831  C CB  . ALA A 1 476 ? 91.20420  -12.11716 1.37169    1.000 112.69250 ? 476 ALA A CB  1 
ATOM 3832  N N   . MET A 1 477 ? 88.21019  -14.28939 1.26352    1.000 56.50865  ? 477 MET A N   1 
ATOM 3833  C CA  . MET A 1 477 ? 87.58214  -15.43526 1.90436    1.000 73.13338  ? 477 MET A CA  1 
ATOM 3834  C C   . MET A 1 477 ? 88.14553  -16.77403 1.43609    1.000 70.99284  ? 477 MET A C   1 
ATOM 3835  O O   . MET A 1 477 ? 87.75330  -17.80864 1.98775    1.000 93.73105  ? 477 MET A O   1 
ATOM 3836  C CB  . MET A 1 477 ? 86.07216  -15.36925 1.65697    1.000 107.32636 ? 477 MET A CB  1 
ATOM 3837  C CG  . MET A 1 477 ? 85.21583  -16.05728 2.70275    1.000 123.30995 ? 477 MET A CG  1 
ATOM 3838  S SD  . MET A 1 477 ? 83.46678  -15.66631 2.49941    1.000 128.22413 ? 477 MET A SD  1 
ATOM 3839  C CE  . MET A 1 477 ? 83.12546  -16.45332 0.92738    1.000 129.70099 ? 477 MET A CE  1 
ATOM 3840  N N   . ASP A 1 478 ? 89.05450  -16.79112 0.45923    1.000 65.81136  ? 478 ASP A N   1 
ATOM 3841  C CA  . ASP A 1 478 ? 89.54411  -18.04278 -0.10666   1.000 86.60439  ? 478 ASP A CA  1 
ATOM 3842  C C   . ASP A 1 478 ? 91.06150  -18.18517 -0.15405   1.000 79.53623  ? 478 ASP A C   1 
ATOM 3843  O O   . ASP A 1 478 ? 91.54296  -19.31649 -0.28948   1.000 92.59228  ? 478 ASP A O   1 
ATOM 3844  C CB  . ASP A 1 478 ? 88.99888  -18.22440 -1.53155   1.000 103.77847 ? 478 ASP A CB  1 
ATOM 3845  C CG  . ASP A 1 478 ? 87.52383  -18.56616 -1.55034   1.000 118.42861 ? 478 ASP A CG  1 
ATOM 3846  O OD1 . ASP A 1 478 ? 87.05956  -19.25550 -0.61769   1.000 125.54836 ? 478 ASP A OD1 1 
ATOM 3847  O OD2 . ASP A 1 478 ? 86.82653  -18.14059 -2.49451   1.000 125.00380 ? 478 ASP A OD2 1 
ATOM 3848  N N   . ASP A 1 479 ? 91.82715  -17.10092 -0.06127   1.000 51.31122  ? 479 ASP A N   1 
ATOM 3849  C CA  . ASP A 1 479 ? 93.27227  -17.14691 -0.24086   1.000 50.63799  ? 479 ASP A CA  1 
ATOM 3850  C C   . ASP A 1 479 ? 93.98002  -16.47059 0.92545    1.000 49.08540  ? 479 ASP A C   1 
ATOM 3851  O O   . ASP A 1 479 ? 93.38644  -15.68410 1.66804    1.000 48.00540  ? 479 ASP A O   1 
ATOM 3852  C CB  . ASP A 1 479 ? 93.68102  -16.48987 -1.56698   1.000 78.98412  ? 479 ASP A CB  1 
ATOM 3853  C CG  . ASP A 1 479 ? 92.88539  -15.23297 -1.85838   1.000 101.57535 ? 479 ASP A CG  1 
ATOM 3854  O OD1 . ASP A 1 479 ? 91.80818  -15.06436 -1.24811   1.000 109.96958 ? 479 ASP A OD1 1 
ATOM 3855  O OD2 . ASP A 1 479 ? 93.32069  -14.42721 -2.70734   1.000 109.49271 ? 479 ASP A OD2 1 
ATOM 3856  N N   . PHE A 1 480 ? 95.26565  -16.79311 1.08139    1.000 56.89029  ? 480 PHE A N   1 
ATOM 3857  C CA  . PHE A 1 480 ? 96.07456  -16.20000 2.14172    1.000 50.57649  ? 480 PHE A CA  1 
ATOM 3858  C C   . PHE A 1 480 ? 96.52484  -14.81914 1.68834    1.000 58.45442  ? 480 PHE A C   1 
ATOM 3859  O O   . PHE A 1 480 ? 97.37515  -14.69685 0.80117    1.000 89.18229  ? 480 PHE A O   1 
ATOM 3860  C CB  . PHE A 1 480 ? 97.28818  -17.06412 2.47612    1.000 50.38845  ? 480 PHE A CB  1 
ATOM 3861  C CG  . PHE A 1 480 ? 96.99115  -18.52811 2.59144    1.000 52.92808  ? 480 PHE A CG  1 
ATOM 3862  C CD1 . PHE A 1 480 ? 95.96570  -18.97994 3.40121    1.000 53.21017  ? 480 PHE A CD1 1 
ATOM 3863  C CD2 . PHE A 1 480 ? 97.77154  -19.45726 1.92373    1.000 55.28800  ? 480 PHE A CD2 1 
ATOM 3864  C CE1 . PHE A 1 480 ? 95.70312  -20.32783 3.51785    1.000 58.80780  ? 480 PHE A CE1 1 
ATOM 3865  C CE2 . PHE A 1 480 ? 97.51671  -20.80660 2.04178    1.000 57.74903  ? 480 PHE A CE2 1 
ATOM 3866  C CZ  . PHE A 1 480 ? 96.47995  -21.24356 2.83741    1.000 62.61149  ? 480 PHE A CZ  1 
ATOM 3867  N N   . GLN A 1 481 ? 95.96985  -13.78216 2.30293    1.000 52.57134  ? 481 GLN A N   1 
ATOM 3868  C CA  . GLN A 1 481 ? 96.31712  -12.40704 1.98223    1.000 54.58654  ? 481 GLN A CA  1 
ATOM 3869  C C   . GLN A 1 481 ? 97.28420  -11.85640 3.02284    1.000 51.16145  ? 481 GLN A C   1 
ATOM 3870  O O   . GLN A 1 481 ? 97.12905  -12.10072 4.22315    1.000 46.91801  ? 481 GLN A O   1 
ATOM 3871  C CB  . GLN A 1 481 ? 95.05875  -11.53874 1.89304    1.000 61.01499  ? 481 GLN A CB  1 
ATOM 3872  C CG  . GLN A 1 481 ? 95.28116  -10.05376 2.12997    1.000 61.51092  ? 481 GLN A CG  1 
ATOM 3873  C CD  . GLN A 1 481 ? 94.07783  -9.22120  1.73359    1.000 59.35419  ? 481 GLN A CD  1 
ATOM 3874  O OE1 . GLN A 1 481 ? 93.19585  -9.69124  1.01706    1.000 60.38560  ? 481 GLN A OE1 1 
ATOM 3875  N NE2 . GLN A 1 481 ? 94.03716  -7.97718  2.19586    1.000 59.88191  ? 481 GLN A NE2 1 
ATOM 3876  N N   . LEU A 1 482 ? 98.28559  -11.11655 2.55200    1.000 51.20645  ? 482 LEU A N   1 
ATOM 3877  C CA  . LEU A 1 482 ? 99.24478  -10.46104 3.43258    1.000 64.79048  ? 482 LEU A CA  1 
ATOM 3878  C C   . LEU A 1 482 ? 98.67330  -9.13496  3.92005    1.000 69.32882  ? 482 LEU A C   1 
ATOM 3879  O O   . LEU A 1 482 ? 98.34085  -8.26017  3.11237    1.000 63.27346  ? 482 LEU A O   1 
ATOM 3880  C CB  . LEU A 1 482 ? 100.57048 -10.24339 2.70779    1.000 62.68366  ? 482 LEU A CB  1 
ATOM 3881  C CG  . LEU A 1 482 ? 101.67934 -9.59654  3.53969    1.000 54.02690  ? 482 LEU A CG  1 
ATOM 3882  C CD1 . LEU A 1 482 ? 102.28289 -10.60004 4.50467    1.000 54.92263  ? 482 LEU A CD1 1 
ATOM 3883  C CD2 . LEU A 1 482 ? 102.75246 -9.00186  2.64003    1.000 56.77445  ? 482 LEU A CD2 1 
ATOM 3884  N N   . ILE A 1 483 ? 98.56434  -8.98597  5.23347    1.000 70.79929  ? 483 ILE A N   1 
ATOM 3885  C CA  . ILE A 1 483 ? 97.93516  -7.82858  5.86215    1.000 56.09595  ? 483 ILE A CA  1 
ATOM 3886  C C   . ILE A 1 483 ? 99.00905  -7.06558  6.63074    1.000 47.18107  ? 483 ILE A C   1 
ATOM 3887  O O   . ILE A 1 483 ? 99.56057  -7.59666  7.60422    1.000 52.13411  ? 483 ILE A O   1 
ATOM 3888  C CB  . ILE A 1 483 ? 96.78842  -8.24984  6.79457    1.000 62.63430  ? 483 ILE A CB  1 
ATOM 3889  C CG1 . ILE A 1 483 ? 95.84474  -9.21316  6.07455    1.000 61.74739  ? 483 ILE A CG1 1 
ATOM 3890  C CG2 . ILE A 1 483 ? 96.02665  -7.03262  7.29681    1.000 92.48280  ? 483 ILE A CG2 1 
ATOM 3891  C CD1 . ILE A 1 483 ? 94.86115  -9.89157  6.99351    1.000 68.18663  ? 483 ILE A CD1 1 
ATOM 3892  N N   . PRO A 1 484 ? 99.33413  -5.83581  6.24158    1.000 46.83157  ? 484 PRO A N   1 
ATOM 3893  C CA  . PRO A 1 484 ? 100.35623 -5.07251  6.96323    1.000 52.28057  ? 484 PRO A CA  1 
ATOM 3894  C C   . PRO A 1 484 ? 99.82686  -4.49381  8.26538    1.000 69.07170  ? 484 PRO A C   1 
ATOM 3895  O O   . PRO A 1 484 ? 98.65168  -4.14171  8.38972    1.000 57.95814  ? 484 PRO A O   1 
ATOM 3896  C CB  . PRO A 1 484 ? 100.72318 -3.95149  5.97901    1.000 43.08130  ? 484 PRO A CB  1 
ATOM 3897  C CG  . PRO A 1 484 ? 100.12942 -4.36335  4.65652    1.000 44.34860  ? 484 PRO A CG  1 
ATOM 3898  C CD  . PRO A 1 484 ? 98.91353  -5.15419  5.00918    1.000 47.77702  ? 484 PRO A CD  1 
ATOM 3899  N N   . MET A 1 485 ? 100.72255 -4.40127  9.24807    1.000 82.28210  ? 485 MET A N   1 
ATOM 3900  C CA  . MET A 1 485 ? 100.40230 -3.78872  10.53718   1.000 77.52754  ? 485 MET A CA  1 
ATOM 3901  C C   . MET A 1 485 ? 100.80519 -2.31864  10.49339   1.000 65.56129  ? 485 MET A C   1 
ATOM 3902  O O   . MET A 1 485 ? 101.90570 -1.94008  10.89140   1.000 54.67216  ? 485 MET A O   1 
ATOM 3903  C CB  . MET A 1 485 ? 101.08903 -4.52915  11.67866   1.000 66.84535  ? 485 MET A CB  1 
ATOM 3904  C CG  . MET A 1 485 ? 100.64454 -5.97545  11.83891   1.000 53.52966  ? 485 MET A CG  1 
ATOM 3905  S SD  . MET A 1 485 ? 101.46454 -6.80923  13.21131   1.000 51.91887  ? 485 MET A SD  1 
ATOM 3906  C CE  . MET A 1 485 ? 100.71934 -5.97138  14.60784   1.000 40.33198  ? 485 MET A CE  1 
ATOM 3907  N N   . ILE A 1 486 ? 99.90480  -1.47383  9.99720    1.000 39.49687  ? 486 ILE A N   1 
ATOM 3908  C CA  . ILE A 1 486 ? 100.19128 -0.06168  9.76957    1.000 39.70841  ? 486 ILE A CA  1 
ATOM 3909  C C   . ILE A 1 486 ? 99.42103  0.78097   10.77546   1.000 39.33552  ? 486 ILE A C   1 
ATOM 3910  O O   . ILE A 1 486 ? 98.23453  0.54138   11.02590   1.000 38.91714  ? 486 ILE A O   1 
ATOM 3911  C CB  . ILE A 1 486 ? 99.85673  0.35916   8.32470    1.000 40.01478  ? 486 ILE A CB  1 
ATOM 3912  C CG1 . ILE A 1 486 ? 100.90522 -0.19743  7.36227    1.000 43.41192  ? 486 ILE A CG1 1 
ATOM 3913  C CG2 . ILE A 1 486 ? 99.77026  1.87505   8.19970    1.000 44.62448  ? 486 ILE A CG2 1 
ATOM 3914  C CD1 . ILE A 1 486 ? 100.71164 0.24306   5.93441    1.000 68.72470  ? 486 ILE A CD1 1 
ATOM 3915  N N   . SER A 1 487 ? 100.10720 1.75764   11.36193   1.000 63.38508  ? 487 SER A N   1 
ATOM 3916  C CA  . SER A 1 487 ? 99.48671  2.80752   12.15641   1.000 56.35280  ? 487 SER A CA  1 
ATOM 3917  C C   . SER A 1 487 ? 99.89477  4.16218   11.59140   1.000 61.64705  ? 487 SER A C   1 
ATOM 3918  O O   . SER A 1 487 ? 100.82181 4.27062   10.78710   1.000 57.11787  ? 487 SER A O   1 
ATOM 3919  C CB  . SER A 1 487 ? 99.88616  2.70496   13.63404   1.000 43.39869  ? 487 SER A CB  1 
ATOM 3920  O OG  . SER A 1 487 ? 101.21803 3.14650   13.83106   1.000 58.16564  ? 487 SER A OG  1 
ATOM 3921  N N   . LYS A 1 488 ? 99.18399  5.20680   12.00810   1.000 59.62394  ? 488 LYS A N   1 
ATOM 3922  C CA  . LYS A 1 488 ? 99.49569  6.56065   11.57326   1.000 60.42069  ? 488 LYS A CA  1 
ATOM 3923  C C   . LYS A 1 488 ? 99.38883  7.51215   12.75369   1.000 50.35907  ? 488 LYS A C   1 
ATOM 3924  O O   . LYS A 1 488 ? 98.53664  7.33798   13.62885   1.000 53.09277  ? 488 LYS A O   1 
ATOM 3925  C CB  . LYS A 1 488 ? 98.57923  7.02891   10.43337   1.000 71.84760  ? 488 LYS A CB  1 
ATOM 3926  C CG  . LYS A 1 488 ? 98.82894  6.32353   9.11161    1.000 84.78682  ? 488 LYS A CG  1 
ATOM 3927  C CD  . LYS A 1 488 ? 97.85526  6.78069   8.04374    1.000 92.52680  ? 488 LYS A CD  1 
ATOM 3928  C CE  . LYS A 1 488 ? 98.11047  6.05276   6.73468    1.000 93.59548  ? 488 LYS A CE  1 
ATOM 3929  N NZ  . LYS A 1 488 ? 97.13170  6.43192   5.67800    1.000 89.05400  ? 488 LYS A NZ  1 
ATOM 3930  N N   . CYS A 1 489 ? 100.26222 8.51476   12.77068   1.000 45.90771  ? 489 CYS A N   1 
ATOM 3931  C CA  . CYS A 1 489 ? 100.30827 9.47464   13.86614   1.000 44.28328  ? 489 CYS A CA  1 
ATOM 3932  C C   . CYS A 1 489 ? 100.86183 10.78992  13.33224   1.000 56.27755  ? 489 CYS A C   1 
ATOM 3933  O O   . CYS A 1 489 ? 101.04392 10.96267  12.12390   1.000 62.43685  ? 489 CYS A O   1 
ATOM 3934  C CB  . CYS A 1 489 ? 101.14808 8.93120   15.02852   1.000 44.36155  ? 489 CYS A CB  1 
ATOM 3935  S SG  . CYS A 1 489 ? 102.82493 8.43736   14.56723   1.000 46.34371  ? 489 CYS A SG  1 
ATOM 3936  N N   . ARG A 1 490 ? 101.14570 11.71983  14.24127   1.000 58.02532  ? 490 ARG A N   1 
ATOM 3937  C CA  . ARG A 1 490 ? 101.70110 13.01939  13.88426   1.000 73.92852  ? 490 ARG A CA  1 
ATOM 3938  C C   . ARG A 1 490 ? 102.86277 13.32165  14.81545   1.000 86.28326  ? 490 ARG A C   1 
ATOM 3939  O O   . ARG A 1 490 ? 102.69242 13.33518  16.03865   1.000 81.41155  ? 490 ARG A O   1 
ATOM 3940  C CB  . ARG A 1 490 ? 100.64149 14.12131  13.96786   1.000 70.40629  ? 490 ARG A CB  1 
ATOM 3941  C CG  . ARG A 1 490 ? 101.17988 15.51234  13.68086   1.000 85.69621  ? 490 ARG A CG  1 
ATOM 3942  C CD  . ARG A 1 490 ? 100.05104 16.49778  13.44869   1.000 97.81526  ? 490 ARG A CD  1 
ATOM 3943  N NE  . ARG A 1 490 ? 99.36561  16.24254  12.18544   1.000 107.32860 ? 490 ARG A NE  1 
ATOM 3944  C CZ  . ARG A 1 490 ? 98.33631  16.95334  11.73822   1.000 114.80349 ? 490 ARG A CZ  1 
ATOM 3945  N NH1 . ARG A 1 490 ? 97.86967  17.96814  12.45242   1.000 121.32962 ? 490 ARG A NH1 1 
ATOM 3946  N NH2 . ARG A 1 490 ? 97.77539  16.65180  10.57558   1.000 116.59436 ? 490 ARG A NH2 1 
ATOM 3947  N N   . THR A 1 491 ? 104.03181 13.58188  14.23429   1.000 92.92942  ? 491 THR A N   1 
ATOM 3948  C CA  . THR A 1 491 ? 105.24114 13.81685  15.00683   1.000 79.86827  ? 491 THR A CA  1 
ATOM 3949  C C   . THR A 1 491 ? 105.11921 15.11489  15.80010   1.000 85.40237  ? 491 THR A C   1 
ATOM 3950  O O   . THR A 1 491 ? 104.12326 15.84028  15.72119   1.000 93.84306  ? 491 THR A O   1 
ATOM 3951  C CB  . THR A 1 491 ? 106.45830 13.87239  14.08718   1.000 76.04506  ? 491 THR A CB  1 
ATOM 3952  O OG1 . THR A 1 491 ? 106.29804 14.94238  13.14865   1.000 96.52290  ? 491 THR A OG1 1 
ATOM 3953  C CG2 . THR A 1 491 ? 106.59938 12.57762  13.32466   1.000 66.33426  ? 491 THR A CG2 1 
ATOM 3954  N N   . LYS A 1 492 ? 106.15948 15.41138  16.58041   1.000 72.66940  ? 492 LYS A N   1 
ATOM 3955  C CA  . LYS A 1 492 ? 106.14731 16.63389  17.37235   1.000 88.84921  ? 492 LYS A CA  1 
ATOM 3956  C C   . LYS A 1 492 ? 106.20077 17.87235  16.48588   1.000 90.07980  ? 492 LYS A C   1 
ATOM 3957  O O   . LYS A 1 492 ? 105.60402 18.90017  16.82632   1.000 103.33396 ? 492 LYS A O   1 
ATOM 3958  C CB  . LYS A 1 492 ? 107.31099 16.63105  18.36300   1.000 106.62500 ? 492 LYS A CB  1 
ATOM 3959  C CG  . LYS A 1 492 ? 107.21395 17.71073  19.42672   1.000 122.81383 ? 492 LYS A CG  1 
ATOM 3960  C CD  . LYS A 1 492 ? 106.02498 17.45760  20.34238   1.000 114.28803 ? 492 LYS A CD  1 
ATOM 3961  C CE  . LYS A 1 492 ? 105.88034 18.55478  21.38304   1.000 101.72076 ? 492 LYS A CE  1 
ATOM 3962  N NZ  . LYS A 1 492 ? 107.05207 18.61463  22.29914   1.000 85.36910  ? 492 LYS A NZ  1 
ATOM 3963  N N   . GLU A 1 493 ? 106.89842 17.79865  15.35172   1.000 77.39458  ? 493 GLU A N   1 
ATOM 3964  C CA  . GLU A 1 493 ? 107.00206 18.93766  14.44698   1.000 89.11321  ? 493 GLU A CA  1 
ATOM 3965  C C   . GLU A 1 493 ? 105.76950 19.11734  13.56604   1.000 77.53591  ? 493 GLU A C   1 
ATOM 3966  O O   . GLU A 1 493 ? 105.78684 19.97541  12.67778   1.000 70.55608  ? 493 GLU A O   1 
ATOM 3967  C CB  . GLU A 1 493 ? 108.24672 18.81431  13.55983   1.000 110.88261 ? 493 GLU A CB  1 
ATOM 3968  C CG  . GLU A 1 493 ? 108.31548 17.55018  12.71406   1.000 112.49255 ? 493 GLU A CG  1 
ATOM 3969  C CD  . GLU A 1 493 ? 109.19390 16.47875  13.32754   1.000 111.15387 ? 493 GLU A CD  1 
ATOM 3970  O OE1 . GLU A 1 493 ? 109.59804 16.63568  14.49894   1.000 118.48583 ? 493 GLU A OE1 1 
ATOM 3971  O OE2 . GLU A 1 493 ? 109.48668 15.48134  12.63377   1.000 101.24789 ? 493 GLU A OE2 1 
ATOM 3972  N N   . GLY A 1 494 ? 104.71253 18.34165  13.78211   1.000 88.46421  ? 494 GLY A N   1 
ATOM 3973  C CA  . GLY A 1 494 ? 103.49488 18.51233  13.01202   1.000 88.63020  ? 494 GLY A CA  1 
ATOM 3974  C C   . GLY A 1 494 ? 103.55092 17.97724  11.59797   1.000 89.36021  ? 494 GLY A C   1 
ATOM 3975  O O   . GLY A 1 494 ? 103.07371 18.64006  10.66825   1.000 100.85080 ? 494 GLY A O   1 
ATOM 3976  N N   . ARG A 1 495 ? 104.11899 16.78918  11.40616   1.000 88.95019  ? 495 ARG A N   1 
ATOM 3977  C CA  . ARG A 1 495 ? 104.15640 16.13074  10.10673   1.000 89.37930  ? 495 ARG A CA  1 
ATOM 3978  C C   . ARG A 1 495 ? 103.60359 14.72375  10.25862   1.000 99.65457  ? 495 ARG A C   1 
ATOM 3979  O O   . ARG A 1 495 ? 103.99646 13.99622  11.17611   1.000 111.37094 ? 495 ARG A O   1 
ATOM 3980  C CB  . ARG A 1 495 ? 105.57584 16.08710  9.53056    1.000 78.93273  ? 495 ARG A CB  1 
ATOM 3981  C CG  . ARG A 1 495 ? 106.14112 17.44785  9.15677    1.000 80.72752  ? 495 ARG A CG  1 
ATOM 3982  C CD  . ARG A 1 495 ? 107.29003 17.31713  8.16791    1.000 81.36926  ? 495 ARG A CD  1 
ATOM 3983  N NE  . ARG A 1 495 ? 107.65451 18.60337  7.57916    1.000 99.12171  ? 495 ARG A NE  1 
ATOM 3984  C CZ  . ARG A 1 495 ? 108.59628 18.76301  6.65442    1.000 118.49811 ? 495 ARG A CZ  1 
ATOM 3985  N NH1 . ARG A 1 495 ? 109.27201 17.71454  6.20418    1.000 117.98863 ? 495 ARG A NH1 1 
ATOM 3986  N NH2 . ARG A 1 495 ? 108.86033 19.97094  6.17525    1.000 128.42647 ? 495 ARG A NH2 1 
ATOM 3987  N N   . ARG A 1 496 ? 102.69489 14.34619  9.36361    1.000 90.04807  ? 496 ARG A N   1 
ATOM 3988  C CA  . ARG A 1 496 ? 102.03913 13.05231  9.47492    1.000 84.21411  ? 496 ARG A CA  1 
ATOM 3989  C C   . ARG A 1 496 ? 103.02085 11.92997  9.16574    1.000 69.73835  ? 496 ARG A C   1 
ATOM 3990  O O   . ARG A 1 496 ? 103.78946 11.99811  8.20154    1.000 75.97399  ? 496 ARG A O   1 
ATOM 3991  C CB  . ARG A 1 496 ? 100.84208 12.98441  8.52740    1.000 91.07752  ? 496 ARG A CB  1 
ATOM 3992  C CG  . ARG A 1 496 ? 99.64485  13.79604  8.99638    1.000 111.09145 ? 496 ARG A CG  1 
ATOM 3993  C CD  . ARG A 1 496 ? 98.43297  13.56988  8.10744    1.000 139.60405 ? 496 ARG A CD  1 
ATOM 3994  N NE  . ARG A 1 496 ? 97.26392  14.30745  8.57872    1.000 162.71282 ? 496 ARG A NE  1 
ATOM 3995  C CZ  . ARG A 1 496 ? 96.08268  14.30356  7.96969    1.000 165.95034 ? 496 ARG A CZ  1 
ATOM 3996  N NH1 . ARG A 1 496 ? 95.07455  15.00682  8.46803    1.000 181.94762 ? 496 ARG A NH1 1 
ATOM 3997  N NH2 . ARG A 1 496 ? 95.91219  13.60398  6.85629    1.000 143.87007 ? 496 ARG A NH2 1 
ATOM 3998  N N   . LYS A 1 497 ? 102.98656 10.89141  9.99524    1.000 56.64843  ? 497 LYS A N   1 
ATOM 3999  C CA  . LYS A 1 497 ? 103.92508 9.78265   9.93377    1.000 51.15082  ? 497 LYS A CA  1 
ATOM 4000  C C   . LYS A 1 497 ? 103.16225 8.46900   9.85575    1.000 57.50749  ? 497 LYS A C   1 
ATOM 4001  O O   . LYS A 1 497 ? 102.14584 8.28666   10.53607   1.000 91.72032  ? 497 LYS A O   1 
ATOM 4002  C CB  . LYS A 1 497 ? 104.85419 9.78340   11.15540   1.000 75.16018  ? 497 LYS A CB  1 
ATOM 4003  C CG  . LYS A 1 497 ? 105.70790 8.53838   11.29079   1.000 89.67673  ? 497 LYS A CG  1 
ATOM 4004  C CD  . LYS A 1 497 ? 106.37378 8.45770   12.65740   1.000 85.89043  ? 497 LYS A CD  1 
ATOM 4005  C CE  . LYS A 1 497 ? 107.60900 9.33876   12.73769   1.000 85.87322  ? 497 LYS A CE  1 
ATOM 4006  N NZ  . LYS A 1 497 ? 108.29907 9.20653   14.05104   1.000 87.58551  ? 497 LYS A NZ  1 
ATOM 4007  N N   . THR A 1 498 ? 103.66180 7.55972   9.02275    1.000 53.86768  ? 498 THR A N   1 
ATOM 4008  C CA  . THR A 1 498 ? 103.08690 6.23351   8.84235    1.000 61.09114  ? 498 THR A CA  1 
ATOM 4009  C C   . THR A 1 498 ? 104.07559 5.19814   9.36139    1.000 70.91568  ? 498 THR A C   1 
ATOM 4010  O O   . THR A 1 498 ? 105.21032 5.12356   8.87860    1.000 97.91908  ? 498 THR A O   1 
ATOM 4011  C CB  . THR A 1 498 ? 102.76356 5.97335   7.37101    1.000 65.39152  ? 498 THR A CB  1 
ATOM 4012  O OG1 . THR A 1 498 ? 101.75244 6.88960   6.93382    1.000 80.88379  ? 498 THR A OG1 1 
ATOM 4013  C CG2 . THR A 1 498 ? 102.27000 4.54849   7.17789    1.000 58.75536  ? 498 THR A CG2 1 
ATOM 4014  N N   . ASN A 1 499 ? 103.64419 4.40209   10.33489   1.000 38.48339  ? 499 ASN A N   1 
ATOM 4015  C CA  . ASN A 1 499 ? 104.48480 3.41328   10.98884   1.000 44.60764  ? 499 ASN A CA  1 
ATOM 4016  C C   . ASN A 1 499 ? 104.05497 2.00928   10.58860   1.000 50.71963  ? 499 ASN A C   1 
ATOM 4017  O O   . ASN A 1 499 ? 102.86509 1.73600   10.40363   1.000 66.14371  ? 499 ASN A O   1 
ATOM 4018  C CB  . ASN A 1 499 ? 104.40639 3.54759   12.51133   1.000 61.55883  ? 499 ASN A CB  1 
ATOM 4019  C CG  . ASN A 1 499 ? 104.95920 4.86029   13.00839   1.000 92.95787  ? 499 ASN A CG  1 
ATOM 4020  O OD1 . ASN A 1 499 ? 105.99216 5.32973   12.53392   1.000 118.14417 ? 499 ASN A OD1 1 
ATOM 4021  N ND2 . ASN A 1 499 ? 104.26791 5.46871   13.96479   1.000 86.60248  ? 499 ASN A ND2 1 
ATOM 4022  N N   . LEU A 1 500 ? 105.03705 1.11665   10.47880   1.000 62.78360  ? 500 LEU A N   1 
ATOM 4023  C CA  . LEU A 1 500 ? 104.80511 -0.28901  10.16961   1.000 42.04991  ? 500 LEU A CA  1 
ATOM 4024  C C   . LEU A 1 500 ? 105.40794 -1.13715  11.27903   1.000 45.21230  ? 500 LEU A C   1 
ATOM 4025  O O   . LEU A 1 500 ? 106.62673 -1.12140  11.48332   1.000 46.68822  ? 500 LEU A O   1 
ATOM 4026  C CB  . LEU A 1 500 ? 105.41427 -0.66611  8.81829    1.000 41.32167  ? 500 LEU A CB  1 
ATOM 4027  C CG  . LEU A 1 500 ? 105.32064 -2.13651  8.40683    1.000 41.31450  ? 500 LEU A CG  1 
ATOM 4028  C CD1 . LEU A 1 500 ? 103.86722 -2.55537  8.26545    1.000 50.54321  ? 500 LEU A CD1 1 
ATOM 4029  C CD2 . LEU A 1 500 ? 106.08516 -2.39856  7.11703    1.000 42.09934  ? 500 LEU A CD2 1 
ATOM 4030  N N   . TYR A 1 501 ? 104.55570 -1.87752  11.98734   1.000 49.64277  ? 501 TYR A N   1 
ATOM 4031  C CA  . TYR A 1 501 ? 104.99477 -2.73391  13.07902   1.000 58.47049  ? 501 TYR A CA  1 
ATOM 4032  C C   . TYR A 1 501 ? 105.33359 -4.14631  12.62854   1.000 56.68092  ? 501 TYR A C   1 
ATOM 4033  O O   . TYR A 1 501 ? 106.01664 -4.86724  13.36317   1.000 49.55036  ? 501 TYR A O   1 
ATOM 4034  C CB  . TYR A 1 501 ? 103.91324 -2.81191  14.15978   1.000 53.67023  ? 501 TYR A CB  1 
ATOM 4035  C CG  . TYR A 1 501 ? 103.62227 -1.50150  14.84881   1.000 52.69536  ? 501 TYR A CG  1 
ATOM 4036  C CD1 . TYR A 1 501 ? 104.42031 -1.04983  15.89041   1.000 68.32364  ? 501 TYR A CD1 1 
ATOM 4037  C CD2 . TYR A 1 501 ? 102.53952 -0.72221  14.46699   1.000 48.37370  ? 501 TYR A CD2 1 
ATOM 4038  C CE1 . TYR A 1 501 ? 104.15259 0.14553   16.52813   1.000 71.79620  ? 501 TYR A CE1 1 
ATOM 4039  C CE2 . TYR A 1 501 ? 102.26278 0.47252   15.09912   1.000 54.71197  ? 501 TYR A CE2 1 
ATOM 4040  C CZ  . TYR A 1 501 ? 103.07271 0.90287   16.12843   1.000 71.90576  ? 501 TYR A CZ  1 
ATOM 4041  O OH  . TYR A 1 501 ? 102.80274 2.09443   16.76152   1.000 85.71721  ? 501 TYR A OH  1 
ATOM 4042  N N   . GLY A 1 502 ? 104.86768 -4.55839  11.46188   1.000 57.28541  ? 502 GLY A N   1 
ATOM 4043  C CA  . GLY A 1 502 ? 105.08206 -5.90792  10.98769   1.000 61.35405  ? 502 GLY A CA  1 
ATOM 4044  C C   . GLY A 1 502 ? 103.97645 -6.31369  10.03412   1.000 48.72309  ? 502 GLY A C   1 
ATOM 4045  O O   . GLY A 1 502 ? 103.19257 -5.48950  9.57405    1.000 45.05711  ? 502 GLY A O   1 
ATOM 4046  N N   . PHE A 1 503 ? 103.93106 -7.61213  9.75185    1.000 39.82078  ? 503 PHE A N   1 
ATOM 4047  C CA  . PHE A 1 503 ? 102.98594 -8.18637  8.80769    1.000 46.99749  ? 503 PHE A CA  1 
ATOM 4048  C C   . PHE A 1 503 ? 102.14164 -9.25755  9.48750    1.000 40.69557  ? 503 PHE A C   1 
ATOM 4049  O O   . PHE A 1 503 ? 102.48040 -9.76494  10.56045   1.000 41.43865  ? 503 PHE A O   1 
ATOM 4050  C CB  . PHE A 1 503 ? 103.71040 -8.79078  7.59588    1.000 69.07244  ? 503 PHE A CB  1 
ATOM 4051  C CG  . PHE A 1 503 ? 104.22085 -7.77072  6.61465    1.000 72.32589  ? 503 PHE A CG  1 
ATOM 4052  C CD1 . PHE A 1 503 ? 103.97642 -6.42087  6.79897    1.000 57.46665  ? 503 PHE A CD1 1 
ATOM 4053  C CD2 . PHE A 1 503 ? 104.95496 -8.16532  5.51036    1.000 95.76745  ? 503 PHE A CD2 1 
ATOM 4054  C CE1 . PHE A 1 503 ? 104.44642 -5.48545  5.89934    1.000 68.64025  ? 503 PHE A CE1 1 
ATOM 4055  C CE2 . PHE A 1 503 ? 105.42835 -7.23493  4.60768    1.000 102.46246 ? 503 PHE A CE2 1 
ATOM 4056  C CZ  . PHE A 1 503 ? 105.17250 -5.89354  4.80150    1.000 91.79548  ? 503 PHE A CZ  1 
ATOM 4057  N N   . ILE A 1 504 ? 101.02193 -9.58811  8.84929    1.000 36.01345  ? 504 ILE A N   1 
ATOM 4058  C CA  . ILE A 1 504 ? 100.14629 -10.66719 9.29275    1.000 36.08749  ? 504 ILE A CA  1 
ATOM 4059  C C   . ILE A 1 504 ? 99.63420  -11.40151 8.06216    1.000 36.69305  ? 504 ILE A C   1 
ATOM 4060  O O   . ILE A 1 504 ? 99.14688  -10.77449 7.11618    1.000 36.61610  ? 504 ILE A O   1 
ATOM 4061  C CB  . ILE A 1 504 ? 98.97192  -10.15263 10.14926   1.000 35.31527  ? 504 ILE A CB  1 
ATOM 4062  C CG1 . ILE A 1 504 ? 99.44412  -9.84566  11.57253   1.000 34.99192  ? 504 ILE A CG1 1 
ATOM 4063  C CG2 . ILE A 1 504 ? 97.84094  -11.16819 10.17141   1.000 35.54632  ? 504 ILE A CG2 1 
ATOM 4064  C CD1 . ILE A 1 504 ? 98.35410  -9.33851  12.49154   1.000 34.34606  ? 504 ILE A CD1 1 
ATOM 4065  N N   . ILE A 1 505 ? 99.73987  -12.72665 8.07689    1.000 35.56918  ? 505 ILE A N   1 
ATOM 4066  C CA  . ILE A 1 505 ? 99.24401  -13.57591 6.99913    1.000 36.36907  ? 505 ILE A CA  1 
ATOM 4067  C C   . ILE A 1 505 ? 97.97056  -14.25682 7.48132    1.000 36.39041  ? 505 ILE A C   1 
ATOM 4068  O O   . ILE A 1 505 ? 97.98092  -14.96485 8.49653    1.000 36.49521  ? 505 ILE A O   1 
ATOM 4069  C CB  . ILE A 1 505 ? 100.29287 -14.60476 6.55317    1.000 37.45815  ? 505 ILE A CB  1 
ATOM 4070  C CG1 . ILE A 1 505 ? 101.54467 -13.89138 6.04103    1.000 37.55133  ? 505 ILE A CG1 1 
ATOM 4071  C CG2 . ILE A 1 505 ? 99.72182  -15.51513 5.47681    1.000 38.44075  ? 505 ILE A CG2 1 
ATOM 4072  C CD1 . ILE A 1 505 ? 102.67844 -14.82347 5.70595    1.000 38.67898  ? 505 ILE A CD1 1 
ATOM 4073  N N   . LYS A 1 506 ? 96.87554  -14.02556 6.75847    1.000 40.01039  ? 506 LYS A N   1 
ATOM 4074  C CA  . LYS A 1 506 ? 95.55884  -14.54386 7.10676    1.000 40.13182  ? 506 LYS A CA  1 
ATOM 4075  C C   . LYS A 1 506 ? 95.28570  -15.85579 6.38191    1.000 41.41172  ? 506 LYS A C   1 
ATOM 4076  O O   . LYS A 1 506 ? 95.68313  -16.03588 5.22849    1.000 61.16559  ? 506 LYS A O   1 
ATOM 4077  C CB  . LYS A 1 506 ? 94.47871  -13.51951 6.75006    1.000 39.60629  ? 506 LYS A CB  1 
ATOM 4078  C CG  . LYS A 1 506 ? 93.05196  -13.98453 6.98873    1.000 39.88468  ? 506 LYS A CG  1 
ATOM 4079  C CD  . LYS A 1 506 ? 92.05123  -13.03733 6.34609    1.000 45.61064  ? 506 LYS A CD  1 
ATOM 4080  C CE  . LYS A 1 506 ? 92.14263  -13.09022 4.82877    1.000 52.71721  ? 506 LYS A CE  1 
ATOM 4081  N NZ  . LYS A 1 506 ? 91.85564  -14.45488 4.30048    1.000 58.80026  ? 506 LYS A NZ  1 
ATOM 4082  N N   . GLY A 1 507 ? 94.60781  -16.77142 7.06678    1.000 48.07286  ? 507 GLY A N   1 
ATOM 4083  C CA  . GLY A 1 507 ? 94.17984  -18.02522 6.48117    1.000 59.58928  ? 507 GLY A CA  1 
ATOM 4084  C C   . GLY A 1 507 ? 92.83746  -17.91277 5.78674    1.000 59.01072  ? 507 GLY A C   1 
ATOM 4085  O O   . GLY A 1 507 ? 92.41452  -16.83671 5.35652    1.000 55.63486  ? 507 GLY A O   1 
ATOM 4086  N N   . ARG A 1 508 ? 92.16139  -19.05449 5.67137    1.000 53.24788  ? 508 ARG A N   1 
ATOM 4087  C CA  . ARG A 1 508 ? 90.81790  -19.07437 5.10731    1.000 54.36426  ? 508 ARG A CA  1 
ATOM 4088  C C   . ARG A 1 508 ? 89.84672  -18.37250 6.04745    1.000 52.37919  ? 508 ARG A C   1 
ATOM 4089  O O   . ARG A 1 508 ? 89.81371  -18.65689 7.24813    1.000 68.95638  ? 508 ARG A O   1 
ATOM 4090  C CB  . ARG A 1 508 ? 90.36676  -20.51208 4.85419    1.000 67.44812  ? 508 ARG A CB  1 
ATOM 4091  C CG  . ARG A 1 508 ? 91.00090  -21.15857 3.63641    1.000 84.52859  ? 508 ARG A CG  1 
ATOM 4092  C CD  . ARG A 1 508 ? 90.35714  -20.64089 2.36171    1.000 96.99957  ? 508 ARG A CD  1 
ATOM 4093  N NE  . ARG A 1 508 ? 91.03123  -21.13089 1.16346    1.000 114.39332 ? 508 ARG A NE  1 
ATOM 4094  C CZ  . ARG A 1 508 ? 90.64785  -22.20055 0.47445    1.000 123.92306 ? 508 ARG A CZ  1 
ATOM 4095  N NH1 . ARG A 1 508 ? 89.58835  -22.89842 0.86155    1.000 113.13320 ? 508 ARG A NH1 1 
ATOM 4096  N NH2 . ARG A 1 508 ? 91.32371  -22.57249 -0.60374   1.000 134.99257 ? 508 ARG A NH2 1 
ATOM 4097  N N   . SER A 1 509 ? 89.05299  -17.45232 5.49833    1.000 56.31913  ? 509 SER A N   1 
ATOM 4098  C CA  . SER A 1 509 ? 88.18865  -16.61436 6.32133    1.000 62.17506  ? 509 SER A CA  1 
ATOM 4099  C C   . SER A 1 509 ? 86.71092  -16.79506 5.99158    1.000 84.44383  ? 509 SER A C   1 
ATOM 4100  O O   . SER A 1 509 ? 85.97938  -15.80987 5.84712    1.000 89.07059  ? 509 SER A O   1 
ATOM 4101  C CB  . SER A 1 509 ? 88.58630  -15.14375 6.17600    1.000 54.58871  ? 509 SER A CB  1 
ATOM 4102  O OG  . SER A 1 509 ? 88.33799  -14.66831 4.86631    1.000 58.47801  ? 509 SER A OG  1 
ATOM 4103  N N   . HIS A 1 510 ? 86.25821  -18.04363 5.87623    1.000 92.31137  ? 510 HIS A N   1 
ATOM 4104  C CA  . HIS A 1 510 ? 84.83743  -18.31743 5.69013    1.000 84.64500  ? 510 HIS A CA  1 
ATOM 4105  C C   . HIS A 1 510 ? 84.08331  -18.06624 6.99042    1.000 57.83170  ? 510 HIS A C   1 
ATOM 4106  O O   . HIS A 1 510 ? 83.62824  -19.00989 7.64526    1.000 52.71633  ? 510 HIS A O   1 
ATOM 4107  C CB  . HIS A 1 510 ? 84.61730  -19.75611 5.21578    1.000 87.41686  ? 510 HIS A CB  1 
ATOM 4108  C CG  . HIS A 1 510 ? 84.78411  -19.94187 3.73942    1.000 95.64884  ? 510 HIS A CG  1 
ATOM 4109  N ND1 . HIS A 1 510 ? 83.76343  -19.71375 2.84173    1.000 98.87464  ? 510 HIS A ND1 1 
ATOM 4110  C CD2 . HIS A 1 510 ? 85.84902  -20.34113 3.00429    1.000 99.24502  ? 510 HIS A CD2 1 
ATOM 4111  C CE1 . HIS A 1 510 ? 84.19312  -19.96069 1.61714    1.000 101.34766 ? 510 HIS A CE1 1 
ATOM 4112  N NE2 . HIS A 1 510 ? 85.45550  -20.34302 1.68788    1.000 101.61725 ? 510 HIS A NE2 1 
ATOM 4113  N N   . LEU A 1 511 ? 83.94403  -16.79424 7.36913    1.000 48.08732  ? 511 LEU A N   1 
ATOM 4114  C CA  . LEU A 1 511 ? 83.36662  -16.42208 8.66054    1.000 55.38656  ? 511 LEU A CA  1 
ATOM 4115  C C   . LEU A 1 511 ? 81.85689  -16.25483 8.51244    1.000 59.96401  ? 511 LEU A C   1 
ATOM 4116  O O   . LEU A 1 511 ? 81.32590  -15.15508 8.33938    1.000 51.77878  ? 511 LEU A O   1 
ATOM 4117  C CB  . LEU A 1 511 ? 84.02890  -15.15814 9.19171    1.000 57.75823  ? 511 LEU A CB  1 
ATOM 4118  C CG  . LEU A 1 511 ? 85.53353  -15.28647 9.43366    1.000 56.04622  ? 511 LEU A CG  1 
ATOM 4119  C CD1 . LEU A 1 511 ? 86.09786  -14.01124 10.03981   1.000 58.95114  ? 511 LEU A CD1 1 
ATOM 4120  C CD2 . LEU A 1 511 ? 85.83154  -16.48742 10.31761   1.000 60.75295  ? 511 LEU A CD2 1 
ATOM 4121  N N   . ARG A 1 512 ? 81.15624  -17.38728 8.58174    1.000 71.18651  ? 512 ARG A N   1 
ATOM 4122  C CA  . ARG A 1 512 ? 79.69916  -17.36627 8.52011    1.000 63.96945  ? 512 ARG A CA  1 
ATOM 4123  C C   . ARG A 1 512 ? 79.10479  -16.82832 9.81709    1.000 78.51019  ? 512 ARG A C   1 
ATOM 4124  O O   . ARG A 1 512 ? 78.22595  -15.95874 9.79603    1.000 91.36512  ? 512 ARG A O   1 
ATOM 4125  C CB  . ARG A 1 512 ? 79.16880  -18.76686 8.21308    1.000 72.59383  ? 512 ARG A CB  1 
ATOM 4126  C CG  . ARG A 1 512 ? 79.47086  -19.22970 6.79611    1.000 103.10612 ? 512 ARG A CG  1 
ATOM 4127  C CD  . ARG A 1 512 ? 79.10359  -20.68837 6.58228    1.000 129.00793 ? 512 ARG A CD  1 
ATOM 4128  N NE  . ARG A 1 512 ? 79.05869  -21.02775 5.16277    1.000 146.31723 ? 512 ARG A NE  1 
ATOM 4129  C CZ  . ARG A 1 512 ? 78.47395  -22.11405 4.66951    1.000 153.52088 ? 512 ARG A CZ  1 
ATOM 4130  N NH1 . ARG A 1 512 ? 77.87817  -22.97673 5.48106    1.000 165.63477 ? 512 ARG A NH1 1 
ATOM 4131  N NH2 . ARG A 1 512 ? 78.48662  -22.33833 3.36271    1.000 145.09964 ? 512 ARG A NH2 1 
ATOM 4132  N N   . ASN A 1 513 ? 79.56861  -17.33453 10.95714   1.000 71.66676  ? 513 ASN A N   1 
ATOM 4133  C CA  . ASN A 1 513 ? 79.06386  -16.88948 12.24525   1.000 73.42696  ? 513 ASN A CA  1 
ATOM 4134  C C   . ASN A 1 513 ? 79.96470  -15.79756 12.81713   1.000 86.54536  ? 513 ASN A C   1 
ATOM 4135  O O   . ASN A 1 513 ? 80.90910  -15.33265 12.17375   1.000 105.24023 ? 513 ASN A O   1 
ATOM 4136  C CB  . ASN A 1 513 ? 78.96240  -18.06444 13.21375   1.000 86.85370  ? 513 ASN A CB  1 
ATOM 4137  C CG  . ASN A 1 513 ? 78.14914  -19.21074 12.65492   1.000 128.44540 ? 513 ASN A CG  1 
ATOM 4138  O OD1 . ASN A 1 513 ? 77.17849  -19.00701 11.92526   1.000 154.29075 ? 513 ASN A OD1 1 
ATOM 4139  N ND2 . ASN A 1 513 ? 78.55293  -20.43026 12.98375   1.000 134.86206 ? 513 ASN A ND2 1 
ATOM 4140  N N   . ASP A 1 514 ? 79.67256  -15.37986 14.04787   1.000 94.14031  ? 514 ASP A N   1 
ATOM 4141  C CA  . ASP A 1 514 ? 80.51375  -14.40416 14.72873   1.000 98.49789  ? 514 ASP A CA  1 
ATOM 4142  C C   . ASP A 1 514 ? 81.62453  -15.04283 15.54946   1.000 68.23936  ? 514 ASP A C   1 
ATOM 4143  O O   . ASP A 1 514 ? 82.67475  -14.41993 15.74207   1.000 55.30777  ? 514 ASP A O   1 
ATOM 4144  C CB  . ASP A 1 514 ? 79.66202  -13.51108 15.63409   1.000 129.26703 ? 514 ASP A CB  1 
ATOM 4145  C CG  . ASP A 1 514 ? 78.59674  -12.75495 14.86824   1.000 138.16974 ? 514 ASP A CG  1 
ATOM 4146  O OD1 . ASP A 1 514 ? 78.81593  -12.46865 13.67206   1.000 136.49390 ? 514 ASP A OD1 1 
ATOM 4147  O OD2 . ASP A 1 514 ? 77.54482  -12.43907 15.46242   1.000 138.03463 ? 514 ASP A OD2 1 
ATOM 4148  N N   . THR A 1 515 ? 81.42488  -16.26794 16.02849   1.000 68.49626  ? 515 THR A N   1 
ATOM 4149  C CA  . THR A 1 515 ? 82.43086  -16.97931 16.80518   1.000 75.00194  ? 515 THR A CA  1 
ATOM 4150  C C   . THR A 1 515 ? 83.35173  -17.82472 15.93596   1.000 68.64714  ? 515 THR A C   1 
ATOM 4151  O O   . THR A 1 515 ? 84.30339  -18.41546 16.45782   1.000 58.65739  ? 515 THR A O   1 
ATOM 4152  C CB  . THR A 1 515 ? 81.75980  -17.86438 17.86295   1.000 95.25698  ? 515 THR A CB  1 
ATOM 4153  O OG1 . THR A 1 515 ? 81.02466  -18.91248 17.21898   1.000 127.62434 ? 515 THR A OG1 1 
ATOM 4154  C CG2 . THR A 1 515 ? 80.81174  -17.04133 18.72446   1.000 89.40540  ? 515 THR A CG2 1 
ATOM 4155  N N   . ASP A 1 516 ? 83.08920  -17.90070 14.63180   1.000 65.20351  ? 516 ASP A N   1 
ATOM 4156  C CA  . ASP A 1 516 ? 83.95069  -18.66102 13.73710   1.000 56.73524  ? 516 ASP A CA  1 
ATOM 4157  C C   . ASP A 1 516 ? 85.33667  -18.03227 13.68999   1.000 44.81404  ? 516 ASP A C   1 
ATOM 4158  O O   . ASP A 1 516 ? 85.47766  -16.81372 13.55070   1.000 43.15076  ? 516 ASP A O   1 
ATOM 4159  C CB  . ASP A 1 516 ? 83.33814  -18.72426 12.33884   1.000 69.38085  ? 516 ASP A CB  1 
ATOM 4160  C CG  . ASP A 1 516 ? 82.05330  -19.53185 12.30245   1.000 94.66348  ? 516 ASP A CG  1 
ATOM 4161  O OD1 . ASP A 1 516 ? 81.82680  -20.33728 13.23072   1.000 99.02204  ? 516 ASP A OD1 1 
ATOM 4162  O OD2 . ASP A 1 516 ? 81.27329  -19.36753 11.34137   1.000 113.76988 ? 516 ASP A OD2 1 
ATOM 4163  N N   . VAL A 1 517 ? 86.35983  -18.87127 13.80576   1.000 40.22313  ? 517 VAL A N   1 
ATOM 4164  C CA  . VAL A 1 517 ? 87.73491  -18.42136 13.97996   1.000 43.46598  ? 517 VAL A CA  1 
ATOM 4165  C C   . VAL A 1 517 ? 88.48622  -18.54835 12.66388   1.000 39.54992  ? 517 VAL A C   1 
ATOM 4166  O O   . VAL A 1 517 ? 88.33406  -19.53647 11.93359   1.000 41.73062  ? 517 VAL A O   1 
ATOM 4167  C CB  . VAL A 1 517 ? 88.43454  -19.22252 15.09563   1.000 74.57369  ? 517 VAL A CB  1 
ATOM 4168  C CG1 . VAL A 1 517 ? 89.85609  -18.72057 15.31207   1.000 85.35194  ? 517 VAL A CG1 1 
ATOM 4169  C CG2 . VAL A 1 517 ? 87.63315  -19.14582 16.38534   1.000 97.72388  ? 517 VAL A CG2 1 
ATOM 4170  N N   . VAL A 1 518 ? 89.29567  -17.53773 12.36008   1.000 41.04220  ? 518 VAL A N   1 
ATOM 4171  C CA  . VAL A 1 518 ? 90.24725  -17.56299 11.25883   1.000 43.11499  ? 518 VAL A CA  1 
ATOM 4172  C C   . VAL A 1 518 ? 91.64595  -17.54209 11.86023   1.000 42.39552  ? 518 VAL A C   1 
ATOM 4173  O O   . VAL A 1 518 ? 91.92098  -16.77206 12.79220   1.000 47.96552  ? 518 VAL A O   1 
ATOM 4174  C CB  . VAL A 1 518 ? 90.03078  -16.38543 10.28997   1.000 40.58559  ? 518 VAL A CB  1 
ATOM 4175  C CG1 . VAL A 1 518 ? 89.89234  -15.07451 11.05101   1.000 39.35242  ? 518 VAL A CG1 1 
ATOM 4176  C CG2 . VAL A 1 518 ? 91.16995  -16.30402 9.28358    1.000 40.68057  ? 518 VAL A CG2 1 
ATOM 4177  N N   . ASN A 1 519 ? 92.51196  -18.41566 11.35588   1.000 38.62212  ? 519 ASN A N   1 
ATOM 4178  C CA  . ASN A 1 519 ? 93.88167  -18.49637 11.83180   1.000 38.48413  ? 519 ASN A CA  1 
ATOM 4179  C C   . ASN A 1 519 ? 94.74615  -17.47576 11.10802   1.000 37.79865  ? 519 ASN A C   1 
ATOM 4180  O O   . ASN A 1 519 ? 94.48679  -17.11612 9.95629    1.000 40.13333  ? 519 ASN A O   1 
ATOM 4181  C CB  . ASN A 1 519 ? 94.44711  -19.89986 11.60794   1.000 46.48065  ? 519 ASN A CB  1 
ATOM 4182  C CG  . ASN A 1 519 ? 93.68542  -20.96558 12.36909   1.000 78.51902  ? 519 ASN A CG  1 
ATOM 4183  O OD1 . ASN A 1 519 ? 93.04742  -21.83238 11.77106   1.000 91.93929  ? 519 ASN A OD1 1 
ATOM 4184  N ND2 . ASN A 1 519 ? 93.75267  -20.91146 13.69491   1.000 81.24158  ? 519 ASN A ND2 1 
ATOM 4185  N N   . PHE A 1 520 ? 95.77952  -17.00139 11.79809   1.000 37.62408  ? 520 PHE A N   1 
ATOM 4186  C CA  . PHE A 1 520 ? 96.68157  -16.02677 11.20979   1.000 37.09763  ? 520 PHE A CA  1 
ATOM 4187  C C   . PHE A 1 520 ? 98.06694  -16.18589 11.81749   1.000 37.28845  ? 520 PHE A C   1 
ATOM 4188  O O   . PHE A 1 520 ? 98.25231  -16.83330 12.85418   1.000 37.62578  ? 520 PHE A O   1 
ATOM 4189  C CB  . PHE A 1 520 ? 96.16620  -14.59288 11.39994   1.000 35.97215  ? 520 PHE A CB  1 
ATOM 4190  C CG  . PHE A 1 520 ? 96.22228  -14.10559 12.82148   1.000 38.01307  ? 520 PHE A CG  1 
ATOM 4191  C CD1 . PHE A 1 520 ? 95.25605  -14.48453 13.73894   1.000 51.49302  ? 520 PHE A CD1 1 
ATOM 4192  C CD2 . PHE A 1 520 ? 97.23729  -13.25889 13.23717   1.000 55.71988  ? 520 PHE A CD2 1 
ATOM 4193  C CE1 . PHE A 1 520 ? 95.30548  -14.03353 15.04641   1.000 61.95480  ? 520 PHE A CE1 1 
ATOM 4194  C CE2 . PHE A 1 520 ? 97.29231  -12.80502 14.54220   1.000 61.24294  ? 520 PHE A CE2 1 
ATOM 4195  C CZ  . PHE A 1 520 ? 96.32515  -13.19218 15.44747   1.000 61.25339  ? 520 PHE A CZ  1 
ATOM 4196  N N   . VAL A 1 521 ? 99.04150  -15.58948 11.13901   1.000 36.37599  ? 521 VAL A N   1 
ATOM 4197  C CA  . VAL A 1 521 ? 100.43446 -15.58563 11.56784   1.000 36.65381  ? 521 VAL A CA  1 
ATOM 4198  C C   . VAL A 1 521 ? 100.87426 -14.13531 11.67191   1.000 38.29743  ? 521 VAL A C   1 
ATOM 4199  O O   . VAL A 1 521 ? 100.80855 -13.39269 10.68478   1.000 73.77009  ? 521 VAL A O   1 
ATOM 4200  C CB  . VAL A 1 521 ? 101.33617 -16.36133 10.59572   1.000 37.71193  ? 521 VAL A CB  1 
ATOM 4201  C CG1 . VAL A 1 521 ? 102.79214 -16.22263 11.00086   1.000 38.06016  ? 521 VAL A CG1 1 
ATOM 4202  C CG2 . VAL A 1 521 ? 100.92940 -17.82350 10.54940   1.000 39.32427  ? 521 VAL A CG2 1 
ATOM 4203  N N   . SER A 1 522 ? 101.31638 -13.73130 12.85852   1.000 41.10414  ? 522 SER A N   1 
ATOM 4204  C CA  . SER A 1 522 ? 101.79560 -12.37548 13.08624   1.000 54.65566  ? 522 SER A CA  1 
ATOM 4205  C C   . SER A 1 522 ? 103.31658 -12.37961 13.14363   1.000 65.51445  ? 522 SER A C   1 
ATOM 4206  O O   . SER A 1 522 ? 103.90936 -13.12630 13.93070   1.000 86.07304  ? 522 SER A O   1 
ATOM 4207  C CB  . SER A 1 522 ? 101.21416 -11.79767 14.37794   1.000 48.16592  ? 522 SER A CB  1 
ATOM 4208  O OG  . SER A 1 522 ? 101.82930 -12.37081 15.51756   1.000 49.67451  ? 522 SER A OG  1 
ATOM 4209  N N   . MET A 1 523 ? 103.94057 -11.54636 12.31042   1.000 48.79996  ? 523 MET A N   1 
ATOM 4210  C CA  . MET A 1 523 ? 105.39181 -11.39465 12.24337   1.000 43.41439  ? 523 MET A CA  1 
ATOM 4211  C C   . MET A 1 523 ? 105.68364 -9.93010  12.54718   1.000 46.79356  ? 523 MET A C   1 
ATOM 4212  O O   . MET A 1 523 ? 105.49841 -9.06971  11.68193   1.000 49.36352  ? 523 MET A O   1 
ATOM 4213  C CB  . MET A 1 523 ? 105.92099 -11.78053 10.86520   1.000 43.71651  ? 523 MET A CB  1 
ATOM 4214  C CG  . MET A 1 523 ? 105.45696 -13.13035 10.35214   1.000 44.34983  ? 523 MET A CG  1 
ATOM 4215  S SD  . MET A 1 523 ? 106.06849 -13.45325 8.68456    1.000 51.61023  ? 523 MET A SD  1 
ATOM 4216  C CE  . MET A 1 523 ? 105.35713 -15.06470 8.35904    1.000 58.88296  ? 523 MET A CE  1 
ATOM 4217  N N   . GLU A 1 524 ? 106.14232 -9.63634  13.76045   1.000 56.05667  ? 524 GLU A N   1 
ATOM 4218  C CA  . GLU A 1 524 ? 106.27790 -8.26285  14.22544   1.000 66.89667  ? 524 GLU A CA  1 
ATOM 4219  C C   . GLU A 1 524 ? 107.74062 -7.91846  14.47275   1.000 74.57058  ? 524 GLU A C   1 
ATOM 4220  O O   . GLU A 1 524 ? 108.51167 -8.74849  14.96410   1.000 74.28987  ? 524 GLU A O   1 
ATOM 4221  C CB  . GLU A 1 524 ? 105.45978 -8.04711  15.50059   1.000 60.80345  ? 524 GLU A CB  1 
ATOM 4222  C CG  . GLU A 1 524 ? 104.19541 -8.89078  15.54610   1.000 52.26099  ? 524 GLU A CG  1 
ATOM 4223  C CD  . GLU A 1 524 ? 103.32468 -8.58077  16.74300   1.000 61.50147  ? 524 GLU A CD  1 
ATOM 4224  O OE1 . GLU A 1 524 ? 103.38486 -7.43739  17.24067   1.000 65.34980  ? 524 GLU A OE1 1 
ATOM 4225  O OE2 . GLU A 1 524 ? 102.58147 -9.48234  17.18608   1.000 65.86436  ? 524 GLU A OE2 1 
ATOM 4226  N N   . PHE A 1 525 ? 108.11375 -6.68712  14.13251   1.000 80.14106  ? 525 PHE A N   1 
ATOM 4227  C CA  . PHE A 1 525 ? 109.46649 -6.19861  14.34924   1.000 74.86897  ? 525 PHE A CA  1 
ATOM 4228  C C   . PHE A 1 525 ? 109.68129 -5.87332  15.82179   1.000 63.50359  ? 525 PHE A C   1 
ATOM 4229  O O   . PHE A 1 525 ? 108.75648 -5.46223  16.52837   1.000 67.73991  ? 525 PHE A O   1 
ATOM 4230  C CB  . PHE A 1 525 ? 109.72680 -4.95142  13.50326   1.000 73.88712  ? 525 PHE A CB  1 
ATOM 4231  C CG  . PHE A 1 525 ? 109.59705 -5.18052  12.02513   1.000 62.25853  ? 525 PHE A CG  1 
ATOM 4232  C CD1 . PHE A 1 525 ? 109.99043 -6.38064  11.45767   1.000 53.95236  ? 525 PHE A CD1 1 
ATOM 4233  C CD2 . PHE A 1 525 ? 109.06815 -4.19832  11.20439   1.000 58.42771  ? 525 PHE A CD2 1 
ATOM 4234  C CE1 . PHE A 1 525 ? 109.86954 -6.59205  10.09777   1.000 48.66474  ? 525 PHE A CE1 1 
ATOM 4235  C CE2 . PHE A 1 525 ? 108.94254 -4.40450  9.84483    1.000 51.73489  ? 525 PHE A CE2 1 
ATOM 4236  C CZ  . PHE A 1 525 ? 109.34368 -5.60298  9.29104    1.000 51.21451  ? 525 PHE A CZ  1 
ATOM 4237  N N   . SER A 1 526 ? 110.91559 -6.06206  16.28322   1.000 51.20121  ? 526 SER A N   1 
ATOM 4238  C CA  . SER A 1 526 ? 111.25346 -5.78735  17.67358   1.000 61.75473  ? 526 SER A CA  1 
ATOM 4239  C C   . SER A 1 526 ? 112.75285 -5.54415  17.78317   1.000 68.69073  ? 526 SER A C   1 
ATOM 4240  O O   . SER A 1 526 ? 113.52002 -5.82760  16.86024   1.000 87.71416  ? 526 SER A O   1 
ATOM 4241  C CB  . SER A 1 526 ? 110.81602 -6.93565  18.59007   1.000 54.76405  ? 526 SER A CB  1 
ATOM 4242  O OG  . SER A 1 526 ? 111.28322 -6.74011  19.91369   1.000 45.97654  ? 526 SER A OG  1 
ATOM 4243  N N   . LEU A 1 527 ? 113.16099 -5.00674  18.93777   1.000 59.73558  ? 527 LEU A N   1 
ATOM 4244  C CA  . LEU A 1 527 ? 114.57269 -4.83882  19.26656   1.000 63.45525  ? 527 LEU A CA  1 
ATOM 4245  C C   . LEU A 1 527 ? 114.92540 -5.48970  20.59851   1.000 78.26627  ? 527 LEU A C   1 
ATOM 4246  O O   . LEU A 1 527 ? 115.95076 -5.14729  21.19684   1.000 95.07445  ? 527 LEU A O   1 
ATOM 4247  C CB  . LEU A 1 527 ? 114.96508 -3.36001  19.29049   1.000 58.48443  ? 527 LEU A CB  1 
ATOM 4248  C CG  . LEU A 1 527 ? 114.97267 -2.64046  17.94292   1.000 57.36963  ? 527 LEU A CG  1 
ATOM 4249  C CD1 . LEU A 1 527 ? 115.38836 -1.18800  18.11353   1.000 57.28497  ? 527 LEU A CD1 1 
ATOM 4250  C CD2 . LEU A 1 527 ? 115.88515 -3.35389  16.96173   1.000 59.38957  ? 527 LEU A CD2 1 
ATOM 4251  N N   . THR A 1 528 ? 114.10240 -6.41708  21.07466   1.000 59.95051  ? 528 THR A N   1 
ATOM 4252  C CA  . THR A 1 528 ? 114.30661 -7.06193  22.36272   1.000 57.16306  ? 528 THR A CA  1 
ATOM 4253  C C   . THR A 1 528 ? 114.81204 -8.47536  22.12641   1.000 64.46927  ? 528 THR A C   1 
ATOM 4254  O O   . THR A 1 528 ? 114.23727 -9.21996  21.32520   1.000 85.53156  ? 528 THR A O   1 
ATOM 4255  C CB  . THR A 1 528 ? 113.01665 -7.09653  23.18500   1.000 54.58304  ? 528 THR A CB  1 
ATOM 4256  O OG1 . THR A 1 528 ? 112.47379 -5.77477  23.28644   1.000 66.19991  ? 528 THR A OG1 1 
ATOM 4257  C CG2 . THR A 1 528 ? 113.29360 -7.63782  24.58096   1.000 51.93525  ? 528 THR A CG2 1 
ATOM 4258  N N   . ASP A 1 529 ? 115.88031 -8.83486  22.81499   1.000 57.79539  ? 529 ASP A N   1 
ATOM 4259  C CA  . ASP A 1 529 ? 116.39181 -10.19275 22.74198   1.000 61.26303  ? 529 ASP A CA  1 
ATOM 4260  C C   . ASP A 1 529 ? 115.45414 -11.12314 23.50037   1.000 68.86222  ? 529 ASP A C   1 
ATOM 4261  O O   . ASP A 1 529 ? 115.19976 -10.89270 24.68975   1.000 86.45547  ? 529 ASP A O   1 
ATOM 4262  C CB  . ASP A 1 529 ? 117.80044 -10.26032 23.32589   1.000 88.47222  ? 529 ASP A CB  1 
ATOM 4263  C CG  . ASP A 1 529 ? 118.84821 -9.65845  22.40701   1.000 128.52737 ? 529 ASP A CG  1 
ATOM 4264  O OD1 . ASP A 1 529 ? 118.59061 -9.55829  21.19145   1.000 138.55613 ? 529 ASP A OD1 1 
ATOM 4265  O OD2 . ASP A 1 529 ? 119.93919 -9.30014  22.89977   1.000 146.45616 ? 529 ASP A OD2 1 
ATOM 4266  N N   . PRO A 1 530 ? 114.91681 -12.17084 22.86934   1.000 60.43512  ? 530 PRO A N   1 
ATOM 4267  C CA  . PRO A 1 530 ? 114.12528 -13.14280 23.63430   1.000 70.91953  ? 530 PRO A CA  1 
ATOM 4268  C C   . PRO A 1 530 ? 114.96645 -13.89985 24.63643   1.000 99.61545  ? 530 PRO A C   1 
ATOM 4269  O O   . PRO A 1 530 ? 114.43594 -14.38271 25.64414   1.000 120.36684 ? 530 PRO A O   1 
ATOM 4270  C CB  . PRO A 1 530 ? 113.57699 -14.07172 22.54780   1.000 60.26668  ? 530 PRO A CB  1 
ATOM 4271  C CG  . PRO A 1 530 ? 114.64175 -14.03823 21.50961   1.000 52.94096  ? 530 PRO A CG  1 
ATOM 4272  C CD  . PRO A 1 530 ? 115.12042 -12.61235 21.48148   1.000 52.74594  ? 530 PRO A CD  1 
ATOM 4273  N N   . ARG A 1 531 ? 116.27123 -14.01572 24.38145   1.000 79.95274  ? 531 ARG A N   1 
ATOM 4274  C CA  . ARG A 1 531 ? 117.19095 -14.66109 25.30518   1.000 72.64386  ? 531 ARG A CA  1 
ATOM 4275  C C   . ARG A 1 531 ? 117.27028 -13.94055 26.64342   1.000 68.47504  ? 531 ARG A C   1 
ATOM 4276  O O   . ARG A 1 531 ? 117.79094 -14.51339 27.60640   1.000 76.04531  ? 531 ARG A O   1 
ATOM 4277  C CB  . ARG A 1 531 ? 118.57893 -14.72990 24.67098   1.000 90.98990  ? 531 ARG A CB  1 
ATOM 4278  C CG  . ARG A 1 531 ? 119.02911 -13.39096 24.11370   1.000 99.73484  ? 531 ARG A CG  1 
ATOM 4279  C CD  . ARG A 1 531 ? 120.40580 -13.44457 23.48624   1.000 112.87040 ? 531 ARG A CD  1 
ATOM 4280  N NE  . ARG A 1 531 ? 120.45055 -14.11249 22.18779   1.000 106.66054 ? 531 ARG A NE  1 
ATOM 4281  C CZ  . ARG A 1 531 ? 120.47584 -13.47418 21.01994   1.000 104.91815 ? 531 ARG A CZ  1 
ATOM 4282  N NH1 . ARG A 1 531 ? 120.46102 -12.14891 20.98344   1.000 109.08420 ? 531 ARG A NH1 1 
ATOM 4283  N NH2 . ARG A 1 531 ? 120.52931 -14.16158 19.88812   1.000 100.87014 ? 531 ARG A NH2 1 
ATOM 4284  N N   . LEU A 1 532 ? 116.77702 -12.70373 26.72390   1.000 71.04243  ? 532 LEU A N   1 
ATOM 4285  C CA  . LEU A 1 532 ? 116.73651 -11.99934 28.00050   1.000 77.18724  ? 532 LEU A CA  1 
ATOM 4286  C C   . LEU A 1 532 ? 115.65599 -12.57894 28.90538   1.000 74.18930  ? 532 LEU A C   1 
ATOM 4287  O O   . LEU A 1 532 ? 115.90862 -12.88458 30.07655   1.000 85.13318  ? 532 LEU A O   1 
ATOM 4288  C CB  . LEU A 1 532 ? 116.50160 -10.50709 27.76578   1.000 73.33383  ? 532 LEU A CB  1 
ATOM 4289  C CG  . LEU A 1 532 ? 117.55875 -9.79109  26.92386   1.000 62.94181  ? 532 LEU A CG  1 
ATOM 4290  C CD1 . LEU A 1 532 ? 117.16839 -8.34096  26.67633   1.000 65.52088  ? 532 LEU A CD1 1 
ATOM 4291  C CD2 . LEU A 1 532 ? 118.92262 -9.87978  27.58746   1.000 61.17132  ? 532 LEU A CD2 1 
ATOM 4292  N N   . GLU A 1 533 ? 114.44197 -12.73304 28.37737   1.000 56.96132  ? 533 GLU A N   1 
ATOM 4293  C CA  . GLU A 1 533 ? 113.31608 -13.31981 29.10397   1.000 80.23474  ? 533 GLU A CA  1 
ATOM 4294  C C   . GLU A 1 533 ? 112.67003 -14.37855 28.22026   1.000 86.58126  ? 533 GLU A C   1 
ATOM 4295  O O   . GLU A 1 533 ? 111.63029 -14.13354 27.59321   1.000 98.72692  ? 533 GLU A O   1 
ATOM 4296  C CB  . GLU A 1 533 ? 112.30442 -12.25164 29.52209   1.000 93.79646  ? 533 GLU A CB  1 
ATOM 4297  C CG  . GLU A 1 533 ? 112.81058 -11.30790 30.60046   1.000 100.73590 ? 533 GLU A CG  1 
ATOM 4298  C CD  . GLU A 1 533 ? 111.80335 -10.23092 30.95318   1.000 102.84472 ? 533 GLU A CD  1 
ATOM 4299  O OE1 . GLU A 1 533 ? 110.81461 -10.07103 30.20662   1.000 100.37002 ? 533 GLU A OE1 1 
ATOM 4300  O OE2 . GLU A 1 533 ? 112.00046 -9.54415  31.97765   1.000 106.23202 ? 533 GLU A OE2 1 
ATOM 4301  N N   . PRO A 1 534 ? 113.26441 -15.57285 28.14324   1.000 78.89939  ? 534 PRO A N   1 
ATOM 4302  C CA  . PRO A 1 534 ? 112.69879 -16.60917 27.26557   1.000 77.47357  ? 534 PRO A CA  1 
ATOM 4303  C C   . PRO A 1 534 ? 111.35390 -17.13037 27.73806   1.000 71.23999  ? 534 PRO A C   1 
ATOM 4304  O O   . PRO A 1 534 ? 110.56203 -17.60257 26.91263   1.000 70.39954  ? 534 PRO A O   1 
ATOM 4305  C CB  . PRO A 1 534 ? 113.77224 -17.70493 27.28853   1.000 85.78955  ? 534 PRO A CB  1 
ATOM 4306  C CG  . PRO A 1 534 ? 114.43197 -17.53911 28.61879   1.000 89.44987  ? 534 PRO A CG  1 
ATOM 4307  C CD  . PRO A 1 534 ? 114.43650 -16.05743 28.89289   1.000 82.38636  ? 534 PRO A CD  1 
ATOM 4308  N N   . HIS A 1 535 ? 111.07224 -17.06524 29.04135   1.000 77.26864  ? 535 HIS A N   1 
ATOM 4309  C CA  . HIS A 1 535 ? 109.79188 -17.53549 29.55598   1.000 72.26262  ? 535 HIS A CA  1 
ATOM 4310  C C   . HIS A 1 535 ? 108.62716 -16.67727 29.08102   1.000 61.51936  ? 535 HIS A C   1 
ATOM 4311  O O   . HIS A 1 535 ? 107.48846 -17.15488 29.05782   1.000 59.67748  ? 535 HIS A O   1 
ATOM 4312  C CB  . HIS A 1 535 ? 109.82196 -17.55933 31.08536   1.000 88.26790  ? 535 HIS A CB  1 
ATOM 4313  C CG  . HIS A 1 535 ? 110.98340 -18.31231 31.65604   1.000 120.88621 ? 535 HIS A CG  1 
ATOM 4314  N ND1 . HIS A 1 535 ? 111.04472 -19.68917 31.67206   1.000 129.96548 ? 535 HIS A ND1 1 
ATOM 4315  C CD2 . HIS A 1 535 ? 112.13165 -17.87830 32.22772   1.000 129.37621 ? 535 HIS A CD2 1 
ATOM 4316  C CE1 . HIS A 1 535 ? 112.17915 -20.07089 32.23157   1.000 131.98111 ? 535 HIS A CE1 1 
ATOM 4317  N NE2 . HIS A 1 535 ? 112.85700 -18.99130 32.57730   1.000 130.95145 ? 535 HIS A NE2 1 
ATOM 4318  N N   . LYS A 1 536 ? 108.88844 -15.42407 28.70696   1.000 63.49241  ? 536 LYS A N   1 
ATOM 4319  C CA  . LYS A 1 536 ? 107.82956 -14.55340 28.20707   1.000 74.26488  ? 536 LYS A CA  1 
ATOM 4320  C C   . LYS A 1 536 ? 107.32414 -15.00215 26.83978   1.000 73.78267  ? 536 LYS A C   1 
ATOM 4321  O O   . LYS A 1 536 ? 106.11996 -14.93752 26.56630   1.000 68.61436  ? 536 LYS A O   1 
ATOM 4322  C CB  . LYS A 1 536 ? 108.34086 -13.11352 28.15019   1.000 70.18949  ? 536 LYS A CB  1 
ATOM 4323  C CG  . LYS A 1 536 ? 107.31562 -12.07612 27.73042   1.000 52.27192  ? 536 LYS A CG  1 
ATOM 4324  C CD  . LYS A 1 536 ? 107.92117 -10.68217 27.79659   1.000 47.92752  ? 536 LYS A CD  1 
ATOM 4325  C CE  . LYS A 1 536 ? 106.92465 -9.61738  27.37947   1.000 45.07471  ? 536 LYS A CE  1 
ATOM 4326  N NZ  . LYS A 1 536 ? 107.52497 -8.25558  27.41587   1.000 44.76651  ? 536 LYS A NZ  1 
ATOM 4327  N N   . TRP A 1 537 ? 108.22294 -15.46082 25.97150   1.000 71.36663  ? 537 TRP A N   1 
ATOM 4328  C CA  . TRP A 1 537 ? 107.87198 -15.79111 24.58972   1.000 71.34651  ? 537 TRP A CA  1 
ATOM 4329  C C   . TRP A 1 537 ? 107.64705 -17.29379 24.43212   1.000 64.21223  ? 537 TRP A C   1 
ATOM 4330  O O   . TRP A 1 537 ? 108.36117 -17.98735 23.71383   1.000 64.65459  ? 537 TRP A O   1 
ATOM 4331  C CB  . TRP A 1 537 ? 108.95681 -15.29503 23.63922   1.000 79.37692  ? 537 TRP A CB  1 
ATOM 4332  C CG  . TRP A 1 537 ? 109.50146 -13.96233 24.01575   1.000 82.37028  ? 537 TRP A CG  1 
ATOM 4333  C CD1 . TRP A 1 537 ? 110.74473 -13.69145 24.50649   1.000 81.98077  ? 537 TRP A CD1 1 
ATOM 4334  C CD2 . TRP A 1 537 ? 108.81538 -12.70987 23.94466   1.000 72.32389  ? 537 TRP A CD2 1 
ATOM 4335  N NE1 . TRP A 1 537 ? 110.87784 -12.34449 24.73931   1.000 77.68610  ? 537 TRP A NE1 1 
ATOM 4336  C CE2 . TRP A 1 537 ? 109.70563 -11.71996 24.40303   1.000 77.27685  ? 537 TRP A CE2 1 
ATOM 4337  C CE3 . TRP A 1 537 ? 107.53435 -12.32869 23.53511   1.000 51.69343  ? 537 TRP A CE3 1 
ATOM 4338  C CZ2 . TRP A 1 537 ? 109.35599 -10.37522 24.46377   1.000 71.28179  ? 537 TRP A CZ2 1 
ATOM 4339  C CZ3 . TRP A 1 537 ? 107.19024 -10.99466 23.59553   1.000 50.27150  ? 537 TRP A CZ3 1 
ATOM 4340  C CH2 . TRP A 1 537 ? 108.09668 -10.03416 24.05525   1.000 56.80505  ? 537 TRP A CH2 1 
ATOM 4341  N N   . GLU A 1 538 ? 106.60671 -17.79406 25.09674   1.000 58.18697  ? 538 GLU A N   1 
ATOM 4342  C CA  . GLU A 1 538 ? 106.31570 -19.21982 24.99113   1.000 64.41583  ? 538 GLU A CA  1 
ATOM 4343  C C   . GLU A 1 538 ? 105.69946 -19.55725 23.63814   1.000 62.54396  ? 538 GLU A C   1 
ATOM 4344  O O   . GLU A 1 538 ? 106.11061 -20.52150 22.98218   1.000 65.93476  ? 538 GLU A O   1 
ATOM 4345  C CB  . GLU A 1 538 ? 105.39919 -19.66750 26.12927   1.000 78.97657  ? 538 GLU A CB  1 
ATOM 4346  C CG  . GLU A 1 538 ? 104.96283 -21.12278 26.02254   1.000 101.31908 ? 538 GLU A CG  1 
ATOM 4347  C CD  . GLU A 1 538 ? 106.12721 -22.09735 26.09850   1.000 120.65646 ? 538 GLU A CD  1 
ATOM 4348  O OE1 . GLU A 1 538 ? 107.17838 -21.73983 26.67257   1.000 128.11037 ? 538 GLU A OE1 1 
ATOM 4349  O OE2 . GLU A 1 538 ? 105.99267 -23.22279 25.57389   1.000 130.04342 ? 538 GLU A OE2 1 
ATOM 4350  N N   . LYS A 1 539 ? 104.71521 -18.77510 23.20150   1.000 50.47014  ? 539 LYS A N   1 
ATOM 4351  C CA  . LYS A 1 539 ? 104.05114 -18.99965 21.92478   1.000 77.81078  ? 539 LYS A CA  1 
ATOM 4352  C C   . LYS A 1 539 ? 104.72651 -18.27712 20.76165   1.000 76.83026  ? 539 LYS A C   1 
ATOM 4353  O O   . LYS A 1 539 ? 104.15027 -18.21749 19.67058   1.000 98.71614  ? 539 LYS A O   1 
ATOM 4354  C CB  . LYS A 1 539 ? 102.58593 -18.56126 22.01514   1.000 94.79726  ? 539 LYS A CB  1 
ATOM 4355  C CG  . LYS A 1 539 ? 101.76168 -19.32584 23.03758   1.000 93.37999  ? 539 LYS A CG  1 
ATOM 4356  C CD  . LYS A 1 539 ? 101.39031 -20.71106 22.53568   1.000 92.68058  ? 539 LYS A CD  1 
ATOM 4357  C CE  . LYS A 1 539 ? 100.15754 -20.66951 21.64451   1.000 89.39792  ? 539 LYS A CE  1 
ATOM 4358  N NZ  . LYS A 1 539 ? 98.94602  -20.24716 22.40080   1.000 84.54636  ? 539 LYS A NZ  1 
ATOM 4359  N N   . TYR A 1 540 ? 105.92644 -17.73710 20.96161   1.000 59.03918  ? 540 TYR A N   1 
ATOM 4360  C CA  . TYR A 1 540 ? 106.62810 -16.97447 19.93821   1.000 49.53719  ? 540 TYR A CA  1 
ATOM 4361  C C   . TYR A 1 540 ? 107.86460 -17.71536 19.44518   1.000 55.73389  ? 540 TYR A C   1 
ATOM 4362  O O   . TYR A 1 540 ? 108.54061 -18.40656 20.21339   1.000 66.19773  ? 540 TYR A O   1 
ATOM 4363  C CB  . TYR A 1 540 ? 107.02909 -15.59249 20.46226   1.000 53.41445  ? 540 TYR A CB  1 
ATOM 4364  C CG  . TYR A 1 540 ? 105.90000 -14.58660 20.45814   1.000 60.68670  ? 540 TYR A CG  1 
ATOM 4365  C CD1 . TYR A 1 540 ? 105.60871 -13.85057 19.31628   1.000 67.60856  ? 540 TYR A CD1 1 
ATOM 4366  C CD2 . TYR A 1 540 ? 105.12530 -14.37228 21.59180   1.000 59.03846  ? 540 TYR A CD2 1 
ATOM 4367  C CE1 . TYR A 1 540 ? 104.57861 -12.92914 19.30270   1.000 60.44126  ? 540 TYR A CE1 1 
ATOM 4368  C CE2 . TYR A 1 540 ? 104.09180 -13.45196 21.58781   1.000 56.83941  ? 540 TYR A CE2 1 
ATOM 4369  C CZ  . TYR A 1 540 ? 103.82360 -12.73396 20.44074   1.000 50.46807  ? 540 TYR A CZ  1 
ATOM 4370  O OH  . TYR A 1 540 ? 102.79687 -11.81824 20.43175   1.000 41.16842  ? 540 TYR A OH  1 
ATOM 4371  N N   . CYS A 1 541 ? 108.14369 -17.56661 18.15235   1.000 50.76123  ? 541 CYS A N   1 
ATOM 4372  C CA  . CYS A 1 541 ? 109.37778 -18.02185 17.52575   1.000 60.59636  ? 541 CYS A CA  1 
ATOM 4373  C C   . CYS A 1 541 ? 110.12067 -16.80300 16.99409   1.000 54.01712  ? 541 CYS A C   1 
ATOM 4374  O O   . CYS A 1 541 ? 109.52929 -15.96170 16.31202   1.000 57.25877  ? 541 CYS A O   1 
ATOM 4375  C CB  . CYS A 1 541 ? 109.08905 -19.01831 16.40091   1.000 62.29506  ? 541 CYS A CB  1 
ATOM 4376  S SG  . CYS A 1 541 ? 110.54610 -19.87080 15.76698   1.000 50.42431  ? 541 CYS A SG  1 
ATOM 4377  N N   . VAL A 1 542 ? 111.40789 -16.70238 17.30656   1.000 46.75505  ? 542 VAL A N   1 
ATOM 4378  C CA  . VAL A 1 542 ? 112.17677 -15.48254 17.08740   1.000 60.73648  ? 542 VAL A CA  1 
ATOM 4379  C C   . VAL A 1 542 ? 113.16705 -15.67760 15.94858   1.000 61.48172  ? 542 VAL A C   1 
ATOM 4380  O O   . VAL A 1 542 ? 113.84468 -16.70864 15.86912   1.000 59.66871  ? 542 VAL A O   1 
ATOM 4381  C CB  . VAL A 1 542 ? 112.90289 -15.05834 18.37492   1.000 76.69113  ? 542 VAL A CB  1 
ATOM 4382  C CG1 . VAL A 1 542 ? 113.71621 -13.79754 18.13074   1.000 68.96664  ? 542 VAL A CG1 1 
ATOM 4383  C CG2 . VAL A 1 542 ? 111.89151 -14.86789 19.49234   1.000 85.22672  ? 542 VAL A CG2 1 
ATOM 4384  N N   . LEU A 1 543 ? 113.25494 -14.67519 15.07164   1.000 68.39403  ? 543 LEU A N   1 
ATOM 4385  C CA  . LEU A 1 543 ? 114.20072 -14.66868 13.95911   1.000 72.22519  ? 543 LEU A CA  1 
ATOM 4386  C C   . LEU A 1 543 ? 115.01631 -13.38577 14.05317   1.000 66.43595  ? 543 LEU A C   1 
ATOM 4387  O O   . LEU A 1 543 ? 114.48250 -12.29908 13.81660   1.000 70.38974  ? 543 LEU A O   1 
ATOM 4388  C CB  . LEU A 1 543 ? 113.46926 -14.72256 12.61563   1.000 66.11872  ? 543 LEU A CB  1 
ATOM 4389  C CG  . LEU A 1 543 ? 112.41334 -15.79423 12.33518   1.000 58.01540  ? 543 LEU A CG  1 
ATOM 4390  C CD1 . LEU A 1 543 ? 111.70625 -15.50677 11.01738   1.000 54.43594  ? 543 LEU A CD1 1 
ATOM 4391  C CD2 . LEU A 1 543 ? 113.02319 -17.17651 12.31191   1.000 60.30072  ? 543 LEU A CD2 1 
ATOM 4392  N N   . GLU A 1 544 ? 116.30066 -13.48923 14.38541   1.000 55.61967  ? 544 GLU A N   1 
ATOM 4393  C CA  . GLU A 1 544 ? 117.16887 -12.32218 14.25739   1.000 52.95271  ? 544 GLU A CA  1 
ATOM 4394  C C   . GLU A 1 544 ? 117.30725 -11.99237 12.77769   1.000 52.10468  ? 544 GLU A C   1 
ATOM 4395  O O   . GLU A 1 544 ? 117.96397 -12.72423 12.03048   1.000 61.28922  ? 544 GLU A O   1 
ATOM 4396  C CB  . GLU A 1 544 ? 118.53019 -12.57362 14.89657   1.000 69.99457  ? 544 GLU A CB  1 
ATOM 4397  C CG  . GLU A 1 544 ? 119.53573 -11.46634 14.61438   1.000 81.88309  ? 544 GLU A CG  1 
ATOM 4398  C CD  . GLU A 1 544 ? 120.71326 -11.47688 15.56819   1.000 79.87100  ? 544 GLU A CD  1 
ATOM 4399  O OE1 . GLU A 1 544 ? 120.64329 -12.17706 16.60089   1.000 85.30566  ? 544 GLU A OE1 1 
ATOM 4400  O OE2 . GLU A 1 544 ? 121.71264 -10.78585 15.27954   1.000 70.23970  ? 544 GLU A OE2 1 
ATOM 4401  N N   . ILE A 1 545 ? 116.67956 -10.90129 12.33999   1.000 47.27137  ? 545 ILE A N   1 
ATOM 4402  C CA  . ILE A 1 545 ? 116.48865 -10.66026 10.91570   1.000 59.22078  ? 545 ILE A CA  1 
ATOM 4403  C C   . ILE A 1 545 ? 117.38056 -9.55153  10.37438   1.000 77.96943  ? 545 ILE A C   1 
ATOM 4404  O O   . ILE A 1 545 ? 117.53435 -9.44997  9.14583    1.000 82.25452  ? 545 ILE A O   1 
ATOM 4405  C CB  . ILE A 1 545 ? 115.00464 -10.36867 10.59771   1.000 64.02417  ? 545 ILE A CB  1 
ATOM 4406  C CG1 . ILE A 1 545 ? 114.73716 -10.45025 9.09181    1.000 81.26015  ? 545 ILE A CG1 1 
ATOM 4407  C CG2 . ILE A 1 545 ? 114.58416 -9.02131  11.17215   1.000 43.75590  ? 545 ILE A CG2 1 
ATOM 4408  C CD1 . ILE A 1 545 ? 115.32644 -11.69071 8.45123    1.000 87.21146  ? 545 ILE A CD1 1 
ATOM 4409  N N   . GLY A 1 546 ? 118.00194 -8.74716  11.22732   1.000 82.75655  ? 546 GLY A N   1 
ATOM 4410  C CA  . GLY A 1 546 ? 118.95786 -7.78581  10.71620   1.000 84.77700  ? 546 GLY A CA  1 
ATOM 4411  C C   . GLY A 1 546 ? 119.57477 -6.94762  11.81197   1.000 75.88039  ? 546 GLY A C   1 
ATOM 4412  O O   . GLY A 1 546 ? 119.38990 -7.19646  13.00563   1.000 81.61339  ? 546 GLY A O   1 
ATOM 4413  N N   . ASP A 1 547 ? 120.31583 -5.93912  11.36517   1.000 87.25708  ? 547 ASP A N   1 
ATOM 4414  C CA  . ASP A 1 547 ? 120.88916 -4.90483  12.20951   1.000 84.22284  ? 547 ASP A CA  1 
ATOM 4415  C C   . ASP A 1 547 ? 120.45271 -3.56949  11.63074   1.000 66.36050  ? 547 ASP A C   1 
ATOM 4416  O O   . ASP A 1 547 ? 120.42487 -3.40129  10.40739   1.000 66.29745  ? 547 ASP A O   1 
ATOM 4417  C CB  . ASP A 1 547 ? 122.41730 -4.99988  12.25387   1.000 94.97489  ? 547 ASP A CB  1 
ATOM 4418  C CG  . ASP A 1 547 ? 122.90602 -6.36353  12.71073   1.000 71.22530  ? 547 ASP A CG  1 
ATOM 4419  O OD1 . ASP A 1 547 ? 122.17333 -7.04956  13.45414   1.000 60.54453  ? 547 ASP A OD1 1 
ATOM 4420  O OD2 . ASP A 1 547 ? 124.02756 -6.75076  12.31972   1.000 61.12082  ? 547 ASP A OD2 1 
ATOM 4421  N N   . MET A 1 548 ? 120.10854 -2.62223  12.49725   1.000 63.10822  ? 548 MET A N   1 
ATOM 4422  C CA  . MET A 1 548 ? 119.58300 -1.34544  12.04224   1.000 69.19238  ? 548 MET A CA  1 
ATOM 4423  C C   . MET A 1 548 ? 120.43693 -0.18847  12.53788   1.000 82.12066  ? 548 MET A C   1 
ATOM 4424  O O   . MET A 1 548 ? 121.07810 -0.26248  13.58987   1.000 83.28594  ? 548 MET A O   1 
ATOM 4425  C CB  . MET A 1 548 ? 118.13001 -1.14043  12.49359   1.000 67.69707  ? 548 MET A CB  1 
ATOM 4426  C CG  . MET A 1 548 ? 117.93687 -0.71302  13.93570   1.000 71.06559  ? 548 MET A CG  1 
ATOM 4427  S SD  . MET A 1 548 ? 116.21356 -0.26076  14.22177   1.000 91.14628  ? 548 MET A SD  1 
ATOM 4428  C CE  . MET A 1 548 ? 116.05836 1.15840   13.13815   1.000 68.90720  ? 548 MET A CE  1 
ATOM 4429  N N   . LEU A 1 549 ? 120.42220 0.88648   11.75410   1.000 102.34151 ? 549 LEU A N   1 
ATOM 4430  C CA  . LEU A 1 549 ? 121.16170 2.10117   12.06636   1.000 123.35052 ? 549 LEU A CA  1 
ATOM 4431  C C   . LEU A 1 549 ? 120.46822 2.87236   13.18686   1.000 114.64750 ? 549 LEU A C   1 
ATOM 4432  O O   . LEU A 1 549 ? 119.31000 3.27826   13.05353   1.000 118.80178 ? 549 LEU A O   1 
ATOM 4433  C CB  . LEU A 1 549 ? 121.31008 2.95046   10.80317   1.000 137.88989 ? 549 LEU A CB  1 
ATOM 4434  C CG  . LEU A 1 549 ? 120.07703 3.22257   9.92750    1.000 113.84172 ? 549 LEU A CG  1 
ATOM 4435  C CD1 . LEU A 1 549 ? 119.39259 4.54760   10.26796   1.000 99.79721  ? 549 LEU A CD1 1 
ATOM 4436  C CD2 . LEU A 1 549 ? 120.43512 3.16355   8.44794    1.000 107.99688 ? 549 LEU A CD2 1 
ATOM 4437  N N   . LEU A 1 550 ? 121.16658 3.03392   14.30644   1.000 111.99821 ? 550 LEU A N   1 
ATOM 4438  C CA  . LEU A 1 550 ? 120.60523 3.70075   15.47474   1.000 108.75298 ? 550 LEU A CA  1 
ATOM 4439  C C   . LEU A 1 550 ? 121.38128 4.98016   15.77363   1.000 107.50837 ? 550 LEU A C   1 
ATOM 4440  O O   . LEU A 1 550 ? 122.42215 4.95203   16.42876   1.000 117.58221 ? 550 LEU A O   1 
ATOM 4441  C CB  . LEU A 1 550 ? 120.62656 2.75646   16.68385   1.000 116.12228 ? 550 LEU A CB  1 
ATOM 4442  C CG  . LEU A 1 550 ? 119.80740 3.07268   17.94256   1.000 109.02183 ? 550 LEU A CG  1 
ATOM 4443  C CD1 . LEU A 1 550 ? 120.48075 4.10023   18.84839   1.000 109.69597 ? 550 LEU A CD1 1 
ATOM 4444  C CD2 . LEU A 1 550 ? 118.40976 3.53255   17.55972   1.000 101.09431 ? 550 LEU A CD2 1 
ATOM 4445  N N   . GLN A 1 556 ? 126.19402 5.39989   17.13412   1.000 112.23812 ? 556 GLN A N   1 
ATOM 4446  C CA  . GLN A 1 556 ? 125.58505 4.46287   16.19925   1.000 132.12272 ? 556 GLN A CA  1 
ATOM 4447  C C   . GLN A 1 556 ? 125.77713 3.03991   16.71824   1.000 140.86365 ? 556 GLN A C   1 
ATOM 4448  O O   . GLN A 1 556 ? 126.71337 2.34324   16.32586   1.000 145.04490 ? 556 GLN A O   1 
ATOM 4449  C CB  . GLN A 1 556 ? 126.18404 4.62829   14.80195   1.000 136.78936 ? 556 GLN A CB  1 
ATOM 4450  C CG  . GLN A 1 556 ? 126.43494 6.07948   14.39214   1.000 124.26200 ? 556 GLN A CG  1 
ATOM 4451  C CD  . GLN A 1 556 ? 125.22537 6.98146   14.58821   1.000 112.47711 ? 556 GLN A CD  1 
ATOM 4452  O OE1 . GLN A 1 556 ? 124.31947 7.01785   13.75544   1.000 115.34306 ? 556 GLN A OE1 1 
ATOM 4453  N NE2 . GLN A 1 556 ? 125.22319 7.73807   15.68058   1.000 95.64786  ? 556 GLN A NE2 1 
ATOM 4454  N N   . MET A 1 557 ? 124.87387 2.61477   17.60657   1.000 136.84491 ? 557 MET A N   1 
ATOM 4455  C CA  . MET A 1 557 ? 125.04150 1.33038   18.28035   1.000 136.26205 ? 557 MET A CA  1 
ATOM 4456  C C   . MET A 1 557 ? 124.81285 0.14908   17.34455   1.000 106.52308 ? 557 MET A C   1 
ATOM 4457  O O   . MET A 1 557 ? 125.41299 -0.91343  17.54217   1.000 103.92568 ? 557 MET A O   1 
ATOM 4458  C CB  . MET A 1 557 ? 124.09192 1.24582   19.47492   1.000 150.96623 ? 557 MET A CB  1 
ATOM 4459  C CG  . MET A 1 557 ? 124.43728 2.19519   20.60569   1.000 171.82309 ? 557 MET A CG  1 
ATOM 4460  S SD  . MET A 1 557 ? 123.97882 3.89215   20.20829   1.000 184.52217 ? 557 MET A SD  1 
ATOM 4461  C CE  . MET A 1 557 ? 125.56020 4.71400   20.37484   1.000 191.72634 ? 557 MET A CE  1 
ATOM 4462  N N   . SER A 1 558 ? 123.96521 0.31279   16.32713   1.000 86.45906  ? 558 SER A N   1 
ATOM 4463  C CA  . SER A 1 558 ? 123.65358 -0.74534  15.36385   1.000 94.52426  ? 558 SER A CA  1 
ATOM 4464  C C   . SER A 1 558 ? 123.14551 -2.00523  16.07134   1.000 113.55504 ? 558 SER A C   1 
ATOM 4465  O O   . SER A 1 558 ? 123.75070 -3.07755  16.01015   1.000 132.67194 ? 558 SER A O   1 
ATOM 4466  C CB  . SER A 1 558 ? 124.86708 -1.05864  14.47980   1.000 77.65980  ? 558 SER A CB  1 
ATOM 4467  O OG  . SER A 1 558 ? 124.68424 -2.27317  13.77221   1.000 67.38709  ? 558 SER A OG  1 
ATOM 4468  N N   . ARG A 1 559 ? 122.01062 -1.85490  16.75273   1.000 84.43649  ? 559 ARG A N   1 
ATOM 4469  C CA  . ARG A 1 559 ? 121.48362 -2.96254  17.53190   1.000 79.73796  ? 559 ARG A CA  1 
ATOM 4470  C C   . ARG A 1 559 ? 120.74855 -3.95207  16.62768   1.000 80.29737  ? 559 ARG A C   1 
ATOM 4471  O O   . ARG A 1 559 ? 120.18894 -3.56639  15.59747   1.000 85.90940  ? 559 ARG A O   1 
ATOM 4472  C CB  . ARG A 1 559 ? 120.54835 -2.45309  18.62395   1.000 90.81957  ? 559 ARG A CB  1 
ATOM 4473  C CG  . ARG A 1 559 ? 121.24209 -1.54958  19.63614   1.000 108.80721 ? 559 ARG A CG  1 
ATOM 4474  C CD  . ARG A 1 559 ? 120.43353 -1.37172  20.91644   1.000 121.13947 ? 559 ARG A CD  1 
ATOM 4475  N NE  . ARG A 1 559 ? 120.08315 -2.64948  21.53417   1.000 127.91945 ? 559 ARG A NE  1 
ATOM 4476  C CZ  . ARG A 1 559 ? 118.85490 -3.15693  21.56577   1.000 134.39810 ? 559 ARG A CZ  1 
ATOM 4477  N NH1 . ARG A 1 559 ? 118.63292 -4.32669  22.14967   1.000 142.81194 ? 559 ARG A NH1 1 
ATOM 4478  N NH2 . ARG A 1 559 ? 117.84678 -2.49408  21.01654   1.000 129.53930 ? 559 ARG A NH2 1 
ATOM 4479  N N   . PRO A 1 560 ? 120.73762 -5.23328  16.99337   1.000 79.11649  ? 560 PRO A N   1 
ATOM 4480  C CA  . PRO A 1 560 ? 120.11504 -6.24037  16.12575   1.000 79.13030  ? 560 PRO A CA  1 
ATOM 4481  C C   . PRO A 1 560 ? 118.59775 -6.13182  16.12740   1.000 65.71838  ? 560 PRO A C   1 
ATOM 4482  O O   . PRO A 1 560 ? 117.96675 -5.95062  17.17143   1.000 64.95636  ? 560 PRO A O   1 
ATOM 4483  C CB  . PRO A 1 560 ? 120.58071 -7.57110  16.73228   1.000 74.51872  ? 560 PRO A CB  1 
ATOM 4484  C CG  . PRO A 1 560 ? 121.75260 -7.21721  17.60685   1.000 67.68214  ? 560 PRO A CG  1 
ATOM 4485  C CD  . PRO A 1 560 ? 121.45108 -5.84952  18.12286   1.000 65.78147  ? 560 PRO A CD  1 
ATOM 4486  N N   . MET A 1 561 ? 118.01835 -6.25140  14.93557   1.000 60.10974  ? 561 MET A N   1 
ATOM 4487  C CA  . MET A 1 561 ? 116.57679 -6.18163  14.73403   1.000 62.19464  ? 561 MET A CA  1 
ATOM 4488  C C   . MET A 1 561 ? 116.00005 -7.58800  14.63182   1.000 66.23450  ? 561 MET A C   1 
ATOM 4489  O O   . MET A 1 561 ? 116.47186 -8.40047  13.82850   1.000 74.02285  ? 561 MET A O   1 
ATOM 4490  C CB  . MET A 1 561 ? 116.25582 -5.37995  13.47198   1.000 56.51263  ? 561 MET A CB  1 
ATOM 4491  C CG  . MET A 1 561 ? 114.77760 -5.15043  13.22356   1.000 48.94711  ? 561 MET A CG  1 
ATOM 4492  S SD  . MET A 1 561 ? 114.50938 -4.26685  11.67510   1.000 49.34502  ? 561 MET A SD  1 
ATOM 4493  C CE  . MET A 1 561 ? 114.94640 -5.52410  10.47737   1.000 64.42255  ? 561 MET A CE  1 
ATOM 4494  N N   . PHE A 1 562 ? 115.01332 -7.88756  15.47470   1.000 49.72382  ? 562 PHE A N   1 
ATOM 4495  C CA  . PHE A 1 562 ? 114.42850 -9.21714  15.55764   1.000 49.48058  ? 562 PHE A CA  1 
ATOM 4496  C C   . PHE A 1 562 ? 113.00265 -9.21526  15.01958   1.000 47.98193  ? 562 PHE A C   1 
ATOM 4497  O O   . PHE A 1 562 ? 112.34546 -8.17559  14.92511   1.000 47.04295  ? 562 PHE A O   1 
ATOM 4498  C CB  . PHE A 1 562 ? 114.43462 -9.74366  16.99882   1.000 49.90417  ? 562 PHE A CB  1 
ATOM 4499  C CG  . PHE A 1 562 ? 115.79908 -10.12493 17.51013   1.000 51.63105  ? 562 PHE A CG  1 
ATOM 4500  C CD1 . PHE A 1 562 ? 116.94977 -9.65167  16.90544   1.000 59.72263  ? 562 PHE A CD1 1 
ATOM 4501  C CD2 . PHE A 1 562 ? 115.92766 -10.97507 18.59015   1.000 54.81027  ? 562 PHE A CD2 1 
ATOM 4502  C CE1 . PHE A 1 562 ? 118.19486 -10.00330 17.37700   1.000 69.36744  ? 562 PHE A CE1 1 
ATOM 4503  C CE2 . PHE A 1 562 ? 117.17551 -11.33538 19.06261   1.000 74.29662  ? 562 PHE A CE2 1 
ATOM 4504  C CZ  . PHE A 1 562 ? 118.30927 -10.84932 18.45248   1.000 75.89400  ? 562 PHE A CZ  1 
ATOM 4505  N N   . LEU A 1 563 ? 112.52963 -10.41059 14.67436   1.000 47.23276  ? 563 LEU A N   1 
ATOM 4506  C CA  . LEU A 1 563 ? 111.17756 -10.62795 14.17320   1.000 46.06890  ? 563 LEU A CA  1 
ATOM 4507  C C   . LEU A 1 563 ? 110.52322 -11.70533 15.02632   1.000 46.02181  ? 563 LEU A C   1 
ATOM 4508  O O   . LEU A 1 563 ? 110.94719 -12.86668 14.99439   1.000 46.94043  ? 563 LEU A O   1 
ATOM 4509  C CB  . LEU A 1 563 ? 111.19623 -11.03930 12.70286   1.000 46.23833  ? 563 LEU A CB  1 
ATOM 4510  C CG  . LEU A 1 563 ? 109.82897 -11.30665 12.07721   1.000 45.27036  ? 563 LEU A CG  1 
ATOM 4511  C CD1 . LEU A 1 563 ? 109.05165 -10.01045 11.91854   1.000 44.15211  ? 563 LEU A CD1 1 
ATOM 4512  C CD2 . LEU A 1 563 ? 109.98594 -12.01760 10.74888   1.000 47.33031  ? 563 LEU A CD2 1 
ATOM 4513  N N   . TYR A 1 564 ? 109.52299 -11.31735 15.81214   1.000 52.59456  ? 564 TYR A N   1 
ATOM 4514  C CA  . TYR A 1 564 ? 108.75836 -12.26066 16.61753   1.000 51.99477  ? 564 TYR A CA  1 
ATOM 4515  C C   . TYR A 1 564 ? 107.57245 -12.75031 15.79443   1.000 45.78568  ? 564 TYR A C   1 
ATOM 4516  O O   . TYR A 1 564 ? 106.71339 -11.95269 15.40524   1.000 38.49457  ? 564 TYR A O   1 
ATOM 4517  C CB  . TYR A 1 564 ? 108.28486 -11.61238 17.91924   1.000 44.40054  ? 564 TYR A CB  1 
ATOM 4518  C CG  . TYR A 1 564 ? 109.38393 -11.36607 18.93463   1.000 69.36553  ? 564 TYR A CG  1 
ATOM 4519  C CD1 . TYR A 1 564 ? 110.71273 -11.63453 18.63404   1.000 79.08250  ? 564 TYR A CD1 1 
ATOM 4520  C CD2 . TYR A 1 564 ? 109.08841 -10.87754 20.20071   1.000 88.32053  ? 564 TYR A CD2 1 
ATOM 4521  C CE1 . TYR A 1 564 ? 111.71569 -11.40923 19.55885   1.000 80.15200  ? 564 TYR A CE1 1 
ATOM 4522  C CE2 . TYR A 1 564 ? 110.08605 -10.65482 21.13259   1.000 90.86461  ? 564 TYR A CE2 1 
ATOM 4523  C CZ  . TYR A 1 564 ? 111.39738 -10.92448 20.80643   1.000 80.09200  ? 564 TYR A CZ  1 
ATOM 4524  O OH  . TYR A 1 564 ? 112.39427 -10.70492 21.72971   1.000 73.62727  ? 564 TYR A OH  1 
ATOM 4525  N N   . VAL A 1 565 ? 107.53621 -14.05065 15.51347   1.000 40.16048  ? 565 VAL A N   1 
ATOM 4526  C CA  . VAL A 1 565 ? 106.51123 -14.66379 14.68096   1.000 39.83139  ? 565 VAL A CA  1 
ATOM 4527  C C   . VAL A 1 565 ? 105.72787 -15.63997 15.54079   1.000 40.00457  ? 565 VAL A C   1 
ATOM 4528  O O   . VAL A 1 565 ? 106.31883 -16.49675 16.20612   1.000 40.99550  ? 565 VAL A O   1 
ATOM 4529  C CB  . VAL A 1 565 ? 107.12469 -15.38932 13.47029   1.000 40.71230  ? 565 VAL A CB  1 
ATOM 4530  C CG1 . VAL A 1 565 ? 106.03403 -15.98381 12.59762   1.000 40.51183  ? 565 VAL A CG1 1 
ATOM 4531  C CG2 . VAL A 1 565 ? 108.00348 -14.44286 12.67398   1.000 40.73211  ? 565 VAL A CG2 1 
ATOM 4532  N N   . ARG A 1 566 ? 104.40503 -15.52070 15.52003   1.000 52.36202  ? 566 ARG A N   1 
ATOM 4533  C CA  . ARG A 1 566 ? 103.56459 -16.45079 16.25727   1.000 60.03442  ? 566 ARG A CA  1 
ATOM 4534  C C   . ARG A 1 566 ? 102.32663 -16.78240 15.44036   1.000 52.09158  ? 566 ARG A C   1 
ATOM 4535  O O   . ARG A 1 566 ? 101.84587 -15.97251 14.64190   1.000 61.32045  ? 566 ARG A O   1 
ATOM 4536  C CB  . ARG A 1 566 ? 103.15235 -15.90687 17.63370   1.000 52.44298  ? 566 ARG A CB  1 
ATOM 4537  C CG  . ARG A 1 566 ? 102.05514 -14.85857 17.61217   1.000 65.49206  ? 566 ARG A CG  1 
ATOM 4538  C CD  . ARG A 1 566 ? 101.37150 -14.77600 18.96971   1.000 64.18707  ? 566 ARG A CD  1 
ATOM 4539  N NE  . ARG A 1 566 ? 100.68918 -16.02404 19.30563   1.000 54.32887  ? 566 ARG A NE  1 
ATOM 4540  C CZ  . ARG A 1 566 ? 100.00817 -16.22929 20.42882   1.000 60.46247  ? 566 ARG A CZ  1 
ATOM 4541  N NH1 . ARG A 1 566 ? 99.42050  -17.39798 20.64357   1.000 61.28053  ? 566 ARG A NH1 1 
ATOM 4542  N NH2 . ARG A 1 566 ? 99.91545  -15.26908 21.33898   1.000 67.78698  ? 566 ARG A NH2 1 
ATOM 4543  N N   . THR A 1 567 ? 101.81815 -17.99077 15.65115   1.000 41.07536  ? 567 THR A N   1 
ATOM 4544  C CA  . THR A 1 567 ? 100.57113 -18.43781 15.05223   1.000 41.00806  ? 567 THR A CA  1 
ATOM 4545  C C   . THR A 1 567 ? 99.45580  -18.28778 16.07617   1.000 53.33420  ? 567 THR A C   1 
ATOM 4546  O O   . THR A 1 567 ? 99.59772  -18.72760 17.22225   1.000 73.70874  ? 567 THR A O   1 
ATOM 4547  C CB  . THR A 1 567 ? 100.67917 -19.89355 14.59788   1.000 42.35723  ? 567 THR A CB  1 
ATOM 4548  O OG1 . THR A 1 567 ? 100.87605 -20.73454 15.74134   1.000 71.10533  ? 567 THR A OG1 1 
ATOM 4549  C CG2 . THR A 1 567 ? 101.86481 -20.06159 13.66418   1.000 43.00831  ? 567 THR A CG2 1 
ATOM 4550  N N   . ASN A 1 568 ? 98.35467  -17.66161 15.66915   1.000 44.13011  ? 568 ASN A N   1 
ATOM 4551  C CA  . ASN A 1 568 ? 97.24287  -17.42659 16.57699   1.000 47.62003  ? 568 ASN A CA  1 
ATOM 4552  C C   . ASN A 1 568 ? 95.94741  -17.51569 15.78067   1.000 55.46189  ? 568 ASN A C   1 
ATOM 4553  O O   . ASN A 1 568 ? 95.95276  -17.77501 14.57483   1.000 66.27625  ? 568 ASN A O   1 
ATOM 4554  C CB  . ASN A 1 568 ? 97.39522  -16.07647 17.28760   1.000 51.92307  ? 568 ASN A CB  1 
ATOM 4555  C CG  . ASN A 1 568 ? 96.68955  -16.03969 18.62992   1.000 66.14633  ? 568 ASN A CG  1 
ATOM 4556  O OD1 . ASN A 1 568 ? 95.83304  -16.87540 18.91772   1.000 77.33176  ? 568 ASN A OD1 1 
ATOM 4557  N ND2 . ASN A 1 568 ? 97.05533  -15.07274 19.46386   1.000 65.81559  ? 568 ASN A ND2 1 
ATOM 4558  N N   . GLY A 1 569 ? 94.82937  -17.30474 16.46618   1.000 56.11824  ? 569 GLY A N   1 
ATOM 4559  C CA  . GLY A 1 569 ? 93.53808  -17.32073 15.80980   1.000 54.79292  ? 569 GLY A CA  1 
ATOM 4560  C C   . GLY A 1 569 ? 92.60411  -16.27524 16.37743   1.000 53.79934  ? 569 GLY A C   1 
ATOM 4561  O O   . GLY A 1 569 ? 92.62190  -16.01503 17.58422   1.000 55.79116  ? 569 GLY A O   1 
ATOM 4562  N N   . THR A 1 570 ? 91.78552  -15.66229 15.52542   1.000 52.56952  ? 570 THR A N   1 
ATOM 4563  C CA  . THR A 1 570 ? 90.87509  -14.62191 15.97997   1.000 48.08059  ? 570 THR A CA  1 
ATOM 4564  C C   . THR A 1 570 ? 89.51810  -14.81553 15.32105   1.000 48.40658  ? 570 THR A C   1 
ATOM 4565  O O   . THR A 1 570 ? 89.40467  -15.39864 14.24333   1.000 44.53038  ? 570 THR A O   1 
ATOM 4566  C CB  . THR A 1 570 ? 91.42141  -13.21527 15.68562   1.000 41.79226  ? 570 THR A CB  1 
ATOM 4567  O OG1 . THR A 1 570 ? 90.62084  -12.23795 16.36206   1.000 43.66531  ? 570 THR A OG1 1 
ATOM 4568  C CG2 . THR A 1 570 ? 91.41145  -12.92873 14.18966   1.000 45.24688  ? 570 THR A CG2 1 
ATOM 4569  N N   . SER A 1 571 ? 88.48458  -14.31260 15.97958   1.000 59.10261  ? 571 SER A N   1 
ATOM 4570  C CA  . SER A 1 571 ? 87.12247  -14.41033 15.48120   1.000 51.05426  ? 571 SER A CA  1 
ATOM 4571  C C   . SER A 1 571 ? 86.59825  -13.02298 15.12790   1.000 52.03737  ? 571 SER A C   1 
ATOM 4572  O O   . SER A 1 571 ? 87.28054  -12.00857 15.29596   1.000 55.49713  ? 571 SER A O   1 
ATOM 4573  C CB  . SER A 1 571 ? 86.22166  -15.09827 16.50922   1.000 61.45753  ? 571 SER A CB  1 
ATOM 4574  O OG  . SER A 1 571 ? 86.13649  -14.33764 17.70084   1.000 54.99005  ? 571 SER A OG  1 
ATOM 4575  N N   . LYS A 1 572 ? 85.36488  -12.99153 14.62013   1.000 53.98677  ? 572 LYS A N   1 
ATOM 4576  C CA  . LYS A 1 572 ? 84.74778  -11.72194 14.25149   1.000 68.73827  ? 572 LYS A CA  1 
ATOM 4577  C C   . LYS A 1 572 ? 84.51501  -10.84886 15.47867   1.000 60.91010  ? 572 LYS A C   1 
ATOM 4578  O O   . LYS A 1 572 ? 84.80308  -9.64522  15.45772   1.000 46.90784  ? 572 LYS A O   1 
ATOM 4579  C CB  . LYS A 1 572 ? 83.43671  -11.98031 13.50802   1.000 94.33486  ? 572 LYS A CB  1 
ATOM 4580  C CG  . LYS A 1 572 ? 83.00425  -10.85612 12.57880   1.000 104.03008 ? 572 LYS A CG  1 
ATOM 4581  C CD  . LYS A 1 572 ? 81.85915  -11.30136 11.67989   1.000 118.08836 ? 572 LYS A CD  1 
ATOM 4582  C CE  . LYS A 1 572 ? 81.47037  -10.22072 10.68336   1.000 124.10514 ? 572 LYS A CE  1 
ATOM 4583  N NZ  . LYS A 1 572 ? 80.36464  -10.67679 9.79472    1.000 124.05669 ? 572 LYS A NZ  1 
ATOM 4584  N N   . ILE A 1 573 ? 83.99823  -11.43990 16.55805   1.000 70.17114  ? 573 ILE A N   1 
ATOM 4585  C CA  . ILE A 1 573 ? 83.76323  -10.68200 17.78197   1.000 67.73614  ? 573 ILE A CA  1 
ATOM 4586  C C   . ILE A 1 573 ? 85.08595  -10.25276 18.40630   1.000 77.65540  ? 573 ILE A C   1 
ATOM 4587  O O   . ILE A 1 573 ? 85.20856  -9.13771  18.92808   1.000 111.68998 ? 573 ILE A O   1 
ATOM 4588  C CB  . ILE A 1 573 ? 82.90536  -11.50630 18.76041   1.000 52.04281  ? 573 ILE A CB  1 
ATOM 4589  C CG1 . ILE A 1 573 ? 82.87736  -10.85306 20.14423   1.000 43.84852  ? 573 ILE A CG1 1 
ATOM 4590  C CG2 . ILE A 1 573 ? 83.41280  -12.93784 18.84564   1.000 60.83096  ? 573 ILE A CG2 1 
ATOM 4591  C CD1 . ILE A 1 573 ? 82.19009  -9.50383  20.16737   1.000 43.87661  ? 573 ILE A CD1 1 
ATOM 4592  N N   . LYS A 1 574 ? 86.09838  -11.12252 18.35640   1.000 46.13841  ? 574 LYS A N   1 
ATOM 4593  C CA  . LYS A 1 574 ? 87.41868  -10.74469 18.84976   1.000 64.26512  ? 574 LYS A CA  1 
ATOM 4594  C C   . LYS A 1 574 ? 87.97478  -9.55317  18.08041   1.000 51.43976  ? 574 LYS A C   1 
ATOM 4595  O O   . LYS A 1 574 ? 88.65194  -8.69380  18.65655   1.000 48.49342  ? 574 LYS A O   1 
ATOM 4596  C CB  . LYS A 1 574 ? 88.37626  -11.93320 18.75916   1.000 92.69522  ? 574 LYS A CB  1 
ATOM 4597  C CG  . LYS A 1 574 ? 88.23441  -12.94492 19.88511   1.000 83.22998  ? 574 LYS A CG  1 
ATOM 4598  C CD  . LYS A 1 574 ? 89.33478  -13.99445 19.81977   1.000 72.98575  ? 574 LYS A CD  1 
ATOM 4599  C CE  . LYS A 1 574 ? 89.33134  -14.88332 21.05478   1.000 81.21766  ? 574 LYS A CE  1 
ATOM 4600  N NZ  . LYS A 1 574 ? 89.76602  -14.14798 22.27757   1.000 91.35270  ? 574 LYS A NZ  1 
ATOM 4601  N N   . MET A 1 575 ? 87.69838  -9.48270  16.77678   1.000 56.17148  ? 575 MET A N   1 
ATOM 4602  C CA  . MET A 1 575 ? 88.18446  -8.36145  15.97928   1.000 52.35642  ? 575 MET A CA  1 
ATOM 4603  C C   . MET A 1 575 ? 87.41192  -7.08470  16.28991   1.000 58.92652  ? 575 MET A C   1 
ATOM 4604  O O   . MET A 1 575 ? 88.00774  -6.01490  16.46215   1.000 57.77428  ? 575 MET A O   1 
ATOM 4605  C CB  . MET A 1 575 ? 88.09589  -8.69289  14.48824   1.000 56.88630  ? 575 MET A CB  1 
ATOM 4606  C CG  . MET A 1 575 ? 89.14815  -9.67495  13.99569   1.000 50.26042  ? 575 MET A CG  1 
ATOM 4607  S SD  . MET A 1 575 ? 89.04465  -9.97721  12.21902   1.000 50.70452  ? 575 MET A SD  1 
ATOM 4608  C CE  . MET A 1 575 ? 87.61353  -11.04920 12.12960   1.000 51.02473  ? 575 MET A CE  1 
ATOM 4609  N N   . LYS A 1 576 ? 86.08109  -7.17553  16.36794   1.000 54.03329  ? 576 LYS A N   1 
ATOM 4610  C CA  . LYS A 1 576 ? 85.28332  -5.97455  16.60230   1.000 60.05822  ? 576 LYS A CA  1 
ATOM 4611  C C   . LYS A 1 576 ? 85.49975  -5.40878  18.00293   1.000 57.79866  ? 576 LYS A C   1 
ATOM 4612  O O   . LYS A 1 576 ? 85.45393  -4.18663  18.18497   1.000 41.36468  ? 576 LYS A O   1 
ATOM 4613  C CB  . LYS A 1 576 ? 83.80350  -6.26332  16.34397   1.000 77.96520  ? 576 LYS A CB  1 
ATOM 4614  C CG  . LYS A 1 576 ? 83.14935  -7.22764  17.31280   1.000 115.12922 ? 576 LYS A CG  1 
ATOM 4615  C CD  . LYS A 1 576 ? 81.67596  -7.39665  16.98203   1.000 135.56236 ? 576 LYS A CD  1 
ATOM 4616  C CE  . LYS A 1 576 ? 81.49940  -8.05163  15.61963   1.000 138.11453 ? 576 LYS A CE  1 
ATOM 4617  N NZ  . LYS A 1 576 ? 80.18672  -8.74241  15.48984   1.000 137.72009 ? 576 LYS A NZ  1 
ATOM 4618  N N   . TRP A 1 577 ? 85.73561  -6.26284  18.99922   1.000 68.44949  ? 577 TRP A N   1 
ATOM 4619  C CA  . TRP A 1 577 ? 86.15724  -5.79222  20.31918   1.000 81.17618  ? 577 TRP A CA  1 
ATOM 4620  C C   . TRP A 1 577 ? 87.64753  -5.49801  20.23359   1.000 57.29609  ? 577 TRP A C   1 
ATOM 4621  O O   . TRP A 1 577 ? 88.49630  -6.32941  20.56098   1.000 69.19713  ? 577 TRP A O   1 
ATOM 4622  C CB  . TRP A 1 577 ? 85.83870  -6.80770  21.40959   1.000 103.34221 ? 577 TRP A CB  1 
ATOM 4623  C CG  . TRP A 1 577 ? 86.28763  -6.37533  22.79299   1.000 90.49118  ? 577 TRP A CG  1 
ATOM 4624  C CD1 . TRP A 1 577 ? 87.00995  -7.11551  23.68358   1.000 41.87569  ? 577 TRP A CD1 1 
ATOM 4625  C CD2 . TRP A 1 577 ? 86.04488  -5.10837  23.43262   1.000 110.50944 ? 577 TRP A CD2 1 
ATOM 4626  N NE1 . TRP A 1 577 ? 87.22984  -6.39500  24.83285   1.000 50.14552  ? 577 TRP A NE1 1 
ATOM 4627  C CE2 . TRP A 1 577 ? 86.64865  -5.16095  24.70486   1.000 73.15383  ? 577 TRP A CE2 1 
ATOM 4628  C CE3 . TRP A 1 577 ? 85.37467  -3.93873  23.05425   1.000 118.93418 ? 577 TRP A CE3 1 
ATOM 4629  C CZ2 . TRP A 1 577 ? 86.60358  -4.09001  25.59937   1.000 49.27589  ? 577 TRP A CZ2 1 
ATOM 4630  C CZ3 . TRP A 1 577 ? 85.33288  -2.87659  23.94417   1.000 72.11176  ? 577 TRP A CZ3 1 
ATOM 4631  C CH2 . TRP A 1 577 ? 85.94301  -2.96035  25.20068   1.000 38.28898  ? 577 TRP A CH2 1 
ATOM 4632  N N   . GLY A 1 578 ? 87.96267  -4.28676  19.78774   1.000 58.75471  ? 578 GLY A N   1 
ATOM 4633  C CA  . GLY A 1 578 ? 89.31453  -3.91853  19.42425   1.000 64.46986  ? 578 GLY A CA  1 
ATOM 4634  C C   . GLY A 1 578 ? 89.31990  -2.95120  18.25966   1.000 47.90220  ? 578 GLY A C   1 
ATOM 4635  O O   . GLY A 1 578 ? 90.29274  -2.22114  18.04736   1.000 55.48788  ? 578 GLY A O   1 
ATOM 4636  N N   . MET A 1 579 ? 88.22949  -2.94094  17.49183   1.000 40.80010  ? 579 MET A N   1 
ATOM 4637  C CA  . MET A 1 579 ? 87.97271  -1.82800  16.58715   1.000 41.70382  ? 579 MET A CA  1 
ATOM 4638  C C   . MET A 1 579 ? 87.31744  -0.66307  17.31424   1.000 50.73207  ? 579 MET A C   1 
ATOM 4639  O O   . MET A 1 579 ? 87.44179  0.48684   16.87806   1.000 59.28583  ? 579 MET A O   1 
ATOM 4640  C CB  . MET A 1 579 ? 87.09567  -2.28565  15.42128   1.000 42.06317  ? 579 MET A CB  1 
ATOM 4641  C CG  . MET A 1 579 ? 87.80502  -3.20503  14.44243   1.000 54.23067  ? 579 MET A CG  1 
ATOM 4642  S SD  . MET A 1 579 ? 86.75725  -3.71199  13.06717   1.000 56.47303  ? 579 MET A SD  1 
ATOM 4643  C CE  . MET A 1 579 ? 86.32829  -2.11733  12.37223   1.000 59.51566  ? 579 MET A CE  1 
ATOM 4644  N N   . GLU A 1 580 ? 86.62479  -0.94461  18.41599   1.000 60.75860  ? 580 GLU A N   1 
ATOM 4645  C CA  . GLU A 1 580 ? 86.01562  0.06392   19.27963   1.000 71.08157  ? 580 GLU A CA  1 
ATOM 4646  C C   . GLU A 1 580 ? 86.82468  0.26414   20.55497   1.000 46.73257  ? 580 GLU A C   1 
ATOM 4647  O O   . GLU A 1 580 ? 86.26183  0.45846   21.63561   1.000 54.93680  ? 580 GLU A O   1 
ATOM 4648  C CB  . GLU A 1 580 ? 84.57520  -0.32102  19.60592   1.000 106.32665 ? 580 GLU A CB  1 
ATOM 4649  C CG  . GLU A 1 580 ? 83.66965  -0.37595  18.38768   1.000 140.08234 ? 580 GLU A CG  1 
ATOM 4650  C CD  . GLU A 1 580 ? 82.26664  -0.85165  18.71253   1.000 163.82372 ? 580 GLU A CD  1 
ATOM 4651  O OE1 . GLU A 1 580 ? 82.02849  -1.28841  19.85845   1.000 170.32912 ? 580 GLU A OE1 1 
ATOM 4652  O OE2 . GLU A 1 580 ? 81.39927  -0.78759  17.81639   1.000 170.95092 ? 580 GLU A OE2 1 
ATOM 4653  N N   . MET A 1 581 ? 88.15671  0.21477   20.45277   1.000 48.65057  ? 581 MET A N   1 
ATOM 4654  C CA  . MET A 1 581 ? 89.01252  0.38587   21.62248   1.000 50.14168  ? 581 MET A CA  1 
ATOM 4655  C C   . MET A 1 581 ? 89.05152  1.82006   22.12886   1.000 59.50385  ? 581 MET A C   1 
ATOM 4656  O O   . MET A 1 581 ? 89.46073  2.04471   23.27351   1.000 65.47077  ? 581 MET A O   1 
ATOM 4657  C CB  . MET A 1 581 ? 90.43743  -0.07305  21.31394   1.000 41.99012  ? 581 MET A CB  1 
ATOM 4658  C CG  . MET A 1 581 ? 90.68240  -1.54353  21.56353   1.000 41.43254  ? 581 MET A CG  1 
ATOM 4659  S SD  . MET A 1 581 ? 92.40238  -2.01107  21.31104   1.000 41.42843  ? 581 MET A SD  1 
ATOM 4660  C CE  . MET A 1 581 ? 92.32118  -3.76371  21.67220   1.000 45.97322  ? 581 MET A CE  1 
ATOM 4661  N N   . ARG A 1 582 ? 88.64595  2.79525   21.31499   1.000 52.13868  ? 582 ARG A N   1 
ATOM 4662  C CA  . ARG A 1 582 ? 88.60808  4.16930   21.79854   1.000 49.52335  ? 582 ARG A CA  1 
ATOM 4663  C C   . ARG A 1 582 ? 87.57276  4.37389   22.89834   1.000 42.81591  ? 582 ARG A C   1 
ATOM 4664  O O   . ARG A 1 582 ? 87.58997  5.42482   23.54864   1.000 44.69702  ? 582 ARG A O   1 
ATOM 4665  C CB  . ARG A 1 582 ? 88.36217  5.13335   20.63650   1.000 46.46455  ? 582 ARG A CB  1 
ATOM 4666  C CG  . ARG A 1 582 ? 87.20454  4.76010   19.73805   1.000 56.96854  ? 582 ARG A CG  1 
ATOM 4667  C CD  . ARG A 1 582 ? 87.33854  5.43175   18.38017   1.000 64.35646  ? 582 ARG A CD  1 
ATOM 4668  N NE  . ARG A 1 582 ? 88.32664  4.77364   17.53114   1.000 67.57204  ? 582 ARG A NE  1 
ATOM 4669  C CZ  . ARG A 1 582 ? 88.75624  5.26381   16.37314   1.000 71.99440  ? 582 ARG A CZ  1 
ATOM 4670  N NH1 . ARG A 1 582 ? 89.65697  4.60198   15.66145   1.000 66.20421  ? 582 ARG A NH1 1 
ATOM 4671  N NH2 . ARG A 1 582 ? 88.28143  6.41676   15.92405   1.000 92.94736  ? 582 ARG A NH2 1 
ATOM 4672  N N   . ARG A 1 583 ? 86.67904  3.40299   23.11812   1.000 39.51290  ? 583 ARG A N   1 
ATOM 4673  C CA  . ARG A 1 583 ? 85.85138  3.40931   24.32042   1.000 41.93950  ? 583 ARG A CA  1 
ATOM 4674  C C   . ARG A 1 583 ? 86.69917  3.51628   25.57880   1.000 48.02615  ? 583 ARG A C   1 
ATOM 4675  O O   . ARG A 1 583 ? 86.27511  4.13557   26.56291   1.000 47.85674  ? 583 ARG A O   1 
ATOM 4676  C CB  . ARG A 1 583 ? 84.98653  2.14893   24.37869   1.000 60.08986  ? 583 ARG A CB  1 
ATOM 4677  C CG  . ARG A 1 583 ? 83.93614  2.05417   23.28910   1.000 70.71613  ? 583 ARG A CG  1 
ATOM 4678  C CD  . ARG A 1 583 ? 83.13605  0.76915   23.41895   1.000 74.46337  ? 583 ARG A CD  1 
ATOM 4679  N NE  . ARG A 1 583 ? 82.03953  0.70637   22.45909   1.000 91.75875  ? 583 ARG A NE  1 
ATOM 4680  C CZ  . ARG A 1 583 ? 80.83948  1.23653   22.66868   1.000 90.20461  ? 583 ARG A CZ  1 
ATOM 4681  N NH1 . ARG A 1 583 ? 80.58290  1.86738   23.80774   1.000 53.90525  ? 583 ARG A NH1 1 
ATOM 4682  N NH2 . ARG A 1 583 ? 79.89584  1.13611   21.74301   1.000 109.73706 ? 583 ARG A NH2 1 
ATOM 4683  N N   . CYS A 1 584 ? 87.89746  2.92033   25.56419   1.000 43.95280  ? 584 CYS A N   1 
ATOM 4684  C CA  . CYS A 1 584 ? 88.80601  3.01919   26.70248   1.000 54.36315  ? 584 CYS A CA  1 
ATOM 4685  C C   . CYS A 1 584 ? 89.07619  4.46857   27.08046   1.000 70.92446  ? 584 CYS A C   1 
ATOM 4686  O O   . CYS A 1 584 ? 89.38582  4.76275   28.24084   1.000 78.81230  ? 584 CYS A O   1 
ATOM 4687  C CB  . CYS A 1 584 ? 90.12006  2.30262   26.38543   1.000 34.54522  ? 584 CYS A CB  1 
ATOM 4688  S SG  . CYS A 1 584 ? 89.95050  0.53502   26.04681   1.000 51.03888  ? 584 CYS A SG  1 
ATOM 4689  N N   . LEU A 1 585 ? 88.96741  5.38611   26.11841   1.000 63.21896  ? 585 LEU A N   1 
ATOM 4690  C CA  . LEU A 1 585 ? 89.02619  6.80639   26.44159   1.000 47.43783  ? 585 LEU A CA  1 
ATOM 4691  C C   . LEU A 1 585 ? 87.81144  7.22111   27.26327   1.000 40.30817  ? 585 LEU A C   1 
ATOM 4692  O O   . LEU A 1 585 ? 87.94413  7.67311   28.40778   1.000 44.49957  ? 585 LEU A O   1 
ATOM 4693  C CB  . LEU A 1 585 ? 89.11821  7.63417   25.15734   1.000 48.33239  ? 585 LEU A CB  1 
ATOM 4694  C CG  . LEU A 1 585 ? 90.31463  7.40122   24.23375   1.000 41.91663  ? 585 LEU A CG  1 
ATOM 4695  C CD1 . LEU A 1 585 ? 90.11044  8.12558   22.91367   1.000 33.94344  ? 585 LEU A CD1 1 
ATOM 4696  C CD2 . LEU A 1 585 ? 91.59765  7.86563   24.89879   1.000 45.94524  ? 585 LEU A CD2 1 
ATOM 4697  N N   . LEU A 1 586 ? 86.61139  7.03079   26.70229   1.000 39.32574  ? 586 LEU A N   1 
ATOM 4698  C CA  . LEU A 1 586 ? 85.38460  7.47112   27.36142   1.000 42.52962  ? 586 LEU A CA  1 
ATOM 4699  C C   . LEU A 1 586 ? 85.27195  6.90556   28.76909   1.000 53.84293  ? 586 LEU A C   1 
ATOM 4700  O O   . LEU A 1 586 ? 85.04125  7.64909   29.73094   1.000 84.56699  ? 586 LEU A O   1 
ATOM 4701  C CB  . LEU A 1 586 ? 84.16967  7.05619   26.52952   1.000 40.70066  ? 586 LEU A CB  1 
ATOM 4702  C CG  . LEU A 1 586 ? 83.88445  7.81908   25.23694   1.000 40.69447  ? 586 LEU A CG  1 
ATOM 4703  C CD1 . LEU A 1 586 ? 82.80591  7.11726   24.42862   1.000 37.36238  ? 586 LEU A CD1 1 
ATOM 4704  C CD2 . LEU A 1 586 ? 83.45998  9.23848   25.55903   1.000 46.91815  ? 586 LEU A CD2 1 
ATOM 4705  N N   . GLN A 1 587 ? 85.44670  5.58757   28.90755   1.000 34.35177  ? 587 GLN A N   1 
ATOM 4706  C CA  . GLN A 1 587 ? 85.42682  4.96851   30.22802   1.000 53.67203  ? 587 GLN A CA  1 
ATOM 4707  C C   . GLN A 1 587 ? 86.34137  5.71689   31.18761   1.000 76.00593  ? 587 GLN A C   1 
ATOM 4708  O O   . GLN A 1 587 ? 85.90351  6.17526   32.25066   1.000 104.77476 ? 587 GLN A O   1 
ATOM 4709  C CB  . GLN A 1 587 ? 85.83423  3.49800   30.12488   1.000 55.89511  ? 587 GLN A CB  1 
ATOM 4710  C CG  . GLN A 1 587 ? 85.24564  2.61778   31.21511   1.000 76.51275  ? 587 GLN A CG  1 
ATOM 4711  C CD  . GLN A 1 587 ? 85.83295  1.22085   31.21864   1.000 96.89089  ? 587 GLN A CD  1 
ATOM 4712  O OE1 . GLN A 1 587 ? 86.72321  0.90681   30.42839   1.000 104.81914 ? 587 GLN A OE1 1 
ATOM 4713  N NE2 . GLN A 1 587 ? 85.33387  0.37183   32.10970   1.000 105.87316 ? 587 GLN A NE2 1 
ATOM 4714  N N   . SER A 1 588 ? 87.59000  5.95485   30.77273   1.000 62.54706  ? 588 SER A N   1 
ATOM 4715  C CA  . SER A 1 588 ? 88.51137  6.68001   31.63940   1.000 48.94986  ? 588 SER A CA  1 
ATOM 4716  C C   . SER A 1 588 ? 87.90490  8.01376   32.03720   1.000 70.15552  ? 588 SER A C   1 
ATOM 4717  O O   . SER A 1 588 ? 87.79571  8.33257   33.22877   1.000 76.31603  ? 588 SER A O   1 
ATOM 4718  C CB  . SER A 1 588 ? 89.85642  6.87494   30.93975   1.000 40.26491  ? 588 SER A CB  1 
ATOM 4719  O OG  . SER A 1 588 ? 90.41227  5.63028   30.55678   1.000 39.55133  ? 588 SER A OG  1 
ATOM 4720  N N   . LEU A 1 589 ? 87.41390  8.76190   31.04939   1.000 82.24385  ? 589 LEU A N   1 
ATOM 4721  C CA  . LEU A 1 589 ? 86.83302  10.06483  31.33285   1.000 68.84020  ? 589 LEU A CA  1 
ATOM 4722  C C   . LEU A 1 589 ? 85.73055  9.93785   32.37587   1.000 67.02800  ? 589 LEU A C   1 
ATOM 4723  O O   . LEU A 1 589 ? 85.73521  10.65253  33.38598   1.000 65.03096  ? 589 LEU A O   1 
ATOM 4724  C CB  . LEU A 1 589 ? 86.30807  10.69926  30.04434   1.000 53.24139  ? 589 LEU A CB  1 
ATOM 4725  C CG  . LEU A 1 589 ? 86.01089  12.19842  30.10446   1.000 44.27624  ? 589 LEU A CG  1 
ATOM 4726  C CD1 . LEU A 1 589 ? 87.23009  12.95511  30.60571   1.000 41.85629  ? 589 LEU A CD1 1 
ATOM 4727  C CD2 . LEU A 1 589 ? 85.58868  12.71327  28.74020   1.000 46.06900  ? 589 LEU A CD2 1 
ATOM 4728  N N   . GLN A 1 590 ? 84.79772  8.99721   32.17416   1.000 61.34354  ? 590 GLN A N   1 
ATOM 4729  C CA  . GLN A 1 590 ? 83.71028  8.87182   33.13827   1.000 65.94765  ? 590 GLN A CA  1 
ATOM 4730  C C   . GLN A 1 590 ? 84.24264  8.49388   34.51499   1.000 77.86211  ? 590 GLN A C   1 
ATOM 4731  O O   . GLN A 1 590 ? 83.83101  9.07935   35.52501   1.000 86.31664  ? 590 GLN A O   1 
ATOM 4732  C CB  . GLN A 1 590 ? 82.65750  7.86603   32.65048   1.000 66.54297  ? 590 GLN A CB  1 
ATOM 4733  C CG  . GLN A 1 590 ? 83.02693  6.39587   32.77125   1.000 74.48589  ? 590 GLN A CG  1 
ATOM 4734  C CD  . GLN A 1 590 ? 81.84745  5.46895   32.58166   1.000 91.96763  ? 590 GLN A CD  1 
ATOM 4735  O OE1 . GLN A 1 590 ? 80.73484  5.91361   32.31267   1.000 92.67933  ? 590 GLN A OE1 1 
ATOM 4736  N NE2 . GLN A 1 590 ? 82.08479  4.16935   32.72621   1.000 95.89805  ? 590 GLN A NE2 1 
ATOM 4737  N N   . GLN A 1 591 ? 85.21608  7.57609   34.57591   1.000 72.80824  ? 591 GLN A N   1 
ATOM 4738  C CA  . GLN A 1 591 ? 85.74638  7.20328   35.88123   1.000 63.87804  ? 591 GLN A CA  1 
ATOM 4739  C C   . GLN A 1 591 ? 86.59137  8.32020   36.47014   1.000 54.28930  ? 591 GLN A C   1 
ATOM 4740  O O   . GLN A 1 591 ? 86.83979  8.32547   37.68069   1.000 56.53569  ? 591 GLN A O   1 
ATOM 4741  C CB  . GLN A 1 591 ? 86.51749  5.88076   35.80870   1.000 62.02282  ? 591 GLN A CB  1 
ATOM 4742  C CG  . GLN A 1 591 ? 87.79555  5.88715   35.01181   1.000 66.65371  ? 591 GLN A CG  1 
ATOM 4743  C CD  . GLN A 1 591 ? 88.20239  4.49289   34.57889   1.000 88.85956  ? 591 GLN A CD  1 
ATOM 4744  O OE1 . GLN A 1 591 ? 87.50659  3.51677   34.86054   1.000 96.03316  ? 591 GLN A OE1 1 
ATOM 4745  N NE2 . GLN A 1 591 ? 89.33468  4.39105   33.89396   1.000 98.56439  ? 591 GLN A NE2 1 
ATOM 4746  N N   . ILE A 1 592 ? 87.02907  9.26620   35.63996   1.000 54.04158  ? 592 ILE A N   1 
ATOM 4747  C CA  . ILE A 1 592 ? 87.54318  10.52524  36.16114   1.000 53.21866  ? 592 ILE A CA  1 
ATOM 4748  C C   . ILE A 1 592 ? 86.39368  11.44212  36.55335   1.000 49.25901  ? 592 ILE A C   1 
ATOM 4749  O O   . ILE A 1 592 ? 86.37094  11.99770  37.65820   1.000 51.79238  ? 592 ILE A O   1 
ATOM 4750  C CB  . ILE A 1 592 ? 88.46291  11.19770  35.12473   1.000 47.34082  ? 592 ILE A CB  1 
ATOM 4751  C CG1 . ILE A 1 592 ? 89.78626  10.44337  35.00017   1.000 46.88136  ? 592 ILE A CG1 1 
ATOM 4752  C CG2 . ILE A 1 592 ? 88.70790  12.65293  35.49455   1.000 48.72419  ? 592 ILE A CG2 1 
ATOM 4753  C CD1 . ILE A 1 592 ? 90.72376  10.66899  36.16295   1.000 48.15954  ? 592 ILE A CD1 1 
ATOM 4754  N N   . GLU A 1 593 ? 85.40109  11.57867  35.66894   1.000 44.73072  ? 593 GLU A N   1 
ATOM 4755  C CA  . GLU A 1 593 ? 84.36233  12.58151  35.87869   1.000 45.70332  ? 593 GLU A CA  1 
ATOM 4756  C C   . GLU A 1 593 ? 83.54073  12.27926  37.12392   1.000 52.43007  ? 593 GLU A C   1 
ATOM 4757  O O   . GLU A 1 593 ? 83.16311  13.19651  37.86414   1.000 69.84640  ? 593 GLU A O   1 
ATOM 4758  C CB  . GLU A 1 593 ? 83.46930  12.66462  34.64314   1.000 53.67810  ? 593 GLU A CB  1 
ATOM 4759  C CG  . GLU A 1 593 ? 82.66449  13.94260  34.54679   1.000 68.98570  ? 593 GLU A CG  1 
ATOM 4760  C CD  . GLU A 1 593 ? 82.05995  14.13766  33.17441   1.000 86.79100  ? 593 GLU A CD  1 
ATOM 4761  O OE1 . GLU A 1 593 ? 81.96235  13.14446  32.42311   1.000 94.91757  ? 593 GLU A OE1 1 
ATOM 4762  O OE2 . GLU A 1 593 ? 81.67917  15.28090  32.84759   1.000 91.13366  ? 593 GLU A OE2 1 
ATOM 4763  N N   . SER A 1 594 ? 83.28128  10.99615  37.38698   1.000 59.28287  ? 594 SER A N   1 
ATOM 4764  C CA  . SER A 1 594 ? 82.63664  10.60508  38.63582   1.000 74.69279  ? 594 SER A CA  1 
ATOM 4765  C C   . SER A 1 594 ? 83.38498  11.17791  39.83260   1.000 73.23157  ? 594 SER A C   1 
ATOM 4766  O O   . SER A 1 594 ? 82.78627  11.80421  40.71545   1.000 75.88800  ? 594 SER A O   1 
ATOM 4767  C CB  . SER A 1 594 ? 82.55152  9.07980   38.72508   1.000 89.86396  ? 594 SER A CB  1 
ATOM 4768  O OG  . SER A 1 594 ? 81.96995  8.66605   39.95009   1.000 107.04365 ? 594 SER A OG  1 
ATOM 4769  N N   . MET A 1 595 ? 84.71004  11.00061  39.85838   1.000 61.65181  ? 595 MET A N   1 
ATOM 4770  C CA  . MET A 1 595 ? 85.49831  11.53343  40.96414   1.000 71.11717  ? 595 MET A CA  1 
ATOM 4771  C C   . MET A 1 595 ? 85.42941  13.05214  41.02665   1.000 72.75833  ? 595 MET A C   1 
ATOM 4772  O O   . MET A 1 595 ? 85.55856  13.63222  42.10972   1.000 59.91807  ? 595 MET A O   1 
ATOM 4773  C CB  . MET A 1 595 ? 86.95437  11.08440  40.84482   1.000 83.36698  ? 595 MET A CB  1 
ATOM 4774  C CG  . MET A 1 595 ? 87.15878  9.58310   40.88416   1.000 81.06341  ? 595 MET A CG  1 
ATOM 4775  S SD  . MET A 1 595 ? 88.90557  9.14528   40.99215   1.000 59.78600  ? 595 MET A SD  1 
ATOM 4776  C CE  . MET A 1 595 ? 89.50700  9.78169   39.43257   1.000 46.86363  ? 595 MET A CE  1 
ATOM 4777  N N   . ILE A 1 596 ? 85.22996  13.71572  39.88601   1.000 75.90436  ? 596 ILE A N   1 
ATOM 4778  C CA  . ILE A 1 596 ? 85.10502  15.16767  39.92017   1.000 69.61380  ? 596 ILE A CA  1 
ATOM 4779  C C   . ILE A 1 596 ? 83.75461  15.57258  40.49549   1.000 55.69429  ? 596 ILE A C   1 
ATOM 4780  O O   . ILE A 1 596 ? 83.61074  16.66925  41.04723   1.000 55.16509  ? 596 ILE A O   1 
ATOM 4781  C CB  . ILE A 1 596 ? 85.33663  15.76609  38.52091   1.000 86.01342  ? 596 ILE A CB  1 
ATOM 4782  C CG1 . ILE A 1 596 ? 86.61727  15.20056  37.90931   1.000 107.90903 ? 596 ILE A CG1 1 
ATOM 4783  C CG2 . ILE A 1 596 ? 85.44278  17.28067  38.59411   1.000 69.76780  ? 596 ILE A CG2 1 
ATOM 4784  C CD1 . ILE A 1 596 ? 86.91457  15.73372  36.52850   1.000 117.12162 ? 596 ILE A CD1 1 
ATOM 4785  N N   . GLU A 1 597 ? 82.74550  14.70957  40.37821   1.000 70.49743  ? 597 GLU A N   1 
ATOM 4786  C CA  . GLU A 1 597 ? 81.40154  15.02919  40.84612   1.000 69.94680  ? 597 GLU A CA  1 
ATOM 4787  C C   . GLU A 1 597 ? 81.09700  14.39417  42.19953   1.000 69.95591  ? 597 GLU A C   1 
ATOM 4788  O O   . GLU A 1 597 ? 80.73875  15.09846  43.14781   1.000 71.41820  ? 597 GLU A O   1 
ATOM 4789  C CB  . GLU A 1 597 ? 80.36449  14.60442  39.79851   1.000 71.09895  ? 597 GLU A CB  1 
ATOM 4790  C CG  . GLU A 1 597 ? 80.56967  15.25523  38.43948   1.000 62.49802  ? 597 GLU A CG  1 
ATOM 4791  C CD  . GLU A 1 597 ? 79.42634  14.98435  37.48511   1.000 58.10810  ? 597 GLU A CD  1 
ATOM 4792  O OE1 . GLU A 1 597 ? 78.63872  14.05300  37.74973   1.000 56.69798  ? 597 GLU A OE1 1 
ATOM 4793  O OE2 . GLU A 1 597 ? 79.31381  15.70387  36.47108   1.000 57.78331  ? 597 GLU A OE2 1 
ATOM 4794  N N   . ALA A 1 598 ? 81.23191  13.06920  42.30530   1.000 71.53259  ? 598 ALA A N   1 
ATOM 4795  C CA  . ALA A 1 598 ? 80.87114  12.37912  43.54204   1.000 81.38177  ? 598 ALA A CA  1 
ATOM 4796  C C   . ALA A 1 598 ? 81.72376  12.85197  44.71434   1.000 95.49782  ? 598 ALA A C   1 
ATOM 4797  O O   . ALA A 1 598 ? 81.20594  13.12468  45.80393   1.000 102.03575 ? 598 ALA A O   1 
ATOM 4798  C CB  . ALA A 1 598 ? 81.00124  10.86740  43.35451   1.000 80.95942  ? 598 ALA A CB  1 
ATOM 4799  N N   . GLU A 1 599 ? 83.03866  12.95523  44.50997   1.000 79.42185  ? 599 GLU A N   1 
ATOM 4800  C CA  . GLU A 1 599 ? 83.91711  13.44479  45.56622   1.000 114.69776 ? 599 GLU A CA  1 
ATOM 4801  C C   . GLU A 1 599 ? 83.75653  14.94029  45.80134   1.000 113.77840 ? 599 GLU A C   1 
ATOM 4802  O O   . GLU A 1 599 ? 84.17298  15.43939  46.85283   1.000 136.51000 ? 599 GLU A O   1 
ATOM 4803  C CB  . GLU A 1 599 ? 85.37479  13.12129  45.22759   1.000 129.74395 ? 599 GLU A CB  1 
ATOM 4804  C CG  . GLU A 1 599 ? 86.31872  13.10946  46.42312   1.000 133.34401 ? 599 GLU A CG  1 
ATOM 4805  C CD  . GLU A 1 599 ? 87.26602  14.29541  46.43540   1.000 120.82963 ? 599 GLU A CD  1 
ATOM 4806  O OE1 . GLU A 1 599 ? 87.72502  14.70606  45.34921   1.000 111.46328 ? 599 GLU A OE1 1 
ATOM 4807  O OE2 . GLU A 1 599 ? 87.55337  14.81652  47.53396   1.000 113.41468 ? 599 GLU A OE2 1 
ATOM 4808  N N   . SER A 1 600 ? 83.15930  15.66325  44.85409   1.000 114.14690 ? 600 SER A N   1 
ATOM 4809  C CA  . SER A 1 600 ? 82.95426  17.09968  44.98628   1.000 96.70681  ? 600 SER A CA  1 
ATOM 4810  C C   . SER A 1 600 ? 81.48175  17.49775  44.98088   1.000 77.69412  ? 600 SER A C   1 
ATOM 4811  O O   . SER A 1 600 ? 81.17470  18.68362  44.80833   1.000 77.47441  ? 600 SER A O   1 
ATOM 4812  C CB  . SER A 1 600 ? 83.70365  17.83967  43.87656   1.000 107.84940 ? 600 SER A CB  1 
ATOM 4813  O OG  . SER A 1 600 ? 85.09392  17.57918  43.92535   1.000 126.76330 ? 600 SER A OG  1 
ATOM 4814  N N   . SER A 1 601 ? 80.56180  16.54483  45.16079   1.000 82.04045  ? 601 SER A N   1 
ATOM 4815  C CA  . SER A 1 601 ? 79.14776  16.88742  45.27997   1.000 79.51182  ? 601 SER A CA  1 
ATOM 4816  C C   . SER A 1 601 ? 78.86078  17.72270  46.51937   1.000 83.04696  ? 601 SER A C   1 
ATOM 4817  O O   . SER A 1 601 ? 77.85712  18.44327  46.55004   1.000 93.10047  ? 601 SER A O   1 
ATOM 4818  C CB  . SER A 1 601 ? 78.29344  15.61717  45.30378   1.000 79.66053  ? 601 SER A CB  1 
ATOM 4819  O OG  . SER A 1 601 ? 78.42584  14.92965  46.53653   1.000 77.49340  ? 601 SER A OG  1 
ATOM 4820  N N   . VAL A 1 602 ? 79.71322  17.64097  47.53626   1.000 75.32667  ? 602 VAL A N   1 
ATOM 4821  C CA  . VAL A 1 602 ? 79.53530  18.43620  48.76320   1.000 89.86889  ? 602 VAL A CA  1 
ATOM 4822  C C   . VAL A 1 602 ? 80.27809  19.74740  48.53391   1.000 91.27480  ? 602 VAL A C   1 
ATOM 4823  O O   . VAL A 1 602 ? 81.41286  19.95255  48.97254   1.000 78.55852  ? 602 VAL A O   1 
ATOM 4824  C CB  . VAL A 1 602 ? 80.02543  17.68850  50.00722   1.000 87.01217  ? 602 VAL A CB  1 
ATOM 4825  C CG1 . VAL A 1 602 ? 79.54349  18.38047  51.27553   1.000 105.34437 ? 602 VAL A CG1 1 
ATOM 4826  C CG2 . VAL A 1 602 ? 79.57103  16.23628  49.96929   1.000 76.21871  ? 602 VAL A CG2 1 
ATOM 4827  N N   . LYS A 1 603 ? 79.61041  20.66888  47.83985   1.000 93.23439  ? 603 LYS A N   1 
ATOM 4828  C CA  . LYS A 1 603 ? 80.15447  21.99184  47.55635   1.000 97.74769  ? 603 LYS A CA  1 
ATOM 4829  C C   . LYS A 1 603 ? 79.07837  22.83016  46.88087   1.000 120.60734 ? 603 LYS A C   1 
ATOM 4830  O O   . LYS A 1 603 ? 78.24977  22.30624  46.13141   1.000 126.60805 ? 603 LYS A O   1 
ATOM 4831  C CB  . LYS A 1 603 ? 81.40570  21.91537  46.66906   1.000 100.19746 ? 603 LYS A CB  1 
ATOM 4832  C CG  . LYS A 1 603 ? 82.07795  23.25392  46.43536   1.000 120.21725 ? 603 LYS A CG  1 
ATOM 4833  C CD  . LYS A 1 603 ? 82.54683  23.87515  47.73897   1.000 137.90854 ? 603 LYS A CD  1 
ATOM 4834  C CE  . LYS A 1 603 ? 83.20917  25.21998  47.49793   1.000 136.74651 ? 603 LYS A CE  1 
ATOM 4835  N NZ  . LYS A 1 603 ? 83.66307  25.84426  48.76936   1.000 125.26080 ? 603 LYS A NZ  1 
ATOM 4836  N N   . GLU A 1 604 ? 79.10478  24.13809  47.15485   1.000 131.64215 ? 604 GLU A N   1 
ATOM 4837  C CA  . GLU A 1 604 ? 78.17055  25.06330  46.51883   1.000 152.94037 ? 604 GLU A CA  1 
ATOM 4838  C C   . GLU A 1 604 ? 78.62137  25.42388  45.10730   1.000 165.28606 ? 604 GLU A C   1 
ATOM 4839  O O   . GLU A 1 604 ? 77.85525  25.28595  44.14774   1.000 161.05515 ? 604 GLU A O   1 
ATOM 4840  C CB  . GLU A 1 604 ? 78.01812  26.32503  47.37100   1.000 152.52269 ? 604 GLU A CB  1 
ATOM 4841  C CG  . GLU A 1 604 ? 77.36851  27.49488  46.64420   1.000 150.01988 ? 604 GLU A CG  1 
ATOM 4842  C CD  . GLU A 1 604 ? 75.89623  27.26655  46.35305   1.000 151.14956 ? 604 GLU A CD  1 
ATOM 4843  O OE1 . GLU A 1 604 ? 75.26688  26.44647  47.05358   1.000 153.84302 ? 604 GLU A OE1 1 
ATOM 4844  O OE2 . GLU A 1 604 ? 75.36693  27.91009  45.42180   1.000 151.89817 ? 604 GLU A OE2 1 
ATOM 4845  N N   . LYS A 1 605 ? 79.85748  25.89390  44.96409   1.000 188.51353 ? 605 LYS A N   1 
ATOM 4846  C CA  . LYS A 1 605 ? 80.47194  26.14305  43.66195   1.000 174.54902 ? 605 LYS A CA  1 
ATOM 4847  C C   . LYS A 1 605 ? 81.48127  25.02279  43.44180   1.000 165.20595 ? 605 LYS A C   1 
ATOM 4848  O O   . LYS A 1 605 ? 82.58423  25.05686  43.99525   1.000 172.72268 ? 605 LYS A O   1 
ATOM 4849  C CB  . LYS A 1 605 ? 81.13248  27.51801  43.61009   1.000 163.40050 ? 605 LYS A CB  1 
ATOM 4850  C CG  . LYS A 1 605 ? 80.17625  28.68827  43.78059   1.000 149.70499 ? 605 LYS A CG  1 
ATOM 4851  C CD  . LYS A 1 605 ? 79.11438  28.70171  42.69326   1.000 129.87633 ? 605 LYS A CD  1 
ATOM 4852  C CE  . LYS A 1 605 ? 78.15303  29.86523  42.87396   1.000 122.93326 ? 605 LYS A CE  1 
ATOM 4853  N NZ  . LYS A 1 605 ? 77.31400  29.70501  44.09179   1.000 123.76290 ? 605 LYS A NZ  1 
ATOM 4854  N N   . ASP A 1 606 ? 81.09814  24.04735  42.61466   1.000 138.25614 ? 606 ASP A N   1 
ATOM 4855  C CA  . ASP A 1 606 ? 81.76076  22.74819  42.58297   1.000 131.93292 ? 606 ASP A CA  1 
ATOM 4856  C C   . ASP A 1 606 ? 83.26679  22.89005  42.40588   1.000 123.43710 ? 606 ASP A C   1 
ATOM 4857  O O   . ASP A 1 606 ? 83.75713  23.80615  41.73900   1.000 130.97408 ? 606 ASP A O   1 
ATOM 4858  C CB  . ASP A 1 606 ? 81.19833  21.88447  41.45191   1.000 144.93232 ? 606 ASP A CB  1 
ATOM 4859  C CG  . ASP A 1 606 ? 81.67864  20.44731  41.52224   1.000 153.08120 ? 606 ASP A CG  1 
ATOM 4860  O OD1 . ASP A 1 606 ? 82.49767  20.14198  42.40745   1.000 150.53800 ? 606 ASP A OD1 1 
ATOM 4861  O OD2 . ASP A 1 606 ? 81.25538  19.62409  40.68617   1.000 158.22296 ? 606 ASP A OD2 1 
ATOM 4862  N N   . MET A 1 607 ? 83.99873  21.95699  43.01040   1.000 121.97772 ? 607 MET A N   1 
ATOM 4863  C CA  . MET A 1 607 ? 85.44408  21.85883  42.83628   1.000 121.63338 ? 607 MET A CA  1 
ATOM 4864  C C   . MET A 1 607 ? 85.71713  21.17582  41.50304   1.000 109.89715 ? 607 MET A C   1 
ATOM 4865  O O   . MET A 1 607 ? 85.60393  19.95384  41.37947   1.000 104.42401 ? 607 MET A O   1 
ATOM 4866  C CB  . MET A 1 607 ? 86.07761  21.08814  43.98805   1.000 134.46722 ? 607 MET A CB  1 
ATOM 4867  C CG  . MET A 1 607 ? 87.54380  20.77426  43.76088   1.000 159.19067 ? 607 MET A CG  1 
ATOM 4868  S SD  . MET A 1 607 ? 87.91082  19.01824  43.60798   1.000 191.85213 ? 607 MET A SD  1 
ATOM 4869  C CE  . MET A 1 607 ? 87.71676  18.47777  45.30263   1.000 190.11476 ? 607 MET A CE  1 
ATOM 4870  N N   . THR A 1 608 ? 86.05843  21.96835  40.49538   1.000 108.97337 ? 608 THR A N   1 
ATOM 4871  C CA  . THR A 1 608 ? 86.42808  21.46318  39.17948   1.000 97.95069  ? 608 THR A CA  1 
ATOM 4872  C C   . THR A 1 608 ? 87.79989  21.94030  38.73775   1.000 89.17580  ? 608 THR A C   1 
ATOM 4873  O O   . THR A 1 608 ? 88.56075  21.16292  38.15661   1.000 77.49292  ? 608 THR A O   1 
ATOM 4874  C CB  . THR A 1 608 ? 85.37905  21.87711  38.13166   1.000 103.11071 ? 608 THR A CB  1 
ATOM 4875  O OG1 . THR A 1 608 ? 84.06989  21.52546  38.59648   1.000 109.38035 ? 608 THR A OG1 1 
ATOM 4876  C CG2 . THR A 1 608 ? 85.63836  21.17450  36.80342   1.000 94.09215  ? 608 THR A CG2 1 
ATOM 4877  N N   . LYS A 1 609 ? 88.14261  23.19903  39.01219   1.000 105.75128 ? 609 LYS A N   1 
ATOM 4878  C CA  . LYS A 1 609 ? 89.46036  23.71828  38.67690   1.000 119.46439 ? 609 LYS A CA  1 
ATOM 4879  C C   . LYS A 1 609 ? 90.49983  23.41115  39.74711   1.000 97.78738  ? 609 LYS A C   1 
ATOM 4880  O O   . LYS A 1 609 ? 91.69798  23.55445  39.48206   1.000 93.09829  ? 609 LYS A O   1 
ATOM 4881  C CB  . LYS A 1 609 ? 89.38535  25.23136  38.44055   1.000 145.00375 ? 609 LYS A CB  1 
ATOM 4882  C CG  . LYS A 1 609 ? 90.59427  25.81663  37.71759   1.000 153.06005 ? 609 LYS A CG  1 
ATOM 4883  C CD  . LYS A 1 609 ? 90.39252  27.28494  37.38038   1.000 137.79868 ? 609 LYS A CD  1 
ATOM 4884  C CE  . LYS A 1 609 ? 91.62999  27.87624  36.72054   1.000 100.35996 ? 609 LYS A CE  1 
ATOM 4885  N NZ  . LYS A 1 609 ? 91.96257  27.19905  35.43669   1.000 76.55313  ? 609 LYS A NZ  1 
ATOM 4886  N N   . GLU A 1 610 ? 90.07746  22.99723  40.94425   1.000 83.97186  ? 610 GLU A N   1 
ATOM 4887  C CA  . GLU A 1 610 ? 91.02332  22.52092  41.94569   1.000 115.90519 ? 610 GLU A CA  1 
ATOM 4888  C C   . GLU A 1 610 ? 91.42262  21.06932  41.72265   1.000 124.47975 ? 610 GLU A C   1 
ATOM 4889  O O   . GLU A 1 610 ? 92.48137  20.65121  42.20531   1.000 140.28768 ? 610 GLU A O   1 
ATOM 4890  C CB  . GLU A 1 610 ? 90.44241  22.68044  43.35258   1.000 139.75413 ? 610 GLU A CB  1 
ATOM 4891  C CG  . GLU A 1 610 ? 90.30867  24.11740  43.82307   1.000 157.01824 ? 610 GLU A CG  1 
ATOM 4892  C CD  . GLU A 1 610 ? 89.79650  24.21376  45.24695   1.000 161.95976 ? 610 GLU A CD  1 
ATOM 4893  O OE1 . GLU A 1 610 ? 89.39484  23.17231  45.80781   1.000 158.11965 ? 610 GLU A OE1 1 
ATOM 4894  O OE2 . GLU A 1 610 ? 89.79778  25.32982  45.80671   1.000 169.11750 ? 610 GLU A OE2 1 
ATOM 4895  N N   . PHE A 1 611 ? 90.60035  20.29382  41.00990   1.000 117.07634 ? 611 PHE A N   1 
ATOM 4896  C CA  . PHE A 1 611 ? 90.96993  18.91998  40.68699   1.000 98.56197  ? 611 PHE A CA  1 
ATOM 4897  C C   . PHE A 1 611 ? 92.15939  18.90001  39.73579   1.000 82.20471  ? 611 PHE A C   1 
ATOM 4898  O O   . PHE A 1 611 ? 93.16131  18.22119  39.98846   1.000 84.38595  ? 611 PHE A O   1 
ATOM 4899  C CB  . PHE A 1 611 ? 89.76993  18.18767  40.08252   1.000 97.67217  ? 611 PHE A CB  1 
ATOM 4900  C CG  . PHE A 1 611 ? 89.61651  16.76801  40.55749   1.000 76.35787  ? 611 PHE A CG  1 
ATOM 4901  C CD1 . PHE A 1 611 ? 89.34107  16.49661  41.88616   1.000 60.72248  ? 611 PHE A CD1 1 
ATOM 4902  C CD2 . PHE A 1 611 ? 89.72661  15.70781  39.67306   1.000 83.47304  ? 611 PHE A CD2 1 
ATOM 4903  C CE1 . PHE A 1 611 ? 89.19049  15.19876  42.32962   1.000 66.45456  ? 611 PHE A CE1 1 
ATOM 4904  C CE2 . PHE A 1 611 ? 89.57646  14.40363  40.11109   1.000 93.47237  ? 611 PHE A CE2 1 
ATOM 4905  C CZ  . PHE A 1 611 ? 89.30798  14.15040  41.44208   1.000 86.52284  ? 611 PHE A CZ  1 
ATOM 4906  N N   . PHE A 1 612 ? 92.06403  19.64316  38.63705   1.000 84.35409  ? 612 PHE A N   1 
ATOM 4907  C CA  . PHE A 1 612 ? 93.20245  19.92053  37.77770   1.000 82.35529  ? 612 PHE A CA  1 
ATOM 4908  C C   . PHE A 1 612 ? 93.92977  21.15062  38.32044   1.000 97.64063  ? 612 PHE A C   1 
ATOM 4909  O O   . PHE A 1 612 ? 93.61736  21.65342  39.40269   1.000 109.21002 ? 612 PHE A O   1 
ATOM 4910  C CB  . PHE A 1 612 ? 92.74426  20.13105  36.33482   1.000 76.78677  ? 612 PHE A CB  1 
ATOM 4911  C CG  . PHE A 1 612 ? 92.31071  18.87189  35.63730   1.000 73.62621  ? 612 PHE A CG  1 
ATOM 4912  C CD1 . PHE A 1 612 ? 92.80007  17.63854  36.02682   1.000 75.15889  ? 612 PHE A CD1 1 
ATOM 4913  C CD2 . PHE A 1 612 ? 91.40180  18.92518  34.59369   1.000 70.23607  ? 612 PHE A CD2 1 
ATOM 4914  C CE1 . PHE A 1 612 ? 92.39715  16.48332  35.38080   1.000 73.63354  ? 612 PHE A CE1 1 
ATOM 4915  C CE2 . PHE A 1 612 ? 90.99519  17.77534  33.94753   1.000 64.12789  ? 612 PHE A CE2 1 
ATOM 4916  C CZ  . PHE A 1 612 ? 91.49425  16.55258  34.34184   1.000 68.93648  ? 612 PHE A CZ  1 
ATOM 4917  N N   . GLU A 1 613 ? 94.92851  21.63377  37.58414   1.000 87.98904  ? 613 GLU A N   1 
ATOM 4918  C CA  . GLU A 1 613 ? 95.57320  22.92658  37.80595   1.000 112.17522 ? 613 GLU A CA  1 
ATOM 4919  C C   . GLU A 1 613 ? 96.17602  23.07964  39.20086   1.000 116.58489 ? 613 GLU A C   1 
ATOM 4920  O O   . GLU A 1 613 ? 96.61555  24.17897  39.55978   1.000 122.00729 ? 613 GLU A O   1 
ATOM 4921  C CB  . GLU A 1 613 ? 94.59377  24.07962  37.54289   1.000 130.11082 ? 613 GLU A CB  1 
ATOM 4922  C CG  . GLU A 1 613 ? 94.25548  24.29588  36.07401   1.000 153.81060 ? 613 GLU A CG  1 
ATOM 4923  C CD  . GLU A 1 613 ? 95.41284  24.86780  35.28004   1.000 182.44398 ? 613 GLU A CD  1 
ATOM 4924  O OE1 . GLU A 1 613 ? 96.24907  25.57999  35.87372   1.000 196.83108 ? 613 GLU A OE1 1 
ATOM 4925  O OE2 . GLU A 1 613 ? 95.48574  24.60507  34.06028   1.000 186.57024 ? 613 GLU A OE2 1 
ATOM 4926  N N   . ASN A 1 614 ? 96.20536  22.01423  40.00395   1.000 121.69603 ? 614 ASN A N   1 
ATOM 4927  C CA  . ASN A 1 614 ? 96.69381  22.07953  41.38551   1.000 119.39045 ? 614 ASN A CA  1 
ATOM 4928  C C   . ASN A 1 614 ? 97.58452  20.85864  41.61162   1.000 117.67215 ? 614 ASN A C   1 
ATOM 4929  O O   . ASN A 1 614 ? 97.10506  19.78798  41.99443   1.000 113.59553 ? 614 ASN A O   1 
ATOM 4930  C CB  . ASN A 1 614 ? 95.53807  22.13466  42.37706   1.000 126.09737 ? 614 ASN A CB  1 
ATOM 4931  C CG  . ASN A 1 614 ? 95.97026  22.59913  43.75390   1.000 142.63530 ? 614 ASN A CG  1 
ATOM 4932  O OD1 . ASN A 1 614 ? 97.15623  22.58961  44.08351   1.000 146.39516 ? 614 ASN A OD1 1 
ATOM 4933  N ND2 . ASN A 1 614 ? 95.00483  23.01184  44.56676   1.000 153.22313 ? 614 ASN A ND2 1 
ATOM 4934  N N   . LYS A 1 615 ? 98.88553  21.02941  41.37113   1.000 122.82267 ? 615 LYS A N   1 
ATOM 4935  C CA  . LYS A 1 615 ? 99.83503  19.93243  41.51478   1.000 124.06644 ? 615 LYS A CA  1 
ATOM 4936  C C   . LYS A 1 615 ? 100.10373 19.54867  42.96451   1.000 130.02604 ? 615 LYS A C   1 
ATOM 4937  O O   . LYS A 1 615 ? 100.76961 18.53421  43.19892   1.000 141.70743 ? 615 LYS A O   1 
ATOM 4938  C CB  . LYS A 1 615 ? 101.14915 20.28862  40.81908   1.000 118.66240 ? 615 LYS A CB  1 
ATOM 4939  C CG  . LYS A 1 615 ? 100.99056 20.55040  39.33196   1.000 113.64077 ? 615 LYS A CG  1 
ATOM 4940  C CD  . LYS A 1 615 ? 100.44982 19.31662  38.62661   1.000 114.40838 ? 615 LYS A CD  1 
ATOM 4941  C CE  . LYS A 1 615 ? 100.36929 19.51827  37.12374   1.000 123.80654 ? 615 LYS A CE  1 
ATOM 4942  N NZ  . LYS A 1 615 ? 99.85632  18.30155  36.43445   1.000 126.86986 ? 615 LYS A NZ  1 
ATOM 4943  N N   . SER A 1 616 ? 99.62098  20.32501  43.93730   1.000 133.45601 ? 616 SER A N   1 
ATOM 4944  C CA  . SER A 1 616 ? 99.76907  19.91595  45.33019   1.000 127.43247 ? 616 SER A CA  1 
ATOM 4945  C C   . SER A 1 616 ? 98.95400  18.66541  45.63702   1.000 135.01449 ? 616 SER A C   1 
ATOM 4946  O O   . SER A 1 616 ? 99.34638  17.86607  46.49479   1.000 115.76636 ? 616 SER A O   1 
ATOM 4947  C CB  . SER A 1 616 ? 99.36225  21.05900  46.26036   1.000 125.10714 ? 616 SER A CB  1 
ATOM 4948  O OG  . SER A 1 616 ? 99.56804  20.70954  47.61798   1.000 123.26573 ? 616 SER A OG  1 
ATOM 4949  N N   . GLU A 1 617 ? 97.82571  18.48160  44.95437   1.000 145.10991 ? 617 GLU A N   1 
ATOM 4950  C CA  . GLU A 1 617 ? 96.99637  17.29016  45.11339   1.000 143.16931 ? 617 GLU A CA  1 
ATOM 4951  C C   . GLU A 1 617 ? 97.65469  16.11538  44.39667   1.000 123.71026 ? 617 GLU A C   1 
ATOM 4952  O O   . GLU A 1 617 ? 97.72302  16.08905  43.16326   1.000 90.25242  ? 617 GLU A O   1 
ATOM 4953  C CB  . GLU A 1 617 ? 95.58780  17.54763  44.58680   1.000 133.73092 ? 617 GLU A CB  1 
ATOM 4954  C CG  . GLU A 1 617 ? 94.74874  18.43383  45.49778   1.000 131.78449 ? 617 GLU A CG  1 
ATOM 4955  C CD  . GLU A 1 617 ? 94.33422  17.73203  46.77878   1.000 138.58195 ? 617 GLU A CD  1 
ATOM 4956  O OE1 . GLU A 1 617 ? 94.34605  16.48395  46.80543   1.000 139.81179 ? 617 GLU A OE1 1 
ATOM 4957  O OE2 . GLU A 1 617 ? 94.00096  18.42823  47.76146   1.000 141.32349 ? 617 GLU A OE2 1 
ATOM 4958  N N   . THR A 1 618 ? 98.13415  15.14223  45.16681   1.000 124.41014 ? 618 THR A N   1 
ATOM 4959  C CA  . THR A 1 618 ? 98.83447  13.97818  44.64444   1.000 111.70605 ? 618 THR A CA  1 
ATOM 4960  C C   . THR A 1 618 ? 98.05064  12.71384  44.97255   1.000 75.15950  ? 618 THR A C   1 
ATOM 4961  O O   . THR A 1 618 ? 97.41362  12.61756  46.02593   1.000 70.10780  ? 618 THR A O   1 
ATOM 4962  C CB  . THR A 1 618 ? 100.25128 13.87375  45.22215   1.000 131.73029 ? 618 THR A CB  1 
ATOM 4963  O OG1 . THR A 1 618 ? 100.17754 13.72182  46.64513   1.000 146.93251 ? 618 THR A OG1 1 
ATOM 4964  C CG2 . THR A 1 618 ? 101.05557 15.12230  44.89131   1.000 119.41830 ? 618 THR A CG2 1 
ATOM 4965  N N   . TRP A 1 619 ? 98.09931  11.73983  44.05922   1.000 71.15644  ? 619 TRP A N   1 
ATOM 4966  C CA  . TRP A 1 619 ? 97.32988  10.51560  44.23323   1.000 64.37898  ? 619 TRP A CA  1 
ATOM 4967  C C   . TRP A 1 619 ? 98.23566  9.29144   44.26640   1.000 59.14695  ? 619 TRP A C   1 
ATOM 4968  O O   . TRP A 1 619 ? 99.19676  9.21130   43.49597   1.000 58.74004  ? 619 TRP A O   1 
ATOM 4969  C CB  . TRP A 1 619 ? 96.30641  10.34067  43.10331   1.000 64.98691  ? 619 TRP A CB  1 
ATOM 4970  C CG  . TRP A 1 619 ? 95.08516  11.17583  43.25162   1.000 64.90262  ? 619 TRP A CG  1 
ATOM 4971  C CD1 . TRP A 1 619 ? 93.94258  10.84715  43.92143   1.000 60.97551  ? 619 TRP A CD1 1 
ATOM 4972  C CD2 . TRP A 1 619 ? 94.87879  12.48777  42.72403   1.000 62.06598  ? 619 TRP A CD2 1 
ATOM 4973  N NE1 . TRP A 1 619 ? 93.03460  11.87410  43.83789   1.000 61.70661  ? 619 TRP A NE1 1 
ATOM 4974  C CE2 . TRP A 1 619 ? 93.58645  12.89415  43.10876   1.000 63.38318  ? 619 TRP A CE2 1 
ATOM 4975  C CE3 . TRP A 1 619 ? 95.66096  13.35929  41.96343   1.000 66.28814  ? 619 TRP A CE3 1 
ATOM 4976  C CZ2 . TRP A 1 619 ? 93.05948  14.13352  42.75768   1.000 76.56742  ? 619 TRP A CZ2 1 
ATOM 4977  C CZ3 . TRP A 1 619 ? 95.13675  14.58578  41.61927   1.000 76.62273  ? 619 TRP A CZ3 1 
ATOM 4978  C CH2 . TRP A 1 619 ? 93.84883  14.96319  42.01301   1.000 82.52693  ? 619 TRP A CH2 1 
ATOM 4979  N N   . PRO A 1 620 ? 97.94877  8.32147   45.13671   1.000 53.95030  ? 620 PRO A N   1 
ATOM 4980  C CA  . PRO A 1 620 ? 98.79649  7.12051   45.23505   1.000 76.76132  ? 620 PRO A CA  1 
ATOM 4981  C C   . PRO A 1 620 ? 98.68959  6.27862   43.97133   1.000 56.28325  ? 620 PRO A C   1 
ATOM 4982  O O   . PRO A 1 620 ? 97.59999  5.84208   43.59491   1.000 50.40405  ? 620 PRO A O   1 
ATOM 4983  C CB  . PRO A 1 620 ? 98.22936  6.38221   46.45595   1.000 91.63669  ? 620 PRO A CB  1 
ATOM 4984  C CG  . PRO A 1 620 ? 97.35455  7.38326   47.16509   1.000 55.78581  ? 620 PRO A CG  1 
ATOM 4985  C CD  . PRO A 1 620 ? 96.84055  8.29670   46.10373   1.000 54.55585  ? 620 PRO A CD  1 
ATOM 4986  N N   . ILE A 1 621 ? 99.82593  6.05744   43.30982   1.000 66.42555  ? 621 ILE A N   1 
ATOM 4987  C CA  . ILE A 1 621 ? 99.83262  5.30315   42.06073   1.000 60.81690  ? 621 ILE A CA  1 
ATOM 4988  C C   . ILE A 1 621 ? 100.93991 4.25522   42.04016   1.000 73.69046  ? 621 ILE A C   1 
ATOM 4989  O O   . ILE A 1 621 ? 100.94235 3.36842   41.17929   1.000 85.50071  ? 621 ILE A O   1 
ATOM 4990  C CB  . ILE A 1 621 ? 99.96492  6.24503   40.84986   1.000 49.58393  ? 621 ILE A CB  1 
ATOM 4991  C CG1 . ILE A 1 621 ? 101.04727 7.29486   41.10643   1.000 51.20013  ? 621 ILE A CG1 1 
ATOM 4992  C CG2 . ILE A 1 621 ? 98.62676  6.90077   40.52934   1.000 48.70319  ? 621 ILE A CG2 1 
ATOM 4993  C CD1 . ILE A 1 621 ? 101.49519 8.01766   39.85786   1.000 58.10209  ? 621 ILE A CD1 1 
ATOM 4994  N N   . GLY A 1 622 ? 101.89039 4.34298   42.96951   1.000 70.62064  ? 622 GLY A N   1 
ATOM 4995  C CA  . GLY A 1 622 ? 103.04325 3.46181   42.91829   1.000 75.20502  ? 622 GLY A CA  1 
ATOM 4996  C C   . GLY A 1 622 ? 103.70913 3.24158   44.25936   1.000 86.06394  ? 622 GLY A C   1 
ATOM 4997  O O   . GLY A 1 622 ? 103.49768 3.98936   45.22025   1.000 101.68565 ? 622 GLY A O   1 
ATOM 4998  N N   . GLU A 1 623 ? 104.52071 2.17784   44.31020   1.000 89.12416  ? 623 GLU A N   1 
ATOM 4999  C CA  . GLU A 1 623 ? 105.29015 1.80126   45.50202   1.000 105.60418 ? 623 GLU A CA  1 
ATOM 5000  C C   . GLU A 1 623 ? 106.63382 1.22548   45.04982   1.000 86.68366  ? 623 GLU A C   1 
ATOM 5001  O O   . GLU A 1 623 ? 106.76427 0.01276   44.85949   1.000 85.87756  ? 623 GLU A O   1 
ATOM 5002  C CB  . GLU A 1 623 ? 104.50747 0.79655   46.33884   1.000 130.83371 ? 623 GLU A CB  1 
ATOM 5003  C CG  . GLU A 1 623 ? 105.21191 0.32237   47.59653   1.000 149.60962 ? 623 GLU A CG  1 
ATOM 5004  C CD  . GLU A 1 623 ? 104.46306 -0.80003  48.28983   1.000 146.06181 ? 623 GLU A CD  1 
ATOM 5005  O OE1 . GLU A 1 623 ? 103.36725 -1.17068  47.81682   1.000 142.96555 ? 623 GLU A OE1 1 
ATOM 5006  O OE2 . GLU A 1 623 ? 104.97440 -1.31655  49.30480   1.000 140.64708 ? 623 GLU A OE2 1 
ATOM 5007  N N   . SER A 1 624 ? 107.62743 2.09812   44.85782   1.000 77.21368  ? 624 SER A N   1 
ATOM 5008  C CA  . SER A 1 624 ? 108.97950 1.60928   44.59806   1.000 102.07779 ? 624 SER A CA  1 
ATOM 5009  C C   . SER A 1 624 ? 109.76935 1.27299   45.86612   1.000 84.53114  ? 624 SER A C   1 
ATOM 5010  O O   . SER A 1 624 ? 110.21521 0.12831   46.01156   1.000 76.80249  ? 624 SER A O   1 
ATOM 5011  C CB  . SER A 1 624 ? 109.75670 2.60397   43.72741   1.000 141.76055 ? 624 SER A CB  1 
ATOM 5012  O OG  . SER A 1 624 ? 109.42109 3.94765   44.02164   1.000 169.41089 ? 624 SER A OG  1 
ATOM 5013  N N   . PRO A 1 625 ? 109.98416 2.23550   46.82870   1.000 105.82879 ? 625 PRO A N   1 
ATOM 5014  C CA  . PRO A 1 625 ? 110.90273 1.99233   47.94640   1.000 115.24914 ? 625 PRO A CA  1 
ATOM 5015  C C   . PRO A 1 625 ? 110.21239 1.43528   49.18920   1.000 152.10460 ? 625 PRO A C   1 
ATOM 5016  O O   . PRO A 1 625 ? 110.38204 1.94894   50.30166   1.000 157.16712 ? 625 PRO A O   1 
ATOM 5017  C CB  . PRO A 1 625 ? 111.47995 3.38616   48.20466   1.000 107.83612 ? 625 PRO A CB  1 
ATOM 5018  C CG  . PRO A 1 625 ? 110.29059 4.28252   47.96993   1.000 111.79182 ? 625 PRO A CG  1 
ATOM 5019  C CD  . PRO A 1 625 ? 109.37016 3.57082   46.97283   1.000 114.70142 ? 625 PRO A CD  1 
ATOM 5020  N N   . LYS A 1 626 ? 109.43089 0.36893   49.01000   1.000 153.08452 ? 626 LYS A N   1 
ATOM 5021  C CA  . LYS A 1 626 ? 108.56476 -0.16722  50.06413   1.000 179.28697 ? 626 LYS A CA  1 
ATOM 5022  C C   . LYS A 1 626 ? 107.65565 0.90808   50.65762   1.000 192.39179 ? 626 LYS A C   1 
ATOM 5023  O O   . LYS A 1 626 ? 107.16446 0.76587   51.78191   1.000 209.51678 ? 626 LYS A O   1 
ATOM 5024  C CB  . LYS A 1 626 ? 109.38071 -0.84173  51.17308   1.000 167.12881 ? 626 LYS A CB  1 
ATOM 5025  C CG  . LYS A 1 626 ? 109.88930 -2.22807  50.82148   1.000 144.43620 ? 626 LYS A CG  1 
ATOM 5026  C CD  . LYS A 1 626 ? 108.74133 -3.21603  50.70196   1.000 137.36897 ? 626 LYS A CD  1 
ATOM 5027  C CE  . LYS A 1 626 ? 108.03060 -3.39035  52.03410   1.000 127.15711 ? 626 LYS A CE  1 
ATOM 5028  N NZ  . LYS A 1 626 ? 106.89482 -4.34660  51.93891   1.000 115.70479 ? 626 LYS A NZ  1 
ATOM 5029  N N   . GLY A 1 627 ? 107.42873 1.99216   49.91701   1.000 184.99272 ? 627 GLY A N   1 
ATOM 5030  C CA  . GLY A 1 627 ? 106.61728 3.08495   50.40619   1.000 149.65683 ? 627 GLY A CA  1 
ATOM 5031  C C   . GLY A 1 627 ? 105.79415 3.68357   49.28438   1.000 108.58126 ? 627 GLY A C   1 
ATOM 5032  O O   . GLY A 1 627 ? 106.13364 3.57389   48.10394   1.000 82.75407  ? 627 GLY A O   1 
ATOM 5033  N N   . VAL A 1 628 ? 104.69850 4.33017   49.68064   1.000 104.04198 ? 628 VAL A N   1 
ATOM 5034  C CA  . VAL A 1 628 ? 103.76280 4.89165   48.71456   1.000 87.52749  ? 628 VAL A CA  1 
ATOM 5035  C C   . VAL A 1 628 ? 104.42365 6.04208   47.96838   1.000 85.95066  ? 628 VAL A C   1 
ATOM 5036  O O   . VAL A 1 628 ? 104.98899 6.95893   48.57857   1.000 93.41194  ? 628 VAL A O   1 
ATOM 5037  C CB  . VAL A 1 628 ? 102.47672 5.34986   49.41709   1.000 99.88958  ? 628 VAL A CB  1 
ATOM 5038  C CG1 . VAL A 1 628 ? 101.61155 6.16163   48.46426   1.000 85.90062  ? 628 VAL A CG1 1 
ATOM 5039  C CG2 . VAL A 1 628 ? 101.71259 4.15014   49.95477   1.000 123.43164 ? 628 VAL A CG2 1 
ATOM 5040  N N   . GLU A 1 629 ? 104.35517 5.99654   46.64025   1.000 79.00371  ? 629 GLU A N   1 
ATOM 5041  C CA  . GLU A 1 629 ? 104.88345 7.04056   45.76492   1.000 85.44097  ? 629 GLU A CA  1 
ATOM 5042  C C   . GLU A 1 629 ? 103.70828 7.64684   45.00540   1.000 89.09309  ? 629 GLU A C   1 
ATOM 5043  O O   . GLU A 1 629 ? 103.31509 7.15024   43.94695   1.000 107.53632 ? 629 GLU A O   1 
ATOM 5044  C CB  . GLU A 1 629 ? 105.93852 6.48467   44.81221   1.000 92.17242  ? 629 GLU A CB  1 
ATOM 5045  C CG  . GLU A 1 629 ? 107.26890 6.17751   45.46925   1.000 93.01430  ? 629 GLU A CG  1 
ATOM 5046  C CD  . GLU A 1 629 ? 108.03842 7.43142   45.83388   1.000 96.27395  ? 629 GLU A CD  1 
ATOM 5047  O OE1 . GLU A 1 629 ? 107.77765 8.49112   45.22577   1.000 90.94724  ? 629 GLU A OE1 1 
ATOM 5048  O OE2 . GLU A 1 629 ? 108.90455 7.35761   46.72980   1.000 109.99388 ? 629 GLU A OE2 1 
ATOM 5049  N N   . ASP A 1 630 ? 103.15009 8.72416   45.54938   1.000 66.46687  ? 630 ASP A N   1 
ATOM 5050  C CA  . ASP A 1 630 ? 102.03029 9.39526   44.90862   1.000 79.33291  ? 630 ASP A CA  1 
ATOM 5051  C C   . ASP A 1 630 ? 102.51587 10.27733  43.76472   1.000 83.81534  ? 630 ASP A C   1 
ATOM 5052  O O   . ASP A 1 630 ? 103.59403 10.87537  43.83070   1.000 93.60418  ? 630 ASP A O   1 
ATOM 5053  C CB  . ASP A 1 630 ? 101.24895 10.22927  45.92596   1.000 95.72062  ? 630 ASP A CB  1 
ATOM 5054  C CG  . ASP A 1 630 ? 102.14281 11.12679  46.75913   1.000 127.88286 ? 630 ASP A CG  1 
ATOM 5055  O OD1 . ASP A 1 630 ? 103.38123 11.03160  46.62582   1.000 139.47274 ? 630 ASP A OD1 1 
ATOM 5056  O OD2 . ASP A 1 630 ? 101.60424 11.93029  47.54934   1.000 142.19969 ? 630 ASP A OD2 1 
ATOM 5057  N N   . GLY A 1 631 ? 101.70972 10.34622  42.71026   1.000 70.90111  ? 631 GLY A N   1 
ATOM 5058  C CA  . GLY A 1 631 ? 102.02843 11.14983  41.54931   1.000 72.36168  ? 631 GLY A CA  1 
ATOM 5059  C C   . GLY A 1 631 ? 101.02780 12.25387  41.28099   1.000 85.30796  ? 631 GLY A C   1 
ATOM 5060  O O   . GLY A 1 631 ? 100.13213 12.51190  42.09393   1.000 78.53781  ? 631 GLY A O   1 
ATOM 5061  N N   . SER A 1 632 ? 101.17031 12.90236  40.12816   1.000 89.52307  ? 632 SER A N   1 
ATOM 5062  C CA  . SER A 1 632 ? 100.36000 14.05185  39.75910   1.000 91.43304  ? 632 SER A CA  1 
ATOM 5063  C C   . SER A 1 632 ? 99.06515  13.58991  39.09095   1.000 74.29546  ? 632 SER A C   1 
ATOM 5064  O O   . SER A 1 632 ? 98.69969  12.41192  39.13291   1.000 75.24632  ? 632 SER A O   1 
ATOM 5065  C CB  . SER A 1 632 ? 101.16022 14.98972  38.85818   1.000 105.22288 ? 632 SER A CB  1 
ATOM 5066  O OG  . SER A 1 632 ? 101.24958 14.47329  37.54246   1.000 101.12108 ? 632 SER A OG  1 
ATOM 5067  N N   . ILE A 1 633 ? 98.35549  14.52907  38.46195   1.000 83.06117  ? 633 ILE A N   1 
ATOM 5068  C CA  . ILE A 1 633 ? 97.05089  14.22275  37.88394   1.000 75.64512  ? 633 ILE A CA  1 
ATOM 5069  C C   . ILE A 1 633 ? 97.20262  13.51793  36.54317   1.000 67.38579  ? 633 ILE A C   1 
ATOM 5070  O O   . ILE A 1 633 ? 96.44807  12.58929  36.23209   1.000 58.77073  ? 633 ILE A O   1 
ATOM 5071  C CB  . ILE A 1 633 ? 96.21514  15.50603  37.74194   1.000 76.95037  ? 633 ILE A CB  1 
ATOM 5072  C CG1 . ILE A 1 633 ? 96.24425  16.31510  39.03644   1.000 91.87385  ? 633 ILE A CG1 1 
ATOM 5073  C CG2 . ILE A 1 633 ? 94.78682  15.14728  37.41356   1.000 55.44795  ? 633 ILE A CG2 1 
ATOM 5074  C CD1 . ILE A 1 633 ? 96.66949  17.76806  38.84992   1.000 84.10541  ? 633 ILE A CD1 1 
ATOM 5075  N N   . GLY A 1 634 ? 98.15995  13.95932  35.72423   1.000 64.65853  ? 634 GLY A N   1 
ATOM 5076  C CA  . GLY A 1 634 ? 98.33984  13.34898  34.41844   1.000 82.20226  ? 634 GLY A CA  1 
ATOM 5077  C C   . GLY A 1 634 ? 98.73878  11.89011  34.51344   1.000 82.29836  ? 634 GLY A C   1 
ATOM 5078  O O   . GLY A 1 634 ? 98.32519  11.06685  33.69111   1.000 87.40924  ? 634 GLY A O   1 
ATOM 5079  N N   . LYS A 1 635 ? 99.54933  11.54956  35.51828   1.000 71.84944  ? 635 LYS A N   1 
ATOM 5080  C CA  . LYS A 1 635 ? 99.86728  10.14766  35.75852   1.000 64.66427  ? 635 LYS A CA  1 
ATOM 5081  C C   . LYS A 1 635 ? 98.61043  9.35207   36.08502   1.000 70.49313  ? 635 LYS A C   1 
ATOM 5082  O O   . LYS A 1 635 ? 98.46050  8.21331   35.63661   1.000 69.38742  ? 635 LYS A O   1 
ATOM 5083  C CB  . LYS A 1 635 ? 100.89443 10.01930  36.88405   1.000 70.22501  ? 635 LYS A CB  1 
ATOM 5084  C CG  . LYS A 1 635 ? 102.33914 10.19717  36.44063   1.000 93.94672  ? 635 LYS A CG  1 
ATOM 5085  C CD  . LYS A 1 635 ? 102.72228 11.66361  36.34122   1.000 109.33016 ? 635 LYS A CD  1 
ATOM 5086  C CE  . LYS A 1 635 ? 104.20342 11.82699  36.03705   1.000 93.28337  ? 635 LYS A CE  1 
ATOM 5087  N NZ  . LYS A 1 635 ? 104.59694 13.26220  35.96275   1.000 69.31122  ? 635 LYS A NZ  1 
ATOM 5088  N N   . VAL A 1 636 ? 97.68079  9.94706   36.83611   1.000 67.58469  ? 636 VAL A N   1 
ATOM 5089  C CA  . VAL A 1 636 ? 96.42048  9.27278   37.14517   1.000 52.54664  ? 636 VAL A CA  1 
ATOM 5090  C C   . VAL A 1 636 ? 95.59827  9.06073   35.87817   1.000 60.26441  ? 636 VAL A C   1 
ATOM 5091  O O   . VAL A 1 636 ? 95.04888  7.97464   35.64612   1.000 72.87341  ? 636 VAL A O   1 
ATOM 5092  C CB  . VAL A 1 636 ? 95.63350  10.07267  38.19924   1.000 48.03533  ? 636 VAL A CB  1 
ATOM 5093  C CG1 . VAL A 1 636 ? 94.18657  9.60029   38.26542   1.000 47.18513  ? 636 VAL A CG1 1 
ATOM 5094  C CG2 . VAL A 1 636 ? 96.30016  9.95244   39.55515   1.000 49.67161  ? 636 VAL A CG2 1 
ATOM 5095  N N   . CYS A 1 637 ? 95.48542  10.10313  35.05092   1.000 68.55437  ? 637 CYS A N   1 
ATOM 5096  C CA  . CYS A 1 637 ? 94.72615  9.98910   33.80875   1.000 48.59301  ? 637 CYS A CA  1 
ATOM 5097  C C   . CYS A 1 637 ? 95.30027  8.89571   32.91681   1.000 53.98270  ? 637 CYS A C   1 
ATOM 5098  O O   . CYS A 1 637 ? 94.56769  8.02765   32.42435   1.000 72.59440  ? 637 CYS A O   1 
ATOM 5099  C CB  . CYS A 1 637 ? 94.71442  11.33092  33.07451   1.000 45.42407  ? 637 CYS A CB  1 
ATOM 5100  S SG  . CYS A 1 637 ? 93.86475  12.66796  33.94582   1.000 56.41224  ? 637 CYS A SG  1 
ATOM 5101  N N   . ARG A 1 638 ? 96.61921  8.91604   32.70800   1.000 49.39362  ? 638 ARG A N   1 
ATOM 5102  C CA  . ARG A 1 638 ? 97.24566  7.91396   31.85368   1.000 43.47149  ? 638 ARG A CA  1 
ATOM 5103  C C   . ARG A 1 638 ? 97.18346  6.52363   32.47294   1.000 47.42696  ? 638 ARG A C   1 
ATOM 5104  O O   . ARG A 1 638 ? 97.06349  5.53348   31.74543   1.000 59.11611  ? 638 ARG A O   1 
ATOM 5105  C CB  . ARG A 1 638 ? 98.69113  8.30719   31.55155   1.000 48.58208  ? 638 ARG A CB  1 
ATOM 5106  C CG  . ARG A 1 638 ? 98.81343  9.50430   30.62298   1.000 53.59921  ? 638 ARG A CG  1 
ATOM 5107  C CD  . ARG A 1 638 ? 100.26116 9.77701   30.25231   1.000 70.13024  ? 638 ARG A CD  1 
ATOM 5108  N NE  . ARG A 1 638 ? 101.03287 10.28184  31.38440   1.000 77.58446  ? 638 ARG A NE  1 
ATOM 5109  C CZ  . ARG A 1 638 ? 101.06768 11.55812  31.75438   1.000 63.57339  ? 638 ARG A CZ  1 
ATOM 5110  N NH1 . ARG A 1 638 ? 101.79762 11.92889  32.79683   1.000 66.49626  ? 638 ARG A NH1 1 
ATOM 5111  N NH2 . ARG A 1 638 ? 100.37340 12.46530  31.08137   1.000 50.63784  ? 638 ARG A NH2 1 
ATOM 5112  N N   . THR A 1 639 ? 97.23599  6.42614   33.80332   1.000 41.00029  ? 639 THR A N   1 
ATOM 5113  C CA  . THR A 1 639 ? 97.12644  5.12934   34.45867   1.000 40.91062  ? 639 THR A CA  1 
ATOM 5114  C C   . THR A 1 639 ? 95.74753  4.52619   34.24075   1.000 39.89930  ? 639 THR A C   1 
ATOM 5115  O O   . THR A 1 639 ? 95.62559  3.34524   33.90333   1.000 39.34159  ? 639 THR A O   1 
ATOM 5116  C CB  . THR A 1 639 ? 97.41837  5.26967   35.95373   1.000 73.78765  ? 639 THR A CB  1 
ATOM 5117  O OG1 . THR A 1 639 ? 98.72854  5.81860   36.14047   1.000 79.17986  ? 639 THR A OG1 1 
ATOM 5118  C CG2 . THR A 1 639 ? 97.33893  3.91527   36.64495   1.000 82.68206  ? 639 THR A CG2 1 
ATOM 5119  N N   . LEU A 1 640 ? 94.69343  5.32413   34.42730   1.000 41.87906  ? 640 LEU A N   1 
ATOM 5120  C CA  . LEU A 1 640 ? 93.34559  4.81938   34.17657   1.000 41.05452  ? 640 LEU A CA  1 
ATOM 5121  C C   . LEU A 1 640 ? 93.14579  4.47346   32.70474   1.000 44.66698  ? 640 LEU A C   1 
ATOM 5122  O O   . LEU A 1 640 ? 92.52091  3.45323   32.37865   1.000 39.05571  ? 640 LEU A O   1 
ATOM 5123  C CB  . LEU A 1 640 ? 92.30075  5.82756   34.64993   1.000 41.56610  ? 640 LEU A CB  1 
ATOM 5124  C CG  . LEU A 1 640 ? 92.31712  6.06605   36.15861   1.000 42.92830  ? 640 LEU A CG  1 
ATOM 5125  C CD1 . LEU A 1 640 ? 91.32280  7.14079   36.54121   1.000 43.53368  ? 640 LEU A CD1 1 
ATOM 5126  C CD2 . LEU A 1 640 ? 92.01757  4.76882   36.89153   1.000 42.95934  ? 640 LEU A CD2 1 
ATOM 5127  N N   . LEU A 1 641 ? 93.67507  5.30199   31.79922   1.000 45.00145  ? 641 LEU A N   1 
ATOM 5128  C CA  . LEU A 1 641 ? 93.55500  4.99894   30.37655   1.000 35.35505  ? 641 LEU A CA  1 
ATOM 5129  C C   . LEU A 1 641 ? 94.22953  3.67607   30.03818   1.000 34.86717  ? 641 LEU A C   1 
ATOM 5130  O O   . LEU A 1 641 ? 93.63096  2.81013   29.39146   1.000 34.08251  ? 641 LEU A O   1 
ATOM 5131  C CB  . LEU A 1 641 ? 94.15660  6.12339   29.53741   1.000 35.46355  ? 641 LEU A CB  1 
ATOM 5132  C CG  . LEU A 1 641 ? 94.26207  5.69953   28.07064   1.000 34.48855  ? 641 LEU A CG  1 
ATOM 5133  C CD1 . LEU A 1 641 ? 92.88597  5.65596   27.42236   1.000 33.82584  ? 641 LEU A CD1 1 
ATOM 5134  C CD2 . LEU A 1 641 ? 95.22070  6.57441   27.28897   1.000 34.73800  ? 641 LEU A CD2 1 
ATOM 5135  N N   . ALA A 1 642 ? 95.47705  3.49742   30.48136   1.000 37.46936  ? 642 ALA A N   1 
ATOM 5136  C CA  . ALA A 1 642 ? 96.20463  2.27069   30.18185   1.000 47.41564  ? 642 ALA A CA  1 
ATOM 5137  C C   . ALA A 1 642 ? 95.57953  1.06570   30.86810   1.000 42.38097  ? 642 ALA A C   1 
ATOM 5138  O O   . ALA A 1 642 ? 95.61892  -0.04047  30.32268   1.000 36.64047  ? 642 ALA A O   1 
ATOM 5139  C CB  . ALA A 1 642 ? 97.67116  2.41454   30.58756   1.000 62.49689  ? 642 ALA A CB  1 
ATOM 5140  N N   . LYS A 1 643 ? 94.99801  1.25598   32.05392   1.000 52.06870  ? 643 LYS A N   1 
ATOM 5141  C CA  . LYS A 1 643 ? 94.27766  0.17296   32.71179   1.000 40.45133  ? 643 LYS A CA  1 
ATOM 5142  C C   . LYS A 1 643 ? 93.08785  -0.27588  31.87570   1.000 36.94314  ? 643 LYS A C   1 
ATOM 5143  O O   . LYS A 1 643 ? 92.89265  -1.47487  31.64823   1.000 47.92157  ? 643 LYS A O   1 
ATOM 5144  C CB  . LYS A 1 643 ? 93.82470  0.61873   34.10214   1.000 39.27155  ? 643 LYS A CB  1 
ATOM 5145  C CG  . LYS A 1 643 ? 93.10369  -0.45648  34.89301   1.000 38.17137  ? 643 LYS A CG  1 
ATOM 5146  C CD  . LYS A 1 643 ? 92.69429  0.04846   36.26489   1.000 39.26446  ? 643 LYS A CD  1 
ATOM 5147  C CE  . LYS A 1 643 ? 92.05431  -1.05808  37.08272   1.000 57.68165  ? 643 LYS A CE  1 
ATOM 5148  N NZ  . LYS A 1 643 ? 90.78535  -1.52832  36.46307   1.000 61.55950  ? 643 LYS A NZ  1 
ATOM 5149  N N   . SER A 1 644 ? 92.28168  0.67932   31.40305   1.000 38.46011  ? 644 SER A N   1 
ATOM 5150  C CA  . SER A 1 644 ? 91.14311  0.32885   30.55800   1.000 46.32399  ? 644 SER A CA  1 
ATOM 5151  C C   . SER A 1 644 ? 91.60202  -0.33885  29.26598   1.000 43.98668  ? 644 SER A C   1 
ATOM 5152  O O   . SER A 1 644 ? 90.99696  -1.31855  28.81102   1.000 48.72054  ? 644 SER A O   1 
ATOM 5153  C CB  . SER A 1 644 ? 90.31214  1.57645   30.25742   1.000 45.98513  ? 644 SER A CB  1 
ATOM 5154  O OG  . SER A 1 644 ? 89.15251  1.25369   29.50981   1.000 65.82558  ? 644 SER A OG  1 
ATOM 5155  N N   . VAL A 1 645 ? 92.68466  0.16621   28.67099   1.000 38.17716  ? 645 VAL A N   1 
ATOM 5156  C CA  . VAL A 1 645 ? 93.18985  -0.41107  27.42735   1.000 39.96603  ? 645 VAL A CA  1 
ATOM 5157  C C   . VAL A 1 645 ? 93.63310  -1.85162  27.65312   1.000 37.22506  ? 645 VAL A C   1 
ATOM 5158  O O   . VAL A 1 645 ? 93.23217  -2.76406  26.91969   1.000 57.24934  ? 645 VAL A O   1 
ATOM 5159  C CB  . VAL A 1 645 ? 94.33067  0.45079   26.85736   1.000 37.17899  ? 645 VAL A CB  1 
ATOM 5160  C CG1 . VAL A 1 645 ? 94.94789  -0.21913  25.64408   1.000 36.71801  ? 645 VAL A CG1 1 
ATOM 5161  C CG2 . VAL A 1 645 ? 93.81591  1.82347   26.48932   1.000 37.13256  ? 645 VAL A CG2 1 
ATOM 5162  N N   . PHE A 1 646 ? 94.45696  -2.07821  28.68166   1.000 48.25728  ? 646 PHE A N   1 
ATOM 5163  C CA  . PHE A 1 646 ? 94.91867  -3.42847  28.98458   1.000 46.12013  ? 646 PHE A CA  1 
ATOM 5164  C C   . PHE A 1 646 ? 93.75202  -4.34956  29.31301   1.000 46.26955  ? 646 PHE A C   1 
ATOM 5165  O O   . PHE A 1 646 ? 93.77494  -5.53458  28.96648   1.000 35.52473  ? 646 PHE A O   1 
ATOM 5166  C CB  . PHE A 1 646 ? 95.91985  -3.39746  30.14003   1.000 49.17702  ? 646 PHE A CB  1 
ATOM 5167  C CG  . PHE A 1 646 ? 97.34882  -3.22124  29.70539   1.000 62.40614  ? 646 PHE A CG  1 
ATOM 5168  C CD1 . PHE A 1 646 ? 97.65908  -2.91506  28.39093   1.000 62.13555  ? 646 PHE A CD1 1 
ATOM 5169  C CD2 . PHE A 1 646 ? 98.38329  -3.36591  30.61448   1.000 55.80986  ? 646 PHE A CD2 1 
ATOM 5170  C CE1 . PHE A 1 646 ? 98.97644  -2.75459  27.99359   1.000 36.47386  ? 646 PHE A CE1 1 
ATOM 5171  C CE2 . PHE A 1 646 ? 99.70018  -3.20743  30.22486   1.000 38.16591  ? 646 PHE A CE2 1 
ATOM 5172  C CZ  . PHE A 1 646 ? 99.99752  -2.90114  28.91306   1.000 37.49460  ? 646 PHE A CZ  1 
ATOM 5173  N N   . ASN A 1 647 ? 92.71598  -3.82503  29.97233   1.000 63.27461  ? 647 ASN A N   1 
ATOM 5174  C CA  . ASN A 1 647 ? 91.50451  -4.61505  30.16145   1.000 49.11575  ? 647 ASN A CA  1 
ATOM 5175  C C   . ASN A 1 647 ? 90.86391  -4.96439  28.82696   1.000 34.21970  ? 647 ASN A C   1 
ATOM 5176  O O   . ASN A 1 647 ? 90.26782  -6.03742  28.68613   1.000 33.17952  ? 647 ASN A O   1 
ATOM 5177  C CB  . ASN A 1 647 ? 90.50761  -3.86794  31.04786   1.000 52.39763  ? 647 ASN A CB  1 
ATOM 5178  C CG  . ASN A 1 647 ? 91.01364  -3.67614  32.46204   1.000 52.99242  ? 647 ASN A CG  1 
ATOM 5179  O OD1 . ASN A 1 647 ? 91.79174  -4.48288  32.96991   1.000 40.22763  ? 647 ASN A OD1 1 
ATOM 5180  N ND2 . ASN A 1 647 ? 90.56943  -2.60500  33.10903   1.000 57.87556  ? 647 ASN A ND2 1 
ATOM 5181  N N   . SER A 1 648 ? 90.97055  -4.07153  27.84192   1.000 36.69089  ? 648 SER A N   1 
ATOM 5182  C CA  . SER A 1 648 ? 90.35492  -4.33573  26.54568   1.000 53.26606  ? 648 SER A CA  1 
ATOM 5183  C C   . SER A 1 648 ? 91.11475  -5.41051  25.77363   1.000 34.70078  ? 648 SER A C   1 
ATOM 5184  O O   . SER A 1 648 ? 90.50632  -6.33880  25.22794   1.000 34.68926  ? 648 SER A O   1 
ATOM 5185  C CB  . SER A 1 648 ? 90.27087  -3.04598  25.72937   1.000 68.44195  ? 648 SER A CB  1 
ATOM 5186  O OG  . SER A 1 648 ? 89.51855  -3.24551  24.54527   1.000 52.35099  ? 648 SER A OG  1 
ATOM 5187  N N   . LEU A 1 649 ? 92.44584  -5.31157  25.71681   1.000 38.80800  ? 649 LEU A N   1 
ATOM 5188  C CA  . LEU A 1 649 ? 93.19696  -6.27806  24.91775   1.000 48.60244  ? 649 LEU A CA  1 
ATOM 5189  C C   . LEU A 1 649 ? 93.57936  -7.52998  25.69684   1.000 59.05122  ? 649 LEU A C   1 
ATOM 5190  O O   . LEU A 1 649 ? 93.61522  -8.61964  25.11391   1.000 77.17675  ? 649 LEU A O   1 
ATOM 5191  C CB  . LEU A 1 649 ? 94.46030  -5.65949  24.30560   1.000 37.55173  ? 649 LEU A CB  1 
ATOM 5192  C CG  . LEU A 1 649 ? 95.65530  -5.19197  25.12841   1.000 35.21888  ? 649 LEU A CG  1 
ATOM 5193  C CD1 . LEU A 1 649 ? 96.90913  -5.56882  24.37872   1.000 36.11449  ? 649 LEU A CD1 1 
ATOM 5194  C CD2 . LEU A 1 649 ? 95.62171  -3.69914  25.29870   1.000 35.10555  ? 649 LEU A CD2 1 
ATOM 5195  N N   . TYR A 1 650 ? 93.87949  -7.41170  26.99130   1.000 37.82346  ? 650 TYR A N   1 
ATOM 5196  C CA  . TYR A 1 650 ? 94.08317  -8.58018  27.83635   1.000 36.35971  ? 650 TYR A CA  1 
ATOM 5197  C C   . TYR A 1 650 ? 92.77248  -9.10455  28.40979   1.000 49.60188  ? 650 TYR A C   1 
ATOM 5198  O O   . TYR A 1 650 ? 92.78193  -9.76062  29.45866   1.000 48.79642  ? 650 TYR A O   1 
ATOM 5199  C CB  . TYR A 1 650 ? 95.05500  -8.26520  28.97770   1.000 35.98077  ? 650 TYR A CB  1 
ATOM 5200  C CG  . TYR A 1 650 ? 96.52042  -8.29237  28.60564   1.000 39.46306  ? 650 TYR A CG  1 
ATOM 5201  C CD1 . TYR A 1 650 ? 97.18370  -9.49626  28.40566   1.000 63.18769  ? 650 TYR A CD1 1 
ATOM 5202  C CD2 . TYR A 1 650 ? 97.24690  -7.11579  28.47778   1.000 50.46770  ? 650 TYR A CD2 1 
ATOM 5203  C CE1 . TYR A 1 650 ? 98.52665  -9.52723  28.07504   1.000 82.45511  ? 650 TYR A CE1 1 
ATOM 5204  C CE2 . TYR A 1 650 ? 98.59090  -7.13672  28.14718   1.000 69.90438  ? 650 TYR A CE2 1 
ATOM 5205  C CZ  . TYR A 1 650 ? 99.22514  -8.34530  27.94687   1.000 84.42983  ? 650 TYR A CZ  1 
ATOM 5206  O OH  . TYR A 1 650 ? 100.56152 -8.37328  27.61725   1.000 93.47420  ? 650 TYR A OH  1 
ATOM 5207  N N   . ALA A 1 651 ? 91.65080  -8.81540  27.74946   1.000 56.74051  ? 651 ALA A N   1 
ATOM 5208  C CA  . ALA A 1 651 ? 90.34130  -9.21854  28.24489   1.000 50.09806  ? 651 ALA A CA  1 
ATOM 5209  C C   . ALA A 1 651 ? 90.25965  -10.73170 28.39038   1.000 46.80295  ? 651 ALA A C   1 
ATOM 5210  O O   . ALA A 1 651 ? 90.53093  -11.47749 27.44484   1.000 50.01823  ? 651 ALA A O   1 
ATOM 5211  C CB  . ALA A 1 651 ? 89.24619  -8.71823  27.30291   1.000 54.38139  ? 651 ALA A CB  1 
ATOM 5212  N N   . SER A 1 652 ? 89.87920  -11.18279 29.58547   1.000 43.30448  ? 652 SER A N   1 
ATOM 5213  C CA  . SER A 1 652 ? 89.74435  -12.59460 29.88165   1.000 45.90745  ? 652 SER A CA  1 
ATOM 5214  C C   . SER A 1 652 ? 88.64890  -12.74627 30.92404   1.000 62.28765  ? 652 SER A C   1 
ATOM 5215  O O   . SER A 1 652 ? 88.50409  -11.86620 31.78556   1.000 91.04500  ? 652 SER A O   1 
ATOM 5216  C CB  . SER A 1 652 ? 91.05387  -13.19861 30.39911   1.000 68.17809  ? 652 SER A CB  1 
ATOM 5217  O OG  . SER A 1 652 ? 92.11468  -12.97000 29.48680   1.000 102.59410 ? 652 SER A OG  1 
ATOM 5218  N N   . PRO A 1 653 ? 87.85661  -13.82062 30.86773   1.000 60.34520  ? 653 PRO A N   1 
ATOM 5219  C CA  . PRO A 1 653 ? 86.81205  -14.00848 31.88827   1.000 64.95297  ? 653 PRO A CA  1 
ATOM 5220  C C   . PRO A 1 653 ? 87.36114  -14.08757 33.30175   1.000 77.12317  ? 653 PRO A C   1 
ATOM 5221  O O   . PRO A 1 653 ? 86.62954  -13.78159 34.25398   1.000 88.09785  ? 653 PRO A O   1 
ATOM 5222  C CB  . PRO A 1 653 ? 86.13903  -15.32236 31.46540   1.000 57.86577  ? 653 PRO A CB  1 
ATOM 5223  C CG  . PRO A 1 653 ? 87.17024  -16.02934 30.64041   1.000 55.71125  ? 653 PRO A CG  1 
ATOM 5224  C CD  . PRO A 1 653 ? 87.90789  -14.94259 29.91502   1.000 58.30996  ? 653 PRO A CD  1 
ATOM 5225  N N   . GLN A 1 654 ? 88.62761  -14.47969 33.46866   1.000 59.15379  ? 654 GLN A N   1 
ATOM 5226  C CA  . GLN A 1 654 ? 89.25025  -14.41675 34.78560   1.000 49.04963  ? 654 GLN A CA  1 
ATOM 5227  C C   . GLN A 1 654 ? 89.27591  -12.98652 35.30476   1.000 41.90687  ? 654 GLN A C   1 
ATOM 5228  O O   . GLN A 1 654 ? 89.01756  -12.74438 36.48716   1.000 68.48553  ? 654 GLN A O   1 
ATOM 5229  C CB  . GLN A 1 654 ? 90.66995  -14.97943 34.73087   1.000 76.11491  ? 654 GLN A CB  1 
ATOM 5230  C CG  . GLN A 1 654 ? 90.79332  -16.36210 34.11935   1.000 108.09929 ? 654 GLN A CG  1 
ATOM 5231  C CD  . GLN A 1 654 ? 92.22255  -16.86563 34.14762   1.000 128.86799 ? 654 GLN A CD  1 
ATOM 5232  O OE1 . GLN A 1 654 ? 93.07844  -16.28868 34.81822   1.000 110.89170 ? 654 GLN A OE1 1 
ATOM 5233  N NE2 . GLN A 1 654 ? 92.49106  -17.94023 33.41410   1.000 155.70730 ? 654 GLN A NE2 1 
ATOM 5234  N N   . LEU A 1 655 ? 89.59023  -12.02582 34.43102   1.000 42.79131  ? 655 LEU A N   1 
ATOM 5235  C CA  . LEU A 1 655 ? 89.59316  -10.62164 34.83021   1.000 46.69896  ? 655 LEU A CA  1 
ATOM 5236  C C   . LEU A 1 655 ? 88.20332  -10.16616 35.25797   1.000 61.63760  ? 655 LEU A C   1 
ATOM 5237  O O   . LEU A 1 655 ? 88.05395  -9.45026  36.25545   1.000 52.27954  ? 655 LEU A O   1 
ATOM 5238  C CB  . LEU A 1 655 ? 90.11614  -9.76051  33.67998   1.000 45.57087  ? 655 LEU A CB  1 
ATOM 5239  C CG  . LEU A 1 655 ? 90.05570  -8.24085  33.83130   1.000 57.08671  ? 655 LEU A CG  1 
ATOM 5240  C CD1 . LEU A 1 655 ? 90.91772  -7.78218  34.99594   1.000 68.34860  ? 655 LEU A CD1 1 
ATOM 5241  C CD2 . LEU A 1 655 ? 90.48679  -7.56601  32.53910   1.000 58.61559  ? 655 LEU A CD2 1 
ATOM 5242  N N   . GLU A 1 656 ? 87.17368  -10.57919 34.51684   1.000 62.45486  ? 656 GLU A N   1 
ATOM 5243  C CA  . GLU A 1 656 ? 85.80175  -10.22687 34.86900   1.000 56.29201  ? 656 GLU A CA  1 
ATOM 5244  C C   . GLU A 1 656 ? 85.42363  -10.79353 36.23332   1.000 50.92591  ? 656 GLU A C   1 
ATOM 5245  O O   . GLU A 1 656 ? 84.89822  -10.07623 37.09659   1.000 50.08801  ? 656 GLU A O   1 
ATOM 5246  C CB  . GLU A 1 656 ? 84.85402  -10.73127 33.77917   1.000 63.26821  ? 656 GLU A CB  1 
ATOM 5247  C CG  . GLU A 1 656 ? 83.37564  -10.63506 34.10516   1.000 72.10890  ? 656 GLU A CG  1 
ATOM 5248  C CD  . GLU A 1 656 ? 82.50775  -11.09373 32.94786   1.000 65.83425  ? 656 GLU A CD  1 
ATOM 5249  O OE1 . GLU A 1 656 ? 83.03741  -11.21021 31.82229   1.000 56.33532  ? 656 GLU A OE1 1 
ATOM 5250  O OE2 . GLU A 1 656 ? 81.30136  -11.33861 33.16046   1.000 66.05734  ? 656 GLU A OE2 1 
ATOM 5251  N N   . GLY A 1 657 ? 85.68261  -12.08738 36.44203   1.000 69.35305  ? 657 GLY A N   1 
ATOM 5252  C CA  . GLY A 1 657 ? 85.37529  -12.69747 37.72620   1.000 64.74404  ? 657 GLY A CA  1 
ATOM 5253  C C   . GLY A 1 657 ? 86.14782  -12.07104 38.87106   1.000 46.32017  ? 657 GLY A C   1 
ATOM 5254  O O   . GLY A 1 657 ? 85.60853  -11.87560 39.96474   1.000 46.27628  ? 657 GLY A O   1 
ATOM 5255  N N   . PHE A 1 658 ? 87.42162  -11.74547 38.63550   1.000 43.66518  ? 658 PHE A N   1 
ATOM 5256  C CA  . PHE A 1 658 ? 88.23448  -11.11693 39.66957   1.000 44.62510  ? 658 PHE A CA  1 
ATOM 5257  C C   . PHE A 1 658 ? 87.68667  -9.74492  40.02785   1.000 59.16271  ? 658 PHE A C   1 
ATOM 5258  O O   . PHE A 1 658 ? 87.60143  -9.39158  41.20673   1.000 72.52724  ? 658 PHE A O   1 
ATOM 5259  C CB  . PHE A 1 658 ? 89.69107  -11.00839 39.21748   1.000 43.91214  ? 658 PHE A CB  1 
ATOM 5260  C CG  . PHE A 1 658 ? 90.61114  -10.48025 40.28222   1.000 44.80781  ? 658 PHE A CG  1 
ATOM 5261  C CD1 . PHE A 1 658 ? 90.36548  -10.74675 41.61926   1.000 46.22188  ? 658 PHE A CD1 1 
ATOM 5262  C CD2 . PHE A 1 658 ? 91.70161  -9.69483  39.95200   1.000 56.01010  ? 658 PHE A CD2 1 
ATOM 5263  C CE1 . PHE A 1 658 ? 91.19706  -10.25662 42.60436   1.000 47.21329  ? 658 PHE A CE1 1 
ATOM 5264  C CE2 . PHE A 1 658 ? 92.53829  -9.19985  40.93552   1.000 58.91031  ? 658 PHE A CE2 1 
ATOM 5265  C CZ  . PHE A 1 658 ? 92.28434  -9.48214  42.26315   1.000 46.81067  ? 658 PHE A CZ  1 
ATOM 5266  N N   . SER A 1 659 ? 87.33731  -8.94277  39.01941   1.000 46.54533  ? 659 SER A N   1 
ATOM 5267  C CA  . SER A 1 659 ? 86.73247  -7.64486  39.29431   1.000 54.20855  ? 659 SER A CA  1 
ATOM 5268  C C   . SER A 1 659 ? 85.46754  -7.81129  40.12505   1.000 47.29917  ? 659 SER A C   1 
ATOM 5269  O O   . SER A 1 659 ? 85.29313  -7.14861  41.15662   1.000 48.11537  ? 659 SER A O   1 
ATOM 5270  C CB  . SER A 1 659 ? 86.42647  -6.91743  37.98332   1.000 72.09865  ? 659 SER A CB  1 
ATOM 5271  O OG  . SER A 1 659 ? 87.61535  -6.60689  37.27731   1.000 77.55910  ? 659 SER A OG  1 
ATOM 5272  N N   . ALA A 1 660 ? 84.59189  -8.73139  39.70744   1.000 46.46087  ? 660 ALA A N   1 
ATOM 5273  C CA  . ALA A 1 660 ? 83.31835  -8.91823  40.39523   1.000 53.94386  ? 660 ALA A CA  1 
ATOM 5274  C C   . ALA A 1 660 ? 83.51750  -9.33268  41.84797   1.000 50.72154  ? 660 ALA A C   1 
ATOM 5275  O O   . ALA A 1 660 ? 82.83348  -8.82381  42.74379   1.000 67.73096  ? 660 ALA A O   1 
ATOM 5276  C CB  . ALA A 1 660 ? 82.47185  -9.95360  39.65620   1.000 73.73492  ? 660 ALA A CB  1 
ATOM 5277  N N   . GLU A 1 661 ? 84.44571  -10.25624 42.10536   1.000 51.13737  ? 661 GLU A N   1 
ATOM 5278  C CA  . GLU A 1 661 ? 84.60335  -10.75947 43.46656   1.000 54.88297  ? 661 GLU A CA  1 
ATOM 5279  C C   . GLU A 1 661 ? 85.41224  -9.81112  44.34656   1.000 46.66789  ? 661 GLU A C   1 
ATOM 5280  O O   . GLU A 1 661 ? 85.11834  -9.67362  45.53928   1.000 47.97966  ? 661 GLU A O   1 
ATOM 5281  C CB  . GLU A 1 661 ? 85.24547  -12.14730 43.44288   1.000 77.93248  ? 661 GLU A CB  1 
ATOM 5282  C CG  . GLU A 1 661 ? 84.39516  -13.21278 42.76419   1.000 100.14417 ? 661 GLU A CG  1 
ATOM 5283  C CD  . GLU A 1 661 ? 83.04656  -13.41355 43.43846   1.000 126.12404 ? 661 GLU A CD  1 
ATOM 5284  O OE1 . GLU A 1 661 ? 82.92523  -13.12129 44.64782   1.000 139.71234 ? 661 GLU A OE1 1 
ATOM 5285  O OE2 . GLU A 1 661 ? 82.10181  -13.85981 42.75433   1.000 137.27929 ? 661 GLU A OE2 1 
ATOM 5286  N N   . SER A 1 662 ? 86.43122  -9.15176  43.79096   1.000 49.64313  ? 662 SER A N   1 
ATOM 5287  C CA  . SER A 1 662 ? 87.25131  -8.23351  44.56779   1.000 50.23109  ? 662 SER A CA  1 
ATOM 5288  C C   . SER A 1 662 ? 86.56065  -6.90519  44.83797   1.000 50.18661  ? 662 SER A C   1 
ATOM 5289  O O   . SER A 1 662 ? 86.94174  -6.21291  45.78855   1.000 51.17049  ? 662 SER A O   1 
ATOM 5290  C CB  . SER A 1 662 ? 88.58242  -7.98230  43.85403   1.000 49.44459  ? 662 SER A CB  1 
ATOM 5291  O OG  . SER A 1 662 ? 88.37804  -7.42512  42.56705   1.000 47.87986  ? 662 SER A OG  1 
ATOM 5292  N N   . ARG A 1 663 ? 85.56732  -6.52492  44.02686   1.000 50.44581  ? 663 ARG A N   1 
ATOM 5293  C CA  . ARG A 1 663 ? 84.83434  -5.29446  44.30489   1.000 50.57688  ? 663 ARG A CA  1 
ATOM 5294  C C   . ARG A 1 663 ? 84.11734  -5.37070  45.64632   1.000 52.16713  ? 663 ARG A C   1 
ATOM 5295  O O   . ARG A 1 663 ? 84.04074  -4.37560  46.37562   1.000 69.51644  ? 663 ARG A O   1 
ATOM 5296  C CB  . ARG A 1 663 ? 83.83969  -5.01576  43.17962   1.000 54.10772  ? 663 ARG A CB  1 
ATOM 5297  C CG  . ARG A 1 663 ? 83.42905  -3.55927  43.05091   1.000 50.78109  ? 663 ARG A CG  1 
ATOM 5298  C CD  . ARG A 1 663 ? 82.41352  -3.36674  41.93420   1.000 48.53535  ? 663 ARG A CD  1 
ATOM 5299  N NE  . ARG A 1 663 ? 82.86318  -3.95598  40.67639   1.000 46.96621  ? 663 ARG A NE  1 
ATOM 5300  C CZ  . ARG A 1 663 ? 82.35794  -5.06786  40.15310   1.000 46.73325  ? 663 ARG A CZ  1 
ATOM 5301  N NH1 . ARG A 1 663 ? 81.38327  -5.71126  40.78092   1.000 47.66151  ? 663 ARG A NH1 1 
ATOM 5302  N NH2 . ARG A 1 663 ? 82.82691  -5.53618  39.00519   1.000 51.79075  ? 663 ARG A NH2 1 
ATOM 5303  N N   . LYS A 1 664 ? 83.59748  -6.54899  45.99493   1.000 53.27069  ? 664 LYS A N   1 
ATOM 5304  C CA  . LYS A 1 664 ? 82.92491  -6.71397  47.27916   1.000 54.92047  ? 664 LYS A CA  1 
ATOM 5305  C C   . LYS A 1 664 ? 83.90437  -6.54973  48.43446   1.000 63.32305  ? 664 LYS A C   1 
ATOM 5306  O O   . LYS A 1 664 ? 83.61581  -5.84984  49.41409   1.000 69.39230  ? 664 LYS A O   1 
ATOM 5307  C CB  . LYS A 1 664 ? 82.23782  -8.07753  47.33801   1.000 55.44462  ? 664 LYS A CB  1 
ATOM 5308  C CG  . LYS A 1 664 ? 81.11718  -8.23730  46.32734   1.000 56.58702  ? 664 LYS A CG  1 
ATOM 5309  C CD  . LYS A 1 664 ? 80.44801  -9.59428  46.44609   1.000 57.10060  ? 664 LYS A CD  1 
ATOM 5310  C CE  . LYS A 1 664 ? 79.26264  -9.70252  45.50009   1.000 57.82202  ? 664 LYS A CE  1 
ATOM 5311  N NZ  . LYS A 1 664 ? 79.67739  -9.58709  44.07181   1.000 54.32909  ? 664 LYS A NZ  1 
ATOM 5312  N N   . LEU A 1 665 ? 85.06406  -7.20557  48.34336   1.000 67.78081  ? 665 LEU A N   1 
ATOM 5313  C CA  . LEU A 1 665 ? 86.08158  -7.05349  49.37660   1.000 62.18786  ? 665 LEU A CA  1 
ATOM 5314  C C   . LEU A 1 665 ? 86.52457  -5.60242  49.49575   1.000 55.56179  ? 665 LEU A C   1 
ATOM 5315  O O   . LEU A 1 665 ? 86.71849  -5.09473  50.60505   1.000 57.04239  ? 665 LEU A O   1 
ATOM 5316  C CB  . LEU A 1 665 ? 87.27579  -7.95722  49.06766   1.000 55.50799  ? 665 LEU A CB  1 
ATOM 5317  C CG  . LEU A 1 665 ? 88.42329  -7.97051  50.07904   1.000 57.02414  ? 665 LEU A CG  1 
ATOM 5318  C CD1 . LEU A 1 665 ? 87.91547  -8.35509  51.45887   1.000 59.00506  ? 665 LEU A CD1 1 
ATOM 5319  C CD2 . LEU A 1 665 ? 89.53332  -8.91097  49.63001   1.000 56.85104  ? 665 LEU A CD2 1 
ATOM 5320  N N   . LEU A 1 666 ? 86.65447  -4.90956  48.36222   1.000 67.47115  ? 666 LEU A N   1 
ATOM 5321  C CA  . LEU A 1 666 ? 87.02303  -3.49801  48.38710   1.000 62.36951  ? 666 LEU A CA  1 
ATOM 5322  C C   . LEU A 1 666 ? 85.96212  -2.65859  49.08796   1.000 67.65041  ? 666 LEU A C   1 
ATOM 5323  O O   . LEU A 1 666 ? 86.28731  -1.77559  49.89034   1.000 74.87238  ? 666 LEU A O   1 
ATOM 5324  C CB  . LEU A 1 666 ? 87.24247  -2.99649  46.96157   1.000 51.96719  ? 666 LEU A CB  1 
ATOM 5325  C CG  . LEU A 1 666 ? 87.30744  -1.48265  46.76694   1.000 51.77429  ? 666 LEU A CG  1 
ATOM 5326  C CD1 . LEU A 1 666 ? 88.59891  -0.91765  47.33895   1.000 52.71569  ? 666 LEU A CD1 1 
ATOM 5327  C CD2 . LEU A 1 666 ? 87.15467  -1.13492  45.29815   1.000 49.99417  ? 666 LEU A CD2 1 
ATOM 5328  N N   . LEU A 1 667 ? 84.68527  -2.91263  48.79025   1.000 72.79573  ? 667 LEU A N   1 
ATOM 5329  C CA  . LEU A 1 667 ? 83.61685  -2.14301  49.41955   1.000 77.12778  ? 667 LEU A CA  1 
ATOM 5330  C C   . LEU A 1 667 ? 83.55508  -2.39807  50.92022   1.000 82.46393  ? 667 LEU A C   1 
ATOM 5331  O O   . LEU A 1 667 ? 83.29595  -1.47411  51.69948   1.000 71.10337  ? 667 LEU A O   1 
ATOM 5332  C CB  . LEU A 1 667 ? 82.27424  -2.46231  48.76355   1.000 63.79386  ? 667 LEU A CB  1 
ATOM 5333  C CG  . LEU A 1 667 ? 82.07707  -1.90857  47.35160   1.000 50.30798  ? 667 LEU A CG  1 
ATOM 5334  C CD1 . LEU A 1 667 ? 80.74948  -2.37418  46.77559   1.000 49.59216  ? 667 LEU A CD1 1 
ATOM 5335  C CD2 . LEU A 1 667 ? 82.16751  -0.39050  47.35354   1.000 50.24015  ? 667 LEU A CD2 1 
ATOM 5336  N N   . VAL A 1 668 ? 83.79763  -3.63823  51.35124   1.000 84.81530  ? 668 VAL A N   1 
ATOM 5337  C CA  . VAL A 1 668 ? 83.77320  -3.89919  52.78896   1.000 66.73457  ? 668 VAL A CA  1 
ATOM 5338  C C   . VAL A 1 668 ? 84.99902  -3.28916  53.46437   1.000 64.14125  ? 668 VAL A C   1 
ATOM 5339  O O   . VAL A 1 668 ? 84.91639  -2.81133  54.60445   1.000 65.89645  ? 668 VAL A O   1 
ATOM 5340  C CB  . VAL A 1 668 ? 83.64872  -5.40626  53.07936   1.000 63.71186  ? 668 VAL A CB  1 
ATOM 5341  C CG1 . VAL A 1 668 ? 83.38815  -5.62459  54.55358   1.000 70.42889  ? 668 VAL A CG1 1 
ATOM 5342  C CG2 . VAL A 1 668 ? 82.51647  -6.00855  52.27239   1.000 62.70451  ? 668 VAL A CG2 1 
ATOM 5343  N N   . VAL A 1 669 ? 86.14523  -3.27301  52.77785   1.000 70.96237  ? 669 VAL A N   1 
ATOM 5344  C CA  . VAL A 1 669 ? 87.31565  -2.57612  53.30627   1.000 71.91484  ? 669 VAL A CA  1 
ATOM 5345  C C   . VAL A 1 669 ? 87.00997  -1.09340  53.47446   1.000 77.13794  ? 669 VAL A C   1 
ATOM 5346  O O   . VAL A 1 669 ? 87.38868  -0.47222  54.47534   1.000 73.94472  ? 669 VAL A O   1 
ATOM 5347  C CB  . VAL A 1 669 ? 88.53366  -2.79969  52.38721   1.000 70.72612  ? 669 VAL A CB  1 
ATOM 5348  C CG1 . VAL A 1 669 ? 89.65929  -1.83874  52.74191   1.000 71.57785  ? 669 VAL A CG1 1 
ATOM 5349  C CG2 . VAL A 1 669 ? 89.01777  -4.23923  52.46617   1.000 70.96460  ? 669 VAL A CG2 1 
ATOM 5350  N N   . GLN A 1 670 ? 86.30823  -0.50780  52.50115   1.000 96.83299  ? 670 GLN A N   1 
ATOM 5351  C CA  . GLN A 1 670 ? 85.93772  0.90180   52.58755   1.000 84.95331  ? 670 GLN A CA  1 
ATOM 5352  C C   . GLN A 1 670 ? 84.94818  1.14925   53.72105   1.000 70.96925  ? 670 GLN A C   1 
ATOM 5353  O O   . GLN A 1 670 ? 85.03897  2.16476   54.42066   1.000 90.13009  ? 670 GLN A O   1 
ATOM 5354  C CB  . GLN A 1 670 ? 85.35343  1.36890   51.25432   1.000 82.33296  ? 670 GLN A CB  1 
ATOM 5355  C CG  . GLN A 1 670 ? 84.93938  2.82835   51.23578   1.000 80.65652  ? 670 GLN A CG  1 
ATOM 5356  C CD  . GLN A 1 670 ? 86.11680  3.76489   51.41706   1.000 74.72647  ? 670 GLN A CD  1 
ATOM 5357  O OE1 . GLN A 1 670 ? 87.17210  3.57729   50.81147   1.000 76.00286  ? 670 GLN A OE1 1 
ATOM 5358  N NE2 . GLN A 1 670 ? 85.94505  4.77618   52.25986   1.000 69.75462  ? 670 GLN A NE2 1 
ATOM 5359  N N   . ALA A 1 671 ? 83.99344  0.23454   53.91350   1.000 73.10168  ? 671 ALA A N   1 
ATOM 5360  C CA  . ALA A 1 671 ? 83.05178  0.36568   55.02088   1.000 81.89924  ? 671 ALA A CA  1 
ATOM 5361  C C   . ALA A 1 671 ? 83.74555  0.25546   56.37265   1.000 76.70151  ? 671 ALA A C   1 
ATOM 5362  O O   . ALA A 1 671 ? 83.32640  0.90759   57.33588   1.000 74.15626  ? 671 ALA A O   1 
ATOM 5363  C CB  . ALA A 1 671 ? 81.95112  -0.68865  54.90323   1.000 85.69257  ? 671 ALA A CB  1 
ATOM 5364  N N   . LEU A 1 672 ? 84.79863  -0.56019  56.46895   1.000 69.96729  ? 672 LEU A N   1 
ATOM 5365  C CA  . LEU A 1 672 ? 85.57537  -0.59955  57.70530   1.000 72.12286  ? 672 LEU A CA  1 
ATOM 5366  C C   . LEU A 1 672 ? 86.39022  0.67598   57.87752   1.000 82.87923  ? 672 LEU A C   1 
ATOM 5367  O O   . LEU A 1 672 ? 86.54105  1.17639   58.99815   1.000 97.98897  ? 672 LEU A O   1 
ATOM 5368  C CB  . LEU A 1 672 ? 86.48659  -1.82886  57.72841   1.000 72.15588  ? 672 LEU A CB  1 
ATOM 5369  C CG  . LEU A 1 672 ? 87.06523  -2.28537  59.07852   1.000 74.59754  ? 672 LEU A CG  1 
ATOM 5370  C CD1 . LEU A 1 672 ? 88.29694  -1.47985  59.49032   1.000 79.59739  ? 672 LEU A CD1 1 
ATOM 5371  C CD2 . LEU A 1 672 ? 86.01728  -2.22796  60.17640   1.000 77.97315  ? 672 LEU A CD2 1 
ATOM 5372  N N   . ARG A 1 673 ? 86.91947  1.21801   56.77722   1.000 69.31269  ? 673 ARG A N   1 
ATOM 5373  C CA  . ARG A 1 673 ? 87.72648  2.43047   56.86419   1.000 81.47805  ? 673 ARG A CA  1 
ATOM 5374  C C   . ARG A 1 673 ? 86.88238  3.63533   57.26046   1.000 98.73608  ? 673 ARG A C   1 
ATOM 5375  O O   . ARG A 1 673 ? 87.39222  4.56522   57.89559   1.000 114.41000 ? 673 ARG A O   1 
ATOM 5376  C CB  . ARG A 1 673 ? 88.45442  2.67878   55.54015   1.000 73.92936  ? 673 ARG A CB  1 
ATOM 5377  C CG  . ARG A 1 673 ? 89.65521  1.75765   55.33938   1.000 74.85571  ? 673 ARG A CG  1 
ATOM 5378  C CD  . ARG A 1 673 ? 90.70643  2.31548   54.38121   1.000 66.63385  ? 673 ARG A CD  1 
ATOM 5379  N NE  . ARG A 1 673 ? 90.23418  2.44981   53.00708   1.000 64.31912  ? 673 ARG A NE  1 
ATOM 5380  C CZ  . ARG A 1 673 ? 90.06808  3.61191   52.38467   1.000 73.18557  ? 673 ARG A CZ  1 
ATOM 5381  N NH1 . ARG A 1 673 ? 90.34325  4.74780   53.01136   1.000 70.40167  ? 673 ARG A NH1 1 
ATOM 5382  N NH2 . ARG A 1 673 ? 89.63648  3.63941   51.13156   1.000 71.91910  ? 673 ARG A NH2 1 
ATOM 5383  N N   . ASP A 1 674 ? 85.60086  3.64100   56.89781   1.000 85.23524  ? 674 ASP A N   1 
ATOM 5384  C CA  . ASP A 1 674 ? 84.67984  4.67778   57.34577   1.000 90.76778  ? 674 ASP A CA  1 
ATOM 5385  C C   . ASP A 1 674 ? 84.16449  4.43234   58.75837   1.000 108.72117 ? 674 ASP A C   1 
ATOM 5386  O O   . ASP A 1 674 ? 83.34651  5.22064   59.24630   1.000 118.46183 ? 674 ASP A O   1 
ATOM 5387  C CB  . ASP A 1 674 ? 83.49653  4.78255   56.38088   1.000 85.54080  ? 674 ASP A CB  1 
ATOM 5388  C CG  . ASP A 1 674 ? 83.92153  5.15623   54.97515   1.000 101.52608 ? 674 ASP A CG  1 
ATOM 5389  O OD1 . ASP A 1 674 ? 84.95413  5.84334   54.82620   1.000 107.09598 ? 674 ASP A OD1 1 
ATOM 5390  O OD2 . ASP A 1 674 ? 83.22160  4.76190   54.01783   1.000 106.66712 ? 674 ASP A OD2 1 
ATOM 5391  N N   . ASN A 1 675 ? 84.62090  3.36226   59.41280   1.000 108.99063 ? 675 ASN A N   1 
ATOM 5392  C CA  . ASN A 1 675 ? 84.20832  2.99770   60.76827   1.000 101.41353 ? 675 ASN A CA  1 
ATOM 5393  C C   . ASN A 1 675 ? 82.69047  2.81198   60.84792   1.000 100.75410 ? 675 ASN A C   1 
ATOM 5394  O O   . ASN A 1 675 ? 81.99075  3.46733   61.62360   1.000 93.52474  ? 675 ASN A O   1 
ATOM 5395  C CB  . ASN A 1 675 ? 84.69912  4.03489   61.78587   1.000 91.75248  ? 675 ASN A CB  1 
ATOM 5396  C CG  . ASN A 1 675 ? 84.74641  3.48811   63.19881   1.000 101.00626 ? 675 ASN A CG  1 
ATOM 5397  O OD1 . ASN A 1 675 ? 84.42185  2.32544   63.43739   1.000 114.60233 ? 675 ASN A OD1 1 
ATOM 5398  N ND2 . ASN A 1 675 ? 85.15528  4.32634   64.14542   1.000 102.36977 ? 675 ASN A ND2 1 
ATOM 5399  N N   . LEU A 1 676 ? 82.18994  1.89657   60.01574   1.000 114.12875 ? 676 LEU A N   1 
ATOM 5400  C CA  . LEU A 1 676 ? 80.77097  1.56757   59.96442   1.000 74.91531  ? 676 LEU A CA  1 
ATOM 5401  C C   . LEU A 1 676 ? 80.48327  0.16683   60.49626   1.000 75.60056  ? 676 LEU A C   1 
ATOM 5402  O O   . LEU A 1 676 ? 79.45689  -0.42413  60.14412   1.000 75.00694  ? 676 LEU A O   1 
ATOM 5403  C CB  . LEU A 1 676 ? 80.24740  1.70816   58.53551   1.000 72.51085  ? 676 LEU A CB  1 
ATOM 5404  C CG  . LEU A 1 676 ? 80.26704  3.11553   57.93585   1.000 71.87883  ? 676 LEU A CG  1 
ATOM 5405  C CD1 . LEU A 1 676 ? 79.55004  3.13341   56.59471   1.000 71.55330  ? 676 LEU A CD1 1 
ATOM 5406  C CD2 . LEU A 1 676 ? 79.64561  4.11903   58.89716   1.000 73.92891  ? 676 LEU A CD2 1 
ATOM 5407  N N   . GLU A 1 677 ? 81.36669  -0.36030  61.34977   1.000 74.01374  ? 677 GLU A N   1 
ATOM 5408  C CA  . GLU A 1 677 ? 81.29460  -1.68642  61.95863   1.000 74.99009  ? 677 GLU A CA  1 
ATOM 5409  C C   . GLU A 1 677 ? 80.69309  -2.75329  61.01828   1.000 73.25468  ? 677 GLU A C   1 
ATOM 5410  O O   . GLU A 1 677 ? 79.63384  -3.29065  61.29163   1.000 73.86412  ? 677 GLU A O   1 
ATOM 5411  C CB  . GLU A 1 677 ? 80.53310  -1.64574  63.28240   1.000 77.52591  ? 677 GLU A CB  1 
ATOM 5412  C CG  . GLU A 1 677 ? 79.20732  -0.89388  63.27690   1.000 106.03247 ? 677 GLU A CG  1 
ATOM 5413  C CD  . GLU A 1 677 ? 78.75302  -0.50349  64.66938   1.000 101.33369 ? 677 GLU A CD  1 
ATOM 5414  O OE1 . GLU A 1 677 ? 79.50604  -0.75684  65.63356   1.000 98.78749  ? 677 GLU A OE1 1 
ATOM 5415  O OE2 . GLU A 1 677 ? 77.64788  0.06476   64.79907   1.000 92.43199  ? 677 GLU A OE2 1 
ATOM 5416  N N   . PRO A 1 678 ? 81.37727  -3.05456  59.91368   1.000 73.57340  ? 678 PRO A N   1 
ATOM 5417  C CA  . PRO A 1 678 ? 80.85849  -4.05773  58.97884   1.000 72.01770  ? 678 PRO A CA  1 
ATOM 5418  C C   . PRO A 1 678 ? 81.15583  -5.47699  59.44756   1.000 72.92266  ? 678 PRO A C   1 
ATOM 5419  O O   . PRO A 1 678 ? 81.92431  -5.71486  60.37994   1.000 74.53741  ? 678 PRO A O   1 
ATOM 5420  C CB  . PRO A 1 678 ? 81.60276  -3.73515  57.68059   1.000 80.41257  ? 678 PRO A CB  1 
ATOM 5421  C CG  . PRO A 1 678 ? 82.90613  -3.21020  58.14363   1.000 73.05272  ? 678 PRO A CG  1 
ATOM 5422  C CD  . PRO A 1 678 ? 82.61839  -2.44169  59.41309   1.000 72.74704  ? 678 PRO A CD  1 
ATOM 5423  N N   . GLY A 1 679 ? 80.52266  -6.42772  58.76770   1.000 93.70288  ? 679 GLY A N   1 
ATOM 5424  C CA  . GLY A 1 679 ? 80.72793  -7.83303  59.05883   1.000 83.37695  ? 679 GLY A CA  1 
ATOM 5425  C C   . GLY A 1 679 ? 80.31197  -8.68078  57.88161   1.000 68.32502  ? 679 GLY A C   1 
ATOM 5426  O O   . GLY A 1 679 ? 79.46043  -8.28343  57.08056   1.000 64.11580  ? 679 GLY A O   1 
ATOM 5427  N N   . THR A 1 680 ? 80.92902  -9.85115  57.76686   1.000 70.14358  ? 680 THR A N   1 
ATOM 5428  C CA  . THR A 1 680 ? 80.65322  -10.79036 56.69022   1.000 68.80276  ? 680 THR A CA  1 
ATOM 5429  C C   . THR A 1 680 ? 79.95701  -12.03136 57.24126   1.000 70.35785  ? 680 THR A C   1 
ATOM 5430  O O   . THR A 1 680 ? 79.69452  -12.15104 58.44127   1.000 79.85520  ? 680 THR A O   1 
ATOM 5431  C CB  . THR A 1 680 ? 81.94353  -11.16789 55.95868   1.000 67.62249  ? 680 THR A CB  1 
ATOM 5432  O OG1 . THR A 1 680 ? 82.78327  -11.93497 56.83036   1.000 69.27291  ? 680 THR A OG1 1 
ATOM 5433  C CG2 . THR A 1 680 ? 82.68889  -9.92091  55.51157   1.000 74.49904  ? 680 THR A CG2 1 
ATOM 5434  N N   . PHE A 1 681 ? 79.65703  -12.96442 56.33851   1.000 67.55628  ? 681 PHE A N   1 
ATOM 5435  C CA  . PHE A 1 681 ? 79.12815  -14.27493 56.69602   1.000 77.04786  ? 681 PHE A CA  1 
ATOM 5436  C C   . PHE A 1 681 ? 80.13957  -15.38612 56.46691   1.000 69.07153  ? 681 PHE A C   1 
ATOM 5437  O O   . PHE A 1 681 ? 80.42945  -16.16156 57.38288   1.000 70.97734  ? 681 PHE A O   1 
ATOM 5438  C CB  . PHE A 1 681 ? 77.85548  -14.60045 55.89758   1.000 96.79087  ? 681 PHE A CB  1 
ATOM 5439  C CG  . PHE A 1 681 ? 76.81141  -13.52367 55.92006   1.000 101.90232 ? 681 PHE A CG  1 
ATOM 5440  C CD1 . PHE A 1 681 ? 76.85028  -12.48015 55.01083   1.000 96.68662  ? 681 PHE A CD1 1 
ATOM 5441  C CD2 . PHE A 1 681 ? 75.77239  -13.57151 56.83362   1.000 69.89734  ? 681 PHE A CD2 1 
ATOM 5442  C CE1 . PHE A 1 681 ? 75.88079  -11.49793 55.02270   1.000 84.75383  ? 681 PHE A CE1 1 
ATOM 5443  C CE2 . PHE A 1 681 ? 74.80235  -12.59105 56.85146   1.000 69.80549  ? 681 PHE A CE2 1 
ATOM 5444  C CZ  . PHE A 1 681 ? 74.85299  -11.55683 55.94231   1.000 67.88806  ? 681 PHE A CZ  1 
ATOM 5445  N N   . ASP A 1 682 ? 80.67076  -15.49279 55.24868   1.000 83.81000  ? 682 ASP A N   1 
ATOM 5446  C CA  . ASP A 1 682 ? 81.66270  -16.50371 54.88219   1.000 82.12476  ? 682 ASP A CA  1 
ATOM 5447  C C   . ASP A 1 682 ? 82.76868  -15.79468 54.10573   1.000 97.30437  ? 682 ASP A C   1 
ATOM 5448  O O   . ASP A 1 682 ? 82.73247  -15.73267 52.87407   1.000 114.89068 ? 682 ASP A O   1 
ATOM 5449  C CB  . ASP A 1 682 ? 81.01677  -17.62456 54.06498   1.000 65.52932  ? 682 ASP A CB  1 
ATOM 5450  C CG  . ASP A 1 682 ? 81.98564  -18.74361 53.72348   1.000 65.74015  ? 682 ASP A CG  1 
ATOM 5451  O OD1 . ASP A 1 682 ? 83.14171  -18.71364 54.19606   1.000 68.34825  ? 682 ASP A OD1 1 
ATOM 5452  O OD2 . ASP A 1 682 ? 81.58483  -19.65819 52.97265   1.000 65.51390  ? 682 ASP A OD2 1 
ATOM 5453  N N   . LEU A 1 683 ? 83.75374  -15.25996 54.83217   1.000 79.26908  ? 683 LEU A N   1 
ATOM 5454  C CA  . LEU A 1 683 ? 84.90207  -14.64758 54.17360   1.000 73.25635  ? 683 LEU A CA  1 
ATOM 5455  C C   . LEU A 1 683 ? 85.74223  -15.68855 53.44686   1.000 66.23175  ? 683 LEU A C   1 
ATOM 5456  O O   . LEU A 1 683 ? 86.36040  -15.38415 52.41672   1.000 72.86466  ? 683 LEU A O   1 
ATOM 5457  C CB  . LEU A 1 683 ? 85.74988  -13.89616 55.19991   1.000 66.92975  ? 683 LEU A CB  1 
ATOM 5458  C CG  . LEU A 1 683 ? 86.88030  -13.01779 54.66365   1.000 65.71393  ? 683 LEU A CG  1 
ATOM 5459  C CD1 . LEU A 1 683 ? 86.32900  -11.94264 53.74306   1.000 63.73774  ? 683 LEU A CD1 1 
ATOM 5460  C CD2 . LEU A 1 683 ? 87.66968  -12.40164 55.80877   1.000 67.33666  ? 683 LEU A CD2 1 
ATOM 5461  N N   . GLU A 1 684 ? 85.76180  -16.92143 53.95854   1.000 73.60261  ? 684 GLU A N   1 
ATOM 5462  C CA  . GLU A 1 684 ? 86.47836  -17.99157 53.27772   1.000 77.09867  ? 684 GLU A CA  1 
ATOM 5463  C C   . GLU A 1 684 ? 85.85998  -18.28148 51.91907   1.000 70.76255  ? 684 GLU A C   1 
ATOM 5464  O O   . GLU A 1 684 ? 86.57359  -18.58971 50.96212   1.000 69.68236  ? 684 GLU A O   1 
ATOM 5465  C CB  . GLU A 1 684 ? 86.49899  -19.25048 54.14485   1.000 102.80430 ? 684 GLU A CB  1 
ATOM 5466  C CG  . GLU A 1 684 ? 87.54372  -19.21982 55.25001   1.000 127.61686 ? 684 GLU A CG  1 
ATOM 5467  C CD  . GLU A 1 684 ? 88.96344  -19.12749 54.71557   1.000 155.09712 ? 684 GLU A CD  1 
ATOM 5468  O OE1 . GLU A 1 684 ? 89.20826  -19.57721 53.57506   1.000 164.77536 ? 684 GLU A OE1 1 
ATOM 5469  O OE2 . GLU A 1 684 ? 89.83588  -18.60029 55.43755   1.000 163.46814 ? 684 GLU A OE2 1 
ATOM 5470  N N   . GLY A 1 685 ? 84.53464  -18.17596 51.81083   1.000 76.22178  ? 685 GLY A N   1 
ATOM 5471  C CA  . GLY A 1 685 ? 83.89487  -18.36329 50.51861   1.000 86.72587  ? 685 GLY A CA  1 
ATOM 5472  C C   . GLY A 1 685 ? 84.28315  -17.29168 49.51707   1.000 77.86506  ? 685 GLY A C   1 
ATOM 5473  O O   . GLY A 1 685 ? 84.52726  -17.58480 48.34208   1.000 64.58280  ? 685 GLY A O   1 
ATOM 5474  N N   . LEU A 1 686 ? 84.33975  -16.03410 49.96433   1.000 66.81796  ? 686 LEU A N   1 
ATOM 5475  C CA  . LEU A 1 686 ? 84.80116  -14.95926 49.09115   1.000 63.94841  ? 686 LEU A CA  1 
ATOM 5476  C C   . LEU A 1 686 ? 86.24027  -15.18874 48.64788   1.000 63.47888  ? 686 LEU A C   1 
ATOM 5477  O O   . LEU A 1 686 ? 86.57720  -14.98689 47.47353   1.000 61.87354  ? 686 LEU A O   1 
ATOM 5478  C CB  . LEU A 1 686 ? 84.66862  -13.61137 49.79950   1.000 64.08135  ? 686 LEU A CB  1 
ATOM 5479  C CG  . LEU A 1 686 ? 85.02619  -12.37912 48.96670   1.000 62.32628  ? 686 LEU A CG  1 
ATOM 5480  C CD1 . LEU A 1 686 ? 84.02594  -12.19077 47.83796   1.000 60.87882  ? 686 LEU A CD1 1 
ATOM 5481  C CD2 . LEU A 1 686 ? 85.09699  -11.13662 49.83926   1.000 62.89718  ? 686 LEU A CD2 1 
ATOM 5482  N N   . TYR A 1 687 ? 87.10670  -15.61236 49.57251   1.000 70.67707  ? 687 TYR A N   1 
ATOM 5483  C CA  . TYR A 1 687 ? 88.48862  -15.88853 49.19107   1.000 72.52719  ? 687 TYR A CA  1 
ATOM 5484  C C   . TYR A 1 687 ? 88.57710  -17.06319 48.22380   1.000 91.46052  ? 687 TYR A C   1 
ATOM 5485  O O   . TYR A 1 687 ? 89.40096  -17.04845 47.30573   1.000 99.18757  ? 687 TYR A O   1 
ATOM 5486  C CB  . TYR A 1 687 ? 89.34966  -16.13560 50.42854   1.000 81.49663  ? 687 TYR A CB  1 
ATOM 5487  C CG  . TYR A 1 687 ? 89.94203  -14.87309 51.01458   1.000 85.23373  ? 687 TYR A CG  1 
ATOM 5488  C CD1 . TYR A 1 687 ? 89.53624  -13.61985 50.57142   1.000 72.25972  ? 687 TYR A CD1 1 
ATOM 5489  C CD2 . TYR A 1 687 ? 90.92775  -14.93481 51.99086   1.000 97.77029  ? 687 TYR A CD2 1 
ATOM 5490  C CE1 . TYR A 1 687 ? 90.08350  -12.46316 51.09849   1.000 78.58234  ? 687 TYR A CE1 1 
ATOM 5491  C CE2 . TYR A 1 687 ? 91.48114  -13.78528 52.52313   1.000 97.59570  ? 687 TYR A CE2 1 
ATOM 5492  C CZ  . TYR A 1 687 ? 91.05569  -12.55222 52.07405   1.000 83.44078  ? 687 TYR A CZ  1 
ATOM 5493  O OH  . TYR A 1 687 ? 91.60603  -11.40597 52.60281   1.000 61.94853  ? 687 TYR A OH  1 
ATOM 5494  N N   . GLU A 1 688 ? 87.74869  -18.09263 48.41486   1.000 106.65126 ? 688 GLU A N   1 
ATOM 5495  C CA  . GLU A 1 688 ? 87.71446  -19.19966 47.46263   1.000 94.44932  ? 688 GLU A CA  1 
ATOM 5496  C C   . GLU A 1 688 ? 87.29756  -18.71671 46.08017   1.000 68.93190  ? 688 GLU A C   1 
ATOM 5497  O O   . GLU A 1 688 ? 87.89847  -19.10227 45.07022   1.000 63.26311  ? 688 GLU A O   1 
ATOM 5498  C CB  . GLU A 1 688 ? 86.76789  -20.29799 47.95276   1.000 101.25127 ? 688 GLU A CB  1 
ATOM 5499  C CG  . GLU A 1 688 ? 87.20261  -21.00574 49.23320   1.000 110.85715 ? 688 GLU A CG  1 
ATOM 5500  C CD  . GLU A 1 688 ? 88.46934  -21.82730 49.07419   1.000 121.37149 ? 688 GLU A CD  1 
ATOM 5501  O OE1 . GLU A 1 688 ? 88.89846  -22.06517 47.92501   1.000 130.57479 ? 688 GLU A OE1 1 
ATOM 5502  O OE2 . GLU A 1 688 ? 89.03692  -22.23909 50.10844   1.000 117.69183 ? 688 GLU A OE2 1 
ATOM 5503  N N   . ALA A 1 689 ? 86.26611  -17.87020 46.01789   1.000 75.60292  ? 689 ALA A N   1 
ATOM 5504  C CA  . ALA A 1 689 ? 85.82687  -17.33120 44.73483   1.000 82.55841  ? 689 ALA A CA  1 
ATOM 5505  C C   . ALA A 1 689 ? 86.93390  -16.51805 44.07624   1.000 60.54065  ? 689 ALA A C   1 
ATOM 5506  O O   . ALA A 1 689 ? 87.09957  -16.55690 42.85115   1.000 56.71600  ? 689 ALA A O   1 
ATOM 5507  C CB  . ALA A 1 689 ? 84.57127  -16.47994 44.92287   1.000 96.42064  ? 689 ALA A CB  1 
ATOM 5508  N N   . ILE A 1 690 ? 87.69554  -15.76717 44.87365   1.000 58.29614  ? 690 ILE A N   1 
ATOM 5509  C CA  . ILE A 1 690 ? 88.77853  -14.95808 44.32001   1.000 61.24865  ? 690 ILE A CA  1 
ATOM 5510  C C   . ILE A 1 690 ? 89.90382  -15.85185 43.80350   1.000 75.07407  ? 690 ILE A C   1 
ATOM 5511  O O   . ILE A 1 690 ? 90.41769  -15.65205 42.69578   1.000 65.93297  ? 690 ILE A O   1 
ATOM 5512  C CB  . ILE A 1 690 ? 89.28473  -13.94137 45.35887   1.000 57.84134  ? 690 ILE A CB  1 
ATOM 5513  C CG1 . ILE A 1 690 ? 88.25513  -12.82534 45.54562   1.000 57.35629  ? 690 ILE A CG1 1 
ATOM 5514  C CG2 . ILE A 1 690 ? 90.61846  -13.35604 44.92756   1.000 57.21245  ? 690 ILE A CG2 1 
ATOM 5515  C CD1 . ILE A 1 690 ? 88.67213  -11.76382 46.53668   1.000 58.06988  ? 690 ILE A CD1 1 
ATOM 5516  N N   . GLU A 1 691 ? 90.30244  -16.85415 44.59454   1.000 77.62744  ? 691 GLU A N   1 
ATOM 5517  C CA  . GLU A 1 691 ? 91.36756  -17.75956 44.17308   1.000 79.16634  ? 691 GLU A CA  1 
ATOM 5518  C C   . GLU A 1 691 ? 90.94916  -18.65633 43.01464   1.000 69.23758  ? 691 GLU A C   1 
ATOM 5519  O O   . GLU A 1 691 ? 91.81712  -19.20775 42.33039   1.000 50.52088  ? 691 GLU A O   1 
ATOM 5520  C CB  . GLU A 1 691 ? 91.79008  -18.68450 45.32706   1.000 84.40254  ? 691 GLU A CB  1 
ATOM 5521  C CG  . GLU A 1 691 ? 92.16002  -18.08596 46.69994   1.000 89.03083  ? 691 GLU A CG  1 
ATOM 5522  C CD  . GLU A 1 691 ? 93.01165  -16.82571 46.68855   1.000 113.75625 ? 691 GLU A CD  1 
ATOM 5523  O OE1 . GLU A 1 691 ? 93.59024  -16.45740 45.64536   1.000 127.91773 ? 691 GLU A OE1 1 
ATOM 5524  O OE2 . GLU A 1 691 ? 93.10218  -16.19476 47.76354   1.000 122.49879 ? 691 GLU A OE2 1 
ATOM 5525  N N   . GLU A 1 692 ? 89.64419  -18.79944 42.77005   1.000 79.64611  ? 692 GLU A N   1 
ATOM 5526  C CA  . GLU A 1 692 ? 89.18544  -19.65332 41.68177   1.000 64.83166  ? 692 GLU A CA  1 
ATOM 5527  C C   . GLU A 1 692 ? 89.44736  -19.04276 40.31024   1.000 68.56659  ? 692 GLU A C   1 
ATOM 5528  O O   . GLU A 1 692 ? 89.63686  -19.77979 39.33595   1.000 80.89687  ? 692 GLU A O   1 
ATOM 5529  C CB  . GLU A 1 692 ? 87.69765  -19.95602 41.86529   1.000 53.22331  ? 692 GLU A CB  1 
ATOM 5530  C CG  . GLU A 1 692 ? 87.16181  -21.05546 40.97058   1.000 62.89464  ? 692 GLU A CG  1 
ATOM 5531  C CD  . GLU A 1 692 ? 85.70056  -21.35546 41.23847   1.000 81.19523  ? 692 GLU A CD  1 
ATOM 5532  O OE1 . GLU A 1 692 ? 85.07532  -20.62041 42.03309   1.000 87.97409  ? 692 GLU A OE1 1 
ATOM 5533  O OE2 . GLU A 1 692 ? 85.17907  -22.33037 40.65789   1.000 87.41182  ? 692 GLU A OE2 1 
ATOM 5534  N N   . CYS A 1 693 ? 89.46630  -17.71330 40.20668   1.000 69.22938  ? 693 CYS A N   1 
ATOM 5535  C CA  . CYS A 1 693 ? 89.70294  -17.03241 38.93854   1.000 76.77817  ? 693 CYS A CA  1 
ATOM 5536  C C   . CYS A 1 693 ? 91.12492  -16.49098 38.81893   1.000 74.06385  ? 693 CYS A C   1 
ATOM 5537  O O   . CYS A 1 693 ? 91.34165  -15.44980 38.18851   1.000 55.99153  ? 693 CYS A O   1 
ATOM 5538  C CB  . CYS A 1 693 ? 88.68464  -15.90883 38.74021   1.000 77.52484  ? 693 CYS A CB  1 
ATOM 5539  S SG  . CYS A 1 693 ? 88.64540  -14.67635 40.06080   1.000 73.35497  ? 693 CYS A SG  1 
ATOM 5540  N N   . LEU A 1 694 ? 92.09911  -17.18298 39.40825   1.000 82.01679  ? 694 LEU A N   1 
ATOM 5541  C CA  . LEU A 1 694 ? 93.51251  -16.81709 39.31505   1.000 79.39629  ? 694 LEU A CA  1 
ATOM 5542  C C   . LEU A 1 694 ? 94.28869  -18.06839 38.91402   1.000 92.76941  ? 694 LEU A C   1 
ATOM 5543  O O   . LEU A 1 694 ? 94.62324  -18.89279 39.76955   1.000 110.00397 ? 694 LEU A O   1 
ATOM 5544  C CB  . LEU A 1 694 ? 94.02513  -16.25861 40.63962   1.000 57.61720  ? 694 LEU A CB  1 
ATOM 5545  C CG  . LEU A 1 694 ? 94.10515  -14.74282 40.82681   1.000 63.54545  ? 694 LEU A CG  1 
ATOM 5546  C CD1 . LEU A 1 694 ? 92.71836  -14.12165 40.82468   1.000 86.76913  ? 694 LEU A CD1 1 
ATOM 5547  C CD2 . LEU A 1 694 ? 94.83818  -14.41199 42.11771   1.000 54.44872  ? 694 LEU A CD2 1 
ATOM 5548  N N   . ILE A 1 695 ? 94.56561  -18.22138 37.61794   1.000 77.84649  ? 695 ILE A N   1 
ATOM 5549  C CA  . ILE A 1 695 ? 95.27522  -19.40153 37.13428   1.000 75.72775  ? 695 ILE A CA  1 
ATOM 5550  C C   . ILE A 1 695 ? 96.53375  -19.03120 36.35461   1.000 78.24129  ? 695 ILE A C   1 
ATOM 5551  O O   . ILE A 1 695 ? 97.65182  -19.33931 36.78529   1.000 89.19987  ? 695 ILE A O   1 
ATOM 5552  C CB  . ILE A 1 695 ? 94.35297  -20.29975 36.28162   1.000 77.98770  ? 695 ILE A CB  1 
ATOM 5553  C CG1 . ILE A 1 695 ? 92.94350  -20.40198 36.88793   1.000 65.04700  ? 695 ILE A CG1 1 
ATOM 5554  C CG2 . ILE A 1 695 ? 94.97186  -21.67724 36.08307   1.000 95.10290  ? 695 ILE A CG2 1 
ATOM 5555  C CD1 . ILE A 1 695 ? 91.92293  -19.45696 36.30241   1.000 69.07315  ? 695 ILE A CD1 1 
ATOM 5556  N N   . ASN A 1 696 ? 96.37137  -18.37114 35.20360   1.000 72.82075  ? 696 ASN A N   1 
ATOM 5557  C CA  . ASN A 1 696 ? 97.50252  -18.16486 34.30586   1.000 60.84845  ? 696 ASN A CA  1 
ATOM 5558  C C   . ASN A 1 696 ? 97.56206  -16.80038 33.62687   1.000 59.96055  ? 696 ASN A C   1 
ATOM 5559  O O   . ASN A 1 696 ? 98.52134  -16.54914 32.89026   1.000 66.98406  ? 696 ASN A O   1 
ATOM 5560  C CB  . ASN A 1 696 ? 97.51398  -19.26527 33.22979   1.000 62.29378  ? 696 ASN A CB  1 
ATOM 5561  C CG  . ASN A 1 696 ? 96.18819  -19.38131 32.50012   1.000 81.89075  ? 696 ASN A CG  1 
ATOM 5562  O OD1 . ASN A 1 696 ? 95.29893  -18.54651 32.66686   1.000 90.65811  ? 696 ASN A OD1 1 
ATOM 5563  N ND2 . ASN A 1 696 ? 96.04354  -20.42937 31.69810   1.000 96.27569  ? 696 ASN A ND2 1 
ATOM 5564  N N   . ASP A 1 697 ? 96.59205  -15.91803 33.83978   1.000 44.05121  ? 697 ASP A N   1 
ATOM 5565  C CA  . ASP A 1 697 ? 96.57529  -14.64079 33.13061   1.000 44.36801  ? 697 ASP A CA  1 
ATOM 5566  C C   . ASP A 1 697 ? 97.52285  -13.65615 33.80712   1.000 58.77498  ? 697 ASP A C   1 
ATOM 5567  O O   . ASP A 1 697 ? 97.33648  -13.34922 34.98948   1.000 97.04814  ? 697 ASP A O   1 
ATOM 5568  C CB  . ASP A 1 697 ? 95.16042  -14.07293 33.09199   1.000 53.09426  ? 697 ASP A CB  1 
ATOM 5569  C CG  . ASP A 1 697 ? 95.03323  -12.85891 32.18145   1.000 63.17358  ? 697 ASP A CG  1 
ATOM 5570  O OD1 . ASP A 1 697 ? 96.04684  -12.42594 31.59534   1.000 67.43076  ? 697 ASP A OD1 1 
ATOM 5571  O OD2 . ASP A 1 697 ? 93.90624  -12.33843 32.04524   1.000 68.91054  ? 697 ASP A OD2 1 
ATOM 5572  N N   . PRO A 1 698 ? 98.53988  -13.14238 33.10641   1.000 44.03992  ? 698 PRO A N   1 
ATOM 5573  C CA  . PRO A 1 698 ? 99.43658  -12.15909 33.74065   1.000 53.46353  ? 698 PRO A CA  1 
ATOM 5574  C C   . PRO A 1 698 ? 98.72718  -10.89626 34.19818   1.000 67.05510  ? 698 PRO A C   1 
ATOM 5575  O O   . PRO A 1 698 ? 99.08926  -10.32794 35.23531   1.000 96.97378  ? 698 PRO A O   1 
ATOM 5576  C CB  . PRO A 1 698 ? 100.46313 -11.86285 32.63764   1.000 47.02599  ? 698 PRO A CB  1 
ATOM 5577  C CG  . PRO A 1 698 ? 100.41142 -13.04780 31.73912   1.000 44.01429  ? 698 PRO A CG  1 
ATOM 5578  C CD  . PRO A 1 698 ? 98.99338  -13.51926 31.75744   1.000 43.34041  ? 698 PRO A CD  1 
ATOM 5579  N N   . TRP A 1 699 ? 97.71829  -10.44187 33.45182   1.000 40.30122  ? 699 TRP A N   1 
ATOM 5580  C CA  . TRP A 1 699 ? 97.00892  -9.22055  33.82239   1.000 39.85689  ? 699 TRP A CA  1 
ATOM 5581  C C   . TRP A 1 699 ? 96.20036  -9.41594  35.10099   1.000 40.62135  ? 699 TRP A C   1 
ATOM 5582  O O   . TRP A 1 699 ? 96.20559  -8.54968  35.98719   1.000 48.38490  ? 699 TRP A O   1 
ATOM 5583  C CB  . TRP A 1 699 ? 96.11742  -8.77532  32.66172   1.000 38.53731  ? 699 TRP A CB  1 
ATOM 5584  C CG  . TRP A 1 699 ? 95.38446  -7.48473  32.88144   1.000 38.09270  ? 699 TRP A CG  1 
ATOM 5585  C CD1 . TRP A 1 699 ? 94.03442  -7.29261  32.83016   1.000 37.63206  ? 699 TRP A CD1 1 
ATOM 5586  C CD2 . TRP A 1 699 ? 95.95925  -6.20759  33.18877   1.000 38.23178  ? 699 TRP A CD2 1 
ATOM 5587  N NE1 . TRP A 1 699 ? 93.73248  -5.97627  33.08110   1.000 37.45714  ? 699 TRP A NE1 1 
ATOM 5588  C CE2 . TRP A 1 699 ? 94.89657  -5.28961  33.30664   1.000 43.49627  ? 699 TRP A CE2 1 
ATOM 5589  C CE3 . TRP A 1 699 ? 97.26738  -5.75186  33.37558   1.000 55.19454  ? 699 TRP A CE3 1 
ATOM 5590  C CZ2 . TRP A 1 699 ? 95.10167  -3.94394  33.60330   1.000 70.60523  ? 699 TRP A CZ2 1 
ATOM 5591  C CZ3 . TRP A 1 699 ? 97.46867  -4.41579  33.67109   1.000 78.22918  ? 699 TRP A CZ3 1 
ATOM 5592  C CH2 . TRP A 1 699 ? 96.39182  -3.52725  33.78016   1.000 80.04429  ? 699 TRP A CH2 1 
ATOM 5593  N N   . VAL A 1 700 ? 95.51102  -10.55287 35.22056   1.000 43.59855  ? 700 VAL A N   1 
ATOM 5594  C CA  . VAL A 1 700 ? 94.74340  -10.83718 36.43065   1.000 44.47192  ? 700 VAL A CA  1 
ATOM 5595  C C   . VAL A 1 700 ? 95.67031  -10.96811 37.63154   1.000 45.88872  ? 700 VAL A C   1 
ATOM 5596  O O   . VAL A 1 700 ? 95.37388  -10.46293 38.72025   1.000 48.50855  ? 700 VAL A O   1 
ATOM 5597  C CB  . VAL A 1 700 ? 93.88686  -12.10202 36.23709   1.000 44.63705  ? 700 VAL A CB  1 
ATOM 5598  C CG1 . VAL A 1 700 ? 93.10737  -12.41699 37.50380   1.000 45.68106  ? 700 VAL A CG1 1 
ATOM 5599  C CG2 . VAL A 1 700 ? 92.94571  -11.92459 35.06420   1.000 45.98838  ? 700 VAL A CG2 1 
ATOM 5600  N N   . LEU A 1 701 ? 96.80297  -11.65385 37.45787   1.000 50.30180  ? 701 LEU A N   1 
ATOM 5601  C CA  . LEU A 1 701 ? 97.74644  -11.80501 38.56185   1.000 46.22626  ? 701 LEU A CA  1 
ATOM 5602  C C   . LEU A 1 701 ? 98.35469  -10.46473 38.95968   1.000 46.61852  ? 701 LEU A C   1 
ATOM 5603  O O   . LEU A 1 701 ? 98.60858  -10.21848 40.14567   1.000 47.81040  ? 701 LEU A O   1 
ATOM 5604  C CB  . LEU A 1 701 ? 98.83891  -12.80634 38.18716   1.000 44.64016  ? 701 LEU A CB  1 
ATOM 5605  C CG  . LEU A 1 701 ? 98.36481  -14.22250 37.85963   1.000 44.84482  ? 701 LEU A CG  1 
ATOM 5606  C CD1 . LEU A 1 701 ? 99.53877  -15.11390 37.49380   1.000 45.61492  ? 701 LEU A CD1 1 
ATOM 5607  C CD2 . LEU A 1 701 ? 97.58770  -14.80489 39.02737   1.000 47.30874  ? 701 LEU A CD2 1 
ATOM 5608  N N   . LEU A 1 702 ? 98.59010  -9.58181  37.98681   1.000 43.25813  ? 702 LEU A N   1 
ATOM 5609  C CA  . LEU A 1 702 ? 99.10637  -8.25775  38.31466   1.000 43.47954  ? 702 LEU A CA  1 
ATOM 5610  C C   . LEU A 1 702 ? 98.07413  -7.44708  39.08864   1.000 49.07947  ? 702 LEU A C   1 
ATOM 5611  O O   . LEU A 1 702 ? 98.41596  -6.75282  40.05346   1.000 58.90456  ? 702 LEU A O   1 
ATOM 5612  C CB  . LEU A 1 702 ? 99.52258  -7.52664  37.03884   1.000 42.29364  ? 702 LEU A CB  1 
ATOM 5613  C CG  . LEU A 1 702 ? 100.38517 -6.28074  37.23976   1.000 42.75014  ? 702 LEU A CG  1 
ATOM 5614  C CD1 . LEU A 1 702 ? 101.63608 -6.63244  38.02793   1.000 55.43837  ? 702 LEU A CD1 1 
ATOM 5615  C CD2 . LEU A 1 702 ? 100.74665 -5.64568  35.91012   1.000 41.64632  ? 702 LEU A CD2 1 
ATOM 5616  N N   . ASN A 1 703 ? 96.80237  -7.53499  38.68991   1.000 50.65083  ? 703 ASN A N   1 
ATOM 5617  C CA  . ASN A 1 703 ? 95.74453  -6.87907  39.45503   1.000 52.64321  ? 703 ASN A CA  1 
ATOM 5618  C C   . ASN A 1 703 ? 95.63049  -7.46031  40.86083   1.000 52.63595  ? 703 ASN A C   1 
ATOM 5619  O O   . ASN A 1 703 ? 95.33624  -6.73658  41.82065   1.000 51.67850  ? 703 ASN A O   1 
ATOM 5620  C CB  . ASN A 1 703 ? 94.41392  -6.99186  38.71339   1.000 49.98732  ? 703 ASN A CB  1 
ATOM 5621  C CG  . ASN A 1 703 ? 94.25168  -5.92813  37.64963   1.000 42.15406  ? 703 ASN A CG  1 
ATOM 5622  O OD1 . ASN A 1 703 ? 93.85969  -4.79920  37.94287   1.000 42.64031  ? 703 ASN A OD1 1 
ATOM 5623  N ND2 . ASN A 1 703 ? 94.55945  -6.27926  36.40715   1.000 47.26331  ? 703 ASN A ND2 1 
ATOM 5624  N N   . ALA A 1 704 ? 95.85861  -8.76713  41.00146   1.000 56.55016  ? 704 ALA A N   1 
ATOM 5625  C CA  . ALA A 1 704 ? 95.81501  -9.38786  42.32203   1.000 51.33802  ? 704 ALA A CA  1 
ATOM 5626  C C   . ALA A 1 704 ? 96.95265  -8.89002  43.20386   1.000 57.51009  ? 704 ALA A C   1 
ATOM 5627  O O   . ALA A 1 704 ? 96.74793  -8.60200  44.38931   1.000 57.20953  ? 704 ALA A O   1 
ATOM 5628  C CB  . ALA A 1 704 ? 95.86317  -10.90862 42.18829   1.000 51.74735  ? 704 ALA A CB  1 
ATOM 5629  N N   . SER A 1 705 ? 98.16062  -8.79168  42.64454   1.000 64.52569  ? 705 SER A N   1 
ATOM 5630  C CA  . SER A 1 705 ? 99.27444  -8.21253  43.39019   1.000 58.32057  ? 705 SER A CA  1 
ATOM 5631  C C   . SER A 1 705 ? 98.98565  -6.76356  43.76299   1.000 56.43374  ? 705 SER A C   1 
ATOM 5632  O O   . SER A 1 705 ? 99.35594  -6.30499  44.85073   1.000 53.82789  ? 705 SER A O   1 
ATOM 5633  C CB  . SER A 1 705 ? 100.56406 -8.31333  42.57695   1.000 52.17795  ? 705 SER A CB  1 
ATOM 5634  O OG  . SER A 1 705 ? 101.62223 -7.62418  43.21967   1.000 53.52752  ? 705 SER A OG  1 
ATOM 5635  N N   . TRP A 1 706 ? 98.32589  -6.02753  42.86643   1.000 49.81298  ? 706 TRP A N   1 
ATOM 5636  C CA  . TRP A 1 706 ? 97.93014  -4.65419  43.16417   1.000 54.08135  ? 706 TRP A CA  1 
ATOM 5637  C C   . TRP A 1 706 ? 96.98136  -4.59500  44.35451   1.000 67.67892  ? 706 TRP A C   1 
ATOM 5638  O O   . TRP A 1 706 ? 97.14725  -3.76559  45.25726   1.000 85.12610  ? 706 TRP A O   1 
ATOM 5639  C CB  . TRP A 1 706 ? 97.28130  -4.02772  41.93383   1.000 48.00957  ? 706 TRP A CB  1 
ATOM 5640  C CG  . TRP A 1 706 ? 98.25556  -3.69963  40.86075   1.000 47.31615  ? 706 TRP A CG  1 
ATOM 5641  C CD1 . TRP A 1 706 ? 99.60092  -3.52583  41.00118   1.000 48.25127  ? 706 TRP A CD1 1 
ATOM 5642  C CD2 . TRP A 1 706 ? 97.96663  -3.50075  39.47489   1.000 45.67820  ? 706 TRP A CD2 1 
ATOM 5643  N NE1 . TRP A 1 706 ? 100.16838 -3.22993  39.78702   1.000 47.27346  ? 706 TRP A NE1 1 
ATOM 5644  C CE2 . TRP A 1 706 ? 99.18536  -3.20938  38.83330   1.000 45.68293  ? 706 TRP A CE2 1 
ATOM 5645  C CE3 . TRP A 1 706 ? 96.79534  -3.54241  38.71269   1.000 44.33444  ? 706 TRP A CE3 1 
ATOM 5646  C CZ2 . TRP A 1 706 ? 99.26641  -2.95926  37.46970   1.000 60.56510  ? 706 TRP A CZ2 1 
ATOM 5647  C CZ3 . TRP A 1 706 ? 96.87896  -3.29458  37.35691   1.000 54.00230  ? 706 TRP A CZ3 1 
ATOM 5648  C CH2 . TRP A 1 706 ? 98.10584  -3.00744  36.74921   1.000 61.76474  ? 706 TRP A CH2 1 
ATOM 5649  N N   . PHE A 1 707 ? 95.95912  -5.45315  44.35778   1.000 66.56137  ? 707 PHE A N   1 
ATOM 5650  C CA  . PHE A 1 707 ? 95.02165  -5.46606  45.47628   1.000 48.68471  ? 707 PHE A CA  1 
ATOM 5651  C C   . PHE A 1 707 ? 95.70296  -5.90601  46.76505   1.000 51.25409  ? 707 PHE A C   1 
ATOM 5652  O O   . PHE A 1 707 ? 95.34650  -5.42917  47.84886   1.000 57.67175  ? 707 PHE A O   1 
ATOM 5653  C CB  . PHE A 1 707 ? 93.83131  -6.37340  45.16976   1.000 47.94754  ? 707 PHE A CB  1 
ATOM 5654  C CG  . PHE A 1 707 ? 92.58191  -5.99841  45.91525   1.000 69.98664  ? 707 PHE A CG  1 
ATOM 5655  C CD1 . PHE A 1 707 ? 92.35584  -4.68496  46.29011   1.000 71.10608  ? 707 PHE A CD1 1 
ATOM 5656  C CD2 . PHE A 1 707 ? 91.63888  -6.95593  46.24847   1.000 83.75794  ? 707 PHE A CD2 1 
ATOM 5657  C CE1 . PHE A 1 707 ? 91.21026  -4.33101  46.97555   1.000 70.63171  ? 707 PHE A CE1 1 
ATOM 5658  C CE2 . PHE A 1 707 ? 90.49029  -6.60792  46.93718   1.000 88.45374  ? 707 PHE A CE2 1 
ATOM 5659  C CZ  . PHE A 1 707 ? 90.27688  -5.29314  47.30076   1.000 78.25148  ? 707 PHE A CZ  1 
ATOM 5660  N N   . ASN A 1 708 ? 96.68790  -6.80174  46.66679   1.000 60.52707  ? 708 ASN A N   1 
ATOM 5661  C CA  . ASN A 1 708 ? 97.45434  -7.18514  47.84715   1.000 71.79059  ? 708 ASN A CA  1 
ATOM 5662  C C   . ASN A 1 708 ? 98.24909  -6.00492  48.38914   1.000 79.69652  ? 708 ASN A C   1 
ATOM 5663  O O   . ASN A 1 708 ? 98.30402  -5.79026  49.60487   1.000 61.44589  ? 708 ASN A O   1 
ATOM 5664  C CB  . ASN A 1 708 ? 98.38191  -8.35389  47.51588   1.000 75.86269  ? 708 ASN A CB  1 
ATOM 5665  C CG  . ASN A 1 708 ? 97.66238  -9.68409  47.52534   1.000 66.16321  ? 708 ASN A CG  1 
ATOM 5666  O OD1 . ASN A 1 708 ? 96.79420  -9.92130  48.36293   1.000 64.68035  ? 708 ASN A OD1 1 
ATOM 5667  N ND2 . ASN A 1 708 ? 98.01703  -10.55999 46.59230   1.000 60.42141  ? 708 ASN A ND2 1 
ATOM 5668  N N   . SER A 1 709 ? 98.86270  -5.22100  47.49909   1.000 101.63800 ? 709 SER A N   1 
ATOM 5669  C CA  . SER A 1 709 ? 99.56658  -4.01641  47.93222   1.000 91.39234  ? 709 SER A CA  1 
ATOM 5670  C C   . SER A 1 709 ? 98.60797  -3.02632  48.58276   1.000 67.93191  ? 709 SER A C   1 
ATOM 5671  O O   . SER A 1 709 ? 98.94043  -2.39788  49.59690   1.000 66.49135  ? 709 SER A O   1 
ATOM 5672  C CB  . SER A 1 709 ? 100.28083 -3.36915  46.74566   1.000 84.81556  ? 709 SER A CB  1 
ATOM 5673  O OG  . SER A 1 709 ? 101.28025 -4.22470  46.22041   1.000 85.85904  ? 709 SER A OG  1 
ATOM 5674  N N   . PHE A 1 710 ? 97.41071  -2.87709  48.01091   1.000 53.17334  ? 710 PHE A N   1 
ATOM 5675  C CA  . PHE A 1 710 ? 96.41876  -1.97062  48.58302   1.000 53.48439  ? 710 PHE A CA  1 
ATOM 5676  C C   . PHE A 1 710 ? 96.01553  -2.40966  49.98442   1.000 69.09810  ? 710 PHE A C   1 
ATOM 5677  O O   . PHE A 1 710 ? 95.96330  -1.59397  50.91221   1.000 79.76040  ? 710 PHE A O   1 
ATOM 5678  C CB  . PHE A 1 710 ? 95.19065  -1.89036  47.67621   1.000 51.59571  ? 710 PHE A CB  1 
ATOM 5679  C CG  . PHE A 1 710 ? 93.99037  -1.27732  48.34145   1.000 52.03196  ? 710 PHE A CG  1 
ATOM 5680  C CD1 . PHE A 1 710 ? 93.87480  0.09502   48.46907   1.000 52.36436  ? 710 PHE A CD1 1 
ATOM 5681  C CD2 . PHE A 1 710 ? 92.97562  -2.07802  48.84003   1.000 52.24333  ? 710 PHE A CD2 1 
ATOM 5682  C CE1 . PHE A 1 710 ? 92.77040  0.65515   49.08637   1.000 52.89306  ? 710 PHE A CE1 1 
ATOM 5683  C CE2 . PHE A 1 710 ? 91.87121  -1.52322  49.45495   1.000 52.75794  ? 710 PHE A CE2 1 
ATOM 5684  C CZ  . PHE A 1 710 ? 91.76777  -0.15529  49.57773   1.000 53.07556  ? 710 PHE A CZ  1 
ATOM 5685  N N   . LEU A 1 711 ? 95.71272  -3.69929  50.15390   1.000 71.84604  ? 711 LEU A N   1 
ATOM 5686  C CA  . LEU A 1 711 ? 95.37731  -4.20767  51.48048   1.000 62.21188  ? 711 LEU A CA  1 
ATOM 5687  C C   . LEU A 1 711 ? 96.55363  -4.08033  52.43869   1.000 64.10543  ? 711 LEU A C   1 
ATOM 5688  O O   . LEU A 1 711 ? 96.35363  -3.91494  53.64713   1.000 65.36258  ? 711 LEU A O   1 
ATOM 5689  C CB  . LEU A 1 711 ? 94.90742  -5.66008  51.39243   1.000 61.10993  ? 711 LEU A CB  1 
ATOM 5690  C CG  . LEU A 1 711 ? 93.61731  -5.89719  50.60339   1.000 59.37514  ? 711 LEU A CG  1 
ATOM 5691  C CD1 . LEU A 1 711 ? 93.21082  -7.36174  50.65670   1.000 59.52120  ? 711 LEU A CD1 1 
ATOM 5692  C CD2 . LEU A 1 711 ? 92.50043  -5.00699  51.12703   1.000 59.62474  ? 711 LEU A CD2 1 
ATOM 5693  N N   . THR A 1 712 ? 97.78385  -4.16268  51.92609   1.000 90.25547  ? 712 THR A N   1 
ATOM 5694  C CA  . THR A 1 712 ? 98.94226  -3.97372  52.79007   1.000 85.33106  ? 712 THR A CA  1 
ATOM 5695  C C   . THR A 1 712 ? 99.07197  -2.52439  53.24206   1.000 66.51584  ? 712 THR A C   1 
ATOM 5696  O O   . THR A 1 712 ? 99.50182  -2.26643  54.37278   1.000 65.23520  ? 712 THR A O   1 
ATOM 5697  C CB  . THR A 1 712 ? 100.21172 -4.41938  52.05889   1.000 91.41710  ? 712 THR A CB  1 
ATOM 5698  O OG1 . THR A 1 712 ? 100.10244 -5.80371  51.70245   1.000 81.06915  ? 712 THR A OG1 1 
ATOM 5699  C CG2 . THR A 1 712 ? 101.44177 -4.21646  52.92785   1.000 108.42821 ? 712 THR A CG2 1 
ATOM 5700  N N   . HIS A 1 713 ? 98.68112  -1.57014  52.39902   1.000 66.84563  ? 713 HIS A N   1 
ATOM 5701  C CA  . HIS A 1 713 ? 98.78465  -0.15272  52.73326   1.000 79.61665  ? 713 HIS A CA  1 
ATOM 5702  C C   . HIS A 1 713 ? 97.42405  0.46697   53.03683   1.000 67.67713  ? 713 HIS A C   1 
ATOM 5703  O O   . HIS A 1 713 ? 97.16587  1.61971   52.69344   1.000 64.33853  ? 713 HIS A O   1 
ATOM 5704  C CB  . HIS A 1 713 ? 99.47437  0.62349   51.61446   1.000 107.78807 ? 713 HIS A CB  1 
ATOM 5705  C CG  . HIS A 1 713 ? 100.95773 0.43337   51.56953   1.000 128.20398 ? 713 HIS A CG  1 
ATOM 5706  N ND1 . HIS A 1 713 ? 101.81896 1.10246   52.41268   1.000 137.54806 ? 713 HIS A ND1 1 
ATOM 5707  C CD2 . HIS A 1 713 ? 101.73327 -0.34929  50.78325   1.000 130.65562 ? 713 HIS A CD2 1 
ATOM 5708  C CE1 . HIS A 1 713 ? 103.06121 0.74005   52.14726   1.000 138.26221 ? 713 HIS A CE1 1 
ATOM 5709  N NE2 . HIS A 1 713 ? 103.03681 -0.14071  51.16322   1.000 135.95355 ? 713 HIS A NE2 1 
ATOM 5710  N N   . ALA A 1 714 ? 96.55504  -0.26942  53.72915   1.000 81.79000  ? 714 ALA A N   1 
ATOM 5711  C CA  . ALA A 1 714 ? 95.26254  0.25529   54.15461   1.000 81.84908  ? 714 ALA A CA  1 
ATOM 5712  C C   . ALA A 1 714 ? 95.05187  0.04847   55.64783   1.000 86.40643  ? 714 ALA A C   1 
ATOM 5713  O O   . ALA A 1 714 ? 93.92141  -0.17034  56.09549   1.000 84.34315  ? 714 ALA A O   1 
ATOM 5714  C CB  . ALA A 1 714 ? 94.12287  -0.38141  53.36026   1.000 79.82662  ? 714 ALA A CB  1 
ATOM 5715  N N   . LEU A 1 715 ? 96.13409  0.11915   56.42528   1.000 126.98129 ? 715 LEU A N   1 
ATOM 5716  C CA  . LEU A 1 715 ? 96.10715  -0.17909  57.85746   1.000 142.56412 ? 715 LEU A CA  1 
ATOM 5717  C C   . LEU A 1 715 ? 95.60432  -1.60173  58.09886   1.000 163.17756 ? 715 LEU A C   1 
ATOM 5718  O O   . LEU A 1 715 ? 94.84868  -1.86884  59.03501   1.000 185.00841 ? 715 LEU A O   1 
ATOM 5719  C CB  . LEU A 1 715 ? 95.27091  0.84871   58.62821   1.000 142.53292 ? 715 LEU A CB  1 
ATOM 5720  C CG  . LEU A 1 715 ? 95.49583  0.97549   60.13867   1.000 127.18656 ? 715 LEU A CG  1 
ATOM 5721  C CD1 . LEU A 1 715 ? 96.92319  1.41212   60.43714   1.000 112.53686 ? 715 LEU A CD1 1 
ATOM 5722  C CD2 . LEU A 1 715 ? 94.49508  1.94086   60.75834   1.000 117.82934 ? 715 LEU A CD2 1 
ATOM 5723  N N   . ARG A 1 716 ? 96.03192  -2.52451  57.24177   1.000 137.27490 ? 716 ARG A N   1 
ATOM 5724  C CA  . ARG A 1 716 ? 95.69139  -3.93555  57.39272   1.000 124.81232 ? 716 ARG A CA  1 
ATOM 5725  C C   . ARG A 1 716 ? 96.76369  -4.83344  56.78405   1.000 88.00219  ? 716 ARG A C   1 
ATOM 5726  O O   . ARG A 1 716 ? 96.94848  -5.97246  57.21456   1.000 67.68992  ? 716 ARG A O   1 
ATOM 5727  C CB  . ARG A 1 716 ? 94.33318  -4.23071  56.75864   1.000 131.44388 ? 716 ARG A CB  1 
ATOM 5728  C CG  . ARG A 1 716 ? 93.97703  -3.32986  55.59098   1.000 122.06294 ? 716 ARG A CG  1 
ATOM 5729  C CD  . ARG A 1 716 ? 92.51451  -3.48370  55.25085   1.000 129.09979 ? 716 ARG A CD  1 
ATOM 5730  N NE  . ARG A 1 716 ? 91.69706  -3.36624  56.45279   1.000 169.35270 ? 716 ARG A NE  1 
ATOM 5731  C CZ  . ARG A 1 716 ? 90.43910  -3.78074  56.54583   1.000 203.90955 ? 716 ARG A CZ  1 
ATOM 5732  N NH1 . ARG A 1 716 ? 89.84563  -4.34600  55.50762   1.000 209.84894 ? 716 ARG A NH1 1 
ATOM 5733  N NH2 . ARG A 1 716 ? 89.77684  -3.63849  57.68243   1.000 219.28230 ? 716 ARG A NH2 1 
ATOM 5734  N N   . MET B 2 1   ? 110.19320 3.11485   39.42329   1.000 61.66239  ? 1   MET B N   1 
ATOM 5735  C CA  . MET B 2 1   ? 109.02635 2.82884   40.24867   1.000 63.71370  ? 1   MET B CA  1 
ATOM 5736  C C   . MET B 2 1   ? 107.97631 2.04477   39.46280   1.000 92.50266  ? 1   MET B C   1 
ATOM 5737  O O   . MET B 2 1   ? 107.93308 2.10467   38.23434   1.000 141.29917 ? 1   MET B O   1 
ATOM 5738  C CB  . MET B 2 1   ? 108.43470 4.13285   40.79621   1.000 62.50376  ? 1   MET B CB  1 
ATOM 5739  C CG  . MET B 2 1   ? 107.78408 5.02310   39.74817   1.000 72.08810  ? 1   MET B CG  1 
ATOM 5740  S SD  . MET B 2 1   ? 105.98910 4.84760   39.66977   1.000 76.15265  ? 1   MET B SD  1 
ATOM 5741  C CE  . MET B 2 1   ? 105.49838 5.63721   41.20143   1.000 56.19230  ? 1   MET B CE  1 
ATOM 5742  N N   . ASP B 2 2   ? 107.13390 1.30873   40.17973   1.000 64.85886  ? 2   ASP B N   1 
ATOM 5743  C CA  . ASP B 2 2   ? 106.07499 0.50974   39.58237   1.000 62.92461  ? 2   ASP B CA  1 
ATOM 5744  C C   . ASP B 2 2   ? 104.73828 1.20957   39.78576   1.000 76.36114  ? 2   ASP B C   1 
ATOM 5745  O O   . ASP B 2 2   ? 104.51195 1.85490   40.81052   1.000 86.63138  ? 2   ASP B O   1 
ATOM 5746  C CB  . ASP B 2 2   ? 106.03369 -0.89206  40.19478   1.000 60.51377  ? 2   ASP B CB  1 
ATOM 5747  C CG  . ASP B 2 2   ? 107.32917 -1.65263  39.99708   1.000 75.59427  ? 2   ASP B CG  1 
ATOM 5748  O OD1 . ASP B 2 2   ? 108.03913 -1.37345  39.00899   1.000 81.15827  ? 2   ASP B OD1 1 
ATOM 5749  O OD2 . ASP B 2 2   ? 107.63976 -2.52797  40.83174   1.000 77.07869  ? 2   ASP B OD2 1 
ATOM 5750  N N   . VAL B 2 3   ? 103.85217 1.07803   38.80085   1.000 60.97608  ? 3   VAL B N   1 
ATOM 5751  C CA  . VAL B 2 3   ? 102.56966 1.77464   38.79846   1.000 60.22477  ? 3   VAL B CA  1 
ATOM 5752  C C   . VAL B 2 3   ? 101.48045 0.80942   39.24374   1.000 60.56105  ? 3   VAL B C   1 
ATOM 5753  O O   . VAL B 2 3   ? 101.41460 -0.33171  38.76927   1.000 60.93209  ? 3   VAL B O   1 
ATOM 5754  C CB  . VAL B 2 3   ? 102.25971 2.35906   37.40911   1.000 59.38806  ? 3   VAL B CB  1 
ATOM 5755  C CG1 . VAL B 2 3   ? 100.83820 2.89763   37.35321   1.000 58.83819  ? 3   VAL B CG1 1 
ATOM 5756  C CG2 . VAL B 2 3   ? 103.25817 3.45245   37.06315   1.000 59.10881  ? 3   VAL B CG2 1 
ATOM 5757  N N   . ASN B 2 4   ? 100.62269 1.27316   40.15402   1.000 63.60119  ? 4   ASN B N   1 
ATOM 5758  C CA  . ASN B 2 4   ? 99.53084  0.49715   40.72822   1.000 64.66142  ? 4   ASN B CA  1 
ATOM 5759  C C   . ASN B 2 4   ? 98.26254  1.34313   40.76710   1.000 65.70299  ? 4   ASN B C   1 
ATOM 5760  O O   . ASN B 2 4   ? 98.18007  2.30350   41.54322   1.000 73.30533  ? 4   ASN B O   1 
ATOM 5761  C CB  . ASN B 2 4   ? 99.90985  0.01191   42.12988   1.000 62.18103  ? 4   ASN B CB  1 
ATOM 5762  C CG  . ASN B 2 4   ? 98.86985  -0.91380  42.73935   1.000 67.29395  ? 4   ASN B CG  1 
ATOM 5763  O OD1 . ASN B 2 4   ? 97.72998  -0.98520  42.28117   1.000 70.37827  ? 4   ASN B OD1 1 
ATOM 5764  N ND2 . ASN B 2 4   ? 99.26640  -1.63392  43.78226   1.000 70.98128  ? 4   ASN B ND2 1 
ATOM 5765  N N   . PRO B 2 5   ? 97.25714  1.02498   39.94665   1.000 55.57535  ? 5   PRO B N   1 
ATOM 5766  C CA  . PRO B 2 5   ? 96.05737  1.87785   39.91760   1.000 51.27009  ? 5   PRO B CA  1 
ATOM 5767  C C   . PRO B 2 5   ? 95.17383  1.73245   41.14540   1.000 51.86496  ? 5   PRO B C   1 
ATOM 5768  O O   . PRO B 2 5   ? 94.58315  2.72496   41.58965   1.000 66.96012  ? 5   PRO B O   1 
ATOM 5769  C CB  . PRO B 2 5   ? 95.34134  1.41874   38.64091   1.000 50.93056  ? 5   PRO B CB  1 
ATOM 5770  C CG  . PRO B 2 5   ? 95.76512  -0.00148  38.47201   1.000 51.43474  ? 5   PRO B CG  1 
ATOM 5771  C CD  . PRO B 2 5   ? 97.18794  -0.06931  38.96292   1.000 51.74280  ? 5   PRO B CD  1 
ATOM 5772  N N   . THR B 2 6   ? 95.05446  0.52227   41.70279   1.000 52.42332  ? 6   THR B N   1 
ATOM 5773  C CA  . THR B 2 6   ? 94.15548  0.31045   42.83545   1.000 53.12796  ? 6   THR B CA  1 
ATOM 5774  C C   . THR B 2 6   ? 94.57231  1.11110   44.06386   1.000 53.59525  ? 6   THR B C   1 
ATOM 5775  O O   . THR B 2 6   ? 93.72323  1.43427   44.90371   1.000 54.06197  ? 6   THR B O   1 
ATOM 5776  C CB  . THR B 2 6   ? 94.07664  -1.17768  43.17978   1.000 53.97269  ? 6   THR B CB  1 
ATOM 5777  O OG1 . THR B 2 6   ? 95.37597  -1.65773  43.54743   1.000 93.48282  ? 6   THR B OG1 1 
ATOM 5778  C CG2 . THR B 2 6   ? 93.55618  -1.97269  41.99000   1.000 53.65774  ? 6   THR B CG2 1 
ATOM 5779  N N   . LEU B 2 7   ? 95.86142  1.44824   44.18498   1.000 53.59748  ? 7   LEU B N   1 
ATOM 5780  C CA  . LEU B 2 7   ? 96.32162  2.25709   45.31067   1.000 54.14055  ? 7   LEU B CA  1 
ATOM 5781  C C   . LEU B 2 7   ? 95.60293  3.59705   45.39688   1.000 62.96327  ? 7   LEU B C   1 
ATOM 5782  O O   . LEU B 2 7   ? 95.61226  4.22648   46.46179   1.000 54.42399  ? 7   LEU B O   1 
ATOM 5783  C CB  . LEU B 2 7   ? 97.83044  2.49396   45.21890   1.000 54.13954  ? 7   LEU B CB  1 
ATOM 5784  C CG  . LEU B 2 7   ? 98.74306  1.28287   45.40518   1.000 71.90244  ? 7   LEU B CG  1 
ATOM 5785  C CD1 . LEU B 2 7   ? 100.20517 1.69744   45.31697   1.000 81.98291  ? 7   LEU B CD1 1 
ATOM 5786  C CD2 . LEU B 2 7   ? 98.45319  0.59554   46.72862   1.000 69.31462  ? 7   LEU B CD2 1 
ATOM 5787  N N   . LEU B 2 8   ? 94.97998  4.04490   44.30410   1.000 52.86882  ? 8   LEU B N   1 
ATOM 5788  C CA  . LEU B 2 8   ? 94.21376  5.28416   44.33002   1.000 52.67125  ? 8   LEU B CA  1 
ATOM 5789  C C   . LEU B 2 8   ? 93.05980  5.22120   45.32105   1.000 53.47338  ? 8   LEU B C   1 
ATOM 5790  O O   . LEU B 2 8   ? 92.58163  6.26999   45.76701   1.000 53.72996  ? 8   LEU B O   1 
ATOM 5791  C CB  . LEU B 2 8   ? 93.69723  5.60620   42.92613   1.000 51.79287  ? 8   LEU B CB  1 
ATOM 5792  C CG  . LEU B 2 8   ? 93.31889  7.06061   42.64021   1.000 51.53157  ? 8   LEU B CG  1 
ATOM 5793  C CD1 . LEU B 2 8   ? 93.74391  7.44357   41.23638   1.000 50.72451  ? 8   LEU B CD1 1 
ATOM 5794  C CD2 . LEU B 2 8   ? 91.82440  7.28110   42.81743   1.000 84.51825  ? 8   LEU B CD2 1 
ATOM 5795  N N   . PHE B 2 9   ? 92.60695  4.01831   45.68274   1.000 53.99916  ? 9   PHE B N   1 
ATOM 5796  C CA  . PHE B 2 9   ? 91.56756  3.88000   46.69523   1.000 54.93180  ? 9   PHE B CA  1 
ATOM 5797  C C   . PHE B 2 9   ? 92.03809  4.29999   48.08133   1.000 55.95414  ? 9   PHE B C   1 
ATOM 5798  O O   . PHE B 2 9   ? 91.21376  4.38098   48.99794   1.000 56.87880  ? 9   PHE B O   1 
ATOM 5799  C CB  . PHE B 2 9   ? 91.06602  2.43708   46.72967   1.000 55.34929  ? 9   PHE B CB  1 
ATOM 5800  C CG  . PHE B 2 9   ? 90.21957  2.06381   45.55006   1.000 54.67703  ? 9   PHE B CG  1 
ATOM 5801  C CD1 . PHE B 2 9   ? 89.15022  2.85684   45.16947   1.000 54.44479  ? 9   PHE B CD1 1 
ATOM 5802  C CD2 . PHE B 2 9   ? 90.50688  0.93170   44.80776   1.000 54.42870  ? 9   PHE B CD2 1 
ATOM 5803  C CE1 . PHE B 2 9   ? 88.37328  2.51844   44.08108   1.000 53.99078  ? 9   PHE B CE1 1 
ATOM 5804  C CE2 . PHE B 2 9   ? 89.73684  0.58999   43.71619   1.000 53.95325  ? 9   PHE B CE2 1 
ATOM 5805  C CZ  . PHE B 2 9   ? 88.66763  1.38452   43.35239   1.000 53.73517  ? 9   PHE B CZ  1 
ATOM 5806  N N   . LEU B 2 10  ? 93.33639  4.55833   48.25780   1.000 55.94190  ? 10  LEU B N   1 
ATOM 5807  C CA  . LEU B 2 10  ? 93.83646  4.98025   49.56113   1.000 57.05865  ? 10  LEU B CA  1 
ATOM 5808  C C   . LEU B 2 10  ? 93.44821  6.41949   49.87121   1.000 58.05698  ? 10  LEU B C   1 
ATOM 5809  O O   . LEU B 2 10  ? 93.23370  6.76463   51.03867   1.000 78.47324  ? 10  LEU B O   1 
ATOM 5810  C CB  . LEU B 2 10  ? 95.35101  4.80083   49.62242   1.000 57.13537  ? 10  LEU B CB  1 
ATOM 5811  C CG  . LEU B 2 10  ? 95.74134  3.32493   49.56673   1.000 57.47583  ? 10  LEU B CG  1 
ATOM 5812  C CD1 . LEU B 2 10  ? 97.25082  3.13663   49.57308   1.000 57.67930  ? 10  LEU B CD1 1 
ATOM 5813  C CD2 . LEU B 2 10  ? 95.08416  2.59094   50.71888   1.000 58.85373  ? 10  LEU B CD2 1 
ATOM 5814  N N   . LYS B 2 11  ? 93.36421  7.26983   48.85032   1.000 57.73139  ? 11  LYS B N   1 
ATOM 5815  C CA  . LYS B 2 11  ? 92.97060  8.66368   49.01455   1.000 57.46916  ? 11  LYS B CA  1 
ATOM 5816  C C   . LYS B 2 11  ? 91.49566  8.90226   48.72112   1.000 64.92852  ? 11  LYS B C   1 
ATOM 5817  O O   . LYS B 2 11  ? 90.85681  9.71306   49.39929   1.000 77.31352  ? 11  LYS B O   1 
ATOM 5818  C CB  . LYS B 2 11  ? 93.81794  9.56173   48.10709   1.000 56.54248  ? 11  LYS B CB  1 
ATOM 5819  C CG  . LYS B 2 11  ? 93.53138  11.04383  48.26629   1.000 72.04690  ? 11  LYS B CG  1 
ATOM 5820  C CD  . LYS B 2 11  ? 94.46576  11.88500  47.41683   1.000 93.06865  ? 11  LYS B CD  1 
ATOM 5821  C CE  . LYS B 2 11  ? 94.16824  13.36534  47.58204   1.000 116.88593 ? 11  LYS B CE  1 
ATOM 5822  N NZ  . LYS B 2 11  ? 94.34273  13.81341  48.99153   1.000 134.93463 ? 11  LYS B NZ  1 
ATOM 5823  N N   . VAL B 2 12  ? 90.94127  8.21306   47.73552   1.000 57.12439  ? 12  VAL B N   1 
ATOM 5824  C CA  . VAL B 2 12  ? 89.54934  8.38502   47.32608   1.000 57.15519  ? 12  VAL B CA  1 
ATOM 5825  C C   . VAL B 2 12  ? 88.73845  7.20102   47.84193   1.000 67.97817  ? 12  VAL B C   1 
ATOM 5826  O O   . VAL B 2 12  ? 89.19327  6.05573   47.71340   1.000 61.22114  ? 12  VAL B O   1 
ATOM 5827  C CB  . VAL B 2 12  ? 89.42750  8.50139   45.79566   1.000 58.01244  ? 12  VAL B CB  1 
ATOM 5828  C CG1 . VAL B 2 12  ? 87.98599  8.75181   45.38874   1.000 72.36945  ? 12  VAL B CG1 1 
ATOM 5829  C CG2 . VAL B 2 12  ? 90.33390  9.60563   45.27275   1.000 59.08395  ? 12  VAL B CG2 1 
ATOM 5830  N N   . PRO B 2 13  ? 87.56380  7.42587   48.43300   1.000 77.67640  ? 13  PRO B N   1 
ATOM 5831  C CA  . PRO B 2 13  ? 86.71890  6.30288   48.85684   1.000 73.90589  ? 13  PRO B CA  1 
ATOM 5832  C C   . PRO B 2 13  ? 86.28409  5.45376   47.66903   1.000 71.69061  ? 13  PRO B C   1 
ATOM 5833  O O   . PRO B 2 13  ? 86.37123  5.86348   46.50938   1.000 65.85024  ? 13  PRO B O   1 
ATOM 5834  C CB  . PRO B 2 13  ? 85.52169  6.99020   49.52497   1.000 70.09607  ? 13  PRO B CB  1 
ATOM 5835  C CG  . PRO B 2 13  ? 86.05429  8.31603   49.96643   1.000 75.13726  ? 13  PRO B CG  1 
ATOM 5836  C CD  . PRO B 2 13  ? 87.04601  8.71886   48.91181   1.000 77.28456  ? 13  PRO B CD  1 
ATOM 5837  N N   . ALA B 2 14  ? 85.80502  4.24522   47.97677   1.000 58.52620  ? 14  ALA B N   1 
ATOM 5838  C CA  . ALA B 2 14  ? 85.48288  3.28337   46.92501   1.000 57.90048  ? 14  ALA B CA  1 
ATOM 5839  C C   . ALA B 2 14  ? 84.31876  3.75473   46.05898   1.000 57.68631  ? 14  ALA B C   1 
ATOM 5840  O O   . ALA B 2 14  ? 84.40273  3.72615   44.82587   1.000 56.82325  ? 14  ALA B O   1 
ATOM 5841  C CB  . ALA B 2 14  ? 85.17071  1.92045   47.54188   1.000 58.70578  ? 14  ALA B CB  1 
ATOM 5842  N N   . GLN B 2 15  ? 83.22072  4.19053   46.68350   1.000 67.40457  ? 15  GLN B N   1 
ATOM 5843  C CA  . GLN B 2 15  ? 82.03427  4.57258   45.92084   1.000 57.76466  ? 15  GLN B CA  1 
ATOM 5844  C C   . GLN B 2 15  ? 82.26524  5.78528   45.02803   1.000 57.08679  ? 15  GLN B C   1 
ATOM 5845  O O   . GLN B 2 15  ? 81.49750  5.99596   44.08211   1.000 56.98260  ? 15  GLN B O   1 
ATOM 5846  C CB  . GLN B 2 15  ? 80.85295  4.83825   46.85517   1.000 59.09784  ? 15  GLN B CB  1 
ATOM 5847  C CG  . GLN B 2 15  ? 80.28279  3.59323   47.51352   1.000 59.91992  ? 15  GLN B CG  1 
ATOM 5848  C CD  . GLN B 2 15  ? 81.02738  3.19405   48.76628   1.000 72.92296  ? 15  GLN B CD  1 
ATOM 5849  O OE1 . GLN B 2 15  ? 81.81044  3.97005   49.31154   1.000 68.48889  ? 15  GLN B OE1 1 
ATOM 5850  N NE2 . GLN B 2 15  ? 80.77989  1.97796   49.23720   1.000 77.25717  ? 15  GLN B NE2 1 
ATOM 5851  N N   . ASN B 2 16  ? 83.29585  6.58642   45.29747   1.000 68.43493  ? 16  ASN B N   1 
ATOM 5852  C CA  . ASN B 2 16  ? 83.56419  7.74978   44.46155   1.000 64.06534  ? 16  ASN B CA  1 
ATOM 5853  C C   . ASN B 2 16  ? 84.28748  7.39366   43.16998   1.000 65.78622  ? 16  ASN B C   1 
ATOM 5854  O O   . ASN B 2 16  ? 84.20003  8.15329   42.19928   1.000 80.58560  ? 16  ASN B O   1 
ATOM 5855  C CB  . ASN B 2 16  ? 84.37923  8.78228   45.24100   1.000 57.58930  ? 16  ASN B CB  1 
ATOM 5856  C CG  . ASN B 2 16  ? 83.64609  9.30155   46.46017   1.000 72.66861  ? 16  ASN B CG  1 
ATOM 5857  O OD1 . ASN B 2 16  ? 84.17878  9.29006   47.56779   1.000 78.79284  ? 16  ASN B OD1 1 
ATOM 5858  N ND2 . ASN B 2 16  ? 82.41529  9.76010   46.26217   1.000 71.75265  ? 16  ASN B ND2 1 
ATOM 5859  N N   . ALA B 2 17  ? 84.99942  6.26924   43.13523   1.000 59.62546  ? 17  ALA B N   1 
ATOM 5860  C CA  . ALA B 2 17  ? 85.72924  5.84362   41.94582   1.000 57.02696  ? 17  ALA B CA  1 
ATOM 5861  C C   . ALA B 2 17  ? 85.53758  4.35378   41.71299   1.000 60.82143  ? 17  ALA B C   1 
ATOM 5862  O O   . ALA B 2 17  ? 86.46173  3.64750   41.29689   1.000 55.48426  ? 17  ALA B O   1 
ATOM 5863  C CB  . ALA B 2 17  ? 87.21522  6.17837   42.05942   1.000 55.41039  ? 17  ALA B CB  1 
ATOM 5864  N N   . ILE B 2 18  ? 84.32778  3.85336   41.97441   1.000 54.15115  ? 18  ILE B N   1 
ATOM 5865  C CA  . ILE B 2 18  ? 84.06940  2.43020   41.80287   1.000 58.43876  ? 18  ILE B CA  1 
ATOM 5866  C C   . ILE B 2 18  ? 84.00577  2.04296   40.33132   1.000 70.04628  ? 18  ILE B C   1 
ATOM 5867  O O   . ILE B 2 18  ? 84.18337  0.86558   39.99661   1.000 88.28912  ? 18  ILE B O   1 
ATOM 5868  C CB  . ILE B 2 18  ? 82.77547  2.02996   42.53719   1.000 55.33129  ? 18  ILE B CB  1 
ATOM 5869  C CG1 . ILE B 2 18  ? 82.73258  0.51651   42.75595   1.000 55.70023  ? 18  ILE B CG1 1 
ATOM 5870  C CG2 . ILE B 2 18  ? 81.55174  2.50279   41.76598   1.000 55.56955  ? 18  ILE B CG2 1 
ATOM 5871  C CD1 . ILE B 2 18  ? 83.88334  -0.00501  43.59333   1.000 55.75837  ? 18  ILE B CD1 1 
ATOM 5872  N N   . SER B 2 19  ? 83.76822  3.00527   39.43562   1.000 74.51233  ? 19  SER B N   1 
ATOM 5873  C CA  . SER B 2 19  ? 83.70117  2.70492   38.01028   1.000 67.15378  ? 19  SER B CA  1 
ATOM 5874  C C   . SER B 2 19  ? 85.03892  2.25483   37.43772   1.000 64.63825  ? 19  SER B C   1 
ATOM 5875  O O   . SER B 2 19  ? 85.07780  1.80249   36.28826   1.000 56.28340  ? 19  SER B O   1 
ATOM 5876  C CB  . SER B 2 19  ? 83.18530  3.92204   37.23854   1.000 53.87338  ? 19  SER B CB  1 
ATOM 5877  O OG  . SER B 2 19  ? 83.88630  5.09735   37.60294   1.000 53.55328  ? 19  SER B OG  1 
ATOM 5878  N N   . THR B 2 20  ? 86.12895  2.37017   38.20069   1.000 57.45063  ? 20  THR B N   1 
ATOM 5879  C CA  . THR B 2 20  ? 87.41410  1.84091   37.76397   1.000 51.71189  ? 20  THR B CA  1 
ATOM 5880  C C   . THR B 2 20  ? 87.48825  0.32581   37.88947   1.000 71.16162  ? 20  THR B C   1 
ATOM 5881  O O   . THR B 2 20  ? 88.32961  -0.29648  37.23193   1.000 69.38675  ? 20  THR B O   1 
ATOM 5882  C CB  . THR B 2 20  ? 88.55605  2.47292   38.56489   1.000 51.44136  ? 20  THR B CB  1 
ATOM 5883  O OG1 . THR B 2 20  ? 88.51848  1.99431   39.91465   1.000 51.99454  ? 20  THR B OG1 1 
ATOM 5884  C CG2 . THR B 2 20  ? 88.43421  3.99009   38.56640   1.000 51.24745  ? 20  THR B CG2 1 
ATOM 5885  N N   . THR B 2 21  ? 86.62924  -0.27778  38.71569   1.000 52.73397  ? 21  THR B N   1 
ATOM 5886  C CA  . THR B 2 21  ? 86.64738  -1.72535  38.88835   1.000 53.24415  ? 21  THR B CA  1 
ATOM 5887  C C   . THR B 2 21  ? 85.95292  -2.44163  37.73821   1.000 68.06292  ? 21  THR B C   1 
ATOM 5888  O O   . THR B 2 21  ? 86.26616  -3.60481  37.46384   1.000 83.71462  ? 21  THR B O   1 
ATOM 5889  C CB  . THR B 2 21  ? 85.99303  -2.11522  40.21661   1.000 54.03996  ? 21  THR B CB  1 
ATOM 5890  O OG1 . THR B 2 21  ? 84.61553  -1.72240  40.20928   1.000 54.37057  ? 21  THR B OG1 1 
ATOM 5891  C CG2 . THR B 2 21  ? 86.69832  -1.43576  41.38036   1.000 54.07574  ? 21  THR B CG2 1 
ATOM 5892  N N   . PHE B 2 22  ? 85.01282  -1.77488  37.06281   1.000 53.36387  ? 22  PHE B N   1 
ATOM 5893  C CA  . PHE B 2 22  ? 84.33282  -2.35883  35.91372   1.000 53.65129  ? 22  PHE B CA  1 
ATOM 5894  C C   . PHE B 2 22  ? 85.28205  -2.32092  34.72297   1.000 53.17614  ? 22  PHE B C   1 
ATOM 5895  O O   . PHE B 2 22  ? 85.49855  -1.25381  34.13385   1.000 52.72896  ? 22  PHE B O   1 
ATOM 5896  C CB  . PHE B 2 22  ? 83.03926  -1.60390  35.60258   1.000 53.94971  ? 22  PHE B CB  1 
ATOM 5897  C CG  . PHE B 2 22  ? 82.00129  -1.70711  36.68396   1.000 54.60361  ? 22  PHE B CG  1 
ATOM 5898  C CD1 . PHE B 2 22  ? 81.19513  -2.82830  36.78528   1.000 55.35414  ? 22  PHE B CD1 1 
ATOM 5899  C CD2 . PHE B 2 22  ? 81.83389  -0.68227  37.60118   1.000 54.58974  ? 22  PHE B CD2 1 
ATOM 5900  C CE1 . PHE B 2 22  ? 80.24104  -2.92523  37.77951   1.000 56.06056  ? 22  PHE B CE1 1 
ATOM 5901  C CE2 . PHE B 2 22  ? 80.88180  -0.77353  38.59791   1.000 55.33827  ? 22  PHE B CE2 1 
ATOM 5902  C CZ  . PHE B 2 22  ? 80.08466  -1.89665  38.68691   1.000 56.06562  ? 22  PHE B CZ  1 
ATOM 5903  N N   . PRO B 2 23  ? 85.86173  -3.45600  34.33607   1.000 53.38993  ? 23  PRO B N   1 
ATOM 5904  C CA  . PRO B 2 23  ? 86.93901  -3.42791  33.33927   1.000 82.63049  ? 23  PRO B CA  1 
ATOM 5905  C C   . PRO B 2 23  ? 86.43594  -3.21750  31.92090   1.000 77.58321  ? 23  PRO B C   1 
ATOM 5906  O O   . PRO B 2 23  ? 87.05502  -2.50012  31.12836   1.000 76.22012  ? 23  PRO B O   1 
ATOM 5907  C CB  . PRO B 2 23  ? 87.59231  -4.80413  33.50798   1.000 75.95556  ? 23  PRO B CB  1 
ATOM 5908  C CG  . PRO B 2 23  ? 86.46141  -5.69123  33.92963   1.000 66.36404  ? 23  PRO B CG  1 
ATOM 5909  C CD  . PRO B 2 23  ? 85.50673  -4.83143  34.73238   1.000 56.86573  ? 23  PRO B CD  1 
ATOM 5910  N N   . TYR B 2 24  ? 85.31293  -3.84545  31.59575   1.000 55.80792  ? 24  TYR B N   1 
ATOM 5911  C CA  . TYR B 2 24  ? 84.80495  -3.87806  30.23539   1.000 56.25872  ? 24  TYR B CA  1 
ATOM 5912  C C   . TYR B 2 24  ? 83.80820  -2.75111  29.99806   1.000 56.32298  ? 24  TYR B C   1 
ATOM 5913  O O   . TYR B 2 24  ? 83.11266  -2.30456  30.91438   1.000 102.92688 ? 24  TYR B O   1 
ATOM 5914  C CB  . TYR B 2 24  ? 84.14211  -5.22792  29.95923   1.000 57.16786  ? 24  TYR B CB  1 
ATOM 5915  C CG  . TYR B 2 24  ? 85.08759  -6.40251  30.08651   1.000 70.86300  ? 24  TYR B CG  1 
ATOM 5916  C CD1 . TYR B 2 24  ? 86.45325  -6.24889  29.88259   1.000 56.89532  ? 24  TYR B CD1 1 
ATOM 5917  C CD2 . TYR B 2 24  ? 84.61686  -7.65927  30.44379   1.000 73.49525  ? 24  TYR B CD2 1 
ATOM 5918  C CE1 . TYR B 2 24  ? 87.31973  -7.31949  30.00915   1.000 62.55912  ? 24  TYR B CE1 1 
ATOM 5919  C CE2 . TYR B 2 24  ? 85.47636  -8.73473  30.57605   1.000 68.74936  ? 24  TYR B CE2 1 
ATOM 5920  C CZ  . TYR B 2 24  ? 86.82539  -8.55977  30.35551   1.000 66.32967  ? 24  TYR B CZ  1 
ATOM 5921  O OH  . TYR B 2 24  ? 87.68489  -9.62679  30.48352   1.000 80.07690  ? 24  TYR B OH  1 
ATOM 5922  N N   . THR B 2 25  ? 83.74622  -2.29271  28.74948   1.000 62.65360  ? 25  THR B N   1 
ATOM 5923  C CA  . THR B 2 25  ? 82.75558  -1.29952  28.34947   1.000 63.01470  ? 25  THR B CA  1 
ATOM 5924  C C   . THR B 2 25  ? 81.46801  -1.98720  27.90601   1.000 100.11190 ? 25  THR B C   1 
ATOM 5925  O O   . THR B 2 25  ? 80.38891  -1.70830  28.43744   1.000 115.56339 ? 25  THR B O   1 
ATOM 5926  C CB  . THR B 2 25  ? 83.30430  -0.40819  27.23024   1.000 63.20816  ? 25  THR B CB  1 
ATOM 5927  O OG1 . THR B 2 25  ? 84.53122  0.19533   27.65697   1.000 67.76428  ? 25  THR B OG1 1 
ATOM 5928  C CG2 . THR B 2 25  ? 82.30349  0.68619   26.89556   1.000 63.47289  ? 25  THR B CG2 1 
ATOM 5929  N N   . GLY B 2 26  ? 81.57278  -2.88802  26.93225   1.000 96.89464  ? 26  GLY B N   1 
ATOM 5930  C CA  . GLY B 2 26  ? 80.43342  -3.65920  26.47995   1.000 87.52733  ? 26  GLY B CA  1 
ATOM 5931  C C   . GLY B 2 26  ? 80.49618  -5.11245  26.90461   1.000 70.37027  ? 26  GLY B C   1 
ATOM 5932  O O   . GLY B 2 26  ? 80.61897  -5.41265  28.09624   1.000 78.05765  ? 26  GLY B O   1 
ATOM 5933  N N   . ASP B 2 27  ? 80.41765  -6.02616  25.93781   1.000 66.73099  ? 27  ASP B N   1 
ATOM 5934  C CA  . ASP B 2 27  ? 80.46493  -7.45302  26.21561   1.000 72.46382  ? 27  ASP B CA  1 
ATOM 5935  C C   . ASP B 2 27  ? 81.75040  -8.06727  25.68562   1.000 80.59104  ? 27  ASP B C   1 
ATOM 5936  O O   . ASP B 2 27  ? 82.11082  -7.83535  24.52372   1.000 100.73140 ? 27  ASP B O   1 
ATOM 5937  C CB  . ASP B 2 27  ? 79.25643  -8.16060  25.59222   1.000 92.93538  ? 27  ASP B CB  1 
ATOM 5938  C CG  . ASP B 2 27  ? 77.95262  -7.80299  26.28004   1.000 130.47374 ? 27  ASP B CG  1 
ATOM 5939  O OD1 . ASP B 2 27  ? 77.98533  -7.46572  27.48200   1.000 142.67173 ? 27  ASP B OD1 1 
ATOM 5940  O OD2 . ASP B 2 27  ? 76.89390  -7.86273  25.62030   1.000 148.97981 ? 27  ASP B OD2 1 
ATOM 5941  N N   . PRO B 2 28  ? 82.45926  -8.84882  26.49481   1.000 79.42166  ? 28  PRO B N   1 
ATOM 5942  C CA  . PRO B 2 28  ? 83.70248  -9.46984  26.03768   1.000 82.99153  ? 28  PRO B CA  1 
ATOM 5943  C C   . PRO B 2 28  ? 83.40402  -10.74733 25.27665   1.000 88.56722  ? 28  PRO B C   1 
ATOM 5944  O O   . PRO B 2 28  ? 82.25573  -11.21587 25.27421   1.000 105.83982 ? 28  PRO B O   1 
ATOM 5945  C CB  . PRO B 2 28  ? 84.43553  -9.76549  27.35025   1.000 88.92296  ? 28  PRO B CB  1 
ATOM 5946  C CG  . PRO B 2 28  ? 83.31343  -10.10740 28.28383   1.000 78.25272  ? 28  PRO B CG  1 
ATOM 5947  C CD  . PRO B 2 28  ? 82.15042  -9.21122  27.88995   1.000 72.74401  ? 28  PRO B CD  1 
ATOM 5948  N N   . PRO B 2 29  ? 84.39121  -11.33382 24.60137   1.000 67.95511  ? 29  PRO B N   1 
ATOM 5949  C CA  . PRO B 2 29  ? 84.18131  -12.67782 24.04936   1.000 69.35764  ? 29  PRO B CA  1 
ATOM 5950  C C   . PRO B 2 29  ? 83.90756  -13.68584 25.15815   1.000 80.51357  ? 29  PRO B C   1 
ATOM 5951  O O   . PRO B 2 29  ? 84.68553  -13.82627 26.10493   1.000 69.10564  ? 29  PRO B O   1 
ATOM 5952  C CB  . PRO B 2 29  ? 85.50036  -12.97100 23.32750   1.000 69.64368  ? 29  PRO B CB  1 
ATOM 5953  C CG  . PRO B 2 29  ? 86.03394  -11.62160 22.97070   1.000 68.64766  ? 29  PRO B CG  1 
ATOM 5954  C CD  . PRO B 2 29  ? 85.63382  -10.71677 24.10483   1.000 67.40001  ? 29  PRO B CD  1 
ATOM 5955  N N   . TYR B 2 30  ? 82.78949  -14.39094 25.02464   1.000 114.91801 ? 30  TYR B N   1 
ATOM 5956  C CA  . TYR B 2 30  ? 82.29435  -15.37524 25.97418   1.000 115.98487 ? 30  TYR B CA  1 
ATOM 5957  C C   . TYR B 2 30  ? 82.50541  -16.78964 25.43665   1.000 127.70629 ? 30  TYR B C   1 
ATOM 5958  O O   . TYR B 2 30  ? 83.13975  -16.99838 24.39648   1.000 123.61754 ? 30  TYR B O   1 
ATOM 5959  C CB  . TYR B 2 30  ? 80.82541  -15.08970 26.29008   1.000 114.12552 ? 30  TYR B CB  1 
ATOM 5960  C CG  . TYR B 2 30  ? 80.11635  -14.35601 25.17961   1.000 120.45907 ? 30  TYR B CG  1 
ATOM 5961  C CD1 . TYR B 2 30  ? 79.75757  -13.02346 25.32652   1.000 129.31639 ? 30  TYR B CD1 1 
ATOM 5962  C CD2 . TYR B 2 30  ? 79.82506  -14.98604 23.97717   1.000 118.85230 ? 30  TYR B CD2 1 
ATOM 5963  C CE1 . TYR B 2 30  ? 79.11919  -12.34045 24.31287   1.000 133.32964 ? 30  TYR B CE1 1 
ATOM 5964  C CE2 . TYR B 2 30  ? 79.18607  -14.31105 22.95604   1.000 121.50410 ? 30  TYR B CE2 1 
ATOM 5965  C CZ  . TYR B 2 30  ? 78.83527  -12.98922 23.12931   1.000 127.66889 ? 30  TYR B CZ  1 
ATOM 5966  O OH  . TYR B 2 30  ? 78.19806  -12.31634 22.11299   1.000 125.21579 ? 30  TYR B OH  1 
ATOM 5967  N N   . SER B 2 31  ? 81.96175  -17.76750 26.15503   1.000 133.91526 ? 31  SER B N   1 
ATOM 5968  C CA  . SER B 2 31  ? 81.89943  -19.13954 25.66455   1.000 134.48013 ? 31  SER B CA  1 
ATOM 5969  C C   . SER B 2 31  ? 80.75820  -19.89407 26.33861   1.000 127.61512 ? 31  SER B C   1 
ATOM 5970  O O   . SER B 2 31  ? 80.60637  -19.84546 27.55976   1.000 121.16064 ? 31  SER B O   1 
ATOM 5971  C CB  . SER B 2 31  ? 83.22075  -19.86768 25.90381   1.000 130.26232 ? 31  SER B CB  1 
ATOM 5972  O OG  . SER B 2 31  ? 83.28156  -20.37371 27.22441   1.000 122.27216 ? 31  SER B OG  1 
ATOM 5973  N N   . GLY B 2 35  ? 77.36349  -23.89573 25.34757   1.000 84.43030  ? 35  GLY B N   1 
ATOM 5974  C CA  . GLY B 2 35  ? 77.84216  -25.26390 25.40897   1.000 87.42213  ? 35  GLY B CA  1 
ATOM 5975  C C   . GLY B 2 35  ? 76.73044  -26.29374 25.45378   1.000 112.45985 ? 35  GLY B C   1 
ATOM 5976  O O   . GLY B 2 35  ? 75.55793  -25.95254 25.62084   1.000 107.18126 ? 35  GLY B O   1 
ATOM 5977  N N   . THR B 2 36  ? 77.10703  -27.56618 25.29714   1.000 121.78066 ? 36  THR B N   1 
ATOM 5978  C CA  . THR B 2 36  ? 76.16331  -28.67229 25.36028   1.000 115.26062 ? 36  THR B CA  1 
ATOM 5979  C C   . THR B 2 36  ? 76.30917  -29.50374 26.62770   1.000 98.79926  ? 36  THR B C   1 
ATOM 5980  O O   . THR B 2 36  ? 75.34836  -30.16505 27.03382   1.000 93.45813  ? 36  THR B O   1 
ATOM 5981  C CB  . THR B 2 36  ? 76.33419  -29.57580 24.12474   1.000 99.77296  ? 36  THR B CB  1 
ATOM 5982  O OG1 . THR B 2 36  ? 76.20181  -28.78241 22.93857   1.000 93.35821  ? 36  THR B OG1 1 
ATOM 5983  C CG2 . THR B 2 36  ? 75.27734  -30.66924 24.08900   1.000 95.71755  ? 36  THR B CG2 1 
ATOM 5984  N N   . GLY B 2 37  ? 77.45971  -29.43544 27.28929   1.000 106.98295 ? 37  GLY B N   1 
ATOM 5985  C CA  . GLY B 2 37  ? 77.70728  -30.16423 28.51579   1.000 104.86280 ? 37  GLY B CA  1 
ATOM 5986  C C   . GLY B 2 37  ? 77.28901  -29.33020 29.70569   1.000 113.19404 ? 37  GLY B C   1 
ATOM 5987  O O   . GLY B 2 37  ? 76.81615  -29.84995 30.72109   1.000 106.51071 ? 37  GLY B O   1 
ATOM 5988  N N   . TYR B 2 38  ? 77.48448  -28.01571 29.57238   1.000 123.42320 ? 38  TYR B N   1 
ATOM 5989  C CA  . TYR B 2 38  ? 77.11260  -27.06417 30.61357   1.000 130.35839 ? 38  TYR B CA  1 
ATOM 5990  C C   . TYR B 2 38  ? 75.64235  -27.19107 30.99363   1.000 114.80230 ? 38  TYR B C   1 
ATOM 5991  O O   . TYR B 2 38  ? 75.26791  -26.90292 32.13634   1.000 104.96691 ? 38  TYR B O   1 
ATOM 5992  C CB  . TYR B 2 38  ? 77.44491  -25.65096 30.11522   1.000 134.82924 ? 38  TYR B CB  1 
ATOM 5993  C CG  . TYR B 2 38  ? 77.03566  -24.49061 30.99930   1.000 120.71983 ? 38  TYR B CG  1 
ATOM 5994  C CD1 . TYR B 2 38  ? 77.96473  -23.86130 31.81777   1.000 113.47564 ? 38  TYR B CD1 1 
ATOM 5995  C CD2 . TYR B 2 38  ? 75.74189  -23.98140 30.96671   1.000 113.46730 ? 38  TYR B CD2 1 
ATOM 5996  C CE1 . TYR B 2 38  ? 77.60763  -22.78847 32.61156   1.000 117.46465 ? 38  TYR B CE1 1 
ATOM 5997  C CE2 . TYR B 2 38  ? 75.37554  -22.90937 31.75724   1.000 111.46122 ? 38  TYR B CE2 1 
ATOM 5998  C CZ  . TYR B 2 38  ? 76.31233  -22.31614 32.57637   1.000 121.91494 ? 38  TYR B CZ  1 
ATOM 5999  O OH  . TYR B 2 38  ? 75.94858  -21.24694 33.36208   1.000 137.93620 ? 38  TYR B OH  1 
ATOM 6000  N N   . THR B 2 39  ? 74.79599  -27.61319 30.05163   1.000 91.66341  ? 39  THR B N   1 
ATOM 6001  C CA  . THR B 2 39  ? 73.39999  -27.89265 30.37393   1.000 92.63772  ? 39  THR B CA  1 
ATOM 6002  C C   . THR B 2 39  ? 73.27493  -29.04423 31.36708   1.000 93.17738  ? 39  THR B C   1 
ATOM 6003  O O   . THR B 2 39  ? 72.48598  -28.97176 32.31828   1.000 105.03243 ? 39  THR B O   1 
ATOM 6004  C CB  . THR B 2 39  ? 72.62263  -28.20475 29.09541   1.000 92.88735  ? 39  THR B CB  1 
ATOM 6005  O OG1 . THR B 2 39  ? 72.78257  -27.12940 28.16183   1.000 91.71728  ? 39  THR B OG1 1 
ATOM 6006  C CG2 . THR B 2 39  ? 71.14431  -28.38969 29.40158   1.000 93.80399  ? 39  THR B CG2 1 
ATOM 6007  N N   . MET B 2 40  ? 74.04928  -30.11510 31.16369   1.000 105.52519 ? 40  MET B N   1 
ATOM 6008  C CA  . MET B 2 40  ? 73.99555  -31.25715 32.07343   1.000 93.03895  ? 40  MET B CA  1 
ATOM 6009  C C   . MET B 2 40  ? 74.43371  -30.87675 33.48136   1.000 92.66772  ? 40  MET B C   1 
ATOM 6010  O O   . MET B 2 40  ? 73.87491  -31.37387 34.46667   1.000 96.16158  ? 40  MET B O   1 
ATOM 6011  C CB  . MET B 2 40  ? 74.86446  -32.39842 31.54473   1.000 95.08602  ? 40  MET B CB  1 
ATOM 6012  C CG  . MET B 2 40  ? 74.28760  -33.13771 30.35144   1.000 100.98195 ? 40  MET B CG  1 
ATOM 6013  S SD  . MET B 2 40  ? 75.29006  -34.57065 29.90955   1.000 110.58620 ? 40  MET B SD  1 
ATOM 6014  C CE  . MET B 2 40  ? 76.76961  -33.76919 29.29418   1.000 112.29682 ? 40  MET B CE  1 
ATOM 6015  N N   . ASP B 2 41  ? 75.44009  -30.00874 33.59792   1.000 82.95364  ? 41  ASP B N   1 
ATOM 6016  C CA  . ASP B 2 41  ? 75.87195  -29.55114 34.91456   1.000 93.26335  ? 41  ASP B CA  1 
ATOM 6017  C C   . ASP B 2 41  ? 74.73031  -28.86447 35.65301   1.000 99.45176  ? 41  ASP B C   1 
ATOM 6018  O O   . ASP B 2 41  ? 74.46255  -29.16056 36.82386   1.000 125.32033 ? 41  ASP B O   1 
ATOM 6019  C CB  . ASP B 2 41  ? 77.06991  -28.61149 34.77399   1.000 102.04550 ? 41  ASP B CB  1 
ATOM 6020  C CG  . ASP B 2 41  ? 78.39285  -29.35043 34.77975   1.000 118.61569 ? 41  ASP B CG  1 
ATOM 6021  O OD1 . ASP B 2 41  ? 78.49234  -30.38902 35.46670   1.000 125.11768 ? 41  ASP B OD1 1 
ATOM 6022  O OD2 . ASP B 2 41  ? 79.33247  -28.89256 34.09567   1.000 128.09019 ? 41  ASP B OD2 1 
ATOM 6023  N N   . THR B 2 42  ? 74.03239  -27.95355 34.97217   1.000 92.07769  ? 42  THR B N   1 
ATOM 6024  C CA  . THR B 2 42  ? 72.93177  -27.23715 35.60599   1.000 88.12761  ? 42  THR B CA  1 
ATOM 6025  C C   . THR B 2 42  ? 71.78055  -28.17758 35.94137   1.000 93.87447  ? 42  THR B C   1 
ATOM 6026  O O   . THR B 2 42  ? 71.14007  -28.03357 36.98959   1.000 96.19955  ? 42  THR B O   1 
ATOM 6027  C CB  . THR B 2 42  ? 72.45398  -26.10414 34.69774   1.000 81.59315  ? 42  THR B CB  1 
ATOM 6028  O OG1 . THR B 2 42  ? 73.56775  -25.27584 34.34161   1.000 80.02859  ? 42  THR B OG1 1 
ATOM 6029  C CG2 . THR B 2 42  ? 71.41138  -25.25465 35.40835   1.000 87.86074  ? 42  THR B CG2 1 
ATOM 6030  N N   . VAL B 2 43  ? 71.50582  -29.15005 35.06818   1.000 83.94272  ? 43  VAL B N   1 
ATOM 6031  C CA  . VAL B 2 43  ? 70.42644  -30.10000 35.33278   1.000 85.80778  ? 43  VAL B CA  1 
ATOM 6032  C C   . VAL B 2 43  ? 70.74414  -30.93904 36.56526   1.000 86.96020  ? 43  VAL B C   1 
ATOM 6033  O O   . VAL B 2 43  ? 69.89126  -31.14003 37.43846   1.000 94.94698  ? 43  VAL B O   1 
ATOM 6034  C CB  . VAL B 2 43  ? 70.17166  -30.98395 34.09846   1.000 87.17946  ? 43  VAL B CB  1 
ATOM 6035  C CG1 . VAL B 2 43  ? 69.29260  -32.16920 34.46637   1.000 89.35827  ? 43  VAL B CG1 1 
ATOM 6036  C CG2 . VAL B 2 43  ? 69.52544  -30.17017 32.98929   1.000 86.44244  ? 43  VAL B CG2 1 
ATOM 6037  N N   . ASN B 2 44  ? 71.98063  -31.43514 36.65970   1.000 85.45215  ? 44  ASN B N   1 
ATOM 6038  C CA  . ASN B 2 44  ? 72.36221  -32.24421 37.81254   1.000 86.73869  ? 44  ASN B CA  1 
ATOM 6039  C C   . ASN B 2 44  ? 72.40328  -31.42240 39.09457   1.000 93.53564  ? 44  ASN B C   1 
ATOM 6040  O O   . ASN B 2 44  ? 72.07725  -31.94003 40.16898   1.000 114.56473 ? 44  ASN B O   1 
ATOM 6041  C CB  . ASN B 2 44  ? 73.71483  -32.91006 37.56472   1.000 87.26799  ? 44  ASN B CB  1 
ATOM 6042  C CG  . ASN B 2 44  ? 73.61505  -34.09686 36.62922   1.000 104.01136 ? 44  ASN B CG  1 
ATOM 6043  O OD1 . ASN B 2 44  ? 74.18667  -34.09346 35.53950   1.000 129.73203 ? 44  ASN B OD1 1 
ATOM 6044  N ND2 . ASN B 2 44  ? 72.87975  -35.12007 37.04917   1.000 98.52377  ? 44  ASN B ND2 1 
ATOM 6045  N N   . ARG B 2 45  ? 72.79928  -30.15058 39.00825   1.000 85.97955  ? 45  ARG B N   1 
ATOM 6046  C CA  . ARG B 2 45  ? 72.78831  -29.29667 40.19208   1.000 85.13605  ? 45  ARG B CA  1 
ATOM 6047  C C   . ARG B 2 45  ? 71.36644  -28.99162 40.64907   1.000 85.47324  ? 45  ARG B C   1 
ATOM 6048  O O   . ARG B 2 45  ? 71.09676  -28.93788 41.85444   1.000 86.01257  ? 45  ARG B O   1 
ATOM 6049  C CB  . ARG B 2 45  ? 73.56194  -28.00837 39.91572   1.000 82.94466  ? 45  ARG B CB  1 
ATOM 6050  C CG  . ARG B 2 45  ? 75.06123  -28.22131 39.78619   1.000 82.66984  ? 45  ARG B CG  1 
ATOM 6051  C CD  . ARG B 2 45  ? 75.80774  -26.91327 39.58104   1.000 80.84029  ? 45  ARG B CD  1 
ATOM 6052  N NE  . ARG B 2 45  ? 75.19379  -26.09348 38.53999   1.000 102.05991 ? 45  ARG B NE  1 
ATOM 6053  C CZ  . ARG B 2 45  ? 75.69630  -24.94482 38.09844   1.000 105.76437 ? 45  ARG B CZ  1 
ATOM 6054  N NH1 . ARG B 2 45  ? 76.82709  -24.47391 38.60649   1.000 111.70415 ? 45  ARG B NH1 1 
ATOM 6055  N NH2 . ARG B 2 45  ? 75.07120  -24.26894 37.14431   1.000 96.18340  ? 45  ARG B NH2 1 
ATOM 6056  N N   . THR B 2 46  ? 70.44622  -28.77795 39.70485   1.000 83.05019  ? 46  THR B N   1 
ATOM 6057  C CA  . THR B 2 46  ? 69.05976  -28.50433 40.07345   1.000 83.53134  ? 46  THR B CA  1 
ATOM 6058  C C   . THR B 2 46  ? 68.43512  -29.68548 40.80803   1.000 85.71521  ? 46  THR B C   1 
ATOM 6059  O O   . THR B 2 46  ? 67.73606  -29.50295 41.81175   1.000 86.25843  ? 46  THR B O   1 
ATOM 6060  C CB  . THR B 2 46  ? 68.24392  -28.15936 38.82879   1.000 83.20618  ? 46  THR B CB  1 
ATOM 6061  O OG1 . THR B 2 46  ? 68.86936  -27.07566 38.13151   1.000 81.30584  ? 46  THR B OG1 1 
ATOM 6062  C CG2 . THR B 2 46  ? 66.83230  -27.75055 39.21952   1.000 83.68079  ? 46  THR B CG2 1 
ATOM 6063  N N   . HIS B 2 47  ? 68.67642  -30.90587 40.32455   1.000 87.11664  ? 47  HIS B N   1 
ATOM 6064  C CA  . HIS B 2 47  ? 68.19704  -32.09968 41.01098   1.000 89.34715  ? 47  HIS B CA  1 
ATOM 6065  C C   . HIS B 2 47  ? 69.00615  -32.42772 42.25896   1.000 89.95566  ? 47  HIS B C   1 
ATOM 6066  O O   . HIS B 2 47  ? 68.63705  -33.35463 42.98850   1.000 91.89802  ? 47  HIS B O   1 
ATOM 6067  C CB  . HIS B 2 47  ? 68.19917  -33.29645 40.05812   1.000 90.80684  ? 47  HIS B CB  1 
ATOM 6068  C CG  . HIS B 2 47  ? 67.14018  -33.22923 39.00179   1.000 90.96665  ? 47  HIS B CG  1 
ATOM 6069  N ND1 . HIS B 2 47  ? 65.82769  -33.57379 39.24220   1.000 92.31452  ? 47  HIS B ND1 1 
ATOM 6070  C CD2 . HIS B 2 47  ? 67.19967  -32.86178 37.70001   1.000 90.10298  ? 47  HIS B CD2 1 
ATOM 6071  C CE1 . HIS B 2 47  ? 65.12354  -33.41944 38.13554   1.000 92.27729  ? 47  HIS B CE1 1 
ATOM 6072  N NE2 . HIS B 2 47  ? 65.93262  -32.98958 37.18427   1.000 90.97304  ? 47  HIS B NE2 1 
ATOM 6073  N N   . GLN B 2 48  ? 70.09029  -31.69556 42.52130   1.000 95.88078  ? 48  GLN B N   1 
ATOM 6074  C CA  . GLN B 2 48  ? 70.89383  -31.94125 43.71395   1.000 103.36956 ? 48  GLN B CA  1 
ATOM 6075  C C   . GLN B 2 48  ? 70.25114  -31.33168 44.95349   1.000 112.61923 ? 48  GLN B C   1 
ATOM 6076  O O   . GLN B 2 48  ? 70.23823  -31.95600 46.02007   1.000 124.07407 ? 48  GLN B O   1 
ATOM 6077  C CB  . GLN B 2 48  ? 72.30523  -31.38616 43.51690   1.000 93.11766  ? 48  GLN B CB  1 
ATOM 6078  C CG  . GLN B 2 48  ? 73.21250  -31.53526 44.72601   1.000 102.08309 ? 48  GLN B CG  1 
ATOM 6079  C CD  . GLN B 2 48  ? 73.45511  -32.98288 45.10018   1.000 116.59301 ? 48  GLN B CD  1 
ATOM 6080  O OE1 . GLN B 2 48  ? 73.35502  -33.35851 46.26834   1.000 116.22261 ? 48  GLN B OE1 1 
ATOM 6081  N NE2 . GLN B 2 48  ? 73.77703  -33.80518 44.10842   1.000 124.46535 ? 48  GLN B NE2 1 
ATOM 6082  N N   . TYR B 2 49  ? 69.71279  -30.12052 44.83311   1.000 95.68178  ? 49  TYR B N   1 
ATOM 6083  C CA  . TYR B 2 49  ? 69.01783  -29.45892 45.92946   1.000 92.32687  ? 49  TYR B CA  1 
ATOM 6084  C C   . TYR B 2 49  ? 67.60009  -29.98332 46.13457   1.000 93.93342  ? 49  TYR B C   1 
ATOM 6085  O O   . TYR B 2 49  ? 66.84329  -29.38570 46.90713   1.000 94.09149  ? 49  TYR B O   1 
ATOM 6086  C CB  . TYR B 2 49  ? 68.97684  -27.94548 45.69280   1.000 93.71919  ? 49  TYR B CB  1 
ATOM 6087  C CG  . TYR B 2 49  ? 70.26194  -27.36937 45.13890   1.000 99.39613  ? 49  TYR B CG  1 
ATOM 6088  C CD1 . TYR B 2 49  ? 71.44752  -27.44559 45.85802   1.000 108.80111 ? 49  TYR B CD1 1 
ATOM 6089  C CD2 . TYR B 2 49  ? 70.28649  -26.73915 43.90140   1.000 93.14027  ? 49  TYR B CD2 1 
ATOM 6090  C CE1 . TYR B 2 49  ? 72.62353  -26.91985 45.35597   1.000 108.98891 ? 49  TYR B CE1 1 
ATOM 6091  C CE2 . TYR B 2 49  ? 71.45790  -26.20913 43.39150   1.000 94.86695  ? 49  TYR B CE2 1 
ATOM 6092  C CZ  . TYR B 2 49  ? 72.62320  -26.30250 44.12356   1.000 107.46521 ? 49  TYR B CZ  1 
ATOM 6093  O OH  . TYR B 2 49  ? 73.79309  -25.77739 43.62378   1.000 118.63399 ? 49  TYR B OH  1 
ATOM 6094  N N   . SER B 2 50  ? 67.22195  -31.07757 45.46258   1.000 94.98672  ? 50  SER B N   1 
ATOM 6095  C CA  . SER B 2 50  ? 65.84817  -31.56247 45.51612   1.000 94.17535  ? 50  SER B CA  1 
ATOM 6096  C C   . SER B 2 50  ? 65.74012  -33.07438 45.69160   1.000 96.04283  ? 50  SER B C   1 
ATOM 6097  O O   . SER B 2 50  ? 64.65305  -33.62729 45.48099   1.000 97.38074  ? 50  SER B O   1 
ATOM 6098  C CB  . SER B 2 50  ? 65.09720  -31.14476 44.24626   1.000 92.79428  ? 50  SER B CB  1 
ATOM 6099  O OG  . SER B 2 50  ? 65.03777  -29.73414 44.12600   1.000 90.86070  ? 50  SER B OG  1 
ATOM 6100  N N   . GLU B 2 51  ? 66.81873  -33.76047 46.07081   1.000 101.70979 ? 51  GLU B N   1 
ATOM 6101  C CA  . GLU B 2 51  ? 66.81829  -35.21972 46.19585   1.000 103.16488 ? 51  GLU B CA  1 
ATOM 6102  C C   . GLU B 2 51  ? 66.24382  -35.63438 47.55090   1.000 109.21422 ? 51  GLU B C   1 
ATOM 6103  O O   . GLU B 2 51  ? 66.96053  -35.91690 48.51399   1.000 130.64051 ? 51  GLU B O   1 
ATOM 6104  C CB  . GLU B 2 51  ? 68.22596  -35.76842 45.98789   1.000 105.29157 ? 51  GLU B CB  1 
ATOM 6105  C CG  . GLU B 2 51  ? 69.31702  -35.03480 46.76294   1.000 103.10515 ? 51  GLU B CG  1 
ATOM 6106  C CD  . GLU B 2 51  ? 70.66412  -35.72657 46.67012   1.000 110.05444 ? 51  GLU B CD  1 
ATOM 6107  O OE1 . GLU B 2 51  ? 70.79735  -36.66169 45.85306   1.000 116.19249 ? 51  GLU B OE1 1 
ATOM 6108  O OE2 . GLU B 2 51  ? 71.58839  -35.33884 47.41608   1.000 111.74824 ? 51  GLU B OE2 1 
ATOM 6109  N N   . LYS B 2 52  ? 64.91462  -35.67003 47.62471   1.000 109.19824 ? 52  LYS B N   1 
ATOM 6110  C CA  . LYS B 2 52  ? 64.21159  -36.14157 48.81769   1.000 111.30307 ? 52  LYS B CA  1 
ATOM 6111  C C   . LYS B 2 52  ? 63.09321  -37.10816 48.44527   1.000 130.22357 ? 52  LYS B C   1 
ATOM 6112  O O   . LYS B 2 52  ? 61.96799  -37.02211 48.94285   1.000 133.69189 ? 52  LYS B O   1 
ATOM 6113  C CB  . LYS B 2 52  ? 63.67660  -34.97948 49.64534   1.000 110.48036 ? 52  LYS B CB  1 
ATOM 6114  C CG  . LYS B 2 52  ? 64.73101  -34.33293 50.52453   1.000 123.04476 ? 52  LYS B CG  1 
ATOM 6115  C CD  . LYS B 2 52  ? 65.43383  -35.36588 51.39206   1.000 139.54252 ? 52  LYS B CD  1 
ATOM 6116  C CE  . LYS B 2 52  ? 66.59407  -34.75152 52.15733   1.000 135.83538 ? 52  LYS B CE  1 
ATOM 6117  N NZ  . LYS B 2 52  ? 67.37754  -35.77932 52.89511   1.000 131.08212 ? 52  LYS B NZ  1 
ATOM 6118  N N   . GLY B 2 53  ? 63.40300  -38.04907 47.55410   1.000 151.21166 ? 53  GLY B N   1 
ATOM 6119  C CA  . GLY B 2 53  ? 62.51371  -39.15743 47.25316   1.000 165.28435 ? 53  GLY B CA  1 
ATOM 6120  C C   . GLY B 2 53  ? 61.12839  -38.78119 46.78339   1.000 159.55871 ? 53  GLY B C   1 
ATOM 6121  O O   . GLY B 2 53  ? 60.19595  -39.57409 46.93781   1.000 161.02406 ? 53  GLY B O   1 
ATOM 6122  N N   . LYS B 2 54  ? 60.96158  -37.58979 46.20911   1.000 148.39530 ? 54  LYS B N   1 
ATOM 6123  C CA  . LYS B 2 54  ? 59.66826  -37.12983 45.71843   1.000 129.11693 ? 54  LYS B CA  1 
ATOM 6124  C C   . LYS B 2 54  ? 59.42873  -37.49816 44.25993   1.000 132.21375 ? 54  LYS B C   1 
ATOM 6125  O O   . LYS B 2 54  ? 58.69012  -36.79377 43.55767   1.000 122.17850 ? 54  LYS B O   1 
ATOM 6126  C CB  . LYS B 2 54  ? 59.53809  -35.62184 45.92373   1.000 114.71285 ? 54  LYS B CB  1 
ATOM 6127  C CG  . LYS B 2 54  ? 59.51974  -35.20428 47.38519   1.000 124.28601 ? 54  LYS B CG  1 
ATOM 6128  C CD  . LYS B 2 54  ? 58.29641  -35.76802 48.09460   1.000 131.58397 ? 54  LYS B CD  1 
ATOM 6129  C CE  . LYS B 2 54  ? 58.16411  -35.22224 49.50794   1.000 122.17673 ? 54  LYS B CE  1 
ATOM 6130  N NZ  . LYS B 2 54  ? 59.27175  -35.67943 50.38998   1.000 114.47658 ? 54  LYS B NZ  1 
ATOM 6131  N N   . TRP B 2 55  ? 60.03675  -38.58315 43.78742   1.000 122.28810 ? 55  TRP B N   1 
ATOM 6132  C CA  . TRP B 2 55  ? 59.93854  -38.95506 42.38295   1.000 116.71195 ? 55  TRP B CA  1 
ATOM 6133  C C   . TRP B 2 55  ? 58.52079  -39.37487 42.02195   1.000 107.48206 ? 55  TRP B C   1 
ATOM 6134  O O   . TRP B 2 55  ? 57.89881  -40.18400 42.71759   1.000 109.61362 ? 55  TRP B O   1 
ATOM 6135  C CB  . TRP B 2 55  ? 60.90774  -40.09173 42.06524   1.000 114.85732 ? 55  TRP B CB  1 
ATOM 6136  C CG  . TRP B 2 55  ? 62.34474  -39.70784 42.15158   1.000 105.39155 ? 55  TRP B CG  1 
ATOM 6137  C CD1 . TRP B 2 55  ? 63.21207  -39.99708 43.16217   1.000 105.83989 ? 55  TRP B CD1 1 
ATOM 6138  C CD2 . TRP B 2 55  ? 63.09175  -38.97027 41.17826   1.000 103.26702 ? 55  TRP B CD2 1 
ATOM 6139  N NE1 . TRP B 2 55  ? 64.45393  -39.48060 42.88169   1.000 104.09532 ? 55  TRP B NE1 1 
ATOM 6140  C CE2 . TRP B 2 55  ? 64.40611  -38.84544 41.66835   1.000 102.47019 ? 55  TRP B CE2 1 
ATOM 6141  C CE3 . TRP B 2 55  ? 62.77544  -38.40111 39.94076   1.000 104.11812 ? 55  TRP B CE3 1 
ATOM 6142  C CZ2 . TRP B 2 55  ? 65.40402  -38.17438 40.96471   1.000 100.49230 ? 55  TRP B CZ2 1 
ATOM 6143  C CZ3 . TRP B 2 55  ? 63.76651  -37.73580 39.24377   1.000 102.21178 ? 55  TRP B CZ3 1 
ATOM 6144  C CH2 . TRP B 2 55  ? 65.06488  -37.62797 39.75705   1.000 100.41508 ? 55  TRP B CH2 1 
ATOM 6145  N N   . THR B 2 56  ? 58.01357  -38.81535 40.92727   1.000 106.58460 ? 56  THR B N   1 
ATOM 6146  C CA  . THR B 2 56  ? 56.75144  -39.23418 40.33333   1.000 108.15726 ? 56  THR B CA  1 
ATOM 6147  C C   . THR B 2 56  ? 56.96609  -39.35185 38.83211   1.000 107.80812 ? 56  THR B C   1 
ATOM 6148  O O   . THR B 2 56  ? 57.36874  -38.38208 38.17998   1.000 113.10112 ? 56  THR B O   1 
ATOM 6149  C CB  . THR B 2 56  ? 55.61959  -38.24976 40.65759   1.000 107.71455 ? 56  THR B CB  1 
ATOM 6150  O OG1 . THR B 2 56  ? 54.49836  -38.50095 39.79998   1.000 108.95600 ? 56  THR B OG1 1 
ATOM 6151  C CG2 . THR B 2 56  ? 56.08090  -36.80215 40.49839   1.000 105.03446 ? 56  THR B CG2 1 
ATOM 6152  N N   . THR B 2 57  ? 56.71716  -40.53974 38.28942   1.000 97.49936  ? 57  THR B N   1 
ATOM 6153  C CA  . THR B 2 57  ? 56.90379  -40.76805 36.86440   1.000 89.99689  ? 57  THR B CA  1 
ATOM 6154  C C   . THR B 2 57  ? 55.74091  -40.15702 36.09575   1.000 90.65500  ? 57  THR B C   1 
ATOM 6155  O O   . THR B 2 57  ? 54.57397  -40.41365 36.40935   1.000 99.05272  ? 57  THR B O   1 
ATOM 6156  C CB  . THR B 2 57  ? 57.01788  -42.26276 36.56762   1.000 93.02438  ? 57  THR B CB  1 
ATOM 6157  O OG1 . THR B 2 57  ? 58.09873  -42.81764 37.32745   1.000 97.65594  ? 57  THR B OG1 1 
ATOM 6158  C CG2 . THR B 2 57  ? 57.28396  -42.49227 35.08559   1.000 89.27644  ? 57  THR B CG2 1 
ATOM 6159  N N   . ASN B 2 58  ? 56.06003  -39.34701 35.09141   1.000 89.33615  ? 58  ASN B N   1 
ATOM 6160  C CA  . ASN B 2 58  ? 55.02037  -38.67699 34.32829   1.000 90.61206  ? 58  ASN B CA  1 
ATOM 6161  C C   . ASN B 2 58  ? 54.24022  -39.68517 33.49353   1.000 94.13300  ? 58  ASN B C   1 
ATOM 6162  O O   . ASN B 2 58  ? 54.76743  -40.71419 33.06337   1.000 101.45564 ? 58  ASN B O   1 
ATOM 6163  C CB  . ASN B 2 58  ? 55.62781  -37.60049 33.42980   1.000 94.90576  ? 58  ASN B CB  1 
ATOM 6164  C CG  . ASN B 2 58  ? 54.59689  -36.60446 32.92902   1.000 77.20075  ? 58  ASN B CG  1 
ATOM 6165  O OD1 . ASN B 2 58  ? 53.40115  -36.89240 32.89099   1.000 89.64226  ? 58  ASN B OD1 1 
ATOM 6166  N ND2 . ASN B 2 58  ? 55.05974  -35.42197 32.54223   1.000 70.07086  ? 58  ASN B ND2 1 
ATOM 6167  N N   . THR B 2 59  ? 52.96533  -39.37448 33.26723   1.000 90.62158  ? 59  THR B N   1 
ATOM 6168  C CA  . THR B 2 59  ? 52.07922  -40.26362 32.52920   1.000 93.29355  ? 59  THR B CA  1 
ATOM 6169  C C   . THR B 2 59  ? 52.02294  -39.93798 31.04427   1.000 93.28455  ? 59  THR B C   1 
ATOM 6170  O O   . THR B 2 59  ? 51.84582  -40.84657 30.22588   1.000 117.91299 ? 59  THR B O   1 
ATOM 6171  C CB  . THR B 2 59  ? 50.66661  -40.21485 33.12022   1.000 94.71346  ? 59  THR B CB  1 
ATOM 6172  O OG1 . THR B 2 59  ? 50.24548  -38.85082 33.25048   1.000 91.41817  ? 59  THR B OG1 1 
ATOM 6173  C CG2 . THR B 2 59  ? 50.63875  -40.88181 34.48793   1.000 97.63198  ? 59  THR B CG2 1 
ATOM 6174  N N   . GLU B 2 60  ? 52.17660  -38.66734 30.67552   1.000 85.44401  ? 60  GLU B N   1 
ATOM 6175  C CA  . GLU B 2 60  ? 52.09312  -38.25863 29.28052   1.000 79.41286  ? 60  GLU B CA  1 
ATOM 6176  C C   . GLU B 2 60  ? 53.44857  -38.00282 28.63759   1.000 84.47140  ? 60  GLU B C   1 
ATOM 6177  O O   . GLU B 2 60  ? 53.53829  -37.99945 27.40515   1.000 85.61711  ? 60  GLU B O   1 
ATOM 6178  C CB  . GLU B 2 60  ? 51.20983  -37.01338 29.14809   1.000 78.92816  ? 60  GLU B CB  1 
ATOM 6179  C CG  . GLU B 2 60  ? 49.74208  -37.36516 28.99104   1.000 96.60719  ? 60  GLU B CG  1 
ATOM 6180  C CD  . GLU B 2 60  ? 49.17710  -38.04330 30.22251   1.000 124.00858 ? 60  GLU B CD  1 
ATOM 6181  O OE1 . GLU B 2 60  ? 49.63151  -37.72443 31.34105   1.000 132.85774 ? 60  GLU B OE1 1 
ATOM 6182  O OE2 . GLU B 2 60  ? 48.31371  -38.93263 30.06708   1.000 137.68168 ? 60  GLU B OE2 1 
ATOM 6183  N N   . THR B 2 61  ? 54.49851  -37.79113 29.42918   1.000 96.90778  ? 61  THR B N   1 
ATOM 6184  C CA  . THR B 2 61  ? 55.84063  -37.62826 28.89137   1.000 96.39961  ? 61  THR B CA  1 
ATOM 6185  C C   . THR B 2 61  ? 56.76021  -38.78867 29.24140   1.000 104.05848 ? 61  THR B C   1 
ATOM 6186  O O   . THR B 2 61  ? 57.82877  -38.91441 28.63357   1.000 111.34096 ? 61  THR B O   1 
ATOM 6187  C CB  . THR B 2 61  ? 56.46938  -36.31508 29.38447   1.000 82.31139  ? 61  THR B CB  1 
ATOM 6188  O OG1 . THR B 2 61  ? 56.82155  -36.43521 30.76757   1.000 72.44185  ? 61  THR B OG1 1 
ATOM 6189  C CG2 . THR B 2 61  ? 55.49572  -35.15821 29.21135   1.000 81.92020  ? 61  THR B CG2 1 
ATOM 6190  N N   . GLY B 2 62  ? 56.37710  -39.63118 30.20024   1.000 104.71909 ? 62  GLY B N   1 
ATOM 6191  C CA  . GLY B 2 62  ? 57.18507  -40.75985 30.61663   1.000 93.36927  ? 62  GLY B CA  1 
ATOM 6192  C C   . GLY B 2 62  ? 58.49779  -40.40829 31.27320   1.000 90.41649  ? 62  GLY B C   1 
ATOM 6193  O O   . GLY B 2 62  ? 59.33492  -41.29489 31.46488   1.000 92.79900  ? 62  GLY B O   1 
ATOM 6194  N N   . ALA B 2 63  ? 58.70497  -39.15024 31.62204   1.000 80.27279  ? 63  ALA B N   1 
ATOM 6195  C CA  . ALA B 2 63  ? 59.94312  -38.69981 32.23695   1.000 79.33766  ? 63  ALA B CA  1 
ATOM 6196  C C   . ALA B 2 63  ? 59.78575  -38.64979 33.74553   1.000 82.84565  ? 63  ALA B C   1 
ATOM 6197  O O   . ALA B 2 63  ? 58.79851  -38.08088 34.23447   1.000 78.76240  ? 63  ALA B O   1 
ATOM 6198  C CB  . ALA B 2 63  ? 60.32766  -37.32157 31.71054   1.000 75.66858  ? 63  ALA B CB  1 
ATOM 6199  N N   . PRO B 2 64  ? 60.70631  -39.23077 34.51588   1.000 99.50396  ? 64  PRO B N   1 
ATOM 6200  C CA  . PRO B 2 64  ? 60.60458  -39.12602 35.97504   1.000 91.37365  ? 64  PRO B CA  1 
ATOM 6201  C C   . PRO B 2 64  ? 60.71701  -37.67371 36.41072   1.000 79.59754  ? 64  PRO B C   1 
ATOM 6202  O O   . PRO B 2 64  ? 61.42837  -36.87117 35.80238   1.000 78.24021  ? 64  PRO B O   1 
ATOM 6203  C CB  . PRO B 2 64  ? 61.78467  -39.96539 36.47874   1.000 88.25882  ? 64  PRO B CB  1 
ATOM 6204  C CG  . PRO B 2 64  ? 62.74450  -39.99420 35.33222   1.000 101.36336 ? 64  PRO B CG  1 
ATOM 6205  C CD  . PRO B 2 64  ? 61.89518  -39.99038 34.09519   1.000 107.29675 ? 64  PRO B CD  1 
ATOM 6206  N N   . GLN B 2 65  ? 60.00269  -37.34031 37.48172   1.000 74.35344  ? 65  GLN B N   1 
ATOM 6207  C CA  . GLN B 2 65  ? 59.87352  -35.95594 37.91237   1.000 71.21779  ? 65  GLN B CA  1 
ATOM 6208  C C   . GLN B 2 65  ? 60.04373  -35.86138 39.41812   1.000 72.32018  ? 65  GLN B C   1 
ATOM 6209  O O   . GLN B 2 65  ? 59.42414  -36.62540 40.16319   1.000 125.20930 ? 65  GLN B O   1 
ATOM 6210  C CB  . GLN B 2 65  ? 58.51411  -35.38348 37.49758   1.000 83.90327  ? 65  GLN B CB  1 
ATOM 6211  C CG  . GLN B 2 65  ? 58.39105  -35.13888 36.00639   1.000 76.21841  ? 65  GLN B CG  1 
ATOM 6212  C CD  . GLN B 2 65  ? 57.00141  -34.70479 35.59587   1.000 74.64461  ? 65  GLN B CD  1 
ATOM 6213  O OE1 . GLN B 2 65  ? 56.84059  -33.77893 34.80390   1.000 69.97215  ? 65  GLN B OE1 1 
ATOM 6214  N NE2 . GLN B 2 65  ? 55.98665  -35.37189 36.13401   1.000 82.91782  ? 65  GLN B NE2 1 
ATOM 6215  N N   . LEU B 2 66  ? 60.87515  -34.92099 39.85798   1.000 77.36675  ? 66  LEU B N   1 
ATOM 6216  C CA  . LEU B 2 66  ? 61.04175  -34.63585 41.27515   1.000 78.12184  ? 66  LEU B CA  1 
ATOM 6217  C C   . LEU B 2 66  ? 60.03261  -33.58731 41.72316   1.000 102.26492 ? 66  LEU B C   1 
ATOM 6218  O O   . LEU B 2 66  ? 59.80618  -32.58887 41.03386   1.000 95.80906  ? 66  LEU B O   1 
ATOM 6219  C CB  . LEU B 2 66  ? 62.46223  -34.15095 41.56888   1.000 77.50451  ? 66  LEU B CB  1 
ATOM 6220  C CG  . LEU B 2 66  ? 63.46859  -35.23427 41.95864   1.000 80.79410  ? 66  LEU B CG  1 
ATOM 6221  C CD1 . LEU B 2 66  ? 64.84512  -34.63607 42.20625   1.000 80.15635  ? 66  LEU B CD1 1 
ATOM 6222  C CD2 . LEU B 2 66  ? 62.97996  -35.99158 43.18285   1.000 83.96499  ? 66  LEU B CD2 1 
ATOM 6223  N N   . ASN B 2 67  ? 59.43187  -33.82089 42.88804   1.000 102.12407 ? 67  ASN B N   1 
ATOM 6224  C CA  . ASN B 2 67  ? 58.39746  -32.94597 43.44333   1.000 93.59294  ? 67  ASN B CA  1 
ATOM 6225  C C   . ASN B 2 67  ? 58.78634  -32.51957 44.85583   1.000 74.73139  ? 67  ASN B C   1 
ATOM 6226  O O   . ASN B 2 67  ? 58.07952  -32.80865 45.82563   1.000 70.15474  ? 67  ASN B O   1 
ATOM 6227  C CB  . ASN B 2 67  ? 57.04825  -33.66363 43.43188   1.000 108.20712 ? 67  ASN B CB  1 
ATOM 6228  C CG  . ASN B 2 67  ? 55.87452  -32.71457 43.53951   1.000 108.33146 ? 67  ASN B CG  1 
ATOM 6229  O OD1 . ASN B 2 67  ? 55.99310  -31.61919 44.08354   1.000 88.28355  ? 67  ASN B OD1 1 
ATOM 6230  N ND2 . ASN B 2 67  ? 54.72820  -33.13310 43.01466   1.000 123.93095 ? 67  ASN B ND2 1 
ATOM 6231  N N   . PRO B 2 68  ? 59.89866  -31.79735 45.00423   1.000 72.03542  ? 68  PRO B N   1 
ATOM 6232  C CA  . PRO B 2 68  ? 60.45681  -31.53790 46.33571   1.000 85.02915  ? 68  PRO B CA  1 
ATOM 6233  C C   . PRO B 2 68  ? 59.73985  -30.46429 47.13890   1.000 86.90395  ? 68  PRO B C   1 
ATOM 6234  O O   . PRO B 2 68  ? 60.22230  -30.11147 48.21844   1.000 106.29388 ? 68  PRO B O   1 
ATOM 6235  C CB  . PRO B 2 68  ? 61.88610  -31.08938 46.00371   1.000 99.46603  ? 68  PRO B CB  1 
ATOM 6236  C CG  . PRO B 2 68  ? 61.71947  -30.35184 44.72527   1.000 92.82104  ? 68  PRO B CG  1 
ATOM 6237  C CD  . PRO B 2 68  ? 60.67001  -31.11251 43.95050   1.000 85.02321  ? 68  PRO B CD  1 
ATOM 6238  N N   . ILE B 2 69  ? 58.61803  -29.92888 46.65273   1.000 95.44245  ? 69  ILE B N   1 
ATOM 6239  C CA  . ILE B 2 69  ? 57.92028  -28.88952 47.39505   1.000 91.46814  ? 69  ILE B CA  1 
ATOM 6240  C C   . ILE B 2 69  ? 57.41860  -29.45592 48.72420   1.000 97.92224  ? 69  ILE B C   1 
ATOM 6241  O O   . ILE B 2 69  ? 57.17432  -30.66147 48.85988   1.000 92.45345  ? 69  ILE B O   1 
ATOM 6242  C CB  . ILE B 2 69  ? 56.76918  -28.31056 46.55497   1.000 81.50711  ? 69  ILE B CB  1 
ATOM 6243  C CG1 . ILE B 2 69  ? 56.33962  -26.93808 47.07795   1.000 79.91486  ? 69  ILE B CG1 1 
ATOM 6244  C CG2 . ILE B 2 69  ? 55.60925  -29.26694 46.52141   1.000 83.83746  ? 69  ILE B CG2 1 
ATOM 6245  C CD1 . ILE B 2 69  ? 57.31530  -25.83484 46.75353   1.000 77.22181  ? 69  ILE B CD1 1 
ATOM 6246  N N   . ASP B 2 70  ? 57.31226  -28.57185 49.72370   1.000 100.22566 ? 70  ASP B N   1 
ATOM 6247  C CA  . ASP B 2 70  ? 56.90156  -28.85596 51.10114   1.000 102.56783 ? 70  ASP B CA  1 
ATOM 6248  C C   . ASP B 2 70  ? 57.43247  -30.19274 51.60993   1.000 89.27993  ? 70  ASP B C   1 
ATOM 6249  O O   . ASP B 2 70  ? 56.72580  -30.92770 52.30658   1.000 101.80988 ? 70  ASP B O   1 
ATOM 6250  C CB  . ASP B 2 70  ? 55.37099  -28.75933 51.25625   1.000 113.90450 ? 70  ASP B CB  1 
ATOM 6251  C CG  . ASP B 2 70  ? 54.59289  -29.74743 50.38884   1.000 127.42687 ? 70  ASP B CG  1 
ATOM 6252  O OD1 . ASP B 2 70  ? 55.00246  -30.91424 50.22723   1.000 140.01333 ? 70  ASP B OD1 1 
ATOM 6253  O OD2 . ASP B 2 70  ? 53.53764  -29.33766 49.86210   1.000 123.86495 ? 70  ASP B OD2 1 
ATOM 6254  N N   . GLY B 2 71  ? 58.68698  -30.49851 51.28861   1.000 97.14720  ? 71  GLY B N   1 
ATOM 6255  C CA  . GLY B 2 71  ? 59.30378  -31.72902 51.71735   1.000 95.80769  ? 71  GLY B CA  1 
ATOM 6256  C C   . GLY B 2 71  ? 60.05133  -31.57225 53.02500   1.000 99.78596  ? 71  GLY B C   1 
ATOM 6257  O O   . GLY B 2 71  ? 59.66302  -30.79442 53.90235   1.000 95.13296  ? 71  GLY B O   1 
ATOM 6258  N N   . PRO B 2 72  ? 61.14410  -32.31647 53.17870   1.000 102.17249 ? 72  PRO B N   1 
ATOM 6259  C CA  . PRO B 2 72  ? 61.91942  -32.24150 54.42124   1.000 102.08722 ? 72  PRO B CA  1 
ATOM 6260  C C   . PRO B 2 72  ? 62.57233  -30.88105 54.60436   1.000 85.02215  ? 72  PRO B C   1 
ATOM 6261  O O   . PRO B 2 72  ? 62.92639  -30.19546 53.64215   1.000 81.84459  ? 72  PRO B O   1 
ATOM 6262  C CB  . PRO B 2 72  ? 62.97212  -33.34423 54.25174   1.000 116.41390 ? 72  PRO B CB  1 
ATOM 6263  C CG  . PRO B 2 72  ? 62.38866  -34.27141 53.23350   1.000 124.26630 ? 72  PRO B CG  1 
ATOM 6264  C CD  . PRO B 2 72  ? 61.62412  -33.38978 52.29415   1.000 116.85390 ? 72  PRO B CD  1 
ATOM 6265  N N   . LEU B 2 73  ? 62.72873  -30.49815 55.86880   1.000 93.51552  ? 73  LEU B N   1 
ATOM 6266  C CA  . LEU B 2 73  ? 63.34630  -29.23565 56.23624   1.000 90.39681  ? 73  LEU B CA  1 
ATOM 6267  C C   . LEU B 2 73  ? 64.86535  -29.32390 56.09513   1.000 89.91188  ? 73  LEU B C   1 
ATOM 6268  O O   . LEU B 2 73  ? 65.44352  -30.40870 56.20513   1.000 100.36667 ? 73  LEU B O   1 
ATOM 6269  C CB  . LEU B 2 73  ? 62.98442  -28.87173 57.67356   1.000 91.92984  ? 73  LEU B CB  1 
ATOM 6270  C CG  . LEU B 2 73  ? 61.57614  -28.33223 57.92962   1.000 91.29634  ? 73  LEU B CG  1 
ATOM 6271  C CD1 . LEU B 2 73  ? 61.47186  -27.75280 59.33199   1.000 93.31878  ? 73  LEU B CD1 1 
ATOM 6272  C CD2 . LEU B 2 73  ? 61.20444  -27.28901 56.88753   1.000 86.88312  ? 73  LEU B CD2 1 
ATOM 6273  N N   . PRO B 2 74  ? 65.53730  -28.19672 55.84996   1.000 95.20203  ? 74  PRO B N   1 
ATOM 6274  C CA  . PRO B 2 74  ? 66.99531  -28.23522 55.67240   1.000 95.64973  ? 74  PRO B CA  1 
ATOM 6275  C C   . PRO B 2 74  ? 67.70280  -28.29265 57.02005   1.000 107.37205 ? 74  PRO B C   1 
ATOM 6276  O O   . PRO B 2 74  ? 67.46449  -27.46323 57.90143   1.000 106.62666 ? 74  PRO B O   1 
ATOM 6277  C CB  . PRO B 2 74  ? 67.29703  -26.92906 54.92966   1.000 92.07281  ? 74  PRO B CB  1 
ATOM 6278  C CG  . PRO B 2 74  ? 66.21932  -25.99811 55.37060   1.000 90.35598  ? 74  PRO B CG  1 
ATOM 6279  C CD  . PRO B 2 74  ? 64.99248  -26.83974 55.65479   1.000 91.94329  ? 74  PRO B CD  1 
ATOM 6280  N N   . GLU B 2 75  ? 68.57759  -29.28556 57.17482   1.000 107.43317 ? 75  GLU B N   1 
ATOM 6281  C CA  . GLU B 2 75  ? 69.38397  -29.40709 58.38185   1.000 131.31498 ? 75  GLU B CA  1 
ATOM 6282  C C   . GLU B 2 75  ? 70.71909  -28.68534 58.27414   1.000 141.09888 ? 75  GLU B C   1 
ATOM 6283  O O   . GLU B 2 75  ? 71.21397  -28.16319 59.27982   1.000 148.50202 ? 75  GLU B O   1 
ATOM 6284  C CB  . GLU B 2 75  ? 69.62734  -30.88316 58.70739   1.000 139.23428 ? 75  GLU B CB  1 
ATOM 6285  C CG  . GLU B 2 75  ? 68.38931  -31.62593 59.17945   1.000 135.32748 ? 75  GLU B CG  1 
ATOM 6286  C CD  . GLU B 2 75  ? 68.67694  -33.07131 59.52903   1.000 137.87648 ? 75  GLU B CD  1 
ATOM 6287  O OE1 . GLU B 2 75  ? 69.77564  -33.55911 59.19095   1.000 139.48194 ? 75  GLU B OE1 1 
ATOM 6288  O OE2 . GLU B 2 75  ? 67.80424  -33.71996 60.14270   1.000 141.27485 ? 75  GLU B OE2 1 
ATOM 6289  N N   . ASP B 2 76  ? 71.31066  -28.64031 57.08612   1.000 142.43327 ? 76  ASP B N   1 
ATOM 6290  C CA  . ASP B 2 76  ? 72.60843  -28.01739 56.88100   1.000 129.70680 ? 76  ASP B CA  1 
ATOM 6291  C C   . ASP B 2 76  ? 72.44432  -26.66697 56.19261   1.000 108.27352 ? 76  ASP B C   1 
ATOM 6292  O O   . ASP B 2 76  ? 71.44597  -26.40093 55.51875   1.000 100.73023 ? 76  ASP B O   1 
ATOM 6293  C CB  . ASP B 2 76  ? 73.52362  -28.92791 56.05613   1.000 138.88073 ? 76  ASP B CB  1 
ATOM 6294  C CG  . ASP B 2 76  ? 72.89222  -29.36006 54.74710   1.000 139.03865 ? 76  ASP B CG  1 
ATOM 6295  O OD1 . ASP B 2 76  ? 71.64624  -29.36309 54.65543   1.000 135.85720 ? 76  ASP B OD1 1 
ATOM 6296  O OD2 . ASP B 2 76  ? 73.64367  -29.69743 53.80863   1.000 139.19780 ? 76  ASP B OD2 1 
ATOM 6297  N N   . ASN B 2 77  ? 73.44895  -25.80813 56.37644   1.000 105.19150 ? 77  ASN B N   1 
ATOM 6298  C CA  . ASN B 2 77  ? 73.39743  -24.45138 55.84568   1.000 102.65309 ? 77  ASN B CA  1 
ATOM 6299  C C   . ASN B 2 77  ? 73.53108  -24.40101 54.32958   1.000 113.55940 ? 77  ASN B C   1 
ATOM 6300  O O   . ASN B 2 77  ? 73.39603  -23.31713 53.75185   1.000 115.96021 ? 77  ASN B O   1 
ATOM 6301  C CB  . ASN B 2 77  ? 74.48958  -23.59699 56.49135   1.000 102.71630 ? 77  ASN B CB  1 
ATOM 6302  C CG  . ASN B 2 77  ? 74.00516  -22.20571 56.84917   1.000 98.75400  ? 77  ASN B CG  1 
ATOM 6303  O OD1 . ASN B 2 77  ? 72.88636  -21.81976 56.51067   1.000 96.54297  ? 77  ASN B OD1 1 
ATOM 6304  N ND2 . ASN B 2 77  ? 74.84555  -21.44588 57.54232   1.000 95.72577  ? 77  ASN B ND2 1 
ATOM 6305  N N   . GLU B 2 78  ? 73.79648  -25.53206 53.67932   1.000 109.00639 ? 78  GLU B N   1 
ATOM 6306  C CA  . GLU B 2 78  ? 73.94933  -25.55927 52.23651   1.000 99.72224  ? 78  GLU B CA  1 
ATOM 6307  C C   . GLU B 2 78  ? 72.62583  -25.20356 51.56070   1.000 82.42778  ? 78  GLU B C   1 
ATOM 6308  O O   . GLU B 2 78  ? 71.55765  -25.32823 52.16537   1.000 82.35463  ? 78  GLU B O   1 
ATOM 6309  C CB  . GLU B 2 78  ? 74.42612  -26.94042 51.78942   1.000 112.04658 ? 78  GLU B CB  1 
ATOM 6310  C CG  . GLU B 2 78  ? 75.74460  -27.37276 52.41471   1.000 128.53758 ? 78  GLU B CG  1 
ATOM 6311  C CD  . GLU B 2 78  ? 76.88942  -26.43094 52.08924   1.000 138.75301 ? 78  GLU B CD  1 
ATOM 6312  O OE1 . GLU B 2 78  ? 76.88250  -25.83674 50.99014   1.000 138.09265 ? 78  GLU B OE1 1 
ATOM 6313  O OE2 . GLU B 2 78  ? 77.79712  -26.28365 52.93519   1.000 144.91346 ? 78  GLU B OE2 1 
ATOM 6314  N N   . PRO B 2 79  ? 72.67007  -24.74594 50.30766   1.000 78.40443  ? 79  PRO B N   1 
ATOM 6315  C CA  . PRO B 2 79  ? 71.42733  -24.35901 49.62845   1.000 75.41832  ? 79  PRO B CA  1 
ATOM 6316  C C   . PRO B 2 79  ? 70.50373  -25.55078 49.42805   1.000 82.39152  ? 79  PRO B C   1 
ATOM 6317  O O   . PRO B 2 79  ? 70.92965  -26.63388 49.02146   1.000 82.18154  ? 79  PRO B O   1 
ATOM 6318  C CB  . PRO B 2 79  ? 71.91462  -23.79321 48.28944   1.000 73.40162  ? 79  PRO B CB  1 
ATOM 6319  C CG  . PRO B 2 79  ? 73.26848  -24.38229 48.09595   1.000 75.68182  ? 79  PRO B CG  1 
ATOM 6320  C CD  . PRO B 2 79  ? 73.85228  -24.48064 49.47064   1.000 78.37836  ? 79  PRO B CD  1 
ATOM 6321  N N   . SER B 2 80  ? 69.22325  -25.33515 49.71989   1.000 97.24884  ? 80  SER B N   1 
ATOM 6322  C CA  . SER B 2 80  ? 68.20349  -26.36536 49.59700   1.000 97.18341  ? 80  SER B CA  1 
ATOM 6323  C C   . SER B 2 80  ? 66.97911  -25.77377 48.91701   1.000 93.19490  ? 80  SER B C   1 
ATOM 6324  O O   . SER B 2 80  ? 66.62803  -24.61413 49.15144   1.000 64.48584  ? 80  SER B O   1 
ATOM 6325  C CB  . SER B 2 80  ? 67.82158  -26.94544 50.96523   1.000 93.13771  ? 80  SER B CB  1 
ATOM 6326  O OG  . SER B 2 80  ? 67.23383  -25.95502 51.79058   1.000 90.73653  ? 80  SER B OG  1 
ATOM 6327  N N   . GLY B 2 81  ? 66.33514  -26.57713 48.07541   1.000 103.17293 ? 81  GLY B N   1 
ATOM 6328  C CA  . GLY B 2 81  ? 65.15843  -26.13631 47.35264   1.000 95.36872  ? 81  GLY B CA  1 
ATOM 6329  C C   . GLY B 2 81  ? 63.85650  -26.70307 47.88006   1.000 85.35492  ? 81  GLY B C   1 
ATOM 6330  O O   . GLY B 2 81  ? 62.92599  -26.95113 47.10720   1.000 66.96854  ? 81  GLY B O   1 
ATOM 6331  N N   . TYR B 2 82  ? 63.77281  -26.90844 49.19321   1.000 90.91823  ? 82  TYR B N   1 
ATOM 6332  C CA  . TYR B 2 82  ? 62.58426  -27.47711 49.82486   1.000 87.18688  ? 82  TYR B CA  1 
ATOM 6333  C C   . TYR B 2 82  ? 61.81308  -26.33978 50.48371   1.000 69.38915  ? 82  TYR B C   1 
ATOM 6334  O O   . TYR B 2 82  ? 62.17406  -25.87338 51.56722   1.000 66.58005  ? 82  TYR B O   1 
ATOM 6335  C CB  . TYR B 2 82  ? 62.95983  -28.55336 50.83835   1.000 96.18581  ? 82  TYR B CB  1 
ATOM 6336  C CG  . TYR B 2 82  ? 63.98164  -29.54246 50.33377   1.000 94.91008  ? 82  TYR B CG  1 
ATOM 6337  C CD1 . TYR B 2 82  ? 63.65864  -30.45776 49.34202   1.000 98.83461  ? 82  TYR B CD1 1 
ATOM 6338  C CD2 . TYR B 2 82  ? 65.26383  -29.57510 50.86438   1.000 91.75603  ? 82  TYR B CD2 1 
ATOM 6339  C CE1 . TYR B 2 82  ? 64.58980  -31.36389 48.87869   1.000 99.78434  ? 82  TYR B CE1 1 
ATOM 6340  C CE2 . TYR B 2 82  ? 66.20111  -30.48114 50.41170   1.000 93.88896  ? 82  TYR B CE2 1 
ATOM 6341  C CZ  . TYR B 2 82  ? 65.85956  -31.37327 49.41817   1.000 98.92081  ? 82  TYR B CZ  1 
ATOM 6342  O OH  . TYR B 2 82  ? 66.78976  -32.28008 48.96358   1.000 105.83912 ? 82  TYR B OH  1 
ATOM 6343  N N   . ALA B 2 83  ? 60.74492  -25.90098 49.82575   1.000 65.91337  ? 83  ALA B N   1 
ATOM 6344  C CA  . ALA B 2 83  ? 59.92496  -24.79190 50.28939   1.000 67.74020  ? 83  ALA B CA  1 
ATOM 6345  C C   . ALA B 2 83  ? 58.54594  -25.31441 50.65902   1.000 89.66999  ? 83  ALA B C   1 
ATOM 6346  O O   . ALA B 2 83  ? 57.94286  -26.07639 49.89676   1.000 112.23505 ? 83  ALA B O   1 
ATOM 6347  C CB  . ALA B 2 83  ? 59.81210  -23.70486 49.21847   1.000 61.56880  ? 83  ALA B CB  1 
ATOM 6348  N N   . GLN B 2 84  ? 58.05073  -24.90247 51.82155   1.000 93.72219  ? 84  GLN B N   1 
ATOM 6349  C CA  . GLN B 2 84  ? 56.74239  -25.34045 52.28205   1.000 95.39267  ? 84  GLN B CA  1 
ATOM 6350  C C   . GLN B 2 84  ? 55.64345  -24.51876 51.62005   1.000 92.01783  ? 84  GLN B C   1 
ATOM 6351  O O   . GLN B 2 84  ? 55.75816  -23.29733 51.48051   1.000 74.74471  ? 84  GLN B O   1 
ATOM 6352  C CB  . GLN B 2 84  ? 56.65346  -25.22763 53.80402   1.000 100.65815 ? 84  GLN B CB  1 
ATOM 6353  C CG  . GLN B 2 84  ? 57.75329  -25.98768 54.53336   1.000 102.47487 ? 84  GLN B CG  1 
ATOM 6354  C CD  . GLN B 2 84  ? 57.68623  -27.48463 54.30021   1.000 104.42986 ? 84  GLN B CD  1 
ATOM 6355  O OE1 . GLN B 2 84  ? 56.60577  -28.07408 54.28121   1.000 120.54709 ? 84  GLN B OE1 1 
ATOM 6356  N NE2 . GLN B 2 84  ? 58.84485  -28.10681 54.11156   1.000 86.90447  ? 84  GLN B NE2 1 
ATOM 6357  N N   . THR B 2 85  ? 54.57268  -25.20215 51.20933   1.000 99.20216  ? 85  THR B N   1 
ATOM 6358  C CA  . THR B 2 85  ? 53.50504  -24.54186 50.46323   1.000 91.94163  ? 85  THR B CA  1 
ATOM 6359  C C   . THR B 2 85  ? 52.73228  -23.57067 51.34792   1.000 91.24759  ? 85  THR B C   1 
ATOM 6360  O O   . THR B 2 85  ? 52.45584  -22.43028 50.94788   1.000 95.92914  ? 85  THR B O   1 
ATOM 6361  C CB  . THR B 2 85  ? 52.56324  -25.58988 49.86850   1.000 80.78605  ? 85  THR B CB  1 
ATOM 6362  O OG1 . THR B 2 85  ? 53.31735  -26.51992 49.08063   1.000 74.84137  ? 85  THR B OG1 1 
ATOM 6363  C CG2 . THR B 2 85  ? 51.50799  -24.92836 48.99529   1.000 77.80408  ? 85  THR B CG2 1 
ATOM 6364  N N   . ASP B 2 86  ? 52.36695  -24.01138 52.55505   1.000 87.59207  ? 86  ASP B N   1 
ATOM 6365  C CA  . ASP B 2 86  ? 51.61165  -23.15138 53.45718   1.000 84.67154  ? 86  ASP B CA  1 
ATOM 6366  C C   . ASP B 2 86  ? 52.39939  -21.90105 53.82433   1.000 69.32826  ? 86  ASP B C   1 
ATOM 6367  O O   . ASP B 2 86  ? 51.80621  -20.84310 54.04833   1.000 68.59009  ? 86  ASP B O   1 
ATOM 6368  C CB  . ASP B 2 86  ? 51.20045  -23.92822 54.70902   1.000 109.99445 ? 86  ASP B CB  1 
ATOM 6369  C CG  . ASP B 2 86  ? 52.35333  -24.68445 55.33671   1.000 132.90326 ? 86  ASP B CG  1 
ATOM 6370  O OD1 . ASP B 2 86  ? 53.45900  -24.68552 54.75634   1.000 145.28494 ? 86  ASP B OD1 1 
ATOM 6371  O OD2 . ASP B 2 86  ? 52.14935  -25.28072 56.41506   1.000 138.27222 ? 86  ASP B OD2 1 
ATOM 6372  N N   . CYS B 2 87  ? 53.73002  -21.99633 53.87723   1.000 78.31420  ? 87  CYS B N   1 
ATOM 6373  C CA  . CYS B 2 87  ? 54.54986  -20.81642 54.13937   1.000 82.25288  ? 87  CYS B CA  1 
ATOM 6374  C C   . CYS B 2 87  ? 54.39983  -19.78505 53.02522   1.000 91.44135  ? 87  CYS B C   1 
ATOM 6375  O O   . CYS B 2 87  ? 54.22668  -18.58881 53.28841   1.000 104.28640 ? 87  CYS B O   1 
ATOM 6376  C CB  . CYS B 2 87  ? 56.01437  -21.22218 54.30933   1.000 74.34806  ? 87  CYS B CB  1 
ATOM 6377  S SG  . CYS B 2 87  ? 56.36560  -22.16086 55.81598   1.000 97.05481  ? 87  CYS B SG  1 
ATOM 6378  N N   . VAL B 2 88  ? 54.47057  -20.23231 51.76847   1.000 79.20594  ? 88  VAL B N   1 
ATOM 6379  C CA  . VAL B 2 88  ? 54.31850  -19.31535 50.64050   1.000 60.09882  ? 88  VAL B CA  1 
ATOM 6380  C C   . VAL B 2 88  ? 52.92270  -18.70569 50.63664   1.000 80.54543  ? 88  VAL B C   1 
ATOM 6381  O O   . VAL B 2 88  ? 52.75138  -17.50249 50.39496   1.000 59.05334  ? 88  VAL B O   1 
ATOM 6382  C CB  . VAL B 2 88  ? 54.62070  -20.04316 49.31689   1.000 58.70632  ? 88  VAL B CB  1 
ATOM 6383  C CG1 . VAL B 2 88  ? 54.44322  -19.10265 48.13356   1.000 56.14427  ? 88  VAL B CG1 1 
ATOM 6384  C CG2 . VAL B 2 88  ? 56.02451  -20.62575 49.33815   1.000 58.66249  ? 88  VAL B CG2 1 
ATOM 6385  N N   . LEU B 2 89  ? 51.90277  -19.52336 50.90831   1.000 72.24133  ? 89  LEU B N   1 
ATOM 6386  C CA  . LEU B 2 89  ? 50.53869  -19.00350 50.93450   1.000 63.11663  ? 89  LEU B CA  1 
ATOM 6387  C C   . LEU B 2 89  ? 50.34865  -18.00006 52.06808   1.000 64.15846  ? 89  LEU B C   1 
ATOM 6388  O O   . LEU B 2 89  ? 49.64487  -16.99712 51.90427   1.000 63.70457  ? 89  LEU B O   1 
ATOM 6389  C CB  . LEU B 2 89  ? 49.54035  -20.15342 51.04156   1.000 65.68985  ? 89  LEU B CB  1 
ATOM 6390  C CG  . LEU B 2 89  ? 49.58115  -21.10819 49.84702   1.000 64.87234  ? 89  LEU B CG  1 
ATOM 6391  C CD1 . LEU B 2 89  ? 48.54952  -22.21393 49.99502   1.000 106.57993 ? 89  LEU B CD1 1 
ATOM 6392  C CD2 . LEU B 2 89  ? 49.37892  -20.34345 48.54603   1.000 62.17435  ? 89  LEU B CD2 1 
ATOM 6393  N N   . GLU B 2 90  ? 50.97249  -18.24647 53.22231   1.000 63.66353  ? 90  GLU B N   1 
ATOM 6394  C CA  . GLU B 2 90  ? 50.86946  -17.31153 54.33721   1.000 82.13857  ? 90  GLU B CA  1 
ATOM 6395  C C   . GLU B 2 90  ? 51.60438  -16.01252 54.03427   1.000 86.03610  ? 90  GLU B C   1 
ATOM 6396  O O   . GLU B 2 90  ? 51.15466  -14.93129 54.43033   1.000 84.86827  ? 90  GLU B O   1 
ATOM 6397  C CB  . GLU B 2 90  ? 51.41868  -17.95883 55.60794   1.000 88.32739  ? 90  GLU B CB  1 
ATOM 6398  C CG  . GLU B 2 90  ? 51.25827  -17.11985 56.85993   1.000 95.39416  ? 90  GLU B CG  1 
ATOM 6399  C CD  . GLU B 2 90  ? 51.49911  -17.91918 58.12331   1.000 98.81348  ? 90  GLU B CD  1 
ATOM 6400  O OE1 . GLU B 2 90  ? 51.42830  -19.16380 58.06098   1.000 98.79406  ? 90  GLU B OE1 1 
ATOM 6401  O OE2 . GLU B 2 90  ? 51.76646  -17.30472 59.17660   1.000 102.41310 ? 90  GLU B OE2 1 
ATOM 6402  N N   . ALA B 2 91  ? 52.73289  -16.09729 53.32612   1.000 102.90162 ? 91  ALA B N   1 
ATOM 6403  C CA  . ALA B 2 91  ? 53.42106  -14.88506 52.89651   1.000 101.47616 ? 91  ALA B CA  1 
ATOM 6404  C C   . ALA B 2 91  ? 52.55335  -14.07943 51.93905   1.000 80.06338  ? 91  ALA B C   1 
ATOM 6405  O O   . ALA B 2 91  ? 52.46447  -12.85041 52.05154   1.000 65.40654  ? 91  ALA B O   1 
ATOM 6406  C CB  . ALA B 2 91  ? 54.75848  -15.23920 52.24617   1.000 106.51597 ? 91  ALA B CB  1 
ATOM 6407  N N   . MET B 2 92  ? 51.89205  -14.76067 50.99869   1.000 75.54224  ? 92  MET B N   1 
ATOM 6408  C CA  . MET B 2 92  ? 50.96073  -14.08136 50.09957   1.000 82.71744  ? 92  MET B CA  1 
ATOM 6409  C C   . MET B 2 92  ? 49.82722  -13.41829 50.87434   1.000 91.76590  ? 92  MET B C   1 
ATOM 6410  O O   . MET B 2 92  ? 49.46096  -12.26762 50.59961   1.000 95.48774  ? 92  MET B O   1 
ATOM 6411  C CB  . MET B 2 92  ? 50.39034  -15.07933 49.09093   1.000 81.81725  ? 92  MET B CB  1 
ATOM 6412  C CG  . MET B 2 92  ? 51.36730  -15.60073 48.04832   1.000 77.54672  ? 92  MET B CG  1 
ATOM 6413  S SD  . MET B 2 92  ? 51.73806  -14.39817 46.76089   1.000 79.46428  ? 92  MET B SD  1 
ATOM 6414  C CE  . MET B 2 92  ? 53.34283  -13.81686 47.28987   1.000 67.19834  ? 92  MET B CE  1 
ATOM 6415  N N   . ALA B 2 93  ? 49.26010  -14.13568 51.84780   1.000 86.51786  ? 93  ALA B N   1 
ATOM 6416  C CA  . ALA B 2 93  ? 48.14852  -13.60053 52.62733   1.000 83.22156  ? 93  ALA B CA  1 
ATOM 6417  C C   . ALA B 2 93  ? 48.57071  -12.38538 53.44185   1.000 88.66871  ? 93  ALA B C   1 
ATOM 6418  O O   . ALA B 2 93  ? 47.82689  -11.40349 53.53298   1.000 101.88300 ? 93  ALA B O   1 
ATOM 6419  C CB  . ALA B 2 93  ? 47.57833  -14.68532 53.53930   1.000 90.44509  ? 93  ALA B CB  1 
ATOM 6420  N N   . PHE B 2 94  ? 49.76176  -12.42954 54.04342   1.000 74.93146  ? 94  PHE B N   1 
ATOM 6421  C CA  . PHE B 2 94  ? 50.22527  -11.28797 54.82451   1.000 78.17108  ? 94  PHE B CA  1 
ATOM 6422  C C   . PHE B 2 94  ? 50.58094  -10.10516 53.93362   1.000 93.70837  ? 94  PHE B C   1 
ATOM 6423  O O   . PHE B 2 94  ? 50.36817  -8.95031  54.32605   1.000 116.51840 ? 94  PHE B O   1 
ATOM 6424  C CB  . PHE B 2 94  ? 51.42043  -11.69342 55.68681   1.000 64.76637  ? 94  PHE B CB  1 
ATOM 6425  C CG  . PHE B 2 94  ? 51.03916  -12.45709 56.92085   1.000 67.85892  ? 94  PHE B CG  1 
ATOM 6426  C CD1 . PHE B 2 94  ? 49.77172  -12.32847 57.46162   1.000 70.24655  ? 94  PHE B CD1 1 
ATOM 6427  C CD2 . PHE B 2 94  ? 51.94317  -13.30542 57.53770   1.000 79.84000  ? 94  PHE B CD2 1 
ATOM 6428  C CE1 . PHE B 2 94  ? 49.41090  -13.02889 58.59482   1.000 89.72151  ? 94  PHE B CE1 1 
ATOM 6429  C CE2 . PHE B 2 94  ? 51.58876  -14.00924 58.67327   1.000 97.54859  ? 94  PHE B CE2 1 
ATOM 6430  C CZ  . PHE B 2 94  ? 50.32041  -13.87057 59.20205   1.000 101.60501 ? 94  PHE B CZ  1 
ATOM 6431  N N   . LEU B 2 95  ? 51.10083  -10.36805 52.73090   1.000 84.49043  ? 95  LEU B N   1 
ATOM 6432  C CA  . LEU B 2 95  ? 51.31397  -9.29110  51.77129   1.000 64.59453  ? 95  LEU B CA  1 
ATOM 6433  C C   . LEU B 2 95  ? 49.99367  -8.62265  51.41197   1.000 61.85235  ? 95  LEU B C   1 
ATOM 6434  O O   . LEU B 2 95  ? 49.90474  -7.39025  51.36403   1.000 75.34293  ? 95  LEU B O   1 
ATOM 6435  C CB  . LEU B 2 95  ? 52.01153  -9.83366  50.52083   1.000 58.80738  ? 95  LEU B CB  1 
ATOM 6436  C CG  . LEU B 2 95  ? 52.77651  -8.87428  49.59895   1.000 56.92079  ? 95  LEU B CG  1 
ATOM 6437  C CD1 . LEU B 2 95  ? 53.72537  -9.65258  48.70088   1.000 55.19001  ? 95  LEU B CD1 1 
ATOM 6438  C CD2 . LEU B 2 95  ? 51.84648  -8.02005  48.75060   1.000 57.97169  ? 95  LEU B CD2 1 
ATOM 6439  N N   . GLU B 2 96  ? 48.95490  -9.42147  51.15356   1.000 60.62158  ? 96  GLU B N   1 
ATOM 6440  C CA  . GLU B 2 96  ? 47.65624  -8.84352  50.82103   1.000 63.26973  ? 96  GLU B CA  1 
ATOM 6441  C C   . GLU B 2 96  ? 47.02182  -8.14517  52.01950   1.000 64.24437  ? 96  GLU B C   1 
ATOM 6442  O O   . GLU B 2 96  ? 46.25050  -7.19533  51.84514   1.000 65.08145  ? 96  GLU B O   1 
ATOM 6443  C CB  . GLU B 2 96  ? 46.71724  -9.92365  50.28552   1.000 90.88974  ? 96  GLU B CB  1 
ATOM 6444  C CG  . GLU B 2 96  ? 45.46584  -9.37374  49.61960   1.000 106.63183 ? 96  GLU B CG  1 
ATOM 6445  C CD  . GLU B 2 96  ? 44.47935  -10.45922 49.24166   1.000 128.68929 ? 96  GLU B CD  1 
ATOM 6446  O OE1 . GLU B 2 96  ? 44.68932  -11.62297 49.64414   1.000 141.63526 ? 96  GLU B OE1 1 
ATOM 6447  O OE2 . GLU B 2 96  ? 43.49259  -10.14744 48.54264   1.000 133.51854 ? 96  GLU B OE2 1 
ATOM 6448  N N   . GLU B 2 97  ? 47.32314  -8.59963  53.23699   1.000 64.06396  ? 97  GLU B N   1 
ATOM 6449  C CA  . GLU B 2 97  ? 46.82335  -7.90924  54.42129   1.000 75.54790  ? 97  GLU B CA  1 
ATOM 6450  C C   . GLU B 2 97  ? 47.49995  -6.55637  54.59605   1.000 82.03442  ? 97  GLU B C   1 
ATOM 6451  O O   . GLU B 2 97  ? 46.85529  -5.57973  54.99667   1.000 76.26414  ? 97  GLU B O   1 
ATOM 6452  C CB  . GLU B 2 97  ? 47.03220  -8.77540  55.66443   1.000 103.23947 ? 97  GLU B CB  1 
ATOM 6453  C CG  . GLU B 2 97  ? 46.62195  -8.10192  56.96752   1.000 116.49696 ? 97  GLU B CG  1 
ATOM 6454  C CD  . GLU B 2 97  ? 46.81150  -8.99693  58.17697   1.000 124.11986 ? 97  GLU B CD  1 
ATOM 6455  O OE1 . GLU B 2 97  ? 47.06634  -10.20532 57.99180   1.000 125.27444 ? 97  GLU B OE1 1 
ATOM 6456  O OE2 . GLU B 2 97  ? 46.70797  -8.49073  59.31422   1.000 131.71818 ? 97  GLU B OE2 1 
ATOM 6457  N N   . SER B 2 98  ? 48.79619  -6.47554  54.28644   1.000 90.25506  ? 98  SER B N   1 
ATOM 6458  C CA  . SER B 2 98  ? 49.50496  -5.20684  54.41735   1.000 94.60231  ? 98  SER B CA  1 
ATOM 6459  C C   . SER B 2 98  ? 49.10296  -4.21723  53.33095   1.000 89.30901  ? 98  SER B C   1 
ATOM 6460  O O   . SER B 2 98  ? 49.16396  -3.00195  53.55001   1.000 84.37312  ? 98  SER B O   1 
ATOM 6461  C CB  . SER B 2 98  ? 51.01403  -5.44241  54.38969   1.000 83.25017  ? 98  SER B CB  1 
ATOM 6462  O OG  . SER B 2 98  ? 51.42049  -6.25818  55.47391   1.000 70.33184  ? 98  SER B OG  1 
ATOM 6463  N N   . HIS B 2 99  ? 48.68796  -4.70937  52.16637   1.000 71.17388  ? 99  HIS B N   1 
ATOM 6464  C CA  . HIS B 2 99  ? 48.29232  -3.86159  51.04249   1.000 66.10302  ? 99  HIS B CA  1 
ATOM 6465  C C   . HIS B 2 99  ? 46.88494  -4.25576  50.61690   1.000 83.49510  ? 99  HIS B C   1 
ATOM 6466  O O   . HIS B 2 99  ? 46.70354  -5.29155  49.95244   1.000 110.83249 ? 99  HIS B O   1 
ATOM 6467  C CB  . HIS B 2 99  ? 49.26710  -4.00023  49.87952   1.000 66.69907  ? 99  HIS B CB  1 
ATOM 6468  C CG  . HIS B 2 99  ? 50.67197  -3.61261  50.21987   1.000 91.98053  ? 99  HIS B CG  1 
ATOM 6469  N ND1 . HIS B 2 99  ? 51.10267  -2.30340  50.22782   1.000 100.28649 ? 99  HIS B ND1 1 
ATOM 6470  C CD2 . HIS B 2 99  ? 51.74435  -4.36340  50.56547   1.000 99.61625  ? 99  HIS B CD2 1 
ATOM 6471  C CE1 . HIS B 2 99  ? 52.38008  -2.26482  50.56332   1.000 103.11277 ? 99  HIS B CE1 1 
ATOM 6472  N NE2 . HIS B 2 99  ? 52.79322  -3.50145  50.77380   1.000 96.49113  ? 99  HIS B NE2 1 
ATOM 6473  N N   . PRO B 2 100 ? 45.86948  -3.46143  50.96787   1.000 92.14398  ? 100 PRO B N   1 
ATOM 6474  C CA  . PRO B 2 100 ? 44.48191  -3.89837  50.75630   1.000 78.99019  ? 100 PRO B CA  1 
ATOM 6475  C C   . PRO B 2 100 ? 44.12118  -4.10851  49.29378   1.000 82.79635  ? 100 PRO B C   1 
ATOM 6476  O O   . PRO B 2 100 ? 44.09303  -3.15908  48.50411   1.000 88.22822  ? 100 PRO B O   1 
ATOM 6477  C CB  . PRO B 2 100 ? 43.65808  -2.75636  51.36860   1.000 77.62097  ? 100 PRO B CB  1 
ATOM 6478  C CG  . PRO B 2 100 ? 44.60314  -2.03423  52.27946   1.000 79.72855  ? 100 PRO B CG  1 
ATOM 6479  C CD  . PRO B 2 100 ? 45.94212  -2.14641  51.62484   1.000 86.68292  ? 100 PRO B CD  1 
ATOM 6480  N N   . GLY B 2 101 ? 43.84022  -5.35977  48.93548   1.000 78.47928  ? 101 GLY B N   1 
ATOM 6481  C CA  . GLY B 2 101 ? 43.29954  -5.68899  47.62667   1.000 79.64763  ? 101 GLY B CA  1 
ATOM 6482  C C   . GLY B 2 101 ? 44.16351  -5.30900  46.44531   1.000 82.65933  ? 101 GLY B C   1 
ATOM 6483  O O   . GLY B 2 101 ? 43.62767  -4.98064  45.38237   1.000 103.44189 ? 101 GLY B O   1 
ATOM 6484  N N   . ILE B 2 102 ? 45.49043  -5.35347  46.59252   1.000 72.53274  ? 102 ILE B N   1 
ATOM 6485  C CA  . ILE B 2 102 ? 46.36232  -5.09558  45.44844   1.000 70.99559  ? 102 ILE B CA  1 
ATOM 6486  C C   . ILE B 2 102 ? 46.20764  -6.18950  44.39811   1.000 81.67426  ? 102 ILE B C   1 
ATOM 6487  O O   . ILE B 2 102 ? 46.26876  -5.92079  43.18640   1.000 99.50412  ? 102 ILE B O   1 
ATOM 6488  C CB  . ILE B 2 102 ? 47.82553  -4.95814  45.91591   1.000 67.15278  ? 102 ILE B CB  1 
ATOM 6489  C CG1 . ILE B 2 102 ? 48.75375  -4.69201  44.72899   1.000 71.66498  ? 102 ILE B CG1 1 
ATOM 6490  C CG2 . ILE B 2 102 ? 48.27572  -6.19087  46.69324   1.000 63.49715  ? 102 ILE B CG2 1 
ATOM 6491  C CD1 . ILE B 2 102 ? 50.19938  -4.48471  45.12616   1.000 77.75759  ? 102 ILE B CD1 1 
ATOM 6492  N N   . PHE B 2 103 ? 45.96633  -7.42606  44.83975   1.000 77.79764  ? 103 PHE B N   1 
ATOM 6493  C CA  . PHE B 2 103 ? 45.86305  -8.54542  43.91230   1.000 76.38787  ? 103 PHE B CA  1 
ATOM 6494  C C   . PHE B 2 103 ? 44.66952  -8.38538  42.98228   1.000 88.76557  ? 103 PHE B C   1 
ATOM 6495  O O   . PHE B 2 103 ? 44.75867  -8.70620  41.79504   1.000 101.78915 ? 103 PHE B O   1 
ATOM 6496  C CB  . PHE B 2 103 ? 45.77958  -9.86428  44.68101   1.000 70.70334  ? 103 PHE B CB  1 
ATOM 6497  C CG  . PHE B 2 103 ? 47.05611  -10.24106 45.37892   1.000 65.90399  ? 103 PHE B CG  1 
ATOM 6498  C CD1 . PHE B 2 103 ? 48.25495  -9.64250  45.02705   1.000 61.40929  ? 103 PHE B CD1 1 
ATOM 6499  C CD2 . PHE B 2 103 ? 47.06022  -11.20042 46.37811   1.000 79.08375  ? 103 PHE B CD2 1 
ATOM 6500  C CE1 . PHE B 2 103 ? 49.43169  -9.98801  45.66283   1.000 61.89356  ? 103 PHE B CE1 1 
ATOM 6501  C CE2 . PHE B 2 103 ? 48.23508  -11.55095 47.01813   1.000 68.01005  ? 103 PHE B CE2 1 
ATOM 6502  C CZ  . PHE B 2 103 ? 49.42151  -10.94368 46.66005   1.000 65.24874  ? 103 PHE B CZ  1 
ATOM 6503  N N   . GLU B 2 104 ? 43.54544  -7.88282  43.49669   1.000 83.10407  ? 104 GLU B N   1 
ATOM 6504  C CA  . GLU B 2 104 ? 42.35336  -7.76825  42.66144   1.000 76.27733  ? 104 GLU B CA  1 
ATOM 6505  C C   . GLU B 2 104 ? 42.51164  -6.68088  41.60265   1.000 71.71187  ? 104 GLU B C   1 
ATOM 6506  O O   . GLU B 2 104 ? 42.08378  -6.85918  40.45519   1.000 86.43799  ? 104 GLU B O   1 
ATOM 6507  C CB  . GLU B 2 104 ? 41.12886  -7.49836  43.53651   1.000 83.03007  ? 104 GLU B CB  1 
ATOM 6508  C CG  . GLU B 2 104 ? 40.49886  -8.75283  44.13044   1.000 103.15340 ? 104 GLU B CG  1 
ATOM 6509  C CD  . GLU B 2 104 ? 41.38144  -9.43392  45.16506   1.000 129.79324 ? 104 GLU B CD  1 
ATOM 6510  O OE1 . GLU B 2 104 ? 42.37375  -8.82048  45.61449   1.000 139.19529 ? 104 GLU B OE1 1 
ATOM 6511  O OE2 . GLU B 2 104 ? 41.08406  -10.59270 45.52428   1.000 143.81465 ? 104 GLU B OE2 1 
ATOM 6512  N N   . ASN B 2 105 ? 43.14660  -5.56032  41.95465   1.000 57.06209  ? 105 ASN B N   1 
ATOM 6513  C CA  . ASN B 2 105 ? 43.42361  -4.52773  40.95924   1.000 56.80924  ? 105 ASN B CA  1 
ATOM 6514  C C   . ASN B 2 105 ? 44.38584  -5.04126  39.89395   1.000 75.95142  ? 105 ASN B C   1 
ATOM 6515  O O   . ASN B 2 105 ? 44.17035  -4.83682  38.68881   1.000 103.48924 ? 105 ASN B O   1 
ATOM 6516  C CB  . ASN B 2 105 ? 43.98460  -3.27388  41.63246   1.000 64.45011  ? 105 ASN B CB  1 
ATOM 6517  C CG  . ASN B 2 105 ? 43.11195  -2.77781  42.76790   1.000 73.82220  ? 105 ASN B CG  1 
ATOM 6518  O OD1 . ASN B 2 105 ? 43.55007  -2.70028  43.91476   1.000 76.79689  ? 105 ASN B OD1 1 
ATOM 6519  N ND2 . ASN B 2 105 ? 41.86732  -2.44059  42.45310   1.000 76.86933  ? 105 ASN B ND2 1 
ATOM 6520  N N   . SER B 2 106 ? 45.46491  -5.70537  40.32316   1.000 70.78473  ? 106 SER B N   1 
ATOM 6521  C CA  . SER B 2 106 ? 46.40549  -6.26706  39.35842   1.000 62.53893  ? 106 SER B CA  1 
ATOM 6522  C C   . SER B 2 106 ? 45.72895  -7.30350  38.46701   1.000 75.56736  ? 106 SER B C   1 
ATOM 6523  O O   . SER B 2 106 ? 46.00777  -7.37833  37.26387   1.000 90.16862  ? 106 SER B O   1 
ATOM 6524  C CB  . SER B 2 106 ? 47.60128  -6.87966  40.08887   1.000 61.64171  ? 106 SER B CB  1 
ATOM 6525  O OG  . SER B 2 106 ? 48.31270  -5.89706  40.82355   1.000 65.65571  ? 106 SER B OG  1 
ATOM 6526  N N   . CYS B 2 107 ? 44.80474  -8.08453  39.03108   1.000 67.82308  ? 107 CYS B N   1 
ATOM 6527  C CA  . CYS B 2 107 ? 44.11402  -9.10675  38.25468   1.000 77.22700  ? 107 CYS B CA  1 
ATOM 6528  C C   . CYS B 2 107 ? 43.16060  -8.48616  37.24449   1.000 65.00164  ? 107 CYS B C   1 
ATOM 6529  O O   . CYS B 2 107 ? 43.01413  -8.99814  36.13181   1.000 72.80971  ? 107 CYS B O   1 
ATOM 6530  C CB  . CYS B 2 107 ? 43.36387  -10.05632 39.18795   1.000 88.76269  ? 107 CYS B CB  1 
ATOM 6531  S SG  . CYS B 2 107 ? 44.40472  -11.32002 39.95029   1.000 73.20730  ? 107 CYS B SG  1 
ATOM 6532  N N   . LEU B 2 108 ? 42.49881  -7.38710  37.61177   1.000 56.79624  ? 108 LEU B N   1 
ATOM 6533  C CA  . LEU B 2 108 ? 41.64235  -6.69755  36.65067   1.000 56.66978  ? 108 LEU B CA  1 
ATOM 6534  C C   . LEU B 2 108 ? 42.46196  -6.10493  35.50989   1.000 66.37899  ? 108 LEU B C   1 
ATOM 6535  O O   . LEU B 2 108 ? 42.06444  -6.19109  34.33798   1.000 94.19361  ? 108 LEU B O   1 
ATOM 6536  C CB  . LEU B 2 108 ? 40.82087  -5.61717  37.35333   1.000 58.86703  ? 108 LEU B CB  1 
ATOM 6537  C CG  . LEU B 2 108 ? 39.37799  -6.01791  37.67587   1.000 75.59945  ? 108 LEU B CG  1 
ATOM 6538  C CD1 . LEU B 2 108 ? 39.33648  -7.22671  38.59821   1.000 65.56266  ? 108 LEU B CD1 1 
ATOM 6539  C CD2 . LEU B 2 108 ? 38.60929  -4.85177  38.28129   1.000 99.11000  ? 108 LEU B CD2 1 
ATOM 6540  N N   . GLU B 2 109 ? 43.60508  -5.49227  35.83133   1.000 57.29908  ? 109 GLU B N   1 
ATOM 6541  C CA  . GLU B 2 109 ? 44.47472  -4.98114  34.77457   1.000 56.19985  ? 109 GLU B CA  1 
ATOM 6542  C C   . GLU B 2 109 ? 44.94008  -6.10774  33.85589   1.000 67.20952  ? 109 GLU B C   1 
ATOM 6543  O O   . GLU B 2 109 ? 44.95550  -5.95717  32.62559   1.000 104.08479 ? 109 GLU B O   1 
ATOM 6544  C CB  . GLU B 2 109 ? 45.66867  -4.24563  35.38394   1.000 56.79281  ? 109 GLU B CB  1 
ATOM 6545  C CG  . GLU B 2 109 ? 45.28807  -3.02627  36.21583   1.000 68.28256  ? 109 GLU B CG  1 
ATOM 6546  C CD  . GLU B 2 109 ? 46.48737  -2.36754  36.87235   1.000 94.84216  ? 109 GLU B CD  1 
ATOM 6547  O OE1 . GLU B 2 109 ? 47.60760  -2.90096  36.73529   1.000 95.32306  ? 109 GLU B OE1 1 
ATOM 6548  O OE2 . GLU B 2 109 ? 46.31076  -1.31733  37.52622   1.000 111.06620 ? 109 GLU B OE2 1 
ATOM 6549  N N   . THR B 2 110 ? 45.28961  -7.25960  34.43377   1.000 59.22317  ? 110 THR B N   1 
ATOM 6550  C CA  . THR B 2 110 ? 45.73156  -8.38590  33.61940   1.000 58.33345  ? 110 THR B CA  1 
ATOM 6551  C C   . THR B 2 110 ? 44.58817  -8.96409  32.79245   1.000 58.48091  ? 110 THR B C   1 
ATOM 6552  O O   . THR B 2 110 ? 44.81664  -9.44915  31.68123   1.000 54.85134  ? 110 THR B O   1 
ATOM 6553  C CB  . THR B 2 110 ? 46.35314  -9.46105  34.50945   1.000 62.66866  ? 110 THR B CB  1 
ATOM 6554  O OG1 . THR B 2 110 ? 47.37649  -8.86760  35.31658   1.000 57.83510  ? 110 THR B OG1 1 
ATOM 6555  C CG2 . THR B 2 110 ? 46.97650  -10.56326 33.66484   1.000 61.29430  ? 110 THR B CG2 1 
ATOM 6556  N N   . MET B 2 111 ? 43.35792  -8.92364  33.30920   1.000 68.14447  ? 111 MET B N   1 
ATOM 6557  C CA  . MET B 2 111 ? 42.21321  -9.35944  32.51526   1.000 71.69695  ? 111 MET B CA  1 
ATOM 6558  C C   . MET B 2 111 ? 42.00291  -8.44489  31.31806   1.000 70.23923  ? 111 MET B C   1 
ATOM 6559  O O   . MET B 2 111 ? 41.72874  -8.91795  30.20842   1.000 68.60287  ? 111 MET B O   1 
ATOM 6560  C CB  . MET B 2 111 ? 40.94964  -9.40757  33.37242   1.000 77.86860  ? 111 MET B CB  1 
ATOM 6561  C CG  . MET B 2 111 ? 40.85767  -10.60735 34.29461   1.000 85.29803  ? 111 MET B CG  1 
ATOM 6562  S SD  . MET B 2 111 ? 39.23872  -10.72210 35.07839   1.000 86.11524  ? 111 MET B SD  1 
ATOM 6563  C CE  . MET B 2 111 ? 38.81448  -8.98809  35.24199   1.000 87.66595  ? 111 MET B CE  1 
ATOM 6564  N N   . GLU B 2 112 ? 42.12210  -7.13194  31.52555   1.000 72.88635  ? 112 GLU B N   1 
ATOM 6565  C CA  . GLU B 2 112 ? 42.08097  -6.21042  30.39370   1.000 85.43319  ? 112 GLU B CA  1 
ATOM 6566  C C   . GLU B 2 112 ? 43.16764  -6.54894  29.37997   1.000 72.23631  ? 112 GLU B C   1 
ATOM 6567  O O   . GLU B 2 112 ? 42.92089  -6.55317  28.16539   1.000 63.07269  ? 112 GLU B O   1 
ATOM 6568  C CB  . GLU B 2 112 ? 42.23345  -4.76834  30.87567   1.000 97.28409  ? 112 GLU B CB  1 
ATOM 6569  C CG  . GLU B 2 112 ? 41.08051  -4.25997  31.71999   1.000 99.54809  ? 112 GLU B CG  1 
ATOM 6570  C CD  . GLU B 2 112 ? 41.22797  -2.79306  32.07140   1.000 86.26635  ? 112 GLU B CD  1 
ATOM 6571  O OE1 . GLU B 2 112 ? 42.19001  -2.15933  31.58672   1.000 74.34979  ? 112 GLU B OE1 1 
ATOM 6572  O OE2 . GLU B 2 112 ? 40.38030  -2.27319  32.82723   1.000 83.41449  ? 112 GLU B OE2 1 
ATOM 6573  N N   . VAL B 2 113 ? 44.37573  -6.84603  29.86601   1.000 74.04261  ? 113 VAL B N   1 
ATOM 6574  C CA  . VAL B 2 113 ? 45.48202  -7.18515  28.97180   1.000 59.87730  ? 113 VAL B CA  1 
ATOM 6575  C C   . VAL B 2 113 ? 45.15150  -8.42970  28.15192   1.000 74.56181  ? 113 VAL B C   1 
ATOM 6576  O O   . VAL B 2 113 ? 45.29267  -8.43823  26.92381   1.000 88.90495  ? 113 VAL B O   1 
ATOM 6577  C CB  . VAL B 2 113 ? 46.78377  -7.36762  29.77336   1.000 50.73731  ? 113 VAL B CB  1 
ATOM 6578  C CG1 . VAL B 2 113 ? 47.85141  -8.02265  28.91063   1.000 49.55423  ? 113 VAL B CG1 1 
ATOM 6579  C CG2 . VAL B 2 113 ? 47.27198  -6.02830  30.30283   1.000 53.47410  ? 113 VAL B CG2 1 
ATOM 6580  N N   . VAL B 2 114 ? 44.69162  -9.49492  28.81629   1.000 76.37390  ? 114 VAL B N   1 
ATOM 6581  C CA  . VAL B 2 114 ? 44.44875  -10.75384 28.11268   1.000 63.68521  ? 114 VAL B CA  1 
ATOM 6582  C C   . VAL B 2 114 ? 43.25724  -10.63600 27.17121   1.000 64.64846  ? 114 VAL B C   1 
ATOM 6583  O O   . VAL B 2 114 ? 43.18244  -11.35247 26.16525   1.000 63.54774  ? 114 VAL B O   1 
ATOM 6584  C CB  . VAL B 2 114 ? 44.25500  -11.92111 29.10456   1.000 59.26310  ? 114 VAL B CB  1 
ATOM 6585  C CG1 . VAL B 2 114 ? 45.42795  -12.02294 30.06298   1.000 64.00718  ? 114 VAL B CG1 1 
ATOM 6586  C CG2 . VAL B 2 114 ? 42.94461  -11.78992 29.86478   1.000 56.22820  ? 114 VAL B CG2 1 
ATOM 6587  N N   . GLN B 2 115 ? 42.30822  -9.74497  27.46985   1.000 56.88751  ? 115 GLN B N   1 
ATOM 6588  C CA  . GLN B 2 115 ? 41.20369  -9.52290  26.54355   1.000 73.13830  ? 115 GLN B CA  1 
ATOM 6589  C C   . GLN B 2 115 ? 41.65072  -8.74181  25.31406   1.000 97.01033  ? 115 GLN B C   1 
ATOM 6590  O O   . GLN B 2 115 ? 41.22391  -9.04412  24.19358   1.000 104.92154 ? 115 GLN B O   1 
ATOM 6591  C CB  . GLN B 2 115 ? 40.05905  -8.79605  27.24804   1.000 79.88319  ? 115 GLN B CB  1 
ATOM 6592  C CG  . GLN B 2 115 ? 39.23147  -9.68061  28.16222   1.000 95.09895  ? 115 GLN B CG  1 
ATOM 6593  C CD  . GLN B 2 115 ? 37.95686  -9.00427  28.62785   1.000 131.87788 ? 115 GLN B CD  1 
ATOM 6594  O OE1 . GLN B 2 115 ? 37.58795  -7.93938  28.13189   1.000 153.02959 ? 115 GLN B OE1 1 
ATOM 6595  N NE2 . GLN B 2 115 ? 37.27687  -9.62057  29.58746   1.000 141.44369 ? 115 GLN B NE2 1 
ATOM 6596  N N   . GLN B 2 116 ? 42.50932  -7.73656  25.49840   1.000 97.93494  ? 116 GLN B N   1 
ATOM 6597  C CA  . GLN B 2 116 ? 42.88630  -6.85940  24.39579   1.000 99.35784  ? 116 GLN B CA  1 
ATOM 6598  C C   . GLN B 2 116 ? 44.11758  -7.31607  23.62146   1.000 82.15840  ? 116 GLN B C   1 
ATOM 6599  O O   . GLN B 2 116 ? 44.34061  -6.82315  22.50980   1.000 66.60486  ? 116 GLN B O   1 
ATOM 6600  C CB  . GLN B 2 116 ? 43.13096  -5.44116  24.92048   1.000 107.19025 ? 116 GLN B CB  1 
ATOM 6601  C CG  . GLN B 2 116 ? 41.86044  -4.69013  25.26358   1.000 100.43058 ? 116 GLN B CG  1 
ATOM 6602  C CD  . GLN B 2 116 ? 41.94743  -3.98252  26.59932   1.000 91.05908  ? 116 GLN B CD  1 
ATOM 6603  O OE1 . GLN B 2 116 ? 43.03847  -3.71586  27.10288   1.000 76.30092  ? 116 GLN B OE1 1 
ATOM 6604  N NE2 . GLN B 2 116 ? 40.79460  -3.68889  27.18991   1.000 101.47793 ? 116 GLN B NE2 1 
ATOM 6605  N N   . THR B 2 117 ? 44.91580  -8.23300  24.16552   1.000 86.46500  ? 117 THR B N   1 
ATOM 6606  C CA  . THR B 2 117 ? 46.19902  -8.56549  23.55461   1.000 72.91631  ? 117 THR B CA  1 
ATOM 6607  C C   . THR B 2 117 ? 46.00382  -9.26232  22.21275   1.000 81.27141  ? 117 THR B C   1 
ATOM 6608  O O   . THR B 2 117 ? 45.27444  -10.25343 22.11320   1.000 85.39419  ? 117 THR B O   1 
ATOM 6609  C CB  . THR B 2 117 ? 47.02605  -9.44993  24.48711   1.000 53.20802  ? 117 THR B CB  1 
ATOM 6610  O OG1 . THR B 2 117 ? 47.23754  -8.76685  25.72830   1.000 56.26737  ? 117 THR B OG1 1 
ATOM 6611  C CG2 . THR B 2 117 ? 48.37648  -9.76108  23.86405   1.000 52.21563  ? 117 THR B CG2 1 
ATOM 6612  N N   . ARG B 2 118 ? 46.66114  -8.73883  21.18107   1.000 88.91470  ? 118 ARG B N   1 
ATOM 6613  C CA  . ARG B 2 118 ? 46.66670  -9.35106  19.86240   1.000 74.04261  ? 118 ARG B CA  1 
ATOM 6614  C C   . ARG B 2 118 ? 47.78719  -10.38932 19.79751   1.000 63.76805  ? 118 ARG B C   1 
ATOM 6615  O O   . ARG B 2 118 ? 48.39243  -10.74607 20.81135   1.000 57.36870  ? 118 ARG B O   1 
ATOM 6616  C CB  . ARG B 2 118 ? 46.82414  -8.28130  18.78326   1.000 75.75910  ? 118 ARG B CB  1 
ATOM 6617  C CG  . ARG B 2 118 ? 45.67661  -7.28788  18.69703   1.000 99.20383  ? 118 ARG B CG  1 
ATOM 6618  C CD  . ARG B 2 118 ? 44.39757  -7.94381  18.21058   1.000 121.02819 ? 118 ARG B CD  1 
ATOM 6619  N NE  . ARG B 2 118 ? 43.31129  -6.97750  18.07842   1.000 135.36084 ? 118 ARG B NE  1 
ATOM 6620  C CZ  . ARG B 2 118 ? 42.07628  -7.29152  17.70295   1.000 140.53413 ? 118 ARG B CZ  1 
ATOM 6621  N NH1 . ARG B 2 118 ? 41.77009  -8.54973  17.41971   1.000 137.11110 ? 118 ARG B NH1 1 
ATOM 6622  N NH2 . ARG B 2 118 ? 41.14823  -6.34907  17.60750   1.000 144.19789 ? 118 ARG B NH2 1 
ATOM 6623  N N   . VAL B 2 119 ? 48.08170  -10.88911 18.59212   1.000 62.38159  ? 119 VAL B N   1 
ATOM 6624  C CA  . VAL B 2 119 ? 49.21202  -11.79309 18.40417   1.000 72.76920  ? 119 VAL B CA  1 
ATOM 6625  C C   . VAL B 2 119 ? 50.49920  -11.03421 18.10845   1.000 80.93258  ? 119 VAL B C   1 
ATOM 6626  O O   . VAL B 2 119 ? 51.56655  -11.65170 17.98712   1.000 65.22502  ? 119 VAL B O   1 
ATOM 6627  C CB  . VAL B 2 119 ? 48.89871  -12.81100 17.28566   1.000 66.27576  ? 119 VAL B CB  1 
ATOM 6628  C CG1 . VAL B 2 119 ? 49.76702  -14.05404 17.42163   1.000 77.93576  ? 119 VAL B CG1 1 
ATOM 6629  C CG2 . VAL B 2 119 ? 47.42850  -13.18562 17.31585   1.000 49.08326  ? 119 VAL B CG2 1 
ATOM 6630  N N   . ASP B 2 120 ? 50.42991  -9.70623  17.99192   1.000 75.01464  ? 120 ASP B N   1 
ATOM 6631  C CA  . ASP B 2 120 ? 51.62744  -8.90588  17.75631   1.000 85.59719  ? 120 ASP B CA  1 
ATOM 6632  C C   . ASP B 2 120 ? 52.60968  -9.02220  18.91223   1.000 96.32050  ? 120 ASP B C   1 
ATOM 6633  O O   . ASP B 2 120 ? 53.82073  -9.15389  18.69753   1.000 116.74003 ? 120 ASP B O   1 
ATOM 6634  C CB  . ASP B 2 120 ? 51.24195  -7.44527  17.53081   1.000 89.61860  ? 120 ASP B CB  1 
ATOM 6635  C CG  . ASP B 2 120 ? 50.45116  -7.24798  16.26119   1.000 86.60696  ? 120 ASP B CG  1 
ATOM 6636  O OD1 . ASP B 2 120 ? 50.70158  -8.00697  15.30526   1.000 84.25544  ? 120 ASP B OD1 1 
ATOM 6637  O OD2 . ASP B 2 120 ? 49.58639  -6.34638  16.21886   1.000 85.26310  ? 120 ASP B OD2 1 
ATOM 6638  N N   . ARG B 2 121 ? 52.10657  -8.96526  20.14755   1.000 92.57558  ? 121 ARG B N   1 
ATOM 6639  C CA  . ARG B 2 121 ? 52.97303  -9.03379  21.31902   1.000 80.16693  ? 121 ARG B CA  1 
ATOM 6640  C C   . ARG B 2 121 ? 53.76222  -10.33614 21.37530   1.000 83.75988  ? 121 ARG B C   1 
ATOM 6641  O O   . ARG B 2 121 ? 54.74499  -10.42566 22.12006   1.000 113.92600 ? 121 ARG B O   1 
ATOM 6642  C CB  . ARG B 2 121 ? 52.12471  -8.87129  22.58380   1.000 65.35656  ? 121 ARG B CB  1 
ATOM 6643  C CG  . ARG B 2 121 ? 52.90126  -8.61542  23.86219   1.000 62.89252  ? 121 ARG B CG  1 
ATOM 6644  C CD  . ARG B 2 121 ? 53.68838  -7.31677  23.77343   1.000 92.64931  ? 121 ARG B CD  1 
ATOM 6645  N NE  . ARG B 2 121 ? 52.83430  -6.14708  23.96973   1.000 116.63263 ? 121 ARG B NE  1 
ATOM 6646  C CZ  . ARG B 2 121 ? 52.71478  -5.48922  25.11880   1.000 124.87757 ? 121 ARG B CZ  1 
ATOM 6647  N NH1 . ARG B 2 121 ? 53.39294  -5.88677  26.18546   1.000 124.81510 ? 121 ARG B NH1 1 
ATOM 6648  N NH2 . ARG B 2 121 ? 51.91353  -4.43497  25.20311   1.000 128.61344 ? 121 ARG B NH2 1 
ATOM 6649  N N   . LEU B 2 122 ? 53.36370  -11.34072 20.59837   1.000 56.50989  ? 122 LEU B N   1 
ATOM 6650  C CA  . LEU B 2 122 ? 54.08269  -12.60472 20.54944   1.000 49.26839  ? 122 LEU B CA  1 
ATOM 6651  C C   . LEU B 2 122 ? 55.24946  -12.60013 19.56534   1.000 59.91547  ? 122 LEU B C   1 
ATOM 6652  O O   . LEU B 2 122 ? 56.13820  -13.45203 19.68187   1.000 70.23479  ? 122 LEU B O   1 
ATOM 6653  C CB  . LEU B 2 122 ? 53.11052  -13.73693 20.20229   1.000 49.70899  ? 122 LEU B CB  1 
ATOM 6654  C CG  . LEU B 2 122 ? 53.50465  -15.15012 20.63155   1.000 49.07460  ? 122 LEU B CG  1 
ATOM 6655  C CD1 . LEU B 2 122 ? 53.72257  -15.20203 22.13345   1.000 47.69425  ? 122 LEU B CD1 1 
ATOM 6656  C CD2 . LEU B 2 122 ? 52.43849  -16.15002 20.21435   1.000 49.95173  ? 122 LEU B CD2 1 
ATOM 6657  N N   . THR B 2 123 ? 55.27947  -11.66602 18.61015   1.000 67.93868  ? 123 THR B N   1 
ATOM 6658  C CA  . THR B 2 123 ? 56.39791  -11.56998 17.67658   1.000 73.32283  ? 123 THR B CA  1 
ATOM 6659  C C   . THR B 2 123 ? 57.50497  -10.63967 18.15135   1.000 85.96976  ? 123 THR B C   1 
ATOM 6660  O O   . THR B 2 123 ? 58.62655  -10.72218 17.63784   1.000 103.82841 ? 123 THR B O   1 
ATOM 6661  C CB  . THR B 2 123 ? 55.92003  -11.08223 16.30336   1.000 50.80453  ? 123 THR B CB  1 
ATOM 6662  O OG1 . THR B 2 123 ? 55.73952  -9.66146  16.33606   1.000 51.57372  ? 123 THR B OG1 1 
ATOM 6663  C CG2 . THR B 2 123 ? 54.60433  -11.73944 15.93028   1.000 51.12928  ? 123 THR B CG2 1 
ATOM 6664  N N   . GLN B 2 124 ? 57.21694  -9.75103  19.10194   1.000 85.60935  ? 124 GLN B N   1 
ATOM 6665  C CA  . GLN B 2 124 ? 58.20193  -8.79814  19.61189   1.000 89.15908  ? 124 GLN B CA  1 
ATOM 6666  C C   . GLN B 2 124 ? 59.04487  -9.48296  20.68442   1.000 98.61342  ? 124 GLN B C   1 
ATOM 6667  O O   . GLN B 2 124 ? 58.79065  -9.38536  21.88737   1.000 107.76056 ? 124 GLN B O   1 
ATOM 6668  C CB  . GLN B 2 124 ? 57.50950  -7.55058  20.14497   1.000 99.07382  ? 124 GLN B CB  1 
ATOM 6669  C CG  . GLN B 2 124 ? 56.68806  -6.81401  19.09491   1.000 113.80071 ? 124 GLN B CG  1 
ATOM 6670  C CD  . GLN B 2 124 ? 55.91109  -5.64175  19.66635   1.000 120.54073 ? 124 GLN B CD  1 
ATOM 6671  O OE1 . GLN B 2 124 ? 55.93626  -5.39272  20.87172   1.000 127.05892 ? 124 GLN B OE1 1 
ATOM 6672  N NE2 . GLN B 2 124 ? 55.21401  -4.91480  18.79911   1.000 116.57815 ? 124 GLN B NE2 1 
ATOM 6673  N N   . GLY B 2 125 ? 60.07078  -10.19468 20.23236   1.000 108.51848 ? 125 GLY B N   1 
ATOM 6674  C CA  . GLY B 2 125 ? 60.93787  -10.90155 21.15695   1.000 106.59410 ? 125 GLY B CA  1 
ATOM 6675  C C   . GLY B 2 125 ? 62.21675  -11.32336 20.47224   1.000 86.46635  ? 125 GLY B C   1 
ATOM 6676  O O   . GLY B 2 125 ? 62.38356  -11.16343 19.25995   1.000 81.46671  ? 125 GLY B O   1 
ATOM 6677  N N   . ARG B 2 126 ? 63.12155  -11.87378 21.27883   1.000 69.11302  ? 126 ARG B N   1 
ATOM 6678  C CA  . ARG B 2 126 ? 64.42809  -12.32356 20.82236   1.000 86.92551  ? 126 ARG B CA  1 
ATOM 6679  C C   . ARG B 2 126 ? 64.32843  -13.76526 20.32152   1.000 86.09946  ? 126 ARG B C   1 
ATOM 6680  O O   . ARG B 2 126 ? 63.23702  -14.27835 20.06106   1.000 85.55418  ? 126 ARG B O   1 
ATOM 6681  C CB  . ARG B 2 126 ? 65.46169  -12.17386 21.93949   1.000 107.36151 ? 126 ARG B CB  1 
ATOM 6682  C CG  . ARG B 2 126 ? 66.86210  -11.82871 21.44181   1.000 116.95319 ? 126 ARG B CG  1 
ATOM 6683  C CD  . ARG B 2 126 ? 67.83925  -11.57515 22.58019   1.000 119.26531 ? 126 ARG B CD  1 
ATOM 6684  N NE  . ARG B 2 126 ? 67.40463  -10.48840 23.45160   1.000 118.24798 ? 126 ARG B NE  1 
ATOM 6685  C CZ  . ARG B 2 126 ? 67.11164  -10.63752 24.73869   1.000 108.52197 ? 126 ARG B CZ  1 
ATOM 6686  N NH1 . ARG B 2 126 ? 67.20951  -11.83103 25.30659   1.000 103.14897 ? 126 ARG B NH1 1 
ATOM 6687  N NH2 . ARG B 2 126 ? 66.72365  -9.59408  25.45887   1.000 105.75445 ? 126 ARG B NH2 1 
ATOM 6688  N N   . GLN B 2 127 ? 65.48167  -14.41749 20.14906   1.000 95.75779  ? 127 GLN B N   1 
ATOM 6689  C CA  . GLN B 2 127 ? 65.53142  -15.79466 19.67011   1.000 99.78535  ? 127 GLN B CA  1 
ATOM 6690  C C   . GLN B 2 127 ? 64.59783  -16.69006 20.47544   1.000 90.97310  ? 127 GLN B C   1 
ATOM 6691  O O   . GLN B 2 127 ? 64.55038  -16.62023 21.70625   1.000 103.75152 ? 127 GLN B O   1 
ATOM 6692  C CB  . GLN B 2 127 ? 66.96265  -16.33133 19.77273   1.000 115.14227 ? 127 GLN B CB  1 
ATOM 6693  C CG  . GLN B 2 127 ? 67.99099  -15.60446 18.92099   1.000 134.23392 ? 127 GLN B CG  1 
ATOM 6694  C CD  . GLN B 2 127 ? 68.11413  -16.18671 17.52755   1.000 149.86510 ? 127 GLN B CD  1 
ATOM 6695  O OE1 . GLN B 2 127 ? 67.90817  -17.38270 17.32119   1.000 152.75739 ? 127 GLN B OE1 1 
ATOM 6696  N NE2 . GLN B 2 127 ? 68.46092  -15.34295 16.56270   1.000 155.98913 ? 127 GLN B NE2 1 
ATOM 6697  N N   . THR B 2 128 ? 63.85388  -17.53828 19.77032   1.000 89.85252  ? 128 THR B N   1 
ATOM 6698  C CA  . THR B 2 128 ? 62.97448  -18.51564 20.39546   1.000 75.76602  ? 128 THR B CA  1 
ATOM 6699  C C   . THR B 2 128 ? 63.27722  -19.89238 19.81739   1.000 76.02463  ? 128 THR B C   1 
ATOM 6700  O O   . THR B 2 128 ? 64.10032  -20.04368 18.91074   1.000 79.02230  ? 128 THR B O   1 
ATOM 6701  C CB  . THR B 2 128 ? 61.49608  -18.15169 20.20324   1.000 72.05829  ? 128 THR B CB  1 
ATOM 6702  O OG1 . THR B 2 128 ? 61.23148  -17.92803 18.81301   1.000 86.53476  ? 128 THR B OG1 1 
ATOM 6703  C CG2 . THR B 2 128 ? 61.14304  -16.90142 20.99885   1.000 64.95513  ? 128 THR B CG2 1 
ATOM 6704  N N   . TYR B 2 129 ? 62.59517  -20.90288 20.34533   1.000 65.32284  ? 129 TYR B N   1 
ATOM 6705  C CA  . TYR B 2 129 ? 62.80266  -22.29374 19.95767   1.000 69.68034  ? 129 TYR B CA  1 
ATOM 6706  C C   . TYR B 2 129 ? 61.60637  -22.72252 19.11702   1.000 88.86355  ? 129 TYR B C   1 
ATOM 6707  O O   . TYR B 2 129 ? 60.48395  -22.81422 19.62624   1.000 99.46993  ? 129 TYR B O   1 
ATOM 6708  C CB  . TYR B 2 129 ? 62.96873  -23.17038 21.19976   1.000 71.29803  ? 129 TYR B CB  1 
ATOM 6709  C CG  . TYR B 2 129 ? 63.15649  -24.65895 20.96088   1.000 94.39856  ? 129 TYR B CG  1 
ATOM 6710  C CD1 . TYR B 2 129 ? 63.35585  -25.17792 19.68585   1.000 112.83603 ? 129 TYR B CD1 1 
ATOM 6711  C CD2 . TYR B 2 129 ? 63.12886  -25.54695 22.02567   1.000 112.23042 ? 129 TYR B CD2 1 
ATOM 6712  C CE1 . TYR B 2 129 ? 63.51969  -26.53525 19.48409   1.000 127.13273 ? 129 TYR B CE1 1 
ATOM 6713  C CE2 . TYR B 2 129 ? 63.29607  -26.89974 21.83271   1.000 118.01087 ? 129 TYR B CE2 1 
ATOM 6714  C CZ  . TYR B 2 129 ? 63.48850  -27.39090 20.56309   1.000 118.50240 ? 129 TYR B CZ  1 
ATOM 6715  O OH  . TYR B 2 129 ? 63.65218  -28.74373 20.37703   1.000 107.61513 ? 129 TYR B OH  1 
ATOM 6716  N N   . ASP B 2 130 ? 61.84600  -22.98087 17.83340   1.000 75.27787  ? 130 ASP B N   1 
ATOM 6717  C CA  . ASP B 2 130 ? 60.82732  -23.50979 16.94125   1.000 81.84609  ? 130 ASP B CA  1 
ATOM 6718  C C   . ASP B 2 130 ? 60.88560  -25.03144 16.96920   1.000 88.00292  ? 130 ASP B C   1 
ATOM 6719  O O   . ASP B 2 130 ? 61.91176  -25.62934 16.61559   1.000 122.31731 ? 130 ASP B O   1 
ATOM 6720  C CB  . ASP B 2 130 ? 61.03456  -22.99488 15.51801   1.000 82.77061  ? 130 ASP B CB  1 
ATOM 6721  C CG  . ASP B 2 130 ? 59.91922  -23.41037 14.58092   1.000 82.63721  ? 130 ASP B CG  1 
ATOM 6722  O OD1 . ASP B 2 130 ? 58.85806  -23.84706 15.07552   1.000 83.51726  ? 130 ASP B OD1 1 
ATOM 6723  O OD2 . ASP B 2 130 ? 60.10897  -23.31256 13.35026   1.000 86.01207  ? 130 ASP B OD2 1 
ATOM 6724  N N   . TRP B 2 131 ? 59.78689  -25.64941 17.40279   1.000 77.37843  ? 131 TRP B N   1 
ATOM 6725  C CA  . TRP B 2 131 ? 59.65396  -27.09811 17.38350   1.000 74.84986  ? 131 TRP B CA  1 
ATOM 6726  C C   . TRP B 2 131 ? 59.35292  -27.62544 15.98903   1.000 83.89435  ? 131 TRP B C   1 
ATOM 6727  O O   . TRP B 2 131 ? 59.53926  -28.82149 15.73857   1.000 92.75806  ? 131 TRP B O   1 
ATOM 6728  C CB  . TRP B 2 131 ? 58.54416  -27.52401 18.34292   1.000 66.36523  ? 131 TRP B CB  1 
ATOM 6729  C CG  . TRP B 2 131 ? 57.22848  -26.92444 17.97282   1.000 64.47553  ? 131 TRP B CG  1 
ATOM 6730  C CD1 . TRP B 2 131 ? 56.76332  -25.68972 18.32006   1.000 62.03334  ? 131 TRP B CD1 1 
ATOM 6731  C CD2 . TRP B 2 131 ? 56.20928  -27.52634 17.16829   1.000 68.56582  ? 131 TRP B CD2 1 
ATOM 6732  N NE1 . TRP B 2 131 ? 55.51605  -25.48624 17.78237   1.000 66.37499  ? 131 TRP B NE1 1 
ATOM 6733  C CE2 . TRP B 2 131 ? 55.15185  -26.60066 17.07310   1.000 70.73668  ? 131 TRP B CE2 1 
ATOM 6734  C CE3 . TRP B 2 131 ? 56.08674  -28.75947 16.52207   1.000 74.05093  ? 131 TRP B CE3 1 
ATOM 6735  C CZ2 . TRP B 2 131 ? 53.98735  -26.86982 16.35845   1.000 76.00345  ? 131 TRP B CZ2 1 
ATOM 6736  C CZ3 . TRP B 2 131 ? 54.93055  -29.02457 15.81319   1.000 77.06125  ? 131 TRP B CZ3 1 
ATOM 6737  C CH2 . TRP B 2 131 ? 53.89612  -28.08475 15.73738   1.000 76.13978  ? 131 TRP B CH2 1 
ATOM 6738  N N   . THR B 2 132 ? 58.88021  -26.76037 15.08619   1.000 69.48282  ? 132 THR B N   1 
ATOM 6739  C CA  . THR B 2 132 ? 58.62296  -27.18007 13.71253   1.000 72.35755  ? 132 THR B CA  1 
ATOM 6740  C C   . THR B 2 132 ? 59.90995  -27.61847 13.02839   1.000 67.32400  ? 132 THR B C   1 
ATOM 6741  O O   . THR B 2 132 ? 59.93371  -28.63051 12.31798   1.000 69.03486  ? 132 THR B O   1 
ATOM 6742  C CB  . THR B 2 132 ? 57.95918  -26.04373 12.93096   1.000 94.74332  ? 132 THR B CB  1 
ATOM 6743  O OG1 . THR B 2 132 ? 56.71743  -25.69128 13.55496   1.000 104.68525 ? 132 THR B OG1 1 
ATOM 6744  C CG2 . THR B 2 132 ? 57.69839  -26.46079 11.49138   1.000 106.93060 ? 132 THR B CG2 1 
ATOM 6745  N N   . LEU B 2 133 ? 60.99313  -26.87335 13.23994   1.000 69.03140  ? 133 LEU B N   1 
ATOM 6746  C CA  . LEU B 2 133 ? 62.29935  -27.21965 12.70461   1.000 81.91360  ? 133 LEU B CA  1 
ATOM 6747  C C   . LEU B 2 133 ? 63.24411  -27.73269 13.77991   1.000 97.98165  ? 133 LEU B C   1 
ATOM 6748  O O   . LEU B 2 133 ? 64.39498  -28.06186 13.47024   1.000 110.87506 ? 133 LEU B O   1 
ATOM 6749  C CB  . LEU B 2 133 ? 62.92032  -26.00702 12.00156   1.000 86.09148  ? 133 LEU B CB  1 
ATOM 6750  C CG  . LEU B 2 133 ? 62.04915  -25.34936 10.92920   1.000 86.60821  ? 133 LEU B CG  1 
ATOM 6751  C CD1 . LEU B 2 133 ? 62.75319  -24.14601 10.31881   1.000 85.11903  ? 133 LEU B CD1 1 
ATOM 6752  C CD2 . LEU B 2 133 ? 61.66034  -26.35497 9.85496    1.000 86.92101  ? 133 LEU B CD2 1 
ATOM 6753  N N   . ASN B 2 134 ? 62.77995  -27.81425 15.02935   1.000 100.20056 ? 134 ASN B N   1 
ATOM 6754  C CA  . ASN B 2 134 ? 63.58933  -28.25754 16.16501   1.000 91.32378  ? 134 ASN B CA  1 
ATOM 6755  C C   . ASN B 2 134 ? 64.88193  -27.45178 16.27124   1.000 87.45268  ? 134 ASN B C   1 
ATOM 6756  O O   . ASN B 2 134 ? 65.96289  -27.99531 16.50707   1.000 99.60909  ? 134 ASN B O   1 
ATOM 6757  C CB  . ASN B 2 134 ? 63.88054  -29.75717 16.07636   1.000 96.13344  ? 134 ASN B CB  1 
ATOM 6758  C CG  . ASN B 2 134 ? 64.25580  -30.35947 17.41649   1.000 112.44346 ? 134 ASN B CG  1 
ATOM 6759  O OD1 . ASN B 2 134 ? 64.27846  -29.67025 18.43542   1.000 112.17846 ? 134 ASN B OD1 1 
ATOM 6760  N ND2 . ASN B 2 134 ? 64.55158  -31.65430 17.42104   1.000 128.52591 ? 134 ASN B ND2 1 
ATOM 6761  N N   . ARG B 2 135 ? 64.77229  -26.13824 16.08339   1.000 88.02706  ? 135 ARG B N   1 
ATOM 6762  C CA  . ARG B 2 135 ? 65.95124  -25.28283 16.07478   1.000 74.53750  ? 135 ARG B CA  1 
ATOM 6763  C C   . ARG B 2 135 ? 65.57120  -23.90600 16.59637   1.000 69.62932  ? 135 ARG B C   1 
ATOM 6764  O O   . ARG B 2 135 ? 64.39521  -23.54281 16.64204   1.000 80.38978  ? 135 ARG B O   1 
ATOM 6765  C CB  . ARG B 2 135 ? 66.56029  -25.17064 14.66937   1.000 78.42885  ? 135 ARG B CB  1 
ATOM 6766  C CG  . ARG B 2 135 ? 68.04480  -24.83234 14.66115   1.000 94.96634  ? 135 ARG B CG  1 
ATOM 6767  C CD  . ARG B 2 135 ? 68.54378  -24.47018 13.26845   1.000 114.35964 ? 135 ARG B CD  1 
ATOM 6768  N NE  . ARG B 2 135 ? 68.25403  -25.50503 12.28006   1.000 133.76653 ? 135 ARG B NE  1 
ATOM 6769  C CZ  . ARG B 2 135 ? 67.59292  -25.29221 11.14672   1.000 142.81082 ? 135 ARG B CZ  1 
ATOM 6770  N NH1 . ARG B 2 135 ? 67.15315  -24.07668 10.85066   1.000 136.09569 ? 135 ARG B NH1 1 
ATOM 6771  N NH2 . ARG B 2 135 ? 67.37591  -26.29381 10.30491   1.000 154.35833 ? 135 ARG B NH2 1 
ATOM 6772  N N   . ASN B 2 136 ? 66.57987  -23.14028 17.00084   1.000 75.78507  ? 136 ASN B N   1 
ATOM 6773  C CA  . ASN B 2 136 ? 66.34579  -21.76348 17.41059   1.000 76.73272  ? 136 ASN B CA  1 
ATOM 6774  C C   . ASN B 2 136 ? 66.15178  -20.88338 16.18219   1.000 100.70500 ? 136 ASN B C   1 
ATOM 6775  O O   . ASN B 2 136 ? 66.96082  -20.90935 15.24924   1.000 122.11778 ? 136 ASN B O   1 
ATOM 6776  C CB  . ASN B 2 136 ? 67.49863  -21.24355 18.26747   1.000 77.42179  ? 136 ASN B CB  1 
ATOM 6777  C CG  . ASN B 2 136 ? 67.53628  -21.88300 19.64160   1.000 75.12286  ? 136 ASN B CG  1 
ATOM 6778  O OD1 . ASN B 2 136 ? 66.49753  -22.22571 20.20714   1.000 71.75525  ? 136 ASN B OD1 1 
ATOM 6779  N ND2 . ASN B 2 136 ? 68.73421  -22.02981 20.19451   1.000 90.67057  ? 136 ASN B ND2 1 
ATOM 6780  N N   . GLN B 2 137 ? 65.07906  -20.10671 16.19131   1.000 90.67209  ? 137 GLN B N   1 
ATOM 6781  C CA  . GLN B 2 137 ? 64.70292  -19.22768 15.09712   1.000 96.97024  ? 137 GLN B CA  1 
ATOM 6782  C C   . GLN B 2 137 ? 64.24775  -17.90181 15.68367   1.000 102.91055 ? 137 GLN B C   1 
ATOM 6783  O O   . GLN B 2 137 ? 63.91763  -17.82494 16.87269   1.000 107.12879 ? 137 GLN B O   1 
ATOM 6784  C CB  . GLN B 2 137 ? 63.58794  -19.84352 14.23919   1.000 89.08591  ? 137 GLN B CB  1 
ATOM 6785  C CG  . GLN B 2 137 ? 64.04094  -21.00116 13.36023   1.000 82.68329  ? 137 GLN B CG  1 
ATOM 6786  C CD  . GLN B 2 137 ? 64.87140  -20.54681 12.17399   1.000 80.23041  ? 137 GLN B CD  1 
ATOM 6787  O OE1 . GLN B 2 137 ? 64.53317  -19.57371 11.50032   1.000 76.08601  ? 137 GLN B OE1 1 
ATOM 6788  N NE2 . GLN B 2 137 ? 65.96542  -21.25359 11.91198   1.000 85.68808  ? 137 GLN B NE2 1 
ATOM 6789  N N   . PRO B 2 138 ? 64.23199  -16.83580 14.88145   1.000 92.03088  ? 138 PRO B N   1 
ATOM 6790  C CA  . PRO B 2 138 ? 63.67880  -15.56683 15.36576   1.000 72.47060  ? 138 PRO B CA  1 
ATOM 6791  C C   . PRO B 2 138 ? 62.20107  -15.69970 15.70494   1.000 74.25734  ? 138 PRO B C   1 
ATOM 6792  O O   . PRO B 2 138 ? 61.52362  -16.65121 15.30935   1.000 90.63943  ? 138 PRO B O   1 
ATOM 6793  C CB  . PRO B 2 138 ? 63.90319  -14.60275 14.19248   1.000 60.00480  ? 138 PRO B CB  1 
ATOM 6794  C CG  . PRO B 2 138 ? 64.12308  -15.47938 13.00269   1.000 75.79613  ? 138 PRO B CG  1 
ATOM 6795  C CD  . PRO B 2 138 ? 64.80186  -16.70373 13.52995   1.000 87.45830  ? 138 PRO B CD  1 
ATOM 6796  N N   . ALA B 2 139 ? 61.70405  -14.71431 16.45563   1.000 71.03879  ? 139 ALA B N   1 
ATOM 6797  C CA  . ALA B 2 139 ? 60.35481  -14.80225 17.00658   1.000 79.42485  ? 139 ALA B CA  1 
ATOM 6798  C C   . ALA B 2 139 ? 59.30335  -14.86821 15.90530   1.000 59.31457  ? 139 ALA B C   1 
ATOM 6799  O O   . ALA B 2 139 ? 58.43984  -15.75340 15.90997   1.000 63.77049  ? 139 ALA B O   1 
ATOM 6800  C CB  . ALA B 2 139 ? 60.09213  -13.61686 17.93516   1.000 105.04576 ? 139 ALA B CB  1 
ATOM 6801  N N   . ALA B 2 140 ? 59.35890  -13.93637 14.95073   1.000 53.63837  ? 140 ALA B N   1 
ATOM 6802  C CA  . ALA B 2 140 ? 58.32797  -13.87723 13.91887   1.000 54.92171  ? 140 ALA B CA  1 
ATOM 6803  C C   . ALA B 2 140 ? 58.36130  -15.10838 13.02205   1.000 56.06358  ? 140 ALA B C   1 
ATOM 6804  O O   . ALA B 2 140 ? 57.30852  -15.62884 12.63586   1.000 56.39441  ? 140 ALA B O   1 
ATOM 6805  C CB  . ALA B 2 140 ? 58.48971  -12.60600 13.08732   1.000 61.31051  ? 140 ALA B CB  1 
ATOM 6806  N N   . THR B 2 141 ? 59.55774  -15.59626 12.68807   1.000 54.13323  ? 141 THR B N   1 
ATOM 6807  C CA  . THR B 2 141 ? 59.65603  -16.76525 11.81934   1.000 60.03744  ? 141 THR B CA  1 
ATOM 6808  C C   . THR B 2 141 ? 59.14974  -18.02302 12.51747   1.000 68.25931  ? 141 THR B C   1 
ATOM 6809  O O   . THR B 2 141 ? 58.42551  -18.82317 11.91425   1.000 87.34815  ? 141 THR B O   1 
ATOM 6810  C CB  . THR B 2 141 ? 61.09656  -16.95100 11.34629   1.000 76.52973  ? 141 THR B CB  1 
ATOM 6811  O OG1 . THR B 2 141 ? 61.49903  -15.80290 10.58888   1.000 86.09928  ? 141 THR B OG1 1 
ATOM 6812  C CG2 . THR B 2 141 ? 61.21144  -18.18876 10.46986   1.000 72.60899  ? 141 THR B CG2 1 
ATOM 6813  N N   . ALA B 2 142 ? 59.51971  -18.21847 13.78588   1.000 69.20759  ? 142 ALA B N   1 
ATOM 6814  C CA  . ALA B 2 142 ? 59.00799  -19.36528 14.53068   1.000 58.07057  ? 142 ALA B CA  1 
ATOM 6815  C C   . ALA B 2 142 ? 57.49631  -19.27552 14.69754   1.000 61.60846  ? 142 ALA B C   1 
ATOM 6816  O O   . ALA B 2 142 ? 56.78807  -20.28854 14.61019   1.000 66.51118  ? 142 ALA B O   1 
ATOM 6817  C CB  . ALA B 2 142 ? 59.69806  -19.45994 15.89106   1.000 54.70602  ? 142 ALA B CB  1 
ATOM 6818  N N   . LEU B 2 143 ? 56.98393  -18.06350 14.92481   1.000 53.93989  ? 143 LEU B N   1 
ATOM 6819  C CA  . LEU B 2 143 ? 55.54298  -17.87268 15.04405   1.000 53.75070  ? 143 LEU B CA  1 
ATOM 6820  C C   . LEU B 2 143 ? 54.83188  -18.22516 13.74534   1.000 55.69129  ? 143 LEU B C   1 
ATOM 6821  O O   . LEU B 2 143 ? 53.79170  -18.89160 13.76132   1.000 60.03747  ? 143 LEU B O   1 
ATOM 6822  C CB  . LEU B 2 143 ? 55.24529  -16.42862 15.45001   1.000 53.09820  ? 143 LEU B CB  1 
ATOM 6823  C CG  . LEU B 2 143 ? 53.80563  -16.04641 15.79283   1.000 57.54235  ? 143 LEU B CG  1 
ATOM 6824  C CD1 . LEU B 2 143 ? 53.79451  -15.07108 16.94404   1.000 73.96051  ? 143 LEU B CD1 1 
ATOM 6825  C CD2 . LEU B 2 143 ? 53.13236  -15.42119 14.58646   1.000 54.75083  ? 143 LEU B CD2 1 
ATOM 6826  N N   . ALA B 2 144 ? 55.38046  -17.79131 12.60884   1.000 53.91531  ? 144 ALA B N   1 
ATOM 6827  C CA  . ALA B 2 144 ? 54.77541  -18.12382 11.32272   1.000 56.04421  ? 144 ALA B CA  1 
ATOM 6828  C C   . ALA B 2 144 ? 54.85505  -19.61977 11.04162   1.000 56.76565  ? 144 ALA B C   1 
ATOM 6829  O O   . ALA B 2 144 ? 53.91624  -20.20186 10.48575   1.000 57.98337  ? 144 ALA B O   1 
ATOM 6830  C CB  . ALA B 2 144 ? 55.44837  -17.32722 10.20657   1.000 70.28860  ? 144 ALA B CB  1 
ATOM 6831  N N   . ASN B 2 145 ? 55.96557  -20.25813 11.42141   1.000 56.20023  ? 145 ASN B N   1 
ATOM 6832  C CA  . ASN B 2 145 ? 56.08929  -21.70420 11.26102   1.000 63.35540  ? 145 ASN B CA  1 
ATOM 6833  C C   . ASN B 2 145 ? 55.00180  -22.43234 12.04027   1.000 76.48127  ? 145 ASN B C   1 
ATOM 6834  O O   . ASN B 2 145 ? 54.31693  -23.31537 11.50553   1.000 100.50966 ? 145 ASN B O   1 
ATOM 6835  C CB  . ASN B 2 145 ? 57.47230  -22.16208 11.72738   1.000 65.41873  ? 145 ASN B CB  1 
ATOM 6836  C CG  . ASN B 2 145 ? 58.57605  -21.76760 10.76807   1.000 72.32699  ? 145 ASN B CG  1 
ATOM 6837  O OD1 . ASN B 2 145 ? 58.48120  -21.99679 9.56420    1.000 85.85227  ? 145 ASN B OD1 1 
ATOM 6838  N ND2 . ASN B 2 145 ? 59.63363  -21.16658 11.30123   1.000 62.51900  ? 145 ASN B ND2 1 
ATOM 6839  N N   . THR B 2 146 ? 54.82501  -22.06255 13.31172   1.000 65.46512  ? 146 THR B N   1 
ATOM 6840  C CA  . THR B 2 146 ? 53.80077  -22.69924 14.13317   1.000 57.27984  ? 146 THR B CA  1 
ATOM 6841  C C   . THR B 2 146 ? 52.40382  -22.41447 13.59059   1.000 70.02505  ? 146 THR B C   1 
ATOM 6842  O O   . THR B 2 146 ? 51.54600  -23.30569 13.56495   1.000 69.22832  ? 146 THR B O   1 
ATOM 6843  C CB  . THR B 2 146 ? 53.92746  -22.23386 15.58478   1.000 55.14923  ? 146 THR B CB  1 
ATOM 6844  O OG1 . THR B 2 146 ? 55.22939  -22.56930 16.08126   1.000 54.50618  ? 146 THR B OG1 1 
ATOM 6845  C CG2 . THR B 2 146 ? 52.87937  -22.90778 16.45699   1.000 59.63789  ? 146 THR B CG2 1 
ATOM 6846  N N   . ILE B 2 147 ? 52.16211  -21.18223 13.13410   1.000 67.24600  ? 147 ILE B N   1 
ATOM 6847  C CA  . ILE B 2 147 ? 50.85404  -20.82823 12.58692   1.000 66.61757  ? 147 ILE B CA  1 
ATOM 6848  C C   . ILE B 2 147 ? 50.53619  -21.67980 11.36508   1.000 72.06470  ? 147 ILE B C   1 
ATOM 6849  O O   . ILE B 2 147 ? 49.42831  -22.21320 11.23005   1.000 77.79655  ? 147 ILE B O   1 
ATOM 6850  C CB  . ILE B 2 147 ? 50.79704  -19.32675 12.25123   1.000 63.40070  ? 147 ILE B CB  1 
ATOM 6851  C CG1 . ILE B 2 147 ? 50.60192  -18.49622 13.51993   1.000 59.58880  ? 147 ILE B CG1 1 
ATOM 6852  C CG2 . ILE B 2 147 ? 49.69206  -19.04284 11.24213   1.000 65.13653  ? 147 ILE B CG2 1 
ATOM 6853  C CD1 . ILE B 2 147 ? 50.26293  -17.04679 13.24683   1.000 57.71742  ? 147 ILE B CD1 1 
ATOM 6854  N N   . GLU B 2 148 ? 51.50126  -21.81870 10.45343   1.000 62.10739  ? 148 GLU B N   1 
ATOM 6855  C CA  . GLU B 2 148 ? 51.23863  -22.57010 9.23137    1.000 69.56941  ? 148 GLU B CA  1 
ATOM 6856  C C   . GLU B 2 148 ? 51.11626  -24.06376 9.50331    1.000 72.14665  ? 148 GLU B C   1 
ATOM 6857  O O   . GLU B 2 148 ? 50.31694  -24.74374 8.84875    1.000 95.07589  ? 148 GLU B O   1 
ATOM 6858  C CB  . GLU B 2 148 ? 52.32759  -22.30020 8.19374    1.000 79.50000  ? 148 GLU B CB  1 
ATOM 6859  C CG  . GLU B 2 148 ? 51.97280  -22.78318 6.79189    1.000 89.66485  ? 148 GLU B CG  1 
ATOM 6860  C CD  . GLU B 2 148 ? 50.82715  -21.99894 6.17075    1.000 79.85989  ? 148 GLU B CD  1 
ATOM 6861  O OE1 . GLU B 2 148 ? 50.63473  -20.82274 6.54702    1.000 76.00041  ? 148 GLU B OE1 1 
ATOM 6862  O OE2 . GLU B 2 148 ? 50.11726  -22.55895 5.30809    1.000 72.46441  ? 148 GLU B OE2 1 
ATOM 6863  N N   . VAL B 2 149 ? 51.87248  -24.59324 10.46996   1.000 69.94978  ? 149 VAL B N   1 
ATOM 6864  C CA  . VAL B 2 149 ? 51.74878  -26.01947 10.75531   1.000 73.28008  ? 149 VAL B CA  1 
ATOM 6865  C C   . VAL B 2 149 ? 50.44669  -26.30462 11.49471   1.000 78.87576  ? 149 VAL B C   1 
ATOM 6866  O O   . VAL B 2 149 ? 49.90334  -27.41168 11.40091   1.000 89.63145  ? 149 VAL B O   1 
ATOM 6867  C CB  . VAL B 2 149 ? 52.97558  -26.53712 11.53355   1.000 75.63360  ? 149 VAL B CB  1 
ATOM 6868  C CG1 . VAL B 2 149 ? 52.94788  -26.06610 12.97612   1.000 80.15123  ? 149 VAL B CG1 1 
ATOM 6869  C CG2 . VAL B 2 149 ? 53.04944  -28.05773 11.46244   1.000 75.26132  ? 149 VAL B CG2 1 
ATOM 6870  N N   . PHE B 2 150 ? 49.91683  -25.32334 12.23084   1.000 73.97468  ? 150 PHE B N   1 
ATOM 6871  C CA  . PHE B 2 150 ? 48.59281  -25.49091 12.81954   1.000 71.76763  ? 150 PHE B CA  1 
ATOM 6872  C C   . PHE B 2 150 ? 47.50191  -25.39274 11.75983   1.000 72.15478  ? 150 PHE B C   1 
ATOM 6873  O O   . PHE B 2 150 ? 46.54040  -26.17001 11.77679   1.000 77.63441  ? 150 PHE B O   1 
ATOM 6874  C CB  . PHE B 2 150 ? 48.36292  -24.45162 13.91753   1.000 67.51683  ? 150 PHE B CB  1 
ATOM 6875  C CG  . PHE B 2 150 ? 49.03902  -24.78028 15.21810   1.000 66.42251  ? 150 PHE B CG  1 
ATOM 6876  C CD1 . PHE B 2 150 ? 49.63897  -26.01289 15.40984   1.000 69.61754  ? 150 PHE B CD1 1 
ATOM 6877  C CD2 . PHE B 2 150 ? 49.06236  -23.85987 16.25436   1.000 64.43667  ? 150 PHE B CD2 1 
ATOM 6878  C CE1 . PHE B 2 150 ? 50.25924  -26.31909 16.60544   1.000 72.90486  ? 150 PHE B CE1 1 
ATOM 6879  C CE2 . PHE B 2 150 ? 49.67969  -24.16077 17.45409   1.000 63.05781  ? 150 PHE B CE2 1 
ATOM 6880  C CZ  . PHE B 2 150 ? 50.27919  -25.39154 17.62939   1.000 68.97140  ? 150 PHE B CZ  1 
ATOM 6881  N N   . ARG B 2 151 ? 47.63164  -24.43874 10.83307   1.000 63.96690  ? 151 ARG B N   1 
ATOM 6882  C CA  . ARG B 2 151 ? 46.62779  -24.26680 9.78732    1.000 71.74651  ? 151 ARG B CA  1 
ATOM 6883  C C   . ARG B 2 151 ? 46.60773  -25.44118 8.81648    1.000 94.17435  ? 151 ARG B C   1 
ATOM 6884  O O   . ARG B 2 151 ? 45.55192  -25.76161 8.25699    1.000 110.84282 ? 151 ARG B O   1 
ATOM 6885  C CB  . ARG B 2 151 ? 46.87556  -22.95262 9.04397    1.000 79.62225  ? 151 ARG B CB  1 
ATOM 6886  C CG  . ARG B 2 151 ? 45.96447  -22.71191 7.85099    1.000 75.63321  ? 151 ARG B CG  1 
ATOM 6887  C CD  . ARG B 2 151 ? 46.72157  -22.86340 6.54261    1.000 70.75172  ? 151 ARG B CD  1 
ATOM 6888  N NE  . ARG B 2 151 ? 45.85348  -22.68013 5.38417    1.000 76.51545  ? 151 ARG B NE  1 
ATOM 6889  C CZ  . ARG B 2 151 ? 46.24399  -22.85351 4.12628    1.000 99.81228  ? 151 ARG B CZ  1 
ATOM 6890  N NH1 . ARG B 2 151 ? 47.49348  -23.21099 3.86336    1.000 104.70850 ? 151 ARG B NH1 1 
ATOM 6891  N NH2 . ARG B 2 151 ? 45.38766  -22.66515 3.13142    1.000 111.17412 ? 151 ARG B NH2 1 
ATOM 6892  N N   . SER B 2 152 ? 47.74989  -26.10223 8.61273    1.000 97.56097  ? 152 SER B N   1 
ATOM 6893  C CA  . SER B 2 152 ? 47.75422  -27.30597 7.78918    1.000 104.57000 ? 152 SER B CA  1 
ATOM 6894  C C   . SER B 2 152 ? 46.93129  -28.41516 8.43060    1.000 92.57837  ? 152 SER B C   1 
ATOM 6895  O O   . SER B 2 152 ? 46.34605  -29.24240 7.72170    1.000 96.74620  ? 152 SER B O   1 
ATOM 6896  C CB  . SER B 2 152 ? 49.18862  -27.77588 7.54510    1.000 108.58586 ? 152 SER B CB  1 
ATOM 6897  O OG  . SER B 2 152 ? 49.89685  -26.85637 6.73158    1.000 104.91067 ? 152 SER B OG  1 
ATOM 6898  N N   . ASN B 2 153 ? 46.87846  -28.45141 9.75785    1.000 67.11342  ? 153 ASN B N   1 
ATOM 6899  C CA  . ASN B 2 153 ? 46.01792  -29.36156 10.49233   1.000 68.07450  ? 153 ASN B CA  1 
ATOM 6900  C C   . ASN B 2 153 ? 44.71664  -28.64275 10.86077   1.000 90.16736  ? 153 ASN B C   1 
ATOM 6901  O O   . ASN B 2 153 ? 44.43691  -27.53425 10.39311   1.000 116.27607 ? 153 ASN B O   1 
ATOM 6902  C CB  . ASN B 2 153 ? 46.76448  -29.90600 11.71225   1.000 66.42919  ? 153 ASN B CB  1 
ATOM 6903  C CG  . ASN B 2 153 ? 48.05273  -30.62863 11.33709   1.000 66.68702  ? 153 ASN B CG  1 
ATOM 6904  O OD1 . ASN B 2 153 ? 49.14894  -30.18419 11.67814   1.000 64.73547  ? 153 ASN B OD1 1 
ATOM 6905  N ND2 . ASN B 2 153 ? 47.92295  -31.75021 10.63766   1.000 69.34402  ? 153 ASN B ND2 1 
ATOM 6906  N N   . GLY B 2 154 ? 43.90522  -29.27168 11.70790   1.000 117.36277 ? 154 GLY B N   1 
ATOM 6907  C CA  . GLY B 2 154 ? 42.61490  -28.71281 12.06700   1.000 120.42821 ? 154 GLY B CA  1 
ATOM 6908  C C   . GLY B 2 154 ? 42.66671  -27.70421 13.19693   1.000 98.21221  ? 154 GLY B C   1 
ATOM 6909  O O   . GLY B 2 154 ? 41.91138  -27.81384 14.16715   1.000 99.19478  ? 154 GLY B O   1 
ATOM 6910  N N   . LEU B 2 155 ? 43.55706  -26.71551 13.08805   1.000 86.37584  ? 155 LEU B N   1 
ATOM 6911  C CA  . LEU B 2 155 ? 43.74878  -25.70824 14.13738   1.000 79.24097  ? 155 LEU B CA  1 
ATOM 6912  C C   . LEU B 2 155 ? 43.84467  -24.34203 13.45816   1.000 78.66220  ? 155 LEU B C   1 
ATOM 6913  O O   . LEU B 2 155 ? 44.92521  -23.92273 13.03334   1.000 74.58776  ? 155 LEU B O   1 
ATOM 6914  C CB  . LEU B 2 155 ? 44.98582  -26.00940 14.97481   1.000 82.13476  ? 155 LEU B CB  1 
ATOM 6915  C CG  . LEU B 2 155 ? 45.01301  -27.32774 15.75277   1.000 93.04779  ? 155 LEU B CG  1 
ATOM 6916  C CD1 . LEU B 2 155 ? 45.58123  -28.46353 14.91213   1.000 103.93079 ? 155 LEU B CD1 1 
ATOM 6917  C CD2 . LEU B 2 155 ? 45.81292  -27.15801 17.02011   1.000 94.49576  ? 155 LEU B CD2 1 
ATOM 6918  N N   . THR B 2 156 ? 42.71116  -23.64927 13.36647   1.000 80.79059  ? 156 THR B N   1 
ATOM 6919  C CA  . THR B 2 156 ? 42.62346  -22.37181 12.66710   1.000 88.25357  ? 156 THR B CA  1 
ATOM 6920  C C   . THR B 2 156 ? 41.88313  -21.33785 13.50497   1.000 82.95498  ? 156 THR B C   1 
ATOM 6921  O O   . THR B 2 156 ? 41.03436  -20.59681 13.00020   1.000 108.73908 ? 156 THR B O   1 
ATOM 6922  C CB  . THR B 2 156 ? 41.93982  -22.53914 11.31227   1.000 121.98868 ? 156 THR B CB  1 
ATOM 6923  O OG1 . THR B 2 156 ? 40.88140  -23.49913 11.42655   1.000 140.34538 ? 156 THR B OG1 1 
ATOM 6924  C CG2 . THR B 2 156 ? 42.93568  -23.02769 10.27218   1.000 132.42827 ? 156 THR B CG2 1 
ATOM 6925  N N   . ALA B 2 157 ? 42.18766  -21.26619 14.80091   1.000 70.21531  ? 157 ALA B N   1 
ATOM 6926  C CA  . ALA B 2 157 ? 41.53235  -20.29859 15.67279   1.000 82.24589  ? 157 ALA B CA  1 
ATOM 6927  C C   . ALA B 2 157 ? 42.29802  -18.98985 15.80499   1.000 86.34880  ? 157 ALA B C   1 
ATOM 6928  O O   . ALA B 2 157 ? 41.70753  -17.98331 16.21215   1.000 99.87335  ? 157 ALA B O   1 
ATOM 6929  C CB  . ALA B 2 157 ? 41.31623  -20.89515 17.06707   1.000 92.47955  ? 157 ALA B CB  1 
ATOM 6930  N N   . ASN B 2 158 ? 43.58998  -18.97574 15.47099   1.000 87.44508  ? 158 ASN B N   1 
ATOM 6931  C CA  . ASN B 2 158 ? 44.38949  -17.76771 15.63815   1.000 78.65003  ? 158 ASN B CA  1 
ATOM 6932  C C   . ASN B 2 158 ? 44.02914  -16.67149 14.64215   1.000 72.20449  ? 158 ASN B C   1 
ATOM 6933  O O   . ASN B 2 158 ? 44.40012  -15.51349 14.86155   1.000 71.21884  ? 158 ASN B O   1 
ATOM 6934  C CB  . ASN B 2 158 ? 45.87714  -18.10498 15.52434   1.000 72.79960  ? 158 ASN B CB  1 
ATOM 6935  C CG  . ASN B 2 158 ? 46.18892  -18.96596 14.31680   1.000 86.50477  ? 158 ASN B CG  1 
ATOM 6936  O OD1 . ASN B 2 158 ? 45.31819  -19.23607 13.49026   1.000 114.89949 ? 158 ASN B OD1 1 
ATOM 6937  N ND2 . ASN B 2 158 ? 47.43850  -19.39996 14.20744   1.000 74.32002  ? 158 ASN B ND2 1 
ATOM 6938  N N   . GLU B 2 159 ? 43.31918  -16.99859 13.55924   1.000 64.47817  ? 159 GLU B N   1 
ATOM 6939  C CA  . GLU B 2 159 ? 43.01574  -15.99153 12.54639   1.000 70.36809  ? 159 GLU B CA  1 
ATOM 6940  C C   . GLU B 2 159 ? 41.98603  -14.96657 13.00630   1.000 74.59464  ? 159 GLU B C   1 
ATOM 6941  O O   . GLU B 2 159 ? 41.69654  -14.03274 12.25001   1.000 81.04641  ? 159 GLU B O   1 
ATOM 6942  C CB  . GLU B 2 159 ? 42.53853  -16.65366 11.25147   1.000 89.01978  ? 159 GLU B CB  1 
ATOM 6943  C CG  . GLU B 2 159 ? 41.30031  -17.51803 11.38648   1.000 117.09061 ? 159 GLU B CG  1 
ATOM 6944  C CD  . GLU B 2 159 ? 40.99644  -18.28221 10.11198   1.000 133.27382 ? 159 GLU B CD  1 
ATOM 6945  O OE1 . GLU B 2 159 ? 41.76512  -18.14145 9.13699    1.000 133.92622 ? 159 GLU B OE1 1 
ATOM 6946  O OE2 . GLU B 2 159 ? 39.98877  -19.01872 10.08183   1.000 141.84060 ? 159 GLU B OE2 1 
ATOM 6947  N N   . SER B 2 160 ? 41.42170  -15.11054 14.20496   1.000 80.65457  ? 160 SER B N   1 
ATOM 6948  C CA  . SER B 2 160 ? 40.56050  -14.07151 14.75211   1.000 82.56315  ? 160 SER B CA  1 
ATOM 6949  C C   . SER B 2 160 ? 41.34777  -12.89667 15.31695   1.000 70.97986  ? 160 SER B C   1 
ATOM 6950  O O   . SER B 2 160 ? 40.74437  -11.87294 15.65690   1.000 75.04106  ? 160 SER B O   1 
ATOM 6951  C CB  . SER B 2 160 ? 39.65365  -14.65408 15.83781   1.000 82.47011  ? 160 SER B CB  1 
ATOM 6952  O OG  . SER B 2 160 ? 40.40554  -15.00982 16.98261   1.000 88.79882  ? 160 SER B OG  1 
ATOM 6953  N N   . GLY B 2 161 ? 42.67068  -13.02181 15.42760   1.000 70.02411  ? 161 GLY B N   1 
ATOM 6954  C CA  . GLY B 2 161 ? 43.53040  -11.95912 15.89220   1.000 68.60550  ? 161 GLY B CA  1 
ATOM 6955  C C   . GLY B 2 161 ? 43.85695  -12.00391 17.37009   1.000 70.98245  ? 161 GLY B C   1 
ATOM 6956  O O   . GLY B 2 161 ? 44.79510  -11.32513 17.80265   1.000 72.55380  ? 161 GLY B O   1 
ATOM 6957  N N   . ARG B 2 162 ? 43.11110  -12.77686 18.15226   1.000 72.67540  ? 162 ARG B N   1 
ATOM 6958  C CA  . ARG B 2 162 ? 43.31732  -12.82260 19.59211   1.000 93.69186  ? 162 ARG B CA  1 
ATOM 6959  C C   . ARG B 2 162 ? 44.43695  -13.78855 19.95865   1.000 86.25133  ? 162 ARG B C   1 
ATOM 6960  O O   . ARG B 2 162 ? 44.53019  -14.89244 19.41397   1.000 87.55831  ? 162 ARG B O   1 
ATOM 6961  C CB  . ARG B 2 162 ? 42.02488  -13.22174 20.30342   1.000 109.37219 ? 162 ARG B CB  1 
ATOM 6962  C CG  . ARG B 2 162 ? 40.85399  -12.31511 19.97509   1.000 105.39161 ? 162 ARG B CG  1 
ATOM 6963  C CD  . ARG B 2 162 ? 39.53153  -12.89504 20.44224   1.000 89.27252  ? 162 ARG B CD  1 
ATOM 6964  N NE  . ARG B 2 162 ? 39.53102  -13.18355 21.87435   1.000 71.82509  ? 162 ARG B NE  1 
ATOM 6965  C CZ  . ARG B 2 162 ? 39.41868  -12.25807 22.82139   1.000 66.17397  ? 162 ARG B CZ  1 
ATOM 6966  N NH1 . ARG B 2 162 ? 39.31531  -10.98192 22.48752   1.000 63.98986  ? 162 ARG B NH1 1 
ATOM 6967  N NH2 . ARG B 2 162 ? 39.41927  -12.60329 24.10201   1.000 64.91229  ? 162 ARG B NH2 1 
ATOM 6968  N N   . LEU B 2 163 ? 45.29240  -13.36069 20.89120   1.000 70.58271  ? 163 LEU B N   1 
ATOM 6969  C CA  . LEU B 2 163 ? 46.30946  -14.25617 21.43234   1.000 65.71879  ? 163 LEU B CA  1 
ATOM 6970  C C   . LEU B 2 163 ? 45.68099  -15.39769 22.22147   1.000 67.92539  ? 163 LEU B C   1 
ATOM 6971  O O   . LEU B 2 163 ? 46.20971  -16.51697 22.22705   1.000 79.39231  ? 163 LEU B O   1 
ATOM 6972  C CB  . LEU B 2 163 ? 47.27981  -13.46935 22.31594   1.000 50.90991  ? 163 LEU B CB  1 
ATOM 6973  C CG  . LEU B 2 163 ? 48.34478  -14.26067 23.08016   1.000 47.55127  ? 163 LEU B CG  1 
ATOM 6974  C CD1 . LEU B 2 163 ? 49.25340  -15.01900 22.12448   1.000 47.49870  ? 163 LEU B CD1 1 
ATOM 6975  C CD2 . LEU B 2 163 ? 49.15442  -13.34661 23.98628   1.000 46.27654  ? 163 LEU B CD2 1 
ATOM 6976  N N   . ILE B 2 164 ? 44.55315  -15.13533 22.88521   1.000 59.96522  ? 164 ILE B N   1 
ATOM 6977  C CA  . ILE B 2 164 ? 43.87005  -16.17690 23.64242   1.000 59.16653  ? 164 ILE B CA  1 
ATOM 6978  C C   . ILE B 2 164 ? 43.34926  -17.26782 22.71126   1.000 68.70535  ? 164 ILE B C   1 
ATOM 6979  O O   . ILE B 2 164 ? 43.30484  -18.44512 23.08642   1.000 68.87989  ? 164 ILE B O   1 
ATOM 6980  C CB  . ILE B 2 164 ? 42.74776  -15.54697 24.49055   1.000 61.46952  ? 164 ILE B CB  1 
ATOM 6981  C CG1 . ILE B 2 164 ? 41.99508  -16.61205 25.28726   1.000 77.93613  ? 164 ILE B CG1 1 
ATOM 6982  C CG2 . ILE B 2 164 ? 41.80141  -14.75034 23.61743   1.000 61.66314  ? 164 ILE B CG2 1 
ATOM 6983  C CD1 . ILE B 2 164 ? 42.85152  -17.29556 26.31917   1.000 78.79386  ? 164 ILE B CD1 1 
ATOM 6984  N N   . ASP B 2 165 ? 42.97406  -16.91166 21.47962   1.000 57.17741  ? 165 ASP B N   1 
ATOM 6985  C CA  . ASP B 2 165 ? 42.56127  -17.92852 20.51626   1.000 67.58898  ? 165 ASP B CA  1 
ATOM 6986  C C   . ASP B 2 165 ? 43.74445  -18.78484 20.07719   1.000 81.50098  ? 165 ASP B C   1 
ATOM 6987  O O   . ASP B 2 165 ? 43.60160  -19.99659 19.86762   1.000 106.32736 ? 165 ASP B O   1 
ATOM 6988  C CB  . ASP B 2 165 ? 41.88778  -17.26764 19.31423   1.000 79.67875  ? 165 ASP B CB  1 
ATOM 6989  C CG  . ASP B 2 165 ? 40.46488  -16.83372 19.61270   1.000 104.64837 ? 165 ASP B CG  1 
ATOM 6990  O OD1 . ASP B 2 165 ? 39.87175  -17.36606 20.57442   1.000 111.47203 ? 165 ASP B OD1 1 
ATOM 6991  O OD2 . ASP B 2 165 ? 39.93978  -15.96023 18.89140   1.000 107.00631 ? 165 ASP B OD2 1 
ATOM 6992  N N   . PHE B 2 166 ? 44.92585  -18.17697 19.94830   1.000 69.20115  ? 166 PHE B N   1 
ATOM 6993  C CA  . PHE B 2 166 ? 46.12975  -18.95794 19.68365   1.000 60.07506  ? 166 PHE B CA  1 
ATOM 6994  C C   . PHE B 2 166 ? 46.43160  -19.89677 20.84528   1.000 63.28786  ? 166 PHE B C   1 
ATOM 6995  O O   . PHE B 2 166 ? 46.87961  -21.03279 20.64203   1.000 76.84850  ? 166 PHE B O   1 
ATOM 6996  C CB  . PHE B 2 166 ? 47.31013  -18.02305 19.41855   1.000 65.26619  ? 166 PHE B CB  1 
ATOM 6997  C CG  . PHE B 2 166 ? 48.62005  -18.73471 19.23195   1.000 82.55712  ? 166 PHE B CG  1 
ATOM 6998  C CD1 . PHE B 2 166 ? 48.93674  -19.32243 18.01873   1.000 72.04581  ? 166 PHE B CD1 1 
ATOM 6999  C CD2 . PHE B 2 166 ? 49.53871  -18.80890 20.26773   1.000 86.96496  ? 166 PHE B CD2 1 
ATOM 7000  C CE1 . PHE B 2 166 ? 50.14098  -19.97626 17.84261   1.000 56.27342  ? 166 PHE B CE1 1 
ATOM 7001  C CE2 . PHE B 2 166 ? 50.74519  -19.46156 20.09774   1.000 69.06014  ? 166 PHE B CE2 1 
ATOM 7002  C CZ  . PHE B 2 166 ? 51.04624  -20.04577 18.88310   1.000 58.97532  ? 166 PHE B CZ  1 
ATOM 7003  N N   . LEU B 2 167 ? 46.18453  -19.43992 22.07425   1.000 63.32075  ? 167 LEU B N   1 
ATOM 7004  C CA  . LEU B 2 167 ? 46.36889  -20.30844 23.23216   1.000 61.20792  ? 167 LEU B CA  1 
ATOM 7005  C C   . LEU B 2 167 ? 45.36004  -21.45290 23.22713   1.000 63.73868  ? 167 LEU B C   1 
ATOM 7006  O O   . LEU B 2 167 ? 45.68241  -22.57383 23.63323   1.000 63.06324  ? 167 LEU B O   1 
ATOM 7007  C CB  . LEU B 2 167 ? 46.26242  -19.49192 24.51946   1.000 57.84874  ? 167 LEU B CB  1 
ATOM 7008  C CG  . LEU B 2 167 ? 47.29990  -18.37375 24.66137   1.000 53.54815  ? 167 LEU B CG  1 
ATOM 7009  C CD1 . LEU B 2 167 ? 47.19542  -17.68173 26.01437   1.000 52.06763  ? 167 LEU B CD1 1 
ATOM 7010  C CD2 . LEU B 2 167 ? 48.70753  -18.89953 24.42471   1.000 52.84943  ? 167 LEU B CD2 1 
ATOM 7011  N N   . LYS B 2 168 ? 44.13440  -21.18926 22.76796   1.000 69.77160  ? 168 LYS B N   1 
ATOM 7012  C CA  . LYS B 2 168 ? 43.14889  -22.25893 22.62250   1.000 71.77567  ? 168 LYS B CA  1 
ATOM 7013  C C   . LYS B 2 168 ? 43.59708  -23.27712 21.57979   1.000 86.10637  ? 168 LYS B C   1 
ATOM 7014  O O   . LYS B 2 168 ? 43.40312  -24.48901 21.75247   1.000 97.87403  ? 168 LYS B O   1 
ATOM 7015  C CB  . LYS B 2 168 ? 41.79130  -21.67215 22.23431   1.000 59.53646  ? 168 LYS B CB  1 
ATOM 7016  C CG  . LYS B 2 168 ? 41.13515  -20.81147 23.29862   1.000 56.34284  ? 168 LYS B CG  1 
ATOM 7017  C CD  . LYS B 2 168 ? 39.80224  -20.27128 22.80201   1.000 68.80898  ? 168 LYS B CD  1 
ATOM 7018  C CE  . LYS B 2 168 ? 39.13241  -19.38464 23.83835   1.000 86.34237  ? 168 LYS B CE  1 
ATOM 7019  N NZ  . LYS B 2 168 ? 37.83891  -18.83934 23.33945   1.000 103.86253 ? 168 LYS B NZ  1 
ATOM 7020  N N   . ASP B 2 169 ? 44.19350  -22.79820 20.48523   1.000 67.05797  ? 169 ASP B N   1 
ATOM 7021  C CA  . ASP B 2 169 ? 44.76317  -23.70443 19.49144   1.000 83.87168  ? 169 ASP B CA  1 
ATOM 7022  C C   . ASP B 2 169 ? 45.86204  -24.56333 20.10420   1.000 70.75558  ? 169 ASP B C   1 
ATOM 7023  O O   . ASP B 2 169 ? 45.91597  -25.77831 19.88020   1.000 90.63288  ? 169 ASP B O   1 
ATOM 7024  C CB  . ASP B 2 169 ? 45.30926  -22.91258 18.30245   1.000 103.79304 ? 169 ASP B CB  1 
ATOM 7025  C CG  . ASP B 2 169 ? 44.26904  -22.67677 17.23069   1.000 110.10411 ? 169 ASP B CG  1 
ATOM 7026  O OD1 . ASP B 2 169 ? 43.31498  -23.47728 17.14210   1.000 113.88699 ? 169 ASP B OD1 1 
ATOM 7027  O OD2 . ASP B 2 169 ? 44.40992  -21.69542 16.47134   1.000 108.54303 ? 169 ASP B OD2 1 
ATOM 7028  N N   . VAL B 2 170 ? 46.75134  -23.94050 20.88104   1.000 63.93641  ? 170 VAL B N   1 
ATOM 7029  C CA  . VAL B 2 170 ? 47.80311  -24.68632 21.57046   1.000 63.15720  ? 170 VAL B CA  1 
ATOM 7030  C C   . VAL B 2 170 ? 47.19916  -25.73830 22.49440   1.000 67.67831  ? 170 VAL B C   1 
ATOM 7031  O O   . VAL B 2 170 ? 47.69156  -26.87096 22.57855   1.000 71.14030  ? 170 VAL B O   1 
ATOM 7032  C CB  . VAL B 2 170 ? 48.72305  -23.71799 22.33763   1.000 60.89340  ? 170 VAL B CB  1 
ATOM 7033  C CG1 . VAL B 2 170 ? 49.54816  -24.46745 23.37063   1.000 60.39705  ? 170 VAL B CG1 1 
ATOM 7034  C CG2 . VAL B 2 170 ? 49.62446  -22.96723 21.36973   1.000 61.14712  ? 170 VAL B CG2 1 
ATOM 7035  N N   . MET B 2 171 ? 46.11863  -25.38373 23.19323   1.000 84.13671  ? 171 MET B N   1 
ATOM 7036  C CA  . MET B 2 171 ? 45.46441  -26.33060 24.09179   1.000 84.98535  ? 171 MET B CA  1 
ATOM 7037  C C   . MET B 2 171 ? 44.93483  -27.53389 23.32763   1.000 68.86621  ? 171 MET B C   1 
ATOM 7038  O O   . MET B 2 171 ? 45.20336  -28.68527 23.69018   1.000 58.56968  ? 171 MET B O   1 
ATOM 7039  C CB  . MET B 2 171 ? 44.32478  -25.64439 24.84416   1.000 91.38396  ? 171 MET B CB  1 
ATOM 7040  C CG  . MET B 2 171 ? 44.78562  -24.65856 25.88095   1.000 96.21646  ? 171 MET B CG  1 
ATOM 7041  S SD  . MET B 2 171 ? 45.75746  -25.46003 27.15996   1.000 109.95111 ? 171 MET B SD  1 
ATOM 7042  C CE  . MET B 2 171 ? 46.63230  -24.04546 27.80152   1.000 105.42699 ? 171 MET B CE  1 
ATOM 7043  N N   . GLU B 2 172 ? 44.17961  -27.28315 22.25847   1.000 84.23579  ? 172 GLU B N   1 
ATOM 7044  C CA  . GLU B 2 172 ? 43.58379  -28.38111 21.50835   1.000 94.50717  ? 172 GLU B CA  1 
ATOM 7045  C C   . GLU B 2 172 ? 44.61868  -29.17768 20.72421   1.000 101.98615 ? 172 GLU B C   1 
ATOM 7046  O O   . GLU B 2 172 ? 44.32890  -30.30877 20.31959   1.000 127.42787 ? 172 GLU B O   1 
ATOM 7047  C CB  . GLU B 2 172 ? 42.48949  -27.85714 20.57915   1.000 91.42183  ? 172 GLU B CB  1 
ATOM 7048  C CG  . GLU B 2 172 ? 41.35571  -27.16999 21.32301   1.000 96.33685  ? 172 GLU B CG  1 
ATOM 7049  C CD  . GLU B 2 172 ? 40.21209  -26.77377 20.41542   1.000 127.64264 ? 172 GLU B CD  1 
ATOM 7050  O OE1 . GLU B 2 172 ? 40.24632  -27.13620 19.22124   1.000 143.86646 ? 172 GLU B OE1 1 
ATOM 7051  O OE2 . GLU B 2 172 ? 39.27423  -26.10607 20.89947   1.000 141.50322 ? 172 GLU B OE2 1 
ATOM 7052  N N   . SER B 2 173 ? 45.81059  -28.61772 20.49609   1.000 98.03980  ? 173 SER B N   1 
ATOM 7053  C CA  . SER B 2 173 ? 46.83632  -29.35531 19.76406   1.000 67.62544  ? 173 SER B CA  1 
ATOM 7054  C C   . SER B 2 173 ? 47.30622  -30.57402 20.54735   1.000 70.95441  ? 173 SER B C   1 
ATOM 7055  O O   . SER B 2 173 ? 47.53991  -31.64022 19.96594   1.000 77.31712  ? 173 SER B O   1 
ATOM 7056  C CB  . SER B 2 173 ? 48.01885  -28.44046 19.44865   1.000 64.71969  ? 173 SER B CB  1 
ATOM 7057  O OG  . SER B 2 173 ? 48.70529  -28.06677 20.63096   1.000 76.77093  ? 173 SER B OG  1 
ATOM 7058  N N   . MET B 2 174 ? 47.45295  -30.43714 21.86637   1.000 72.50065  ? 174 MET B N   1 
ATOM 7059  C CA  . MET B 2 174 ? 47.91511  -31.54914 22.68641   1.000 80.15314  ? 174 MET B CA  1 
ATOM 7060  C C   . MET B 2 174 ? 46.87506  -32.65351 22.81742   1.000 106.17066 ? 174 MET B C   1 
ATOM 7061  O O   . MET B 2 174 ? 47.20193  -33.73022 23.32806   1.000 104.89959 ? 174 MET B O   1 
ATOM 7062  C CB  . MET B 2 174 ? 48.31598  -31.04301 24.07359   1.000 72.27321  ? 174 MET B CB  1 
ATOM 7063  C CG  . MET B 2 174 ? 49.43408  -30.01132 24.05366   1.000 79.51813  ? 174 MET B CG  1 
ATOM 7064  S SD  . MET B 2 174 ? 49.80180  -29.33555 25.68393   1.000 89.19475  ? 174 MET B SD  1 
ATOM 7065  C CE  . MET B 2 174 ? 51.11644  -28.18734 25.28235   1.000 88.66508  ? 174 MET B CE  1 
ATOM 7066  N N   . ASP B 2 175 ? 45.64215  -32.41683 22.36864   1.000 109.04202 ? 175 ASP B N   1 
ATOM 7067  C CA  . ASP B 2 175 ? 44.59700  -33.43038 22.40334   1.000 109.30753 ? 175 ASP B CA  1 
ATOM 7068  C C   . ASP B 2 175 ? 44.55749  -34.28540 21.14465   1.000 97.77144  ? 175 ASP B C   1 
ATOM 7069  O O   . ASP B 2 175 ? 43.94080  -35.35689 21.15880   1.000 87.92054  ? 175 ASP B O   1 
ATOM 7070  C CB  . ASP B 2 175 ? 43.23064  -32.76968 22.61266   1.000 114.32411 ? 175 ASP B CB  1 
ATOM 7071  C CG  . ASP B 2 175 ? 43.18900  -31.89841 23.85340   1.000 107.73872 ? 175 ASP B CG  1 
ATOM 7072  O OD1 . ASP B 2 175 ? 44.19895  -31.85873 24.58731   1.000 105.32789 ? 175 ASP B OD1 1 
ATOM 7073  O OD2 . ASP B 2 175 ? 42.14793  -31.25112 24.09289   1.000 103.06503 ? 175 ASP B OD2 1 
ATOM 7074  N N   . LYS B 2 176 ? 45.19422  -33.83710 20.06532   1.000 113.35606 ? 176 LYS B N   1 
ATOM 7075  C CA  . LYS B 2 176 ? 45.20471  -34.57668 18.81069   1.000 116.19410 ? 176 LYS B CA  1 
ATOM 7076  C C   . LYS B 2 176 ? 46.26709  -35.66636 18.86419   1.000 105.94635 ? 176 LYS B C   1 
ATOM 7077  O O   . LYS B 2 176 ? 47.34724  -35.47055 19.42865   1.000 77.01636  ? 176 LYS B O   1 
ATOM 7078  C CB  . LYS B 2 176 ? 45.45212  -33.63312 17.63409   1.000 115.57775 ? 176 LYS B CB  1 
ATOM 7079  C CG  . LYS B 2 176 ? 44.28890  -32.68235 17.37593   1.000 111.21185 ? 176 LYS B CG  1 
ATOM 7080  C CD  . LYS B 2 176 ? 44.48071  -31.84865 16.11718   1.000 107.60874 ? 176 LYS B CD  1 
ATOM 7081  C CE  . LYS B 2 176 ? 43.87995  -32.52596 14.89376   1.000 113.32865 ? 176 LYS B CE  1 
ATOM 7082  N NZ  . LYS B 2 176 ? 44.58670  -33.77640 14.51118   1.000 123.23015 ? 176 LYS B NZ  1 
ATOM 7083  N N   . GLU B 2 177 ? 45.95373  -36.82513 18.27623   1.000 127.57811 ? 177 GLU B N   1 
ATOM 7084  C CA  . GLU B 2 177 ? 46.84016  -37.97522 18.42684   1.000 123.48238 ? 177 GLU B CA  1 
ATOM 7085  C C   . GLU B 2 177 ? 48.13515  -37.80841 17.63773   1.000 110.44572 ? 177 GLU B C   1 
ATOM 7086  O O   . GLU B 2 177 ? 49.19363  -38.27070 18.07726   1.000 109.11256 ? 177 GLU B O   1 
ATOM 7087  C CB  . GLU B 2 177 ? 46.12659  -39.25180 17.97204   1.000 128.63114 ? 177 GLU B CB  1 
ATOM 7088  C CG  . GLU B 2 177 ? 44.92418  -39.68039 18.80873   1.000 123.12705 ? 177 GLU B CG  1 
ATOM 7089  C CD  . GLU B 2 177 ? 43.68639  -38.83784 18.53656   1.000 108.58368 ? 177 GLU B CD  1 
ATOM 7090  O OE1 . GLU B 2 177 ? 43.57994  -38.27668 17.42381   1.000 101.64664 ? 177 GLU B OE1 1 
ATOM 7091  O OE2 . GLU B 2 177 ? 42.81574  -38.74667 19.42801   1.000 100.35514 ? 177 GLU B OE2 1 
ATOM 7092  N N   . GLU B 2 178 ? 48.07913  -37.17171 16.46925   1.000 99.05563  ? 178 GLU B N   1 
ATOM 7093  C CA  . GLU B 2 178 ? 49.25453  -37.06204 15.61531   1.000 94.47523  ? 178 GLU B CA  1 
ATOM 7094  C C   . GLU B 2 178 ? 49.29921  -35.68547 14.96429   1.000 93.04590  ? 178 GLU B C   1 
ATOM 7095  O O   . GLU B 2 178 ? 48.26405  -35.13909 14.57276   1.000 110.74855 ? 178 GLU B O   1 
ATOM 7096  C CB  . GLU B 2 178 ? 49.30922  -38.19989 14.58179   1.000 100.46134 ? 178 GLU B CB  1 
ATOM 7097  C CG  . GLU B 2 178 ? 48.88018  -37.88277 13.16922   1.000 108.97011 ? 178 GLU B CG  1 
ATOM 7098  C CD  . GLU B 2 178 ? 49.09706  -39.07189 12.25034   1.000 118.97507 ? 178 GLU B CD  1 
ATOM 7099  O OE1 . GLU B 2 178 ? 48.61700  -39.04060 11.09892   1.000 129.49208 ? 178 GLU B OE1 1 
ATOM 7100  O OE2 . GLU B 2 178 ? 49.75668  -40.04115 12.68561   1.000 113.05536 ? 178 GLU B OE2 1 
ATOM 7101  N N   . MET B 2 179 ? 50.50331  -35.12428 14.86608   1.000 79.64735  ? 179 MET B N   1 
ATOM 7102  C CA  . MET B 2 179 ? 50.73704  -33.80189 14.29366   1.000 73.44470  ? 179 MET B CA  1 
ATOM 7103  C C   . MET B 2 179 ? 51.70624  -33.95899 13.12763   1.000 89.96168  ? 179 MET B C   1 
ATOM 7104  O O   . MET B 2 179 ? 52.86357  -34.34503 13.31994   1.000 98.74216  ? 179 MET B O   1 
ATOM 7105  C CB  . MET B 2 179 ? 51.29934  -32.84511 15.34533   1.000 64.52085  ? 179 MET B CB  1 
ATOM 7106  C CG  . MET B 2 179 ? 51.11920  -31.36632 15.02975   1.000 62.82539  ? 179 MET B CG  1 
ATOM 7107  S SD  . MET B 2 179 ? 49.41307  -30.89557 14.68723   1.000 62.14333  ? 179 MET B SD  1 
ATOM 7108  C CE  . MET B 2 179 ? 49.07296  -29.83904 16.09347   1.000 58.71150  ? 179 MET B CE  1 
ATOM 7109  N N   . GLU B 2 180 ? 51.22394  -33.70152 11.91519   1.000 88.68818  ? 180 GLU B N   1 
ATOM 7110  C CA  . GLU B 2 180 ? 52.02443  -33.87002 10.70942   1.000 83.70534  ? 180 GLU B CA  1 
ATOM 7111  C C   . GLU B 2 180 ? 52.68033  -32.54818 10.32959   1.000 71.00121  ? 180 GLU B C   1 
ATOM 7112  O O   . GLU B 2 180 ? 52.01399  -31.50884 10.29103   1.000 68.41625  ? 180 GLU B O   1 
ATOM 7113  C CB  . GLU B 2 180 ? 51.14010  -34.37630 9.56878    1.000 94.46395  ? 180 GLU B CB  1 
ATOM 7114  C CG  . GLU B 2 180 ? 51.57999  -33.95550 8.18038    1.000 109.92875 ? 180 GLU B CG  1 
ATOM 7115  C CD  . GLU B 2 180 ? 50.62728  -34.43964 7.10641    1.000 136.56011 ? 180 GLU B CD  1 
ATOM 7116  O OE1 . GLU B 2 180 ? 50.24203  -35.62785 7.14254    1.000 148.03460 ? 180 GLU B OE1 1 
ATOM 7117  O OE2 . GLU B 2 180 ? 50.25621  -33.63017 6.23137    1.000 144.73152 ? 180 GLU B OE2 1 
ATOM 7118  N N   . ILE B 2 181 ? 53.98363  -32.58755 10.05159   1.000 74.68415  ? 181 ILE B N   1 
ATOM 7119  C CA  . ILE B 2 181 ? 54.76184  -31.39522 9.73556    1.000 70.82864  ? 181 ILE B CA  1 
ATOM 7120  C C   . ILE B 2 181 ? 55.18593  -31.46962 8.27481    1.000 79.32964  ? 181 ILE B C   1 
ATOM 7121  O O   . ILE B 2 181 ? 55.81826  -32.44682 7.84882    1.000 82.89413  ? 181 ILE B O   1 
ATOM 7122  C CB  . ILE B 2 181 ? 55.98047  -31.25487 10.66072   1.000 68.38698  ? 181 ILE B CB  1 
ATOM 7123  C CG1 . ILE B 2 181 ? 55.53757  -30.81296 12.05692   1.000 66.44392  ? 181 ILE B CG1 1 
ATOM 7124  C CG2 . ILE B 2 181 ? 56.98658  -30.27385 10.08125   1.000 67.28131  ? 181 ILE B CG2 1 
ATOM 7125  C CD1 . ILE B 2 181 ? 56.68196  -30.62188 13.03151   1.000 73.32969  ? 181 ILE B CD1 1 
ATOM 7126  N N   . THR B 2 182 ? 54.82209  -30.44424 7.50955    1.000 81.08232  ? 182 THR B N   1 
ATOM 7127  C CA  . THR B 2 182 ? 55.16041  -30.33907 6.09824    1.000 77.02376  ? 182 THR B CA  1 
ATOM 7128  C C   . THR B 2 182 ? 56.33620  -29.38759 5.92337    1.000 93.71020  ? 182 THR B C   1 
ATOM 7129  O O   . THR B 2 182 ? 56.45500  -28.39463 6.64691    1.000 122.88183 ? 182 THR B O   1 
ATOM 7130  C CB  . THR B 2 182 ? 53.96108  -29.85314 5.28022    1.000 75.85619  ? 182 THR B CB  1 
ATOM 7131  O OG1 . THR B 2 182 ? 53.61459  -28.52221 5.68078    1.000 81.74256  ? 182 THR B OG1 1 
ATOM 7132  C CG2 . THR B 2 182 ? 52.76503  -30.76828 5.49351    1.000 74.66729  ? 182 THR B CG2 1 
ATOM 7133  N N   . THR B 2 183 ? 57.20210  -29.69338 4.96278    1.000 72.86718  ? 183 THR B N   1 
ATOM 7134  C CA  . THR B 2 183 ? 58.35065  -28.83735 4.67820    1.000 72.74464  ? 183 THR B CA  1 
ATOM 7135  C C   . THR B 2 183 ? 58.39956  -28.44735 3.20482    1.000 75.37827  ? 183 THR B C   1 
ATOM 7136  O O   . THR B 2 183 ? 58.96088  -27.41155 2.84624    1.000 75.39926  ? 183 THR B O   1 
ATOM 7137  C CB  . THR B 2 183 ? 59.67940  -29.51869 5.05943    1.000 73.17934  ? 183 THR B CB  1 
ATOM 7138  O OG1 . THR B 2 183 ? 59.80605  -30.75656 4.34910    1.000 88.35124  ? 183 THR B OG1 1 
ATOM 7139  C CG2 . THR B 2 183 ? 59.74071  -29.78242 6.55794    1.000 70.67613  ? 183 THR B CG2 1 
ATOM 7140  N N   . LYS B 2 209 ? 57.27597  -33.90948 3.78330    1.000 79.68134  ? 209 LYS B N   1 
ATOM 7141  C CA  . LYS B 2 209 ? 56.44151  -33.88216 4.97897    1.000 85.26303  ? 209 LYS B CA  1 
ATOM 7142  C C   . LYS B 2 209 ? 56.49618  -35.22552 5.69847    1.000 90.32586  ? 209 LYS B C   1 
ATOM 7143  O O   . LYS B 2 209 ? 56.55902  -36.27706 5.05763    1.000 88.86225  ? 209 LYS B O   1 
ATOM 7144  C CB  . LYS B 2 209 ? 54.99591  -33.51942 4.61563    1.000 81.89481  ? 209 LYS B CB  1 
ATOM 7145  C CG  . LYS B 2 209 ? 54.01631  -34.68426 4.57996    1.000 92.49983  ? 209 LYS B CG  1 
ATOM 7146  C CD  . LYS B 2 209 ? 52.66801  -34.25106 4.02899    1.000 100.74821 ? 209 LYS B CD  1 
ATOM 7147  C CE  . LYS B 2 209 ? 52.75306  -33.94306 2.54247    1.000 106.00576 ? 209 LYS B CE  1 
ATOM 7148  N NZ  . LYS B 2 209 ? 51.46881  -33.40695 2.01372    1.000 104.94203 ? 209 LYS B NZ  1 
ATOM 7149  N N   . GLN B 2 210 ? 56.49510  -35.19081 7.03093    1.000 86.66949  ? 210 GLN B N   1 
ATOM 7150  C CA  . GLN B 2 210 ? 56.48093  -36.41157 7.82561    1.000 111.66887 ? 210 GLN B CA  1 
ATOM 7151  C C   . GLN B 2 210 ? 55.66788  -36.18126 9.09249    1.000 107.49180 ? 210 GLN B C   1 
ATOM 7152  O O   . GLN B 2 210 ? 55.43326  -35.04549 9.51063    1.000 108.68763 ? 210 GLN B O   1 
ATOM 7153  C CB  . GLN B 2 210 ? 57.89964  -36.89459 8.17821    1.000 133.18875 ? 210 GLN B CB  1 
ATOM 7154  C CG  . GLN B 2 210 ? 58.77418  -37.22107 6.96889    1.000 147.51501 ? 210 GLN B CG  1 
ATOM 7155  C CD  . GLN B 2 210 ? 59.36854  -38.61681 7.02791    1.000 137.21690 ? 210 GLN B CD  1 
ATOM 7156  O OE1 . GLN B 2 210 ? 60.56443  -38.78881 7.26533    1.000 130.54884 ? 210 GLN B OE1 1 
ATOM 7157  N NE2 . GLN B 2 210 ? 58.53163  -39.62300 6.80386    1.000 126.02656 ? 210 GLN B NE2 1 
ATOM 7158  N N   . ARG B 2 211 ? 55.23471  -37.28147 9.69772    1.000 109.90535 ? 211 ARG B N   1 
ATOM 7159  C CA  . ARG B 2 211 ? 54.36642  -37.23698 10.86291   1.000 105.23832 ? 211 ARG B CA  1 
ATOM 7160  C C   . ARG B 2 211 ? 55.17993  -37.19955 12.15282   1.000 123.76097 ? 211 ARG B C   1 
ATOM 7161  O O   . ARG B 2 211 ? 56.34075  -37.61325 12.20106   1.000 138.58584 ? 211 ARG B O   1 
ATOM 7162  C CB  . ARG B 2 211 ? 53.43140  -38.44814 10.87922   1.000 92.49064  ? 211 ARG B CB  1 
ATOM 7163  C CG  . ARG B 2 211 ? 54.02485  -39.69296 10.23473   1.000 95.85062  ? 211 ARG B CG  1 
ATOM 7164  C CD  . ARG B 2 211 ? 53.45059  -40.96696 10.83703   1.000 108.39914 ? 211 ARG B CD  1 
ATOM 7165  N NE  . ARG B 2 211 ? 53.55272  -42.10115 9.92252    1.000 121.25856 ? 211 ARG B NE  1 
ATOM 7166  C CZ  . ARG B 2 211 ? 53.51855  -43.37406 10.30458   1.000 115.82952 ? 211 ARG B CZ  1 
ATOM 7167  N NH1 . ARG B 2 211 ? 53.61904  -44.34337 9.40486    1.000 111.08058 ? 211 ARG B NH1 1 
ATOM 7168  N NH2 . ARG B 2 211 ? 53.38927  -43.67904 11.58854   1.000 110.95678 ? 211 ARG B NH2 1 
ATOM 7169  N N   . VAL B 2 212 ? 54.54812  -36.68846 13.20849   1.000 120.91765 ? 212 VAL B N   1 
ATOM 7170  C CA  . VAL B 2 212 ? 55.03860  -36.80152 14.57304   1.000 102.20917 ? 212 VAL B CA  1 
ATOM 7171  C C   . VAL B 2 212 ? 53.86849  -37.28341 15.41507   1.000 109.23540 ? 212 VAL B C   1 
ATOM 7172  O O   . VAL B 2 212 ? 52.71520  -36.93211 15.14472   1.000 130.45355 ? 212 VAL B O   1 
ATOM 7173  C CB  . VAL B 2 212 ? 55.58933  -35.46205 15.11379   1.000 75.52561  ? 212 VAL B CB  1 
ATOM 7174  C CG1 . VAL B 2 212 ? 56.43103  -35.69260 16.36213   1.000 74.40819  ? 212 VAL B CG1 1 
ATOM 7175  C CG2 . VAL B 2 212 ? 56.39382  -34.73069 14.04607   1.000 76.16940  ? 212 VAL B CG2 1 
ATOM 7176  N N   . ASN B 2 213 ? 54.15267  -38.10618 16.41592   1.000 96.75900  ? 213 ASN B N   1 
ATOM 7177  C CA  . ASN B 2 213 ? 53.08660  -38.61190 17.26065   1.000 91.14429  ? 213 ASN B CA  1 
ATOM 7178  C C   . ASN B 2 213 ? 52.87082  -37.67122 18.44559   1.000 92.47961  ? 213 ASN B C   1 
ATOM 7179  O O   . ASN B 2 213 ? 53.54152  -36.64620 18.59118   1.000 102.12545 ? 213 ASN B O   1 
ATOM 7180  C CB  . ASN B 2 213 ? 53.39921  -40.03920 17.70885   1.000 95.64021  ? 213 ASN B CB  1 
ATOM 7181  C CG  . ASN B 2 213 ? 54.75045  -40.15785 18.38734   1.000 95.91093  ? 213 ASN B CG  1 
ATOM 7182  O OD1 . ASN B 2 213 ? 55.64374  -39.33738 18.17199   1.000 96.86435  ? 213 ASN B OD1 1 
ATOM 7183  N ND2 . ASN B 2 213 ? 54.90710  -41.18695 19.21191   1.000 98.91614  ? 213 ASN B ND2 1 
ATOM 7184  N N   . LYS B 2 214 ? 51.91838  -38.02816 19.31001   1.000 93.31027  ? 214 LYS B N   1 
ATOM 7185  C CA  . LYS B 2 214 ? 51.50602  -37.11622 20.37280   1.000 88.18341  ? 214 LYS B CA  1 
ATOM 7186  C C   . LYS B 2 214 ? 52.57828  -36.99803 21.44767   1.000 89.60246  ? 214 LYS B C   1 
ATOM 7187  O O   . LYS B 2 214 ? 52.79399  -35.91343 21.99874   1.000 100.14872 ? 214 LYS B O   1 
ATOM 7188  C CB  . LYS B 2 214 ? 50.17921  -37.57361 20.97778   1.000 97.19364  ? 214 LYS B CB  1 
ATOM 7189  C CG  . LYS B 2 214 ? 49.60888  -36.61771 22.01434   1.000 93.05116  ? 214 LYS B CG  1 
ATOM 7190  C CD  . LYS B 2 214 ? 48.36365  -37.18952 22.67266   1.000 84.59220  ? 214 LYS B CD  1 
ATOM 7191  C CE  . LYS B 2 214 ? 48.71659  -38.19493 23.75593   1.000 88.22220  ? 214 LYS B CE  1 
ATOM 7192  N NZ  . LYS B 2 214 ? 47.51662  -38.59801 24.54063   1.000 90.65087  ? 214 LYS B NZ  1 
ATOM 7193  N N   . ARG B 2 215 ? 53.24572  -38.10687 21.77130   1.000 84.95980  ? 215 ARG B N   1 
ATOM 7194  C CA  . ARG B 2 215 ? 54.23456  -38.09943 22.84505   1.000 85.85608  ? 215 ARG B CA  1 
ATOM 7195  C C   . ARG B 2 215 ? 55.40423  -37.18039 22.50990   1.000 79.90456  ? 215 ARG B C   1 
ATOM 7196  O O   . ARG B 2 215 ? 55.77294  -36.30528 23.30460   1.000 81.16232  ? 215 ARG B O   1 
ATOM 7197  C CB  . ARG B 2 215 ? 54.72222  -39.52452 23.10437   1.000 90.66445  ? 215 ARG B CB  1 
ATOM 7198  C CG  . ARG B 2 215 ? 55.64785  -39.66644 24.29553   1.000 100.43472 ? 215 ARG B CG  1 
ATOM 7199  C CD  . ARG B 2 215 ? 56.32890  -41.02361 24.28506   1.000 113.68048 ? 215 ARG B CD  1 
ATOM 7200  N NE  . ARG B 2 215 ? 57.28582  -41.16453 25.37733   1.000 124.68737 ? 215 ARG B NE  1 
ATOM 7201  C CZ  . ARG B 2 215 ? 58.11139  -42.19607 25.51844   1.000 127.62723 ? 215 ARG B CZ  1 
ATOM 7202  N NH1 . ARG B 2 215 ? 58.09997  -43.18410 24.63395   1.000 134.62631 ? 215 ARG B NH1 1 
ATOM 7203  N NH2 . ARG B 2 215 ? 58.95015  -42.23946 26.54406   1.000 124.72280 ? 215 ARG B NH2 1 
ATOM 7204  N N   . SER B 2 216 ? 56.00802  -37.37086 21.33400   1.000 73.10875  ? 216 SER B N   1 
ATOM 7205  C CA  . SER B 2 216 ? 57.12145  -36.51701 20.93760   1.000 83.09197  ? 216 SER B CA  1 
ATOM 7206  C C   . SER B 2 216 ? 56.68011  -35.07039 20.76003   1.000 81.20214  ? 216 SER B C   1 
ATOM 7207  O O   . SER B 2 216 ? 57.46677  -34.14826 21.00334   1.000 111.50895 ? 216 SER B O   1 
ATOM 7208  C CB  . SER B 2 216 ? 57.75683  -37.04300 19.65069   1.000 89.45569  ? 216 SER B CB  1 
ATOM 7209  O OG  . SER B 2 216 ? 58.93770  -36.32444 19.33942   1.000 78.58364  ? 216 SER B OG  1 
ATOM 7210  N N   . TYR B 2 217 ? 55.42746  -34.84685 20.35443   1.000 65.91880  ? 217 TYR B N   1 
ATOM 7211  C CA  . TYR B 2 217 ? 54.92435  -33.47944 20.28010   1.000 63.46618  ? 217 TYR B CA  1 
ATOM 7212  C C   . TYR B 2 217 ? 54.85298  -32.84306 21.66220   1.000 61.58268  ? 217 TYR B C   1 
ATOM 7213  O O   . TYR B 2 217 ? 55.20611  -31.67165 21.82620   1.000 63.78573  ? 217 TYR B O   1 
ATOM 7214  C CB  . TYR B 2 217 ? 53.55528  -33.43077 19.60551   1.000 64.80604  ? 217 TYR B CB  1 
ATOM 7215  C CG  . TYR B 2 217 ? 52.90650  -32.06917 19.73589   1.000 67.61190  ? 217 TYR B CG  1 
ATOM 7216  C CD1 . TYR B 2 217 ? 53.31328  -31.00959 18.93323   1.000 60.67618  ? 217 TYR B CD1 1 
ATOM 7217  C CD2 . TYR B 2 217 ? 51.89922  -31.83758 20.66545   1.000 75.51106  ? 217 TYR B CD2 1 
ATOM 7218  C CE1 . TYR B 2 217 ? 52.73563  -29.75937 19.04960   1.000 58.94834  ? 217 TYR B CE1 1 
ATOM 7219  C CE2 . TYR B 2 217 ? 51.31408  -30.58881 20.78853   1.000 73.07340  ? 217 TYR B CE2 1 
ATOM 7220  C CZ  . TYR B 2 217 ? 51.73647  -29.55460 19.97700   1.000 65.97029  ? 217 TYR B CZ  1 
ATOM 7221  O OH  . TYR B 2 217 ? 51.15982  -28.31080 20.09237   1.000 70.66059  ? 217 TYR B OH  1 
ATOM 7222  N N   . LEU B 2 218 ? 54.35244  -33.58133 22.65626   1.000 67.19748  ? 218 LEU B N   1 
ATOM 7223  C CA  . LEU B 2 218 ? 54.34903  -33.07369 24.02547   1.000 58.77302  ? 218 LEU B CA  1 
ATOM 7224  C C   . LEU B 2 218 ? 55.76370  -32.77765 24.49919   1.000 66.09295  ? 218 LEU B C   1 
ATOM 7225  O O   . LEU B 2 218 ? 55.99916  -31.78510 25.19875   1.000 63.64745  ? 218 LEU B O   1 
ATOM 7226  C CB  . LEU B 2 218 ? 53.67935  -34.07750 24.96317   1.000 58.87516  ? 218 LEU B CB  1 
ATOM 7227  C CG  . LEU B 2 218 ? 52.21922  -33.83916 25.34405   1.000 72.21763  ? 218 LEU B CG  1 
ATOM 7228  C CD1 . LEU B 2 218 ? 51.30390  -34.02881 24.14784   1.000 101.07540 ? 218 LEU B CD1 1 
ATOM 7229  C CD2 . LEU B 2 218 ? 51.81901  -34.76383 26.47793   1.000 65.54922  ? 218 LEU B CD2 1 
ATOM 7230  N N   . ILE B 2 219 ? 56.71526  -33.64190 24.14317   1.000 80.41267  ? 219 ILE B N   1 
ATOM 7231  C CA  . ILE B 2 219 ? 58.11066  -33.39344 24.49871   1.000 72.16585  ? 219 ILE B CA  1 
ATOM 7232  C C   . ILE B 2 219 ? 58.59825  -32.08956 23.87594   1.000 65.91920  ? 219 ILE B C   1 
ATOM 7233  O O   . ILE B 2 219 ? 59.26938  -31.28392 24.53159   1.000 63.46535  ? 219 ILE B O   1 
ATOM 7234  C CB  . ILE B 2 219 ? 58.99314  -34.58450 24.08218   1.000 70.32152  ? 219 ILE B CB  1 
ATOM 7235  C CG1 . ILE B 2 219 ? 58.50021  -35.87137 24.74582   1.000 68.32969  ? 219 ILE B CG1 1 
ATOM 7236  C CG2 . ILE B 2 219 ? 60.44620  -34.31807 24.44614   1.000 89.63254  ? 219 ILE B CG2 1 
ATOM 7237  C CD1 . ILE B 2 219 ? 59.19138  -37.12015 24.24861   1.000 73.41624  ? 219 ILE B CD1 1 
ATOM 7238  N N   . ARG B 2 220 ? 58.26416  -31.85924 22.60242   1.000 67.20572  ? 220 ARG B N   1 
ATOM 7239  C CA  . ARG B 2 220 ? 58.72917  -30.65548 21.91671   1.000 62.34072  ? 220 ARG B CA  1 
ATOM 7240  C C   . ARG B 2 220 ? 58.01556  -29.39710 22.40097   1.000 57.99212  ? 220 ARG B C   1 
ATOM 7241  O O   . ARG B 2 220 ? 58.58428  -28.30155 22.33603   1.000 58.06081  ? 220 ARG B O   1 
ATOM 7242  C CB  . ARG B 2 220 ? 58.54907  -30.80400 20.40686   1.000 70.45513  ? 220 ARG B CB  1 
ATOM 7243  C CG  . ARG B 2 220 ? 59.45468  -31.83662 19.75967   1.000 72.10753  ? 220 ARG B CG  1 
ATOM 7244  C CD  . ARG B 2 220 ? 59.35493  -31.75866 18.24483   1.000 77.02364  ? 220 ARG B CD  1 
ATOM 7245  N NE  . ARG B 2 220 ? 60.26186  -32.68735 17.57790   1.000 83.97549  ? 220 ARG B NE  1 
ATOM 7246  C CZ  . ARG B 2 220 ? 60.45077  -32.72871 16.26298   1.000 91.50657  ? 220 ARG B CZ  1 
ATOM 7247  N NH1 . ARG B 2 220 ? 59.79604  -31.89085 15.47022   1.000 87.10940  ? 220 ARG B NH1 1 
ATOM 7248  N NH2 . ARG B 2 220 ? 61.29654  -33.60549 15.73987   1.000 100.84241 ? 220 ARG B NH2 1 
ATOM 7249  N N   . ALA B 2 221 ? 56.77216  -29.52034 22.86022   1.000 67.10083  ? 221 ALA B N   1 
ATOM 7250  C CA  . ALA B 2 221 ? 56.06106  -28.35446 23.37070   1.000 69.08467  ? 221 ALA B CA  1 
ATOM 7251  C C   . ALA B 2 221 ? 56.57295  -27.94211 24.74312   1.000 67.27145  ? 221 ALA B C   1 
ATOM 7252  O O   . ALA B 2 221 ? 56.48591  -26.76472 25.10857   1.000 65.66693  ? 221 ALA B O   1 
ATOM 7253  C CB  . ALA B 2 221 ? 54.56140  -28.63599 23.42322   1.000 81.06292  ? 221 ALA B CB  1 
ATOM 7254  N N   . LEU B 2 222 ? 57.11027  -28.88970 25.50925   1.000 64.80500  ? 222 LEU B N   1 
ATOM 7255  C CA  . LEU B 2 222 ? 57.58651  -28.60570 26.85493   1.000 61.13041  ? 222 LEU B CA  1 
ATOM 7256  C C   . LEU B 2 222 ? 59.08769  -28.84103 26.94781   1.000 89.98888  ? 222 LEU B C   1 
ATOM 7257  O O   . LEU B 2 222 ? 59.55629  -29.55256 27.84279   1.000 124.95946 ? 222 LEU B O   1 
ATOM 7258  C CB  . LEU B 2 222 ? 56.85833  -29.48090 27.87501   1.000 59.16938  ? 222 LEU B CB  1 
ATOM 7259  C CG  . LEU B 2 222 ? 55.33026  -29.51319 27.85246   1.000 62.68265  ? 222 LEU B CG  1 
ATOM 7260  C CD1 . LEU B 2 222 ? 54.83668  -30.91149 28.19685   1.000 75.26710  ? 222 LEU B CD1 1 
ATOM 7261  C CD2 . LEU B 2 222 ? 54.75492  -28.49757 28.81637   1.000 55.69983  ? 222 LEU B CD2 1 
ATOM 7262  N N   . THR B 2 223 ? 59.84842  -28.25334 26.03178   1.000 73.81910  ? 223 THR B N   1 
ATOM 7263  C CA  . THR B 2 223 ? 61.29871  -28.35150 26.05590   1.000 65.57135  ? 223 THR B CA  1 
ATOM 7264  C C   . THR B 2 223 ? 61.89641  -26.97411 25.82436   1.000 65.02731  ? 223 THR B C   1 
ATOM 7265  O O   . THR B 2 223 ? 61.35238  -26.16534 25.06608   1.000 62.76802  ? 223 THR B O   1 
ATOM 7266  C CB  . THR B 2 223 ? 61.82793  -29.34696 25.01385   1.000 78.96226  ? 223 THR B CB  1 
ATOM 7267  O OG1 . THR B 2 223 ? 63.26058  -29.33181 25.01984   1.000 107.97325 ? 223 THR B OG1 1 
ATOM 7268  C CG2 . THR B 2 223 ? 61.33546  -28.98819 23.63424   1.000 65.40005  ? 223 THR B CG2 1 
ATOM 7269  N N   . LEU B 2 224 ? 63.00753  -26.71113 26.50155   1.000 68.66249  ? 224 LEU B N   1 
ATOM 7270  C CA  . LEU B 2 224 ? 63.65405  -25.41153 26.49092   1.000 70.53366  ? 224 LEU B CA  1 
ATOM 7271  C C   . LEU B 2 224 ? 65.08440  -25.56341 25.99214   1.000 76.41543  ? 224 LEU B C   1 
ATOM 7272  O O   . LEU B 2 224 ? 65.64311  -26.66338 25.96664   1.000 76.48777  ? 224 LEU B O   1 
ATOM 7273  C CB  . LEU B 2 224 ? 63.63617  -24.77164 27.88953   1.000 60.33931  ? 224 LEU B CB  1 
ATOM 7274  C CG  . LEU B 2 224 ? 62.36405  -24.05721 28.37513   1.000 56.36439  ? 224 LEU B CG  1 
ATOM 7275  C CD1 . LEU B 2 224 ? 61.13209  -24.95560 28.37888   1.000 63.48585  ? 224 LEU B CD1 1 
ATOM 7276  C CD2 . LEU B 2 224 ? 62.57693  -23.46819 29.76012   1.000 54.54610  ? 224 LEU B CD2 1 
ATOM 7277  N N   . ASN B 2 225 ? 65.67497  -24.44249 25.59041   1.000 89.20270  ? 225 ASN B N   1 
ATOM 7278  C CA  . ASN B 2 225 ? 67.00775  -24.43604 25.01131   1.000 97.50353  ? 225 ASN B CA  1 
ATOM 7279  C C   . ASN B 2 225 ? 67.85716  -23.37266 25.69482   1.000 100.22716 ? 225 ASN B C   1 
ATOM 7280  O O   . ASN B 2 225 ? 67.35808  -22.53010 26.44575   1.000 99.13032  ? 225 ASN B O   1 
ATOM 7281  C CB  . ASN B 2 225 ? 66.95082  -24.19601 23.49667   1.000 98.26124  ? 225 ASN B CB  1 
ATOM 7282  C CG  . ASN B 2 225 ? 68.15073  -24.76806 22.77218   1.000 109.17394 ? 225 ASN B CG  1 
ATOM 7283  O OD1 . ASN B 2 225 ? 69.06251  -25.31449 23.39280   1.000 123.80989 ? 225 ASN B OD1 1 
ATOM 7284  N ND2 . ASN B 2 225 ? 68.15085  -24.65717 21.44983   1.000 103.97284 ? 225 ASN B ND2 1 
ATOM 7285  N N   . THR B 2 226 ? 69.15780  -23.42544 25.42614   1.000 119.06008 ? 226 THR B N   1 
ATOM 7286  C CA  . THR B 2 226 ? 70.10897  -22.49658 26.02415   1.000 111.45788 ? 226 THR B CA  1 
ATOM 7287  C C   . THR B 2 226 ? 70.18862  -21.20043 25.22577   1.000 114.11293 ? 226 THR B C   1 
ATOM 7288  O O   . THR B 2 226 ? 70.06612  -20.10954 25.78230   1.000 114.49280 ? 226 THR B O   1 
ATOM 7289  C CB  . THR B 2 226 ? 71.51644  -23.11543 26.12054   1.000 107.51248 ? 226 THR B CB  1 
ATOM 7290  O OG1 . THR B 2 226 ? 71.88354  -23.67491 24.85290   1.000 104.81341 ? 226 THR B OG1 1 
ATOM 7291  C CG2 . THR B 2 226 ? 71.54983  -24.20475 27.18103   1.000 104.22144 ? 226 THR B CG2 1 
ATOM 7292  N N   . THR B 2 243 ? 65.79556  -19.84429 26.62042   1.000 43.23939  ? 243 THR B N   1 
ATOM 7293  C CA  . THR B 2 243 ? 65.08335  -19.88585 25.34727   1.000 69.77091  ? 243 THR B CA  1 
ATOM 7294  C C   . THR B 2 243 ? 63.83408  -20.75394 25.45249   1.000 84.20337  ? 243 THR B C   1 
ATOM 7295  O O   . THR B 2 243 ? 63.92193  -21.98194 25.46531   1.000 101.67376 ? 243 THR B O   1 
ATOM 7296  C CB  . THR B 2 243 ? 65.97771  -20.42134 24.21449   1.000 90.21107  ? 243 THR B CB  1 
ATOM 7297  O OG1 . THR B 2 243 ? 67.16946  -19.63036 24.12722   1.000 110.51178 ? 243 THR B OG1 1 
ATOM 7298  C CG2 . THR B 2 243 ? 65.24158  -20.36413 22.88575   1.000 87.46728  ? 243 THR B CG2 1 
ATOM 7299  N N   . PRO B 2 244 ? 62.67090  -20.11580 25.52254   1.000 90.33425  ? 244 PRO B N   1 
ATOM 7300  C CA  . PRO B 2 244 ? 61.42125  -20.85445 25.71817   1.000 83.05038  ? 244 PRO B CA  1 
ATOM 7301  C C   . PRO B 2 244 ? 60.86754  -21.38221 24.39971   1.000 72.94300  ? 244 PRO B C   1 
ATOM 7302  O O   . PRO B 2 244 ? 61.27586  -20.97982 23.30907   1.000 75.57315  ? 244 PRO B O   1 
ATOM 7303  C CB  . PRO B 2 244 ? 60.49593  -19.79665 26.31975   1.000 86.26399  ? 244 PRO B CB  1 
ATOM 7304  C CG  . PRO B 2 244 ? 60.94741  -18.52732 25.66019   1.000 86.61420  ? 244 PRO B CG  1 
ATOM 7305  C CD  . PRO B 2 244 ? 62.44497  -18.65999 25.46183   1.000 88.06748  ? 244 PRO B CD  1 
ATOM 7306  N N   . GLY B 2 245 ? 59.92426  -22.30966 24.52294   1.000 65.78684  ? 245 GLY B N   1 
ATOM 7307  C CA  . GLY B 2 245 ? 59.20600  -22.81527 23.37458   1.000 79.48457  ? 245 GLY B CA  1 
ATOM 7308  C C   . GLY B 2 245 ? 58.24108  -21.77653 22.83120   1.000 95.50666  ? 245 GLY B C   1 
ATOM 7309  O O   . GLY B 2 245 ? 58.09072  -20.67328 23.35717   1.000 102.22283 ? 245 GLY B O   1 
ATOM 7310  N N   . MET B 2 246 ? 57.56351  -22.14749 21.74414   1.000 87.22677  ? 246 MET B N   1 
ATOM 7311  C CA  . MET B 2 246 ? 56.63997  -21.20893 21.11692   1.000 85.12384  ? 246 MET B CA  1 
ATOM 7312  C C   . MET B 2 246 ? 55.28929  -21.17076 21.82194   1.000 92.06661  ? 246 MET B C   1 
ATOM 7313  O O   . MET B 2 246 ? 54.62835  -20.12664 21.82733   1.000 91.22380  ? 246 MET B O   1 
ATOM 7314  C CB  . MET B 2 246 ? 56.45255  -21.55961 19.64053   1.000 81.53432  ? 246 MET B CB  1 
ATOM 7315  C CG  . MET B 2 246 ? 55.77617  -20.46195 18.84780   1.000 82.48003  ? 246 MET B CG  1 
ATOM 7316  S SD  . MET B 2 246 ? 56.74718  -18.94394 18.90062   1.000 82.24453  ? 246 MET B SD  1 
ATOM 7317  C CE  . MET B 2 246 ? 55.45489  -17.71928 18.76281   1.000 52.17238  ? 246 MET B CE  1 
ATOM 7318  N N   . GLN B 2 247 ? 54.86755  -22.28383 22.42319   1.000 105.21261 ? 247 GLN B N   1 
ATOM 7319  C CA  . GLN B 2 247 ? 53.55457  -22.33873 23.05806   1.000 83.35114  ? 247 GLN B CA  1 
ATOM 7320  C C   . GLN B 2 247 ? 53.53104  -21.59765 24.39028   1.000 70.49488  ? 247 GLN B C   1 
ATOM 7321  O O   . GLN B 2 247 ? 52.55408  -20.90752 24.70157   1.000 65.65225  ? 247 GLN B O   1 
ATOM 7322  C CB  . GLN B 2 247 ? 53.12650  -23.79231 23.25721   1.000 79.98120  ? 247 GLN B CB  1 
ATOM 7323  C CG  . GLN B 2 247 ? 52.91355  -24.56882 21.96751   1.000 79.65632  ? 247 GLN B CG  1 
ATOM 7324  C CD  . GLN B 2 247 ? 54.17740  -25.23713 21.46763   1.000 71.13199  ? 247 GLN B CD  1 
ATOM 7325  O OE1 . GLN B 2 247 ? 55.21552  -25.20371 22.12811   1.000 72.05866  ? 247 GLN B OE1 1 
ATOM 7326  N NE2 . GLN B 2 247 ? 54.09116  -25.86423 20.30133   1.000 70.52370  ? 247 GLN B NE2 1 
ATOM 7327  N N   . ILE B 2 248 ? 54.59416  -21.72973 25.18722   1.000 70.61396  ? 248 ILE B N   1 
ATOM 7328  C CA  . ILE B 2 248 ? 54.60413  -21.20928 26.55062   1.000 68.87729  ? 248 ILE B CA  1 
ATOM 7329  C C   . ILE B 2 248 ? 54.70576  -19.69176 26.60950   1.000 84.51642  ? 248 ILE B C   1 
ATOM 7330  O O   . ILE B 2 248 ? 54.47971  -19.10384 27.67632   1.000 88.23962  ? 248 ILE B O   1 
ATOM 7331  C CB  . ILE B 2 248 ? 55.76738  -21.85335 27.33336   1.000 46.39540  ? 248 ILE B CB  1 
ATOM 7332  C CG1 . ILE B 2 248 ? 55.93961  -23.31257 26.91054   1.000 52.40300  ? 248 ILE B CG1 1 
ATOM 7333  C CG2 . ILE B 2 248 ? 55.50908  -21.79276 28.83123   1.000 46.08701  ? 248 ILE B CG2 1 
ATOM 7334  C CD1 . ILE B 2 248 ? 57.12803  -24.00301 27.54435   1.000 77.96592  ? 248 ILE B CD1 1 
ATOM 7335  N N   . ARG B 2 249 ? 55.03153  -19.04042 25.48917   1.000 78.56186  ? 249 ARG B N   1 
ATOM 7336  C CA  . ARG B 2 249 ? 55.36192  -17.61950 25.52724   1.000 67.07304  ? 249 ARG B CA  1 
ATOM 7337  C C   . ARG B 2 249 ? 54.14644  -16.76576 25.87575   1.000 49.92487  ? 249 ARG B C   1 
ATOM 7338  O O   . ARG B 2 249 ? 54.26902  -15.77359 26.60170   1.000 45.00614  ? 249 ARG B O   1 
ATOM 7339  C CB  . ARG B 2 249 ? 55.95969  -17.18829 24.18856   1.000 72.05789  ? 249 ARG B CB  1 
ATOM 7340  C CG  . ARG B 2 249 ? 56.77875  -15.91132 24.26072   1.000 76.30242  ? 249 ARG B CG  1 
ATOM 7341  C CD  . ARG B 2 249 ? 57.63878  -15.73631 23.01973   1.000 78.98292  ? 249 ARG B CD  1 
ATOM 7342  N NE  . ARG B 2 249 ? 58.38204  -14.47979 23.04063   1.000 86.75616  ? 249 ARG B NE  1 
ATOM 7343  C CZ  . ARG B 2 249 ? 59.58087  -14.32906 23.59415   1.000 115.19659 ? 249 ARG B CZ  1 
ATOM 7344  N NH1 . ARG B 2 249 ? 60.18034  -15.35905 24.17562   1.000 121.98697 ? 249 ARG B NH1 1 
ATOM 7345  N NH2 . ARG B 2 249 ? 60.18194  -13.14735 23.56567   1.000 128.69641 ? 249 ARG B NH2 1 
ATOM 7346  N N   . GLY B 2 250 ? 52.96225  -17.14050 25.39068   1.000 55.51665  ? 250 GLY B N   1 
ATOM 7347  C CA  . GLY B 2 250 ? 51.77177  -16.36828 25.71747   1.000 60.65872  ? 250 GLY B CA  1 
ATOM 7348  C C   . GLY B 2 250 ? 51.43218  -16.42251 27.19639   1.000 56.63528  ? 250 GLY B C   1 
ATOM 7349  O O   . GLY B 2 250 ? 51.15910  -15.39296 27.82802   1.000 69.97550  ? 250 GLY B O   1 
ATOM 7350  N N   . PHE B 2 251 ? 51.43622  -17.62936 27.76759   1.000 49.32447  ? 251 PHE B N   1 
ATOM 7351  C CA  . PHE B 2 251 ? 51.14672  -17.77260 29.18891   1.000 69.94070  ? 251 PHE B CA  1 
ATOM 7352  C C   . PHE B 2 251 ? 52.20422  -17.07962 30.03759   1.000 50.60148  ? 251 PHE B C   1 
ATOM 7353  O O   . PHE B 2 251 ? 51.88202  -16.46429 31.06311   1.000 51.63987  ? 251 PHE B O   1 
ATOM 7354  C CB  . PHE B 2 251 ? 51.04152  -19.25133 29.55872   1.000 92.81257  ? 251 PHE B CB  1 
ATOM 7355  C CG  . PHE B 2 251 ? 50.28006  -20.06962 28.55828   1.000 92.50803  ? 251 PHE B CG  1 
ATOM 7356  C CD1 . PHE B 2 251 ? 48.89756  -20.01723 28.50862   1.000 74.50809  ? 251 PHE B CD1 1 
ATOM 7357  C CD2 . PHE B 2 251 ? 50.94716  -20.90069 27.67441   1.000 87.56269  ? 251 PHE B CD2 1 
ATOM 7358  C CE1 . PHE B 2 251 ? 48.19610  -20.77286 27.58956   1.000 58.32571  ? 251 PHE B CE1 1 
ATOM 7359  C CE2 . PHE B 2 251 ? 50.25178  -21.65897 26.75511   1.000 65.80090  ? 251 PHE B CE2 1 
ATOM 7360  C CZ  . PHE B 2 251 ? 48.87583  -21.59527 26.71202   1.000 59.07679  ? 251 PHE B CZ  1 
ATOM 7361  N N   . VAL B 2 252 ? 53.47380  -17.15748 29.62474   1.000 45.09852  ? 252 VAL B N   1 
ATOM 7362  C CA  . VAL B 2 252 ? 54.51283  -16.49730 30.40650   1.000 44.29946  ? 252 VAL B CA  1 
ATOM 7363  C C   . VAL B 2 252 ? 54.36774  -14.98338 30.30756   1.000 61.29278  ? 252 VAL B C   1 
ATOM 7364  O O   . VAL B 2 252 ? 54.60477  -14.27070 31.28887   1.000 81.45743  ? 252 VAL B O   1 
ATOM 7365  C CB  . VAL B 2 252 ? 55.91890  -16.98131 29.98703   1.000 44.13553  ? 252 VAL B CB  1 
ATOM 7366  C CG1 . VAL B 2 252 ? 56.41385  -16.27921 28.73604   1.000 44.09433  ? 252 VAL B CG1 1 
ATOM 7367  C CG2 . VAL B 2 252 ? 56.90930  -16.78647 31.12259   1.000 43.74185  ? 252 VAL B CG2 1 
ATOM 7368  N N   . TYR B 2 253 ? 53.92147  -14.46713 29.15641   1.000 71.94396  ? 253 TYR B N   1 
ATOM 7369  C CA  . TYR B 2 253 ? 53.67806  -13.03314 29.04487   1.000 70.12922  ? 253 TYR B CA  1 
ATOM 7370  C C   . TYR B 2 253 ? 52.52608  -12.59617 29.93757   1.000 72.64257  ? 253 TYR B C   1 
ATOM 7371  O O   . TYR B 2 253 ? 52.59340  -11.53690 30.56824   1.000 75.59801  ? 253 TYR B O   1 
ATOM 7372  C CB  . TYR B 2 253 ? 53.39017  -12.64441 27.59568   1.000 48.54572  ? 253 TYR B CB  1 
ATOM 7373  C CG  . TYR B 2 253 ? 52.84660  -11.23831 27.46619   1.000 53.37632  ? 253 TYR B CG  1 
ATOM 7374  C CD1 . TYR B 2 253 ? 53.66580  -10.13497 27.66512   1.000 81.35073  ? 253 TYR B CD1 1 
ATOM 7375  C CD2 . TYR B 2 253 ? 51.50868  -11.01473 27.16884   1.000 62.99420  ? 253 TYR B CD2 1 
ATOM 7376  C CE1 . TYR B 2 253 ? 53.17132  -8.84836  27.55719   1.000 94.79258  ? 253 TYR B CE1 1 
ATOM 7377  C CE2 . TYR B 2 253 ? 51.00470  -9.73157  27.06046   1.000 79.45428  ? 253 TYR B CE2 1 
ATOM 7378  C CZ  . TYR B 2 253 ? 51.84087  -8.65234  27.25424   1.000 84.26508  ? 253 TYR B CZ  1 
ATOM 7379  O OH  . TYR B 2 253 ? 51.34725  -7.37193  27.14889   1.000 69.03993  ? 253 TYR B OH  1 
ATOM 7380  N N   . PHE B 2 254 ? 51.45465  -13.38858 29.99598   1.000 71.42017  ? 254 PHE B N   1 
ATOM 7381  C CA  . PHE B 2 254 ? 50.33412  -13.02075 30.86057   1.000 62.45700  ? 254 PHE B CA  1 
ATOM 7382  C C   . PHE B 2 254 ? 50.73141  -13.05481 32.33561   1.000 55.08364  ? 254 PHE B C   1 
ATOM 7383  O O   . PHE B 2 254 ? 50.37986  -12.14543 33.10531   1.000 58.98128  ? 254 PHE B O   1 
ATOM 7384  C CB  . PHE B 2 254 ? 49.13871  -13.92990 30.58588   1.000 57.65661  ? 254 PHE B CB  1 
ATOM 7385  C CG  . PHE B 2 254 ? 48.42304  -13.60539 29.30657   1.000 52.91384  ? 254 PHE B CG  1 
ATOM 7386  C CD1 . PHE B 2 254 ? 48.56690  -12.35819 28.72116   1.000 51.27102  ? 254 PHE B CD1 1 
ATOM 7387  C CD2 . PHE B 2 254 ? 47.60554  -14.53764 28.69219   1.000 56.45384  ? 254 PHE B CD2 1 
ATOM 7388  C CE1 . PHE B 2 254 ? 47.91184  -12.04738 27.54703   1.000 52.35265  ? 254 PHE B CE1 1 
ATOM 7389  C CE2 . PHE B 2 254 ? 46.94673  -14.23185 27.51553   1.000 58.30367  ? 254 PHE B CE2 1 
ATOM 7390  C CZ  . PHE B 2 254 ? 47.10058  -12.98475 26.94323   1.000 54.99725  ? 254 PHE B CZ  1 
ATOM 7391  N N   . VAL B 2 255 ? 51.46887  -14.09009 32.74756   1.000 42.78090  ? 255 VAL B N   1 
ATOM 7392  C CA  . VAL B 2 255 ? 51.93988  -14.15604 34.12919   1.000 44.37708  ? 255 VAL B CA  1 
ATOM 7393  C C   . VAL B 2 255 ? 52.85761  -12.97723 34.43382   1.000 61.80224  ? 255 VAL B C   1 
ATOM 7394  O O   . VAL B 2 255 ? 52.81123  -12.39853 35.52825   1.000 74.25791  ? 255 VAL B O   1 
ATOM 7395  C CB  . VAL B 2 255 ? 52.63511  -15.50418 34.39791   1.000 62.20606  ? 255 VAL B CB  1 
ATOM 7396  C CG1 . VAL B 2 255 ? 53.23092  -15.52368 35.79572   1.000 61.23333  ? 255 VAL B CG1 1 
ATOM 7397  C CG2 . VAL B 2 255 ? 51.65279  -16.65157 34.23056   1.000 75.28479  ? 255 VAL B CG2 1 
ATOM 7398  N N   . GLU B 2 256 ? 53.69777  -12.59245 33.46835   1.000 63.46427  ? 256 GLU B N   1 
ATOM 7399  C CA  . GLU B 2 256 ? 54.58617  -11.45665 33.67908   1.000 72.75549  ? 256 GLU B CA  1 
ATOM 7400  C C   . GLU B 2 256 ? 53.81491  -10.14646 33.75219   1.000 64.78863  ? 256 GLU B C   1 
ATOM 7401  O O   . GLU B 2 256 ? 54.20365  -9.24916  34.50136   1.000 58.06751  ? 256 GLU B O   1 
ATOM 7402  C CB  . GLU B 2 256 ? 55.64039  -11.39652 32.57523   1.000 97.05734  ? 256 GLU B CB  1 
ATOM 7403  C CG  . GLU B 2 256 ? 56.74889  -12.42059 32.73787   1.000 111.94893 ? 256 GLU B CG  1 
ATOM 7404  C CD  . GLU B 2 256 ? 57.51592  -12.23910 34.03161   1.000 124.02999 ? 256 GLU B CD  1 
ATOM 7405  O OE1 . GLU B 2 256 ? 57.88141  -11.09049 34.35437   1.000 130.89076 ? 256 GLU B OE1 1 
ATOM 7406  O OE2 . GLU B 2 256 ? 57.74489  -13.24428 34.73305   1.000 126.64705 ? 256 GLU B OE2 1 
ATOM 7407  N N   . THR B 2 257 ? 52.72989  -10.01031 32.98686   1.000 70.73442  ? 257 THR B N   1 
ATOM 7408  C CA  . THR B 2 257 ? 51.90351  -8.81140  33.10282   1.000 61.49158  ? 257 THR B CA  1 
ATOM 7409  C C   . THR B 2 257 ? 51.24532  -8.73112  34.47321   1.000 60.13445  ? 257 THR B C   1 
ATOM 7410  O O   . THR B 2 257 ? 51.15233  -7.64611  35.06041   1.000 76.54432  ? 257 THR B O   1 
ATOM 7411  C CB  . THR B 2 257 ? 50.84185  -8.77442  32.00341   1.000 55.81991  ? 257 THR B CB  1 
ATOM 7412  O OG1 . THR B 2 257 ? 50.11429  -10.00845 31.98943   1.000 64.79499  ? 257 THR B OG1 1 
ATOM 7413  C CG2 . THR B 2 257 ? 51.48324  -8.54111  30.64929   1.000 51.30322  ? 257 THR B CG2 1 
ATOM 7414  N N   . LEU B 2 258 ? 50.78692  -9.86765  35.00323   1.000 61.25693  ? 258 LEU B N   1 
ATOM 7415  C CA  . LEU B 2 258 ? 50.22931  -9.85898  36.35475   1.000 64.51107  ? 258 LEU B CA  1 
ATOM 7416  C C   . LEU B 2 258 ? 51.28989  -9.46936  37.38065   1.000 61.78674  ? 258 LEU B C   1 
ATOM 7417  O O   . LEU B 2 258 ? 51.05144  -8.62412  38.25522   1.000 68.29762  ? 258 LEU B O   1 
ATOM 7418  C CB  . LEU B 2 258 ? 49.62645  -11.22083 36.69583   1.000 57.08532  ? 258 LEU B CB  1 
ATOM 7419  C CG  . LEU B 2 258 ? 49.09712  -11.30683 38.13004   1.000 53.53086  ? 258 LEU B CG  1 
ATOM 7420  C CD1 . LEU B 2 258 ? 48.00461  -10.27114 38.36242   1.000 56.47191  ? 258 LEU B CD1 1 
ATOM 7421  C CD2 . LEU B 2 258 ? 48.59255  -12.70275 38.44860   1.000 53.61844  ? 258 LEU B CD2 1 
ATOM 7422  N N   . ALA B 2 259 ? 52.47548  -10.07627 37.28432   1.000 57.32986  ? 259 ALA B N   1 
ATOM 7423  C CA  . ALA B 2 259 ? 53.55536  -9.73085  38.20294   1.000 57.80310  ? 259 ALA B CA  1 
ATOM 7424  C C   . ALA B 2 259 ? 53.97139  -8.27137  38.05711   1.000 64.31291  ? 259 ALA B C   1 
ATOM 7425  O O   . ALA B 2 259 ? 54.36514  -7.63719  39.04009   1.000 74.81882  ? 259 ALA B O   1 
ATOM 7426  C CB  . ALA B 2 259 ? 54.75097  -10.65568 37.97741   1.000 67.35980  ? 259 ALA B CB  1 
ATOM 7427  N N   . ARG B 2 260 ? 53.87463  -7.72082  36.84629   1.000 54.85855  ? 260 ARG B N   1 
ATOM 7428  C CA  . ARG B 2 260 ? 54.19837  -6.31731  36.61510   1.000 57.58242  ? 260 ARG B CA  1 
ATOM 7429  C C   . ARG B 2 260 ? 53.17680  -5.40462  37.27866   1.000 74.52265  ? 260 ARG B C   1 
ATOM 7430  O O   . ARG B 2 260 ? 53.53789  -4.41112  37.92108   1.000 73.50810  ? 260 ARG B O   1 
ATOM 7431  C CB  . ARG B 2 260 ? 54.25499  -6.05420  35.10979   1.000 72.53482  ? 260 ARG B CB  1 
ATOM 7432  C CG  . ARG B 2 260 ? 54.98299  -4.79362  34.68493   1.000 93.42881  ? 260 ARG B CG  1 
ATOM 7433  C CD  . ARG B 2 260 ? 54.97262  -4.68087  33.16657   1.000 108.51760 ? 260 ARG B CD  1 
ATOM 7434  N NE  . ARG B 2 260 ? 55.45603  -5.90360  32.52922   1.000 123.78879 ? 260 ARG B NE  1 
ATOM 7435  C CZ  . ARG B 2 260 ? 55.24658  -6.21594  31.25403   1.000 124.04864 ? 260 ARG B CZ  1 
ATOM 7436  N NH1 . ARG B 2 260 ? 54.55788  -5.39568  30.47256   1.000 114.69401 ? 260 ARG B NH1 1 
ATOM 7437  N NH2 . ARG B 2 260 ? 55.72037  -7.35220  30.76087   1.000 129.31886 ? 260 ARG B NH2 1 
ATOM 7438  N N   . SER B 2 261 ? 51.88996  -5.72189  37.11733   1.000 92.34797  ? 261 SER B N   1 
ATOM 7439  C CA  . SER B 2 261 ? 50.84650  -4.94763  37.77865   1.000 79.76106  ? 261 SER B CA  1 
ATOM 7440  C C   . SER B 2 261 ? 50.95772  -5.04387  39.29338   1.000 65.68167  ? 261 SER B C   1 
ATOM 7441  O O   . SER B 2 261 ? 50.54747  -4.12031  40.00626   1.000 65.05751  ? 261 SER B O   1 
ATOM 7442  C CB  . SER B 2 261 ? 49.46874  -5.42173  37.31553   1.000 71.33330  ? 261 SER B CB  1 
ATOM 7443  O OG  . SER B 2 261 ? 49.22974  -5.05424  35.96807   1.000 67.15274  ? 261 SER B OG  1 
ATOM 7444  N N   . ILE B 2 262 ? 51.51259  -6.14353  39.80291   1.000 67.61095  ? 262 ILE B N   1 
ATOM 7445  C CA  . ILE B 2 262 ? 51.72632  -6.25397  41.24308   1.000 66.65758  ? 262 ILE B CA  1 
ATOM 7446  C C   . ILE B 2 262 ? 52.92428  -5.41662  41.67871   1.000 64.22950  ? 262 ILE B C   1 
ATOM 7447  O O   . ILE B 2 262 ? 52.85302  -4.66726  42.65945   1.000 64.49252  ? 262 ILE B O   1 
ATOM 7448  C CB  . ILE B 2 262 ? 51.88851  -7.72946  41.65230   1.000 68.34120  ? 262 ILE B CB  1 
ATOM 7449  C CG1 . ILE B 2 262 ? 50.57474  -8.48334  41.44474   1.000 60.73697  ? 262 ILE B CG1 1 
ATOM 7450  C CG2 . ILE B 2 262 ? 52.32939  -7.83292  43.10408   1.000 76.91044  ? 262 ILE B CG2 1 
ATOM 7451  C CD1 . ILE B 2 262 ? 50.65289  -9.95077  41.78028   1.000 55.27602  ? 262 ILE B CD1 1 
ATOM 7452  N N   . CYS B 2 263 ? 54.03945  -5.52258  40.95160   1.000 75.88569  ? 263 CYS B N   1 
ATOM 7453  C CA  . CYS B 2 263 ? 55.25634  -4.80676  41.31796   1.000 81.94479  ? 263 CYS B CA  1 
ATOM 7454  C C   . CYS B 2 263 ? 55.13023  -3.29987  41.13931   1.000 76.44707  ? 263 CYS B C   1 
ATOM 7455  O O   . CYS B 2 263 ? 55.87528  -2.55108  41.78039   1.000 69.58027  ? 263 CYS B O   1 
ATOM 7456  C CB  . CYS B 2 263 ? 56.43771  -5.32455  40.49608   1.000 70.75877  ? 263 CYS B CB  1 
ATOM 7457  S SG  . CYS B 2 263 ? 56.93594  -7.01643  40.88594   1.000 54.73597  ? 263 CYS B SG  1 
ATOM 7458  N N   . GLU B 2 264 ? 54.22270  -2.83840  40.27478   1.000 66.56120  ? 264 GLU B N   1 
ATOM 7459  C CA  . GLU B 2 264 ? 54.05922  -1.40059  40.08412   1.000 74.25321  ? 264 GLU B CA  1 
ATOM 7460  C C   . GLU B 2 264 ? 53.53350  -0.71471  41.33877   1.000 93.73779  ? 264 GLU B C   1 
ATOM 7461  O O   . GLU B 2 264 ? 53.80099  0.47398   41.54962   1.000 119.74405 ? 264 GLU B O   1 
ATOM 7462  C CB  . GLU B 2 264 ? 53.12845  -1.12236  38.90419   1.000 87.35648  ? 264 GLU B CB  1 
ATOM 7463  C CG  . GLU B 2 264 ? 53.78831  -1.25986  37.54344   1.000 116.01472 ? 264 GLU B CG  1 
ATOM 7464  C CD  . GLU B 2 264 ? 52.87494  -0.83803  36.40993   1.000 150.05405 ? 264 GLU B CD  1 
ATOM 7465  O OE1 . GLU B 2 264 ? 51.69108  -0.54091  36.67697   1.000 162.54466 ? 264 GLU B OE1 1 
ATOM 7466  O OE2 . GLU B 2 264 ? 53.34251  -0.79935  35.25246   1.000 161.00895 ? 264 GLU B OE2 1 
ATOM 7467  N N   . LYS B 2 265 ? 52.79244  -1.43607  42.18061   1.000 86.95501  ? 265 LYS B N   1 
ATOM 7468  C CA  . LYS B 2 265 ? 52.16687  -0.86160  43.36533   1.000 76.40521  ? 265 LYS B CA  1 
ATOM 7469  C C   . LYS B 2 265 ? 52.91531  -1.21757  44.64557   1.000 65.22389  ? 265 LYS B C   1 
ATOM 7470  O O   . LYS B 2 265 ? 52.31337  -1.26375  45.72368   1.000 61.64175  ? 265 LYS B O   1 
ATOM 7471  C CB  . LYS B 2 265 ? 50.71269  -1.32121  43.46579   1.000 76.58077  ? 265 LYS B CB  1 
ATOM 7472  C CG  . LYS B 2 265 ? 49.87781  -1.04760  42.22780   1.000 71.28787  ? 265 LYS B CG  1 
ATOM 7473  C CD  . LYS B 2 265 ? 48.48543  -1.64115  42.37054   1.000 64.88027  ? 265 LYS B CD  1 
ATOM 7474  C CE  . LYS B 2 265 ? 47.64761  -1.39840  41.12680   1.000 64.01548  ? 265 LYS B CE  1 
ATOM 7475  N NZ  . LYS B 2 265 ? 48.21930  -2.08521  39.93521   1.000 64.45632  ? 265 LYS B NZ  1 
ATOM 7476  N N   . LEU B 2 266 ? 54.21835  -1.47279  44.54915   1.000 70.79676  ? 266 LEU B N   1 
ATOM 7477  C CA  . LEU B 2 266 ? 55.03279  -1.84786  45.69857   1.000 70.54353  ? 266 LEU B CA  1 
ATOM 7478  C C   . LEU B 2 266 ? 56.23872  -0.92603  45.77610   1.000 82.65129  ? 266 LEU B C   1 
ATOM 7479  O O   . LEU B 2 266 ? 57.02999  -0.85548  44.82999   1.000 88.84715  ? 266 LEU B O   1 
ATOM 7480  C CB  . LEU B 2 266 ? 55.48234  -3.30893  45.60305   1.000 63.43569  ? 266 LEU B CB  1 
ATOM 7481  C CG  . LEU B 2 266 ? 54.37085  -4.35731  45.54716   1.000 54.24877  ? 266 LEU B CG  1 
ATOM 7482  C CD1 . LEU B 2 266 ? 54.95865  -5.75317  45.43039   1.000 53.77899  ? 266 LEU B CD1 1 
ATOM 7483  C CD2 . LEU B 2 266 ? 53.47502  -4.24834  46.77051   1.000 57.88830  ? 266 LEU B CD2 1 
ATOM 7484  N N   . GLU B 2 267 ? 56.37558  -0.22015  46.90061   1.000 69.52056  ? 267 GLU B N   1 
ATOM 7485  C CA  . GLU B 2 267 ? 57.56754  0.59115   47.12364   1.000 85.92679  ? 267 GLU B CA  1 
ATOM 7486  C C   . GLU B 2 267 ? 58.81578  -0.27509  47.23598   1.000 88.29313  ? 267 GLU B C   1 
ATOM 7487  O O   . GLU B 2 267 ? 59.90236  0.13811   46.81314   1.000 97.16342  ? 267 GLU B O   1 
ATOM 7488  C CB  . GLU B 2 267 ? 57.38585  1.44632   48.38129   1.000 121.77999 ? 267 GLU B CB  1 
ATOM 7489  C CG  . GLU B 2 267 ? 58.66961  2.04458   48.95091   1.000 146.59384 ? 267 GLU B CG  1 
ATOM 7490  C CD  . GLU B 2 267 ? 59.24309  3.15829   48.09165   1.000 152.98482 ? 267 GLU B CD  1 
ATOM 7491  O OE1 . GLU B 2 267 ? 58.54434  3.62940   47.16936   1.000 157.80816 ? 267 GLU B OE1 1 
ATOM 7492  O OE2 . GLU B 2 267 ? 60.39952  3.56225   48.34113   1.000 146.47505 ? 267 GLU B OE2 1 
ATOM 7493  N N   . GLN B 2 268 ? 58.67548  -1.48428  47.77938   1.000 83.65316  ? 268 GLN B N   1 
ATOM 7494  C CA  . GLN B 2 268 ? 59.80415  -2.37102  48.02830   1.000 70.53720  ? 268 GLN B CA  1 
ATOM 7495  C C   . GLN B 2 268 ? 60.28174  -3.11298  46.78452   1.000 68.17870  ? 268 GLN B C   1 
ATOM 7496  O O   . GLN B 2 268 ? 61.33900  -3.75010  46.83631   1.000 65.06084  ? 268 GLN B O   1 
ATOM 7497  C CB  . GLN B 2 268 ? 59.42208  -3.37962  49.11410   1.000 62.97906  ? 268 GLN B CB  1 
ATOM 7498  C CG  . GLN B 2 268 ? 58.72130  -2.74761  50.30789   1.000 65.23441  ? 268 GLN B CG  1 
ATOM 7499  C CD  . GLN B 2 268 ? 58.18562  -3.77302  51.28705   1.000 97.20423  ? 268 GLN B CD  1 
ATOM 7500  O OE1 . GLN B 2 268 ? 58.43473  -4.97003  51.14910   1.000 125.57171 ? 268 GLN B OE1 1 
ATOM 7501  N NE2 . GLN B 2 268 ? 57.43551  -3.30736  52.27960   1.000 103.22397 ? 268 GLN B NE2 1 
ATOM 7502  N N   . SER B 2 269 ? 59.54305  -3.04966  45.67868   1.000 77.14533  ? 269 SER B N   1 
ATOM 7503  C CA  . SER B 2 269 ? 59.92205  -3.71126  44.43476   1.000 90.00794  ? 269 SER B CA  1 
ATOM 7504  C C   . SER B 2 269 ? 60.60142  -2.70658  43.51088   1.000 75.24249  ? 269 SER B C   1 
ATOM 7505  O O   . SER B 2 269 ? 60.00516  -1.68437  43.15484   1.000 73.49677  ? 269 SER B O   1 
ATOM 7506  C CB  . SER B 2 269 ? 58.70311  -4.33011  43.75090   1.000 113.64261 ? 269 SER B CB  1 
ATOM 7507  O OG  . SER B 2 269 ? 59.04055  -4.82548  42.46700   1.000 129.28302 ? 269 SER B OG  1 
ATOM 7508  N N   . GLY B 2 270 ? 61.84404  -2.99546  43.12794   1.000 74.30425  ? 270 GLY B N   1 
ATOM 7509  C CA  . GLY B 2 270 ? 62.57992  -2.10384  42.25302   1.000 71.85737  ? 270 GLY B CA  1 
ATOM 7510  C C   . GLY B 2 270 ? 62.83863  -2.62265  40.85211   1.000 82.57236  ? 270 GLY B C   1 
ATOM 7511  O O   . GLY B 2 270 ? 63.72969  -2.11783  40.16298   1.000 83.08876  ? 270 GLY B O   1 
ATOM 7512  N N   . LEU B 2 271 ? 62.08104  -3.62881  40.41373   1.000 90.94185  ? 271 LEU B N   1 
ATOM 7513  C CA  . LEU B 2 271 ? 62.27707  -4.17775  39.07376   1.000 103.01128 ? 271 LEU B CA  1 
ATOM 7514  C C   . LEU B 2 271 ? 61.66744  -3.31884  37.96609   1.000 104.99182 ? 271 LEU B C   1 
ATOM 7515  O O   . LEU B 2 271 ? 62.37663  -2.98491  37.00795   1.000 119.25153 ? 271 LEU B O   1 
ATOM 7516  C CB  . LEU B 2 271 ? 61.72963  -5.60431  38.97084   1.000 95.33292  ? 271 LEU B CB  1 
ATOM 7517  C CG  . LEU B 2 271 ? 62.70814  -6.73471  39.28182   1.000 89.80191  ? 271 LEU B CG  1 
ATOM 7518  C CD1 . LEU B 2 271 ? 62.25649  -8.01057  38.59446   1.000 96.71937  ? 271 LEU B CD1 1 
ATOM 7519  C CD2 . LEU B 2 271 ? 64.10736  -6.35421  38.83347   1.000 76.79893  ? 271 LEU B CD2 1 
ATOM 7520  N N   . PRO B 2 272 ? 60.37591  -2.95549  38.02648   1.000 91.32509  ? 272 PRO B N   1 
ATOM 7521  C CA  . PRO B 2 272 ? 59.79147  -2.23028  36.88171   1.000 80.10664  ? 272 PRO B CA  1 
ATOM 7522  C C   . PRO B 2 272 ? 60.45184  -0.89038  36.61165   1.000 82.79226  ? 272 PRO B C   1 
ATOM 7523  O O   . PRO B 2 272 ? 60.59944  -0.50125  35.44638   1.000 73.45286  ? 272 PRO B O   1 
ATOM 7524  C CB  . PRO B 2 272 ? 58.31939  -2.06799  37.28479   1.000 79.96452  ? 272 PRO B CB  1 
ATOM 7525  C CG  . PRO B 2 272 ? 58.32270  -2.15122  38.76300   1.000 72.86876  ? 272 PRO B CG  1 
ATOM 7526  C CD  . PRO B 2 272 ? 59.37892  -3.15309  39.09662   1.000 78.41346  ? 272 PRO B CD  1 
ATOM 7527  N N   . VAL B 2 273 ? 60.85829  -0.17301  37.65515   1.000 90.18670  ? 273 VAL B N   1 
ATOM 7528  C CA  . VAL B 2 273 ? 61.51091  1.11413   37.46483   1.000 88.06096  ? 273 VAL B CA  1 
ATOM 7529  C C   . VAL B 2 273 ? 62.96587  0.90390   37.05761   1.000 64.33813  ? 273 VAL B C   1 
ATOM 7530  O O   . VAL B 2 273 ? 63.53706  -0.17975  37.20591   1.000 60.62777  ? 273 VAL B O   1 
ATOM 7531  C CB  . VAL B 2 273 ? 61.40533  1.97928   38.73288   1.000 95.09352  ? 273 VAL B CB  1 
ATOM 7532  C CG1 . VAL B 2 273 ? 59.94651  2.19435   39.10742   1.000 92.19791  ? 273 VAL B CG1 1 
ATOM 7533  C CG2 . VAL B 2 273 ? 62.16916  1.33468   39.88090   1.000 76.89743  ? 273 VAL B CG2 1 
ATOM 7534  N N   . GLY B 2 274 ? 63.56895  1.96395   36.52992   1.000 68.07477  ? 274 GLY B N   1 
ATOM 7535  C CA  . GLY B 2 274 ? 64.95867  1.91527   36.12075   1.000 71.57330  ? 274 GLY B CA  1 
ATOM 7536  C C   . GLY B 2 274 ? 65.56079  3.29848   36.12206   1.000 73.95872  ? 274 GLY B C   1 
ATOM 7537  O O   . GLY B 2 274 ? 64.87374  4.29193   35.86483   1.000 79.01053  ? 274 GLY B O   1 
ATOM 7538  N N   . GLY B 2 275 ? 66.85591  3.36402   36.41791   1.000 73.48517  ? 275 GLY B N   1 
ATOM 7539  C CA  . GLY B 2 275 ? 67.55159  4.63507   36.42851   1.000 78.85742  ? 275 GLY B CA  1 
ATOM 7540  C C   . GLY B 2 275 ? 67.24539  5.49359   37.63843   1.000 79.78703  ? 275 GLY B C   1 
ATOM 7541  O O   . GLY B 2 275 ? 67.22834  5.00249   38.77251   1.000 98.83176  ? 275 GLY B O   1 
ATOM 7542  N N   . ASN B 2 276 ? 67.00248  6.78645   37.39578   1.000 68.88604  ? 276 ASN B N   1 
ATOM 7543  C CA  . ASN B 2 276 ? 66.83220  7.74537   38.48370   1.000 74.22039  ? 276 ASN B CA  1 
ATOM 7544  C C   . ASN B 2 276 ? 65.72360  7.33181   39.44322   1.000 78.98275  ? 276 ASN B C   1 
ATOM 7545  O O   . ASN B 2 276 ? 65.82380  7.59145   40.64881   1.000 78.50199  ? 276 ASN B O   1 
ATOM 7546  C CB  . ASN B 2 276 ? 66.54644  9.13414   37.91331   1.000 78.91300  ? 276 ASN B CB  1 
ATOM 7547  C CG  . ASN B 2 276 ? 67.52809  9.53189   36.82894   1.000 101.98341 ? 276 ASN B CG  1 
ATOM 7548  O OD1 . ASN B 2 276 ? 68.74123  9.43989   37.01038   1.000 131.15405 ? 276 ASN B OD1 1 
ATOM 7549  N ND2 . ASN B 2 276 ? 67.00584  9.97278   35.69020   1.000 105.91414 ? 276 ASN B ND2 1 
ATOM 7550  N N   . GLU B 2 277 ? 64.65848  6.70605   38.93108   1.000 72.88479  ? 277 GLU B N   1 
ATOM 7551  C CA  . GLU B 2 277 ? 63.59163  6.21953   39.80104   1.000 74.40369  ? 277 GLU B CA  1 
ATOM 7552  C C   . GLU B 2 277 ? 64.15697  5.33784   40.90672   1.000 81.95549  ? 277 GLU B C   1 
ATOM 7553  O O   . GLU B 2 277 ? 63.86856  5.54529   42.09241   1.000 103.10777 ? 277 GLU B O   1 
ATOM 7554  C CB  . GLU B 2 277 ? 62.54838  5.45459   38.98379   1.000 86.08248  ? 277 GLU B CB  1 
ATOM 7555  C CG  . GLU B 2 277 ? 61.48673  6.32747   38.33277   1.000 108.83096 ? 277 GLU B CG  1 
ATOM 7556  C CD  . GLU B 2 277 ? 61.98798  7.04400   37.09381   1.000 133.57716 ? 277 GLU B CD  1 
ATOM 7557  O OE1 . GLU B 2 277 ? 63.11966  6.75769   36.65033   1.000 140.08372 ? 277 GLU B OE1 1 
ATOM 7558  O OE2 . GLU B 2 277 ? 61.24664  7.89565   36.56041   1.000 147.29252 ? 277 GLU B OE2 1 
ATOM 7559  N N   . LYS B 2 278 ? 64.98584  4.35623   40.52933   1.000 81.40018  ? 278 LYS B N   1 
ATOM 7560  C CA  . LYS B 2 278 ? 65.63885  3.50363   41.51784   1.000 62.54677  ? 278 LYS B CA  1 
ATOM 7561  C C   . LYS B 2 278 ? 66.33085  4.34096   42.58233   1.000 70.62344  ? 278 LYS B C   1 
ATOM 7562  O O   . LYS B 2 278 ? 66.22166  4.04843   43.78061   1.000 64.44760  ? 278 LYS B O   1 
ATOM 7563  C CB  . LYS B 2 278 ? 66.64216  2.57243   40.83508   1.000 61.89447  ? 278 LYS B CB  1 
ATOM 7564  C CG  . LYS B 2 278 ? 66.04708  1.27779   40.30271   1.000 59.57154  ? 278 LYS B CG  1 
ATOM 7565  C CD  . LYS B 2 278 ? 67.13722  0.37658   39.74012   1.000 60.06254  ? 278 LYS B CD  1 
ATOM 7566  C CE  . LYS B 2 278 ? 66.59272  -0.95728  39.25936   1.000 57.24328  ? 278 LYS B CE  1 
ATOM 7567  N NZ  . LYS B 2 278 ? 66.16252  -1.81973  40.39454   1.000 56.17941  ? 278 LYS B NZ  1 
ATOM 7568  N N   . LYS B 2 279 ? 67.02791  5.40244   42.15781   1.000 79.17241  ? 279 LYS B N   1 
ATOM 7569  C CA  . LYS B 2 279 ? 67.67632  6.31145   43.09806   1.000 79.00100  ? 279 LYS B CA  1 
ATOM 7570  C C   . LYS B 2 279 ? 66.72784  6.68918   44.22581   1.000 87.44658  ? 279 LYS B C   1 
ATOM 7571  O O   . LYS B 2 279 ? 67.03915  6.49666   45.40756   1.000 105.71304 ? 279 LYS B O   1 
ATOM 7572  C CB  . LYS B 2 279 ? 68.16285  7.56686   42.36946   1.000 78.97016  ? 279 LYS B CB  1 
ATOM 7573  C CG  . LYS B 2 279 ? 69.36409  7.35659   41.46245   1.000 76.57093  ? 279 LYS B CG  1 
ATOM 7574  C CD  . LYS B 2 279 ? 69.85606  8.68463   40.90574   1.000 79.18045  ? 279 LYS B CD  1 
ATOM 7575  C CE  . LYS B 2 279 ? 71.12359  8.51493   40.08668   1.000 77.46200  ? 279 LYS B CE  1 
ATOM 7576  N NZ  . LYS B 2 279 ? 71.63891  9.82448   39.59744   1.000 78.68070  ? 279 LYS B NZ  1 
ATOM 7577  N N   . ALA B 2 280 ? 65.54032  7.18707   43.87174   1.000 77.19793  ? 280 ALA B N   1 
ATOM 7578  C CA  . ALA B 2 280 ? 64.56741  7.56669   44.88849   1.000 77.57772  ? 280 ALA B CA  1 
ATOM 7579  C C   . ALA B 2 280 ? 64.29393  6.40299   45.83027   1.000 75.80137  ? 280 ALA B C   1 
ATOM 7580  O O   . ALA B 2 280 ? 64.44185  6.52909   47.05282   1.000 76.76758  ? 280 ALA B O   1 
ATOM 7581  C CB  . ALA B 2 280 ? 63.27543  8.04604   44.22611   1.000 81.22562  ? 280 ALA B CB  1 
ATOM 7582  N N   . LYS B 2 281 ? 63.96471  5.23461   45.26596   1.000 69.74996  ? 281 LYS B N   1 
ATOM 7583  C CA  . LYS B 2 281 ? 63.60323  4.08858   46.09193   1.000 79.55119  ? 281 LYS B CA  1 
ATOM 7584  C C   . LYS B 2 281 ? 64.72939  3.66685   47.01873   1.000 85.59062  ? 281 LYS B C   1 
ATOM 7585  O O   . LYS B 2 281 ? 64.47984  2.93137   47.97972   1.000 109.26983 ? 281 LYS B O   1 
ATOM 7586  C CB  . LYS B 2 281 ? 63.17290  2.90544   45.22556   1.000 83.11103  ? 281 LYS B CB  1 
ATOM 7587  C CG  . LYS B 2 281 ? 61.75564  3.01782   44.70492   1.000 95.96324  ? 281 LYS B CG  1 
ATOM 7588  C CD  . LYS B 2 281 ? 61.30771  1.73257   44.03827   1.000 97.04345  ? 281 LYS B CD  1 
ATOM 7589  C CE  . LYS B 2 281 ? 59.86123  1.83212   43.58438   1.000 101.29378 ? 281 LYS B CE  1 
ATOM 7590  N NZ  . LYS B 2 281 ? 59.37772  0.57831   42.94343   1.000 110.88319 ? 281 LYS B NZ  1 
ATOM 7591  N N   . LEU B 2 282 ? 65.95736  4.11478   46.76642   1.000 73.88274  ? 282 LEU B N   1 
ATOM 7592  C CA  . LEU B 2 282 ? 66.99108  3.94067   47.77616   1.000 77.52087  ? 282 LEU B CA  1 
ATOM 7593  C C   . LEU B 2 282 ? 66.87698  5.03318   48.83294   1.000 81.42000  ? 282 LEU B C   1 
ATOM 7594  O O   . LEU B 2 282 ? 66.55459  4.75863   49.99663   1.000 82.03495  ? 282 LEU B O   1 
ATOM 7595  C CB  . LEU B 2 282 ? 68.37412  3.94167   47.11901   1.000 81.07797  ? 282 LEU B CB  1 
ATOM 7596  C CG  . LEU B 2 282 ? 68.60482  2.78524   46.14044   1.000 78.16886  ? 282 LEU B CG  1 
ATOM 7597  C CD1 . LEU B 2 282 ? 69.89758  2.96151   45.35648   1.000 78.10805  ? 282 LEU B CD1 1 
ATOM 7598  C CD2 . LEU B 2 282 ? 68.59381  1.45205   46.86927   1.000 83.36248  ? 282 LEU B CD2 1 
ATOM 7599  N N   . ALA B 2 283 ? 67.05822  6.29160   48.41830   1.000 93.35089  ? 283 ALA B N   1 
ATOM 7600  C CA  . ALA B 2 283 ? 67.11799  7.39261   49.37204   1.000 88.46044  ? 283 ALA B CA  1 
ATOM 7601  C C   . ALA B 2 283 ? 65.83471  7.52687   50.17428   1.000 98.04881  ? 283 ALA B C   1 
ATOM 7602  O O   . ALA B 2 283 ? 65.86377  8.06917   51.28271   1.000 107.12873 ? 283 ALA B O   1 
ATOM 7603  C CB  . ALA B 2 283 ? 67.42120  8.70440   48.64625   1.000 86.78475  ? 283 ALA B CB  1 
ATOM 7604  N N   . ASN B 2 284 ? 64.71503  7.03308   49.64729   1.000 94.36608  ? 284 ASN B N   1 
ATOM 7605  C CA  . ASN B 2 284 ? 63.47637  7.02106   50.41489   1.000 94.65376  ? 284 ASN B CA  1 
ATOM 7606  C C   . ASN B 2 284 ? 63.53758  5.98466   51.52971   1.000 108.78903 ? 284 ASN B C   1 
ATOM 7607  O O   . ASN B 2 284 ? 63.33386  6.30643   52.70659   1.000 129.38092 ? 284 ASN B O   1 
ATOM 7608  C CB  . ASN B 2 284 ? 62.28695  6.75178   49.49149   1.000 93.05116  ? 284 ASN B CB  1 
ATOM 7609  C CG  . ASN B 2 284 ? 60.95434  6.95685   50.18506   1.000 95.00593  ? 284 ASN B CG  1 
ATOM 7610  O OD1 . ASN B 2 284 ? 60.89513  7.47093   51.30242   1.000 96.70383  ? 284 ASN B OD1 1 
ATOM 7611  N ND2 . ASN B 2 284 ? 59.87579  6.55184   49.52575   1.000 101.04619 ? 284 ASN B ND2 1 
ATOM 7612  N N   . VAL B 2 285 ? 63.82392  4.72825   51.17414   1.000 94.14978  ? 285 VAL B N   1 
ATOM 7613  C CA  . VAL B 2 285 ? 63.66412  3.63369   52.13008   1.000 91.25741  ? 285 VAL B CA  1 
ATOM 7614  C C   . VAL B 2 285 ? 64.63446  3.78780   53.29339   1.000 96.47074  ? 285 VAL B C   1 
ATOM 7615  O O   . VAL B 2 285 ? 64.27854  3.54214   54.45340   1.000 125.55223 ? 285 VAL B O   1 
ATOM 7616  C CB  . VAL B 2 285 ? 63.82044  2.27751   51.41889   1.000 78.72787  ? 285 VAL B CB  1 
ATOM 7617  C CG1 . VAL B 2 285 ? 63.95731  1.15507   52.43132   1.000 69.86161  ? 285 VAL B CG1 1 
ATOM 7618  C CG2 . VAL B 2 285 ? 62.61698  2.02857   50.52257   1.000 84.27300  ? 285 VAL B CG2 1 
ATOM 7619  N N   . VAL B 2 286 ? 65.86471  4.22008   53.00767   1.000 78.90352  ? 286 VAL B N   1 
ATOM 7620  C CA  . VAL B 2 286 ? 66.82645  4.48613   54.07389   1.000 81.13302  ? 286 VAL B CA  1 
ATOM 7621  C C   . VAL B 2 286 ? 66.25850  5.50720   55.05190   1.000 90.06932  ? 286 VAL B C   1 
ATOM 7622  O O   . VAL B 2 286 ? 66.39875  5.36744   56.27355   1.000 95.33285  ? 286 VAL B O   1 
ATOM 7623  C CB  . VAL B 2 286 ? 68.16743  4.95242   53.47566   1.000 82.17003  ? 286 VAL B CB  1 
ATOM 7624  C CG1 . VAL B 2 286 ? 69.07679  5.51094   54.55996   1.000 85.02370  ? 286 VAL B CG1 1 
ATOM 7625  C CG2 . VAL B 2 286 ? 68.84641  3.80873   52.74069   1.000 91.07211  ? 286 VAL B CG2 1 
ATOM 7626  N N   . ARG B 2 287 ? 65.59261  6.54066   54.53081   1.000 83.21225  ? 287 ARG B N   1 
ATOM 7627  C CA  . ARG B 2 287 ? 64.99703  7.56096   55.38503   1.000 90.15173  ? 287 ARG B CA  1 
ATOM 7628  C C   . ARG B 2 287 ? 63.82693  7.02819   56.20509   1.000 106.62245 ? 287 ARG B C   1 
ATOM 7629  O O   . ARG B 2 287 ? 63.46838  7.64254   57.21533   1.000 124.75640 ? 287 ARG B O   1 
ATOM 7630  C CB  . ARG B 2 287 ? 64.56733  8.75326   54.52869   1.000 90.77700  ? 287 ARG B CB  1 
ATOM 7631  C CG  . ARG B 2 287 ? 65.74751  9.56617   54.01935   1.000 96.09334  ? 287 ARG B CG  1 
ATOM 7632  C CD  . ARG B 2 287 ? 65.33411  10.64213  53.02907   1.000 101.36332 ? 287 ARG B CD  1 
ATOM 7633  N NE  . ARG B 2 287 ? 64.28279  11.51851  53.52575   1.000 120.12126 ? 287 ARG B NE  1 
ATOM 7634  C CZ  . ARG B 2 287 ? 63.66657  12.42700  52.77714   1.000 146.74471 ? 287 ARG B CZ  1 
ATOM 7635  N NH1 . ARG B 2 287 ? 64.00191  12.57423  51.50241   1.000 140.48718 ? 287 ARG B NH1 1 
ATOM 7636  N NH2 . ARG B 2 287 ? 62.71360  13.18644  53.29851   1.000 175.87736 ? 287 ARG B NH2 1 
ATOM 7637  N N   . LYS B 2 288 ? 63.22979  5.90371   55.80497   1.000 102.04878 ? 288 LYS B N   1 
ATOM 7638  C CA  . LYS B 2 288 ? 62.23259  5.24640   56.64181   1.000 90.58678  ? 288 LYS B CA  1 
ATOM 7639  C C   . LYS B 2 288 ? 62.85309  4.50605   57.81766   1.000 79.54494  ? 288 LYS B C   1 
ATOM 7640  O O   . LYS B 2 288 ? 62.12917  4.12719   58.74497   1.000 91.31472  ? 288 LYS B O   1 
ATOM 7641  C CB  . LYS B 2 288 ? 61.38952  4.26757   55.81993   1.000 97.84987  ? 288 LYS B CB  1 
ATOM 7642  C CG  . LYS B 2 288 ? 60.40869  4.92002   54.86197   1.000 104.81106 ? 288 LYS B CG  1 
ATOM 7643  C CD  . LYS B 2 288 ? 59.59166  3.86332   54.13477   1.000 101.66057 ? 288 LYS B CD  1 
ATOM 7644  C CE  . LYS B 2 288 ? 58.63754  4.48627   53.13171   1.000 95.16060  ? 288 LYS B CE  1 
ATOM 7645  N NZ  . LYS B 2 288 ? 57.88748  3.45345   52.36462   1.000 92.43421  ? 288 LYS B NZ  1 
ATOM 7646  N N   . MET B 2 289 ? 64.16746  4.30500   57.80235   1.000 72.77010  ? 289 MET B N   1 
ATOM 7647  C CA  . MET B 2 289 ? 64.88752  3.53902   58.81082   1.000 73.76852  ? 289 MET B CA  1 
ATOM 7648  C C   . MET B 2 289 ? 65.81537  4.40166   59.64992   1.000 76.59716  ? 289 MET B C   1 
ATOM 7649  O O   . MET B 2 289 ? 65.75329  4.36450   60.88309   1.000 83.34024  ? 289 MET B O   1 
ATOM 7650  C CB  . MET B 2 289 ? 65.69173  2.41454   58.14383   1.000 71.93304  ? 289 MET B CB  1 
ATOM 7651  C CG  . MET B 2 289 ? 64.84105  1.31994   57.54245   1.000 69.50529  ? 289 MET B CG  1 
ATOM 7652  S SD  . MET B 2 289 ? 63.88783  0.50927   58.83507   1.000 70.50069  ? 289 MET B SD  1 
ATOM 7653  C CE  . MET B 2 289 ? 63.21923  -0.88132  57.94145   1.000 67.77792  ? 289 MET B CE  1 
ATOM 7654  N N   . MET B 2 290 ? 66.68773  5.17482   59.00296   1.000 93.39716  ? 290 MET B N   1 
ATOM 7655  C CA  . MET B 2 290 ? 67.70238  5.92462   59.73333   1.000 105.31977 ? 290 MET B CA  1 
ATOM 7656  C C   . MET B 2 290 ? 67.07693  7.04068   60.56180   1.000 118.80484 ? 290 MET B C   1 
ATOM 7657  O O   . MET B 2 290 ? 67.49935  7.29182   61.69609   1.000 113.14152 ? 290 MET B O   1 
ATOM 7658  C CB  . MET B 2 290 ? 68.71755  6.49796   58.74395   1.000 116.23804 ? 290 MET B CB  1 
ATOM 7659  C CG  . MET B 2 290 ? 69.95203  7.12748   59.36314   1.000 139.66059 ? 290 MET B CG  1 
ATOM 7660  S SD  . MET B 2 290 ? 70.98344  5.93004   60.22697   1.000 160.89937 ? 290 MET B SD  1 
ATOM 7661  C CE  . MET B 2 290 ? 72.47107  6.89339   60.48717   1.000 163.80227 ? 290 MET B CE  1 
ATOM 7662  N N   . THR B 2 291 ? 66.06664  7.71744   60.01573   1.000 142.58148 ? 291 THR B N   1 
ATOM 7663  C CA  . THR B 2 291 ? 65.39914  8.81877   60.70783   1.000 140.85108 ? 291 THR B CA  1 
ATOM 7664  C C   . THR B 2 291 ? 64.33501  8.32987   61.69626   1.000 135.22189 ? 291 THR B C   1 
ATOM 7665  O O   . THR B 2 291 ? 63.14586  8.61964   61.56424   1.000 121.25906 ? 291 THR B O   1 
ATOM 7666  C CB  . THR B 2 291 ? 64.78727  9.77683   59.69349   1.000 128.21449 ? 291 THR B CB  1 
ATOM 7667  O OG1 . THR B 2 291 ? 63.76619  9.09863   58.95012   1.000 116.30906 ? 291 THR B OG1 1 
ATOM 7668  C CG2 . THR B 2 291 ? 65.85172  10.28588  58.73375   1.000 128.46918 ? 291 THR B CG2 1 
ATOM 7669  N N   . ASN B 2 292 ? 64.76777  7.56943   62.69830   1.000 141.69652 ? 292 ASN B N   1 
ATOM 7670  C CA  . ASN B 2 292 ? 63.87552  7.20553   63.78895   1.000 144.23547 ? 292 ASN B CA  1 
ATOM 7671  C C   . ASN B 2 292 ? 64.15724  8.13925   64.95951   1.000 159.07961 ? 292 ASN B C   1 
ATOM 7672  O O   . ASN B 2 292 ? 65.30651  8.52432   65.19346   1.000 172.75232 ? 292 ASN B O   1 
ATOM 7673  C CB  . ASN B 2 292 ? 64.06348  5.74192   64.20189   1.000 131.29773 ? 292 ASN B CB  1 
ATOM 7674  C CG  . ASN B 2 292 ? 62.86013  4.87911   63.85761   1.000 131.16064 ? 292 ASN B CG  1 
ATOM 7675  O OD1 . ASN B 2 292 ? 62.08599  5.20267   62.95565   1.000 123.49405 ? 292 ASN B OD1 1 
ATOM 7676  N ND2 . ASN B 2 292 ? 62.70260  3.77110   64.57228   1.000 140.29459 ? 292 ASN B ND2 1 
ATOM 7677  N N   . SER B 2 293 ? 63.11200  8.48996   65.70209   1.000 163.44747 ? 293 SER B N   1 
ATOM 7678  C CA  . SER B 2 293 ? 63.28112  9.41216   66.81345   1.000 164.42440 ? 293 SER B CA  1 
ATOM 7679  C C   . SER B 2 293 ? 63.83536  8.68725   68.03535   1.000 166.79121 ? 293 SER B C   1 
ATOM 7680  O O   . SER B 2 293 ? 63.88152  7.45503   68.08403   1.000 151.99362 ? 293 SER B O   1 
ATOM 7681  C CB  . SER B 2 293 ? 61.95442  10.08953  67.15091   1.000 169.64428 ? 293 SER B CB  1 
ATOM 7682  O OG  . SER B 2 293 ? 61.32994  10.59442  65.98402   1.000 174.59431 ? 293 SER B OG  1 
ATOM 7683  N N   . GLN B 2 294 ? 64.21504  9.47404   69.05244   1.000 178.22293 ? 294 GLN B N   1 
ATOM 7684  C CA  . GLN B 2 294 ? 64.76290  8.91401   70.28496   1.000 177.83770 ? 294 GLN B CA  1 
ATOM 7685  C C   . GLN B 2 294 ? 65.81222  7.85138   69.99370   1.000 189.37387 ? 294 GLN B C   1 
ATOM 7686  O O   . GLN B 2 294 ? 65.50595  6.65748   70.07872   1.000 179.82510 ? 294 GLN B O   1 
ATOM 7687  C CB  . GLN B 2 294 ? 63.64871  8.33975   71.16046   1.000 155.48116 ? 294 GLN B CB  1 
ATOM 7688  C CG  . GLN B 2 294 ? 62.99216  9.37684   72.05300   1.000 144.38171 ? 294 GLN B CG  1 
ATOM 7689  C CD  . GLN B 2 294 ? 63.53243  9.34050   73.46749   1.000 145.35087 ? 294 GLN B CD  1 
ATOM 7690  O OE1 . GLN B 2 294 ? 63.99471  8.30245   73.93995   1.000 145.30778 ? 294 GLN B OE1 1 
ATOM 7691  N NE2 . GLN B 2 294 ? 63.48334  10.47864  74.15006   1.000 149.77770 ? 294 GLN B NE2 1 
ATOM 7692  N N   . ASP B 2 295 ? 67.03886  8.25277   69.64561   1.000 187.74040 ? 295 ASP B N   1 
ATOM 7693  C CA  . ASP B 2 295 ? 67.97472  7.28384   69.09018   1.000 186.56217 ? 295 ASP B CA  1 
ATOM 7694  C C   . ASP B 2 295 ? 68.23116  6.15168   70.08026   1.000 200.86626 ? 295 ASP B C   1 
ATOM 7695  O O   . ASP B 2 295 ? 69.16849  6.14313   70.88386   1.000 213.97974 ? 295 ASP B O   1 
ATOM 7696  C CB  . ASP B 2 295 ? 69.27375  7.97503   68.63406   1.000 176.15640 ? 295 ASP B CB  1 
ATOM 7697  C CG  . ASP B 2 295 ? 70.14502  8.44415   69.78513   1.000 171.43289 ? 295 ASP B CG  1 
ATOM 7698  O OD1 . ASP B 2 295 ? 71.20309  7.82018   70.02275   1.000 164.40717 ? 295 ASP B OD1 1 
ATOM 7699  O OD2 . ASP B 2 295 ? 69.77547  9.43394   70.44856   1.000 172.31860 ? 295 ASP B OD2 1 
ATOM 7700  N N   . THR B 2 296 ? 67.32202  5.18470   69.98621   1.000 191.72589 ? 296 THR B N   1 
ATOM 7701  C CA  . THR B 2 296 ? 67.42644  3.83803   70.51858   1.000 183.11702 ? 296 THR B CA  1 
ATOM 7702  C C   . THR B 2 296 ? 67.43524  2.84685   69.36777   1.000 192.79272 ? 296 THR B C   1 
ATOM 7703  O O   . THR B 2 296 ? 67.10508  1.66785   69.53681   1.000 210.37039 ? 296 THR B O   1 
ATOM 7704  C CB  . THR B 2 296 ? 66.27592  3.54438   71.48285   1.000 157.15090 ? 296 THR B CB  1 
ATOM 7705  O OG1 . THR B 2 296 ? 66.50454  2.28871   72.13379   1.000 157.17698 ? 296 THR B OG1 1 
ATOM 7706  C CG2 . THR B 2 296 ? 64.93550  3.51375   70.74500   1.000 131.56650 ? 296 THR B CG2 1 
ATOM 7707  N N   . GLU B 2 297 ? 67.83806  3.32557   68.19714   1.000 186.43505 ? 297 GLU B N   1 
ATOM 7708  C CA  . GLU B 2 297 ? 67.80954  2.58240   66.95451   1.000 155.60970 ? 297 GLU B CA  1 
ATOM 7709  C C   . GLU B 2 297 ? 69.22564  2.17636   66.59033   1.000 134.92772 ? 297 GLU B C   1 
ATOM 7710  O O   . GLU B 2 297 ? 70.16746  2.96121   66.73413   1.000 148.64393 ? 297 GLU B O   1 
ATOM 7711  C CB  . GLU B 2 297 ? 67.20606  3.44154   65.83528   1.000 147.45999 ? 297 GLU B CB  1 
ATOM 7712  C CG  . GLU B 2 297 ? 67.65519  4.91707   65.87725   1.000 139.83791 ? 297 GLU B CG  1 
ATOM 7713  C CD  . GLU B 2 297 ? 68.85294  5.23198   64.98925   1.000 128.69958 ? 297 GLU B CD  1 
ATOM 7714  O OE1 . GLU B 2 297 ? 69.43421  4.29600   64.40097   1.000 123.88973 ? 297 GLU B OE1 1 
ATOM 7715  O OE2 . GLU B 2 297 ? 69.22010  6.42455   64.88988   1.000 123.35303 ? 297 GLU B OE2 1 
ATOM 7716  N N   . LEU B 2 298 ? 69.36302  0.94020   66.12752   1.000 88.11189  ? 298 LEU B N   1 
ATOM 7717  C CA  . LEU B 2 298 ? 70.60460  0.44182   65.54975   1.000 83.97564  ? 298 LEU B CA  1 
ATOM 7718  C C   . LEU B 2 298 ? 70.18281  -0.09363  64.18778   1.000 87.39179  ? 298 LEU B C   1 
ATOM 7719  O O   . LEU B 2 298 ? 69.56148  -1.15636  64.09883   1.000 96.37202  ? 298 LEU B O   1 
ATOM 7720  C CB  . LEU B 2 298 ? 71.22994  -0.62901  66.44081   1.000 85.87071  ? 298 LEU B CB  1 
ATOM 7721  C CG  . LEU B 2 298 ? 72.71354  -0.97620  66.30747   1.000 99.53331  ? 298 LEU B CG  1 
ATOM 7722  C CD1 . LEU B 2 298 ? 72.96188  -1.89403  65.12319   1.000 121.73277 ? 298 LEU B CD1 1 
ATOM 7723  C CD2 . LEU B 2 298 ? 73.54868  0.28952   66.19908   1.000 100.05204 ? 298 LEU B CD2 1 
ATOM 7724  N N   . SER B 2 299 ? 70.51011  0.64242   63.13328   1.000 76.59239  ? 299 SER B N   1 
ATOM 7725  C CA  . SER B 2 299 ? 70.07194  0.31415   61.78236   1.000 73.36427  ? 299 SER B CA  1 
ATOM 7726  C C   . SER B 2 299 ? 71.26019  -0.22286  61.00089   1.000 72.76641  ? 299 SER B C   1 
ATOM 7727  O O   . SER B 2 299 ? 72.20348  0.51991   60.70948   1.000 73.89406  ? 299 SER B O   1 
ATOM 7728  C CB  . SER B 2 299 ? 69.46982  1.53866   61.09528   1.000 72.56329  ? 299 SER B CB  1 
ATOM 7729  O OG  . SER B 2 299 ? 68.34553  2.02239   61.80914   1.000 73.33116  ? 299 SER B OG  1 
ATOM 7730  N N   . PHE B 2 300 ? 71.21743  -1.50618  60.66105   1.000 70.32546  ? 300 PHE B N   1 
ATOM 7731  C CA  . PHE B 2 300 ? 72.26850  -2.11959  59.86673   1.000 69.77659  ? 300 PHE B CA  1 
ATOM 7732  C C   . PHE B 2 300 ? 71.72003  -2.48285  58.49551   1.000 66.64750  ? 300 PHE B C   1 
ATOM 7733  O O   . PHE B 2 300 ? 70.60867  -3.01079  58.37452   1.000 64.96322  ? 300 PHE B O   1 
ATOM 7734  C CB  . PHE B 2 300 ? 72.84875  -3.35594  60.55954   1.000 71.09175  ? 300 PHE B CB  1 
ATOM 7735  C CG  . PHE B 2 300 ? 73.97760  -3.04499  61.50395   1.000 74.39919  ? 300 PHE B CG  1 
ATOM 7736  C CD1 . PHE B 2 300 ? 74.34751  -1.73324  61.75370   1.000 78.72411  ? 300 PHE B CD1 1 
ATOM 7737  C CD2 . PHE B 2 300 ? 74.67378  -4.06232  62.13513   1.000 76.15298  ? 300 PHE B CD2 1 
ATOM 7738  C CE1 . PHE B 2 300 ? 75.38814  -1.44172  62.61681   1.000 95.16700  ? 300 PHE B CE1 1 
ATOM 7739  C CE2 . PHE B 2 300 ? 75.71495  -3.77664  63.00117   1.000 79.43629  ? 300 PHE B CE2 1 
ATOM 7740  C CZ  . PHE B 2 300 ? 76.07078  -2.46511  63.24219   1.000 80.98074  ? 300 PHE B CZ  1 
ATOM 7741  N N   . THR B 2 301 ? 72.51039  -2.19642  57.46771   1.000 74.24878  ? 301 THR B N   1 
ATOM 7742  C CA  . THR B 2 301 ? 72.14019  -2.45512  56.08586   1.000 68.48887  ? 301 THR B CA  1 
ATOM 7743  C C   . THR B 2 301 ? 73.00482  -3.58275  55.54545   1.000 69.62528  ? 301 THR B C   1 
ATOM 7744  O O   . THR B 2 301 ? 74.23358  -3.55643  55.69113   1.000 82.34761  ? 301 THR B O   1 
ATOM 7745  C CB  . THR B 2 301 ? 72.30485  -1.19949  55.22602   1.000 70.08706  ? 301 THR B CB  1 
ATOM 7746  O OG1 . THR B 2 301 ? 71.43825  -0.16657  55.71115   1.000 65.28711  ? 301 THR B OG1 1 
ATOM 7747  C CG2 . THR B 2 301 ? 71.96397  -1.49874  53.77661   1.000 68.45053  ? 301 THR B CG2 1 
ATOM 7748  N N   . ILE B 2 302 ? 72.36238  -4.56786  54.92611   1.000 61.07413  ? 302 ILE B N   1 
ATOM 7749  C CA  . ILE B 2 302 ? 73.05432  -5.67005  54.27438   1.000 60.67545  ? 302 ILE B CA  1 
ATOM 7750  C C   . ILE B 2 302 ? 72.85888  -5.53370  52.76981   1.000 58.55079  ? 302 ILE B C   1 
ATOM 7751  O O   . ILE B 2 302 ? 71.75291  -5.22890  52.29441   1.000 56.69802  ? 302 ILE B O   1 
ATOM 7752  C CB  . ILE B 2 302 ? 72.57610  -7.04264  54.79335   1.000 60.43156  ? 302 ILE B CB  1 
ATOM 7753  C CG1 . ILE B 2 302 ? 71.35633  -7.56395  54.02866   1.000 57.82689  ? 302 ILE B CG1 1 
ATOM 7754  C CG2 . ILE B 2 302 ? 72.22992  -6.96117  56.27027   1.000 62.18929  ? 302 ILE B CG2 1 
ATOM 7755  C CD1 . ILE B 2 302 ? 70.99805  -9.01091  54.34605   1.000 57.80098  ? 302 ILE B CD1 1 
ATOM 7756  N N   . THR B 2 303 ? 73.95510  -5.69265  52.03411   1.000 62.45023  ? 303 THR B N   1 
ATOM 7757  C CA  . THR B 2 303 ? 73.92699  -5.86492  50.59101   1.000 67.23646  ? 303 THR B CA  1 
ATOM 7758  C C   . THR B 2 303 ? 73.94808  -7.36278  50.32424   1.000 67.79368  ? 303 THR B C   1 
ATOM 7759  O O   . THR B 2 303 ? 74.89843  -8.05683  50.71539   1.000 63.45859  ? 303 THR B O   1 
ATOM 7760  C CB  . THR B 2 303 ? 75.11956  -5.17600  49.92782   1.000 69.79627  ? 303 THR B CB  1 
ATOM 7761  O OG1 . THR B 2 303 ? 75.06117  -3.76602  50.17562   1.000 67.01550  ? 303 THR B OG1 1 
ATOM 7762  C CG2 . THR B 2 303 ? 75.12196  -5.42850  48.42504   1.000 81.51103  ? 303 THR B CG2 1 
ATOM 7763  N N   . GLY B 2 304 ? 72.88943  -7.86279  49.68195   1.000 69.00199  ? 304 GLY B N   1 
ATOM 7764  C CA  . GLY B 2 304 ? 72.67356  -9.28152  49.54222   1.000 67.17313  ? 304 GLY B CA  1 
ATOM 7765  C C   . GLY B 2 304 ? 72.64008  -9.73437  48.09156   1.000 65.64351  ? 304 GLY B C   1 
ATOM 7766  O O   . GLY B 2 304 ? 72.61810  -8.93358  47.14852   1.000 61.72539  ? 304 GLY B O   1 
ATOM 7767  N N   . ASP B 2 305 ? 72.63181  -11.05409 47.93812   1.000 61.09021  ? 305 ASP B N   1 
ATOM 7768  C CA  . ASP B 2 305 ? 72.56650  -11.76031 46.66919   1.000 66.77931  ? 305 ASP B CA  1 
ATOM 7769  C C   . ASP B 2 305 ? 72.31955  -13.22210 46.99396   1.000 66.13041  ? 305 ASP B C   1 
ATOM 7770  O O   . ASP B 2 305 ? 72.84742  -13.73195 47.98388   1.000 64.74684  ? 305 ASP B O   1 
ATOM 7771  C CB  . ASP B 2 305 ? 73.86037  -11.59713 45.85913   1.000 95.23196  ? 305 ASP B CB  1 
ATOM 7772  C CG  . ASP B 2 305 ? 73.68009  -11.94462 44.39310   1.000 110.44225 ? 305 ASP B CG  1 
ATOM 7773  O OD1 . ASP B 2 305 ? 72.57743  -12.39606 44.01800   1.000 114.17436 ? 305 ASP B OD1 1 
ATOM 7774  O OD2 . ASP B 2 305 ? 74.64180  -11.76590 43.61537   1.000 113.72149 ? 305 ASP B OD2 1 
ATOM 7775  N N   . ASN B 2 306 ? 71.50299  -13.88056 46.18392   1.000 64.75655  ? 306 ASN B N   1 
ATOM 7776  C CA  . ASN B 2 306 ? 71.10143  -15.25873 46.43789   1.000 76.85144  ? 306 ASN B CA  1 
ATOM 7777  C C   . ASN B 2 306 ? 71.82468  -16.16666 45.45109   1.000 100.80518 ? 306 ASN B C   1 
ATOM 7778  O O   . ASN B 2 306 ? 71.57311  -16.10564 44.24311   1.000 125.76797 ? 306 ASN B O   1 
ATOM 7779  C CB  . ASN B 2 306 ? 69.58514  -15.40334 46.33490   1.000 73.06094  ? 306 ASN B CB  1 
ATOM 7780  C CG  . ASN B 2 306 ? 68.85370  -14.58457 47.38328   1.000 67.47515  ? 306 ASN B CG  1 
ATOM 7781  O OD1 . ASN B 2 306 ? 69.22236  -14.59088 48.55764   1.000 62.40896  ? 306 ASN B OD1 1 
ATOM 7782  N ND2 . ASN B 2 306 ? 67.82199  -13.86301 46.96086   1.000 81.59331  ? 306 ASN B ND2 1 
ATOM 7783  N N   . THR B 2 307 ? 72.71880  -17.00705 45.96642   1.000 89.51642  ? 307 THR B N   1 
ATOM 7784  C CA  . THR B 2 307 ? 73.47289  -17.91967 45.11998   1.000 101.86238 ? 307 THR B CA  1 
ATOM 7785  C C   . THR B 2 307 ? 72.58855  -19.08678 44.69858   1.000 80.42051  ? 307 THR B C   1 
ATOM 7786  O O   . THR B 2 307 ? 71.79893  -19.60803 45.49337   1.000 58.79709  ? 307 THR B O   1 
ATOM 7787  C CB  . THR B 2 307 ? 74.73231  -18.41759 45.83789   1.000 129.80779 ? 307 THR B CB  1 
ATOM 7788  O OG1 . THR B 2 307 ? 75.57941  -19.10588 44.90926   1.000 148.13151 ? 307 THR B OG1 1 
ATOM 7789  C CG2 . THR B 2 307 ? 74.38958  -19.33994 47.00662   1.000 128.92406 ? 307 THR B CG2 1 
ATOM 7790  N N   . LYS B 2 308 ? 72.70895  -19.47389 43.42673   1.000 124.16745 ? 308 LYS B N   1 
ATOM 7791  C CA  . LYS B 2 308 ? 71.85968  -20.50683 42.83074   1.000 112.76030 ? 308 LYS B CA  1 
ATOM 7792  C C   . LYS B 2 308 ? 70.38667  -20.21429 43.10443   1.000 90.44743  ? 308 LYS B C   1 
ATOM 7793  O O   . LYS B 2 308 ? 69.60099  -21.10128 43.44382   1.000 85.23106  ? 308 LYS B O   1 
ATOM 7794  C CB  . LYS B 2 308 ? 72.24740  -21.90504 43.32046   1.000 112.63916 ? 308 LYS B CB  1 
ATOM 7795  C CG  . LYS B 2 308 ? 73.61551  -22.38623 42.84280   1.000 117.95313 ? 308 LYS B CG  1 
ATOM 7796  C CD  . LYS B 2 308 ? 74.74173  -21.90958 43.74989   1.000 123.47758 ? 308 LYS B CD  1 
ATOM 7797  C CE  . LYS B 2 308 ? 76.08207  -21.89801 43.02605   1.000 109.36365 ? 308 LYS B CE  1 
ATOM 7798  N NZ  . LYS B 2 308 ? 76.16357  -20.81535 42.00612   1.000 96.95603  ? 308 LYS B NZ  1 
ATOM 7799  N N   . TRP B 2 309 ? 70.01800  -18.93969 42.95092   1.000 90.43389  ? 309 TRP B N   1 
ATOM 7800  C CA  . TRP B 2 309 ? 68.64578  -18.50323 43.18189   1.000 88.75668  ? 309 TRP B CA  1 
ATOM 7801  C C   . TRP B 2 309 ? 67.69193  -19.05968 42.13434   1.000 77.56027  ? 309 TRP B C   1 
ATOM 7802  O O   . TRP B 2 309 ? 66.52231  -19.32122 42.43589   1.000 68.19175  ? 309 TRP B O   1 
ATOM 7803  C CB  . TRP B 2 309 ? 68.60619  -16.97202 43.18018   1.000 103.88767 ? 309 TRP B CB  1 
ATOM 7804  C CG  . TRP B 2 309 ? 67.29623  -16.36084 42.77647   1.000 102.57670 ? 309 TRP B CG  1 
ATOM 7805  C CD1 . TRP B 2 309 ? 66.84987  -16.13345 41.50390   1.000 97.98124  ? 309 TRP B CD1 1 
ATOM 7806  C CD2 . TRP B 2 309 ? 66.28588  -15.85037 43.65061   1.000 90.66121  ? 309 TRP B CD2 1 
ATOM 7807  N NE1 . TRP B 2 309 ? 65.61192  -15.54162 41.53664   1.000 84.68881  ? 309 TRP B NE1 1 
ATOM 7808  C CE2 . TRP B 2 309 ? 65.24499  -15.35498 42.84292   1.000 80.46968  ? 309 TRP B CE2 1 
ATOM 7809  C CE3 . TRP B 2 309 ? 66.15311  -15.77617 45.03934   1.000 84.01852  ? 309 TRP B CE3 1 
ATOM 7810  C CZ2 . TRP B 2 309 ? 64.09181  -14.79136 43.37815   1.000 78.87121  ? 309 TRP B CZ2 1 
ATOM 7811  C CZ3 . TRP B 2 309 ? 65.00567  -15.21515 45.56617   1.000 71.67085  ? 309 TRP B CZ3 1 
ATOM 7812  C CH2 . TRP B 2 309 ? 63.99047  -14.73187 44.73818   1.000 73.57300  ? 309 TRP B CH2 1 
ATOM 7813  N N   . ASN B 2 310 ? 68.17273  -19.24400 40.90415   1.000 78.86756  ? 310 ASN B N   1 
ATOM 7814  C CA  . ASN B 2 310 ? 67.28899  -19.60335 39.79987   1.000 79.32700  ? 310 ASN B CA  1 
ATOM 7815  C C   . ASN B 2 310 ? 66.82126  -21.05185 39.89365   1.000 85.76315  ? 310 ASN B C   1 
ATOM 7816  O O   . ASN B 2 310 ? 65.65117  -21.34979 39.62675   1.000 77.55281  ? 310 ASN B O   1 
ATOM 7817  C CB  . ASN B 2 310 ? 68.00349  -19.35053 38.47268   1.000 92.99919  ? 310 ASN B CB  1 
ATOM 7818  C CG  . ASN B 2 310 ? 67.08904  -19.49993 37.27669   1.000 126.61739 ? 310 ASN B CG  1 
ATOM 7819  O OD1 . ASN B 2 310 ? 67.45889  -20.11382 36.27631   1.000 148.92541 ? 310 ASN B OD1 1 
ATOM 7820  N ND2 . ASN B 2 310 ? 65.88805  -18.94052 37.37209   1.000 134.51922 ? 310 ASN B ND2 1 
ATOM 7821  N N   . GLU B 2 311 ? 67.71565  -21.96375 40.27155   1.000 78.37535  ? 311 GLU B N   1 
ATOM 7822  C CA  . GLU B 2 311 ? 67.43550  -23.39341 40.20534   1.000 76.95600  ? 311 GLU B CA  1 
ATOM 7823  C C   . GLU B 2 311 ? 66.63335  -23.91761 41.38997   1.000 76.37894  ? 311 GLU B C   1 
ATOM 7824  O O   . GLU B 2 311 ? 66.31427  -25.11118 41.41445   1.000 84.70216  ? 311 GLU B O   1 
ATOM 7825  C CB  . GLU B 2 311 ? 68.74694  -24.17804 40.09137   1.000 79.33786  ? 311 GLU B CB  1 
ATOM 7826  C CG  . GLU B 2 311 ? 69.52819  -23.92059 38.80731   1.000 92.10069  ? 311 GLU B CG  1 
ATOM 7827  C CD  . GLU B 2 311 ? 70.33748  -22.63463 38.84941   1.000 109.13961 ? 311 GLU B CD  1 
ATOM 7828  O OE1 . GLU B 2 311 ? 70.26663  -21.90997 39.86536   1.000 117.37487 ? 311 GLU B OE1 1 
ATOM 7829  O OE2 . GLU B 2 311 ? 71.04573  -22.34819 37.86160   1.000 113.84950 ? 311 GLU B OE2 1 
ATOM 7830  N N   . ASN B 2 312 ? 66.29523  -23.07333 42.36360   1.000 72.76818  ? 312 ASN B N   1 
ATOM 7831  C CA  . ASN B 2 312 ? 65.52788  -23.52115 43.51836   1.000 76.00599  ? 312 ASN B CA  1 
ATOM 7832  C C   . ASN B 2 312 ? 64.04855  -23.17793 43.43326   1.000 83.68036  ? 312 ASN B C   1 
ATOM 7833  O O   . ASN B 2 312 ? 63.25242  -23.76101 44.17792   1.000 88.63230  ? 312 ASN B O   1 
ATOM 7834  C CB  . ASN B 2 312 ? 66.11049  -22.93758 44.81059   1.000 76.72505  ? 312 ASN B CB  1 
ATOM 7835  C CG  . ASN B 2 312 ? 67.45081  -23.54595 45.16723   1.000 93.63476  ? 312 ASN B CG  1 
ATOM 7836  O OD1 . ASN B 2 312 ? 68.44373  -22.84010 45.33788   1.000 134.47183 ? 312 ASN B OD1 1 
ATOM 7837  N ND2 . ASN B 2 312 ? 67.48600  -24.86871 45.27616   1.000 68.72868  ? 312 ASN B ND2 1 
ATOM 7838  N N   . GLN B 2 313 ? 63.66195  -22.25655 42.55534   1.000 89.98645  ? 313 GLN B N   1 
ATOM 7839  C CA  . GLN B 2 313 ? 62.26005  -21.87471 42.42722   1.000 91.32936  ? 313 GLN B CA  1 
ATOM 7840  C C   . GLN B 2 313 ? 61.50309  -22.99582 41.72677   1.000 85.01285  ? 313 GLN B C   1 
ATOM 7841  O O   . GLN B 2 313 ? 61.74999  -23.28428 40.55087   1.000 89.08388  ? 313 GLN B O   1 
ATOM 7842  C CB  . GLN B 2 313 ? 62.13949  -20.56564 41.65465   1.000 91.24382  ? 313 GLN B CB  1 
ATOM 7843  C CG  . GLN B 2 313 ? 63.12213  -19.49400 42.08981   1.000 89.51933  ? 313 GLN B CG  1 
ATOM 7844  C CD  . GLN B 2 313 ? 63.02011  -19.17362 43.56556   1.000 91.97786  ? 313 GLN B CD  1 
ATOM 7845  O OE1 . GLN B 2 313 ? 61.92795  -18.96160 44.09248   1.000 93.78751  ? 313 GLN B OE1 1 
ATOM 7846  N NE2 . GLN B 2 313 ? 64.16146  -19.14059 44.24389   1.000 93.48332  ? 313 GLN B NE2 1 
ATOM 7847  N N   . ASN B 2 314 ? 60.58423  -23.62788 42.44568   1.000 64.89616  ? 314 ASN B N   1 
ATOM 7848  C CA  . ASN B 2 314 ? 59.78612  -24.72083 41.90323   1.000 63.78046  ? 314 ASN B CA  1 
ATOM 7849  C C   . ASN B 2 314 ? 58.51620  -24.16500 41.26903   1.000 61.38119  ? 314 ASN B C   1 
ATOM 7850  O O   . ASN B 2 314 ? 57.77809  -23.42589 41.93072   1.000 58.30517  ? 314 ASN B O   1 
ATOM 7851  C CB  . ASN B 2 314 ? 59.43088  -25.71389 43.00122   1.000 80.13602  ? 314 ASN B CB  1 
ATOM 7852  C CG  . ASN B 2 314 ? 59.35675  -27.14151 42.49977   1.000 103.91092 ? 314 ASN B CG  1 
ATOM 7853  O OD1 . ASN B 2 314 ? 59.16941  -27.39016 41.31048   1.000 101.57042 ? 314 ASN B OD1 1 
ATOM 7854  N ND2 . ASN B 2 314 ? 59.51298  -28.09152 43.41174   1.000 124.97092 ? 314 ASN B ND2 1 
ATOM 7855  N N   . PRO B 2 315 ? 58.24015  -24.47454 39.99817   1.000 68.51021  ? 315 PRO B N   1 
ATOM 7856  C CA  . PRO B 2 315 ? 57.04520  -23.90987 39.34739   1.000 68.91374  ? 315 PRO B CA  1 
ATOM 7857  C C   . PRO B 2 315 ? 55.73945  -24.26326 40.03782   1.000 68.44396  ? 315 PRO B C   1 
ATOM 7858  O O   . PRO B 2 315 ? 54.74457  -23.55526 39.84132   1.000 64.68759  ? 315 PRO B O   1 
ATOM 7859  C CB  . PRO B 2 315 ? 57.10629  -24.49562 37.92880   1.000 67.86000  ? 315 PRO B CB  1 
ATOM 7860  C CG  . PRO B 2 315 ? 58.05146  -25.65457 38.02274   1.000 68.76612  ? 315 PRO B CG  1 
ATOM 7861  C CD  . PRO B 2 315 ? 59.05123  -25.26254 39.05784   1.000 74.28219  ? 315 PRO B CD  1 
ATOM 7862  N N   . ARG B 2 316 ? 55.70397  -25.33012 40.83844   1.000 62.47300  ? 316 ARG B N   1 
ATOM 7863  C CA  . ARG B 2 316 ? 54.50195  -25.62173 41.61054   1.000 72.04590  ? 316 ARG B CA  1 
ATOM 7864  C C   . ARG B 2 316 ? 54.25549  -24.55241 42.66952   1.000 53.43779  ? 316 ARG B C   1 
ATOM 7865  O O   . ARG B 2 316 ? 53.10058  -24.22937 42.96993   1.000 54.03370  ? 316 ARG B O   1 
ATOM 7866  C CB  . ARG B 2 316 ? 54.61704  -27.00894 42.24119   1.000 109.76182 ? 316 ARG B CB  1 
ATOM 7867  C CG  . ARG B 2 316 ? 55.92869  -27.24219 42.96636   1.000 127.41195 ? 316 ARG B CG  1 
ATOM 7868  C CD  . ARG B 2 316 ? 56.28820  -28.71818 43.04122   1.000 126.37508 ? 316 ARG B CD  1 
ATOM 7869  N NE  . ARG B 2 316 ? 56.70712  -29.27697 41.75819   1.000 113.04619 ? 316 ARG B NE  1 
ATOM 7870  C CZ  . ARG B 2 316 ? 55.98988  -30.14186 41.04836   1.000 89.67620  ? 316 ARG B CZ  1 
ATOM 7871  N NH1 . ARG B 2 316 ? 54.80935  -30.54940 41.49307   1.000 62.36366  ? 316 ARG B NH1 1 
ATOM 7872  N NH2 . ARG B 2 316 ? 56.45231  -30.59936 39.89341   1.000 90.63509  ? 316 ARG B NH2 1 
ATOM 7873  N N   . MET B 2 317 ? 55.32489  -23.97611 43.22433   1.000 58.28735  ? 317 MET B N   1 
ATOM 7874  C CA  . MET B 2 317 ? 55.17552  -22.84813 44.13992   1.000 57.83915  ? 317 MET B CA  1 
ATOM 7875  C C   . MET B 2 317 ? 54.60311  -21.63134 43.42213   1.000 58.56346  ? 317 MET B C   1 
ATOM 7876  O O   . MET B 2 317 ? 53.76489  -20.90661 43.97623   1.000 56.13315  ? 317 MET B O   1 
ATOM 7877  C CB  . MET B 2 317 ? 56.52524  -22.51541 44.77587   1.000 75.32181  ? 317 MET B CB  1 
ATOM 7878  C CG  . MET B 2 317 ? 56.53800  -21.25730 45.62511   1.000 120.19166 ? 317 MET B CG  1 
ATOM 7879  S SD  . MET B 2 317 ? 58.20110  -20.86556 46.19926   1.000 153.07844 ? 317 MET B SD  1 
ATOM 7880  C CE  . MET B 2 317 ? 59.05852  -20.69965 44.63601   1.000 135.42467 ? 317 MET B CE  1 
ATOM 7881  N N   . PHE B 2 318 ? 55.05804  -21.38215 42.19044   1.000 55.18254  ? 318 PHE B N   1 
ATOM 7882  C CA  . PHE B 2 318 ? 54.47333  -20.31151 41.39038   1.000 48.73737  ? 318 PHE B CA  1 
ATOM 7883  C C   . PHE B 2 318 ? 52.99627  -20.57097 41.13203   1.000 49.51631  ? 318 PHE B C   1 
ATOM 7884  O O   . PHE B 2 318 ? 52.17434  -19.65045 41.20309   1.000 51.74886  ? 318 PHE B O   1 
ATOM 7885  C CB  . PHE B 2 318 ? 55.21971  -20.17274 40.06368   1.000 44.93057  ? 318 PHE B CB  1 
ATOM 7886  C CG  . PHE B 2 318 ? 56.62264  -19.66360 40.20302   1.000 52.55857  ? 318 PHE B CG  1 
ATOM 7887  C CD1 . PHE B 2 318 ? 56.86922  -18.31322 40.37444   1.000 58.68129  ? 318 PHE B CD1 1 
ATOM 7888  C CD2 . PHE B 2 318 ? 57.69732  -20.53239 40.13771   1.000 72.05884  ? 318 PHE B CD2 1 
ATOM 7889  C CE1 . PHE B 2 318 ? 58.16071  -17.84065 40.49535   1.000 81.02530  ? 318 PHE B CE1 1 
ATOM 7890  C CE2 . PHE B 2 318 ? 58.99023  -20.06651 40.25542   1.000 95.92420  ? 318 PHE B CE2 1 
ATOM 7891  C CZ  . PHE B 2 318 ? 59.22301  -18.71911 40.43514   1.000 97.70429  ? 318 PHE B CZ  1 
ATOM 7892  N N   . LEU B 2 319 ? 52.64626  -21.81982 40.81374   1.000 50.17744  ? 319 LEU B N   1 
ATOM 7893  C CA  . LEU B 2 319 ? 51.24379  -22.18860 40.65291   1.000 53.97646  ? 319 LEU B CA  1 
ATOM 7894  C C   . LEU B 2 319 ? 50.44860  -21.88173 41.91473   1.000 59.63898  ? 319 LEU B C   1 
ATOM 7895  O O   . LEU B 2 319 ? 49.33993  -21.34068 41.84324   1.000 67.08229  ? 319 LEU B O   1 
ATOM 7896  C CB  . LEU B 2 319 ? 51.13113  -23.66940 40.29000   1.000 49.50358  ? 319 LEU B CB  1 
ATOM 7897  C CG  . LEU B 2 319 ? 49.73732  -24.29596 40.35051   1.000 51.72070  ? 319 LEU B CG  1 
ATOM 7898  C CD1 . LEU B 2 319 ? 48.80929  -23.64436 39.33808   1.000 63.14653  ? 319 LEU B CD1 1 
ATOM 7899  C CD2 . LEU B 2 319 ? 49.81678  -25.79611 40.12364   1.000 53.62314  ? 319 LEU B CD2 1 
ATOM 7900  N N   . ALA B 2 320 ? 51.00409  -22.22139 43.07974   1.000 59.29965  ? 320 ALA B N   1 
ATOM 7901  C CA  . ALA B 2 320 ? 50.31371  -21.97565 44.34296   1.000 57.82514  ? 320 ALA B CA  1 
ATOM 7902  C C   . ALA B 2 320 ? 50.09047  -20.48453 44.57287   1.000 56.58268  ? 320 ALA B C   1 
ATOM 7903  O O   . ALA B 2 320 ? 48.98095  -20.05374 44.91770   1.000 57.71177  ? 320 ALA B O   1 
ATOM 7904  C CB  . ALA B 2 320 ? 51.10962  -22.58314 45.49832   1.000 59.22971  ? 320 ALA B CB  1 
ATOM 7905  N N   . MET B 2 321 ? 51.13969  -19.67637 44.39398   1.000 52.70778  ? 321 MET B N   1 
ATOM 7906  C CA  . MET B 2 321 ? 50.99320  -18.24932 44.66505   1.000 51.81240  ? 321 MET B CA  1 
ATOM 7907  C C   . MET B 2 321 ? 50.09246  -17.56886 43.64015   1.000 51.02816  ? 321 MET B C   1 
ATOM 7908  O O   . MET B 2 321 ? 49.38331  -16.61844 43.98427   1.000 52.21057  ? 321 MET B O   1 
ATOM 7909  C CB  . MET B 2 321 ? 52.35815  -17.55898 44.72930   1.000 50.17169  ? 321 MET B CB  1 
ATOM 7910  C CG  . MET B 2 321 ? 53.13769  -17.51686 43.43037   1.000 82.36695  ? 321 MET B CG  1 
ATOM 7911  S SD  . MET B 2 321 ? 54.68412  -16.60483 43.62011   1.000 66.17193  ? 321 MET B SD  1 
ATOM 7912  C CE  . MET B 2 321 ? 55.59771  -17.69906 44.70624   1.000 65.61973  ? 321 MET B CE  1 
ATOM 7913  N N   . ILE B 2 322 ? 50.07827  -18.04804 42.39350   1.000 46.06219  ? 322 ILE B N   1 
ATOM 7914  C CA  . ILE B 2 322 ? 49.13806  -17.52001 41.40833   1.000 45.74586  ? 322 ILE B CA  1 
ATOM 7915  C C   . ILE B 2 322 ? 47.71063  -17.89214 41.79016   1.000 47.97952  ? 322 ILE B C   1 
ATOM 7916  O O   . ILE B 2 322 ? 46.79647  -17.05991 41.73258   1.000 49.50141  ? 322 ILE B O   1 
ATOM 7917  C CB  . ILE B 2 322 ? 49.49262  -18.02174 39.99658   1.000 44.63371  ? 322 ILE B CB  1 
ATOM 7918  C CG1 . ILE B 2 322 ? 50.75498  -17.32984 39.47802   1.000 42.60272  ? 322 ILE B CG1 1 
ATOM 7919  C CG2 . ILE B 2 322 ? 48.33238  -17.78566 39.04262   1.000 45.02225  ? 322 ILE B CG2 1 
ATOM 7920  C CD1 . ILE B 2 322 ? 51.17799  -17.77598 38.08999   1.000 52.00260  ? 322 ILE B CD1 1 
ATOM 7921  N N   . THR B 2 323 ? 47.49863  -19.15337 42.18012   1.000 49.89436  ? 323 THR B N   1 
ATOM 7922  C CA  . THR B 2 323 ? 46.17767  -19.59326 42.61321   1.000 52.48126  ? 323 THR B CA  1 
ATOM 7923  C C   . THR B 2 323 ? 45.67784  -18.77396 43.79330   1.000 53.66642  ? 323 THR B C   1 
ATOM 7924  O O   . THR B 2 323 ? 44.47465  -18.50897 43.89996   1.000 55.36367  ? 323 THR B O   1 
ATOM 7925  C CB  . THR B 2 323 ? 46.21978  -21.07901 42.97694   1.000 54.37582  ? 323 THR B CB  1 
ATOM 7926  O OG1 . THR B 2 323 ? 46.86206  -21.81266 41.92648   1.000 53.25711  ? 323 THR B OG1 1 
ATOM 7927  C CG2 . THR B 2 323 ? 44.81702  -21.62251 43.18202   1.000 57.30450  ? 323 THR B CG2 1 
ATOM 7928  N N   . TYR B 2 324 ? 46.57983  -18.35480 44.68290   1.000 62.29791  ? 324 TYR B N   1 
ATOM 7929  C CA  . TYR B 2 324 ? 46.13863  -17.49006 45.77272   1.000 63.46563  ? 324 TYR B CA  1 
ATOM 7930  C C   . TYR B 2 324 ? 45.88895  -16.06704 45.28475   1.000 62.15954  ? 324 TYR B C   1 
ATOM 7931  O O   . TYR B 2 324 ? 44.97616  -15.39501 45.77501   1.000 66.65723  ? 324 TYR B O   1 
ATOM 7932  C CB  . TYR B 2 324 ? 47.14087  -17.48408 46.92520   1.000 63.54585  ? 324 TYR B CB  1 
ATOM 7933  C CG  . TYR B 2 324 ? 46.60992  -16.71650 48.11730   1.000 76.09723  ? 324 TYR B CG  1 
ATOM 7934  C CD1 . TYR B 2 324 ? 45.65850  -17.28125 48.95732   1.000 68.39151  ? 324 TYR B CD1 1 
ATOM 7935  C CD2 . TYR B 2 324 ? 47.02857  -15.41972 48.38296   1.000 88.18213  ? 324 TYR B CD2 1 
ATOM 7936  C CE1 . TYR B 2 324 ? 45.15505  -16.58647 50.03959   1.000 70.14544  ? 324 TYR B CE1 1 
ATOM 7937  C CE2 . TYR B 2 324 ? 46.53029  -14.71567 49.46678   1.000 94.55275  ? 324 TYR B CE2 1 
ATOM 7938  C CZ  . TYR B 2 324 ? 45.59351  -15.30495 50.29032   1.000 78.54767  ? 324 TYR B CZ  1 
ATOM 7939  O OH  . TYR B 2 324 ? 45.09202  -14.61244 51.36858   1.000 70.87933  ? 324 TYR B OH  1 
ATOM 7940  N N   . ILE B 2 325 ? 46.70290  -15.58143 44.34359   1.000 54.38569  ? 325 ILE B N   1 
ATOM 7941  C CA  . ILE B 2 325 ? 46.47587  -14.24876 43.78980   1.000 53.40559  ? 325 ILE B CA  1 
ATOM 7942  C C   . ILE B 2 325 ? 45.15610  -14.21175 43.03128   1.000 67.49801  ? 325 ILE B C   1 
ATOM 7943  O O   . ILE B 2 325 ? 44.37096  -13.26382 43.16355   1.000 98.90144  ? 325 ILE B O   1 
ATOM 7944  C CB  . ILE B 2 325 ? 47.65668  -13.83057 42.89197   1.000 50.86639  ? 325 ILE B CB  1 
ATOM 7945  C CG1 . ILE B 2 325 ? 48.90860  -13.57721 43.73454   1.000 50.10928  ? 325 ILE B CG1 1 
ATOM 7946  C CG2 . ILE B 2 325 ? 47.30515  -12.59226 42.07444   1.000 54.46477  ? 325 ILE B CG2 1 
ATOM 7947  C CD1 . ILE B 2 325 ? 50.16540  -13.35953 42.91707   1.000 50.09944  ? 325 ILE B CD1 1 
ATOM 7948  N N   . THR B 2 326 ? 44.88305  -15.24616 42.23647   1.000 63.19057  ? 326 THR B N   1 
ATOM 7949  C CA  . THR B 2 326 ? 43.60934  -15.34737 41.53608   1.000 62.43379  ? 326 THR B CA  1 
ATOM 7950  C C   . THR B 2 326 ? 42.55454  -15.94433 42.46021   1.000 73.58298  ? 326 THR B C   1 
ATOM 7951  O O   . THR B 2 326 ? 41.87943  -16.91301 42.09817   1.000 80.31682  ? 326 THR B O   1 
ATOM 7952  C CB  . THR B 2 326 ? 43.75022  -16.19557 40.26934   1.000 56.86872  ? 326 THR B CB  1 
ATOM 7953  O OG1 . THR B 2 326 ? 44.14570  -17.52642 40.62354   1.000 63.37611  ? 326 THR B OG1 1 
ATOM 7954  C CG2 . THR B 2 326 ? 44.79146  -15.59633 39.33649   1.000 54.25076  ? 326 THR B CG2 1 
ATOM 7955  N N   . LYS B 2 327 ? 42.40563  -15.37268 43.65264   1.000 80.00943  ? 327 LYS B N   1 
ATOM 7956  C CA  . LYS B 2 327 ? 41.43037  -15.84464 44.62507   1.000 85.86827  ? 327 LYS B CA  1 
ATOM 7957  C C   . LYS B 2 327 ? 40.08029  -15.20202 44.33885   1.000 92.36830  ? 327 LYS B C   1 
ATOM 7958  O O   . LYS B 2 327 ? 39.99717  -13.98746 44.12871   1.000 80.83231  ? 327 LYS B O   1 
ATOM 7959  C CB  . LYS B 2 327 ? 41.89502  -15.51901 46.04554   1.000 104.12195 ? 327 LYS B CB  1 
ATOM 7960  C CG  . LYS B 2 327 ? 40.96256  -15.96410 47.15855   1.000 123.31732 ? 327 LYS B CG  1 
ATOM 7961  C CD  . LYS B 2 327 ? 41.57525  -15.64008 48.51575   1.000 107.84189 ? 327 LYS B CD  1 
ATOM 7962  C CE  . LYS B 2 327 ? 40.52946  -15.60412 49.61672   1.000 94.95116  ? 327 LYS B CE  1 
ATOM 7963  N NZ  . LYS B 2 327 ? 39.81069  -16.89811 49.74686   1.000 86.81713  ? 327 LYS B NZ  1 
ATOM 7964  N N   . ASN B 2 328 ? 39.03207  -16.02419 44.31632   1.000 100.04639 ? 328 ASN B N   1 
ATOM 7965  C CA  . ASN B 2 328 ? 37.65532  -15.61413 44.05124   1.000 91.49267  ? 328 ASN B CA  1 
ATOM 7966  C C   . ASN B 2 328 ? 37.48161  -14.96264 42.68300   1.000 94.00680  ? 328 ASN B C   1 
ATOM 7967  O O   . ASN B 2 328 ? 36.42987  -14.37025 42.41321   1.000 119.51315 ? 328 ASN B O   1 
ATOM 7968  C CB  . ASN B 2 328 ? 37.12686  -14.68092 45.14822   1.000 86.97724  ? 328 ASN B CB  1 
ATOM 7969  C CG  . ASN B 2 328 ? 36.97669  -15.38251 46.48419   1.000 107.62735 ? 328 ASN B CG  1 
ATOM 7970  O OD1 . ASN B 2 328 ? 36.63549  -16.56436 46.54417   1.000 110.03118 ? 328 ASN B OD1 1 
ATOM 7971  N ND2 . ASN B 2 328 ? 37.24184  -14.65837 47.56491   1.000 125.03106 ? 328 ASN B ND2 1 
ATOM 7972  N N   . GLN B 2 329 ? 38.48460  -15.05212 41.81497   1.000 81.99195  ? 329 GLN B N   1 
ATOM 7973  C CA  . GLN B 2 329 ? 38.39474  -14.53735 40.45988   1.000 90.64493  ? 329 GLN B CA  1 
ATOM 7974  C C   . GLN B 2 329 ? 37.63241  -15.52006 39.57394   1.000 102.46501 ? 329 GLN B C   1 
ATOM 7975  O O   . GLN B 2 329 ? 37.41895  -16.67344 39.95733   1.000 126.04983 ? 329 GLN B O   1 
ATOM 7976  C CB  . GLN B 2 329 ? 39.79648  -14.28834 39.90796   1.000 87.89248  ? 329 GLN B CB  1 
ATOM 7977  C CG  . GLN B 2 329 ? 40.57529  -13.20635 40.64289   1.000 79.41562  ? 329 GLN B CG  1 
ATOM 7978  C CD  . GLN B 2 329 ? 39.88001  -11.85566 40.61418   1.000 84.42437  ? 329 GLN B CD  1 
ATOM 7979  O OE1 . GLN B 2 329 ? 39.19048  -11.51569 39.65161   1.000 81.11185  ? 329 GLN B OE1 1 
ATOM 7980  N NE2 . GLN B 2 329 ? 40.05840  -11.07854 41.67565   1.000 93.39391  ? 329 GLN B NE2 1 
ATOM 7981  N N   . PRO B 2 330 ? 37.18805  -15.08538 38.39029   1.000 85.21331  ? 330 PRO B N   1 
ATOM 7982  C CA  . PRO B 2 330 ? 36.50944  -16.01779 37.48188   1.000 79.92456  ? 330 PRO B CA  1 
ATOM 7983  C C   . PRO B 2 330 ? 37.39717  -17.20330 37.13378   1.000 80.63349  ? 330 PRO B C   1 
ATOM 7984  O O   . PRO B 2 330 ? 38.62401  -17.09617 37.07256   1.000 79.45928  ? 330 PRO B O   1 
ATOM 7985  C CB  . PRO B 2 330 ? 36.20190  -15.15772 36.24791   1.000 79.13976  ? 330 PRO B CB  1 
ATOM 7986  C CG  . PRO B 2 330 ? 37.07408  -13.94437 36.38395   1.000 76.54202  ? 330 PRO B CG  1 
ATOM 7987  C CD  . PRO B 2 330 ? 37.18208  -13.71382 37.85464   1.000 79.95465  ? 330 PRO B CD  1 
ATOM 7988  N N   . GLU B 2 331 ? 36.75034  -18.34864 36.90549   1.000 75.78816  ? 331 GLU B N   1 
ATOM 7989  C CA  . GLU B 2 331 ? 37.48335  -19.59925 36.74032   1.000 92.51870  ? 331 GLU B CA  1 
ATOM 7990  C C   . GLU B 2 331 ? 38.34068  -19.60283 35.47987   1.000 88.57226  ? 331 GLU B C   1 
ATOM 7991  O O   . GLU B 2 331 ? 39.43182  -20.18502 35.48103   1.000 95.38555  ? 331 GLU B O   1 
ATOM 7992  C CB  . GLU B 2 331 ? 36.50627  -20.77601 36.73720   1.000 127.99449 ? 331 GLU B CB  1 
ATOM 7993  C CG  . GLU B 2 331 ? 37.16240  -22.13371 36.93639   1.000 144.00007 ? 331 GLU B CG  1 
ATOM 7994  C CD  . GLU B 2 331 ? 36.16414  -23.27481 36.89911   1.000 147.57028 ? 331 GLU B CD  1 
ATOM 7995  O OE1 . GLU B 2 331 ? 35.00144  -23.03703 36.50997   1.000 145.45986 ? 331 GLU B OE1 1 
ATOM 7996  O OE2 . GLU B 2 331 ? 36.54019  -24.40840 37.26519   1.000 147.73250 ? 331 GLU B OE2 1 
ATOM 7997  N N   . TRP B 2 332 ? 37.87775  -18.96201 34.40261   1.000 78.15259  ? 332 TRP B N   1 
ATOM 7998  C CA  . TRP B 2 332 ? 38.66770  -18.93928 33.17444   1.000 91.83114  ? 332 TRP B CA  1 
ATOM 7999  C C   . TRP B 2 332 ? 39.96536  -18.16348 33.35796   1.000 96.79194  ? 332 TRP B C   1 
ATOM 8000  O O   . TRP B 2 332 ? 40.98982  -18.52093 32.76575   1.000 122.07921 ? 332 TRP B O   1 
ATOM 8001  C CB  . TRP B 2 332 ? 37.85530  -18.34095 32.02366   1.000 99.50506  ? 332 TRP B CB  1 
ATOM 8002  C CG  . TRP B 2 332 ? 37.44907  -16.91004 32.22931   1.000 86.81681  ? 332 TRP B CG  1 
ATOM 8003  C CD1 . TRP B 2 332 ? 36.27504  -16.45574 32.75765   1.000 89.50513  ? 332 TRP B CD1 1 
ATOM 8004  C CD2 . TRP B 2 332 ? 38.21413  -15.74555 31.89186   1.000 60.10170  ? 332 TRP B CD2 1 
ATOM 8005  N NE1 . TRP B 2 332 ? 36.26594  -15.08097 32.77805   1.000 73.76603  ? 332 TRP B NE1 1 
ATOM 8006  C CE2 . TRP B 2 332 ? 37.44501  -14.62128 32.25210   1.000 66.12309  ? 332 TRP B CE2 1 
ATOM 8007  C CE3 . TRP B 2 332 ? 39.47712  -15.54543 31.32511   1.000 56.25982  ? 332 TRP B CE3 1 
ATOM 8008  C CZ2 . TRP B 2 332 ? 37.89731  -13.31611 32.06371   1.000 61.83362  ? 332 TRP B CZ2 1 
ATOM 8009  C CZ3 . TRP B 2 332 ? 39.92457  -14.24908 31.13981   1.000 55.01482  ? 332 TRP B CZ3 1 
ATOM 8010  C CH2 . TRP B 2 332 ? 39.13664  -13.15177 31.50744   1.000 56.35011  ? 332 TRP B CH2 1 
ATOM 8011  N N   . PHE B 2 333 ? 39.94179  -17.10599 34.17119   1.000 70.91496  ? 333 PHE B N   1 
ATOM 8012  C CA  . PHE B 2 333 ? 41.15496  -16.34040 34.43876   1.000 77.33535  ? 333 PHE B CA  1 
ATOM 8013  C C   . PHE B 2 333 ? 42.21217  -17.21289 35.10411   1.000 89.84347  ? 333 PHE B C   1 
ATOM 8014  O O   . PHE B 2 333 ? 43.38135  -17.22144 34.69495   1.000 110.99342 ? 333 PHE B O   1 
ATOM 8015  C CB  . PHE B 2 333 ? 40.81844  -15.13317 35.31384   1.000 76.44313  ? 333 PHE B CB  1 
ATOM 8016  C CG  . PHE B 2 333 ? 41.90531  -14.10234 35.37143   1.000 71.18830  ? 333 PHE B CG  1 
ATOM 8017  C CD1 . PHE B 2 333 ? 42.73318  -13.88785 34.28347   1.000 61.87606  ? 333 PHE B CD1 1 
ATOM 8018  C CD2 . PHE B 2 333 ? 42.09563  -13.34328 36.51310   1.000 80.97104  ? 333 PHE B CD2 1 
ATOM 8019  C CE1 . PHE B 2 333 ? 43.73093  -12.93615 34.33311   1.000 67.53949  ? 333 PHE B CE1 1 
ATOM 8020  C CE2 . PHE B 2 333 ? 43.09278  -12.39125 36.56914   1.000 81.30195  ? 333 PHE B CE2 1 
ATOM 8021  C CZ  . PHE B 2 333 ? 43.91053  -12.18621 35.47741   1.000 75.31240  ? 333 PHE B CZ  1 
ATOM 8022  N N   . ARG B 2 334 ? 41.81413  -17.95173 36.14264   1.000 98.52436  ? 334 ARG B N   1 
ATOM 8023  C CA  . ARG B 2 334 ? 42.74074  -18.85990 36.80749   1.000 90.62732  ? 334 ARG B CA  1 
ATOM 8024  C C   . ARG B 2 334 ? 43.20270  -19.95598 35.85730   1.000 107.43755 ? 334 ARG B C   1 
ATOM 8025  O O   . ARG B 2 334 ? 44.37512  -20.34750 35.87391   1.000 121.75263 ? 334 ARG B O   1 
ATOM 8026  C CB  . ARG B 2 334 ? 42.08703  -19.46114 38.05225   1.000 81.41789  ? 334 ARG B CB  1 
ATOM 8027  C CG  . ARG B 2 334 ? 41.30864  -18.44867 38.87789   1.000 81.38273  ? 334 ARG B CG  1 
ATOM 8028  C CD  . ARG B 2 334 ? 40.56676  -19.09700 40.03689   1.000 70.06699  ? 334 ARG B CD  1 
ATOM 8029  N NE  . ARG B 2 334 ? 41.44561  -19.37638 41.17017   1.000 59.17761  ? 334 ARG B NE  1 
ATOM 8030  C CZ  . ARG B 2 334 ? 41.03599  -19.91105 42.31625   1.000 66.99251  ? 334 ARG B CZ  1 
ATOM 8031  N NH1 . ARG B 2 334 ? 39.75902  -20.22969 42.48137   1.000 71.53694  ? 334 ARG B NH1 1 
ATOM 8032  N NH2 . ARG B 2 334 ? 41.90023  -20.12540 43.29773   1.000 64.21164  ? 334 ARG B NH2 1 
ATOM 8033  N N   . ASN B 2 335 ? 42.29353  -20.46502 35.02027   1.000 84.97873  ? 335 ASN B N   1 
ATOM 8034  C CA  . ASN B 2 335 ? 42.66878  -21.51194 34.07649   1.000 81.02970  ? 335 ASN B CA  1 
ATOM 8035  C C   . ASN B 2 335 ? 43.66721  -21.00918 33.04172   1.000 82.69373  ? 335 ASN B C   1 
ATOM 8036  O O   . ASN B 2 335 ? 44.47308  -21.79446 32.53241   1.000 90.37331  ? 335 ASN B O   1 
ATOM 8037  C CB  . ASN B 2 335 ? 41.42583  -22.06333 33.37796   1.000 80.05758  ? 335 ASN B CB  1 
ATOM 8038  C CG  . ASN B 2 335 ? 40.50995  -22.80946 34.32284   1.000 112.49920 ? 335 ASN B CG  1 
ATOM 8039  O OD1 . ASN B 2 335 ? 40.96073  -23.41583 35.29402   1.000 133.88668 ? 335 ASN B OD1 1 
ATOM 8040  N ND2 . ASN B 2 335 ? 39.21260  -22.76696 34.04416   1.000 121.84927 ? 335 ASN B ND2 1 
ATOM 8041  N N   . VAL B 2 336 ? 43.63128  -19.71647 32.71731   1.000 88.63647  ? 336 VAL B N   1 
ATOM 8042  C CA  . VAL B 2 336 ? 44.58611  -19.16747 31.75811   1.000 66.81633  ? 336 VAL B CA  1 
ATOM 8043  C C   . VAL B 2 336 ? 45.92917  -18.89230 32.42301   1.000 66.50342  ? 336 VAL B C   1 
ATOM 8044  O O   . VAL B 2 336 ? 46.98170  -19.30317 31.92104   1.000 91.45021  ? 336 VAL B O   1 
ATOM 8045  C CB  . VAL B 2 336 ? 44.02067  -17.89469 31.10009   1.000 67.60445  ? 336 VAL B CB  1 
ATOM 8046  C CG1 . VAL B 2 336 ? 45.13878  -17.10363 30.43825   1.000 50.41608  ? 336 VAL B CG1 1 
ATOM 8047  C CG2 . VAL B 2 336 ? 42.95249  -18.24780 30.08409   1.000 90.65696  ? 336 VAL B CG2 1 
ATOM 8048  N N   . LEU B 2 337 ? 45.91504  -18.19803 33.56458   1.000 65.11130  ? 337 LEU B N   1 
ATOM 8049  C CA  . LEU B 2 337 ? 47.16963  -17.77672 34.18378   1.000 62.91690  ? 337 LEU B CA  1 
ATOM 8050  C C   . LEU B 2 337 ? 47.97252  -18.94993 34.73140   1.000 63.56312  ? 337 LEU B C   1 
ATOM 8051  O O   . LEU B 2 337 ? 49.20329  -18.86468 34.81968   1.000 73.66981  ? 337 LEU B O   1 
ATOM 8052  C CB  . LEU B 2 337 ? 46.89866  -16.76784 35.29657   1.000 54.59696  ? 337 LEU B CB  1 
ATOM 8053  C CG  . LEU B 2 337 ? 46.47444  -15.37202 34.84444   1.000 58.73145  ? 337 LEU B CG  1 
ATOM 8054  C CD1 . LEU B 2 337 ? 46.54368  -14.40728 36.01134   1.000 68.69118  ? 337 LEU B CD1 1 
ATOM 8055  C CD2 . LEU B 2 337 ? 47.34217  -14.89215 33.69353   1.000 55.34621  ? 337 LEU B CD2 1 
ATOM 8056  N N   . SER B 2 338 ? 47.30856  -20.04216 35.10276   1.000 58.10175  ? 338 SER B N   1 
ATOM 8057  C CA  . SER B 2 338 ? 47.98444  -21.16676 35.73819   1.000 66.57993  ? 338 SER B CA  1 
ATOM 8058  C C   . SER B 2 338 ? 48.64022  -22.11538 34.74462   1.000 62.44835  ? 338 SER B C   1 
ATOM 8059  O O   . SER B 2 338 ? 49.18517  -23.13975 35.16603   1.000 66.03564  ? 338 SER B O   1 
ATOM 8060  C CB  . SER B 2 338 ? 47.00075  -21.94895 36.61347   1.000 58.62741  ? 338 SER B CB  1 
ATOM 8061  O OG  . SER B 2 338 ? 45.86499  -22.35869 35.87174   1.000 60.13792  ? 338 SER B OG  1 
ATOM 8062  N N   . ILE B 2 339 ? 48.61547  -21.80303 33.45004   1.000 61.99207  ? 339 ILE B N   1 
ATOM 8063  C CA  . ILE B 2 339 ? 49.13946  -22.73544 32.45834   1.000 73.88418  ? 339 ILE B CA  1 
ATOM 8064  C C   . ILE B 2 339 ? 50.66340  -22.74666 32.46493   1.000 71.59236  ? 339 ILE B C   1 
ATOM 8065  O O   . ILE B 2 339 ? 51.28292  -23.81384 32.40103   1.000 63.70831  ? 339 ILE B O   1 
ATOM 8066  C CB  . ILE B 2 339 ? 48.58301  -22.39314 31.06681   1.000 69.62960  ? 339 ILE B CB  1 
ATOM 8067  C CG1 . ILE B 2 339 ? 47.07452  -22.63449 31.03303   1.000 59.91118  ? 339 ILE B CG1 1 
ATOM 8068  C CG2 . ILE B 2 339 ? 49.30111  -23.20016 29.99388   1.000 65.06867  ? 339 ILE B CG2 1 
ATOM 8069  C CD1 . ILE B 2 339 ? 46.66166  -24.01987 31.47171   1.000 58.98156  ? 339 ILE B CD1 1 
ATOM 8070  N N   . ALA B 2 340 ? 51.28873  -21.56988 32.52195   1.000 65.63370  ? 340 ALA B N   1 
ATOM 8071  C CA  . ALA B 2 340 ? 52.74959  -21.50298 32.50513   1.000 68.55977  ? 340 ALA B CA  1 
ATOM 8072  C C   . ALA B 2 340 ? 53.39763  -22.27577 33.64972   1.000 70.17744  ? 340 ALA B C   1 
ATOM 8073  O O   . ALA B 2 340 ? 54.37209  -23.00658 33.39365   1.000 88.22641  ? 340 ALA B O   1 
ATOM 8074  C CB  . ALA B 2 340 ? 53.19713  -20.03709 32.48838   1.000 63.87659  ? 340 ALA B CB  1 
ATOM 8075  N N   . PRO B 2 341 ? 52.94710  -22.16403 34.90863   1.000 55.57657  ? 341 PRO B N   1 
ATOM 8076  C CA  . PRO B 2 341 ? 53.56628  -22.99026 35.96076   1.000 53.37922  ? 341 PRO B CA  1 
ATOM 8077  C C   . PRO B 2 341 ? 53.39028  -24.48083 35.73117   1.000 61.55485  ? 341 PRO B C   1 
ATOM 8078  O O   . PRO B 2 341 ? 54.29708  -25.26227 36.04284   1.000 68.45207  ? 341 PRO B O   1 
ATOM 8079  C CB  . PRO B 2 341 ? 52.85685  -22.51924 37.23880   1.000 53.94211  ? 341 PRO B CB  1 
ATOM 8080  C CG  . PRO B 2 341 ? 52.35611  -21.16017 36.91667   1.000 63.97623  ? 341 PRO B CG  1 
ATOM 8081  C CD  . PRO B 2 341 ? 51.96707  -21.22016 35.47687   1.000 59.57581  ? 341 PRO B CD  1 
ATOM 8082  N N   . ILE B 2 342 ? 52.24112  -24.89887 35.19649   1.000 51.42063  ? 342 ILE B N   1 
ATOM 8083  C CA  . ILE B 2 342 ? 52.01780  -26.31592 34.92659   1.000 73.15300  ? 342 ILE B CA  1 
ATOM 8084  C C   . ILE B 2 342 ? 52.95490  -26.80444 33.82932   1.000 100.23661 ? 342 ILE B C   1 
ATOM 8085  O O   . ILE B 2 342 ? 53.52226  -27.90026 33.91933   1.000 123.39346 ? 342 ILE B O   1 
ATOM 8086  C CB  . ILE B 2 342 ? 50.54135  -26.55721 34.56245   1.000 64.69625  ? 342 ILE B CB  1 
ATOM 8087  C CG1 . ILE B 2 342 ? 49.63705  -26.21858 35.74941   1.000 69.23254  ? 342 ILE B CG1 1 
ATOM 8088  C CG2 . ILE B 2 342 ? 50.32588  -27.99342 34.11184   1.000 57.00628  ? 342 ILE B CG2 1 
ATOM 8089  C CD1 . ILE B 2 342 ? 48.16388  -26.20618 35.41000   1.000 72.86518  ? 342 ILE B CD1 1 
ATOM 8090  N N   . MET B 2 343 ? 53.14055  -25.99815 32.78144   1.000 101.70435 ? 343 MET B N   1 
ATOM 8091  C CA  . MET B 2 343 ? 54.06522  -26.37318 31.71759   1.000 96.37827  ? 343 MET B CA  1 
ATOM 8092  C C   . MET B 2 343 ? 55.50502  -26.40157 32.21060   1.000 84.84268  ? 343 MET B C   1 
ATOM 8093  O O   . MET B 2 343 ? 56.30293  -27.22302 31.74432   1.000 89.55692  ? 343 MET B O   1 
ATOM 8094  C CB  . MET B 2 343 ? 53.92808  -25.41207 30.53708   1.000 73.45630  ? 343 MET B CB  1 
ATOM 8095  C CG  . MET B 2 343 ? 52.52273  -25.32872 29.97015   1.000 62.86923  ? 343 MET B CG  1 
ATOM 8096  S SD  . MET B 2 343 ? 52.44455  -24.42113 28.41613   1.000 68.05958  ? 343 MET B SD  1 
ATOM 8097  C CE  . MET B 2 343 ? 53.16991  -25.61024 27.29039   1.000 72.32299  ? 343 MET B CE  1 
ATOM 8098  N N   . PHE B 2 344 ? 55.85579  -25.51922 33.14669   1.000 55.95273  ? 344 PHE B N   1 
ATOM 8099  C CA  . PHE B 2 344 ? 57.19469  -25.53675 33.72235   1.000 64.78161  ? 344 PHE B CA  1 
ATOM 8100  C C   . PHE B 2 344 ? 57.39454  -26.67436 34.71500   1.000 56.79231  ? 344 PHE B C   1 
ATOM 8101  O O   . PHE B 2 344 ? 58.53809  -27.07712 34.95283   1.000 60.53587  ? 344 PHE B O   1 
ATOM 8102  C CB  . PHE B 2 344 ? 57.49280  -24.19549 34.39253   1.000 100.38508 ? 344 PHE B CB  1 
ATOM 8103  C CG  . PHE B 2 344 ? 57.74123  -23.07875 33.42006   1.000 110.22489 ? 344 PHE B CG  1 
ATOM 8104  C CD1 . PHE B 2 344 ? 57.99503  -23.34989 32.08539   1.000 106.43064 ? 344 PHE B CD1 1 
ATOM 8105  C CD2 . PHE B 2 344 ? 57.71408  -21.75938 33.83681   1.000 106.57408 ? 344 PHE B CD2 1 
ATOM 8106  C CE1 . PHE B 2 344 ? 58.22108  -22.32734 31.18720   1.000 95.66367  ? 344 PHE B CE1 1 
ATOM 8107  C CE2 . PHE B 2 344 ? 57.93925  -20.73199 32.94202   1.000 93.30357  ? 344 PHE B CE2 1 
ATOM 8108  C CZ  . PHE B 2 344 ? 58.19196  -21.01691 31.61626   1.000 89.72138  ? 344 PHE B CZ  1 
ATOM 8109  N N   . SER B 2 345 ? 56.31549  -27.19056 35.30705   1.000 71.10455  ? 345 SER B N   1 
ATOM 8110  C CA  . SER B 2 345 ? 56.44481  -28.33776 36.19937   1.000 83.63600  ? 345 SER B CA  1 
ATOM 8111  C C   . SER B 2 345 ? 56.80484  -29.59443 35.41935   1.000 77.80064  ? 345 SER B C   1 
ATOM 8112  O O   . SER B 2 345 ? 57.58935  -30.42555 35.89187   1.000 69.77600  ? 345 SER B O   1 
ATOM 8113  C CB  . SER B 2 345 ? 55.15088  -28.54081 36.98683   1.000 97.73315  ? 345 SER B CB  1 
ATOM 8114  O OG  . SER B 2 345 ? 55.20435  -29.72348 37.76654   1.000 117.09068 ? 345 SER B OG  1 
ATOM 8115  N N   . ASN B 2 346 ? 56.24152  -29.74989 34.22591   1.000 72.29790  ? 346 ASN B N   1 
ATOM 8116  C CA  . ASN B 2 346 ? 56.52231  -30.88847 33.36009   1.000 75.18890  ? 346 ASN B CA  1 
ATOM 8117  C C   . ASN B 2 346 ? 57.21768  -30.34217 32.11646   1.000 73.54919  ? 346 ASN B C   1 
ATOM 8118  O O   . ASN B 2 346 ? 56.58903  -30.07590 31.09082   1.000 76.84420  ? 346 ASN B O   1 
ATOM 8119  C CB  . ASN B 2 346 ? 55.23333  -31.64042 33.01448   1.000 89.04484  ? 346 ASN B CB  1 
ATOM 8120  C CG  . ASN B 2 346 ? 54.31634  -31.80968 34.21344   1.000 97.63679  ? 346 ASN B CG  1 
ATOM 8121  O OD1 . ASN B 2 346 ? 53.14627  -31.42573 34.17018   1.000 106.02630 ? 346 ASN B OD1 1 
ATOM 8122  N ND2 . ASN B 2 346 ? 54.84073  -32.38909 35.28805   1.000 97.78046  ? 346 ASN B ND2 1 
ATOM 8123  N N   . LYS B 2 347 ? 58.53412  -30.18134 32.21113   1.000 72.78915  ? 347 LYS B N   1 
ATOM 8124  C CA  . LYS B 2 347 ? 59.30555  -29.58356 31.13403   1.000 73.04677  ? 347 LYS B CA  1 
ATOM 8125  C C   . LYS B 2 347 ? 60.58445  -30.37799 30.92456   1.000 74.58169  ? 347 LYS B C   1 
ATOM 8126  O O   . LYS B 2 347 ? 61.11306  -30.99729 31.85229   1.000 78.42204  ? 347 LYS B O   1 
ATOM 8127  C CB  . LYS B 2 347 ? 59.65216  -28.11807 31.42452   1.000 67.08958  ? 347 LYS B CB  1 
ATOM 8128  C CG  . LYS B 2 347 ? 60.60227  -27.94029 32.59152   1.000 69.36278  ? 347 LYS B CG  1 
ATOM 8129  C CD  . LYS B 2 347 ? 60.91368  -26.47937 32.84739   1.000 66.00680  ? 347 LYS B CD  1 
ATOM 8130  C CE  . LYS B 2 347 ? 61.83295  -26.32381 34.04742   1.000 61.23206  ? 347 LYS B CE  1 
ATOM 8131  N NZ  . LYS B 2 347 ? 61.18952  -26.81864 35.29729   1.000 60.26514  ? 347 LYS B NZ  1 
ATOM 8132  N N   . MET B 2 348 ? 61.07348  -30.35522 29.69108   1.000 71.77507  ? 348 MET B N   1 
ATOM 8133  C CA  . MET B 2 348 ? 62.31790  -31.00512 29.32147   1.000 79.92518  ? 348 MET B CA  1 
ATOM 8134  C C   . MET B 2 348 ? 63.35807  -29.95385 28.95756   1.000 73.69776  ? 348 MET B C   1 
ATOM 8135  O O   . MET B 2 348 ? 63.02485  -28.84873 28.52386   1.000 67.10569  ? 348 MET B O   1 
ATOM 8136  C CB  . MET B 2 348 ? 62.11361  -31.97340 28.14941   1.000 85.07838  ? 348 MET B CB  1 
ATOM 8137  C CG  . MET B 2 348 ? 60.93403  -32.93023 28.30744   1.000 77.81280  ? 348 MET B CG  1 
ATOM 8138  S SD  . MET B 2 348 ? 61.05767  -34.02903 29.73460   1.000 63.44885  ? 348 MET B SD  1 
ATOM 8139  C CE  . MET B 2 348 ? 59.54839  -33.62474 30.61316   1.000 61.92196  ? 348 MET B CE  1 
ATOM 8140  N N   . ALA B 2 349 ? 64.62195  -30.29676 29.17044   1.000 63.78930  ? 349 ALA B N   1 
ATOM 8141  C CA  . ALA B 2 349 ? 65.74794  -29.43976 28.82555   1.000 63.19938  ? 349 ALA B CA  1 
ATOM 8142  C C   . ALA B 2 349 ? 66.50417  -30.07234 27.66519   1.000 64.98630  ? 349 ALA B C   1 
ATOM 8143  O O   . ALA B 2 349 ? 66.94199  -31.22448 27.76076   1.000 67.25980  ? 349 ALA B O   1 
ATOM 8144  C CB  . ALA B 2 349 ? 66.67049  -29.23385 30.02681   1.000 63.51590  ? 349 ALA B CB  1 
ATOM 8145  N N   . ARG B 2 350 ? 66.64778  -29.32538 26.57254   1.000 66.35052  ? 350 ARG B N   1 
ATOM 8146  C CA  . ARG B 2 350 ? 67.39675  -29.80946 25.42198   1.000 71.56270  ? 350 ARG B CA  1 
ATOM 8147  C C   . ARG B 2 350 ? 68.89018  -29.69588 25.69250   1.000 83.01785  ? 350 ARG B C   1 
ATOM 8148  O O   . ARG B 2 350 ? 69.37207  -28.65243 26.14474   1.000 78.46835  ? 350 ARG B O   1 
ATOM 8149  C CB  . ARG B 2 350 ? 67.03004  -29.02728 24.16144   1.000 74.13639  ? 350 ARG B CB  1 
ATOM 8150  C CG  . ARG B 2 350 ? 67.63057  -29.62137 22.89660   1.000 81.44468  ? 350 ARG B CG  1 
ATOM 8151  C CD  . ARG B 2 350 ? 67.27748  -28.81935 21.65647   1.000 88.26976  ? 350 ARG B CD  1 
ATOM 8152  N NE  . ARG B 2 350 ? 67.72792  -29.49114 20.44046   1.000 109.77549 ? 350 ARG B NE  1 
ATOM 8153  C CZ  . ARG B 2 350 ? 67.68595  -28.95147 19.22669   1.000 133.65218 ? 350 ARG B CZ  1 
ATOM 8154  N NH1 . ARG B 2 350 ? 68.11978  -29.63870 18.17885   1.000 138.80239 ? 350 ARG B NH1 1 
ATOM 8155  N NH2 . ARG B 2 350 ? 67.21742  -27.72230 19.06018   1.000 146.91442 ? 350 ARG B NH2 1 
ATOM 8156  N N   . LEU B 2 351 ? 69.62160  -30.77581 25.41830   1.000 87.48984  ? 351 LEU B N   1 
ATOM 8157  C CA  . LEU B 2 351 ? 71.05585  -30.78189 25.67934   1.000 81.36597  ? 351 LEU B CA  1 
ATOM 8158  C C   . LEU B 2 351 ? 71.81344  -29.96424 24.63853   1.000 92.84936  ? 351 LEU B C   1 
ATOM 8159  O O   . LEU B 2 351 ? 72.61292  -29.09043 24.99040   1.000 121.46960 ? 351 LEU B O   1 
ATOM 8160  C CB  . LEU B 2 351 ? 71.56736  -32.22077 25.72993   1.000 72.04085  ? 351 LEU B CB  1 
ATOM 8161  C CG  . LEU B 2 351 ? 70.83768  -33.10250 26.74642   1.000 72.34745  ? 351 LEU B CG  1 
ATOM 8162  C CD1 . LEU B 2 351 ? 71.37885  -34.52284 26.73214   1.000 75.81085  ? 351 LEU B CD1 1 
ATOM 8163  C CD2 . LEU B 2 351 ? 70.93445  -32.49967 28.13950   1.000 71.05515  ? 351 LEU B CD2 1 
ATOM 8164  N N   . GLY B 2 352 ? 71.57243  -30.22443 23.35442   1.000 100.96566 ? 352 GLY B N   1 
ATOM 8165  C CA  . GLY B 2 352 ? 72.17982  -29.41107 22.31939   1.000 103.28031 ? 352 GLY B CA  1 
ATOM 8166  C C   . GLY B 2 352 ? 72.88875  -30.17068 21.21715   1.000 113.69313 ? 352 GLY B C   1 
ATOM 8167  O O   . GLY B 2 352 ? 72.37875  -31.16926 20.69948   1.000 108.98470 ? 352 GLY B O   1 
ATOM 8168  N N   . LYS B 2 353 ? 74.08018  -29.69148 20.85349   1.000 118.77185 ? 353 LYS B N   1 
ATOM 8169  C CA  . LYS B 2 353 ? 74.80384  -30.24522 19.71343   1.000 121.10840 ? 353 LYS B CA  1 
ATOM 8170  C C   . LYS B 2 353 ? 75.34791  -31.63162 20.03255   1.000 108.66116 ? 353 LYS B C   1 
ATOM 8171  O O   . LYS B 2 353 ? 75.12579  -32.58809 19.28155   1.000 109.67588 ? 353 LYS B O   1 
ATOM 8172  C CB  . LYS B 2 353 ? 75.93855  -29.29887 19.32105   1.000 139.64657 ? 353 LYS B CB  1 
ATOM 8173  C CG  . LYS B 2 353 ? 75.48316  -27.88212 19.00436   1.000 148.70183 ? 353 LYS B CG  1 
ATOM 8174  C CD  . LYS B 2 353 ? 76.66828  -26.96889 18.73214   1.000 156.34396 ? 353 LYS B CD  1 
ATOM 8175  C CE  . LYS B 2 353 ? 76.22081  -25.53037 18.52653   1.000 148.26488 ? 353 LYS B CE  1 
ATOM 8176  N NZ  . LYS B 2 353 ? 77.37318  -24.61410 18.30353   1.000 145.99375 ? 353 LYS B NZ  1 
ATOM 8177  N N   . GLY B 2 354 ? 76.06935  -31.75544 21.14233   1.000 112.10157 ? 354 GLY B N   1 
ATOM 8178  C CA  . GLY B 2 354 ? 76.67106  -33.01272 21.53337   1.000 110.18769 ? 354 GLY B CA  1 
ATOM 8179  C C   . GLY B 2 354 ? 78.13472  -32.87480 21.89291   1.000 101.88161 ? 354 GLY B C   1 
ATOM 8180  O O   . GLY B 2 354 ? 78.57830  -31.79969 22.30714   1.000 95.53477  ? 354 GLY B O   1 
ATOM 8181  N N   . TYR B 2 355 ? 78.89388  -33.95201 21.73837   1.000 101.95649 ? 355 TYR B N   1 
ATOM 8182  C CA  . TYR B 2 355 ? 80.32235  -33.97273 22.02423   1.000 112.45745 ? 355 TYR B CA  1 
ATOM 8183  C C   . TYR B 2 355 ? 81.08795  -34.36786 20.76603   1.000 127.08100 ? 355 TYR B C   1 
ATOM 8184  O O   . TYR B 2 355 ? 80.50307  -34.68888 19.73118   1.000 128.87954 ? 355 TYR B O   1 
ATOM 8185  C CB  . TYR B 2 355 ? 80.63364  -34.92070 23.18570   1.000 111.44211 ? 355 TYR B CB  1 
ATOM 8186  C CG  . TYR B 2 355 ? 80.44357  -34.29239 24.54774   1.000 120.25323 ? 355 TYR B CG  1 
ATOM 8187  C CD1 . TYR B 2 355 ? 80.29994  -32.91795 24.68494   1.000 121.71669 ? 355 TYR B CD1 1 
ATOM 8188  C CD2 . TYR B 2 355 ? 80.40316  -35.07214 25.69561   1.000 140.07486 ? 355 TYR B CD2 1 
ATOM 8189  C CE1 . TYR B 2 355 ? 80.12499  -32.33679 25.92663   1.000 139.96735 ? 355 TYR B CE1 1 
ATOM 8190  C CE2 . TYR B 2 355 ? 80.22786  -34.49935 26.94277   1.000 153.87532 ? 355 TYR B CE2 1 
ATOM 8191  C CZ  . TYR B 2 355 ? 80.08953  -33.13166 27.05196   1.000 156.12810 ? 355 TYR B CZ  1 
ATOM 8192  O OH  . TYR B 2 355 ? 79.91547  -32.55642 28.29003   1.000 165.88909 ? 355 TYR B OH  1 
ATOM 8193  N N   . MET B 2 356 ? 82.41451  -34.34642 20.86347   1.000 122.87897 ? 356 MET B N   1 
ATOM 8194  C CA  . MET B 2 356 ? 83.27229  -34.69367 19.73931   1.000 146.59681 ? 356 MET B CA  1 
ATOM 8195  C C   . MET B 2 356 ? 84.48406  -35.45790 20.24639   1.000 160.67834 ? 356 MET B C   1 
ATOM 8196  O O   . MET B 2 356 ? 85.10131  -35.06115 21.23903   1.000 166.32128 ? 356 MET B O   1 
ATOM 8197  C CB  . MET B 2 356 ? 83.71283  -33.44327 18.96945   1.000 163.32910 ? 356 MET B CB  1 
ATOM 8198  C CG  . MET B 2 356 ? 84.47333  -33.74307 17.68890   1.000 187.73304 ? 356 MET B CG  1 
ATOM 8199  S SD  . MET B 2 356 ? 84.60828  -32.31167 16.60042   1.000 205.67950 ? 356 MET B SD  1 
ATOM 8200  C CE  . MET B 2 356 ? 85.61862  -31.21657 17.59440   1.000 199.00597 ? 356 MET B CE  1 
ATOM 8201  N N   . PHE B 2 357 ? 84.81838  -36.54873 19.56335   1.000 155.89589 ? 357 PHE B N   1 
ATOM 8202  C CA  . PHE B 2 357 ? 85.92087  -37.41698 19.94162   1.000 156.74931 ? 357 PHE B CA  1 
ATOM 8203  C C   . PHE B 2 357 ? 87.00091  -37.33501 18.87486   1.000 152.88630 ? 357 PHE B C   1 
ATOM 8204  O O   . PHE B 2 357 ? 86.69947  -37.25430 17.67856   1.000 164.04637 ? 357 PHE B O   1 
ATOM 8205  C CB  . PHE B 2 357 ? 85.47431  -38.87923 20.06634   1.000 167.87179 ? 357 PHE B CB  1 
ATOM 8206  C CG  . PHE B 2 357 ? 84.35194  -39.11142 21.03922   1.000 167.98941 ? 357 PHE B CG  1 
ATOM 8207  C CD1 . PHE B 2 357 ? 84.08720  -38.21983 22.06478   1.000 176.14095 ? 357 PHE B CD1 1 
ATOM 8208  C CD2 . PHE B 2 357 ? 83.55410  -40.23775 20.91546   1.000 158.53275 ? 357 PHE B CD2 1 
ATOM 8209  C CE1 . PHE B 2 357 ? 83.04818  -38.45128 22.94951   1.000 176.22425 ? 357 PHE B CE1 1 
ATOM 8210  C CE2 . PHE B 2 357 ? 82.51754  -40.47378 21.79332   1.000 159.40870 ? 357 PHE B CE2 1 
ATOM 8211  C CZ  . PHE B 2 357 ? 82.26309  -39.58054 22.81195   1.000 168.63673 ? 357 PHE B CZ  1 
ATOM 8212  N N   . GLU B 2 358 ? 88.25560  -37.36508 19.31518   1.000 159.15054 ? 358 GLU B N   1 
ATOM 8213  C CA  . GLU B 2 358 ? 89.41261  -37.28167 18.43627   1.000 158.87759 ? 358 GLU B CA  1 
ATOM 8214  C C   . GLU B 2 358 ? 90.29228  -38.50219 18.65680   1.000 175.24329 ? 358 GLU B C   1 
ATOM 8215  O O   . GLU B 2 358 ? 90.61413  -38.83980 19.80104   1.000 184.05910 ? 358 GLU B O   1 
ATOM 8216  C CB  . GLU B 2 358 ? 90.21390  -36.00166 18.69319   1.000 158.49196 ? 358 GLU B CB  1 
ATOM 8217  C CG  . GLU B 2 358 ? 91.56443  -35.96538 17.99154   1.000 173.69227 ? 358 GLU B CG  1 
ATOM 8218  C CD  . GLU B 2 358 ? 92.52555  -34.97536 18.62120   1.000 179.11707 ? 358 GLU B CD  1 
ATOM 8219  O OE1 . GLU B 2 358 ? 92.18638  -34.40576 19.67988   1.000 175.45828 ? 358 GLU B OE1 1 
ATOM 8220  O OE2 . GLU B 2 358 ? 93.62184  -34.76944 18.05882   1.000 182.36378 ? 358 GLU B OE2 1 
ATOM 8221  N N   . SER B 2 359 ? 90.67952  -39.15988 17.56842   1.000 173.33940 ? 359 SER B N   1 
ATOM 8222  C CA  . SER B 2 359 ? 91.61149  -40.27661 17.63879   1.000 201.43847 ? 359 SER B CA  1 
ATOM 8223  C C   . SER B 2 359 ? 93.03105  -39.73741 17.51136   1.000 209.84593 ? 359 SER B C   1 
ATOM 8224  O O   . SER B 2 359 ? 93.36868  -39.09419 16.51091   1.000 215.36925 ? 359 SER B O   1 
ATOM 8225  C CB  . SER B 2 359 ? 91.31900  -41.30185 16.54452   1.000 214.03426 ? 359 SER B CB  1 
ATOM 8226  O OG  . SER B 2 359 ? 91.54893  -40.75442 15.25856   1.000 222.86935 ? 359 SER B OG  1 
ATOM 8227  N N   . LYS B 2 360 ? 93.86101  -39.99998 18.52306   1.000 196.69587 ? 360 LYS B N   1 
ATOM 8228  C CA  . LYS B 2 360 ? 95.22753  -39.49153 18.49530   1.000 203.80564 ? 360 LYS B CA  1 
ATOM 8229  C C   . LYS B 2 360 ? 96.07746  -40.23746 17.47517   1.000 212.20786 ? 360 LYS B C   1 
ATOM 8230  O O   . LYS B 2 360 ? 97.04569  -39.67833 16.94792   1.000 224.00840 ? 360 LYS B O   1 
ATOM 8231  C CB  . LYS B 2 360 ? 95.85097  -39.58134 19.88897   1.000 207.98352 ? 360 LYS B CB  1 
ATOM 8232  C CG  . LYS B 2 360 ? 97.22221  -38.93053 20.00324   1.000 213.14891 ? 360 LYS B CG  1 
ATOM 8233  C CD  . LYS B 2 360 ? 97.13763  -37.42653 19.78002   1.000 208.42218 ? 360 LYS B CD  1 
ATOM 8234  C CE  . LYS B 2 360 ? 98.49462  -36.75997 19.95281   1.000 210.60273 ? 360 LYS B CE  1 
ATOM 8235  N NZ  . LYS B 2 360 ? 98.44133  -35.29556 19.68128   1.000 213.41020 ? 360 LYS B NZ  1 
ATOM 8236  N N   . SER B 2 361 ? 95.72553  -41.48733 17.17320   1.000 198.69543 ? 361 SER B N   1 
ATOM 8237  C CA  . SER B 2 361 ? 96.49522  -42.31310 16.24920   1.000 195.64961 ? 361 SER B CA  1 
ATOM 8238  C C   . SER B 2 361 ? 95.91450  -42.28122 14.83916   1.000 205.64009 ? 361 SER B C   1 
ATOM 8239  O O   . SER B 2 361 ? 96.61465  -41.93216 13.88412   1.000 214.47772 ? 361 SER B O   1 
ATOM 8240  C CB  . SER B 2 361 ? 96.56252  -43.75509 16.76884   1.000 180.97545 ? 361 SER B CB  1 
ATOM 8241  O OG  . SER B 2 361 ? 95.27092  -44.33491 16.82962   1.000 169.27531 ? 361 SER B OG  1 
ATOM 8242  N N   . MET B 2 362 ? 94.63890  -42.64478 14.68943   1.000 192.72120 ? 362 MET B N   1 
ATOM 8243  C CA  . MET B 2 362 ? 94.03333  -42.70373 13.36446   1.000 183.49889 ? 362 MET B CA  1 
ATOM 8244  C C   . MET B 2 362 ? 93.79590  -41.32741 12.75895   1.000 186.06024 ? 362 MET B C   1 
ATOM 8245  O O   . MET B 2 362 ? 93.53313  -41.24262 11.55406   1.000 185.21163 ? 362 MET B O   1 
ATOM 8246  C CB  . MET B 2 362 ? 92.71058  -43.46905 13.42566   1.000 168.50201 ? 362 MET B CB  1 
ATOM 8247  C CG  . MET B 2 362 ? 92.85950  -44.95521 13.69505   1.000 159.46558 ? 362 MET B CG  1 
ATOM 8248  S SD  . MET B 2 362 ? 93.69192  -45.80983 12.34373   1.000 152.81650 ? 362 MET B SD  1 
ATOM 8249  C CE  . MET B 2 362 ? 92.53305  -45.52723 11.00772   1.000 143.97235 ? 362 MET B CE  1 
ATOM 8250  N N   . LYS B 2 363 ? 93.89154  -40.26203 13.55287   1.000 185.80610 ? 363 LYS B N   1 
ATOM 8251  C CA  . LYS B 2 363 ? 93.66617  -38.89235 13.09432   1.000 187.02966 ? 363 LYS B CA  1 
ATOM 8252  C C   . LYS B 2 363 ? 92.31249  -38.75806 12.39502   1.000 193.18381 ? 363 LYS B C   1 
ATOM 8253  O O   . LYS B 2 363 ? 92.21387  -38.41314 11.21625   1.000 194.60394 ? 363 LYS B O   1 
ATOM 8254  C CB  . LYS B 2 363 ? 94.81075  -38.41429 12.19702   1.000 185.05908 ? 363 LYS B CB  1 
ATOM 8255  C CG  . LYS B 2 363 ? 96.13780  -38.29354 12.92845   1.000 168.60779 ? 363 LYS B CG  1 
ATOM 8256  C CD  . LYS B 2 363 ? 97.19792  -37.61500 12.07574   1.000 149.19334 ? 363 LYS B CD  1 
ATOM 8257  C CE  . LYS B 2 363 ? 97.56107  -38.44751 10.85786   1.000 142.81256 ? 363 LYS B CE  1 
ATOM 8258  N NZ  . LYS B 2 363 ? 98.64338  -37.80653 10.05949   1.000 142.48991 ? 363 LYS B NZ  1 
ATOM 8259  N N   . LEU B 2 364 ? 91.25917  -39.05043 13.15449   1.000 199.75321 ? 364 LEU B N   1 
ATOM 8260  C CA  . LEU B 2 364 ? 89.89260  -38.88438 12.68318   1.000 191.37148 ? 364 LEU B CA  1 
ATOM 8261  C C   . LEU B 2 364 ? 89.03345  -38.47977 13.87159   1.000 181.14430 ? 364 LEU B C   1 
ATOM 8262  O O   . LEU B 2 364 ? 89.19035  -39.01739 14.97090   1.000 188.74954 ? 364 LEU B O   1 
ATOM 8263  C CB  . LEU B 2 364 ? 89.35442  -40.16031 12.01786   1.000 189.69369 ? 364 LEU B CB  1 
ATOM 8264  C CG  . LEU B 2 364 ? 89.48431  -41.51910 12.71424   1.000 181.82508 ? 364 LEU B CG  1 
ATOM 8265  C CD1 . LEU B 2 364 ? 88.31061  -41.79214 13.64591   1.000 176.25951 ? 364 LEU B CD1 1 
ATOM 8266  C CD2 . LEU B 2 364 ? 89.61402  -42.62566 11.67912   1.000 174.41096 ? 364 LEU B CD2 1 
ATOM 8267  N N   . ARG B 2 365 ? 88.13679  -37.52324 13.64499   1.000 166.91802 ? 365 ARG B N   1 
ATOM 8268  C CA  . ARG B 2 365 ? 87.24128  -37.02757 14.67767   1.000 151.51502 ? 365 ARG B CA  1 
ATOM 8269  C C   . ARG B 2 365 ? 85.79496  -37.31410 14.30213   1.000 139.48730 ? 365 ARG B C   1 
ATOM 8270  O O   . ARG B 2 365 ? 85.43456  -37.35132 13.12155   1.000 129.13762 ? 365 ARG B O   1 
ATOM 8271  C CB  . ARG B 2 365 ? 87.42745  -35.52104 14.91144   1.000 157.45669 ? 365 ARG B CB  1 
ATOM 8272  C CG  . ARG B 2 365 ? 87.18237  -34.65483 13.68599   1.000 161.06943 ? 365 ARG B CG  1 
ATOM 8273  C CD  . ARG B 2 365 ? 87.28567  -33.17604 14.03077   1.000 165.89818 ? 365 ARG B CD  1 
ATOM 8274  N NE  . ARG B 2 365 ? 88.58576  -32.83275 14.59903   1.000 170.87004 ? 365 ARG B NE  1 
ATOM 8275  C CZ  . ARG B 2 365 ? 88.91274  -31.62204 15.03899   1.000 167.94732 ? 365 ARG B CZ  1 
ATOM 8276  N NH1 . ARG B 2 365 ? 88.03240  -30.63223 14.97814   1.000 167.20827 ? 365 ARG B NH1 1 
ATOM 8277  N NH2 . ARG B 2 365 ? 90.12020  -31.40033 15.54097   1.000 162.65334 ? 365 ARG B NH2 1 
ATOM 8278  N N   . THR B 2 366 ? 84.97175  -37.52187 15.32479   1.000 142.11577 ? 366 THR B N   1 
ATOM 8279  C CA  . THR B 2 366 ? 83.56466  -37.83971 15.12953   1.000 151.45286 ? 366 THR B CA  1 
ATOM 8280  C C   . THR B 2 366 ? 82.71731  -37.13207 16.17509   1.000 148.30920 ? 366 THR B C   1 
ATOM 8281  O O   . THR B 2 366 ? 83.08692  -37.07305 17.34967   1.000 151.02191 ? 366 THR B O   1 
ATOM 8282  C CB  . THR B 2 366 ? 83.31683  -39.35242 15.19705   1.000 155.79288 ? 366 THR B CB  1 
ATOM 8283  O OG1 . THR B 2 366 ? 81.90737  -39.61177 15.17746   1.000 156.47862 ? 366 THR B OG1 1 
ATOM 8284  C CG2 . THR B 2 366 ? 83.93027  -39.94748 16.46003   1.000 152.30969 ? 366 THR B CG2 1 
ATOM 8285  N N   . GLN B 2 367 ? 81.57875  -36.59949 15.74691   1.000 137.68751 ? 367 GLN B N   1 
ATOM 8286  C CA  . GLN B 2 367 ? 80.66724  -35.92709 16.65715   1.000 142.01512 ? 367 GLN B CA  1 
ATOM 8287  C C   . GLN B 2 367 ? 79.54617  -36.87744 17.05753   1.000 161.87530 ? 367 GLN B C   1 
ATOM 8288  O O   . GLN B 2 367 ? 79.13912  -37.75170 16.28792   1.000 172.71050 ? 367 GLN B O   1 
ATOM 8289  C CB  . GLN B 2 367 ? 80.08533  -34.65827 16.02353   1.000 134.74353 ? 367 GLN B CB  1 
ATOM 8290  C CG  . GLN B 2 367 ? 78.87780  -34.88577 15.12307   1.000 143.31839 ? 367 GLN B CG  1 
ATOM 8291  C CD  . GLN B 2 367 ? 79.24732  -35.40912 13.74698   1.000 167.44942 ? 367 GLN B CD  1 
ATOM 8292  O OE1 . GLN B 2 367 ? 80.39006  -35.79350 13.49737   1.000 181.14624 ? 367 GLN B OE1 1 
ATOM 8293  N NE2 . GLN B 2 367 ? 78.27376  -35.42791 12.84393   1.000 172.71877 ? 367 GLN B NE2 1 
ATOM 8294  N N   . ILE B 2 368 ? 79.06721  -36.71320 18.28525   1.000 155.03478 ? 368 ILE B N   1 
ATOM 8295  C CA  . ILE B 2 368 ? 77.95563  -37.50917 18.79539   1.000 142.54483 ? 368 ILE B CA  1 
ATOM 8296  C C   . ILE B 2 368 ? 76.88187  -36.55847 19.31483   1.000 136.40837 ? 368 ILE B C   1 
ATOM 8297  O O   . ILE B 2 368 ? 77.18019  -35.65003 20.10511   1.000 128.24134 ? 368 ILE B O   1 
ATOM 8298  C CB  . ILE B 2 368 ? 78.42690  -38.51272 19.86315   1.000 129.39108 ? 368 ILE B CB  1 
ATOM 8299  C CG1 . ILE B 2 368 ? 79.18642  -37.81715 20.99833   1.000 129.92311 ? 368 ILE B CG1 1 
ATOM 8300  C CG2 . ILE B 2 368 ? 79.30223  -39.58471 19.22708   1.000 126.29447 ? 368 ILE B CG2 1 
ATOM 8301  C CD1 . ILE B 2 368 ? 78.36275  -37.59643 22.26000   1.000 135.75580 ? 368 ILE B CD1 1 
ATOM 8302  N N   . PRO B 2 369 ? 75.64128  -36.69807 18.86834   1.000 134.32476 ? 369 PRO B N   1 
ATOM 8303  C CA  . PRO B 2 369 ? 74.57046  -35.80359 19.31435   1.000 125.25881 ? 369 PRO B CA  1 
ATOM 8304  C C   . PRO B 2 369 ? 74.08069  -36.19485 20.70522   1.000 115.84099 ? 369 PRO B C   1 
ATOM 8305  O O   . PRO B 2 369 ? 74.54553  -37.15734 21.31248   1.000 115.76373 ? 369 PRO B O   1 
ATOM 8306  C CB  . PRO B 2 369 ? 73.47556  -36.00288 18.25747   1.000 132.25814 ? 369 PRO B CB  1 
ATOM 8307  C CG  . PRO B 2 369 ? 74.14372  -36.72353 17.11589   1.000 136.04593 ? 369 PRO B CG  1 
ATOM 8308  C CD  . PRO B 2 369 ? 75.20802  -37.55161 17.75230   1.000 139.07069 ? 369 PRO B CD  1 
ATOM 8309  N N   . ALA B 2 370 ? 73.11843  -35.41782 21.20518   1.000 121.62660 ? 370 ALA B N   1 
ATOM 8310  C CA  . ALA B 2 370 ? 72.55201  -35.69656 22.51978   1.000 124.24549 ? 370 ALA B CA  1 
ATOM 8311  C C   . ALA B 2 370 ? 71.62450  -36.90420 22.49591   1.000 122.11081 ? 370 ALA B C   1 
ATOM 8312  O O   . ALA B 2 370 ? 71.48094  -37.59347 23.51206   1.000 124.95395 ? 370 ALA B O   1 
ATOM 8313  C CB  . ALA B 2 370 ? 71.80521  -34.46971 23.03601   1.000 128.14404 ? 370 ALA B CB  1 
ATOM 8314  N N   . GLU B 2 371 ? 70.98617  -37.17156 21.35549   1.000 131.81204 ? 371 GLU B N   1 
ATOM 8315  C CA  . GLU B 2 371 ? 70.05419  -38.28823 21.24981   1.000 143.45361 ? 371 GLU B CA  1 
ATOM 8316  C C   . GLU B 2 371 ? 70.73953  -39.64078 21.39655   1.000 140.83835 ? 371 GLU B C   1 
ATOM 8317  O O   . GLU B 2 371 ? 70.08384  -40.61510 21.78160   1.000 136.97027 ? 371 GLU B O   1 
ATOM 8318  C CB  . GLU B 2 371 ? 69.30729  -38.21808 19.91632   1.000 150.44840 ? 371 GLU B CB  1 
ATOM 8319  C CG  . GLU B 2 371 ? 68.30011  -37.07615 19.82601   1.000 147.69218 ? 371 GLU B CG  1 
ATOM 8320  C CD  . GLU B 2 371 ? 68.94542  -35.72578 19.55407   1.000 143.95685 ? 371 GLU B CD  1 
ATOM 8321  O OE1 . GLU B 2 371 ? 70.18999  -35.65688 19.46041   1.000 141.73378 ? 371 GLU B OE1 1 
ATOM 8322  O OE2 . GLU B 2 371 ? 68.20206  -34.72846 19.43854   1.000 141.55829 ? 371 GLU B OE2 1 
ATOM 8323  N N   . MET B 2 372 ? 72.03353  -39.72348 21.09894   1.000 121.30044 ? 372 MET B N   1 
ATOM 8324  C CA  . MET B 2 372 ? 72.78095  -40.97241 21.14981   1.000 122.64730 ? 372 MET B CA  1 
ATOM 8325  C C   . MET B 2 372 ? 73.34218  -41.27597 22.53607   1.000 124.47056 ? 372 MET B C   1 
ATOM 8326  O O   . MET B 2 372 ? 74.07217  -42.25981 22.69349   1.000 135.98402 ? 372 MET B O   1 
ATOM 8327  C CB  . MET B 2 372 ? 73.91947  -40.93845 20.12711   1.000 122.34322 ? 372 MET B CB  1 
ATOM 8328  C CG  . MET B 2 372 ? 74.31524  -42.29971 19.58396   1.000 118.91480 ? 372 MET B CG  1 
ATOM 8329  S SD  . MET B 2 372 ? 75.89252  -42.24747 18.71873   1.000 118.81129 ? 372 MET B SD  1 
ATOM 8330  C CE  . MET B 2 372 ? 77.01923  -42.26866 20.10874   1.000 122.27284 ? 372 MET B CE  1 
ATOM 8331  N N   . LEU B 2 373 ? 73.01787  -40.46090 23.54190   1.000 127.80577 ? 373 LEU B N   1 
ATOM 8332  C CA  . LEU B 2 373 ? 73.52284  -40.70377 24.88869   1.000 126.02824 ? 373 LEU B CA  1 
ATOM 8333  C C   . LEU B 2 373 ? 72.92054  -41.94794 25.52892   1.000 124.09849 ? 373 LEU B C   1 
ATOM 8334  O O   . LEU B 2 373 ? 73.49600  -42.47342 26.48736   1.000 126.07246 ? 373 LEU B O   1 
ATOM 8335  C CB  . LEU B 2 373 ? 73.25591  -39.48748 25.77834   1.000 120.86076 ? 373 LEU B CB  1 
ATOM 8336  C CG  . LEU B 2 373 ? 74.39922  -38.48164 25.93436   1.000 102.05537 ? 373 LEU B CG  1 
ATOM 8337  C CD1 . LEU B 2 373 ? 74.71446  -37.80340 24.61157   1.000 98.41531  ? 373 LEU B CD1 1 
ATOM 8338  C CD2 . LEU B 2 373 ? 74.06633  -37.44854 27.00184   1.000 95.61593  ? 373 LEU B CD2 1 
ATOM 8339  N N   . ALA B 2 374 ? 71.78153  -42.42869 25.02955   1.000 126.97165 ? 374 ALA B N   1 
ATOM 8340  C CA  . ALA B 2 374 ? 71.16678  -43.62467 25.59773   1.000 126.24641 ? 374 ALA B CA  1 
ATOM 8341  C C   . ALA B 2 374 ? 71.92905  -44.88590 25.20279   1.000 139.64579 ? 374 ALA B C   1 
ATOM 8342  O O   . ALA B 2 374 ? 72.34897  -45.66937 26.06220   1.000 141.41159 ? 374 ALA B O   1 
ATOM 8343  C CB  . ALA B 2 374 ? 69.70368  -43.71692 25.16138   1.000 120.57461 ? 374 ALA B CB  1 
ATOM 8344  N N   . SER B 2 375 ? 72.11638  -45.09920 23.90256   1.000 129.65333 ? 375 SER B N   1 
ATOM 8345  C CA  . SER B 2 375 ? 72.76359  -46.30942 23.39628   1.000 139.05476 ? 375 SER B CA  1 
ATOM 8346  C C   . SER B 2 375 ? 74.25182  -46.05543 23.15396   1.000 136.99054 ? 375 SER B C   1 
ATOM 8347  O O   . SER B 2 375 ? 74.72232  -45.93358 22.02250   1.000 145.46868 ? 375 SER B O   1 
ATOM 8348  C CB  . SER B 2 375 ? 72.06287  -46.78960 22.12815   1.000 147.09533 ? 375 SER B CB  1 
ATOM 8349  O OG  . SER B 2 375 ? 70.72356  -47.16783 22.39650   1.000 155.05291 ? 375 SER B OG  1 
ATOM 8350  N N   . ILE B 2 376 ? 74.99898  -45.97303 24.25570   1.000 131.78005 ? 376 ILE B N   1 
ATOM 8351  C CA  . ILE B 2 376 ? 76.44292  -45.77957 24.18771   1.000 124.33541 ? 376 ILE B CA  1 
ATOM 8352  C C   . ILE B 2 376 ? 77.08090  -46.38657 25.42991   1.000 128.38070 ? 376 ILE B C   1 
ATOM 8353  O O   . ILE B 2 376 ? 76.45964  -46.47584 26.49275   1.000 126.85379 ? 376 ILE B O   1 
ATOM 8354  C CB  . ILE B 2 376 ? 76.81872  -44.28405 24.03790   1.000 113.53943 ? 376 ILE B CB  1 
ATOM 8355  C CG1 . ILE B 2 376 ? 78.26734  -44.13889 23.56235   1.000 115.03651 ? 376 ILE B CG1 1 
ATOM 8356  C CG2 . ILE B 2 376 ? 76.60024  -43.53282 25.34367   1.000 111.13236 ? 376 ILE B CG2 1 
ATOM 8357  C CD1 . ILE B 2 376 ? 78.68762  -42.71091 23.30085   1.000 113.53505 ? 376 ILE B CD1 1 
ATOM 8358  N N   . ASP B 2 377 ? 78.32776  -46.82254 25.27954   1.000 148.01422 ? 377 ASP B N   1 
ATOM 8359  C CA  . ASP B 2 377 ? 79.12971  -47.34072 26.37601   1.000 150.68694 ? 377 ASP B CA  1 
ATOM 8360  C C   . ASP B 2 377 ? 79.89998  -46.20370 27.04383   1.000 144.02953 ? 377 ASP B C   1 
ATOM 8361  O O   . ASP B 2 377 ? 80.14918  -45.15477 26.44679   1.000 145.12203 ? 377 ASP B O   1 
ATOM 8362  C CB  . ASP B 2 377 ? 80.09109  -48.41963 25.87326   1.000 152.27937 ? 377 ASP B CB  1 
ATOM 8363  C CG  . ASP B 2 377 ? 80.83110  -49.11575 26.99972   1.000 146.44153 ? 377 ASP B CG  1 
ATOM 8364  O OD1 . ASP B 2 377 ? 80.18658  -49.86689 27.76127   1.000 142.65243 ? 377 ASP B OD1 1 
ATOM 8365  O OD2 . ASP B 2 377 ? 82.05698  -48.91148 27.12382   1.000 146.05054 ? 377 ASP B OD2 1 
ATOM 8366  N N   . LEU B 2 378 ? 80.27878  -46.42633 28.30039   1.000 140.43649 ? 378 LEU B N   1 
ATOM 8367  C CA  . LEU B 2 378 ? 80.93410  -45.40776 29.11967   1.000 147.17577 ? 378 LEU B CA  1 
ATOM 8368  C C   . LEU B 2 378 ? 82.43938  -45.62398 29.22178   1.000 162.90717 ? 378 LEU B C   1 
ATOM 8369  O O   . LEU B 2 378 ? 83.02773  -45.44687 30.28993   1.000 165.59234 ? 378 LEU B O   1 
ATOM 8370  C CB  . LEU B 2 378 ? 80.30539  -45.35272 30.51043   1.000 142.36705 ? 378 LEU B CB  1 
ATOM 8371  C CG  . LEU B 2 378 ? 78.97053  -44.61549 30.68667   1.000 135.54960 ? 378 LEU B CG  1 
ATOM 8372  C CD1 . LEU B 2 378 ? 77.83561  -45.24264 29.88675   1.000 135.11866 ? 378 LEU B CD1 1 
ATOM 8373  C CD2 . LEU B 2 378 ? 78.59783  -44.52116 32.16290   1.000 134.55574 ? 378 LEU B CD2 1 
ATOM 8374  N N   . LYS B 2 379 ? 83.08612  -46.03261 28.13239   1.000 162.68303 ? 379 LYS B N   1 
ATOM 8375  C CA  . LYS B 2 379 ? 84.54029  -46.12699 28.08859   1.000 154.67397 ? 379 LYS B CA  1 
ATOM 8376  C C   . LYS B 2 379 ? 85.18560  -44.95121 27.36800   1.000 134.70506 ? 379 LYS B C   1 
ATOM 8377  O O   . LYS B 2 379 ? 86.32664  -44.59395 27.67808   1.000 122.18900 ? 379 LYS B O   1 
ATOM 8378  C CB  . LYS B 2 379 ? 84.96782  -47.43661 27.41196   1.000 156.22170 ? 379 LYS B CB  1 
ATOM 8379  C CG  . LYS B 2 379 ? 86.47589  -47.63147 27.30640   1.000 145.32659 ? 379 LYS B CG  1 
ATOM 8380  C CD  . LYS B 2 379 ? 86.83132  -48.97934 26.70052   1.000 129.29192 ? 379 LYS B CD  1 
ATOM 8381  C CE  . LYS B 2 379 ? 88.33862  -49.19126 26.67707   1.000 122.70026 ? 379 LYS B CE  1 
ATOM 8382  N NZ  . LYS B 2 379 ? 88.71288  -50.52704 26.13355   1.000 124.19202 ? 379 LYS B NZ  1 
ATOM 8383  N N   . TYR B 2 380 ? 84.46487  -44.32769 26.43771   1.000 129.63921 ? 380 TYR B N   1 
ATOM 8384  C CA  . TYR B 2 380 ? 84.98994  -43.28197 25.56978   1.000 123.98713 ? 380 TYR B CA  1 
ATOM 8385  C C   . TYR B 2 380 ? 85.14577  -41.93437 26.26607   1.000 122.22056 ? 380 TYR B C   1 
ATOM 8386  O O   . TYR B 2 380 ? 85.67423  -41.00159 25.65131   1.000 117.70347 ? 380 TYR B O   1 
ATOM 8387  C CB  . TYR B 2 380 ? 84.07734  -43.10125 24.34813   1.000 121.04866 ? 380 TYR B CB  1 
ATOM 8388  C CG  . TYR B 2 380 ? 83.75815  -44.36866 23.57608   1.000 130.99611 ? 380 TYR B CG  1 
ATOM 8389  C CD1 . TYR B 2 380 ? 82.85688  -45.30448 24.07365   1.000 130.03307 ? 380 TYR B CD1 1 
ATOM 8390  C CD2 . TYR B 2 380 ? 84.34987  -44.62369 22.34590   1.000 140.96058 ? 380 TYR B CD2 1 
ATOM 8391  C CE1 . TYR B 2 380 ? 82.56080  -46.45743 23.37404   1.000 128.33871 ? 380 TYR B CE1 1 
ATOM 8392  C CE2 . TYR B 2 380 ? 84.05868  -45.77630 21.63852   1.000 139.39331 ? 380 TYR B CE2 1 
ATOM 8393  C CZ  . TYR B 2 380 ? 83.16391  -46.68832 22.15796   1.000 130.18611 ? 380 TYR B CZ  1 
ATOM 8394  O OH  . TYR B 2 380 ? 82.86887  -47.83648 21.46074   1.000 130.55614 ? 380 TYR B OH  1 
ATOM 8395  N N   . PHE B 2 381 ? 84.70892  -41.80035 27.51469   1.000 128.12612 ? 381 PHE B N   1 
ATOM 8396  C CA  . PHE B 2 381 ? 84.66502  -40.50945 28.18349   1.000 142.03249 ? 381 PHE B CA  1 
ATOM 8397  C C   . PHE B 2 381 ? 85.69226  -40.43680 29.30553   1.000 144.43255 ? 381 PHE B C   1 
ATOM 8398  O O   . PHE B 2 381 ? 86.09926  -41.45774 29.86721   1.000 140.61073 ? 381 PHE B O   1 
ATOM 8399  C CB  . PHE B 2 381 ? 83.27262  -40.24021 28.76928   1.000 147.50400 ? 381 PHE B CB  1 
ATOM 8400  C CG  . PHE B 2 381 ? 82.14455  -40.49562 27.81049   1.000 142.99023 ? 381 PHE B CG  1 
ATOM 8401  C CD1 . PHE B 2 381 ? 81.61195  -39.46564 27.05519   1.000 135.76137 ? 381 PHE B CD1 1 
ATOM 8402  C CD2 . PHE B 2 381 ? 81.59844  -41.76359 27.68551   1.000 137.72232 ? 381 PHE B CD2 1 
ATOM 8403  C CE1 . PHE B 2 381 ? 80.56954  -39.69782 26.17822   1.000 127.59171 ? 381 PHE B CE1 1 
ATOM 8404  C CE2 . PHE B 2 381 ? 80.55699  -42.00216 26.81172   1.000 130.57940 ? 381 PHE B CE2 1 
ATOM 8405  C CZ  . PHE B 2 381 ? 80.04101  -40.96831 26.05793   1.000 128.94159 ? 381 PHE B CZ  1 
ATOM 8406  N N   . ASN B 2 382 ? 86.11195  -39.21339 29.62401   1.000 156.24460 ? 382 ASN B N   1 
ATOM 8407  C CA  . ASN B 2 382 ? 86.97708  -38.98908 30.77215   1.000 147.34630 ? 382 ASN B CA  1 
ATOM 8408  C C   . ASN B 2 382 ? 86.16698  -39.12795 32.06341   1.000 150.79405 ? 382 ASN B C   1 
ATOM 8409  O O   . ASN B 2 382 ? 84.96014  -39.38729 32.05072   1.000 147.04354 ? 382 ASN B O   1 
ATOM 8410  C CB  . ASN B 2 382 ? 87.67351  -37.63150 30.66592   1.000 132.10048 ? 382 ASN B CB  1 
ATOM 8411  C CG  . ASN B 2 382 ? 86.70713  -36.48369 30.44852   1.000 120.57059 ? 382 ASN B CG  1 
ATOM 8412  O OD1 . ASN B 2 382 ? 85.57100  -36.51294 30.91232   1.000 131.22765 ? 382 ASN B OD1 1 
ATOM 8413  N ND2 . ASN B 2 382 ? 87.16012  -35.46154 29.73163   1.000 117.01005 ? 382 ASN B ND2 1 
ATOM 8414  N N   . GLU B 2 383 ? 86.84344  -38.95231 33.20054   1.000 155.18385 ? 383 GLU B N   1 
ATOM 8415  C CA  . GLU B 2 383 ? 86.20278  -39.23298 34.48224   1.000 152.21841 ? 383 GLU B CA  1 
ATOM 8416  C C   . GLU B 2 383 ? 85.10697  -38.22039 34.80060   1.000 136.12280 ? 383 GLU B C   1 
ATOM 8417  O O   . GLU B 2 383 ? 84.05146  -38.58898 35.33009   1.000 123.56190 ? 383 GLU B O   1 
ATOM 8418  C CB  . GLU B 2 383 ? 87.25213  -39.25390 35.59313   1.000 163.52824 ? 383 GLU B CB  1 
ATOM 8419  C CG  . GLU B 2 383 ? 88.37138  -40.25621 35.36352   1.000 169.46996 ? 383 GLU B CG  1 
ATOM 8420  C CD  . GLU B 2 383 ? 89.40715  -40.23924 36.46962   1.000 171.53648 ? 383 GLU B CD  1 
ATOM 8421  O OE1 . GLU B 2 383 ? 89.24749  -39.44936 37.42396   1.000 172.75159 ? 383 GLU B OE1 1 
ATOM 8422  O OE2 . GLU B 2 383 ? 90.38141  -41.01634 36.38403   1.000 171.17921 ? 383 GLU B OE2 1 
ATOM 8423  N N   . SER B 2 384 ? 85.33105  -36.94322 34.47836   1.000 126.73951 ? 384 SER B N   1 
ATOM 8424  C CA  . SER B 2 384 ? 84.32797  -35.92206 34.76956   1.000 122.52744 ? 384 SER B CA  1 
ATOM 8425  C C   . SER B 2 384 ? 83.07389  -36.11453 33.92416   1.000 154.77258 ? 384 SER B C   1 
ATOM 8426  O O   . SER B 2 384 ? 81.95014  -35.99755 34.43160   1.000 178.37337 ? 384 SER B O   1 
ATOM 8427  C CB  . SER B 2 384 ? 84.91733  -34.52931 34.54763   1.000 88.70708  ? 384 SER B CB  1 
ATOM 8428  O OG  . SER B 2 384 ? 83.95090  -33.52342 34.79620   1.000 80.48885  ? 384 SER B OG  1 
ATOM 8429  N N   . THR B 2 385 ? 83.24519  -36.40846 32.63250   1.000 152.91284 ? 385 THR B N   1 
ATOM 8430  C CA  . THR B 2 385 ? 82.09089  -36.62416 31.76653   1.000 130.49134 ? 385 THR B CA  1 
ATOM 8431  C C   . THR B 2 385 ? 81.28466  -37.83111 32.22241   1.000 125.97368 ? 385 THR B C   1 
ATOM 8432  O O   . THR B 2 385 ? 80.05018  -37.80033 32.21429   1.000 138.85228 ? 385 THR B O   1 
ATOM 8433  C CB  . THR B 2 385 ? 82.53833  -36.79861 30.31553   1.000 117.25007 ? 385 THR B CB  1 
ATOM 8434  O OG1 . THR B 2 385 ? 83.38988  -35.70763 29.94363   1.000 114.77661 ? 385 THR B OG1 1 
ATOM 8435  C CG2 . THR B 2 385 ? 81.33561  -36.82858 29.38897   1.000 113.10236 ? 385 THR B CG2 1 
ATOM 8436  N N   . ARG B 2 386 ? 81.96521  -38.90321 32.63043   1.000 123.63719 ? 386 ARG B N   1 
ATOM 8437  C CA  . ARG B 2 386 ? 81.25342  -40.07723 33.12018   1.000 132.45942 ? 386 ARG B CA  1 
ATOM 8438  C C   . ARG B 2 386 ? 80.52780  -39.77563 34.42430   1.000 140.35227 ? 386 ARG B C   1 
ATOM 8439  O O   . ARG B 2 386 ? 79.38387  -40.20342 34.61762   1.000 139.97746 ? 386 ARG B O   1 
ATOM 8440  C CB  . ARG B 2 386 ? 82.22970  -41.23767 33.30308   1.000 137.30767 ? 386 ARG B CB  1 
ATOM 8441  C CG  . ARG B 2 386 ? 82.64860  -41.88894 32.00023   1.000 139.76814 ? 386 ARG B CG  1 
ATOM 8442  C CD  . ARG B 2 386 ? 83.48823  -43.12864 32.24198   1.000 138.44360 ? 386 ARG B CD  1 
ATOM 8443  N NE  . ARG B 2 386 ? 84.79907  -42.81646 32.80383   1.000 144.49065 ? 386 ARG B NE  1 
ATOM 8444  C CZ  . ARG B 2 386 ? 85.71666  -43.72993 33.10418   1.000 156.46544 ? 386 ARG B CZ  1 
ATOM 8445  N NH1 . ARG B 2 386 ? 85.46560  -45.01559 32.89698   1.000 160.63898 ? 386 ARG B NH1 1 
ATOM 8446  N NH2 . ARG B 2 386 ? 86.88501  -43.36002 33.60995   1.000 164.67600 ? 386 ARG B NH2 1 
ATOM 8447  N N   . LYS B 2 387 ? 81.17225  -39.02888 35.32518   1.000 140.62374 ? 387 LYS B N   1 
ATOM 8448  C CA  . LYS B 2 387 ? 80.52808  -38.66035 36.58100   1.000 141.12919 ? 387 LYS B CA  1 
ATOM 8449  C C   . LYS B 2 387 ? 79.29250  -37.80189 36.34251   1.000 136.25980 ? 387 LYS B C   1 
ATOM 8450  O O   . LYS B 2 387 ? 78.30962  -37.90675 37.08539   1.000 129.34449 ? 387 LYS B O   1 
ATOM 8451  C CB  . LYS B 2 387 ? 81.52990  -37.93550 37.48172   1.000 137.01801 ? 387 LYS B CB  1 
ATOM 8452  C CG  . LYS B 2 387 ? 81.02361  -37.61578 38.87854   1.000 124.86278 ? 387 LYS B CG  1 
ATOM 8453  C CD  . LYS B 2 387 ? 82.12154  -36.96894 39.71062   1.000 110.32427 ? 387 LYS B CD  1 
ATOM 8454  C CE  . LYS B 2 387 ? 81.63972  -36.62903 41.11106   1.000 102.28345 ? 387 LYS B CE  1 
ATOM 8455  N NZ  . LYS B 2 387 ? 82.71309  -35.99533 41.92786   1.000 98.67754  ? 387 LYS B NZ  1 
ATOM 8456  N N   . LYS B 2 388 ? 79.32104  -36.95262 35.31386   1.000 139.21056 ? 388 LYS B N   1 
ATOM 8457  C CA  . LYS B 2 388 ? 78.15087  -36.14111 34.99281   1.000 119.16081 ? 388 LYS B CA  1 
ATOM 8458  C C   . LYS B 2 388 ? 77.06693  -36.95230 34.28816   1.000 112.00327 ? 388 LYS B C   1 
ATOM 8459  O O   . LYS B 2 388 ? 75.87346  -36.71181 34.50079   1.000 109.48740 ? 388 LYS B O   1 
ATOM 8460  C CB  . LYS B 2 388 ? 78.56238  -34.95137 34.12582   1.000 114.00214 ? 388 LYS B CB  1 
ATOM 8461  C CG  . LYS B 2 388 ? 79.46169  -33.94889 34.82506   1.000 111.31231 ? 388 LYS B CG  1 
ATOM 8462  C CD  . LYS B 2 388 ? 80.22663  -33.10828 33.81597   1.000 113.21921 ? 388 LYS B CD  1 
ATOM 8463  C CE  . LYS B 2 388 ? 79.28507  -32.32267 32.91889   1.000 117.75673 ? 388 LYS B CE  1 
ATOM 8464  N NZ  . LYS B 2 388 ? 80.02286  -31.40067 32.01107   1.000 122.05752 ? 388 LYS B NZ  1 
ATOM 8465  N N   . ILE B 2 389 ? 77.46043  -37.91141 33.44730   1.000 102.93847 ? 389 ILE B N   1 
ATOM 8466  C CA  . ILE B 2 389 ? 76.48699  -38.67603 32.67192   1.000 102.34016 ? 389 ILE B CA  1 
ATOM 8467  C C   . ILE B 2 389 ? 75.76257  -39.68801 33.55294   1.000 103.22394 ? 389 ILE B C   1 
ATOM 8468  O O   . ILE B 2 389 ? 74.56417  -39.93749 33.37332   1.000 98.63431  ? 389 ILE B O   1 
ATOM 8469  C CB  . ILE B 2 389 ? 77.17944  -39.34898 31.47077   1.000 112.49819 ? 389 ILE B CB  1 
ATOM 8470  C CG1 . ILE B 2 389 ? 77.46820  -38.31837 30.37732   1.000 99.20023  ? 389 ILE B CG1 1 
ATOM 8471  C CG2 . ILE B 2 389 ? 76.33595  -40.48470 30.91220   1.000 126.76859 ? 389 ILE B CG2 1 
ATOM 8472  C CD1 . ILE B 2 389 ? 78.23229  -38.87947 29.19368   1.000 97.03543  ? 389 ILE B CD1 1 
ATOM 8473  N N   . GLU B 2 390 ? 76.46618  -40.27135 34.52830   1.000 104.98890 ? 390 GLU B N   1 
ATOM 8474  C CA  . GLU B 2 390 ? 75.86185  -41.30472 35.36701   1.000 117.94960 ? 390 GLU B CA  1 
ATOM 8475  C C   . GLU B 2 390 ? 74.61902  -40.79175 36.08600   1.000 111.37429 ? 390 GLU B C   1 
ATOM 8476  O O   . GLU B 2 390 ? 73.60308  -41.49266 36.16187   1.000 108.85169 ? 390 GLU B O   1 
ATOM 8477  C CB  . GLU B 2 390 ? 76.88681  -41.81923 36.37810   1.000 129.14584 ? 390 GLU B CB  1 
ATOM 8478  C CG  . GLU B 2 390 ? 77.98935  -42.67132 35.77468   1.000 135.62972 ? 390 GLU B CG  1 
ATOM 8479  C CD  . GLU B 2 390 ? 79.02698  -43.08983 36.79650   1.000 138.68304 ? 390 GLU B CD  1 
ATOM 8480  O OE1 . GLU B 2 390 ? 78.84745  -42.77527 37.99160   1.000 138.78142 ? 390 GLU B OE1 1 
ATOM 8481  O OE2 . GLU B 2 390 ? 80.02708  -43.72581 36.40261   1.000 138.30235 ? 390 GLU B OE2 1 
ATOM 8482  N N   . LYS B 2 391 ? 74.67845  -39.57519 36.61904   1.000 104.71821 ? 391 LYS B N   1 
ATOM 8483  C CA  . LYS B 2 391 ? 73.57614  -39.00884 37.38583   1.000 96.75526  ? 391 LYS B CA  1 
ATOM 8484  C C   . LYS B 2 391 ? 72.47079  -38.41413 36.51557   1.000 90.59637  ? 391 LYS B C   1 
ATOM 8485  O O   . LYS B 2 391 ? 71.55386  -37.78860 37.05946   1.000 82.72788  ? 391 LYS B O   1 
ATOM 8486  C CB  . LYS B 2 391 ? 74.10559  -37.94306 38.34934   1.000 95.01425  ? 391 LYS B CB  1 
ATOM 8487  C CG  . LYS B 2 391 ? 75.03149  -38.49083 39.42363   1.000 95.61329  ? 391 LYS B CG  1 
ATOM 8488  C CD  . LYS B 2 391 ? 75.38450  -37.42839 40.45313   1.000 83.81514  ? 391 LYS B CD  1 
ATOM 8489  C CE  . LYS B 2 391 ? 76.20616  -36.30846 39.83861   1.000 81.65069  ? 391 LYS B CE  1 
ATOM 8490  N NZ  . LYS B 2 391 ? 76.60022  -35.28948 40.85042   1.000 79.83646  ? 391 LYS B NZ  1 
ATOM 8491  N N   . ILE B 2 392 ? 72.52486  -38.58626 35.19437   1.000 92.50679  ? 392 ILE B N   1 
ATOM 8492  C CA  . ILE B 2 392 ? 71.53590  -37.97152 34.31396   1.000 95.87204  ? 392 ILE B CA  1 
ATOM 8493  C C   . ILE B 2 392 ? 70.98341  -38.99256 33.32510   1.000 102.05562 ? 392 ILE B C   1 
ATOM 8494  O O   . ILE B 2 392 ? 70.04072  -38.69963 32.58018   1.000 98.85575  ? 392 ILE B O   1 
ATOM 8495  C CB  . ILE B 2 392 ? 72.13981  -36.76139 33.57501   1.000 89.60690  ? 392 ILE B CB  1 
ATOM 8496  C CG1 . ILE B 2 392 ? 71.03897  -35.79731 33.12405   1.000 81.44702  ? 392 ILE B CG1 1 
ATOM 8497  C CG2 . ILE B 2 392 ? 72.96882  -37.22154 32.38463   1.000 99.77125  ? 392 ILE B CG2 1 
ATOM 8498  C CD1 . ILE B 2 392 ? 71.56140  -34.50542 32.53613   1.000 76.44920  ? 392 ILE B CD1 1 
ATOM 8499  N N   . ARG B 2 393 ? 71.56466  -40.19365 33.30525   1.000 99.03597  ? 393 ARG B N   1 
ATOM 8500  C CA  . ARG B 2 393 ? 71.10132  -41.22167 32.37282   1.000 100.51776 ? 393 ARG B CA  1 
ATOM 8501  C C   . ARG B 2 393 ? 69.62156  -41.55731 32.52755   1.000 95.37047  ? 393 ARG B C   1 
ATOM 8502  O O   . ARG B 2 393 ? 68.90184  -41.53412 31.51370   1.000 100.79067 ? 393 ARG B O   1 
ATOM 8503  C CB  . ARG B 2 393 ? 71.97485  -42.47530 32.50105   1.000 111.22712 ? 393 ARG B CB  1 
ATOM 8504  C CG  . ARG B 2 393 ? 73.30169  -42.38218 31.76587   1.000 120.69871 ? 393 ARG B CG  1 
ATOM 8505  C CD  . ARG B 2 393 ? 73.08954  -42.16629 30.27340   1.000 131.39346 ? 393 ARG B CD  1 
ATOM 8506  N NE  . ARG B 2 393 ? 72.67449  -43.38772 29.58890   1.000 142.65296 ? 393 ARG B NE  1 
ATOM 8507  C CZ  . ARG B 2 393 ? 73.51252  -44.23531 29.00066   1.000 148.68461 ? 393 ARG B CZ  1 
ATOM 8508  N NH1 . ARG B 2 393 ? 74.81608  -43.99423 29.01024   1.000 140.93562 ? 393 ARG B NH1 1 
ATOM 8509  N NH2 . ARG B 2 393 ? 73.04818  -45.32252 28.39975   1.000 159.18805 ? 393 ARG B NH2 1 
ATOM 8510  N N   . PRO B 2 394 ? 69.09635  -41.87274 33.71929   1.000 97.18823  ? 394 PRO B N   1 
ATOM 8511  C CA  . PRO B 2 394 ? 67.67042  -42.22892 33.80555   1.000 104.50528 ? 394 PRO B CA  1 
ATOM 8512  C C   . PRO B 2 394 ? 66.72663  -41.05548 33.59586   1.000 111.02681 ? 394 PRO B C   1 
ATOM 8513  O O   . PRO B 2 394 ? 65.51236  -41.27598 33.49917   1.000 122.26369 ? 394 PRO B O   1 
ATOM 8514  C CB  . PRO B 2 394 ? 67.53779  -42.79649 35.22334   1.000 97.19893  ? 394 PRO B CB  1 
ATOM 8515  C CG  . PRO B 2 394 ? 68.58571  -42.08846 35.99251   1.000 91.55551  ? 394 PRO B CG  1 
ATOM 8516  C CD  . PRO B 2 394 ? 69.74424  -41.93622 35.04438   1.000 94.23237  ? 394 PRO B CD  1 
ATOM 8517  N N   . LEU B 2 395 ? 67.23573  -39.82523 33.52667   1.000 96.88560  ? 395 LEU B N   1 
ATOM 8518  C CA  . LEU B 2 395 ? 66.38535  -38.64955 33.38057   1.000 79.29571  ? 395 LEU B CA  1 
ATOM 8519  C C   . LEU B 2 395 ? 66.07094  -38.31465 31.92674   1.000 77.92649  ? 395 LEU B C   1 
ATOM 8520  O O   . LEU B 2 395 ? 64.95481  -37.87883 31.62261   1.000 76.01254  ? 395 LEU B O   1 
ATOM 8521  C CB  . LEU B 2 395 ? 67.04111  -37.43526 34.04716   1.000 73.94353  ? 395 LEU B CB  1 
ATOM 8522  C CG  . LEU B 2 395 ? 67.01423  -37.30799 35.57362   1.000 73.13711  ? 395 LEU B CG  1 
ATOM 8523  C CD1 . LEU B 2 395 ? 67.96377  -38.29218 36.24562   1.000 77.99775  ? 395 LEU B CD1 1 
ATOM 8524  C CD2 . LEU B 2 395 ? 67.33982  -35.88043 35.98723   1.000 71.67592  ? 395 LEU B CD2 1 
ATOM 8525  N N   . LEU B 2 396 ? 67.02527  -38.51092 31.02057   1.000 86.44220  ? 396 LEU B N   1 
ATOM 8526  C CA  . LEU B 2 396 ? 66.85393  -38.08275 29.63837   1.000 84.02214  ? 396 LEU B CA  1 
ATOM 8527  C C   . LEU B 2 396 ? 65.91351  -39.00722 28.87327   1.000 82.95525  ? 396 LEU B C   1 
ATOM 8528  O O   . LEU B 2 396 ? 65.95249  -40.23074 29.02746   1.000 86.10572  ? 396 LEU B O   1 
ATOM 8529  C CB  . LEU B 2 396 ? 68.21382  -38.00622 28.93970   1.000 83.41122  ? 396 LEU B CB  1 
ATOM 8530  C CG  . LEU B 2 396 ? 68.99530  -39.29784 28.68214   1.000 90.01473  ? 396 LEU B CG  1 
ATOM 8531  C CD1 . LEU B 2 396 ? 68.80023  -39.79005 27.25280   1.000 93.78507  ? 396 LEU B CD1 1 
ATOM 8532  C CD2 . LEU B 2 396 ? 70.47177  -39.09426 28.98744   1.000 89.84098  ? 396 LEU B CD2 1 
ATOM 8533  N N   . ILE B 2 397 ? 65.06359  -38.40254 28.04373   1.000 80.54218  ? 397 ILE B N   1 
ATOM 8534  C CA  . ILE B 2 397 ? 64.16133  -39.11637 27.14544   1.000 81.09771  ? 397 ILE B CA  1 
ATOM 8535  C C   . ILE B 2 397 ? 64.09185  -38.35958 25.82401   1.000 91.13851  ? 397 ILE B C   1 
ATOM 8536  O O   . ILE B 2 397 ? 63.94672  -37.13251 25.81299   1.000 103.71851 ? 397 ILE B O   1 
ATOM 8537  C CB  . ILE B 2 397 ? 62.75390  -39.30635 27.75569   1.000 76.66460  ? 397 ILE B CB  1 
ATOM 8538  C CG1 . ILE B 2 397 ? 62.15980  -37.97586 28.23206   1.000 74.67007  ? 397 ILE B CG1 1 
ATOM 8539  C CG2 . ILE B 2 397 ? 62.77910  -40.33242 28.88464   1.000 78.44432  ? 397 ILE B CG2 1 
ATOM 8540  C CD1 . ILE B 2 397 ? 61.18727  -37.33972 27.26480   1.000 74.25113  ? 397 ILE B CD1 1 
ATOM 8541  N N   . ASP B 2 398 ? 64.22843  -39.08934 24.71426   1.000 86.60824  ? 398 ASP B N   1 
ATOM 8542  C CA  . ASP B 2 398 ? 64.11357  -38.52384 23.36574   1.000 97.06748  ? 398 ASP B CA  1 
ATOM 8543  C C   . ASP B 2 398 ? 65.07801  -37.35737 23.14963   1.000 95.98576  ? 398 ASP B C   1 
ATOM 8544  O O   . ASP B 2 398 ? 64.72039  -36.32932 22.57118   1.000 99.60461  ? 398 ASP B O   1 
ATOM 8545  C CB  . ASP B 2 398 ? 62.67222  -38.09495 23.07747   1.000 107.24727 ? 398 ASP B CB  1 
ATOM 8546  C CG  . ASP B 2 398 ? 62.36074  -38.04275 21.59304   1.000 127.20763 ? 398 ASP B CG  1 
ATOM 8547  O OD1 . ASP B 2 398 ? 63.26952  -38.30888 20.77854   1.000 141.77271 ? 398 ASP B OD1 1 
ATOM 8548  O OD2 . ASP B 2 398 ? 61.20232  -37.73284 21.24197   1.000 131.64329 ? 398 ASP B OD2 1 
ATOM 8549  N N   . GLY B 2 399 ? 66.31201  -37.51744 23.62260   1.000 97.58221  ? 399 GLY B N   1 
ATOM 8550  C CA  . GLY B 2 399 ? 67.34181  -36.51586 23.42606   1.000 92.13227  ? 399 GLY B CA  1 
ATOM 8551  C C   . GLY B 2 399 ? 67.19147  -35.26193 24.25347   1.000 83.61079  ? 399 GLY B C   1 
ATOM 8552  O O   . GLY B 2 399 ? 67.85852  -34.26373 23.96548   1.000 80.62556  ? 399 GLY B O   1 
ATOM 8553  N N   . THR B 2 400 ? 66.34100  -35.28216 25.27668   1.000 81.05390  ? 400 THR B N   1 
ATOM 8554  C CA  . THR B 2 400 ? 66.15175  -34.15492 26.17724   1.000 76.41257  ? 400 THR B CA  1 
ATOM 8555  C C   . THR B 2 400 ? 66.00891  -34.68059 27.59633   1.000 83.39562  ? 400 THR B C   1 
ATOM 8556  O O   . THR B 2 400 ? 65.31268  -35.67164 27.83080   1.000 103.88375 ? 400 THR B O   1 
ATOM 8557  C CB  . THR B 2 400 ? 64.91722  -33.31523 25.80729   1.000 68.19399  ? 400 THR B CB  1 
ATOM 8558  O OG1 . THR B 2 400 ? 63.75930  -34.15788 25.74893   1.000 68.57822  ? 400 THR B OG1 1 
ATOM 8559  C CG2 . THR B 2 400 ? 65.10938  -32.61097 24.46862   1.000 73.35592  ? 400 THR B CG2 1 
ATOM 8560  N N   . ALA B 2 401 ? 66.66856  -34.01382 28.53672   1.000 73.19744  ? 401 ALA B N   1 
ATOM 8561  C CA  . ALA B 2 401 ? 66.60776  -34.43085 29.92751   1.000 72.77388  ? 401 ALA B CA  1 
ATOM 8562  C C   . ALA B 2 401 ? 65.32086  -33.92492 30.56996   1.000 71.39070  ? 401 ALA B C   1 
ATOM 8563  O O   . ALA B 2 401 ? 64.67176  -33.00451 30.07333   1.000 75.87148  ? 401 ALA B O   1 
ATOM 8564  C CB  . ALA B 2 401 ? 67.82229  -33.91834 30.70128   1.000 72.41337  ? 401 ALA B CB  1 
ATOM 8565  N N   . SER B 2 402 ? 64.95071  -34.54094 31.68696   1.000 66.97948  ? 402 SER B N   1 
ATOM 8566  C CA  . SER B 2 402 ? 63.75491  -34.15278 32.42216   1.000 80.99618  ? 402 SER B CA  1 
ATOM 8567  C C   . SER B 2 402 ? 64.15071  -33.28377 33.60677   1.000 73.41938  ? 402 SER B C   1 
ATOM 8568  O O   . SER B 2 402 ? 65.07154  -33.62704 34.35561   1.000 83.39589  ? 402 SER B O   1 
ATOM 8569  C CB  . SER B 2 402 ? 62.98615  -35.38169 32.90501   1.000 107.31722 ? 402 SER B CB  1 
ATOM 8570  O OG  . SER B 2 402 ? 63.76083  -36.14525 33.81244   1.000 134.33774 ? 402 SER B OG  1 
ATOM 8571  N N   . LEU B 2 403 ? 63.45069  -32.15992 33.77378   1.000 68.27856  ? 403 LEU B N   1 
ATOM 8572  C CA  . LEU B 2 403 ? 63.75882  -31.19066 34.82901   1.000 70.72458  ? 403 LEU B CA  1 
ATOM 8573  C C   . LEU B 2 403 ? 62.43891  -30.68351 35.40836   1.000 87.33773  ? 403 LEU B C   1 
ATOM 8574  O O   . LEU B 2 403 ? 61.87725  -29.69500 34.93003   1.000 109.78326 ? 403 LEU B O   1 
ATOM 8575  C CB  . LEU B 2 403 ? 64.61471  -30.05483 34.28627   1.000 69.65994  ? 403 LEU B CB  1 
ATOM 8576  C CG  . LEU B 2 403 ? 65.15012  -29.05966 35.31235   1.000 86.42617  ? 403 LEU B CG  1 
ATOM 8577  C CD1 . LEU B 2 403 ? 66.04144  -29.77288 36.30909   1.000 105.30795 ? 403 LEU B CD1 1 
ATOM 8578  C CD2 . LEU B 2 403 ? 65.91376  -27.95717 34.61356   1.000 86.20759  ? 403 LEU B CD2 1 
ATOM 8579  N N   . SER B 2 404 ? 61.95349  -31.36343 36.44378   1.000 82.60033  ? 404 SER B N   1 
ATOM 8580  C CA  . SER B 2 404 ? 60.69445  -30.99287 37.08035   1.000 90.98003  ? 404 SER B CA  1 
ATOM 8581  C C   . SER B 2 404 ? 60.84945  -29.79716 38.02138   1.000 77.12634  ? 404 SER B C   1 
ATOM 8582  O O   . SER B 2 404 ? 60.10687  -28.81793 37.87420   1.000 74.30994  ? 404 SER B O   1 
ATOM 8583  C CB  . SER B 2 404 ? 60.09493  -32.18778 37.82735   1.000 114.55966 ? 404 SER B CB  1 
ATOM 8584  O OG  . SER B 2 404 ? 58.89359  -31.82453 38.48661   1.000 121.42078 ? 404 SER B OG  1 
ATOM 8585  N N   . PRO B 2 405 ? 61.77151  -29.80924 38.98890   1.000 76.80257  ? 405 PRO B N   1 
ATOM 8586  C CA  . PRO B 2 405 ? 61.86873  -28.68051 39.92064   1.000 78.56908  ? 405 PRO B CA  1 
ATOM 8587  C C   . PRO B 2 405 ? 62.63676  -27.48254 39.38659   1.000 80.29906  ? 405 PRO B C   1 
ATOM 8588  O O   . PRO B 2 405 ? 62.97078  -26.58963 40.17001   1.000 88.26424  ? 405 PRO B O   1 
ATOM 8589  C CB  . PRO B 2 405 ? 62.60728  -29.30185 41.11390   1.000 71.50733  ? 405 PRO B CB  1 
ATOM 8590  C CG  . PRO B 2 405 ? 63.53488  -30.26032 40.48163   1.000 68.79094  ? 405 PRO B CG  1 
ATOM 8591  C CD  . PRO B 2 405 ? 62.80717  -30.82271 39.28261   1.000 73.63412  ? 405 PRO B CD  1 
ATOM 8592  N N   . GLY B 2 406 ? 62.92812  -27.44106 38.08991   1.000 77.88864  ? 406 GLY B N   1 
ATOM 8593  C CA  . GLY B 2 406 ? 63.74396  -26.38108 37.54519   1.000 91.43336  ? 406 GLY B CA  1 
ATOM 8594  C C   . GLY B 2 406 ? 62.97425  -25.11821 37.20293   1.000 98.91616  ? 406 GLY B C   1 
ATOM 8595  O O   . GLY B 2 406 ? 61.74434  -25.07007 37.18812   1.000 91.71816  ? 406 GLY B O   1 
ATOM 8596  N N   . MET B 2 407 ? 63.74999  -24.07356 36.92565   1.000 104.81232 ? 407 MET B N   1 
ATOM 8597  C CA  . MET B 2 407 ? 63.25088  -22.79395 36.43965   1.000 94.49380  ? 407 MET B CA  1 
ATOM 8598  C C   . MET B 2 407 ? 64.42554  -22.09788 35.77602   1.000 97.41999  ? 407 MET B C   1 
ATOM 8599  O O   . MET B 2 407 ? 65.50684  -22.02669 36.36590   1.000 98.14257  ? 407 MET B O   1 
ATOM 8600  C CB  . MET B 2 407 ? 62.67813  -21.92433 37.56284   1.000 87.84521  ? 407 MET B CB  1 
ATOM 8601  C CG  . MET B 2 407 ? 62.38940  -20.49680 37.11672   1.000 100.21738 ? 407 MET B CG  1 
ATOM 8602  S SD  . MET B 2 407 ? 62.49447  -19.27575 38.43598   1.000 134.17948 ? 407 MET B SD  1 
ATOM 8603  C CE  . MET B 2 407 ? 62.32341  -17.75778 37.50328   1.000 136.16617 ? 407 MET B CE  1 
ATOM 8604  N N   . MET B 2 408 ? 64.22615  -21.59994 34.56260   1.000 101.28540 ? 408 MET B N   1 
ATOM 8605  C CA  . MET B 2 408 ? 65.34994  -21.06549 33.81196   1.000 108.43191 ? 408 MET B CA  1 
ATOM 8606  C C   . MET B 2 408 ? 65.50255  -19.56930 34.05506   1.000 123.31454 ? 408 MET B C   1 
ATOM 8607  O O   . MET B 2 408 ? 64.56180  -18.87376 34.44549   1.000 131.58764 ? 408 MET B O   1 
ATOM 8608  C CB  . MET B 2 408 ? 65.18464  -21.35316 32.32061   1.000 109.46061 ? 408 MET B CB  1 
ATOM 8609  C CG  . MET B 2 408 ? 65.25294  -22.83432 31.97828   1.000 121.35625 ? 408 MET B CG  1 
ATOM 8610  S SD  . MET B 2 408 ? 66.79272  -23.62055 32.49586   1.000 132.95044 ? 408 MET B SD  1 
ATOM 8611  C CE  . MET B 2 408 ? 66.27364  -24.47288 33.98317   1.000 137.33660 ? 408 MET B CE  1 
ATOM 8612  N N   . MET B 2 409 ? 66.71655  -19.08176 33.81247   1.000 123.58834 ? 409 MET B N   1 
ATOM 8613  C CA  . MET B 2 409 ? 67.07074  -17.71955 34.18426   1.000 134.95338 ? 409 MET B CA  1 
ATOM 8614  C C   . MET B 2 409 ? 66.32938  -16.71888 33.30853   1.000 133.56733 ? 409 MET B C   1 
ATOM 8615  O O   . MET B 2 409 ? 66.27565  -16.86389 32.08317   1.000 128.43308 ? 409 MET B O   1 
ATOM 8616  C CB  . MET B 2 409 ? 68.58147  -17.51917 34.07836   1.000 143.48443 ? 409 MET B CB  1 
ATOM 8617  C CG  . MET B 2 409 ? 69.07403  -16.20783 34.66901   1.000 158.33922 ? 409 MET B CG  1 
ATOM 8618  S SD  . MET B 2 409 ? 70.85949  -15.99757 34.53347   1.000 172.13077 ? 409 MET B SD  1 
ATOM 8619  C CE  . MET B 2 409 ? 71.43525  -17.26962 35.65447   1.000 154.60966 ? 409 MET B CE  1 
ATOM 8620  N N   . GLY B 2 410 ? 65.75550  -15.70278 33.94626   1.000 121.67195 ? 410 GLY B N   1 
ATOM 8621  C CA  . GLY B 2 410 ? 65.08520  -14.64030 33.22938   1.000 131.42781 ? 410 GLY B CA  1 
ATOM 8622  C C   . GLY B 2 410 ? 63.68042  -14.96556 32.78186   1.000 142.53994 ? 410 GLY B C   1 
ATOM 8623  O O   . GLY B 2 410 ? 63.19807  -14.37044 31.81377   1.000 178.91188 ? 410 GLY B O   1 
ATOM 8624  N N   . MET B 2 411 ? 63.00389  -15.89531 33.45821   1.000 122.99450 ? 411 MET B N   1 
ATOM 8625  C CA  . MET B 2 411 ? 61.64406  -16.29038 33.10183   1.000 104.98285 ? 411 MET B CA  1 
ATOM 8626  C C   . MET B 2 411 ? 60.60152  -15.61262 33.98522   1.000 97.28513  ? 411 MET B C   1 
ATOM 8627  O O   . MET B 2 411 ? 59.69560  -14.94211 33.48173   1.000 107.51007 ? 411 MET B O   1 
ATOM 8628  C CB  . MET B 2 411 ? 61.49878  -17.81530 33.17792   1.000 102.29551 ? 411 MET B CB  1 
ATOM 8629  C CG  . MET B 2 411 ? 62.11457  -18.54069 32.00061   1.000 106.92064 ? 411 MET B CG  1 
ATOM 8630  S SD  . MET B 2 411 ? 61.57154  -17.82624 30.43748   1.000 105.00212 ? 411 MET B SD  1 
ATOM 8631  C CE  . MET B 2 411 ? 60.54257  -19.14626 29.80923   1.000 85.85338  ? 411 MET B CE  1 
ATOM 8632  N N   . PHE B 2 412 ? 60.71414  -15.77864 35.30216   1.000 83.19576  ? 412 PHE B N   1 
ATOM 8633  C CA  . PHE B 2 412 ? 59.73338  -15.23024 36.23180   1.000 87.85804  ? 412 PHE B CA  1 
ATOM 8634  C C   . PHE B 2 412 ? 60.39122  -14.25401 37.19719   1.000 83.83336  ? 412 PHE B C   1 
ATOM 8635  O O   . PHE B 2 412 ? 60.17798  -14.33646 38.41074   1.000 96.22256  ? 412 PHE B O   1 
ATOM 8636  C CB  . PHE B 2 412 ? 59.02796  -16.34954 37.00076   1.000 94.55312  ? 412 PHE B CB  1 
ATOM 8637  C CG  . PHE B 2 412 ? 57.96845  -17.05413 36.20584   1.000 92.16426  ? 412 PHE B CG  1 
ATOM 8638  C CD1 . PHE B 2 412 ? 57.23461  -16.37000 35.25273   1.000 89.49109  ? 412 PHE B CD1 1 
ATOM 8639  C CD2 . PHE B 2 412 ? 57.70812  -18.39854 36.40718   1.000 105.17126 ? 412 PHE B CD2 1 
ATOM 8640  C CE1 . PHE B 2 412 ? 56.25935  -17.01117 34.51847   1.000 100.59786 ? 412 PHE B CE1 1 
ATOM 8641  C CE2 . PHE B 2 412 ? 56.73327  -19.04601 35.67397   1.000 111.63777 ? 412 PHE B CE2 1 
ATOM 8642  C CZ  . PHE B 2 412 ? 56.00915  -18.35126 34.72670   1.000 107.55072 ? 412 PHE B CZ  1 
ATOM 8643  N N   . ASN B 2 413 ? 61.20328  -13.33642 36.66419   1.000 74.15821  ? 413 ASN B N   1 
ATOM 8644  C CA  . ASN B 2 413 ? 61.93692  -12.40516 37.51663   1.000 104.03000 ? 413 ASN B CA  1 
ATOM 8645  C C   . ASN B 2 413 ? 60.99502  -11.55910 38.36407   1.000 102.30720 ? 413 ASN B C   1 
ATOM 8646  O O   . ASN B 2 413 ? 61.25226  -11.33628 39.55174   1.000 128.42350 ? 413 ASN B O   1 
ATOM 8647  C CB  . ASN B 2 413 ? 62.83591  -11.50643 36.66787   1.000 132.31777 ? 413 ASN B CB  1 
ATOM 8648  C CG  . ASN B 2 413 ? 63.74564  -12.29179 35.74868   1.000 140.89930 ? 413 ASN B CG  1 
ATOM 8649  O OD1 . ASN B 2 413 ? 63.66004  -12.17373 34.52749   1.000 154.39703 ? 413 ASN B OD1 1 
ATOM 8650  N ND2 . ASN B 2 413 ? 64.62381  -13.10119 36.33159   1.000 128.19344 ? 413 ASN B ND2 1 
ATOM 8651  N N   . MET B 2 414 ? 59.89937  -11.07632 37.77498   1.000 86.91377  ? 414 MET B N   1 
ATOM 8652  C CA  . MET B 2 414 ? 59.00575  -10.18877 38.51271   1.000 73.67448  ? 414 MET B CA  1 
ATOM 8653  C C   . MET B 2 414 ? 58.14524  -10.95344 39.51272   1.000 78.10838  ? 414 MET B C   1 
ATOM 8654  O O   . MET B 2 414 ? 57.87772  -10.45399 40.61030   1.000 102.39133 ? 414 MET B O   1 
ATOM 8655  C CB  . MET B 2 414 ? 58.14170  -9.38546  37.54055   1.000 61.71674  ? 414 MET B CB  1 
ATOM 8656  C CG  . MET B 2 414 ? 58.92345  -8.31720  36.79094   1.000 64.76698  ? 414 MET B CG  1 
ATOM 8657  S SD  . MET B 2 414 ? 57.87629  -7.06552  36.02914   1.000 85.63995  ? 414 MET B SD  1 
ATOM 8658  C CE  . MET B 2 414 ? 57.23010  -7.98189  34.63376   1.000 101.95464 ? 414 MET B CE  1 
ATOM 8659  N N   . LEU B 2 415 ? 57.71629  -12.16898 39.17275   1.000 65.10459  ? 415 LEU B N   1 
ATOM 8660  C CA  . LEU B 2 415 ? 56.98957  -12.97150 40.15270   1.000 61.73547  ? 415 LEU B CA  1 
ATOM 8661  C C   . LEU B 2 415 ? 57.91505  -13.40253 41.28664   1.000 61.57952  ? 415 LEU B C   1 
ATOM 8662  O O   . LEU B 2 415 ? 57.50443  -13.45586 42.45370   1.000 61.87556  ? 415 LEU B O   1 
ATOM 8663  C CB  . LEU B 2 415 ? 56.34639  -14.17779 39.46913   1.000 61.84059  ? 415 LEU B CB  1 
ATOM 8664  C CG  . LEU B 2 415 ? 55.24498  -14.89752 40.24861   1.000 67.96196  ? 415 LEU B CG  1 
ATOM 8665  C CD1 . LEU B 2 415 ? 54.22932  -13.89735 40.77383   1.000 66.69779  ? 415 LEU B CD1 1 
ATOM 8666  C CD2 . LEU B 2 415 ? 54.55933  -15.92278 39.36320   1.000 56.69823  ? 415 LEU B CD2 1 
ATOM 8667  N N   . SER B 2 416 ? 59.17635  -13.69408 40.96183   1.000 56.16676  ? 416 SER B N   1 
ATOM 8668  C CA  . SER B 2 416 ? 60.16700  -13.96480 41.99815   1.000 66.37861  ? 416 SER B CA  1 
ATOM 8669  C C   . SER B 2 416 ? 60.39167  -12.73873 42.87730   1.000 72.64859  ? 416 SER B C   1 
ATOM 8670  O O   . SER B 2 416 ? 60.58647  -12.85874 44.09351   1.000 90.17432  ? 416 SER B O   1 
ATOM 8671  C CB  . SER B 2 416 ? 61.47745  -14.40972 41.35157   1.000 76.71893  ? 416 SER B CB  1 
ATOM 8672  O OG  . SER B 2 416 ? 61.32012  -15.63392 40.65652   1.000 86.53464  ? 416 SER B OG  1 
ATOM 8673  N N   . THR B 2 417 ? 60.36592  -11.54716 42.27677   1.000 57.68508  ? 417 THR B N   1 
ATOM 8674  C CA  . THR B 2 417 ? 60.46703  -10.31732 43.05495   1.000 57.77316  ? 417 THR B CA  1 
ATOM 8675  C C   . THR B 2 417 ? 59.25539  -10.13832 43.95954   1.000 63.17739  ? 417 THR B C   1 
ATOM 8676  O O   . THR B 2 417 ? 59.38186  -9.63224  45.07645   1.000 79.45112  ? 417 THR B O   1 
ATOM 8677  C CB  . THR B 2 417 ? 60.63303  -9.11886  42.12245   1.000 57.78679  ? 417 THR B CB  1 
ATOM 8678  O OG1 . THR B 2 417 ? 61.85017  -9.26581  41.38379   1.000 57.69034  ? 417 THR B OG1 1 
ATOM 8679  C CG2 . THR B 2 417 ? 60.68317  -7.81867  42.91236   1.000 58.00071  ? 417 THR B CG2 1 
ATOM 8680  N N   . VAL B 2 418 ? 58.07174  -10.52946 43.48704   1.000 57.66259  ? 418 VAL B N   1 
ATOM 8681  C CA  . VAL B 2 418 ? 56.88845  -10.52715 44.34674   1.000 57.93622  ? 418 VAL B CA  1 
ATOM 8682  C C   . VAL B 2 418 ? 57.10574  -11.45331 45.53889   1.000 58.00335  ? 418 VAL B C   1 
ATOM 8683  O O   . VAL B 2 418 ? 56.80235  -11.10661 46.68912   1.000 58.29887  ? 418 VAL B O   1 
ATOM 8684  C CB  . VAL B 2 418 ? 55.63670  -10.92425 43.54315   1.000 58.00991  ? 418 VAL B CB  1 
ATOM 8685  C CG1 . VAL B 2 418 ? 54.44969  -11.11780 44.47204   1.000 58.35756  ? 418 VAL B CG1 1 
ATOM 8686  C CG2 . VAL B 2 418 ? 55.32537  -9.87308  42.49216   1.000 58.07417  ? 418 VAL B CG2 1 
ATOM 8687  N N   . LEU B 2 419 ? 57.63636  -12.65032 45.27591   1.000 53.14041  ? 419 LEU B N   1 
ATOM 8688  C CA  . LEU B 2 419 ? 57.91576  -13.59266 46.35757   1.000 62.80414  ? 419 LEU B CA  1 
ATOM 8689  C C   . LEU B 2 419 ? 58.90741  -13.00920 47.36048   1.000 71.64196  ? 419 LEU B C   1 
ATOM 8690  O O   . LEU B 2 419 ? 58.77298  -13.21858 48.57158   1.000 82.77495  ? 419 LEU B O   1 
ATOM 8691  C CB  . LEU B 2 419 ? 58.44337  -14.90956 45.78708   1.000 70.73992  ? 419 LEU B CB  1 
ATOM 8692  C CG  . LEU B 2 419 ? 58.96415  -15.93179 46.80220   1.000 61.96484  ? 419 LEU B CG  1 
ATOM 8693  C CD1 . LEU B 2 419 ? 57.87954  -16.31455 47.79907   1.000 51.88437  ? 419 LEU B CD1 1 
ATOM 8694  C CD2 . LEU B 2 419 ? 59.50974  -17.16397 46.09781   1.000 62.97186  ? 419 LEU B CD2 1 
ATOM 8695  N N   . GLY B 2 420 ? 59.91500  -12.28242 46.87382   1.000 50.67100  ? 420 GLY B N   1 
ATOM 8696  C CA  . GLY B 2 420 ? 60.87650  -11.66764 47.77957   1.000 50.81442  ? 420 GLY B CA  1 
ATOM 8697  C C   . GLY B 2 420 ? 60.28890  -10.50560 48.56180   1.000 71.93545  ? 420 GLY B C   1 
ATOM 8698  O O   . GLY B 2 420 ? 60.57706  -10.33068 49.75192   1.000 85.46475  ? 420 GLY B O   1 
ATOM 8699  N N   . VAL B 2 421 ? 59.46326  -9.69018  47.90182   1.000 54.97262  ? 421 VAL B N   1 
ATOM 8700  C CA  . VAL B 2 421 ? 58.78476  -8.58548  48.56953   1.000 55.41311  ? 421 VAL B CA  1 
ATOM 8701  C C   . VAL B 2 421 ? 57.84747  -9.11862  49.64089   1.000 55.78348  ? 421 VAL B C   1 
ATOM 8702  O O   . VAL B 2 421 ? 57.56501  -8.43152  50.62568   1.000 56.30064  ? 421 VAL B O   1 
ATOM 8703  C CB  . VAL B 2 421 ? 58.05201  -7.70597  47.53305   1.000 55.43431  ? 421 VAL B CB  1 
ATOM 8704  C CG1 . VAL B 2 421 ? 57.11994  -6.71209  48.20952   1.000 56.04266  ? 421 VAL B CG1 1 
ATOM 8705  C CG2 . VAL B 2 421 ? 59.06056  -6.96181  46.67381   1.000 55.22392  ? 421 VAL B CG2 1 
ATOM 8706  N N   . SER B 2 422 ? 57.35709  -10.34812 49.47699   1.000 53.83518  ? 422 SER B N   1 
ATOM 8707  C CA  . SER B 2 422 ? 56.58602  -10.98175 50.54439   1.000 65.62106  ? 422 SER B CA  1 
ATOM 8708  C C   . SER B 2 422 ? 57.38620  -11.01880 51.84383   1.000 82.65252  ? 422 SER B C   1 
ATOM 8709  O O   . SER B 2 422 ? 56.94113  -10.51656 52.88412   1.000 103.01113 ? 422 SER B O   1 
ATOM 8710  C CB  . SER B 2 422 ? 56.17330  -12.39288 50.12709   1.000 60.83163  ? 422 SER B CB  1 
ATOM 8711  O OG  . SER B 2 422 ? 55.65754  -12.39881 48.81079   1.000 64.62332  ? 422 SER B OG  1 
ATOM 8712  N N   . ILE B 2 423 ? 58.58590  -11.60454 51.79611   1.000 71.71913  ? 423 ILE B N   1 
ATOM 8713  C CA  . ILE B 2 423 ? 59.40476  -11.71563 52.99880   1.000 61.07722  ? 423 ILE B CA  1 
ATOM 8714  C C   . ILE B 2 423 ? 59.89068  -10.34444 53.44722   1.000 59.28750  ? 423 ILE B C   1 
ATOM 8715  O O   . ILE B 2 423 ? 60.10016  -10.11387 54.64462   1.000 61.71385  ? 423 ILE B O   1 
ATOM 8716  C CB  . ILE B 2 423 ? 60.58205  -12.67703 52.75469   1.000 66.25165  ? 423 ILE B CB  1 
ATOM 8717  C CG1 . ILE B 2 423 ? 60.09245  -13.95832 52.07988   1.000 89.90565  ? 423 ILE B CG1 1 
ATOM 8718  C CG2 . ILE B 2 423 ? 61.28510  -13.00726 54.06221   1.000 69.53314  ? 423 ILE B CG2 1 
ATOM 8719  C CD1 . ILE B 2 423 ? 59.06745  -14.71944 52.88979   1.000 105.66034 ? 423 ILE B CD1 1 
ATOM 8720  N N   . LEU B 2 424 ? 60.07411  -9.41249  52.50809   1.000 60.67532  ? 424 LEU B N   1 
ATOM 8721  C CA  . LEU B 2 424 ? 60.42062  -8.04680  52.89484   1.000 61.05302  ? 424 LEU B CA  1 
ATOM 8722  C C   . LEU B 2 424 ? 59.28216  -7.37742  53.65789   1.000 64.59022  ? 424 LEU B C   1 
ATOM 8723  O O   . LEU B 2 424 ? 59.52867  -6.57777  54.56809   1.000 69.09948  ? 424 LEU B O   1 
ATOM 8724  C CB  . LEU B 2 424 ? 60.79555  -7.22655  51.66190   1.000 60.71144  ? 424 LEU B CB  1 
ATOM 8725  C CG  . LEU B 2 424 ? 62.19944  -7.48254  51.11274   1.000 60.30792  ? 424 LEU B CG  1 
ATOM 8726  C CD1 . LEU B 2 424 ? 62.51629  -6.52417  49.97725   1.000 61.97223  ? 424 LEU B CD1 1 
ATOM 8727  C CD2 . LEU B 2 424 ? 63.23065  -7.36719  52.22390   1.000 60.65738  ? 424 LEU B CD2 1 
ATOM 8728  N N   . ASN B 2 425 ? 58.03693  -7.69336  53.29861   1.000 79.41577  ? 425 ASN B N   1 
ATOM 8729  C CA  . ASN B 2 425 ? 56.85712  -7.17316  53.97373   1.000 77.23679  ? 425 ASN B CA  1 
ATOM 8730  C C   . ASN B 2 425 ? 56.58854  -7.89097  55.28633   1.000 70.83795  ? 425 ASN B C   1 
ATOM 8731  O O   . ASN B 2 425 ? 55.89038  -7.34529  56.14723   1.000 73.23347  ? 425 ASN B O   1 
ATOM 8732  C CB  . ASN B 2 425 ? 55.63874  -7.30390  53.05295   1.000 75.00130  ? 425 ASN B CB  1 
ATOM 8733  C CG  . ASN B 2 425 ? 54.55026  -6.29792  53.36762   1.000 85.88321  ? 425 ASN B CG  1 
ATOM 8734  O OD1 . ASN B 2 425 ? 54.60998  -5.58499  54.36857   1.000 99.62926  ? 425 ASN B OD1 1 
ATOM 8735  N ND2 . ASN B 2 425 ? 53.54133  -6.23976  52.50732   1.000 86.29666  ? 425 ASN B ND2 1 
ATOM 8736  N N   . LEU B 2 426 ? 57.12952  -9.09716  55.45781   1.000 70.97048  ? 426 LEU B N   1 
ATOM 8737  C CA  . LEU B 2 426 ? 56.96953  -9.82366  56.71292   1.000 68.03048  ? 426 LEU B CA  1 
ATOM 8738  C C   . LEU B 2 426 ? 57.78989  -9.23589  57.85505   1.000 72.99016  ? 426 LEU B C   1 
ATOM 8739  O O   . LEU B 2 426 ? 57.80822  -9.82681  58.94020   1.000 72.75234  ? 426 LEU B O   1 
ATOM 8740  C CB  . LEU B 2 426 ? 57.33821  -11.29554 56.51612   1.000 62.24541  ? 426 LEU B CB  1 
ATOM 8741  C CG  . LEU B 2 426 ? 56.17458  -12.27459 56.33991   1.000 61.21506  ? 426 LEU B CG  1 
ATOM 8742  C CD1 . LEU B 2 426 ? 55.23617  -11.82814 55.23095   1.000 60.96617  ? 426 LEU B CD1 1 
ATOM 8743  C CD2 . LEU B 2 426 ? 56.69922  -13.67762 56.06112   1.000 60.80328  ? 426 LEU B CD2 1 
ATOM 8744  N N   . GLY B 2 427 ? 58.47066  -8.11072  57.64616   1.000 65.12240  ? 427 GLY B N   1 
ATOM 8745  C CA  . GLY B 2 427 ? 59.23568  -7.48519  58.70655   1.000 74.37940  ? 427 GLY B CA  1 
ATOM 8746  C C   . GLY B 2 427 ? 58.74387  -6.11612  59.13326   1.000 86.50848  ? 427 GLY B C   1 
ATOM 8747  O O   . GLY B 2 427 ? 59.54892  -5.24028  59.45993   1.000 98.46029  ? 427 GLY B O   1 
ATOM 8748  N N   . GLN B 2 428 ? 57.42548  -5.92025  59.16560   1.000 78.16257  ? 428 GLN B N   1 
ATOM 8749  C CA  . GLN B 2 428 ? 56.83977  -4.63761  59.53858   1.000 69.81190  ? 428 GLN B CA  1 
ATOM 8750  C C   . GLN B 2 428 ? 56.61545  -4.49825  61.03563   1.000 83.85511  ? 428 GLN B C   1 
ATOM 8751  O O   . GLN B 2 428 ? 55.68781  -3.78561  61.43754   1.000 103.08429 ? 428 GLN B O   1 
ATOM 8752  C CB  . GLN B 2 428 ? 55.51268  -4.42166  58.80886   1.000 66.38661  ? 428 GLN B CB  1 
ATOM 8753  C CG  . GLN B 2 428 ? 55.60084  -4.26518  57.30845   1.000 76.15977  ? 428 GLN B CG  1 
ATOM 8754  C CD  . GLN B 2 428 ? 54.37987  -3.55829  56.74680   1.000 88.21133  ? 428 GLN B CD  1 
ATOM 8755  O OE1 . GLN B 2 428 ? 53.25119  -4.02812  56.89987   1.000 86.76537  ? 428 GLN B OE1 1 
ATOM 8756  N NE2 . GLN B 2 428 ? 54.59858  -2.41350  56.10937   1.000 92.32950  ? 428 GLN B NE2 1 
ATOM 8757  N N   . LYS B 2 429 ? 57.39457  -5.19862  61.86769   1.000 78.79613  ? 429 LYS B N   1 
ATOM 8758  C CA  . LYS B 2 429 ? 57.30563  -5.16045  63.34132   1.000 80.01258  ? 429 LYS B CA  1 
ATOM 8759  C C   . LYS B 2 429 ? 55.87806  -5.38489  63.84266   1.000 88.44841  ? 429 LYS B C   1 
ATOM 8760  O O   . LYS B 2 429 ? 55.56818  -5.11919  65.00860   1.000 94.94639  ? 429 LYS B O   1 
ATOM 8761  C CB  . LYS B 2 429 ? 57.90122  -3.87227  63.94023   1.000 83.10550  ? 429 LYS B CB  1 
ATOM 8762  C CG  . LYS B 2 429 ? 57.19888  -2.56523  63.61990   1.000 100.26877 ? 429 LYS B CG  1 
ATOM 8763  C CD  . LYS B 2 429 ? 57.93523  -1.37268  64.19878   1.000 107.49957 ? 429 LYS B CD  1 
ATOM 8764  C CE  . LYS B 2 429 ? 57.37233  -0.06982  63.65226   1.000 94.87420  ? 429 LYS B CE  1 
ATOM 8765  N NZ  . LYS B 2 429 ? 57.54567  0.02954   62.17236   1.000 72.79579  ? 429 LYS B NZ  1 
ATOM 8766  N N   . ARG B 2 430 ? 55.00891  -5.88463  62.96296   1.000 82.64572  ? 430 ARG B N   1 
ATOM 8767  C CA  . ARG B 2 430 ? 53.66292  -6.33862  63.27912   1.000 75.61427  ? 430 ARG B CA  1 
ATOM 8768  C C   . ARG B 2 430 ? 53.46590  -7.81341  62.97931   1.000 71.96606  ? 430 ARG B C   1 
ATOM 8769  O O   . ARG B 2 430 ? 52.67959  -8.47272  63.66182   1.000 95.00150  ? 430 ARG B O   1 
ATOM 8770  C CB  . ARG B 2 430 ? 52.61458  -5.51106  62.50898   1.000 73.33531  ? 430 ARG B CB  1 
ATOM 8771  C CG  . ARG B 2 430 ? 52.16499  -4.21700  63.20377   1.000 95.19410  ? 430 ARG B CG  1 
ATOM 8772  C CD  . ARG B 2 430 ? 53.30515  -3.22871  63.40648   1.000 108.76852 ? 430 ARG B CD  1 
ATOM 8773  N NE  . ARG B 2 430 ? 53.82879  -2.68975  62.15584   1.000 118.71060 ? 430 ARG B NE  1 
ATOM 8774  C CZ  . ARG B 2 430 ? 53.73546  -1.41411  61.79534   1.000 131.99056 ? 430 ARG B CZ  1 
ATOM 8775  N NH1 . ARG B 2 430 ? 53.13865  -0.53974  62.59352   1.000 145.25424 ? 430 ARG B NH1 1 
ATOM 8776  N NH2 . ARG B 2 430 ? 54.24726  -1.01239  60.63979   1.000 129.90863 ? 430 ARG B NH2 1 
ATOM 8777  N N   . TYR B 2 431 ? 54.15692  -8.34260  61.96930   1.000 58.95705  ? 431 TYR B N   1 
ATOM 8778  C CA  . TYR B 2 431 ? 54.16669  -9.76603  61.66952   1.000 60.73239  ? 431 TYR B CA  1 
ATOM 8779  C C   . TYR B 2 431 ? 55.38584  -10.46693 62.25032   1.000 73.09896  ? 431 TYR B C   1 
ATOM 8780  O O   . TYR B 2 431 ? 55.42782  -11.70173 62.25891   1.000 80.82426  ? 431 TYR B O   1 
ATOM 8781  C CB  . TYR B 2 431 ? 54.09668  -9.99502  60.15468   1.000 60.03595  ? 431 TYR B CB  1 
ATOM 8782  C CG  . TYR B 2 431 ? 53.00621  -9.19150  59.48582   1.000 78.20920  ? 431 TYR B CG  1 
ATOM 8783  C CD1 . TYR B 2 431 ? 51.70636  -9.67688  59.41974   1.000 93.27504  ? 431 TYR B CD1 1 
ATOM 8784  C CD2 . TYR B 2 431 ? 53.26925  -7.94607  58.93356   1.000 103.98077 ? 431 TYR B CD2 1 
ATOM 8785  C CE1 . TYR B 2 431 ? 50.70015  -8.94778  58.81761   1.000 115.34736 ? 431 TYR B CE1 1 
ATOM 8786  C CE2 . TYR B 2 431 ? 52.26908  -7.20831  58.32965   1.000 129.78230 ? 431 TYR B CE2 1 
ATOM 8787  C CZ  . TYR B 2 431 ? 50.98670  -7.71388  58.27373   1.000 135.42185 ? 431 TYR B CZ  1 
ATOM 8788  O OH  . TYR B 2 431 ? 49.98842  -6.98209  57.67218   1.000 146.99382 ? 431 TYR B OH  1 
ATOM 8789  N N   . THR B 2 432 ? 56.37049  -9.70948  62.73300   1.000 88.23567  ? 432 THR B N   1 
ATOM 8790  C CA  . THR B 2 432 ? 57.47588  -10.27577 63.49242   1.000 87.68719  ? 432 THR B CA  1 
ATOM 8791  C C   . THR B 2 432 ? 57.14948  -10.35791 64.97501   1.000 74.33792  ? 432 THR B C   1 
ATOM 8792  O O   . THR B 2 432 ? 57.68492  -11.22516 65.67460   1.000 66.62376  ? 432 THR B O   1 
ATOM 8793  C CB  . THR B 2 432 ? 58.74643  -9.44278  63.29962   1.000 75.80539  ? 432 THR B CB  1 
ATOM 8794  O OG1 . THR B 2 432 ? 58.50450  -8.09628  63.72519   1.000 72.60943  ? 432 THR B OG1 1 
ATOM 8795  C CG2 . THR B 2 432 ? 59.16637  -9.43934  61.84047   1.000 65.04264  ? 432 THR B CG2 1 
ATOM 8796  N N   . LYS B 2 433 ? 56.28331  -9.46204  65.45702   1.000 66.41679  ? 433 LYS B N   1 
ATOM 8797  C CA  . LYS B 2 433 ? 55.85263  -9.40997  66.85486   1.000 93.35696  ? 433 LYS B CA  1 
ATOM 8798  C C   . LYS B 2 433 ? 57.03282  -9.30146  67.81784   1.000 109.67006 ? 433 LYS B C   1 
ATOM 8799  O O   . LYS B 2 433 ? 56.93638  -9.70888  68.97785   1.000 123.50225 ? 433 LYS B O   1 
ATOM 8800  C CB  . LYS B 2 433 ? 54.99197  -10.62658 67.21202   1.000 98.61422  ? 433 LYS B CB  1 
ATOM 8801  C CG  . LYS B 2 433 ? 53.62565  -10.65743 66.54289   1.000 99.50926  ? 433 LYS B CG  1 
ATOM 8802  C CD  . LYS B 2 433 ? 52.72789  -9.52453  67.00725   1.000 101.82917 ? 433 LYS B CD  1 
ATOM 8803  C CE  . LYS B 2 433 ? 51.35525  -9.62094  66.35518   1.000 87.97650  ? 433 LYS B CE  1 
ATOM 8804  N NZ  . LYS B 2 433 ? 50.45879  -8.50131  66.75685   1.000 73.07119  ? 433 LYS B NZ  1 
ATOM 8805  N N   . THR B 2 434 ? 58.15427  -8.75148  67.35144   1.000 99.68165  ? 434 THR B N   1 
ATOM 8806  C CA  . THR B 2 434 ? 59.35748  -8.62539  68.16250   1.000 86.08760  ? 434 THR B CA  1 
ATOM 8807  C C   . THR B 2 434 ? 59.92702  -7.22473  67.96461   1.000 77.39836  ? 434 THR B C   1 
ATOM 8808  O O   . THR B 2 434 ? 59.39244  -6.41779  67.19696   1.000 78.60498  ? 434 THR B O   1 
ATOM 8809  C CB  . THR B 2 434 ? 60.38014  -9.71123  67.79555   1.000 100.42117 ? 434 THR B CB  1 
ATOM 8810  O OG1 . THR B 2 434 ? 59.68585  -10.91012 67.43288   1.000 108.33651 ? 434 THR B OG1 1 
ATOM 8811  C CG2 . THR B 2 434 ? 61.28377  -10.03049 68.98282   1.000 108.50084 ? 434 THR B CG2 1 
ATOM 8812  N N   . THR B 2 435 ? 61.02656  -6.93176  68.66374   1.000 76.39260  ? 435 THR B N   1 
ATOM 8813  C CA  . THR B 2 435 ? 61.60469  -5.59337  68.60873   1.000 81.96728  ? 435 THR B CA  1 
ATOM 8814  C C   . THR B 2 435 ? 62.32704  -5.33637  67.29013   1.000 89.36217  ? 435 THR B C   1 
ATOM 8815  O O   . THR B 2 435 ? 62.34795  -4.19605  66.81146   1.000 102.09701 ? 435 THR B O   1 
ATOM 8816  C CB  . THR B 2 435 ? 62.55596  -5.38396  69.78660   1.000 63.28098  ? 435 THR B CB  1 
ATOM 8817  O OG1 . THR B 2 435 ? 63.59671  -6.36854  69.74613   1.000 62.81294  ? 435 THR B OG1 1 
ATOM 8818  C CG2 . THR B 2 435 ? 61.80307  -5.50471  71.10315   1.000 64.59704  ? 435 THR B CG2 1 
ATOM 8819  N N   . TYR B 2 436 ? 62.92488  -6.36366  66.69218   1.000 67.07127  ? 436 TYR B N   1 
ATOM 8820  C CA  . TYR B 2 436 ? 63.60688  -6.18368  65.41952   1.000 64.45251  ? 436 TYR B CA  1 
ATOM 8821  C C   . TYR B 2 436 ? 62.59209  -6.06323  64.28868   1.000 63.76679  ? 436 TYR B C   1 
ATOM 8822  O O   . TYR B 2 436 ? 61.52202  -6.67840  64.31572   1.000 69.13715  ? 436 TYR B O   1 
ATOM 8823  C CB  . TYR B 2 436 ? 64.58281  -7.33471  65.14801   1.000 63.74736  ? 436 TYR B CB  1 
ATOM 8824  C CG  . TYR B 2 436 ? 64.00397  -8.73415  65.24530   1.000 78.98959  ? 436 TYR B CG  1 
ATOM 8825  C CD1 . TYR B 2 436 ? 63.17122  -9.24003  64.25351   1.000 80.41354  ? 436 TYR B CD1 1 
ATOM 8826  C CD2 . TYR B 2 436 ? 64.30530  -9.55481  66.32458   1.000 92.61248  ? 436 TYR B CD2 1 
ATOM 8827  C CE1 . TYR B 2 436 ? 62.64943  -10.51696 64.33862   1.000 75.00158  ? 436 TYR B CE1 1 
ATOM 8828  C CE2 . TYR B 2 436 ? 63.78745  -10.83376 66.41779   1.000 86.74987  ? 436 TYR B CE2 1 
ATOM 8829  C CZ  . TYR B 2 436 ? 62.96093  -11.30860 65.42248   1.000 72.92131  ? 436 TYR B CZ  1 
ATOM 8830  O OH  . TYR B 2 436 ? 62.44439  -12.57985 65.51229   1.000 63.06203  ? 436 TYR B OH  1 
ATOM 8831  N N   . TRP B 2 437 ? 62.93150  -5.24433  63.29538   1.000 68.01729  ? 437 TRP B N   1 
ATOM 8832  C CA  . TRP B 2 437 ? 62.06313  -5.04611  62.14402   1.000 70.48031  ? 437 TRP B CA  1 
ATOM 8833  C C   . TRP B 2 437 ? 62.90061  -4.61242  60.95323   1.000 65.84677  ? 437 TRP B C   1 
ATOM 8834  O O   . TRP B 2 437 ? 63.82759  -3.81203  61.09620   1.000 73.16885  ? 437 TRP B O   1 
ATOM 8835  C CB  . TRP B 2 437 ? 60.97166  -4.00869  62.42489   1.000 73.16428  ? 437 TRP B CB  1 
ATOM 8836  C CG  . TRP B 2 437 ? 61.47317  -2.65722  62.83671   1.000 71.69198  ? 437 TRP B CG  1 
ATOM 8837  C CD1 . TRP B 2 437 ? 62.19162  -2.34968  63.95633   1.000 71.21820  ? 437 TRP B CD1 1 
ATOM 8838  C CD2 . TRP B 2 437 ? 61.27219  -1.42335  62.13811   1.000 76.74667  ? 437 TRP B CD2 1 
ATOM 8839  N NE1 . TRP B 2 437 ? 62.45813  -1.00218  63.99196   1.000 75.01220  ? 437 TRP B NE1 1 
ATOM 8840  C CE2 . TRP B 2 437 ? 61.90366  -0.41101  62.88715   1.000 80.09926  ? 437 TRP B CE2 1 
ATOM 8841  C CE3 . TRP B 2 437 ? 60.62245  -1.07726  60.94899   1.000 77.00035  ? 437 TRP B CE3 1 
ATOM 8842  C CZ2 . TRP B 2 437 ? 61.90451  0.92363   62.48586   1.000 84.78574  ? 437 TRP B CZ2 1 
ATOM 8843  C CZ3 . TRP B 2 437 ? 60.62433  0.24770   60.55250   1.000 77.72246  ? 437 TRP B CZ3 1 
ATOM 8844  C CH2 . TRP B 2 437 ? 61.26089  1.23163   61.31836   1.000 81.82373  ? 437 TRP B CH2 1 
ATOM 8845  N N   . TRP B 2 438 ? 62.55739  -5.13080  59.77784   1.000 64.63723  ? 438 TRP B N   1 
ATOM 8846  C CA  . TRP B 2 438 ? 63.35754  -4.92238  58.58394   1.000 63.43233  ? 438 TRP B CA  1 
ATOM 8847  C C   . TRP B 2 438 ? 62.48065  -4.46210  57.42880   1.000 69.83851  ? 438 TRP B C   1 
ATOM 8848  O O   . TRP B 2 438 ? 61.26010  -4.63441  57.43257   1.000 79.94123  ? 438 TRP B O   1 
ATOM 8849  C CB  . TRP B 2 438 ? 64.10095  -6.20838  58.19249   1.000 62.57520  ? 438 TRP B CB  1 
ATOM 8850  C CG  . TRP B 2 438 ? 63.19231  -7.32292  57.73718   1.000 60.62996  ? 438 TRP B CG  1 
ATOM 8851  C CD1 . TRP B 2 438 ? 62.56991  -7.43555  56.52548   1.000 58.21700  ? 438 TRP B CD1 1 
ATOM 8852  C CD2 . TRP B 2 438 ? 62.79562  -8.47228  58.49686   1.000 67.75175  ? 438 TRP B CD2 1 
ATOM 8853  N NE1 . TRP B 2 438 ? 61.81921  -8.58443  56.48266   1.000 60.67759  ? 438 TRP B NE1 1 
ATOM 8854  C CE2 . TRP B 2 438 ? 61.94147  -9.23948  57.67944   1.000 68.74622  ? 438 TRP B CE2 1 
ATOM 8855  C CE3 . TRP B 2 438 ? 63.08401  -8.92939  59.78652   1.000 69.64958  ? 438 TRP B CE3 1 
ATOM 8856  C CZ2 . TRP B 2 438 ? 61.37149  -10.43524 58.11026   1.000 79.61299  ? 438 TRP B CZ2 1 
ATOM 8857  C CZ3 . TRP B 2 438 ? 62.51808  -10.11819 60.21134   1.000 69.51322  ? 438 TRP B CZ3 1 
ATOM 8858  C CH2 . TRP B 2 438 ? 61.67190  -10.85698 59.37586   1.000 80.38453  ? 438 TRP B CH2 1 
ATOM 8859  N N   . ASP B 2 439 ? 63.13389  -3.87145  56.43338   1.000 66.32257  ? 439 ASP B N   1 
ATOM 8860  C CA  . ASP B 2 439 ? 62.50185  -3.56571  55.15730   1.000 77.23145  ? 439 ASP B CA  1 
ATOM 8861  C C   . ASP B 2 439 ? 63.61620  -3.37495  54.14175   1.000 77.44497  ? 439 ASP B C   1 
ATOM 8862  O O   . ASP B 2 439 ? 64.76157  -3.10257  54.50440   1.000 76.85956  ? 439 ASP B O   1 
ATOM 8863  C CB  . ASP B 2 439 ? 61.60082  -2.32655  55.24503   1.000 84.95297  ? 439 ASP B CB  1 
ATOM 8864  C CG  . ASP B 2 439 ? 60.74751  -2.13369  54.00741   1.000 93.92630  ? 439 ASP B CG  1 
ATOM 8865  O OD1 . ASP B 2 439 ? 59.75556  -2.87658  53.84842   1.000 96.81363  ? 439 ASP B OD1 1 
ATOM 8866  O OD2 . ASP B 2 439 ? 61.06869  -1.24171  53.19394   1.000 97.00616  ? 439 ASP B OD2 1 
ATOM 8867  N N   . GLY B 2 440 ? 63.28136  -3.52158  52.86919   1.000 81.22019  ? 440 GLY B N   1 
ATOM 8868  C CA  . GLY B 2 440 ? 64.32273  -3.38365  51.87637   1.000 82.45103  ? 440 GLY B CA  1 
ATOM 8869  C C   . GLY B 2 440 ? 63.77626  -3.30143  50.47213   1.000 80.01243  ? 440 GLY B C   1 
ATOM 8870  O O   . GLY B 2 440 ? 62.56932  -3.18549  50.25175   1.000 80.06140  ? 440 GLY B O   1 
ATOM 8871  N N   . LEU B 2 441 ? 64.70398  -3.36250  49.52467   1.000 67.98157  ? 441 LEU B N   1 
ATOM 8872  C CA  . LEU B 2 441 ? 64.40053  -3.35619  48.10397   1.000 72.69665  ? 441 LEU B CA  1 
ATOM 8873  C C   . LEU B 2 441 ? 64.79148  -4.69771  47.50338   1.000 67.23987  ? 441 LEU B C   1 
ATOM 8874  O O   . LEU B 2 441 ? 65.86155  -5.23830  47.80591   1.000 72.04130  ? 441 LEU B O   1 
ATOM 8875  C CB  . LEU B 2 441 ? 65.13989  -2.22766  47.38046   1.000 97.46151  ? 441 LEU B CB  1 
ATOM 8876  C CG  . LEU B 2 441 ? 64.54349  -0.82250  47.46806   1.000 120.47443 ? 441 LEU B CG  1 
ATOM 8877  C CD1 . LEU B 2 441 ? 64.77357  -0.22869  48.84621   1.000 122.28840 ? 441 LEU B CD1 1 
ATOM 8878  C CD2 . LEU B 2 441 ? 65.13047  0.07269   46.39211   1.000 133.26549 ? 441 LEU B CD2 1 
ATOM 8879  N N   . GLN B 2 442 ? 63.92011  -5.22785  46.65168   1.000 70.39873  ? 442 GLN B N   1 
ATOM 8880  C CA  . GLN B 2 442 ? 64.10155  -6.54157  46.05780   1.000 71.16074  ? 442 GLN B CA  1 
ATOM 8881  C C   . GLN B 2 442 ? 64.23119  -6.42165  44.54658   1.000 75.22758  ? 442 GLN B C   1 
ATOM 8882  O O   . GLN B 2 442 ? 63.51498  -5.64483  43.90678   1.000 74.17127  ? 442 GLN B O   1 
ATOM 8883  C CB  . GLN B 2 442 ? 62.93611  -7.47231  46.40847   1.000 81.70726  ? 442 GLN B CB  1 
ATOM 8884  C CG  . GLN B 2 442 ? 63.12583  -8.90372  45.93718   1.000 87.81731  ? 442 GLN B CG  1 
ATOM 8885  C CD  . GLN B 2 442 ? 64.19986  -9.63220  46.72080   1.000 73.02255  ? 442 GLN B CD  1 
ATOM 8886  O OE1 . GLN B 2 442 ? 64.27925  -9.51387  47.94348   1.000 60.26439  ? 442 GLN B OE1 1 
ATOM 8887  N NE2 . GLN B 2 442 ? 65.03531  -10.38933 46.01888   1.000 73.34252  ? 442 GLN B NE2 1 
ATOM 8888  N N   . SER B 2 443 ? 65.15997  -7.19369  43.98943   1.000 80.19296  ? 443 SER B N   1 
ATOM 8889  C CA  . SER B 2 443 ? 65.26172  -7.40368  42.55225   1.000 76.74358  ? 443 SER B CA  1 
ATOM 8890  C C   . SER B 2 443 ? 65.23122  -8.90261  42.29490   1.000 80.33803  ? 443 SER B C   1 
ATOM 8891  O O   . SER B 2 443 ? 64.88242  -9.67336  43.19586   1.000 108.56274 ? 443 SER B O   1 
ATOM 8892  C CB  . SER B 2 443 ? 66.53561  -6.77128  41.98969   1.000 82.01154  ? 443 SER B CB  1 
ATOM 8893  O OG  . SER B 2 443 ? 66.64661  -6.98606  40.59444   1.000 75.91534  ? 443 SER B OG  1 
ATOM 8894  N N   . SER B 2 444 ? 65.56282  -9.32295  41.07181   1.000 65.93492  ? 444 SER B N   1 
ATOM 8895  C CA  . SER B 2 444 ? 65.56300  -10.74486 40.74145   1.000 84.66455  ? 444 SER B CA  1 
ATOM 8896  C C   . SER B 2 444 ? 66.38022  -11.54518 41.75197   1.000 68.59231  ? 444 SER B C   1 
ATOM 8897  O O   . SER B 2 444 ? 65.86581  -12.45906 42.40448   1.000 58.85608  ? 444 SER B O   1 
ATOM 8898  C CB  . SER B 2 444 ? 66.10187  -10.94777 39.32359   1.000 127.89783 ? 444 SER B CB  1 
ATOM 8899  O OG  . SER B 2 444 ? 65.31759  -10.24832 38.37258   1.000 155.42290 ? 444 SER B OG  1 
ATOM 8900  N N   . ASP B 2 445 ? 67.65009  -11.20354 41.90501   1.000 72.78294  ? 445 ASP B N   1 
ATOM 8901  C CA  . ASP B 2 445 ? 68.49869  -11.84505 42.90595   1.000 78.31111  ? 445 ASP B CA  1 
ATOM 8902  C C   . ASP B 2 445 ? 69.17151  -10.85220 43.84240   1.000 82.68067  ? 445 ASP B C   1 
ATOM 8903  O O   . ASP B 2 445 ? 69.28243  -11.12561 45.03985   1.000 63.23410  ? 445 ASP B O   1 
ATOM 8904  C CB  . ASP B 2 445 ? 69.55478  -12.72435 42.21306   1.000 98.51112  ? 445 ASP B CB  1 
ATOM 8905  C CG  . ASP B 2 445 ? 70.27952  -11.99629 41.10070   1.000 121.54704 ? 445 ASP B CG  1 
ATOM 8906  O OD1 . ASP B 2 445 ? 70.01047  -10.79298 40.90592   1.000 127.43875 ? 445 ASP B OD1 1 
ATOM 8907  O OD2 . ASP B 2 445 ? 71.11265  -12.62783 40.41632   1.000 133.51961 ? 445 ASP B OD2 1 
ATOM 8908  N N   . ASP B 2 446 ? 69.61592  -9.70780  43.33066   1.000 87.96762  ? 446 ASP B N   1 
ATOM 8909  C CA  . ASP B 2 446 ? 70.24179  -8.68582  44.16253   1.000 113.54072 ? 446 ASP B CA  1 
ATOM 8910  C C   . ASP B 2 446 ? 69.19146  -7.97785  45.00901   1.000 84.44008  ? 446 ASP B C   1 
ATOM 8911  O O   . ASP B 2 446 ? 68.30352  -7.30872  44.47381   1.000 65.58193  ? 446 ASP B O   1 
ATOM 8912  C CB  . ASP B 2 446 ? 70.98676  -7.67777  43.29463   1.000 134.71308 ? 446 ASP B CB  1 
ATOM 8913  C CG  . ASP B 2 446 ? 72.34829  -8.17074  42.87155   1.000 134.30816 ? 446 ASP B CG  1 
ATOM 8914  O OD1 . ASP B 2 446 ? 73.03600  -8.80659  43.69797   1.000 132.16961 ? 446 ASP B OD1 1 
ATOM 8915  O OD2 . ASP B 2 446 ? 72.72987  -7.92215  41.71008   1.000 129.99266 ? 446 ASP B OD2 1 
ATOM 8916  N N   . PHE B 2 447 ? 69.28799  -8.12203  46.32791   1.000 97.49644  ? 447 PHE B N   1 
ATOM 8917  C CA  . PHE B 2 447 ? 68.38391  -7.44686  47.24677   1.000 84.74778  ? 447 PHE B CA  1 
ATOM 8918  C C   . PHE B 2 447 ? 69.19243  -6.66489  48.27168   1.000 78.83928  ? 447 PHE B C   1 
ATOM 8919  O O   . PHE B 2 447 ? 70.32393  -7.02958  48.60197   1.000 84.64270  ? 447 PHE B O   1 
ATOM 8920  C CB  . PHE B 2 447 ? 67.44288  -8.44733  47.95414   1.000 86.71670  ? 447 PHE B CB  1 
ATOM 8921  C CG  . PHE B 2 447 ? 68.14139  -9.39090  48.90480   1.000 74.89845  ? 447 PHE B CG  1 
ATOM 8922  C CD1 . PHE B 2 447 ? 68.42291  -10.69022 48.52002   1.000 78.83640  ? 447 PHE B CD1 1 
ATOM 8923  C CD2 . PHE B 2 447 ? 68.46764  -8.99807  50.19634   1.000 57.65351  ? 447 PHE B CD2 1 
ATOM 8924  C CE1 . PHE B 2 447 ? 69.05139  -11.56516 49.38567   1.000 68.47145  ? 447 PHE B CE1 1 
ATOM 8925  C CE2 . PHE B 2 447 ? 69.09703  -9.86971  51.06550   1.000 56.55528  ? 447 PHE B CE2 1 
ATOM 8926  C CZ  . PHE B 2 447 ? 69.38622  -11.15484 50.65997   1.000 56.06423  ? 447 PHE B CZ  1 
ATOM 8927  N N   . ALA B 2 448 ? 68.60138  -5.58016  48.77042   1.000 55.15992  ? 448 ALA B N   1 
ATOM 8928  C CA  . ALA B 2 448 ? 69.23956  -4.73008  49.76980   1.000 55.65692  ? 448 ALA B CA  1 
ATOM 8929  C C   . ALA B 2 448 ? 68.30713  -4.61925  50.96438   1.000 55.98869  ? 448 ALA B C   1 
ATOM 8930  O O   . ALA B 2 448 ? 67.16878  -4.16037  50.82264   1.000 56.01754  ? 448 ALA B O   1 
ATOM 8931  C CB  . ALA B 2 448 ? 69.56036  -3.34428  49.20246   1.000 55.85179  ? 448 ALA B CB  1 
ATOM 8932  N N   . LEU B 2 449 ? 68.78367  -5.03844  52.13453   1.000 63.61978  ? 449 LEU B N   1 
ATOM 8933  C CA  . LEU B 2 449 ? 67.96915  -5.04962  53.34086   1.000 71.72135  ? 449 LEU B CA  1 
ATOM 8934  C C   . LEU B 2 449 ? 68.47366  -4.01115  54.33592   1.000 92.08743  ? 449 LEU B C   1 
ATOM 8935  O O   . LEU B 2 449 ? 69.67110  -3.72509  54.40109   1.000 100.51290 ? 449 LEU B O   1 
ATOM 8936  C CB  . LEU B 2 449 ? 67.97117  -6.44204  53.98466   1.000 54.39075  ? 449 LEU B CB  1 
ATOM 8937  C CG  . LEU B 2 449 ? 67.09034  -6.66532  55.21475   1.000 52.92355  ? 449 LEU B CG  1 
ATOM 8938  C CD1 . LEU B 2 449 ? 65.65188  -6.27587  54.91351   1.000 52.87878  ? 449 LEU B CD1 1 
ATOM 8939  C CD2 . LEU B 2 449 ? 67.17360  -8.10445  55.68235   1.000 52.86091  ? 449 LEU B CD2 1 
ATOM 8940  N N   . ILE B 2 450 ? 67.54990  -3.44396  55.11130   1.000 73.13394  ? 450 ILE B N   1 
ATOM 8941  C CA  . ILE B 2 450 ? 67.87396  -2.58628  56.24398   1.000 70.08111  ? 450 ILE B CA  1 
ATOM 8942  C C   . ILE B 2 450 ? 67.04857  -3.07499  57.42456   1.000 80.99732  ? 450 ILE B C   1 
ATOM 8943  O O   . ILE B 2 450 ? 65.81178  -3.09002  57.35624   1.000 106.91449 ? 450 ILE B O   1 
ATOM 8944  C CB  . ILE B 2 450 ? 67.58041  -1.10193  55.96242   1.000 66.22444  ? 450 ILE B CB  1 
ATOM 8945  C CG1 . ILE B 2 450 ? 68.14686  -0.67519  54.60623   1.000 80.78330  ? 450 ILE B CG1 1 
ATOM 8946  C CG2 . ILE B 2 450 ? 68.14295  -0.23191  57.07450   1.000 66.25091  ? 450 ILE B CG2 1 
ATOM 8947  C CD1 . ILE B 2 450 ? 67.09218  -0.53873  53.52270   1.000 89.30458  ? 450 ILE B CD1 1 
ATOM 8948  N N   . VAL B 2 451 ? 67.72513  -3.48030  58.49771   1.000 53.92125  ? 451 VAL B N   1 
ATOM 8949  C CA  . VAL B 2 451 ? 67.07526  -4.01502  59.68818   1.000 54.45952  ? 451 VAL B CA  1 
ATOM 8950  C C   . VAL B 2 451 ? 67.45582  -3.15143  60.88320   1.000 55.52169  ? 451 VAL B C   1 
ATOM 8951  O O   . VAL B 2 451 ? 68.63763  -2.84171  61.08440   1.000 55.74282  ? 451 VAL B O   1 
ATOM 8952  C CB  . VAL B 2 451 ? 67.45351  -5.48992  59.92389   1.000 54.12131  ? 451 VAL B CB  1 
ATOM 8953  C CG1 . VAL B 2 451 ? 68.95671  -5.69011  59.78150   1.000 53.99956  ? 451 VAL B CG1 1 
ATOM 8954  C CG2 . VAL B 2 451 ? 66.97098  -5.95700  61.28694   1.000 54.84777  ? 451 VAL B CG2 1 
ATOM 8955  N N   . ASN B 2 452 ? 66.45200  -2.74554  61.65844   1.000 60.86557  ? 452 ASN B N   1 
ATOM 8956  C CA  . ASN B 2 452 ? 66.65155  -2.02755  62.90711   1.000 62.04906  ? 452 ASN B CA  1 
ATOM 8957  C C   . ASN B 2 452 ? 66.24826  -2.89986  64.08745   1.000 62.58286  ? 452 ASN B C   1 
ATOM 8958  O O   . ASN B 2 452 ? 65.27415  -3.65790  64.01345   1.000 62.30284  ? 452 ASN B O   1 
ATOM 8959  C CB  . ASN B 2 452 ? 65.84518  -0.72560  62.94380   1.000 62.78348  ? 452 ASN B CB  1 
ATOM 8960  C CG  . ASN B 2 452 ? 66.00694  0.10199   61.68655   1.000 62.26942  ? 452 ASN B CG  1 
ATOM 8961  O OD1 . ASN B 2 452 ? 66.80286  -0.22522  60.80811   1.000 61.40492  ? 452 ASN B OD1 1 
ATOM 8962  N ND2 . ASN B 2 452 ? 65.25626  1.19391   61.60105   1.000 62.90775  ? 452 ASN B ND2 1 
ATOM 8963  N N   . ALA B 2 453 ? 67.00746  -2.78307  65.16946   1.000 78.13262  ? 453 ALA B N   1 
ATOM 8964  C CA  . ALA B 2 453 ? 66.74484  -3.47601  66.42039   1.000 90.88649  ? 453 ALA B CA  1 
ATOM 8965  C C   . ALA B 2 453 ? 67.23324  -2.58072  67.54624   1.000 83.01353  ? 453 ALA B C   1 
ATOM 8966  O O   . ALA B 2 453 ? 68.09509  -1.72095  67.32770   1.000 68.24711  ? 453 ALA B O   1 
ATOM 8967  C CB  . ALA B 2 453 ? 67.43307  -4.84719  66.46659   1.000 101.41627 ? 453 ALA B CB  1 
ATOM 8968  N N   . PRO B 2 454 ? 66.70146  -2.74569  68.76060   1.000 80.01826  ? 454 PRO B N   1 
ATOM 8969  C CA  . PRO B 2 454 ? 67.07258  -1.82067  69.84286   1.000 91.13404  ? 454 PRO B CA  1 
ATOM 8970  C C   . PRO B 2 454 ? 68.50971  -1.95436  70.31968   1.000 116.44004 ? 454 PRO B C   1 
ATOM 8971  O O   . PRO B 2 454 ? 69.03924  -0.98833  70.88244   1.000 142.81181 ? 454 PRO B O   1 
ATOM 8972  C CB  . PRO B 2 454 ? 66.08085  -2.17536  70.95893   1.000 91.05484  ? 454 PRO B CB  1 
ATOM 8973  C CG  . PRO B 2 454 ? 65.72396  -3.59974  70.69118   1.000 89.05003  ? 454 PRO B CG  1 
ATOM 8974  C CD  . PRO B 2 454 ? 65.66625  -3.70039  69.19363   1.000 77.07930  ? 454 PRO B CD  1 
ATOM 8975  N N   . ASN B 2 455 ? 69.16241  -3.09781  70.11985   1.000 106.04108 ? 455 ASN B N   1 
ATOM 8976  C CA  . ASN B 2 455 ? 70.53722  -3.25105  70.57571   1.000 94.60488  ? 455 ASN B CA  1 
ATOM 8977  C C   . ASN B 2 455 ? 71.30114  -4.18432  69.64516   1.000 83.32309  ? 455 ASN B C   1 
ATOM 8978  O O   . ASN B 2 455 ? 70.71371  -4.92836  68.85530   1.000 77.17667  ? 455 ASN B O   1 
ATOM 8979  C CB  . ASN B 2 455 ? 70.60126  -3.75426  72.02128   1.000 106.47757 ? 455 ASN B CB  1 
ATOM 8980  C CG  . ASN B 2 455 ? 71.72458  -3.10540  72.80614   1.000 130.50766 ? 455 ASN B CG  1 
ATOM 8981  O OD1 . ASN B 2 455 ? 72.20925  -2.03322  72.44147   1.000 146.45917 ? 455 ASN B OD1 1 
ATOM 8982  N ND2 . ASN B 2 455 ? 72.14337  -3.74919  73.88890   1.000 131.75851 ? 455 ASN B ND2 1 
ATOM 8983  N N   . HIS B 2 456 ? 72.63418  -4.12886  69.75700   1.000 99.61252  ? 456 HIS B N   1 
ATOM 8984  C CA  . HIS B 2 456 ? 73.52247  -4.94184  68.92942   1.000 95.54815  ? 456 HIS B CA  1 
ATOM 8985  C C   . HIS B 2 456 ? 73.27400  -6.43619  69.08450   1.000 102.28439 ? 456 HIS B C   1 
ATOM 8986  O O   . HIS B 2 456 ? 73.68812  -7.21537  68.21912   1.000 103.40810 ? 456 HIS B O   1 
ATOM 8987  C CB  . HIS B 2 456 ? 74.98089  -4.66553  69.30634   1.000 91.27463  ? 456 HIS B CB  1 
ATOM 8988  C CG  . HIS B 2 456 ? 75.64356  -3.61039  68.47961   1.000 103.12117 ? 456 HIS B CG  1 
ATOM 8989  N ND1 . HIS B 2 456 ? 76.29035  -3.88935  67.29526   1.000 104.89294 ? 456 HIS B ND1 1 
ATOM 8990  C CD2 . HIS B 2 456 ? 75.78411  -2.27901  68.68118   1.000 111.59435 ? 456 HIS B CD2 1 
ATOM 8991  C CE1 . HIS B 2 456 ? 76.78876  -2.77288  66.79526   1.000 110.55355 ? 456 HIS B CE1 1 
ATOM 8992  N NE2 . HIS B 2 456 ? 76.49571  -1.78105  67.61701   1.000 112.74962 ? 456 HIS B NE2 1 
ATOM 8993  N N   . GLU B 2 457 ? 72.60716  -6.85122  70.16033   1.000 101.29289 ? 457 GLU B N   1 
ATOM 8994  C CA  . GLU B 2 457 ? 72.35845  -8.26699  70.40068   1.000 101.87367 ? 457 GLU B CA  1 
ATOM 8995  C C   . GLU B 2 457 ? 71.19843  -8.80801  69.57308   1.000 82.01853  ? 457 GLU B C   1 
ATOM 8996  O O   . GLU B 2 457 ? 71.20918  -9.98600  69.19806   1.000 73.46397  ? 457 GLU B O   1 
ATOM 8997  C CB  . GLU B 2 457 ? 72.10347  -8.48774  71.89431   1.000 130.83762 ? 457 GLU B CB  1 
ATOM 8998  C CG  . GLU B 2 457 ? 73.36890  -8.46792  72.75373   1.000 143.81956 ? 457 GLU B CG  1 
ATOM 8999  C CD  . GLU B 2 457 ? 73.91446  -7.07013  73.01533   1.000 136.53396 ? 457 GLU B CD  1 
ATOM 9000  O OE1 . GLU B 2 457 ? 73.42392  -6.10150  72.39903   1.000 139.74582 ? 457 GLU B OE1 1 
ATOM 9001  O OE2 . GLU B 2 457 ? 74.85475  -6.94443  73.82862   1.000 120.82927 ? 457 GLU B OE2 1 
ATOM 9002  N N   . GLY B 2 458 ? 70.20042  -7.97551  69.27768   1.000 87.33764  ? 458 GLY B N   1 
ATOM 9003  C CA  . GLY B 2 458 ? 69.03075  -8.39487  68.52959   1.000 86.35551  ? 458 GLY B CA  1 
ATOM 9004  C C   . GLY B 2 458 ? 69.11589  -8.33081  67.01944   1.000 79.75561  ? 458 GLY B C   1 
ATOM 9005  O O   . GLY B 2 458 ? 68.26156  -8.91247  66.34441   1.000 67.48350  ? 458 GLY B O   1 
ATOM 9006  N N   . ILE B 2 459 ? 70.11129  -7.63332  66.46556   1.000 79.98615  ? 459 ILE B N   1 
ATOM 9007  C CA  . ILE B 2 459 ? 70.22963  -7.52977  65.01116   1.000 75.14344  ? 459 ILE B CA  1 
ATOM 9008  C C   . ILE B 2 459 ? 70.47385  -8.89539  64.37947   1.000 88.63402  ? 459 ILE B C   1 
ATOM 9009  O O   . ILE B 2 459 ? 69.86086  -9.24042  63.35914   1.000 97.97255  ? 459 ILE B O   1 
ATOM 9010  C CB  . ILE B 2 459 ? 71.33959  -6.53107  64.63255   1.000 65.10417  ? 459 ILE B CB  1 
ATOM 9011  C CG1 . ILE B 2 459 ? 71.09851  -5.17389  65.29630   1.000 61.02545  ? 459 ILE B CG1 1 
ATOM 9012  C CG2 . ILE B 2 459 ? 71.43611  -6.38811  63.11779   1.000 61.53717  ? 459 ILE B CG2 1 
ATOM 9013  C CD1 . ILE B 2 459 ? 70.23956  -4.24323  64.46930   1.000 61.04815  ? 459 ILE B CD1 1 
ATOM 9014  N N   . GLN B 2 460 ? 71.36414  -9.69777  64.97063   1.000 85.67099  ? 460 GLN B N   1 
ATOM 9015  C CA  . GLN B 2 460 ? 71.62106  -11.01922 64.40667   1.000 89.70084  ? 460 GLN B CA  1 
ATOM 9016  C C   . GLN B 2 460 ? 70.39341  -11.91463 64.49286   1.000 109.14636 ? 460 GLN B C   1 
ATOM 9017  O O   . GLN B 2 460 ? 70.17982  -12.74571 63.60757   1.000 111.79625 ? 460 GLN B O   1 
ATOM 9018  C CB  . GLN B 2 460 ? 72.81216  -11.68967 65.09492   1.000 88.81653  ? 460 GLN B CB  1 
ATOM 9019  C CG  . GLN B 2 460 ? 73.09781  -13.09010 64.55269   1.000 84.38024  ? 460 GLN B CG  1 
ATOM 9020  C CD  . GLN B 2 460 ? 74.39415  -13.68372 65.06364   1.000 97.25946  ? 460 GLN B CD  1 
ATOM 9021  O OE1 . GLN B 2 460 ? 75.25332  -12.97569 65.58648   1.000 102.70998 ? 460 GLN B OE1 1 
ATOM 9022  N NE2 . GLN B 2 460 ? 74.54377  -14.99513 64.90813   1.000 103.95554 ? 460 GLN B NE2 1 
ATOM 9023  N N   . ALA B 2 461 ? 69.56721  -11.75157 65.52853   1.000 108.36820 ? 461 ALA B N   1 
ATOM 9024  C CA  . ALA B 2 461 ? 68.33461  -12.52906 65.60614   1.000 101.86246 ? 461 ALA B CA  1 
ATOM 9025  C C   . ALA B 2 461 ? 67.39950  -12.19545 64.44978   1.000 98.01564  ? 461 ALA B C   1 
ATOM 9026  O O   . ALA B 2 461 ? 66.81892  -13.09567 63.83027   1.000 104.52031 ? 461 ALA B O   1 
ATOM 9027  C CB  . ALA B 2 461 ? 67.64241  -12.28491 66.94691   1.000 91.62477  ? 461 ALA B CB  1 
ATOM 9028  N N   . GLY B 2 462 ? 67.25166  -10.90680 64.13533   1.000 86.79947  ? 462 GLY B N   1 
ATOM 9029  C CA  . GLY B 2 462 ? 66.43269  -10.52376 62.99659   1.000 81.94265  ? 462 GLY B CA  1 
ATOM 9030  C C   . GLY B 2 462 ? 66.99635  -11.01528 61.67708   1.000 87.61504  ? 462 GLY B C   1 
ATOM 9031  O O   . GLY B 2 462 ? 66.25412  -11.48707 60.81037   1.000 108.39431 ? 462 GLY B O   1 
ATOM 9032  N N   . VAL B 2 463 ? 68.31772  -10.91422 61.50666   1.000 73.48021  ? 463 VAL B N   1 
ATOM 9033  C CA  . VAL B 2 463 ? 68.94485  -11.39719 60.27804   1.000 62.15493  ? 463 VAL B CA  1 
ATOM 9034  C C   . VAL B 2 463 ? 68.75324  -12.90284 60.13646   1.000 75.65641  ? 463 VAL B C   1 
ATOM 9035  O O   . VAL B 2 463 ? 68.48443  -13.41059 59.04029   1.000 75.86281  ? 463 VAL B O   1 
ATOM 9036  C CB  . VAL B 2 463 ? 70.43525  -11.00848 60.24924   1.000 59.99781  ? 463 VAL B CB  1 
ATOM 9037  C CG1 . VAL B 2 463 ? 71.13222  -11.65052 59.05996   1.000 59.43827  ? 463 VAL B CG1 1 
ATOM 9038  C CG2 . VAL B 2 463 ? 70.58842  -9.49661  60.20312   1.000 60.13141  ? 463 VAL B CG2 1 
ATOM 9039  N N   . ASP B 2 464 ? 68.86989  -13.63857 61.24399   1.000 79.94198  ? 464 ASP B N   1 
ATOM 9040  C CA  . ASP B 2 464 ? 68.68790  -15.08459 61.20060   1.000 95.67009  ? 464 ASP B CA  1 
ATOM 9041  C C   . ASP B 2 464 ? 67.24441  -15.45110 60.89122   1.000 75.53680  ? 464 ASP B C   1 
ATOM 9042  O O   . ASP B 2 464 ? 66.99065  -16.39655 60.13743   1.000 59.42419  ? 464 ASP B O   1 
ATOM 9043  C CB  . ASP B 2 464 ? 69.12935  -15.71128 62.52251   1.000 112.91441 ? 464 ASP B CB  1 
ATOM 9044  C CG  . ASP B 2 464 ? 70.62750  -15.63558 62.72989   1.000 102.56874 ? 464 ASP B CG  1 
ATOM 9045  O OD1 . ASP B 2 464 ? 71.36634  -15.63745 61.72271   1.000 96.87147  ? 464 ASP B OD1 1 
ATOM 9046  O OD2 . ASP B 2 464 ? 71.06617  -15.57764 63.89785   1.000 92.31554  ? 464 ASP B OD2 1 
ATOM 9047  N N   . ARG B 2 465 ? 66.28507  -14.72806 61.47524   1.000 92.25996  ? 465 ARG B N   1 
ATOM 9048  C CA  . ARG B 2 465 ? 64.88391  -14.95847 61.13728   1.000 83.20719  ? 465 ARG B CA  1 
ATOM 9049  C C   . ARG B 2 465 ? 64.63079  -14.71157 59.65532   1.000 72.83448  ? 465 ARG B C   1 
ATOM 9050  O O   . ARG B 2 465 ? 63.94267  -15.49648 58.99138   1.000 77.09504  ? 465 ARG B O   1 
ATOM 9051  C CB  . ARG B 2 465 ? 63.97056  -14.07543 61.98802   1.000 75.23770  ? 465 ARG B CB  1 
ATOM 9052  C CG  . ARG B 2 465 ? 62.51252  -14.15522 61.55353   1.000 75.98242  ? 465 ARG B CG  1 
ATOM 9053  C CD  . ARG B 2 465 ? 61.55255  -13.64374 62.61262   1.000 78.72695  ? 465 ARG B CD  1 
ATOM 9054  N NE  . ARG B 2 465 ? 60.16338  -13.82026 62.19637   1.000 87.37997  ? 465 ARG B NE  1 
ATOM 9055  C CZ  . ARG B 2 465 ? 59.11321  -13.62512 62.98669   1.000 82.97727  ? 465 ARG B CZ  1 
ATOM 9056  N NH1 . ARG B 2 465 ? 59.28999  -13.24592 64.24438   1.000 82.55577  ? 465 ARG B NH1 1 
ATOM 9057  N NH2 . ARG B 2 465 ? 57.88546  -13.81385 62.52106   1.000 77.86101  ? 465 ARG B NH2 1 
ATOM 9058  N N   . PHE B 2 466 ? 65.16684  -13.60938 59.12321   1.000 54.86141  ? 466 PHE B N   1 
ATOM 9059  C CA  . PHE B 2 466 ? 65.00913  -13.31859 57.70076   1.000 58.43261  ? 466 PHE B CA  1 
ATOM 9060  C C   . PHE B 2 466 ? 65.59829  -14.43435 56.84541   1.000 68.68292  ? 466 PHE B C   1 
ATOM 9061  O O   . PHE B 2 466 ? 64.97298  -14.89239 55.88269   1.000 87.62102  ? 466 PHE B O   1 
ATOM 9062  C CB  . PHE B 2 466 ? 65.66362  -11.97978 57.36321   1.000 65.69929  ? 466 PHE B CB  1 
ATOM 9063  C CG  . PHE B 2 466 ? 65.57874  -11.61591 55.90958   1.000 78.14555  ? 466 PHE B CG  1 
ATOM 9064  C CD1 . PHE B 2 466 ? 64.35698  -11.33671 55.32063   1.000 82.80835  ? 466 PHE B CD1 1 
ATOM 9065  C CD2 . PHE B 2 466 ? 66.72028  -11.56705 55.12807   1.000 86.86297  ? 466 PHE B CD2 1 
ATOM 9066  C CE1 . PHE B 2 466 ? 64.27684  -11.00353 53.98068   1.000 91.09518  ? 466 PHE B CE1 1 
ATOM 9067  C CE2 . PHE B 2 466 ? 66.64774  -11.23563 53.78787   1.000 88.57339  ? 466 PHE B CE2 1 
ATOM 9068  C CZ  . PHE B 2 466 ? 65.42396  -10.95388 53.21322   1.000 93.60557  ? 466 PHE B CZ  1 
ATOM 9069  N N   . TYR B 2 467 ? 66.80291  -14.89309 57.19351   1.000 65.67570  ? 467 TYR B N   1 
ATOM 9070  C CA  . TYR B 2 467 ? 67.46860  -15.92427 56.40289   1.000 64.30736  ? 467 TYR B CA  1 
ATOM 9071  C C   . TYR B 2 467 ? 66.71408  -17.24795 56.46794   1.000 57.90351  ? 467 TYR B C   1 
ATOM 9072  O O   . TYR B 2 467 ? 66.57495  -17.94274 55.45364   1.000 56.57029  ? 467 TYR B O   1 
ATOM 9073  C CB  . TYR B 2 467 ? 68.90952  -16.08556 56.89116   1.000 74.88506  ? 467 TYR B CB  1 
ATOM 9074  C CG  . TYR B 2 467 ? 69.67783  -17.22877 56.26934   1.000 80.37716  ? 467 TYR B CG  1 
ATOM 9075  C CD1 . TYR B 2 467 ? 69.79642  -17.34639 54.89193   1.000 85.69070  ? 467 TYR B CD1 1 
ATOM 9076  C CD2 . TYR B 2 467 ? 70.30908  -18.17595 57.06438   1.000 85.91304  ? 467 TYR B CD2 1 
ATOM 9077  C CE1 . TYR B 2 467 ? 70.50747  -18.38667 54.32227   1.000 98.47003  ? 467 TYR B CE1 1 
ATOM 9078  C CE2 . TYR B 2 467 ? 71.02248  -19.21809 56.50570   1.000 95.53154  ? 467 TYR B CE2 1 
ATOM 9079  C CZ  . TYR B 2 467 ? 71.11899  -19.31912 55.13393   1.000 101.21271 ? 467 TYR B CZ  1 
ATOM 9080  O OH  . TYR B 2 467 ? 71.82857  -20.35561 54.57106   1.000 101.34750 ? 467 TYR B OH  1 
ATOM 9081  N N   . ARG B 2 468 ? 66.19350  -17.59998 57.64447   1.000 52.38181  ? 468 ARG B N   1 
ATOM 9082  C CA  . ARG B 2 468 ? 65.46416  -18.85532 57.78520   1.000 52.57415  ? 468 ARG B CA  1 
ATOM 9083  C C   . ARG B 2 468 ? 64.12333  -18.80435 57.06244   1.000 81.10146  ? 468 ARG B C   1 
ATOM 9084  O O   . ARG B 2 468 ? 63.71123  -19.79097 56.44155   1.000 93.11620  ? 468 ARG B O   1 
ATOM 9085  C CB  . ARG B 2 468 ? 65.27833  -19.17831 59.26646   1.000 60.55267  ? 468 ARG B CB  1 
ATOM 9086  C CG  . ARG B 2 468 ? 66.57734  -19.55796 59.95834   1.000 66.97914  ? 468 ARG B CG  1 
ATOM 9087  C CD  . ARG B 2 468 ? 66.43859  -19.59490 61.47144   1.000 59.29726  ? 468 ARG B CD  1 
ATOM 9088  N NE  . ARG B 2 468 ? 65.58583  -20.68797 61.92427   1.000 55.00099  ? 468 ARG B NE  1 
ATOM 9089  C CZ  . ARG B 2 468 ? 65.43876  -21.03900 63.19738   1.000 66.43626  ? 468 ARG B CZ  1 
ATOM 9090  N NH1 . ARG B 2 468 ? 66.08948  -20.38114 64.14776   1.000 74.87476  ? 468 ARG B NH1 1 
ATOM 9091  N NH2 . ARG B 2 468 ? 64.64234  -22.04869 63.52027   1.000 80.28456  ? 468 ARG B NH2 1 
ATOM 9092  N N   . THR B 2 469 ? 63.42695  -17.66525 57.12566   1.000 53.87896  ? 469 THR B N   1 
ATOM 9093  C CA  . THR B 2 469 ? 62.19104  -17.52432 56.36279   1.000 53.51412  ? 469 THR B CA  1 
ATOM 9094  C C   . THR B 2 469 ? 62.45504  -17.52902 54.86228   1.000 52.91365  ? 469 THR B C   1 
ATOM 9095  O O   . THR B 2 469 ? 61.61783  -18.01059 54.09039   1.000 56.92231  ? 469 THR B O   1 
ATOM 9096  C CB  . THR B 2 469 ? 61.45257  -16.25008 56.77301   1.000 53.61029  ? 469 THR B CB  1 
ATOM 9097  O OG1 . THR B 2 469 ? 62.36652  -15.14655 56.78989   1.000 117.16362 ? 469 THR B OG1 1 
ATOM 9098  C CG2 . THR B 2 469 ? 60.83290  -16.41807 58.15274   1.000 54.30297  ? 469 THR B CG2 1 
ATOM 9099  N N   . CYS B 2 470 ? 63.60182  -16.99689 54.43036   1.000 50.41627  ? 470 CYS B N   1 
ATOM 9100  C CA  . CYS B 2 470 ? 63.98703  -17.11741 53.02812   1.000 49.97660  ? 470 CYS B CA  1 
ATOM 9101  C C   . CYS B 2 470 ? 64.20450  -18.57718 52.65074   1.000 64.77160  ? 470 CYS B C   1 
ATOM 9102  O O   . CYS B 2 470 ? 63.75913  -19.02632 51.58802   1.000 84.20162  ? 470 CYS B O   1 
ATOM 9103  C CB  . CYS B 2 470 ? 65.24636  -16.29373 52.75409   1.000 67.26010  ? 470 CYS B CB  1 
ATOM 9104  S SG  . CYS B 2 470 ? 65.00282  -14.49980 52.75972   1.000 97.29193  ? 470 CYS B SG  1 
ATOM 9105  N N   . LYS B 2 471 ? 64.89506  -19.33174 53.50980   1.000 70.72921  ? 471 LYS B N   1 
ATOM 9106  C CA  . LYS B 2 471 ? 65.06899  -20.76054 53.26488   1.000 67.51164  ? 471 LYS B CA  1 
ATOM 9107  C C   . LYS B 2 471 ? 63.72889  -21.48501 53.23220   1.000 58.29926  ? 471 LYS B C   1 
ATOM 9108  O O   . LYS B 2 471 ? 63.58176  -22.49118 52.52939   1.000 57.92699  ? 471 LYS B O   1 
ATOM 9109  C CB  . LYS B 2 471 ? 65.96856  -21.37140 54.34191   1.000 71.23570  ? 471 LYS B CB  1 
ATOM 9110  C CG  . LYS B 2 471 ? 67.37578  -20.80012 54.38737   1.000 68.60745  ? 471 LYS B CG  1 
ATOM 9111  C CD  . LYS B 2 471 ? 68.25612  -21.33625 53.27051   1.000 63.95949  ? 471 LYS B CD  1 
ATOM 9112  C CE  . LYS B 2 471 ? 68.68712  -22.76873 53.55177   1.000 63.24742  ? 471 LYS B CE  1 
ATOM 9113  N NZ  . LYS B 2 471 ? 69.73336  -23.24057 52.60096   1.000 59.46530  ? 471 LYS B NZ  1 
ATOM 9114  N N   . LEU B 2 472 ? 62.74132  -20.98394 53.97959   1.000 62.86708  ? 472 LEU B N   1 
ATOM 9115  C CA  . LEU B 2 472 ? 61.42256  -21.60896 53.99589   1.000 58.64189  ? 472 LEU B CA  1 
ATOM 9116  C C   . LEU B 2 472 ? 60.68404  -21.43235 52.67518   1.000 58.17245  ? 472 LEU B C   1 
ATOM 9117  O O   . LEU B 2 472 ? 59.87768  -22.29168 52.30207   1.000 59.44088  ? 472 LEU B O   1 
ATOM 9118  C CB  . LEU B 2 472 ? 60.58475  -21.04487 55.14338   1.000 58.88525  ? 472 LEU B CB  1 
ATOM 9119  C CG  . LEU B 2 472 ? 60.76639  -21.70916 56.50855   1.000 59.56584  ? 472 LEU B CG  1 
ATOM 9120  C CD1 . LEU B 2 472 ? 59.90951  -21.02139 57.56131   1.000 69.62424  ? 472 LEU B CD1 1 
ATOM 9121  C CD2 . LEU B 2 472 ? 60.43478  -23.19220 56.42447   1.000 59.92109  ? 472 LEU B CD2 1 
ATOM 9122  N N   . VAL B 2 473 ? 60.93059  -20.33446 51.96055   1.000 55.50035  ? 473 VAL B N   1 
ATOM 9123  C CA  . VAL B 2 473 ? 60.24108  -20.06069 50.70460   1.000 57.38785  ? 473 VAL B CA  1 
ATOM 9124  C C   . VAL B 2 473 ? 61.11362  -20.37952 49.49529   1.000 59.49392  ? 473 VAL B C   1 
ATOM 9125  O O   . VAL B 2 473 ? 60.78046  -19.98497 48.37411   1.000 58.56624  ? 473 VAL B O   1 
ATOM 9126  C CB  . VAL B 2 473 ? 59.73997  -18.60789 50.64986   1.000 54.81923  ? 473 VAL B CB  1 
ATOM 9127  C CG1 . VAL B 2 473 ? 58.64534  -18.38508 51.67976   1.000 55.11590  ? 473 VAL B CG1 1 
ATOM 9128  C CG2 . VAL B 2 473 ? 60.88778  -17.64050 50.87370   1.000 54.70930  ? 473 VAL B CG2 1 
ATOM 9129  N N   . GLY B 2 474 ? 62.22447  -21.08247 49.69620   1.000 51.49674  ? 474 GLY B N   1 
ATOM 9130  C CA  . GLY B 2 474 ? 63.09147  -21.45915 48.59930   1.000 51.50644  ? 474 GLY B CA  1 
ATOM 9131  C C   . GLY B 2 474 ? 64.11517  -20.42266 48.20407   1.000 51.24941  ? 474 GLY B C   1 
ATOM 9132  O O   . GLY B 2 474 ? 64.69620  -20.53015 47.11802   1.000 51.23351  ? 474 GLY B O   1 
ATOM 9133  N N   . ILE B 2 475 ? 64.35387  -19.42123 49.04333   1.000 59.41044  ? 475 ILE B N   1 
ATOM 9134  C CA  . ILE B 2 475 ? 65.31398  -18.36140 48.76195   1.000 66.04973  ? 475 ILE B CA  1 
ATOM 9135  C C   . ILE B 2 475 ? 66.57617  -18.67459 49.55793   1.000 70.22772  ? 475 ILE B C   1 
ATOM 9136  O O   . ILE B 2 475 ? 66.65224  -18.40405 50.75963   1.000 60.12596  ? 475 ILE B O   1 
ATOM 9137  C CB  . ILE B 2 475 ? 64.74770  -16.98230 49.11135   1.000 61.91728  ? 475 ILE B CB  1 
ATOM 9138  C CG1 . ILE B 2 475 ? 63.47034  -16.71398 48.31086   1.000 56.85131  ? 475 ILE B CG1 1 
ATOM 9139  C CG2 . ILE B 2 475 ? 65.78721  -15.89401 48.87424   1.000 62.48820  ? 475 ILE B CG2 1 
ATOM 9140  C CD1 . ILE B 2 475 ? 62.82998  -15.37713 48.61039   1.000 60.20725  ? 475 ILE B CD1 1 
ATOM 9141  N N   . ASN B 2 476 ? 67.57538  -19.24779 48.89206   1.000 70.40634  ? 476 ASN B N   1 
ATOM 9142  C CA  . ASN B 2 476 ? 68.84608  -19.56855 49.53359   1.000 66.19852  ? 476 ASN B CA  1 
ATOM 9143  C C   . ASN B 2 476 ? 69.74943  -18.34471 49.44421   1.000 65.88448  ? 476 ASN B C   1 
ATOM 9144  O O   . ASN B 2 476 ? 70.21097  -17.97837 48.35873   1.000 70.97388  ? 476 ASN B O   1 
ATOM 9145  C CB  . ASN B 2 476 ? 69.49094  -20.79301 48.89054   1.000 85.48132  ? 476 ASN B CB  1 
ATOM 9146  C CG  . ASN B 2 476 ? 68.64606  -22.04182 49.04775   1.000 85.52704  ? 476 ASN B CG  1 
ATOM 9147  O OD1 . ASN B 2 476 ? 68.06411  -22.27938 50.10623   1.000 97.04515  ? 476 ASN B OD1 1 
ATOM 9148  N ND2 . ASN B 2 476 ? 68.57458  -22.84741 47.99515   1.000 67.47741  ? 476 ASN B ND2 1 
ATOM 9149  N N   . MET B 2 477 ? 69.99988  -17.71796 50.58892   1.000 67.94391  ? 477 MET B N   1 
ATOM 9150  C CA  . MET B 2 477 ? 70.82767  -16.52189 50.65324   1.000 79.65101  ? 477 MET B CA  1 
ATOM 9151  C C   . MET B 2 477 ? 72.30667  -16.88961 50.65602   1.000 90.12983  ? 477