data_6QPA
# 
_entry.id   6QPA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.322 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6QPA         
WWPDB D_1292100552 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6QPA 
_pdbx_database_status.recvd_initial_deposition_date   2019-02-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Frazao, C.' 1 0000-0002-7725-1671 
'Klezin, A.' 2 ?                   
'Poell, U.'  3 0000-0003-4758-1327 
'Veith, A.'  4 0000-0003-1761-6760 
'Ruehl, P.'  5 0000-0002-5480-3402 
'Coelho, R.' 6 ?                   
# 
loop_
_citation.abstract 
_citation.abstract_id_CAS 
_citation.book_id_ISBN 
_citation.book_publisher 
_citation.book_publisher_city 
_citation.book_title 
_citation.coordinate_linkage 
_citation.country 
_citation.database_id_Medline 
_citation.details 
_citation.id 
_citation.journal_abbrev 
_citation.journal_id_ASTM 
_citation.journal_id_CSD 
_citation.journal_id_ISSN 
_citation.journal_full 
_citation.journal_issue 
_citation.journal_volume 
_citation.language 
_citation.page_first 
_citation.page_last 
_citation.title 
_citation.year 
_citation.database_id_CSD 
_citation.pdbx_database_id_DOI 
_citation.pdbx_database_id_PubMed 
_citation.unpublished_flag 
? ? ? ? ? ? ? ?  ? ? primary 'To Be Published' ?      0353 ?         ? ? ?   ? ?   ?   
;Multiple sulfane modifications in active-site cysteine thiols of two sulfur oxygenase reductases and analysis of substrate/product channels
;
?    ? ?                   ?        ? 
? ? ? ? ? ? ? US ? ? 1       J.Bacteriol.      JOBAAY 0767 1098-5530 ? ? 194 ? 677 685 
'The sulfur oxygenase reductase from the mesophilic bacterium Halothiobacillus neapolitanus is a highly active thermozyme.' 2012 ? 
10.1128/JB.06531-11 22139503 ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Frazao, C.'    1  0000-0002-7725-1671 
primary 'Klezin, A.'    2  0000-0002-7725-1671 
primary 'Poell, U.'     3  0000-0003-4758-1327 
primary 'Veith, A.'     4  0000-0003-1761-6760 
primary 'Ruehl, P.'     5  0000-0002-5480-3402 
primary 'Coelho, R.'    6  ?                   
1       'Veith, A.'     7  ?                   
1       'Botelho, H.M.' 8  ?                   
1       'Kindinger, F.' 9  ?                   
1       'Gomes, C.M.'   10 ?                   
1       'Kletzin, A.'   11 ?                   
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6QPA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     200.840 
_cell.length_a_esd                 ? 
_cell.length_b                     212.450 
_cell.length_b_esd                 ? 
_cell.length_c                     215.980 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        96 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6QPA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Sulfur oxygenase/reductase' 35404.555 24   1.13.11.55 'CSS_33, CSS_103' ? ? 
2 non-polymer syn 'FE (III) ION'               55.845    24   ?          ?                 ? ? 
3 non-polymer syn 'SULFATE ION'                96.063    48   ?          ?                 ? ? 
4 water       nat water                        18.015    3955 ?          ?                 ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MSNENPIIAINMAKIANKPDSYETMMKVGPKV(CSS)ITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMRETLNPMGM
FQYTVWKDVHSHEEMHHDNFKEIFEL(CSS)SGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERVPKV
ALSSQRTVVIGDHWVMDGHEKAFEQGATETLEWMKANVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLGANPPEYN
TNYGNKVHDKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNGVLAHLDKGPYYMFFSPMMEQGLWRKHL
KQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSNENPIIAINMAKIANKPDSYETMMKVGPKVCITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMRETLNPMGMFQYT
VWKDVHSHEEMHHDNFKEIFELCSGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERVPKVALSSQRTV
VIGDHWVMDGHEKAFEQGATETLEWMKANVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLGANPPEYNTNYGNKVH
DKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNGVLAHLDKGPYYMFFSPMMEQGLWRKHLKQ
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,T,U,V,W,Y,Z 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASN n 
1 4   GLU n 
1 5   ASN n 
1 6   PRO n 
1 7   ILE n 
1 8   ILE n 
1 9   ALA n 
1 10  ILE n 
1 11  ASN n 
1 12  MET n 
1 13  ALA n 
1 14  LYS n 
1 15  ILE n 
1 16  ALA n 
1 17  ASN n 
1 18  LYS n 
1 19  PRO n 
1 20  ASP n 
1 21  SER n 
1 22  TYR n 
1 23  GLU n 
1 24  THR n 
1 25  MET n 
1 26  MET n 
1 27  LYS n 
1 28  VAL n 
1 29  GLY n 
1 30  PRO n 
1 31  LYS n 
1 32  VAL n 
1 33  CSS n 
1 34  ILE n 
1 35  THR n 
1 36  THR n 
1 37  ALA n 
1 38  SER n 
1 39  HIS n 
1 40  PRO n 
1 41  GLY n 
1 42  PHE n 
1 43  LEU n 
1 44  GLY n 
1 45  PHE n 
1 46  GLU n 
1 47  GLN n 
1 48  LEU n 
1 49  LEU n 
1 50  GLN n 
1 51  THR n 
1 52  GLY n 
1 53  ILE n 
1 54  HIS n 
1 55  PRO n 
1 56  MET n 
1 57  ALA n 
1 58  GLY n 
1 59  ARG n 
1 60  TYR n 
1 61  GLY n 
1 62  GLY n 
1 63  GLY n 
1 64  ALA n 
1 65  VAL n 
1 66  ASP n 
1 67  MET n 
1 68  ARG n 
1 69  GLU n 
1 70  THR n 
1 71  LEU n 
1 72  ASN n 
1 73  PRO n 
1 74  MET n 
1 75  GLY n 
1 76  MET n 
1 77  PHE n 
1 78  GLN n 
1 79  TYR n 
1 80  THR n 
1 81  VAL n 
1 82  TRP n 
1 83  LYS n 
1 84  ASP n 
1 85  VAL n 
1 86  HIS n 
1 87  SER n 
1 88  HIS n 
1 89  GLU n 
1 90  GLU n 
1 91  MET n 
1 92  HIS n 
1 93  HIS n 
1 94  ASP n 
1 95  ASN n 
1 96  PHE n 
1 97  LYS n 
1 98  GLU n 
1 99  ILE n 
1 100 PHE n 
1 101 GLU n 
1 102 LEU n 
1 103 CSS n 
1 104 SER n 
1 105 GLY n 
1 106 CYS n 
1 107 LEU n 
1 108 GLY n 
1 109 MET n 
1 110 VAL n 
1 111 ILE n 
1 112 GLU n 
1 113 GLY n 
1 114 PRO n 
1 115 TRP n 
1 116 GLU n 
1 117 PRO n 
1 118 TYR n 
1 119 PHE n 
1 120 GLU n 
1 121 VAL n 
1 122 VAL n 
1 123 LYS n 
1 124 SER n 
1 125 ASP n 
1 126 LEU n 
1 127 PRO n 
1 128 GLN n 
1 129 ILE n 
1 130 MET n 
1 131 SER n 
1 132 MET n 
1 133 THR n 
1 134 ASP n 
1 135 VAL n 
1 136 PRO n 
1 137 GLN n 
1 138 VAL n 
1 139 LEU n 
1 140 GLY n 
1 141 ASP n 
1 142 SER n 
1 143 PHE n 
1 144 ALA n 
1 145 LYS n 
1 146 GLN n 
1 147 GLU n 
1 148 ARG n 
1 149 VAL n 
1 150 PRO n 
1 151 LYS n 
1 152 VAL n 
1 153 ALA n 
1 154 LEU n 
1 155 SER n 
1 156 SER n 
1 157 GLN n 
1 158 ARG n 
1 159 THR n 
1 160 VAL n 
1 161 VAL n 
1 162 ILE n 
1 163 GLY n 
1 164 ASP n 
1 165 HIS n 
1 166 TRP n 
1 167 VAL n 
1 168 MET n 
1 169 ASP n 
1 170 GLY n 
1 171 HIS n 
1 172 GLU n 
1 173 LYS n 
1 174 ALA n 
1 175 PHE n 
1 176 GLU n 
1 177 GLN n 
1 178 GLY n 
1 179 ALA n 
1 180 THR n 
1 181 GLU n 
1 182 THR n 
1 183 LEU n 
1 184 GLU n 
1 185 TRP n 
1 186 MET n 
1 187 LYS n 
1 188 ALA n 
1 189 ASN n 
1 190 VAL n 
1 191 PRO n 
1 192 GLY n 
1 193 MET n 
1 194 VAL n 
1 195 GLY n 
1 196 TRP n 
1 197 MET n 
1 198 ILE n 
1 199 MET n 
1 200 LYS n 
1 201 GLN n 
1 202 PHE n 
1 203 GLY n 
1 204 VAL n 
1 205 SER n 
1 206 ALA n 
1 207 ILE n 
1 208 GLY n 
1 209 SER n 
1 210 PHE n 
1 211 GLN n 
1 212 LEU n 
1 213 ASP n 
1 214 PRO n 
1 215 GLU n 
1 216 GLY n 
1 217 ALA n 
1 218 MET n 
1 219 LYS n 
1 220 ALA n 
1 221 VAL n 
1 222 SER n 
1 223 THR n 
1 224 LEU n 
1 225 GLY n 
1 226 ALA n 
1 227 ASN n 
1 228 PRO n 
1 229 PRO n 
1 230 GLU n 
1 231 TYR n 
1 232 ASN n 
1 233 THR n 
1 234 ASN n 
1 235 TYR n 
1 236 GLY n 
1 237 ASN n 
1 238 LYS n 
1 239 VAL n 
1 240 HIS n 
1 241 ASP n 
1 242 LYS n 
1 243 PRO n 
1 244 PRO n 
1 245 ILE n 
1 246 PRO n 
1 247 GLY n 
1 248 GLN n 
1 249 THR n 
1 250 PRO n 
1 251 THR n 
1 252 GLN n 
1 253 TYR n 
1 254 LEU n 
1 255 VAL n 
1 256 HIS n 
1 257 ILE n 
1 258 GLU n 
1 259 TRP n 
1 260 GLU n 
1 261 SER n 
1 262 PRO n 
1 263 GLU n 
1 264 HIS n 
1 265 ALA n 
1 266 HIS n 
1 267 GLN n 
1 268 GLY n 
1 269 LEU n 
1 270 GLY n 
1 271 HIS n 
1 272 VAL n 
1 273 MET n 
1 274 VAL n 
1 275 ASP n 
1 276 TYR n 
1 277 GLU n 
1 278 LEU n 
1 279 ARG n 
1 280 GLN n 
1 281 ILE n 
1 282 HIS n 
1 283 ASN n 
1 284 ASN n 
1 285 GLY n 
1 286 VAL n 
1 287 LEU n 
1 288 ALA n 
1 289 HIS n 
1 290 LEU n 
1 291 ASP n 
1 292 LYS n 
1 293 GLY n 
1 294 PRO n 
1 295 TYR n 
1 296 TYR n 
1 297 MET n 
1 298 PHE n 
1 299 PHE n 
1 300 SER n 
1 301 PRO n 
1 302 MET n 
1 303 MET n 
1 304 GLU n 
1 305 GLN n 
1 306 GLY n 
1 307 LEU n 
1 308 TRP n 
1 309 ARG n 
1 310 LYS n 
1 311 HIS n 
1 312 LEU n 
1 313 LYS n 
1 314 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   314 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 Hneap_1222 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Halothiobacillus neapolitanus (strain ATCC 23641 / c2)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     555778 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    D0L035_HALNC 
_struct_ref.pdbx_db_accession          D0L035 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSNENPIIAINMAKIANKPDSYETMMKVGPKVCITTASHPGFLGFEQLLQTGIHPMAGRYGGGAVDMRETLNPMGMFQYT
VWKDVHSHEEMHHDNFKEIFELCSGCLGMVIEGPWEPYFEVVKSDLPQIMSMTDVPQVLGDSFAKQERVPKVALSSQRTV
VIGDHWVMDGHEKAFEQGATETLEWMKANVPGMVGWMIMKQFGVSAIGSFQLDPEGAMKAVSTLGANPPEYNTNYGNKVH
DKPPIPGQTPTQYLVHIEWESPEHAHQGLGHVMVDYELRQIHNNGVLAHLDKGPYYMFFSPMMEQGLWRKHLKQ
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6QPA A 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
2  1 6QPA B 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
3  1 6QPA C 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
4  1 6QPA D 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
5  1 6QPA E 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
6  1 6QPA F 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
7  1 6QPA G 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
8  1 6QPA H 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
9  1 6QPA I 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
10 1 6QPA J 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
11 1 6QPA K 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
12 1 6QPA L 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
13 1 6QPA M 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
14 1 6QPA N 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
15 1 6QPA O 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
16 1 6QPA P 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
17 1 6QPA Q 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
18 1 6QPA R 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
19 1 6QPA T 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
20 1 6QPA U 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
21 1 6QPA V 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
22 1 6QPA W 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
23 1 6QPA Y 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
24 1 6QPA Z 1 ? 314 ? D0L035 1 ? 314 ? 1 314 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE            ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE           ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE         ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'    ? 'C4 H7 N O4'     133.103 
CSS 'L-peptide linking' n S-MERCAPTOCYSTEINE ? 'C3 H7 N O2 S2'  153.223 
CYS 'L-peptide linking' y CYSTEINE           ? 'C3 H7 N O2 S'   121.158 
FE  non-polymer         . 'FE (III) ION'     ? 'Fe 3'           55.845  
GLN 'L-peptide linking' y GLUTAMINE          ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'    ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE            ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE          ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER              ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE         ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE            ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE             ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE         ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE      ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE            ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE             ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'      ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE          ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN         ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE           ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE             ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6QPA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.63 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         53.16 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.4 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M ADA pH 6.4, 1 M ammomium sulfate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-06-20 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.96112 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.96112 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            36.880 
_reflns.entry_id                         6QPA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.100 
_reflns.d_resolution_low                 83.695 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       532671 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.534 
_reflns.pdbx_Rmerge_I_obs                0.153 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.780 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 0.998 
_reflns.pdbx_scaling_rejects             854 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.159 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         7209077 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_CC_star                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_CC_star 
_reflns_shell.pdbx_R_split 
2.100 2.170  ? 1.290  ? ? ? ? 49518 100.000 ? ? ? ? 0.15  ? ? ? ? ? ? ? ? 11.717 ? ? ? ? 0.159 ? ? 1  1 0.490 ? ? 
2.170 2.240  ? 1.650  ? ? ? ? 43540 100.000 ? ? ? ? 1.721 ? ? ? ? ? ? ? ? 12.342 ? ? ? ? 1.796 ? ? 2  1 0.622 ? ? 
2.240 2.310  ? 2.210  ? ? ? ? 38498 100.000 ? ? ? ? 1.395 ? ? ? ? ? ? ? ? 14.133 ? ? ? ? 1.446 ? ? 3  1 0.750 ? ? 
2.310 2.390  ? 2.940  ? ? ? ? 38651 100.000 ? ? ? ? 1.040 ? ? ? ? ? ? ? ? 14.227 ? ? ? ? 1.078 ? ? 4  1 0.845 ? ? 
2.390 2.480  ? 3.760  ? ? ? ? 37764 100.000 ? ? ? ? 0.805 ? ? ? ? ? ? ? ? 14.091 ? ? ? ? 0.835 ? ? 5  1 0.900 ? ? 
2.480 2.580  ? 4.720  ? ? ? ? 35983 100.000 ? ? ? ? 0.634 ? ? ? ? ? ? ? ? 13.835 ? ? ? ? 0.658 ? ? 6  1 0.933 ? ? 
2.580 2.700  ? 5.760  ? ? ? ? 36462 100.000 ? ? ? ? 0.501 ? ? ? ? ? ? ? ? 13.127 ? ? ? ? 0.522 ? ? 7  1 0.949 ? ? 
2.700 2.830  ? 8.100  ? ? ? ? 32934 100.000 ? ? ? ? 0.357 ? ? ? ? ? ? ? ? 13.703 ? ? ? ? 0.371 ? ? 8  1 0.974 ? ? 
2.830 2.980  ? 10.620 ? ? ? ? 31178 100.000 ? ? ? ? 0.273 ? ? ? ? ? ? ? ? 14.280 ? ? ? ? 0.283 ? ? 9  1 0.986 ? ? 
2.980 3.160  ? 14.390 ? ? ? ? 30039 100.000 ? ? ? ? 0.195 ? ? ? ? ? ? ? ? 14.152 ? ? ? ? 0.202 ? ? 10 1 0.993 ? ? 
3.160 3.380  ? 20.160 ? ? ? ? 28631 100.000 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 13.893 ? ? ? ? 0.138 ? ? 11 1 0.996 ? ? 
3.380 3.650  ? 25.820 ? ? ? ? 26398 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 12.978 ? ? ? ? 0.101 ? ? 12 1 0.998 ? ? 
3.650 4.000  ? 35.000 ? ? ? ? 24471 100.000 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 14.474 ? ? ? ? 0.079 ? ? 13 1 0.999 ? ? 
4.000 4.470  ? 45.030 ? ? ? ? 21994 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 14.160 ? ? ? ? 0.058 ? ? 14 1 0.999 ? ? 
4.470 5.160  ? 48.070 ? ? ? ? 19561 100.000 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 13.199 ? ? ? ? 0.052 ? ? 15 1 0.999 ? ? 
5.160 6.320  ? 44.610 ? ? ? ? 16650 100.000 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 13.833 ? ? ? ? 0.055 ? ? 16 1 0.999 ? ? 
6.320 8.940  ? 52.200 ? ? ? ? 13022 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 13.715 ? ? ? ? 0.045 ? ? 17 1 0.999 ? ? 
8.940 83.695 ? 70.130 ? ? ? ? 7377  99.500  ? ? ? ? 0.030 ? ? ? ? ? ? ? ? 12.772 ? ? ? ? 0.032 ? ? 18 1 0.999 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                142.040 
_refine.B_iso_mean                               45.7773 
_refine.B_iso_min                                16.200 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6QPA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.1000 
_refine.ls_d_res_low                             83.6950 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     532671 
_refine.ls_number_reflns_R_free                  1998 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9000 
_refine.ls_percent_reflns_R_free                 0.3800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1623 
_refine.ls_R_factor_R_free                       0.2004 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1622 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_R_complete                          ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.430 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2cb2 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'thin spherical resolution bins' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.5700 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         final 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.1000 
_refine_hist.d_res_low                        83.6950 
_refine_hist.number_atoms_solvent             3955 
_refine_hist.number_atoms_total               62890 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       7439 
_refine_hist.pdbx_B_iso_mean_ligand           108.54 
_refine_hist.pdbx_B_iso_mean_solvent          48.34 
_refine_hist.pdbx_number_atoms_protein        58671 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         264 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1  ? ? ? ? ? 1  TORSIONAL ? A 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 2  ? ? ? ? ? 2  TORSIONAL ? B 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 3  ? ? ? ? ? 3  TORSIONAL ? C 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 4  ? ? ? ? ? 4  TORSIONAL ? D 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 5  ? ? ? ? ? 5  TORSIONAL ? E 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 6  ? ? ? ? ? 6  TORSIONAL ? F 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 7  ? ? ? ? ? 7  TORSIONAL ? G 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 8  ? ? ? ? ? 8  TORSIONAL ? H 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 9  ? ? ? ? ? 9  TORSIONAL ? I 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 10 ? ? ? ? ? 10 TORSIONAL ? J 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 11 ? ? ? ? ? 11 TORSIONAL ? K 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 12 ? ? ? ? ? 12 TORSIONAL ? L 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 13 ? ? ? ? ? 13 TORSIONAL ? M 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 14 ? ? ? ? ? 14 TORSIONAL ? N 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 15 ? ? ? ? ? 15 TORSIONAL ? O 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 16 ? ? ? ? ? 16 TORSIONAL ? P 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 17 ? ? ? ? ? 17 TORSIONAL ? Q 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 18 ? ? ? ? ? 18 TORSIONAL ? R 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 19 ? ? ? ? ? 19 TORSIONAL ? T 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 20 ? ? ? ? ? 20 TORSIONAL ? U 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 21 ? ? ? ? ? 21 TORSIONAL ? V 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 22 ? ? ? ? ? 22 TORSIONAL ? W 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 23 ? ? ? ? ? 23 TORSIONAL ? Y 35820 7.278 ? 1 
'X-RAY DIFFRACTION' 24 ? ? ? ? ? 24 TORSIONAL ? Z 35820 7.278 ? 1 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_R_complete 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.10   2.1521 . . 149 37220 99.0000  . . . 0.3429 0.0000 0.2888 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1521 2.2103 . . 149 37693 100.0000 . . . 0.3604 0.0000 0.2669 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2103 2.2753 . . 134 37636 100.0000 . . . 0.2813 0.0000 0.2476 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2753 2.3488 . . 147 37742 100.0000 . . . 0.2648 0.0000 0.2196 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3488 2.4327 . . 131 37710 100.0000 . . . 0.2600 0.0000 0.2037 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4327 2.5301 . . 148 37744 100.0000 . . . 0.2523 0.0000 0.1865 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5301 2.6453 . . 134 37779 100.0000 . . . 0.2215 0.0000 0.1852 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6453 2.7848 . . 140 37845 100.0000 . . . 0.2189 0.0000 0.1787 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7848 2.9593 . . 157 37865 100.0000 . . . 0.2618 0.0000 0.1737 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9593 3.1878 . . 131 37912 100.0000 . . . 0.2016 0.0000 0.1657 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1878 3.5086 . . 159 37912 100.0000 . . . 0.1870 0.0000 0.1569 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5086 4.0162 . . 114 38167 100.0000 . . . 0.1698 0.0000 0.1349 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0162 5.0600 . . 176 38229 100.0000 . . . 0.1529 0.0000 0.1153 . . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0600 83.659 . . 129 39016 100.0000 . . . 0.1504 0.0000 0.1471 . . . . . . . . . . . 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1  '(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 2  '(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 3  '(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' 
1 4  '(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' 
1 5  '(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' 
1 6  '(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 7  '(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 8  '(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' 
1 9  '(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 10 '(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 11 '(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 12 '(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' 
1 13 '(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 14 '(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 15 '(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 16 '(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 17 '(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 18 '(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 19 '(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' 
1 20 '(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 21 '(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' 
1 22 '(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
1 23 '(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' 
1 24 '(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1  1 ? A 6   A 210 
'(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 1  2 ? A 212 A 301 
'(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 1  3 ? A 303 A 312 
'(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 1  4 ? A 315 A 317 
'(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 1  5 ? A 319 A 319 
'(chain A and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 2  1 ? B 6   B 210 
'(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 2  2 ? B 212 B 301 
'(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 2  3 ? B 303 B 312 
'(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 2  4 ? B 315 B 317 
'(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 2  5 ? B 319 B 319 
'(chain B and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 3  1 ? C 6   C 210 
'(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 3  2 ? C 212 C 301 
'(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 3  3 ? C 303 C 312 
'(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 3  4 ? C 315 C 317 
'(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 3  5 ? C 320 C 320 
'(chain C and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 4  1 ? D 6   D 210 
'(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 4  2 ? D 212 D 301 
'(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 4  3 ? D 303 D 312 
'(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 4  4 ? D 315 D 318 
'(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 4  5 ? D 320 D 320 
'(chain D and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 5  1 ? E 6   E 210 
'(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 5  2 ? E 212 E 301 
'(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 5  3 ? E 303 E 312 
'(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 5  4 ? E 315 E 317 
'(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 5  5 ? E 320 E 320 
'(chain E and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 6  1 ? F 6   F 210 
'(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 6  2 ? F 212 F 301 
'(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 6  3 ? F 303 F 312 
'(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 6  4 ? F 315 F 317 
'(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 6  5 ? F 319 F 319 
'(chain F and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 7  1 ? G 6   G 210 
'(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 7  2 ? G 212 G 301 
'(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 7  3 ? G 303 G 312 
'(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 7  4 ? G 315 G 317 
'(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 7  5 ? G 319 G 319 
'(chain G and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 8  1 ? H 6   H 210 
'(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 8  2 ? H 212 H 301 
'(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 8  3 ? H 303 H 312 
'(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 8  4 ? H 315 H 317 
'(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 8  5 ? H 320 H 320 
'(chain H and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 9  1 ? I 6   I 210 
'(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 9  2 ? I 212 I 301 
'(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 9  3 ? I 303 I 312 
'(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 9  4 ? I 315 I 317 
'(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 9  5 ? I 319 I 319 
'(chain I and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 10 1 ? J 6   J 210 
'(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 10 2 ? J 212 J 301 
'(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 10 3 ? J 303 J 312 
'(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 10 4 ? J 315 J 317 
'(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 10 5 ? J 319 J 319 
'(chain J and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 11 1 ? K 6   K 210 
'(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 11 2 ? K 212 K 301 
'(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 11 3 ? K 303 K 312 
'(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 11 4 ? K 315 K 317 
'(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 11 5 ? K 319 K 319 
'(chain K and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 12 1 ? L 6   L 210 
'(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 12 2 ? L 212 L 301 
'(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 12 3 ? L 303 L 312 
'(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 12 4 ? L 315 L 317 
'(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 12 5 ? L 320 L 320 
'(chain L and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 320))' ? ? 
? ? ? ? ? ? 
1 13 1 ? M 6   M 210 
'(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 13 2 ? M 212 M 301 
'(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 13 3 ? M 303 M 312 
'(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 13 4 ? M 315 M 317 
'(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 13 5 ? M 319 M 319 
'(chain M and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 14 1 ? N 6   N 210 
'(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 14 2 ? N 212 N 301 
'(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 14 3 ? N 303 N 312 
'(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 14 4 ? N 315 N 317 
'(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 14 5 ? N 319 N 319 
'(chain N and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 15 1 ? O 6   O 210 
'(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 15 2 ? O 212 O 301 
'(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 15 3 ? O 303 O 312 
'(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 15 4 ? O 315 O 317 
'(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 15 5 ? O 319 O 319 
'(chain O and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 16 1 ? P 6   P 210 
'(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 16 2 ? P 212 P 301 
'(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 16 3 ? P 303 P 312 
'(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 16 4 ? P 315 P 317 
'(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 16 5 ? P 319 P 319 
'(chain P and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 17 1 ? Q 6   Q 210 
'(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 17 2 ? Q 212 Q 301 
'(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 17 3 ? Q 303 Q 312 
'(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 17 4 ? Q 315 Q 317 
'(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 17 5 ? Q 319 Q 319 
'(chain Q and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 18 1 ? R 6   R 210 
'(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 18 2 ? R 212 R 301 
'(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 18 3 ? R 303 R 312 
'(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 18 4 ? R 315 R 317 
'(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 18 5 ? R 319 R 319 
'(chain R and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 19 1 ? T 6   T 210 
'(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 19 2 ? T 212 T 301 
'(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 19 3 ? T 303 T 312 
'(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 19 4 ? T 315 T 318 
'(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 19 5 ? T 320 T 320 
'(chain T and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 20 1 ? U 6   U 210 
'(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 20 2 ? U 212 U 301 
'(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 20 3 ? U 303 U 312 
'(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 20 4 ? U 315 U 317 
'(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 20 5 ? U 319 U 319 
'(chain U and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 21 1 ? V 6   V 210 
'(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 21 2 ? V 212 V 301 
'(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 21 3 ? V 303 V 312 
'(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 21 4 ? V 315 V 318 
'(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 21 5 ? V 320 V 320 
'(chain V and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 22 1 ? W 6   W 210 
'(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 22 2 ? W 212 W 301 
'(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 22 3 ? W 303 W 312 
'(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 22 4 ? W 315 W 317 
'(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 22 5 ? W 319 W 319 
'(chain W and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 23 1 ? Y 6   Y 210 
'(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 23 2 ? Y 212 Y 301 
'(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 23 3 ? Y 303 Y 312 
'(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 23 4 ? Y 315 Y 318 
'(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 23 5 ? Y 320 Y 320 
'(chain Y and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 318 or resid 320))' ? ? 
? ? ? ? ? ? 
1 24 1 ? Z 6   Z 210 
'(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 24 2 ? Z 212 Z 301 
'(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 24 3 ? Z 303 Z 312 
'(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 24 4 ? Z 315 Z 317 
'(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
1 24 5 ? Z 319 Z 319 
'(chain Z and (resid 6 through 210 or resid 212 through 301 or resid 303 through 312 or resid 315 through 317 or resid 319))' ? ? 
? ? ? ? ? ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                     6QPA 
_struct.title                        'Halothiobacillus neapolitanus sulfur oxygenase reductase' 
_struct.pdbx_descriptor              'Sulfur oxygenase/reductase (E.C.1.13.11.55)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6QPA 
_struct_keywords.text            
'SULFUR OXYGENASE REDUCTASE, 2-HIS-1-CARBOXYLATE FACIAL TRIAD, CYSTEINE PERSULPHURATION, BIOGEOCHEMICAL SULFUR CYCLE, OXIDOREDUCTASE' 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 2 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 3 ? 
JA N N 2 ? 
KA N N 3 ? 
LA N N 3 ? 
MA N N 2 ? 
NA N N 3 ? 
OA N N 3 ? 
PA N N 2 ? 
QA N N 3 ? 
RA N N 3 ? 
SA N N 3 ? 
TA N N 2 ? 
UA N N 3 ? 
VA N N 3 ? 
WA N N 2 ? 
XA N N 3 ? 
YA N N 3 ? 
ZA N N 2 ? 
AB N N 3 ? 
BB N N 3 ? 
CB N N 2 ? 
DB N N 3 ? 
EB N N 3 ? 
FB N N 2 ? 
GB N N 3 ? 
HB N N 3 ? 
IB N N 2 ? 
JB N N 3 ? 
KB N N 3 ? 
LB N N 2 ? 
MB N N 3 ? 
NB N N 3 ? 
OB N N 2 ? 
PB N N 3 ? 
QB N N 3 ? 
RB N N 2 ? 
SB N N 3 ? 
TB N N 3 ? 
UB N N 2 ? 
VB N N 3 ? 
WB N N 3 ? 
XB N N 2 ? 
YB N N 3 ? 
ZB N N 3 ? 
AC N N 2 ? 
BC N N 3 ? 
CC N N 2 ? 
DC N N 3 ? 
EC N N 2 ? 
FC N N 3 ? 
GC N N 3 ? 
HC N N 3 ? 
IC N N 2 ? 
JC N N 3 ? 
KC N N 3 ? 
LC N N 2 ? 
MC N N 3 ? 
NC N N 3 ? 
OC N N 2 ? 
PC N N 3 ? 
QC N N 2 ? 
RC N N 3 ? 
SC N N 4 ? 
TC N N 4 ? 
UC N N 4 ? 
VC N N 4 ? 
WC N N 4 ? 
XC N N 4 ? 
YC N N 4 ? 
ZC N N 4 ? 
AD N N 4 ? 
BD N N 4 ? 
CD N N 4 ? 
DD N N 4 ? 
ED N N 4 ? 
FD N N 4 ? 
GD N N 4 ? 
HD N N 4 ? 
ID N N 4 ? 
JD N N 4 ? 
KD N N 4 ? 
LD N N 4 ? 
MD N N 4 ? 
ND N N 4 ? 
OD N N 4 ? 
PD N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 LYS A 18  ? VAL A 28  ? LYS A 18  VAL A 28  1 ? 11 
HELX_P HELX_P2   AA2 VAL A 28  ? ALA A 37  ? VAL A 28  ALA A 37  1 ? 10 
HELX_P HELX_P3   AA3 ASP A 84  ? ASN A 95  ? ASP A 84  ASN A 95  1 ? 12 
HELX_P HELX_P4   AA4 ASN A 95  ? LEU A 107 ? ASN A 95  LEU A 107 1 ? 13 
HELX_P HELX_P5   AA5 SER A 131 ? THR A 133 ? SER A 131 THR A 133 5 ? 3  
HELX_P HELX_P6   AA6 ASP A 134 ? LYS A 145 ? ASP A 134 LYS A 145 1 ? 12 
HELX_P HELX_P7   AA7 HIS A 171 ? VAL A 190 ? HIS A 171 VAL A 190 1 ? 20 
HELX_P HELX_P8   AA8 ASP A 213 ? VAL A 221 ? ASP A 213 VAL A 221 1 ? 9  
HELX_P HELX_P9   AA9 SER A 261 ? GLY A 270 ? SER A 261 GLY A 270 1 ? 10 
HELX_P HELX_P10  AB1 GLY A 270 ? ASP A 275 ? GLY A 270 ASP A 275 1 ? 6  
HELX_P HELX_P11  AB2 ASP A 275 ? VAL A 286 ? ASP A 275 VAL A 286 1 ? 12 
HELX_P HELX_P12  AB3 GLY A 306 ? LEU A 312 ? GLY A 306 LEU A 312 5 ? 7  
HELX_P HELX_P13  AB4 LYS B 18  ? ALA B 37  ? LYS B 18  ALA B 37  1 ? 20 
HELX_P HELX_P14  AB5 ASP B 84  ? ASN B 95  ? ASP B 84  ASN B 95  1 ? 12 
HELX_P HELX_P15  AB6 ASN B 95  ? LEU B 107 ? ASN B 95  LEU B 107 1 ? 13 
HELX_P HELX_P16  AB7 SER B 131 ? THR B 133 ? SER B 131 THR B 133 5 ? 3  
HELX_P HELX_P17  AB8 ASP B 134 ? LYS B 145 ? ASP B 134 LYS B 145 1 ? 12 
HELX_P HELX_P18  AB9 HIS B 171 ? VAL B 190 ? HIS B 171 VAL B 190 1 ? 20 
HELX_P HELX_P19  AC1 ASP B 213 ? VAL B 221 ? ASP B 213 VAL B 221 1 ? 9  
HELX_P HELX_P20  AC2 SER B 261 ? GLY B 270 ? SER B 261 GLY B 270 1 ? 10 
HELX_P HELX_P21  AC3 GLY B 270 ? ASP B 275 ? GLY B 270 ASP B 275 1 ? 6  
HELX_P HELX_P22  AC4 ASP B 275 ? VAL B 286 ? ASP B 275 VAL B 286 1 ? 12 
HELX_P HELX_P23  AC5 GLY B 306 ? LEU B 312 ? GLY B 306 LEU B 312 5 ? 7  
HELX_P HELX_P24  AC6 LYS C 18  ? ALA C 37  ? LYS C 18  ALA C 37  1 ? 20 
HELX_P HELX_P25  AC7 ASP C 84  ? ASN C 95  ? ASP C 84  ASN C 95  1 ? 12 
HELX_P HELX_P26  AC8 ASN C 95  ? LEU C 107 ? ASN C 95  LEU C 107 1 ? 13 
HELX_P HELX_P27  AC9 SER C 131 ? THR C 133 ? SER C 131 THR C 133 5 ? 3  
HELX_P HELX_P28  AD1 ASP C 134 ? LYS C 145 ? ASP C 134 LYS C 145 1 ? 12 
HELX_P HELX_P29  AD2 HIS C 171 ? VAL C 190 ? HIS C 171 VAL C 190 1 ? 20 
HELX_P HELX_P30  AD3 ALA C 206 ? PHE C 210 ? ALA C 206 PHE C 210 5 ? 5  
HELX_P HELX_P31  AD4 ASP C 213 ? VAL C 221 ? ASP C 213 VAL C 221 1 ? 9  
HELX_P HELX_P32  AD5 SER C 261 ? ASP C 275 ? SER C 261 ASP C 275 1 ? 15 
HELX_P HELX_P33  AD6 ASP C 275 ? VAL C 286 ? ASP C 275 VAL C 286 1 ? 12 
HELX_P HELX_P34  AD7 GLY C 306 ? LEU C 312 ? GLY C 306 LEU C 312 5 ? 7  
HELX_P HELX_P35  AD8 LYS D 18  ? VAL D 28  ? LYS D 18  VAL D 28  1 ? 11 
HELX_P HELX_P36  AD9 VAL D 28  ? ALA D 37  ? VAL D 28  ALA D 37  1 ? 10 
HELX_P HELX_P37  AE1 ASP D 84  ? ASN D 95  ? ASP D 84  ASN D 95  1 ? 12 
HELX_P HELX_P38  AE2 ASN D 95  ? LEU D 107 ? ASN D 95  LEU D 107 1 ? 13 
HELX_P HELX_P39  AE3 SER D 131 ? THR D 133 ? SER D 131 THR D 133 5 ? 3  
HELX_P HELX_P40  AE4 ASP D 134 ? LYS D 145 ? ASP D 134 LYS D 145 1 ? 12 
HELX_P HELX_P41  AE5 HIS D 171 ? VAL D 190 ? HIS D 171 VAL D 190 1 ? 20 
HELX_P HELX_P42  AE6 ALA D 206 ? PHE D 210 ? ALA D 206 PHE D 210 5 ? 5  
HELX_P HELX_P43  AE7 ASP D 213 ? VAL D 221 ? ASP D 213 VAL D 221 1 ? 9  
HELX_P HELX_P44  AE8 SER D 261 ? GLY D 270 ? SER D 261 GLY D 270 1 ? 10 
HELX_P HELX_P45  AE9 GLY D 270 ? ASP D 275 ? GLY D 270 ASP D 275 1 ? 6  
HELX_P HELX_P46  AF1 ASP D 275 ? VAL D 286 ? ASP D 275 VAL D 286 1 ? 12 
HELX_P HELX_P47  AF2 GLY D 306 ? LEU D 312 ? GLY D 306 LEU D 312 5 ? 7  
HELX_P HELX_P48  AF3 LYS E 18  ? ALA E 37  ? LYS E 18  ALA E 37  1 ? 20 
HELX_P HELX_P49  AF4 ASP E 84  ? ASN E 95  ? ASP E 84  ASN E 95  1 ? 12 
HELX_P HELX_P50  AF5 ASN E 95  ? LEU E 107 ? ASN E 95  LEU E 107 1 ? 13 
HELX_P HELX_P51  AF6 SER E 131 ? THR E 133 ? SER E 131 THR E 133 5 ? 3  
HELX_P HELX_P52  AF7 ASP E 134 ? LYS E 145 ? ASP E 134 LYS E 145 1 ? 12 
HELX_P HELX_P53  AF8 HIS E 171 ? VAL E 190 ? HIS E 171 VAL E 190 1 ? 20 
HELX_P HELX_P54  AF9 ASP E 213 ? VAL E 221 ? ASP E 213 VAL E 221 1 ? 9  
HELX_P HELX_P55  AG1 SER E 261 ? GLY E 270 ? SER E 261 GLY E 270 1 ? 10 
HELX_P HELX_P56  AG2 GLY E 270 ? ASP E 275 ? GLY E 270 ASP E 275 1 ? 6  
HELX_P HELX_P57  AG3 ASP E 275 ? VAL E 286 ? ASP E 275 VAL E 286 1 ? 12 
HELX_P HELX_P58  AG4 GLY E 306 ? HIS E 311 ? GLY E 306 HIS E 311 1 ? 6  
HELX_P HELX_P59  AG5 LYS F 18  ? VAL F 28  ? LYS F 18  VAL F 28  1 ? 11 
HELX_P HELX_P60  AG6 VAL F 28  ? ALA F 37  ? VAL F 28  ALA F 37  1 ? 10 
HELX_P HELX_P61  AG7 ASP F 84  ? ASN F 95  ? ASP F 84  ASN F 95  1 ? 12 
HELX_P HELX_P62  AG8 ASN F 95  ? LEU F 107 ? ASN F 95  LEU F 107 1 ? 13 
HELX_P HELX_P63  AG9 SER F 131 ? THR F 133 ? SER F 131 THR F 133 5 ? 3  
HELX_P HELX_P64  AH1 ASP F 134 ? LYS F 145 ? ASP F 134 LYS F 145 1 ? 12 
HELX_P HELX_P65  AH2 HIS F 171 ? VAL F 190 ? HIS F 171 VAL F 190 1 ? 20 
HELX_P HELX_P66  AH3 ASP F 213 ? VAL F 221 ? ASP F 213 VAL F 221 1 ? 9  
HELX_P HELX_P67  AH4 SER F 261 ? ASP F 275 ? SER F 261 ASP F 275 1 ? 15 
HELX_P HELX_P68  AH5 ASP F 275 ? VAL F 286 ? ASP F 275 VAL F 286 1 ? 12 
HELX_P HELX_P69  AH6 GLY F 306 ? LEU F 312 ? GLY F 306 LEU F 312 5 ? 7  
HELX_P HELX_P70  AH7 LYS G 18  ? ALA G 37  ? LYS G 18  ALA G 37  1 ? 20 
HELX_P HELX_P71  AH8 ASP G 84  ? ASN G 95  ? ASP G 84  ASN G 95  1 ? 12 
HELX_P HELX_P72  AH9 ASN G 95  ? LEU G 107 ? ASN G 95  LEU G 107 1 ? 13 
HELX_P HELX_P73  AI1 SER G 131 ? THR G 133 ? SER G 131 THR G 133 5 ? 3  
HELX_P HELX_P74  AI2 ASP G 134 ? LYS G 145 ? ASP G 134 LYS G 145 1 ? 12 
HELX_P HELX_P75  AI3 HIS G 171 ? VAL G 190 ? HIS G 171 VAL G 190 1 ? 20 
HELX_P HELX_P76  AI4 ASP G 213 ? VAL G 221 ? ASP G 213 VAL G 221 1 ? 9  
HELX_P HELX_P77  AI5 SER G 261 ? GLY G 270 ? SER G 261 GLY G 270 1 ? 10 
HELX_P HELX_P78  AI6 GLY G 270 ? ASP G 275 ? GLY G 270 ASP G 275 1 ? 6  
HELX_P HELX_P79  AI7 ASP G 275 ? VAL G 286 ? ASP G 275 VAL G 286 1 ? 12 
HELX_P HELX_P80  AI8 GLY G 306 ? LEU G 312 ? GLY G 306 LEU G 312 5 ? 7  
HELX_P HELX_P81  AI9 LYS H 18  ? VAL H 28  ? LYS H 18  VAL H 28  1 ? 11 
HELX_P HELX_P82  AJ1 VAL H 28  ? ALA H 37  ? VAL H 28  ALA H 37  1 ? 10 
HELX_P HELX_P83  AJ2 ASP H 84  ? ASN H 95  ? ASP H 84  ASN H 95  1 ? 12 
HELX_P HELX_P84  AJ3 ASN H 95  ? LEU H 107 ? ASN H 95  LEU H 107 1 ? 13 
HELX_P HELX_P85  AJ4 SER H 131 ? THR H 133 ? SER H 131 THR H 133 5 ? 3  
HELX_P HELX_P86  AJ5 ASP H 134 ? LYS H 145 ? ASP H 134 LYS H 145 1 ? 12 
HELX_P HELX_P87  AJ6 HIS H 171 ? VAL H 190 ? HIS H 171 VAL H 190 1 ? 20 
HELX_P HELX_P88  AJ7 ASP H 213 ? VAL H 221 ? ASP H 213 VAL H 221 1 ? 9  
HELX_P HELX_P89  AJ8 SER H 261 ? ASP H 275 ? SER H 261 ASP H 275 1 ? 15 
HELX_P HELX_P90  AJ9 ASP H 275 ? VAL H 286 ? ASP H 275 VAL H 286 1 ? 12 
HELX_P HELX_P91  AK1 GLY H 306 ? LEU H 312 ? GLY H 306 LEU H 312 5 ? 7  
HELX_P HELX_P92  AK2 LYS I 18  ? ALA I 37  ? LYS I 18  ALA I 37  1 ? 20 
HELX_P HELX_P93  AK3 PRO I 55  ? ARG I 59  ? PRO I 55  ARG I 59  5 ? 5  
HELX_P HELX_P94  AK4 ASP I 84  ? ASN I 95  ? ASP I 84  ASN I 95  1 ? 12 
HELX_P HELX_P95  AK5 ASN I 95  ? LEU I 107 ? ASN I 95  LEU I 107 1 ? 13 
HELX_P HELX_P96  AK6 SER I 131 ? THR I 133 ? SER I 131 THR I 133 5 ? 3  
HELX_P HELX_P97  AK7 ASP I 134 ? LYS I 145 ? ASP I 134 LYS I 145 1 ? 12 
HELX_P HELX_P98  AK8 HIS I 171 ? VAL I 190 ? HIS I 171 VAL I 190 1 ? 20 
HELX_P HELX_P99  AK9 ASP I 213 ? VAL I 221 ? ASP I 213 VAL I 221 1 ? 9  
HELX_P HELX_P100 AL1 SER I 261 ? GLY I 270 ? SER I 261 GLY I 270 1 ? 10 
HELX_P HELX_P101 AL2 GLY I 270 ? ASP I 275 ? GLY I 270 ASP I 275 1 ? 6  
HELX_P HELX_P102 AL3 ASP I 275 ? VAL I 286 ? ASP I 275 VAL I 286 1 ? 12 
HELX_P HELX_P103 AL4 GLY I 306 ? HIS I 311 ? GLY I 306 HIS I 311 1 ? 6  
HELX_P HELX_P104 AL5 LYS J 18  ? VAL J 28  ? LYS J 18  VAL J 28  1 ? 11 
HELX_P HELX_P105 AL6 VAL J 28  ? ALA J 37  ? VAL J 28  ALA J 37  1 ? 10 
HELX_P HELX_P106 AL7 ASP J 84  ? ASN J 95  ? ASP J 84  ASN J 95  1 ? 12 
HELX_P HELX_P107 AL8 ASN J 95  ? LEU J 107 ? ASN J 95  LEU J 107 1 ? 13 
HELX_P HELX_P108 AL9 SER J 131 ? THR J 133 ? SER J 131 THR J 133 5 ? 3  
HELX_P HELX_P109 AM1 ASP J 134 ? LYS J 145 ? ASP J 134 LYS J 145 1 ? 12 
HELX_P HELX_P110 AM2 HIS J 171 ? VAL J 190 ? HIS J 171 VAL J 190 1 ? 20 
HELX_P HELX_P111 AM3 ALA J 206 ? PHE J 210 ? ALA J 206 PHE J 210 5 ? 5  
HELX_P HELX_P112 AM4 ASP J 213 ? SER J 222 ? ASP J 213 SER J 222 1 ? 10 
HELX_P HELX_P113 AM5 SER J 261 ? GLY J 270 ? SER J 261 GLY J 270 1 ? 10 
HELX_P HELX_P114 AM6 GLY J 270 ? ASP J 275 ? GLY J 270 ASP J 275 1 ? 6  
HELX_P HELX_P115 AM7 ASP J 275 ? VAL J 286 ? ASP J 275 VAL J 286 1 ? 12 
HELX_P HELX_P116 AM8 GLY J 306 ? LEU J 312 ? GLY J 306 LEU J 312 5 ? 7  
HELX_P HELX_P117 AM9 LYS K 18  ? VAL K 28  ? LYS K 18  VAL K 28  1 ? 11 
HELX_P HELX_P118 AN1 VAL K 28  ? ALA K 37  ? VAL K 28  ALA K 37  1 ? 10 
HELX_P HELX_P119 AN2 PRO K 55  ? ARG K 59  ? PRO K 55  ARG K 59  5 ? 5  
HELX_P HELX_P120 AN3 ASP K 84  ? ASN K 95  ? ASP K 84  ASN K 95  1 ? 12 
HELX_P HELX_P121 AN4 ASN K 95  ? LEU K 107 ? ASN K 95  LEU K 107 1 ? 13 
HELX_P HELX_P122 AN5 SER K 131 ? THR K 133 ? SER K 131 THR K 133 5 ? 3  
HELX_P HELX_P123 AN6 ASP K 134 ? LYS K 145 ? ASP K 134 LYS K 145 1 ? 12 
HELX_P HELX_P124 AN7 HIS K 171 ? VAL K 190 ? HIS K 171 VAL K 190 1 ? 20 
HELX_P HELX_P125 AN8 ASP K 213 ? VAL K 221 ? ASP K 213 VAL K 221 1 ? 9  
HELX_P HELX_P126 AN9 SER K 261 ? GLY K 270 ? SER K 261 GLY K 270 1 ? 10 
HELX_P HELX_P127 AO1 GLY K 270 ? ASP K 275 ? GLY K 270 ASP K 275 1 ? 6  
HELX_P HELX_P128 AO2 ASP K 275 ? VAL K 286 ? ASP K 275 VAL K 286 1 ? 12 
HELX_P HELX_P129 AO3 GLY K 306 ? HIS K 311 ? GLY K 306 HIS K 311 1 ? 6  
HELX_P HELX_P130 AO4 LYS L 18  ? VAL L 28  ? LYS L 18  VAL L 28  1 ? 11 
HELX_P HELX_P131 AO5 VAL L 28  ? ALA L 37  ? VAL L 28  ALA L 37  1 ? 10 
HELX_P HELX_P132 AO6 ASP L 84  ? ASN L 95  ? ASP L 84  ASN L 95  1 ? 12 
HELX_P HELX_P133 AO7 ASN L 95  ? LEU L 107 ? ASN L 95  LEU L 107 1 ? 13 
HELX_P HELX_P134 AO8 SER L 131 ? THR L 133 ? SER L 131 THR L 133 5 ? 3  
HELX_P HELX_P135 AO9 ASP L 134 ? LYS L 145 ? ASP L 134 LYS L 145 1 ? 12 
HELX_P HELX_P136 AP1 HIS L 171 ? VAL L 190 ? HIS L 171 VAL L 190 1 ? 20 
HELX_P HELX_P137 AP2 ASP L 213 ? VAL L 221 ? ASP L 213 VAL L 221 1 ? 9  
HELX_P HELX_P138 AP3 SER L 261 ? GLY L 270 ? SER L 261 GLY L 270 1 ? 10 
HELX_P HELX_P139 AP4 GLY L 270 ? ASP L 275 ? GLY L 270 ASP L 275 1 ? 6  
HELX_P HELX_P140 AP5 ASP L 275 ? VAL L 286 ? ASP L 275 VAL L 286 1 ? 12 
HELX_P HELX_P141 AP6 GLY L 306 ? LEU L 312 ? GLY L 306 LEU L 312 5 ? 7  
HELX_P HELX_P142 AP7 LYS M 18  ? VAL M 28  ? LYS M 18  VAL M 28  1 ? 11 
HELX_P HELX_P143 AP8 VAL M 28  ? ALA M 37  ? VAL M 28  ALA M 37  1 ? 10 
HELX_P HELX_P144 AP9 ASP M 84  ? ASN M 95  ? ASP M 84  ASN M 95  1 ? 12 
HELX_P HELX_P145 AQ1 ASN M 95  ? LEU M 107 ? ASN M 95  LEU M 107 1 ? 13 
HELX_P HELX_P146 AQ2 SER M 131 ? THR M 133 ? SER M 131 THR M 133 5 ? 3  
HELX_P HELX_P147 AQ3 ASP M 134 ? LYS M 145 ? ASP M 134 LYS M 145 1 ? 12 
HELX_P HELX_P148 AQ4 HIS M 171 ? VAL M 190 ? HIS M 171 VAL M 190 1 ? 20 
HELX_P HELX_P149 AQ5 ASP M 213 ? VAL M 221 ? ASP M 213 VAL M 221 1 ? 9  
HELX_P HELX_P150 AQ6 SER M 261 ? GLY M 270 ? SER M 261 GLY M 270 1 ? 10 
HELX_P HELX_P151 AQ7 GLY M 270 ? ASP M 275 ? GLY M 270 ASP M 275 1 ? 6  
HELX_P HELX_P152 AQ8 ASP M 275 ? VAL M 286 ? ASP M 275 VAL M 286 1 ? 12 
HELX_P HELX_P153 AQ9 GLY M 306 ? LEU M 312 ? GLY M 306 LEU M 312 5 ? 7  
HELX_P HELX_P154 AR1 LYS N 18  ? VAL N 28  ? LYS N 18  VAL N 28  1 ? 11 
HELX_P HELX_P155 AR2 VAL N 28  ? ALA N 37  ? VAL N 28  ALA N 37  1 ? 10 
HELX_P HELX_P156 AR3 PRO N 55  ? ARG N 59  ? PRO N 55  ARG N 59  5 ? 5  
HELX_P HELX_P157 AR4 ASP N 84  ? ASN N 95  ? ASP N 84  ASN N 95  1 ? 12 
HELX_P HELX_P158 AR5 ASN N 95  ? LEU N 107 ? ASN N 95  LEU N 107 1 ? 13 
HELX_P HELX_P159 AR6 SER N 131 ? THR N 133 ? SER N 131 THR N 133 5 ? 3  
HELX_P HELX_P160 AR7 ASP N 134 ? LYS N 145 ? ASP N 134 LYS N 145 1 ? 12 
HELX_P HELX_P161 AR8 HIS N 171 ? VAL N 190 ? HIS N 171 VAL N 190 1 ? 20 
HELX_P HELX_P162 AR9 ALA N 206 ? PHE N 210 ? ALA N 206 PHE N 210 5 ? 5  
HELX_P HELX_P163 AS1 ASP N 213 ? VAL N 221 ? ASP N 213 VAL N 221 1 ? 9  
HELX_P HELX_P164 AS2 SER N 261 ? GLY N 270 ? SER N 261 GLY N 270 1 ? 10 
HELX_P HELX_P165 AS3 GLY N 270 ? ASP N 275 ? GLY N 270 ASP N 275 1 ? 6  
HELX_P HELX_P166 AS4 ASP N 275 ? VAL N 286 ? ASP N 275 VAL N 286 1 ? 12 
HELX_P HELX_P167 AS5 GLY N 306 ? LEU N 312 ? GLY N 306 LEU N 312 5 ? 7  
HELX_P HELX_P168 AS6 LYS O 18  ? ALA O 37  ? LYS O 18  ALA O 37  1 ? 20 
HELX_P HELX_P169 AS7 ASP O 84  ? ASN O 95  ? ASP O 84  ASN O 95  1 ? 12 
HELX_P HELX_P170 AS8 ASN O 95  ? LEU O 107 ? ASN O 95  LEU O 107 1 ? 13 
HELX_P HELX_P171 AS9 SER O 131 ? THR O 133 ? SER O 131 THR O 133 5 ? 3  
HELX_P HELX_P172 AT1 ASP O 134 ? LYS O 145 ? ASP O 134 LYS O 145 1 ? 12 
HELX_P HELX_P173 AT2 HIS O 171 ? VAL O 190 ? HIS O 171 VAL O 190 1 ? 20 
HELX_P HELX_P174 AT3 ASP O 213 ? VAL O 221 ? ASP O 213 VAL O 221 1 ? 9  
HELX_P HELX_P175 AT4 SER O 261 ? GLY O 270 ? SER O 261 GLY O 270 1 ? 10 
HELX_P HELX_P176 AT5 GLY O 270 ? ASP O 275 ? GLY O 270 ASP O 275 1 ? 6  
HELX_P HELX_P177 AT6 ASP O 275 ? VAL O 286 ? ASP O 275 VAL O 286 1 ? 12 
HELX_P HELX_P178 AT7 GLY O 306 ? LEU O 312 ? GLY O 306 LEU O 312 5 ? 7  
HELX_P HELX_P179 AT8 LYS P 18  ? VAL P 28  ? LYS P 18  VAL P 28  1 ? 11 
HELX_P HELX_P180 AT9 VAL P 28  ? ALA P 37  ? VAL P 28  ALA P 37  1 ? 10 
HELX_P HELX_P181 AU1 ASP P 84  ? ASN P 95  ? ASP P 84  ASN P 95  1 ? 12 
HELX_P HELX_P182 AU2 ASN P 95  ? LEU P 107 ? ASN P 95  LEU P 107 1 ? 13 
HELX_P HELX_P183 AU3 SER P 131 ? THR P 133 ? SER P 131 THR P 133 5 ? 3  
HELX_P HELX_P184 AU4 ASP P 134 ? LYS P 145 ? ASP P 134 LYS P 145 1 ? 12 
HELX_P HELX_P185 AU5 HIS P 171 ? VAL P 190 ? HIS P 171 VAL P 190 1 ? 20 
HELX_P HELX_P186 AU6 ASP P 213 ? VAL P 221 ? ASP P 213 VAL P 221 1 ? 9  
HELX_P HELX_P187 AU7 SER P 261 ? GLY P 270 ? SER P 261 GLY P 270 1 ? 10 
HELX_P HELX_P188 AU8 GLY P 270 ? ASP P 275 ? GLY P 270 ASP P 275 1 ? 6  
HELX_P HELX_P189 AU9 ASP P 275 ? VAL P 286 ? ASP P 275 VAL P 286 1 ? 12 
HELX_P HELX_P190 AV1 GLY P 306 ? LEU P 312 ? GLY P 306 LEU P 312 5 ? 7  
HELX_P HELX_P191 AV2 LYS Q 18  ? ALA Q 37  ? LYS Q 18  ALA Q 37  1 ? 20 
HELX_P HELX_P192 AV3 ASP Q 84  ? ASN Q 95  ? ASP Q 84  ASN Q 95  1 ? 12 
HELX_P HELX_P193 AV4 ASN Q 95  ? LEU Q 107 ? ASN Q 95  LEU Q 107 1 ? 13 
HELX_P HELX_P194 AV5 SER Q 131 ? THR Q 133 ? SER Q 131 THR Q 133 5 ? 3  
HELX_P HELX_P195 AV6 ASP Q 134 ? LYS Q 145 ? ASP Q 134 LYS Q 145 1 ? 12 
HELX_P HELX_P196 AV7 HIS Q 171 ? VAL Q 190 ? HIS Q 171 VAL Q 190 1 ? 20 
HELX_P HELX_P197 AV8 ASP Q 213 ? SER Q 222 ? ASP Q 213 SER Q 222 1 ? 10 
HELX_P HELX_P198 AV9 SER Q 261 ? ASP Q 275 ? SER Q 261 ASP Q 275 1 ? 15 
HELX_P HELX_P199 AW1 ASP Q 275 ? VAL Q 286 ? ASP Q 275 VAL Q 286 1 ? 12 
HELX_P HELX_P200 AW2 GLY Q 306 ? LEU Q 312 ? GLY Q 306 LEU Q 312 5 ? 7  
HELX_P HELX_P201 AW3 LYS R 18  ? ALA R 37  ? LYS R 18  ALA R 37  1 ? 20 
HELX_P HELX_P202 AW4 ASP R 84  ? ASN R 95  ? ASP R 84  ASN R 95  1 ? 12 
HELX_P HELX_P203 AW5 ASN R 95  ? LEU R 107 ? ASN R 95  LEU R 107 1 ? 13 
HELX_P HELX_P204 AW6 SER R 131 ? THR R 133 ? SER R 131 THR R 133 5 ? 3  
HELX_P HELX_P205 AW7 ASP R 134 ? LYS R 145 ? ASP R 134 LYS R 145 1 ? 12 
HELX_P HELX_P206 AW8 HIS R 171 ? VAL R 190 ? HIS R 171 VAL R 190 1 ? 20 
HELX_P HELX_P207 AW9 ASP R 213 ? VAL R 221 ? ASP R 213 VAL R 221 1 ? 9  
HELX_P HELX_P208 AX1 SER R 261 ? GLY R 270 ? SER R 261 GLY R 270 1 ? 10 
HELX_P HELX_P209 AX2 GLY R 270 ? ASP R 275 ? GLY R 270 ASP R 275 1 ? 6  
HELX_P HELX_P210 AX3 ASP R 275 ? VAL R 286 ? ASP R 275 VAL R 286 1 ? 12 
HELX_P HELX_P211 AX4 GLY R 306 ? LEU R 312 ? GLY R 306 LEU R 312 5 ? 7  
HELX_P HELX_P212 AX5 LYS S 18  ? ALA S 37  ? LYS T 18  ALA T 37  1 ? 20 
HELX_P HELX_P213 AX6 ASP S 84  ? ASN S 95  ? ASP T 84  ASN T 95  1 ? 12 
HELX_P HELX_P214 AX7 ASN S 95  ? LEU S 107 ? ASN T 95  LEU T 107 1 ? 13 
HELX_P HELX_P215 AX8 SER S 131 ? THR S 133 ? SER T 131 THR T 133 5 ? 3  
HELX_P HELX_P216 AX9 ASP S 134 ? LYS S 145 ? ASP T 134 LYS T 145 1 ? 12 
HELX_P HELX_P217 AY1 HIS S 171 ? VAL S 190 ? HIS T 171 VAL T 190 1 ? 20 
HELX_P HELX_P218 AY2 ASP S 213 ? VAL S 221 ? ASP T 213 VAL T 221 1 ? 9  
HELX_P HELX_P219 AY3 SER S 261 ? ASP S 275 ? SER T 261 ASP T 275 1 ? 15 
HELX_P HELX_P220 AY4 ASP S 275 ? VAL S 286 ? ASP T 275 VAL T 286 1 ? 12 
HELX_P HELX_P221 AY5 GLY S 306 ? LEU S 312 ? GLY T 306 LEU T 312 5 ? 7  
HELX_P HELX_P222 AY6 LYS T 18  ? ALA T 37  ? LYS U 18  ALA U 37  1 ? 20 
HELX_P HELX_P223 AY7 ASP T 84  ? ASN T 95  ? ASP U 84  ASN U 95  1 ? 12 
HELX_P HELX_P224 AY8 ASN T 95  ? LEU T 107 ? ASN U 95  LEU U 107 1 ? 13 
HELX_P HELX_P225 AY9 SER T 131 ? THR T 133 ? SER U 131 THR U 133 5 ? 3  
HELX_P HELX_P226 AZ1 ASP T 134 ? LYS T 145 ? ASP U 134 LYS U 145 1 ? 12 
HELX_P HELX_P227 AZ2 HIS T 171 ? VAL T 190 ? HIS U 171 VAL U 190 1 ? 20 
HELX_P HELX_P228 AZ3 ASP T 213 ? VAL T 221 ? ASP U 213 VAL U 221 1 ? 9  
HELX_P HELX_P229 AZ4 SER T 261 ? GLY T 270 ? SER U 261 GLY U 270 1 ? 10 
HELX_P HELX_P230 AZ5 GLY T 270 ? ASP T 275 ? GLY U 270 ASP U 275 1 ? 6  
HELX_P HELX_P231 AZ6 ASP T 275 ? VAL T 286 ? ASP U 275 VAL U 286 1 ? 12 
HELX_P HELX_P232 AZ7 GLY T 306 ? LEU T 312 ? GLY U 306 LEU U 312 5 ? 7  
HELX_P HELX_P233 AZ8 LYS U 18  ? VAL U 28  ? LYS V 18  VAL V 28  1 ? 11 
HELX_P HELX_P234 AZ9 VAL U 28  ? ALA U 37  ? VAL V 28  ALA V 37  1 ? 10 
HELX_P HELX_P235 BA1 ASP U 84  ? ASN U 95  ? ASP V 84  ASN V 95  1 ? 12 
HELX_P HELX_P236 BA2 ASN U 95  ? LEU U 107 ? ASN V 95  LEU V 107 1 ? 13 
HELX_P HELX_P237 BA3 SER U 131 ? THR U 133 ? SER V 131 THR V 133 5 ? 3  
HELX_P HELX_P238 BA4 ASP U 134 ? LYS U 145 ? ASP V 134 LYS V 145 1 ? 12 
HELX_P HELX_P239 BA5 HIS U 171 ? VAL U 190 ? HIS V 171 VAL V 190 1 ? 20 
HELX_P HELX_P240 BA6 ALA U 206 ? PHE U 210 ? ALA V 206 PHE V 210 5 ? 5  
HELX_P HELX_P241 BA7 ASP U 213 ? SER U 222 ? ASP V 213 SER V 222 1 ? 10 
HELX_P HELX_P242 BA8 SER U 261 ? GLY U 270 ? SER V 261 GLY V 270 1 ? 10 
HELX_P HELX_P243 BA9 GLY U 270 ? ASP U 275 ? GLY V 270 ASP V 275 1 ? 6  
HELX_P HELX_P244 BB1 ASP U 275 ? VAL U 286 ? ASP V 275 VAL V 286 1 ? 12 
HELX_P HELX_P245 BB2 GLY U 306 ? LEU U 312 ? GLY V 306 LEU V 312 5 ? 7  
HELX_P HELX_P246 BB3 LYS V 18  ? VAL V 28  ? LYS W 18  VAL W 28  1 ? 11 
HELX_P HELX_P247 BB4 VAL V 28  ? ALA V 37  ? VAL W 28  ALA W 37  1 ? 10 
HELX_P HELX_P248 BB5 ASP V 84  ? ASN V 95  ? ASP W 84  ASN W 95  1 ? 12 
HELX_P HELX_P249 BB6 ASN V 95  ? LEU V 107 ? ASN W 95  LEU W 107 1 ? 13 
HELX_P HELX_P250 BB7 SER V 131 ? THR V 133 ? SER W 131 THR W 133 5 ? 3  
HELX_P HELX_P251 BB8 ASP V 134 ? LYS V 145 ? ASP W 134 LYS W 145 1 ? 12 
HELX_P HELX_P252 BB9 HIS V 171 ? VAL V 190 ? HIS W 171 VAL W 190 1 ? 20 
HELX_P HELX_P253 BC1 ASP V 213 ? VAL V 221 ? ASP W 213 VAL W 221 1 ? 9  
HELX_P HELX_P254 BC2 SER V 261 ? GLY V 270 ? SER W 261 GLY W 270 1 ? 10 
HELX_P HELX_P255 BC3 GLY V 270 ? ASP V 275 ? GLY W 270 ASP W 275 1 ? 6  
HELX_P HELX_P256 BC4 ASP V 275 ? VAL V 286 ? ASP W 275 VAL W 286 1 ? 12 
HELX_P HELX_P257 BC5 GLY V 306 ? LEU V 312 ? GLY W 306 LEU W 312 5 ? 7  
HELX_P HELX_P258 BC6 LYS W 18  ? VAL W 28  ? LYS Y 18  VAL Y 28  1 ? 11 
HELX_P HELX_P259 BC7 VAL W 28  ? ALA W 37  ? VAL Y 28  ALA Y 37  1 ? 10 
HELX_P HELX_P260 BC8 ASP W 84  ? ASN W 95  ? ASP Y 84  ASN Y 95  1 ? 12 
HELX_P HELX_P261 BC9 ASN W 95  ? LEU W 107 ? ASN Y 95  LEU Y 107 1 ? 13 
HELX_P HELX_P262 BD1 SER W 131 ? THR W 133 ? SER Y 131 THR Y 133 5 ? 3  
HELX_P HELX_P263 BD2 ASP W 134 ? LYS W 145 ? ASP Y 134 LYS Y 145 1 ? 12 
HELX_P HELX_P264 BD3 HIS W 171 ? VAL W 190 ? HIS Y 171 VAL Y 190 1 ? 20 
HELX_P HELX_P265 BD4 ASP W 213 ? VAL W 221 ? ASP Y 213 VAL Y 221 1 ? 9  
HELX_P HELX_P266 BD5 SER W 261 ? ASP W 275 ? SER Y 261 ASP Y 275 1 ? 15 
HELX_P HELX_P267 BD6 ASP W 275 ? VAL W 286 ? ASP Y 275 VAL Y 286 1 ? 12 
HELX_P HELX_P268 BD7 GLY W 306 ? LEU W 312 ? GLY Y 306 LEU Y 312 5 ? 7  
HELX_P HELX_P269 BD8 LYS X 18  ? VAL X 28  ? LYS Z 18  VAL Z 28  1 ? 11 
HELX_P HELX_P270 BD9 VAL X 28  ? ALA X 37  ? VAL Z 28  ALA Z 37  1 ? 10 
HELX_P HELX_P271 BE1 ASP X 84  ? ASN X 95  ? ASP Z 84  ASN Z 95  1 ? 12 
HELX_P HELX_P272 BE2 ASN X 95  ? LEU X 107 ? ASN Z 95  LEU Z 107 1 ? 13 
HELX_P HELX_P273 BE3 SER X 131 ? THR X 133 ? SER Z 131 THR Z 133 5 ? 3  
HELX_P HELX_P274 BE4 ASP X 134 ? LYS X 145 ? ASP Z 134 LYS Z 145 1 ? 12 
HELX_P HELX_P275 BE5 HIS X 171 ? VAL X 190 ? HIS Z 171 VAL Z 190 1 ? 20 
HELX_P HELX_P276 BE6 ASP X 213 ? VAL X 221 ? ASP Z 213 VAL Z 221 1 ? 9  
HELX_P HELX_P277 BE7 SER X 261 ? GLY X 270 ? SER Z 261 GLY Z 270 1 ? 10 
HELX_P HELX_P278 BE8 GLY X 270 ? ASP X 275 ? GLY Z 270 ASP Z 275 1 ? 6  
HELX_P HELX_P279 BE9 ASP X 275 ? VAL X 286 ? ASP Z 275 VAL Z 286 1 ? 12 
HELX_P HELX_P280 BF1 GLY X 306 ? LEU X 312 ? GLY Z 306 LEU Z 312 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale one  ? A  VAL 32  C   ? ? ? 1_555 A  CSS 33  N  ? ? A VAL 32  A CSS 33   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2   covale both ? A  CSS 33  C   ? ? ? 1_555 A  ILE 34  N  ? ? A CSS 33  A ILE 34   1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc1   metalc ?    ? A  HIS 88  NE2 ? ? ? 1_555 Y  FE  .   FE ? ? A HIS 88  A FE  401  1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc2   metalc ?    ? A  HIS 92  NE2 ? ? ? 1_555 Y  FE  .   FE ? ? A HIS 92  A FE  401  1_555 ? ? ? ? ? ? ? 2.474 ? 
covale3   covale one  ? A  LEU 102 C   ? ? ? 1_555 A  CSS 103 N  ? ? A LEU 102 A CSS 103  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale4   covale both ? A  CSS 103 C   ? ? ? 1_555 A  SER 104 N  ? ? A CSS 103 A SER 104  1_555 ? ? ? ? ? ? ? 1.336 ? 
metalc3   metalc ?    ? A  GLU 116 OE1 ? ? ? 1_555 Y  FE  .   FE ? ? A GLU 116 A FE  401  1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc4   metalc ?    ? A  GLU 116 OE2 ? ? ? 1_555 Y  FE  .   FE ? ? A GLU 116 A FE  401  1_555 ? ? ? ? ? ? ? 2.095 ? 
covale5   covale one  ? B  VAL 32  C   ? ? ? 1_555 B  CSS 33  N  ? ? B VAL 32  B CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale6   covale both ? B  CSS 33  C   ? ? ? 1_555 B  ILE 34  N  ? ? B CSS 33  B ILE 34   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc5   metalc ?    ? B  HIS 88  NE2 ? ? ? 1_555 CA FE  .   FE ? ? B HIS 88  B FE  401  1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc6   metalc ?    ? B  HIS 92  NE2 ? ? ? 1_555 CA FE  .   FE ? ? B HIS 92  B FE  401  1_555 ? ? ? ? ? ? ? 2.237 ? 
covale7   covale one  ? B  LEU 102 C   ? ? ? 1_555 B  CSS 103 N  ? ? B LEU 102 B CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8   covale both ? B  CSS 103 C   ? ? ? 1_555 B  SER 104 N  ? ? B CSS 103 B SER 104  1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc7   metalc ?    ? B  GLU 116 OE1 ? ? ? 1_555 CA FE  .   FE ? ? B GLU 116 B FE  401  1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc8   metalc ?    ? B  GLU 116 OE2 ? ? ? 1_555 CA FE  .   FE ? ? B GLU 116 B FE  401  1_555 ? ? ? ? ? ? ? 2.256 ? 
covale9   covale one  ? C  VAL 32  C   ? ? ? 1_555 C  CSS 33  N  ? ? C VAL 32  C CSS 33   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale10  covale both ? C  CSS 33  C   ? ? ? 1_555 C  ILE 34  N  ? ? C CSS 33  C ILE 34   1_555 ? ? ? ? ? ? ? 1.335 ? 
metalc9   metalc ?    ? C  HIS 88  NE2 ? ? ? 1_555 FA FE  .   FE ? ? C HIS 88  C FE  401  1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc10  metalc ?    ? C  HIS 92  NE2 ? ? ? 1_555 FA FE  .   FE ? ? C HIS 92  C FE  401  1_555 ? ? ? ? ? ? ? 2.135 ? 
covale11  covale one  ? C  LEU 102 C   ? ? ? 1_555 C  CSS 103 N  ? ? C LEU 102 C CSS 103  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale12  covale both ? C  CSS 103 C   ? ? ? 1_555 C  SER 104 N  ? ? C CSS 103 C SER 104  1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc11  metalc ?    ? C  GLU 116 OE1 ? ? ? 1_555 FA FE  .   FE ? ? C GLU 116 C FE  401  1_555 ? ? ? ? ? ? ? 2.603 ? 
metalc12  metalc ?    ? C  GLU 116 OE2 ? ? ? 1_555 FA FE  .   FE ? ? C GLU 116 C FE  401  1_555 ? ? ? ? ? ? ? 2.370 ? 
covale13  covale one  ? D  VAL 32  C   ? ? ? 1_555 D  CSS 33  N  ? ? D VAL 32  D CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale14  covale both ? D  CSS 33  C   ? ? ? 1_555 D  ILE 34  N  ? ? D CSS 33  D ILE 34   1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc13  metalc ?    ? D  HIS 88  NE2 ? ? ? 1_555 JA FE  .   FE ? ? D HIS 88  D FE  401  1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc14  metalc ?    ? D  HIS 92  NE2 ? ? ? 1_555 JA FE  .   FE ? ? D HIS 92  D FE  401  1_555 ? ? ? ? ? ? ? 2.242 ? 
covale15  covale one  ? D  LEU 102 C   ? ? ? 1_555 D  CSS 103 N  ? ? D LEU 102 D CSS 103  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale16  covale both ? D  CSS 103 C   ? ? ? 1_555 D  SER 104 N  ? ? D CSS 103 D SER 104  1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc15  metalc ?    ? D  GLU 116 OE2 ? ? ? 1_555 JA FE  .   FE ? ? D GLU 116 D FE  401  1_555 ? ? ? ? ? ? ? 2.384 ? 
covale17  covale one  ? E  VAL 32  C   ? ? ? 1_555 E  CSS 33  N  ? ? E VAL 32  E CSS 33   1_555 ? ? ? ? ? ? ? 1.335 ? 
covale18  covale both ? E  CSS 33  C   ? ? ? 1_555 E  ILE 34  N  ? ? E CSS 33  E ILE 34   1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc16  metalc ?    ? E  HIS 88  NE2 ? ? ? 1_555 MA FE  .   FE ? ? E HIS 88  E FE  401  1_555 ? ? ? ? ? ? ? 2.552 ? 
metalc17  metalc ?    ? E  HIS 92  NE2 ? ? ? 1_555 MA FE  .   FE ? ? E HIS 92  E FE  401  1_555 ? ? ? ? ? ? ? 2.096 ? 
covale19  covale one  ? E  LEU 102 C   ? ? ? 1_555 E  CSS 103 N  ? ? E LEU 102 E CSS 103  1_555 ? ? ? ? ? ? ? 1.320 ? 
covale20  covale both ? E  CSS 103 C   ? ? ? 1_555 E  SER 104 N  ? ? E CSS 103 E SER 104  1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc18  metalc ?    ? E  GLU 116 OE2 ? ? ? 1_555 MA FE  .   FE ? ? E GLU 116 E FE  401  1_555 ? ? ? ? ? ? ? 2.340 ? 
covale21  covale one  ? F  VAL 32  C   ? ? ? 1_555 F  CSS 33  N  ? ? F VAL 32  F CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale22  covale both ? F  CSS 33  C   ? ? ? 1_555 F  ILE 34  N  ? ? F CSS 33  F ILE 34   1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc19  metalc ?    ? F  HIS 88  NE2 ? ? ? 1_555 PA FE  .   FE ? ? F HIS 88  F FE  401  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc20  metalc ?    ? F  HIS 92  NE2 ? ? ? 1_555 PA FE  .   FE ? ? F HIS 92  F FE  401  1_555 ? ? ? ? ? ? ? 2.355 ? 
covale23  covale one  ? F  LEU 102 C   ? ? ? 1_555 F  CSS 103 N  ? ? F LEU 102 F CSS 103  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale24  covale both ? F  CSS 103 C   ? ? ? 1_555 F  SER 104 N  ? ? F CSS 103 F SER 104  1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc21  metalc ?    ? F  GLU 116 OE1 ? ? ? 1_555 PA FE  .   FE ? ? F GLU 116 F FE  401  1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc22  metalc ?    ? F  GLU 116 OE2 ? ? ? 1_555 PA FE  .   FE ? ? F GLU 116 F FE  401  1_555 ? ? ? ? ? ? ? 2.209 ? 
covale25  covale one  ? G  VAL 32  C   ? ? ? 1_555 G  CSS 33  N  ? ? G VAL 32  G CSS 33   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale26  covale both ? G  CSS 33  C   ? ? ? 1_555 G  ILE 34  N  ? ? G CSS 33  G ILE 34   1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc23  metalc ?    ? G  HIS 88  NE2 ? ? ? 1_555 TA FE  .   FE ? ? G HIS 88  G FE  401  1_555 ? ? ? ? ? ? ? 2.275 ? 
metalc24  metalc ?    ? G  HIS 92  NE2 ? ? ? 1_555 TA FE  .   FE ? ? G HIS 92  G FE  401  1_555 ? ? ? ? ? ? ? 2.239 ? 
covale27  covale one  ? G  LEU 102 C   ? ? ? 1_555 G  CSS 103 N  ? ? G LEU 102 G CSS 103  1_555 ? ? ? ? ? ? ? 1.326 ? 
covale28  covale both ? G  CSS 103 C   ? ? ? 1_555 G  SER 104 N  ? ? G CSS 103 G SER 104  1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc25  metalc ?    ? G  GLU 116 OE1 ? ? ? 1_555 TA FE  .   FE ? ? G GLU 116 G FE  401  1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc26  metalc ?    ? G  GLU 116 OE2 ? ? ? 1_555 TA FE  .   FE ? ? G GLU 116 G FE  401  1_555 ? ? ? ? ? ? ? 2.174 ? 
covale29  covale one  ? H  VAL 32  C   ? ? ? 1_555 H  CSS 33  N  ? ? H VAL 32  H CSS 33   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale30  covale both ? H  CSS 33  C   ? ? ? 1_555 H  ILE 34  N  ? ? H CSS 33  H ILE 34   1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc27  metalc ?    ? H  HIS 88  NE2 ? ? ? 1_555 WA FE  .   FE ? ? H HIS 88  H FE  401  1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc28  metalc ?    ? H  HIS 92  NE2 ? ? ? 1_555 WA FE  .   FE ? ? H HIS 92  H FE  401  1_555 ? ? ? ? ? ? ? 2.277 ? 
covale31  covale one  ? H  LEU 102 C   ? ? ? 1_555 H  CSS 103 N  ? ? H LEU 102 H CSS 103  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale32  covale both ? H  CSS 103 C   ? ? ? 1_555 H  SER 104 N  ? ? H CSS 103 H SER 104  1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc29  metalc ?    ? H  GLU 116 OE1 ? ? ? 1_555 WA FE  .   FE ? ? H GLU 116 H FE  401  1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc30  metalc ?    ? H  GLU 116 OE2 ? ? ? 1_555 WA FE  .   FE ? ? H GLU 116 H FE  401  1_555 ? ? ? ? ? ? ? 2.286 ? 
covale33  covale one  ? I  VAL 32  C   ? ? ? 1_555 I  CSS 33  N  ? ? I VAL 32  I CSS 33   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale34  covale both ? I  CSS 33  C   ? ? ? 1_555 I  ILE 34  N  ? ? I CSS 33  I ILE 34   1_555 ? ? ? ? ? ? ? 1.324 ? 
metalc31  metalc ?    ? I  HIS 88  NE2 ? ? ? 1_555 ZA FE  .   FE ? ? I HIS 88  I FE  401  1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc32  metalc ?    ? I  HIS 92  NE2 ? ? ? 1_555 ZA FE  .   FE ? ? I HIS 92  I FE  401  1_555 ? ? ? ? ? ? ? 2.350 ? 
covale35  covale one  ? I  LEU 102 C   ? ? ? 1_555 I  CSS 103 N  ? ? I LEU 102 I CSS 103  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale36  covale both ? I  CSS 103 C   ? ? ? 1_555 I  SER 104 N  ? ? I CSS 103 I SER 104  1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc33  metalc ?    ? I  GLU 116 OE1 ? ? ? 1_555 ZA FE  .   FE ? ? I GLU 116 I FE  401  1_555 ? ? ? ? ? ? ? 2.630 ? 
metalc34  metalc ?    ? I  GLU 116 OE2 ? ? ? 1_555 ZA FE  .   FE ? ? I GLU 116 I FE  401  1_555 ? ? ? ? ? ? ? 2.273 ? 
covale37  covale one  ? J  VAL 32  C   ? ? ? 1_555 J  CSS 33  N  ? ? J VAL 32  J CSS 33   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale38  covale both ? J  CSS 33  C   ? ? ? 1_555 J  ILE 34  N  ? ? J CSS 33  J ILE 34   1_555 ? ? ? ? ? ? ? 1.337 ? 
metalc35  metalc ?    ? J  HIS 88  NE2 ? ? ? 1_555 CB FE  .   FE ? ? J HIS 88  J FE  401  1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc36  metalc ?    ? J  HIS 92  NE2 ? ? ? 1_555 CB FE  .   FE ? ? J HIS 92  J FE  401  1_555 ? ? ? ? ? ? ? 2.427 ? 
covale39  covale one  ? J  LEU 102 C   ? ? ? 1_555 J  CSS 103 N  ? ? J LEU 102 J CSS 103  1_555 ? ? ? ? ? ? ? 1.328 ? 
covale40  covale both ? J  CSS 103 C   ? ? ? 1_555 J  SER 104 N  ? ? J CSS 103 J SER 104  1_555 ? ? ? ? ? ? ? 1.336 ? 
metalc37  metalc ?    ? J  GLU 116 OE2 ? ? ? 1_555 CB FE  .   FE ? ? J GLU 116 J FE  401  1_555 ? ? ? ? ? ? ? 2.229 ? 
covale41  covale one  ? K  VAL 32  C   ? ? ? 1_555 K  CSS 33  N  ? ? K VAL 32  K CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale42  covale both ? K  CSS 33  C   ? ? ? 1_555 K  ILE 34  N  ? ? K CSS 33  K ILE 34   1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc38  metalc ?    ? K  HIS 88  NE2 ? ? ? 1_555 FB FE  .   FE ? ? K HIS 88  K FE  401  1_555 ? ? ? ? ? ? ? 2.299 ? 
metalc39  metalc ?    ? K  HIS 92  NE2 ? ? ? 1_555 FB FE  .   FE ? ? K HIS 92  K FE  401  1_555 ? ? ? ? ? ? ? 2.234 ? 
covale43  covale one  ? K  LEU 102 C   ? ? ? 1_555 K  CSS 103 N  ? ? K LEU 102 K CSS 103  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale44  covale both ? K  CSS 103 C   ? ? ? 1_555 K  SER 104 N  ? ? K CSS 103 K SER 104  1_555 ? ? ? ? ? ? ? 1.326 ? 
metalc40  metalc ?    ? K  GLU 116 OE1 ? ? ? 1_555 FB FE  .   FE ? ? K GLU 116 K FE  401  1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc41  metalc ?    ? K  GLU 116 OE2 ? ? ? 1_555 FB FE  .   FE ? ? K GLU 116 K FE  401  1_555 ? ? ? ? ? ? ? 2.179 ? 
covale45  covale one  ? L  VAL 32  C   ? ? ? 1_555 L  CSS 33  N  ? ? L VAL 32  L CSS 33   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale46  covale both ? L  CSS 33  C   ? ? ? 1_555 L  ILE 34  N  ? ? L CSS 33  L ILE 34   1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc42  metalc ?    ? L  HIS 88  NE2 ? ? ? 1_555 IB FE  .   FE ? ? L HIS 88  L FE  401  1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc43  metalc ?    ? L  HIS 92  NE2 ? ? ? 1_555 IB FE  .   FE ? ? L HIS 92  L FE  401  1_555 ? ? ? ? ? ? ? 2.240 ? 
covale47  covale one  ? L  LEU 102 C   ? ? ? 1_555 L  CSS 103 N  ? ? L LEU 102 L CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale48  covale both ? L  CSS 103 C   ? ? ? 1_555 L  SER 104 N  ? ? L CSS 103 L SER 104  1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc44  metalc ?    ? L  GLU 116 OE1 ? ? ? 1_555 IB FE  .   FE ? ? L GLU 116 L FE  401  1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc45  metalc ?    ? L  GLU 116 OE2 ? ? ? 1_555 IB FE  .   FE ? ? L GLU 116 L FE  401  1_555 ? ? ? ? ? ? ? 2.416 ? 
covale49  covale one  ? M  VAL 32  C   ? ? ? 1_555 M  CSS 33  N  ? ? M VAL 32  M CSS 33   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale50  covale both ? M  CSS 33  C   ? ? ? 1_555 M  ILE 34  N  ? ? M CSS 33  M ILE 34   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc46  metalc ?    ? M  HIS 88  NE2 ? ? ? 1_555 LB FE  .   FE ? ? M HIS 88  M FE  401  1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc47  metalc ?    ? M  HIS 92  NE2 ? ? ? 1_555 LB FE  .   FE ? ? M HIS 92  M FE  401  1_555 ? ? ? ? ? ? ? 2.291 ? 
covale51  covale one  ? M  LEU 102 C   ? ? ? 1_555 M  CSS 103 N  ? ? M LEU 102 M CSS 103  1_555 ? ? ? ? ? ? ? 1.320 ? 
covale52  covale both ? M  CSS 103 C   ? ? ? 1_555 M  SER 104 N  ? ? M CSS 103 M SER 104  1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc48  metalc ?    ? M  GLU 116 OE1 ? ? ? 1_555 LB FE  .   FE ? ? M GLU 116 M FE  401  1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc49  metalc ?    ? M  GLU 116 OE2 ? ? ? 1_555 LB FE  .   FE ? ? M GLU 116 M FE  401  1_555 ? ? ? ? ? ? ? 2.282 ? 
covale53  covale one  ? N  VAL 32  C   ? ? ? 1_555 N  CSS 33  N  ? ? N VAL 32  N CSS 33   1_555 ? ? ? ? ? ? ? 1.338 ? 
covale54  covale both ? N  CSS 33  C   ? ? ? 1_555 N  ILE 34  N  ? ? N CSS 33  N ILE 34   1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc50  metalc ?    ? N  HIS 88  NE2 ? ? ? 1_555 OB FE  .   FE ? ? N HIS 88  N FE  401  1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc51  metalc ?    ? N  HIS 92  NE2 ? ? ? 1_555 OB FE  .   FE ? ? N HIS 92  N FE  401  1_555 ? ? ? ? ? ? ? 2.269 ? 
covale55  covale one  ? N  LEU 102 C   ? ? ? 1_555 N  CSS 103 N  ? ? N LEU 102 N CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale56  covale both ? N  CSS 103 C   ? ? ? 1_555 N  SER 104 N  ? ? N CSS 103 N SER 104  1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc52  metalc ?    ? N  GLU 116 OE1 ? ? ? 1_555 OB FE  .   FE ? ? N GLU 116 N FE  401  1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc53  metalc ?    ? N  GLU 116 OE2 ? ? ? 1_555 OB FE  .   FE ? ? N GLU 116 N FE  401  1_555 ? ? ? ? ? ? ? 2.309 ? 
covale57  covale one  ? O  VAL 32  C   ? ? ? 1_555 O  CSS 33  N  ? ? O VAL 32  O CSS 33   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale58  covale both ? O  CSS 33  C   ? ? ? 1_555 O  ILE 34  N  ? ? O CSS 33  O ILE 34   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc54  metalc ?    ? O  HIS 88  NE2 ? ? ? 1_555 RB FE  .   FE ? ? O HIS 88  O FE  401  1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc55  metalc ?    ? O  HIS 92  NE2 ? ? ? 1_555 RB FE  .   FE ? ? O HIS 92  O FE  401  1_555 ? ? ? ? ? ? ? 2.228 ? 
covale59  covale one  ? O  LEU 102 C   ? ? ? 1_555 O  CSS 103 N  ? ? O LEU 102 O CSS 103  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale60  covale both ? O  CSS 103 C   ? ? ? 1_555 O  SER 104 N  ? ? O CSS 103 O SER 104  1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc56  metalc ?    ? O  GLU 116 OE1 ? ? ? 1_555 RB FE  .   FE ? ? O GLU 116 O FE  401  1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc57  metalc ?    ? O  GLU 116 OE2 ? ? ? 1_555 RB FE  .   FE ? ? O GLU 116 O FE  401  1_555 ? ? ? ? ? ? ? 2.327 ? 
covale61  covale one  ? P  VAL 32  C   ? ? ? 1_555 P  CSS 33  N  ? ? P VAL 32  P CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale62  covale both ? P  CSS 33  C   ? ? ? 1_555 P  ILE 34  N  ? ? P CSS 33  P ILE 34   1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc58  metalc ?    ? P  HIS 88  NE2 ? ? ? 1_555 UB FE  .   FE ? ? P HIS 88  P FE  401  1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc59  metalc ?    ? P  HIS 92  NE2 ? ? ? 1_555 UB FE  .   FE ? ? P HIS 92  P FE  401  1_555 ? ? ? ? ? ? ? 2.363 ? 
covale63  covale one  ? P  LEU 102 C   ? ? ? 1_555 P  CSS 103 N  ? ? P LEU 102 P CSS 103  1_555 ? ? ? ? ? ? ? 1.316 ? 
covale64  covale both ? P  CSS 103 C   ? ? ? 1_555 P  SER 104 N  ? ? P CSS 103 P SER 104  1_555 ? ? ? ? ? ? ? 1.326 ? 
metalc60  metalc ?    ? P  GLU 116 OE2 ? ? ? 1_555 UB FE  .   FE ? ? P GLU 116 P FE  401  1_555 ? ? ? ? ? ? ? 2.321 ? 
covale65  covale one  ? Q  VAL 32  C   ? ? ? 1_555 Q  CSS 33  N  ? ? Q VAL 32  Q CSS 33   1_555 ? ? ? ? ? ? ? 1.329 ? 
covale66  covale both ? Q  CSS 33  C   ? ? ? 1_555 Q  ILE 34  N  ? ? Q CSS 33  Q ILE 34   1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc61  metalc ?    ? Q  HIS 88  NE2 ? ? ? 1_555 XB FE  .   FE ? ? Q HIS 88  Q FE  401  1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc62  metalc ?    ? Q  HIS 92  NE2 ? ? ? 1_555 XB FE  .   FE ? ? Q HIS 92  Q FE  401  1_555 ? ? ? ? ? ? ? 2.334 ? 
covale67  covale one  ? Q  LEU 102 C   ? ? ? 1_555 Q  CSS 103 N  ? ? Q LEU 102 Q CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale68  covale both ? Q  CSS 103 C   ? ? ? 1_555 Q  SER 104 N  ? ? Q CSS 103 Q SER 104  1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc63  metalc ?    ? Q  GLU 116 OE1 ? ? ? 1_555 XB FE  .   FE ? ? Q GLU 116 Q FE  401  1_555 ? ? ? ? ? ? ? 2.659 ? 
metalc64  metalc ?    ? Q  GLU 116 OE2 ? ? ? 1_555 XB FE  .   FE ? ? Q GLU 116 Q FE  401  1_555 ? ? ? ? ? ? ? 2.208 ? 
covale69  covale one  ? R  VAL 32  C   ? ? ? 1_555 R  CSS 33  N  ? ? R VAL 32  R CSS 33   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale70  covale both ? R  CSS 33  C   ? ? ? 1_555 R  ILE 34  N  ? ? R CSS 33  R ILE 34   1_555 ? ? ? ? ? ? ? 1.333 ? 
metalc65  metalc ?    ? R  HIS 88  NE2 ? ? ? 1_555 AC FE  .   FE ? ? R HIS 88  R FE  401  1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc66  metalc ?    ? R  HIS 92  NE2 ? ? ? 1_555 AC FE  .   FE ? ? R HIS 92  R FE  401  1_555 ? ? ? ? ? ? ? 2.241 ? 
covale71  covale one  ? R  LEU 102 C   ? ? ? 1_555 R  CSS 103 N  ? ? R LEU 102 R CSS 103  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale72  covale both ? R  CSS 103 C   ? ? ? 1_555 R  SER 104 N  ? ? R CSS 103 R SER 104  1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc67  metalc ?    ? R  GLU 116 OE1 ? ? ? 1_555 AC FE  .   FE ? ? R GLU 116 R FE  401  1_555 ? ? ? ? ? ? ? 2.551 ? 
metalc68  metalc ?    ? R  GLU 116 OE2 ? ? ? 1_555 AC FE  .   FE ? ? R GLU 116 R FE  401  1_555 ? ? ? ? ? ? ? 2.239 ? 
covale73  covale one  ? S  VAL 32  C   ? ? ? 1_555 S  CSS 33  N  ? ? T VAL 32  T CSS 33   1_555 ? ? ? ? ? ? ? 1.334 ? 
covale74  covale both ? S  CSS 33  C   ? ? ? 1_555 S  ILE 34  N  ? ? T CSS 33  T ILE 34   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc69  metalc ?    ? S  HIS 88  NE2 ? ? ? 1_555 CC FE  .   FE ? ? T HIS 88  T FE  401  1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc70  metalc ?    ? S  HIS 92  NE2 ? ? ? 1_555 CC FE  .   FE ? ? T HIS 92  T FE  401  1_555 ? ? ? ? ? ? ? 2.265 ? 
covale75  covale one  ? S  LEU 102 C   ? ? ? 1_555 S  CSS 103 N  ? ? T LEU 102 T CSS 103  1_555 ? ? ? ? ? ? ? 1.321 ? 
covale76  covale both ? S  CSS 103 C   ? ? ? 1_555 S  SER 104 N  ? ? T CSS 103 T SER 104  1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc71  metalc ?    ? S  GLU 116 OE1 ? ? ? 1_555 CC FE  .   FE ? ? T GLU 116 T FE  401  1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc72  metalc ?    ? S  GLU 116 OE2 ? ? ? 1_555 CC FE  .   FE ? ? T GLU 116 T FE  401  1_555 ? ? ? ? ? ? ? 2.264 ? 
covale77  covale one  ? T  VAL 32  C   ? ? ? 1_555 T  CSS 33  N  ? ? U VAL 32  U CSS 33   1_555 ? ? ? ? ? ? ? 1.332 ? 
covale78  covale both ? T  CSS 33  C   ? ? ? 1_555 T  ILE 34  N  ? ? U CSS 33  U ILE 34   1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc73  metalc ?    ? T  HIS 88  NE2 ? ? ? 1_555 EC FE  .   FE ? ? U HIS 88  U FE  401  1_555 ? ? ? ? ? ? ? 2.115 ? 
metalc74  metalc ?    ? T  HIS 92  NE2 ? ? ? 1_555 EC FE  .   FE ? ? U HIS 92  U FE  401  1_555 ? ? ? ? ? ? ? 2.143 ? 
covale79  covale one  ? T  LEU 102 C   ? ? ? 1_555 T  CSS 103 N  ? ? U LEU 102 U CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale80  covale both ? T  CSS 103 C   ? ? ? 1_555 T  SER 104 N  ? ? U CSS 103 U SER 104  1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc75  metalc ?    ? T  GLU 116 OE1 ? ? ? 1_555 EC FE  .   FE ? ? U GLU 116 U FE  401  1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc76  metalc ?    ? T  GLU 116 OE2 ? ? ? 1_555 EC FE  .   FE ? ? U GLU 116 U FE  401  1_555 ? ? ? ? ? ? ? 2.239 ? 
covale81  covale one  ? U  VAL 32  C   ? ? ? 1_555 U  CSS 33  N  ? ? V VAL 32  V CSS 33   1_555 ? ? ? ? ? ? ? 1.330 ? 
covale82  covale both ? U  CSS 33  C   ? ? ? 1_555 U  ILE 34  N  ? ? V CSS 33  V ILE 34   1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc77  metalc ?    ? U  HIS 88  NE2 ? ? ? 1_555 IC FE  .   FE ? ? V HIS 88  V FE  402  1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc78  metalc ?    ? U  HIS 92  NE2 ? ? ? 1_555 IC FE  .   FE ? ? V HIS 92  V FE  402  1_555 ? ? ? ? ? ? ? 2.389 ? 
covale83  covale one  ? U  LEU 102 C   ? ? ? 1_555 U  CSS 103 N  ? ? V LEU 102 V CSS 103  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale84  covale both ? U  CSS 103 C   ? ? ? 1_555 U  SER 104 N  ? ? V CSS 103 V SER 104  1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc79  metalc ?    ? U  GLU 116 OE2 ? ? ? 1_555 IC FE  .   FE ? ? V GLU 116 V FE  402  1_555 ? ? ? ? ? ? ? 2.272 ? 
covale85  covale one  ? V  VAL 32  C   ? ? ? 1_555 V  CSS 33  N  ? ? W VAL 32  W CSS 33   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale86  covale both ? V  CSS 33  C   ? ? ? 1_555 V  ILE 34  N  ? ? W CSS 33  W ILE 34   1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc80  metalc ?    ? V  HIS 88  NE2 ? ? ? 1_555 LC FE  .   FE ? ? W HIS 88  W FE  401  1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc81  metalc ?    ? V  HIS 92  NE2 ? ? ? 1_555 LC FE  .   FE ? ? W HIS 92  W FE  401  1_555 ? ? ? ? ? ? ? 2.337 ? 
covale87  covale one  ? V  LEU 102 C   ? ? ? 1_555 V  CSS 103 N  ? ? W LEU 102 W CSS 103  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale88  covale both ? V  CSS 103 C   ? ? ? 1_555 V  SER 104 N  ? ? W CSS 103 W SER 104  1_555 ? ? ? ? ? ? ? 1.331 ? 
metalc82  metalc ?    ? V  GLU 116 OE1 ? ? ? 1_555 LC FE  .   FE ? ? W GLU 116 W FE  401  1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc83  metalc ?    ? V  GLU 116 OE2 ? ? ? 1_555 LC FE  .   FE ? ? W GLU 116 W FE  401  1_555 ? ? ? ? ? ? ? 2.181 ? 
covale89  covale one  ? W  VAL 32  C   ? ? ? 1_555 W  CSS 33  N  ? ? Y VAL 32  Y CSS 33   1_555 ? ? ? ? ? ? ? 1.331 ? 
covale90  covale both ? W  CSS 33  C   ? ? ? 1_555 W  ILE 34  N  ? ? Y CSS 33  Y ILE 34   1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc84  metalc ?    ? W  HIS 88  NE2 ? ? ? 1_555 OC FE  .   FE ? ? Y HIS 88  Y FE  401  1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc85  metalc ?    ? W  HIS 92  NE2 ? ? ? 1_555 OC FE  .   FE ? ? Y HIS 92  Y FE  401  1_555 ? ? ? ? ? ? ? 2.209 ? 
covale91  covale one  ? W  LEU 102 C   ? ? ? 1_555 W  CSS 103 N  ? ? Y LEU 102 Y CSS 103  1_555 ? ? ? ? ? ? ? 1.327 ? 
covale92  covale both ? W  CSS 103 C   ? ? ? 1_555 W  SER 104 N  ? ? Y CSS 103 Y SER 104  1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc86  metalc ?    ? W  GLU 116 OE2 ? ? ? 1_555 OC FE  .   FE ? ? Y GLU 116 Y FE  401  1_555 ? ? ? ? ? ? ? 2.353 ? 
covale93  covale one  ? X  VAL 32  C   ? ? ? 1_555 X  CSS 33  N  ? ? Z VAL 32  Z CSS 33   1_555 ? ? ? ? ? ? ? 1.333 ? 
covale94  covale both ? X  CSS 33  C   ? ? ? 1_555 X  ILE 34  N  ? ? Z CSS 33  Z ILE 34   1_555 ? ? ? ? ? ? ? 1.327 ? 
metalc87  metalc ?    ? X  HIS 88  NE2 ? ? ? 1_555 QC FE  .   FE ? ? Z HIS 88  Z FE  401  1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc88  metalc ?    ? X  HIS 92  NE2 ? ? ? 1_555 QC FE  .   FE ? ? Z HIS 92  Z FE  401  1_555 ? ? ? ? ? ? ? 2.250 ? 
covale95  covale one  ? X  LEU 102 C   ? ? ? 1_555 X  CSS 103 N  ? ? Z LEU 102 Z CSS 103  1_555 ? ? ? ? ? ? ? 1.325 ? 
covale96  covale both ? X  CSS 103 C   ? ? ? 1_555 X  SER 104 N  ? ? Z CSS 103 Z SER 104  1_555 ? ? ? ? ? ? ? 1.329 ? 
metalc89  metalc ?    ? X  GLU 116 OE1 ? ? ? 1_555 QC FE  .   FE ? ? Z GLU 116 Z FE  401  1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc90  metalc ?    ? X  GLU 116 OE2 ? ? ? 1_555 QC FE  .   FE ? ? Z GLU 116 Z FE  401  1_555 ? ? ? ? ? ? ? 2.337 ? 
metalc91  metalc ?    ? Y  FE  .   FE  ? ? ? 1_555 SC HOH .   O  ? ? A FE  401 A HOH 564  1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc92  metalc ?    ? Y  FE  .   FE  ? ? ? 1_555 SC HOH .   O  ? ? A FE  401 A HOH 659  1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc93  metalc ?    ? CA FE  .   FE  ? ? ? 1_555 TC HOH .   O  ? ? B FE  401 B HOH 609  1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc94  metalc ?    ? CA FE  .   FE  ? ? ? 1_555 TC HOH .   O  ? ? B FE  401 B HOH 633  1_555 ? ? ? ? ? ? ? 2.264 ? 
metalc95  metalc ?    ? FA FE  .   FE  ? ? ? 1_555 UC HOH .   O  ? ? C FE  401 C HOH 608  1_555 ? ? ? ? ? ? ? 2.423 ? 
metalc96  metalc ?    ? MA FE  .   FE  ? ? ? 1_555 WC HOH .   O  ? ? E FE  401 E HOH 623  1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc97  metalc ?    ? PA FE  .   FE  ? ? ? 1_555 XC HOH .   O  ? ? F FE  401 F HOH 598  1_555 ? ? ? ? ? ? ? 2.550 ? 
metalc98  metalc ?    ? PA FE  .   FE  ? ? ? 1_555 XC HOH .   O  ? ? F FE  401 F HOH 600  1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc99  metalc ?    ? TA FE  .   FE  ? ? ? 1_555 YC HOH .   O  ? ? G FE  401 G HOH 663  1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc100 metalc ?    ? TA FE  .   FE  ? ? ? 1_555 YC HOH .   O  ? ? G FE  401 G HOH 683  1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc101 metalc ?    ? WA FE  .   FE  ? ? ? 1_555 ZC HOH .   O  ? ? H FE  401 H HOH 637  1_555 ? ? ? ? ? ? ? 2.244 ? 
metalc102 metalc ?    ? ZA FE  .   FE  ? ? ? 1_555 AD HOH .   O  ? ? I FE  401 I HOH 680  1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc103 metalc ?    ? ZA FE  .   FE  ? ? ? 1_555 AD HOH .   O  ? ? I FE  401 I HOH 621  1_555 ? ? ? ? ? ? ? 2.165 ? 
metalc104 metalc ?    ? CB FE  .   FE  ? ? ? 1_555 BD HOH .   O  ? ? J FE  401 J HOH 646  1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc105 metalc ?    ? CB FE  .   FE  ? ? ? 1_555 BD HOH .   O  ? ? J FE  401 J HOH 687  1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc106 metalc ?    ? FB FE  .   FE  ? ? ? 1_555 CD HOH .   O  ? ? K FE  401 K HOH 655  1_555 ? ? ? ? ? ? ? 2.581 ? 
metalc107 metalc ?    ? FB FE  .   FE  ? ? ? 1_555 CD HOH .   O  ? ? K FE  401 K HOH 658  1_555 ? ? ? ? ? ? ? 2.472 ? 
metalc108 metalc ?    ? IB FE  .   FE  ? ? ? 1_555 DD HOH .   O  ? ? L FE  401 L HOH 584  1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc109 metalc ?    ? LB FE  .   FE  ? ? ? 1_555 ED HOH .   O  ? ? M FE  401 M HOH 665  1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc110 metalc ?    ? LB FE  .   FE  ? ? ? 1_555 ED HOH .   O  ? ? M FE  401 M HOH 670  1_555 ? ? ? ? ? ? ? 2.771 ? 
metalc111 metalc ?    ? OB FE  .   FE  ? ? ? 1_555 FD HOH .   O  ? ? N FE  401 N HOH 694  1_555 ? ? ? ? ? ? ? 2.686 ? 
metalc112 metalc ?    ? OB FE  .   FE  ? ? ? 1_555 FD HOH .   O  ? ? N FE  401 N HOH 675  1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc113 metalc ?    ? RB FE  .   FE  ? ? ? 1_555 GD HOH .   O  ? ? O FE  401 O HOH 1457 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc114 metalc ?    ? UB FE  .   FE  ? ? ? 1_555 HD HOH .   O  ? ? P FE  401 P HOH 585  1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc115 metalc ?    ? UB FE  .   FE  ? ? ? 1_555 HD HOH .   O  ? ? P FE  401 P HOH 635  1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc116 metalc ?    ? XB FE  .   FE  ? ? ? 1_555 ID HOH .   O  ? ? Q FE  401 Q HOH 671  1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc117 metalc ?    ? AC FE  .   FE  ? ? ? 1_555 JD HOH .   O  ? ? R FE  401 R HOH 520  1_555 ? ? ? ? ? ? ? 1.899 ? 
metalc118 metalc ?    ? AC FE  .   FE  ? ? ? 1_555 JD HOH .   O  ? ? R FE  401 R HOH 608  1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc119 metalc ?    ? CC FE  .   FE  ? ? ? 1_555 KD HOH .   O  ? ? T FE  401 T HOH 647  1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc120 metalc ?    ? EC FE  .   FE  ? ? ? 1_555 LD HOH .   O  ? ? U FE  401 U HOH 605  1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc121 metalc ?    ? EC FE  .   FE  ? ? ? 1_555 LD HOH .   O  ? ? U FE  401 U HOH 557  1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc122 metalc ?    ? IC FE  .   FE  ? ? ? 1_555 MD HOH .   O  ? ? V FE  402 V HOH 599  1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc123 metalc ?    ? LC FE  .   FE  ? ? ? 1_555 ND HOH .   O  ? ? W FE  401 W HOH 564  1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc124 metalc ?    ? LC FE  .   FE  ? ? ? 1_555 ND HOH .   O  ? ? W FE  401 W HOH 569  1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc125 metalc ?    ? OC FE  .   FE  ? ? ? 1_555 OD HOH .   O  ? ? Y FE  401 Y HOH 588  1_555 ? ? ? ? ? ? ? 2.249 ? 
metalc126 metalc ?    ? QC FE  .   FE  ? ? ? 1_555 PD HOH .   O  ? ? Z FE  401 Z HOH 644  1_555 ? ? ? ? ? ? ? 2.123 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ASN 72  A . ? ASN 72  A PRO 73  A ? PRO 73  A 1 3.96  
2  GLY 113 A . ? GLY 113 A PRO 114 A ? PRO 114 A 1 0.91  
3  THR 249 A . ? THR 249 A PRO 250 A ? PRO 250 A 1 -4.70 
4  GLY 293 A . ? GLY 293 A PRO 294 A ? PRO 294 A 1 0.14  
5  ASN 72  B . ? ASN 72  B PRO 73  B ? PRO 73  B 1 3.14  
6  GLY 113 B . ? GLY 113 B PRO 114 B ? PRO 114 B 1 0.05  
7  THR 249 B . ? THR 249 B PRO 250 B ? PRO 250 B 1 -3.57 
8  GLY 293 B . ? GLY 293 B PRO 294 B ? PRO 294 B 1 0.59  
9  ASN 72  C . ? ASN 72  C PRO 73  C ? PRO 73  C 1 4.60  
10 GLY 113 C . ? GLY 113 C PRO 114 C ? PRO 114 C 1 2.66  
11 THR 249 C . ? THR 249 C PRO 250 C ? PRO 250 C 1 -2.92 
12 GLY 293 C . ? GLY 293 C PRO 294 C ? PRO 294 C 1 -1.08 
13 ASN 72  D . ? ASN 72  D PRO 73  D ? PRO 73  D 1 3.57  
14 GLY 113 D . ? GLY 113 D PRO 114 D ? PRO 114 D 1 -0.90 
15 THR 249 D . ? THR 249 D PRO 250 D ? PRO 250 D 1 -4.11 
16 GLY 293 D . ? GLY 293 D PRO 294 D ? PRO 294 D 1 1.24  
17 ASN 72  E . ? ASN 72  E PRO 73  E ? PRO 73  E 1 3.25  
18 GLY 113 E . ? GLY 113 E PRO 114 E ? PRO 114 E 1 0.85  
19 THR 249 E . ? THR 249 E PRO 250 E ? PRO 250 E 1 -4.44 
20 GLY 293 E . ? GLY 293 E PRO 294 E ? PRO 294 E 1 0.91  
21 ASN 72  F . ? ASN 72  F PRO 73  F ? PRO 73  F 1 4.86  
22 GLY 113 F . ? GLY 113 F PRO 114 F ? PRO 114 F 1 -0.79 
23 THR 249 F . ? THR 249 F PRO 250 F ? PRO 250 F 1 -3.56 
24 GLY 293 F . ? GLY 293 F PRO 294 F ? PRO 294 F 1 -0.45 
25 ASN 72  G . ? ASN 72  G PRO 73  G ? PRO 73  G 1 4.12  
26 GLY 113 G . ? GLY 113 G PRO 114 G ? PRO 114 G 1 -0.34 
27 THR 249 G . ? THR 249 G PRO 250 G ? PRO 250 G 1 -4.92 
28 GLY 293 G . ? GLY 293 G PRO 294 G ? PRO 294 G 1 1.69  
29 ASN 72  H . ? ASN 72  H PRO 73  H ? PRO 73  H 1 4.61  
30 GLY 113 H . ? GLY 113 H PRO 114 H ? PRO 114 H 1 -0.44 
31 THR 249 H . ? THR 249 H PRO 250 H ? PRO 250 H 1 -4.26 
32 GLY 293 H . ? GLY 293 H PRO 294 H ? PRO 294 H 1 -0.57 
33 ASN 72  I . ? ASN 72  I PRO 73  I ? PRO 73  I 1 4.06  
34 GLY 113 I . ? GLY 113 I PRO 114 I ? PRO 114 I 1 -0.27 
35 THR 249 I . ? THR 249 I PRO 250 I ? PRO 250 I 1 -3.98 
36 GLY 293 I . ? GLY 293 I PRO 294 I ? PRO 294 I 1 0.27  
37 ASN 72  J . ? ASN 72  J PRO 73  J ? PRO 73  J 1 3.64  
38 GLY 113 J . ? GLY 113 J PRO 114 J ? PRO 114 J 1 -1.39 
39 THR 249 J . ? THR 249 J PRO 250 J ? PRO 250 J 1 -2.81 
40 GLY 293 J . ? GLY 293 J PRO 294 J ? PRO 294 J 1 1.39  
41 ASN 72  K . ? ASN 72  K PRO 73  K ? PRO 73  K 1 4.13  
42 GLY 113 K . ? GLY 113 K PRO 114 K ? PRO 114 K 1 -1.14 
43 THR 249 K . ? THR 249 K PRO 250 K ? PRO 250 K 1 -3.93 
44 GLY 293 K . ? GLY 293 K PRO 294 K ? PRO 294 K 1 -0.33 
45 ASN 72  L . ? ASN 72  L PRO 73  L ? PRO 73  L 1 4.84  
46 GLY 113 L . ? GLY 113 L PRO 114 L ? PRO 114 L 1 0.43  
47 THR 249 L . ? THR 249 L PRO 250 L ? PRO 250 L 1 -4.91 
48 GLY 293 L . ? GLY 293 L PRO 294 L ? PRO 294 L 1 0.32  
49 ASN 72  M . ? ASN 72  M PRO 73  M ? PRO 73  M 1 4.49  
50 GLY 113 M . ? GLY 113 M PRO 114 M ? PRO 114 M 1 0.83  
51 THR 249 M . ? THR 249 M PRO 250 M ? PRO 250 M 1 -3.42 
52 GLY 293 M . ? GLY 293 M PRO 294 M ? PRO 294 M 1 -0.64 
53 ASN 72  N . ? ASN 72  N PRO 73  N ? PRO 73  N 1 4.24  
54 GLY 113 N . ? GLY 113 N PRO 114 N ? PRO 114 N 1 0.59  
55 THR 249 N . ? THR 249 N PRO 250 N ? PRO 250 N 1 -3.65 
56 GLY 293 N . ? GLY 293 N PRO 294 N ? PRO 294 N 1 0.97  
57 ASN 72  O . ? ASN 72  O PRO 73  O ? PRO 73  O 1 4.66  
58 GLY 113 O . ? GLY 113 O PRO 114 O ? PRO 114 O 1 0.51  
59 THR 249 O . ? THR 249 O PRO 250 O ? PRO 250 O 1 -4.57 
60 GLY 293 O . ? GLY 293 O PRO 294 O ? PRO 294 O 1 0.16  
61 ASN 72  P . ? ASN 72  P PRO 73  P ? PRO 73  P 1 5.20  
62 GLY 113 P . ? GLY 113 P PRO 114 P ? PRO 114 P 1 -0.59 
63 THR 249 P . ? THR 249 P PRO 250 P ? PRO 250 P 1 -3.59 
64 GLY 293 P . ? GLY 293 P PRO 294 P ? PRO 294 P 1 -0.43 
65 ASN 72  Q . ? ASN 72  Q PRO 73  Q ? PRO 73  Q 1 3.18  
66 GLY 113 Q . ? GLY 113 Q PRO 114 Q ? PRO 114 Q 1 -0.95 
67 THR 249 Q . ? THR 249 Q PRO 250 Q ? PRO 250 Q 1 -4.16 
68 GLY 293 Q . ? GLY 293 Q PRO 294 Q ? PRO 294 Q 1 1.10  
69 ASN 72  R . ? ASN 72  R PRO 73  R ? PRO 73  R 1 3.28  
70 GLY 113 R . ? GLY 113 R PRO 114 R ? PRO 114 R 1 -0.29 
71 THR 249 R . ? THR 249 R PRO 250 R ? PRO 250 R 1 -4.21 
72 GLY 293 R . ? GLY 293 R PRO 294 R ? PRO 294 R 1 -1.49 
73 ASN 72  S . ? ASN 72  T PRO 73  S ? PRO 73  T 1 3.88  
74 GLY 113 S . ? GLY 113 T PRO 114 S ? PRO 114 T 1 -1.00 
75 THR 249 S . ? THR 249 T PRO 250 S ? PRO 250 T 1 -2.98 
76 GLY 293 S . ? GLY 293 T PRO 294 S ? PRO 294 T 1 -0.63 
77 ASN 72  T . ? ASN 72  U PRO 73  T ? PRO 73  U 1 3.03  
78 GLY 113 T . ? GLY 113 U PRO 114 T ? PRO 114 U 1 0.69  
79 THR 249 T . ? THR 249 U PRO 250 T ? PRO 250 U 1 -3.61 
80 GLY 293 T . ? GLY 293 U PRO 294 T ? PRO 294 U 1 -0.40 
81 ASN 72  U . ? ASN 72  V PRO 73  U ? PRO 73  V 1 3.35  
82 GLY 113 U . ? GLY 113 V PRO 114 U ? PRO 114 V 1 -1.26 
83 THR 249 U . ? THR 249 V PRO 250 U ? PRO 250 V 1 -4.08 
84 GLY 293 U . ? GLY 293 V PRO 294 U ? PRO 294 V 1 -1.20 
85 ASN 72  V . ? ASN 72  W PRO 73  V ? PRO 73  W 1 3.75  
86 GLY 113 V . ? GLY 113 W PRO 114 V ? PRO 114 W 1 -1.22 
87 THR 249 V . ? THR 249 W PRO 250 V ? PRO 250 W 1 -3.52 
88 GLY 293 V . ? GLY 293 W PRO 294 V ? PRO 294 W 1 -1.40 
89 ASN 72  W . ? ASN 72  Y PRO 73  W ? PRO 73  Y 1 4.71  
90 GLY 113 W . ? GLY 113 Y PRO 114 W ? PRO 114 Y 1 -0.32 
91 THR 249 W . ? THR 249 Y PRO 250 W ? PRO 250 Y 1 -4.20 
92 GLY 293 W . ? GLY 293 Y PRO 294 W ? PRO 294 Y 1 1.05  
93 ASN 72  X . ? ASN 72  Z PRO 73  X ? PRO 73  Z 1 4.13  
94 GLY 113 X . ? GLY 113 Z PRO 114 X ? PRO 114 Z 1 -0.92 
95 THR 249 X . ? THR 249 Z PRO 250 X ? PRO 250 Z 1 -3.54 
96 GLY 293 X . ? GLY 293 Z PRO 294 X ? PRO 294 Z 1 0.02  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 9  ? 
AA2 ? 5  ? 
AA3 ? 2  ? 
AA4 ? 9  ? 
AA5 ? 5  ? 
AA6 ? 2  ? 
AA7 ? 9  ? 
AA8 ? 5  ? 
AA9 ? 2  ? 
AB1 ? 9  ? 
AB2 ? 5  ? 
AB3 ? 2  ? 
AB4 ? 9  ? 
AB5 ? 5  ? 
AB6 ? 2  ? 
AB7 ? 10 ? 
AB8 ? 2  ? 
AB9 ? 9  ? 
AC1 ? 5  ? 
AC2 ? 2  ? 
AC3 ? 9  ? 
AC4 ? 5  ? 
AC5 ? 2  ? 
AC6 ? 10 ? 
AC7 ? 2  ? 
AC8 ? 9  ? 
AC9 ? 5  ? 
AD1 ? 2  ? 
AD2 ? 9  ? 
AD3 ? 5  ? 
AD4 ? 2  ? 
AD5 ? 9  ? 
AD6 ? 5  ? 
AD7 ? 2  ? 
AD8 ? 9  ? 
AD9 ? 5  ? 
AE1 ? 2  ? 
AE2 ? 9  ? 
AE3 ? 5  ? 
AE4 ? 2  ? 
AE5 ? 9  ? 
AE6 ? 5  ? 
AE7 ? 2  ? 
AE8 ? 9  ? 
AE9 ? 5  ? 
AF1 ? 2  ? 
AF2 ? 9  ? 
AF3 ? 5  ? 
AF4 ? 2  ? 
AF5 ? 10 ? 
AF6 ? 2  ? 
AF7 ? 9  ? 
AF8 ? 5  ? 
AF9 ? 2  ? 
AG1 ? 9  ? 
AG2 ? 5  ? 
AG3 ? 2  ? 
AG4 ? 9  ? 
AG5 ? 5  ? 
AG6 ? 2  ? 
AG7 ? 9  ? 
AG8 ? 5  ? 
AG9 ? 2  ? 
AH1 ? 9  ? 
AH2 ? 5  ? 
AH3 ? 2  ? 
AH4 ? 9  ? 
AH5 ? 5  ? 
AH6 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? anti-parallel 
AA1 2 3  ? anti-parallel 
AA1 3 4  ? anti-parallel 
AA1 4 5  ? anti-parallel 
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? anti-parallel 
AA2 1 2  ? anti-parallel 
AA2 2 3  ? anti-parallel 
AA2 3 4  ? anti-parallel 
AA2 4 5  ? anti-parallel 
AA3 1 2  ? parallel      
AA4 1 2  ? anti-parallel 
AA4 2 3  ? anti-parallel 
AA4 3 4  ? anti-parallel 
AA4 4 5  ? anti-parallel 
AA4 5 6  ? anti-parallel 
AA4 6 7  ? anti-parallel 
AA4 7 8  ? anti-parallel 
AA4 8 9  ? anti-parallel 
AA5 1 2  ? anti-parallel 
AA5 2 3  ? anti-parallel 
AA5 3 4  ? anti-parallel 
AA5 4 5  ? anti-parallel 
AA6 1 2  ? parallel      
AA7 1 2  ? anti-parallel 
AA7 2 3  ? anti-parallel 
AA7 3 4  ? anti-parallel 
AA7 4 5  ? anti-parallel 
AA7 5 6  ? anti-parallel 
AA7 6 7  ? anti-parallel 
AA7 7 8  ? anti-parallel 
AA7 8 9  ? anti-parallel 
AA8 1 2  ? anti-parallel 
AA8 2 3  ? anti-parallel 
AA8 3 4  ? anti-parallel 
AA8 4 5  ? anti-parallel 
AA9 1 2  ? parallel      
AB1 1 2  ? anti-parallel 
AB1 2 3  ? anti-parallel 
AB1 3 4  ? anti-parallel 
AB1 4 5  ? anti-parallel 
AB1 5 6  ? anti-parallel 
AB1 6 7  ? anti-parallel 
AB1 7 8  ? anti-parallel 
AB1 8 9  ? anti-parallel 
AB2 1 2  ? anti-parallel 
AB2 2 3  ? anti-parallel 
AB2 3 4  ? anti-parallel 
AB2 4 5  ? anti-parallel 
AB3 1 2  ? parallel      
AB4 1 2  ? anti-parallel 
AB4 2 3  ? anti-parallel 
AB4 3 4  ? anti-parallel 
AB4 4 5  ? anti-parallel 
AB4 5 6  ? anti-parallel 
AB4 6 7  ? anti-parallel 
AB4 7 8  ? anti-parallel 
AB4 8 9  ? anti-parallel 
AB5 1 2  ? anti-parallel 
AB5 2 3  ? anti-parallel 
AB5 3 4  ? anti-parallel 
AB5 4 5  ? anti-parallel 
AB6 1 2  ? parallel      
AB7 1 2  ? anti-parallel 
AB7 2 3  ? anti-parallel 
AB7 3 4  ? anti-parallel 
AB7 4 5  ? anti-parallel 
AB7 5 6  ? anti-parallel 
AB7 6 7  ? anti-parallel 
AB7 7 8  ? anti-parallel 
AB7 8 9  ? anti-parallel 
AB7 9 10 ? anti-parallel 
AB8 1 2  ? parallel      
AB9 1 2  ? anti-parallel 
AB9 2 3  ? anti-parallel 
AB9 3 4  ? anti-parallel 
AB9 4 5  ? anti-parallel 
AB9 5 6  ? anti-parallel 
AB9 6 7  ? anti-parallel 
AB9 7 8  ? anti-parallel 
AB9 8 9  ? anti-parallel 
AC1 1 2  ? anti-parallel 
AC1 2 3  ? anti-parallel 
AC1 3 4  ? anti-parallel 
AC1 4 5  ? anti-parallel 
AC2 1 2  ? parallel      
AC3 1 2  ? anti-parallel 
AC3 2 3  ? anti-parallel 
AC3 3 4  ? anti-parallel 
AC3 4 5  ? anti-parallel 
AC3 5 6  ? anti-parallel 
AC3 6 7  ? anti-parallel 
AC3 7 8  ? anti-parallel 
AC3 8 9  ? anti-parallel 
AC4 1 2  ? anti-parallel 
AC4 2 3  ? anti-parallel 
AC4 3 4  ? anti-parallel 
AC4 4 5  ? anti-parallel 
AC5 1 2  ? parallel      
AC6 1 2  ? anti-parallel 
AC6 2 3  ? anti-parallel 
AC6 3 4  ? anti-parallel 
AC6 4 5  ? anti-parallel 
AC6 5 6  ? anti-parallel 
AC6 6 7  ? anti-parallel 
AC6 7 8  ? anti-parallel 
AC6 8 9  ? anti-parallel 
AC6 9 10 ? anti-parallel 
AC7 1 2  ? parallel      
AC8 1 2  ? anti-parallel 
AC8 2 3  ? anti-parallel 
AC8 3 4  ? anti-parallel 
AC8 4 5  ? anti-parallel 
AC8 5 6  ? anti-parallel 
AC8 6 7  ? anti-parallel 
AC8 7 8  ? anti-parallel 
AC8 8 9  ? anti-parallel 
AC9 1 2  ? anti-parallel 
AC9 2 3  ? anti-parallel 
AC9 3 4  ? anti-parallel 
AC9 4 5  ? anti-parallel 
AD1 1 2  ? parallel      
AD2 1 2  ? anti-parallel 
AD2 2 3  ? anti-parallel 
AD2 3 4  ? anti-parallel 
AD2 4 5  ? anti-parallel 
AD2 5 6  ? anti-parallel 
AD2 6 7  ? anti-parallel 
AD2 7 8  ? anti-parallel 
AD2 8 9  ? anti-parallel 
AD3 1 2  ? anti-parallel 
AD3 2 3  ? anti-parallel 
AD3 3 4  ? anti-parallel 
AD3 4 5  ? anti-parallel 
AD4 1 2  ? parallel      
AD5 1 2  ? anti-parallel 
AD5 2 3  ? anti-parallel 
AD5 3 4  ? anti-parallel 
AD5 4 5  ? anti-parallel 
AD5 5 6  ? anti-parallel 
AD5 6 7  ? anti-parallel 
AD5 7 8  ? anti-parallel 
AD5 8 9  ? anti-parallel 
AD6 1 2  ? anti-parallel 
AD6 2 3  ? anti-parallel 
AD6 3 4  ? anti-parallel 
AD6 4 5  ? anti-parallel 
AD7 1 2  ? parallel      
AD8 1 2  ? anti-parallel 
AD8 2 3  ? anti-parallel 
AD8 3 4  ? anti-parallel 
AD8 4 5  ? anti-parallel 
AD8 5 6  ? anti-parallel 
AD8 6 7  ? anti-parallel 
AD8 7 8  ? anti-parallel 
AD8 8 9  ? anti-parallel 
AD9 1 2  ? anti-parallel 
AD9 2 3  ? anti-parallel 
AD9 3 4  ? anti-parallel 
AD9 4 5  ? anti-parallel 
AE1 1 2  ? parallel      
AE2 1 2  ? anti-parallel 
AE2 2 3  ? anti-parallel 
AE2 3 4  ? anti-parallel 
AE2 4 5  ? anti-parallel 
AE2 5 6  ? anti-parallel 
AE2 6 7  ? anti-parallel 
AE2 7 8  ? anti-parallel 
AE2 8 9  ? anti-parallel 
AE3 1 2  ? anti-parallel 
AE3 2 3  ? anti-parallel 
AE3 3 4  ? anti-parallel 
AE3 4 5  ? anti-parallel 
AE4 1 2  ? parallel      
AE5 1 2  ? anti-parallel 
AE5 2 3  ? anti-parallel 
AE5 3 4  ? anti-parallel 
AE5 4 5  ? anti-parallel 
AE5 5 6  ? anti-parallel 
AE5 6 7  ? anti-parallel 
AE5 7 8  ? anti-parallel 
AE5 8 9  ? anti-parallel 
AE6 1 2  ? anti-parallel 
AE6 2 3  ? anti-parallel 
AE6 3 4  ? anti-parallel 
AE6 4 5  ? anti-parallel 
AE7 1 2  ? parallel      
AE8 1 2  ? anti-parallel 
AE8 2 3  ? anti-parallel 
AE8 3 4  ? anti-parallel 
AE8 4 5  ? anti-parallel 
AE8 5 6  ? anti-parallel 
AE8 6 7  ? anti-parallel 
AE8 7 8  ? anti-parallel 
AE8 8 9  ? anti-parallel 
AE9 1 2  ? anti-parallel 
AE9 2 3  ? anti-parallel 
AE9 3 4  ? anti-parallel 
AE9 4 5  ? anti-parallel 
AF1 1 2  ? parallel      
AF2 1 2  ? anti-parallel 
AF2 2 3  ? anti-parallel 
AF2 3 4  ? anti-parallel 
AF2 4 5  ? anti-parallel 
AF2 5 6  ? anti-parallel 
AF2 6 7  ? anti-parallel 
AF2 7 8  ? anti-parallel 
AF2 8 9  ? anti-parallel 
AF3 1 2  ? anti-parallel 
AF3 2 3  ? anti-parallel 
AF3 3 4  ? anti-parallel 
AF3 4 5  ? anti-parallel 
AF4 1 2  ? parallel      
AF5 1 2  ? anti-parallel 
AF5 2 3  ? anti-parallel 
AF5 3 4  ? anti-parallel 
AF5 4 5  ? anti-parallel 
AF5 5 6  ? anti-parallel 
AF5 6 7  ? anti-parallel 
AF5 7 8  ? anti-parallel 
AF5 8 9  ? anti-parallel 
AF5 9 10 ? anti-parallel 
AF6 1 2  ? parallel      
AF7 1 2  ? anti-parallel 
AF7 2 3  ? anti-parallel 
AF7 3 4  ? anti-parallel 
AF7 4 5  ? anti-parallel 
AF7 5 6  ? anti-parallel 
AF7 6 7  ? anti-parallel 
AF7 7 8  ? anti-parallel 
AF7 8 9  ? anti-parallel 
AF8 1 2  ? anti-parallel 
AF8 2 3  ? anti-parallel 
AF8 3 4  ? anti-parallel 
AF8 4 5  ? anti-parallel 
AF9 1 2  ? parallel      
AG1 1 2  ? anti-parallel 
AG1 2 3  ? anti-parallel 
AG1 3 4  ? anti-parallel 
AG1 4 5  ? anti-parallel 
AG1 5 6  ? anti-parallel 
AG1 6 7  ? anti-parallel 
AG1 7 8  ? anti-parallel 
AG1 8 9  ? anti-parallel 
AG2 1 2  ? anti-parallel 
AG2 2 3  ? anti-parallel 
AG2 3 4  ? anti-parallel 
AG2 4 5  ? anti-parallel 
AG3 1 2  ? parallel      
AG4 1 2  ? anti-parallel 
AG4 2 3  ? anti-parallel 
AG4 3 4  ? anti-parallel 
AG4 4 5  ? anti-parallel 
AG4 5 6  ? anti-parallel 
AG4 6 7  ? anti-parallel 
AG4 7 8  ? anti-parallel 
AG4 8 9  ? anti-parallel 
AG5 1 2  ? anti-parallel 
AG5 2 3  ? anti-parallel 
AG5 3 4  ? anti-parallel 
AG5 4 5  ? anti-parallel 
AG6 1 2  ? parallel      
AG7 1 2  ? anti-parallel 
AG7 2 3  ? anti-parallel 
AG7 3 4  ? anti-parallel 
AG7 4 5  ? anti-parallel 
AG7 5 6  ? anti-parallel 
AG7 6 7  ? anti-parallel 
AG7 7 8  ? anti-parallel 
AG7 8 9  ? anti-parallel 
AG8 1 2  ? anti-parallel 
AG8 2 3  ? anti-parallel 
AG8 3 4  ? anti-parallel 
AG8 4 5  ? anti-parallel 
AG9 1 2  ? parallel      
AH1 1 2  ? anti-parallel 
AH1 2 3  ? anti-parallel 
AH1 3 4  ? anti-parallel 
AH1 4 5  ? anti-parallel 
AH1 5 6  ? anti-parallel 
AH1 6 7  ? anti-parallel 
AH1 7 8  ? anti-parallel 
AH1 8 9  ? anti-parallel 
AH2 1 2  ? anti-parallel 
AH2 2 3  ? anti-parallel 
AH2 3 4  ? anti-parallel 
AH2 4 5  ? anti-parallel 
AH3 1 2  ? parallel      
AH4 1 2  ? anti-parallel 
AH4 2 3  ? anti-parallel 
AH4 3 4  ? anti-parallel 
AH4 4 5  ? anti-parallel 
AH4 5 6  ? anti-parallel 
AH4 6 7  ? anti-parallel 
AH4 7 8  ? anti-parallel 
AH4 8 9  ? anti-parallel 
AH5 1 2  ? anti-parallel 
AH5 2 3  ? anti-parallel 
AH5 3 4  ? anti-parallel 
AH5 4 5  ? anti-parallel 
AH6 1 2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  VAL A 110 ? TRP A 115 ? VAL A 110 TRP A 115 
AA1 2  ILE A 7   ? ILE A 15  ? ILE A 7   ILE A 15  
AA1 3  MET A 74  ? TRP A 82  ? MET A 74  TRP A 82  
AA1 4  PHE A 42  ? ILE A 53  ? PHE A 42  ILE A 53  
AA1 5  LEU A 290 ? GLN A 305 ? LEU A 290 GLN A 305 
AA1 6  THR A 159 ? VAL A 167 ? THR A 159 VAL A 167 
AA1 7  THR A 251 ? TRP A 259 ? THR A 251 TRP A 259 
AA1 8  MET A 193 ? VAL A 204 ? MET A 193 VAL A 204 
AA1 9  ILE A 245 ? PRO A 246 ? ILE A 245 PRO A 246 
AA2 1  VAL A 110 ? TRP A 115 ? VAL A 110 TRP A 115 
AA2 2  ILE A 7   ? ILE A 15  ? ILE A 7   ILE A 15  
AA2 3  PRO A 117 ? ASP A 125 ? PRO A 117 ASP A 125 
AA2 4  MET A 193 ? VAL A 204 ? MET A 193 VAL A 204 
AA2 5  ILE A 245 ? PRO A 246 ? ILE A 245 PRO A 246 
AA3 1  ILE A 129 ? MET A 130 ? ILE A 129 MET A 130 
AA3 2  ALA A 153 ? LEU A 154 ? ALA A 153 LEU A 154 
AA4 1  VAL B 110 ? TRP B 115 ? VAL B 110 TRP B 115 
AA4 2  ILE B 7   ? ILE B 15  ? ILE B 7   ILE B 15  
AA4 3  MET B 74  ? TRP B 82  ? MET B 74  TRP B 82  
AA4 4  PHE B 42  ? ILE B 53  ? PHE B 42  ILE B 53  
AA4 5  LEU B 290 ? GLN B 305 ? LEU B 290 GLN B 305 
AA4 6  THR B 159 ? VAL B 167 ? THR B 159 VAL B 167 
AA4 7  THR B 251 ? TRP B 259 ? THR B 251 TRP B 259 
AA4 8  MET B 193 ? VAL B 204 ? MET B 193 VAL B 204 
AA4 9  ILE B 245 ? PRO B 246 ? ILE B 245 PRO B 246 
AA5 1  VAL B 110 ? TRP B 115 ? VAL B 110 TRP B 115 
AA5 2  ILE B 7   ? ILE B 15  ? ILE B 7   ILE B 15  
AA5 3  PRO B 117 ? ASP B 125 ? PRO B 117 ASP B 125 
AA5 4  MET B 193 ? VAL B 204 ? MET B 193 VAL B 204 
AA5 5  ILE B 245 ? PRO B 246 ? ILE B 245 PRO B 246 
AA6 1  ILE B 129 ? MET B 130 ? ILE B 129 MET B 130 
AA6 2  ALA B 153 ? LEU B 154 ? ALA B 153 LEU B 154 
AA7 1  VAL C 110 ? TRP C 115 ? VAL C 110 TRP C 115 
AA7 2  ILE C 7   ? ILE C 15  ? ILE C 7   ILE C 15  
AA7 3  MET C 74  ? TRP C 82  ? MET C 74  TRP C 82  
AA7 4  PHE C 42  ? ILE C 53  ? PHE C 42  ILE C 53  
AA7 5  LEU C 290 ? GLN C 305 ? LEU C 290 GLN C 305 
AA7 6  THR C 159 ? VAL C 167 ? THR C 159 VAL C 167 
AA7 7  THR C 251 ? TRP C 259 ? THR C 251 TRP C 259 
AA7 8  MET C 193 ? VAL C 204 ? MET C 193 VAL C 204 
AA7 9  ILE C 245 ? PRO C 246 ? ILE C 245 PRO C 246 
AA8 1  VAL C 110 ? TRP C 115 ? VAL C 110 TRP C 115 
AA8 2  ILE C 7   ? ILE C 15  ? ILE C 7   ILE C 15  
AA8 3  PRO C 117 ? ASP C 125 ? PRO C 117 ASP C 125 
AA8 4  MET C 193 ? VAL C 204 ? MET C 193 VAL C 204 
AA8 5  ILE C 245 ? PRO C 246 ? ILE C 245 PRO C 246 
AA9 1  ILE C 129 ? MET C 130 ? ILE C 129 MET C 130 
AA9 2  ALA C 153 ? LEU C 154 ? ALA C 153 LEU C 154 
AB1 1  VAL D 110 ? TRP D 115 ? VAL D 110 TRP D 115 
AB1 2  ILE D 7   ? ILE D 15  ? ILE D 7   ILE D 15  
AB1 3  MET D 74  ? TRP D 82  ? MET D 74  TRP D 82  
AB1 4  PHE D 42  ? ILE D 53  ? PHE D 42  ILE D 53  
AB1 5  LEU D 290 ? GLN D 305 ? LEU D 290 GLN D 305 
AB1 6  THR D 159 ? VAL D 167 ? THR D 159 VAL D 167 
AB1 7  GLN D 252 ? TRP D 259 ? GLN D 252 TRP D 259 
AB1 8  MET D 193 ? VAL D 204 ? MET D 193 VAL D 204 
AB1 9  ILE D 245 ? PRO D 246 ? ILE D 245 PRO D 246 
AB2 1  VAL D 110 ? TRP D 115 ? VAL D 110 TRP D 115 
AB2 2  ILE D 7   ? ILE D 15  ? ILE D 7   ILE D 15  
AB2 3  PRO D 117 ? ASP D 125 ? PRO D 117 ASP D 125 
AB2 4  MET D 193 ? VAL D 204 ? MET D 193 VAL D 204 
AB2 5  ILE D 245 ? PRO D 246 ? ILE D 245 PRO D 246 
AB3 1  ILE D 129 ? MET D 130 ? ILE D 129 MET D 130 
AB3 2  ALA D 153 ? LEU D 154 ? ALA D 153 LEU D 154 
AB4 1  VAL E 110 ? TRP E 115 ? VAL E 110 TRP E 115 
AB4 2  ILE E 7   ? ILE E 15  ? ILE E 7   ILE E 15  
AB4 3  MET E 74  ? TRP E 82  ? MET E 74  TRP E 82  
AB4 4  PHE E 42  ? ILE E 53  ? PHE E 42  ILE E 53  
AB4 5  LEU E 290 ? GLN E 305 ? LEU E 290 GLN E 305 
AB4 6  THR E 159 ? VAL E 167 ? THR E 159 VAL E 167 
AB4 7  GLN E 252 ? TRP E 259 ? GLN E 252 TRP E 259 
AB4 8  MET E 193 ? VAL E 204 ? MET E 193 VAL E 204 
AB4 9  ILE E 245 ? PRO E 246 ? ILE E 245 PRO E 246 
AB5 1  VAL E 110 ? TRP E 115 ? VAL E 110 TRP E 115 
AB5 2  ILE E 7   ? ILE E 15  ? ILE E 7   ILE E 15  
AB5 3  PRO E 117 ? ASP E 125 ? PRO E 117 ASP E 125 
AB5 4  MET E 193 ? VAL E 204 ? MET E 193 VAL E 204 
AB5 5  ILE E 245 ? PRO E 246 ? ILE E 245 PRO E 246 
AB6 1  ILE E 129 ? MET E 130 ? ILE E 129 MET E 130 
AB6 2  ALA E 153 ? LEU E 154 ? ALA E 153 LEU E 154 
AB7 1  ILE F 245 ? PRO F 246 ? ILE F 245 PRO F 246 
AB7 2  MET F 193 ? SER F 205 ? MET F 193 SER F 205 
AB7 3  THR F 251 ? TRP F 259 ? THR F 251 TRP F 259 
AB7 4  THR F 159 ? VAL F 167 ? THR F 159 VAL F 167 
AB7 5  LEU F 290 ? GLN F 305 ? LEU F 290 GLN F 305 
AB7 6  PHE F 42  ? ILE F 53  ? PHE F 42  ILE F 53  
AB7 7  MET F 74  ? TRP F 82  ? MET F 74  TRP F 82  
AB7 8  ILE F 7   ? ILE F 15  ? ILE F 7   ILE F 15  
AB7 9  VAL F 110 ? ASP F 125 ? VAL F 110 ASP F 125 
AB7 10 MET F 193 ? SER F 205 ? MET F 193 SER F 205 
AB8 1  ILE F 129 ? MET F 130 ? ILE F 129 MET F 130 
AB8 2  ALA F 153 ? LEU F 154 ? ALA F 153 LEU F 154 
AB9 1  VAL G 110 ? TRP G 115 ? VAL G 110 TRP G 115 
AB9 2  ILE G 7   ? ILE G 15  ? ILE G 7   ILE G 15  
AB9 3  MET G 74  ? TRP G 82  ? MET G 74  TRP G 82  
AB9 4  PHE G 42  ? ILE G 53  ? PHE G 42  ILE G 53  
AB9 5  LEU G 290 ? GLN G 305 ? LEU G 290 GLN G 305 
AB9 6  THR G 159 ? VAL G 167 ? THR G 159 VAL G 167 
AB9 7  THR G 251 ? TRP G 259 ? THR G 251 TRP G 259 
AB9 8  MET G 193 ? VAL G 204 ? MET G 193 VAL G 204 
AB9 9  ILE G 245 ? PRO G 246 ? ILE G 245 PRO G 246 
AC1 1  VAL G 110 ? TRP G 115 ? VAL G 110 TRP G 115 
AC1 2  ILE G 7   ? ILE G 15  ? ILE G 7   ILE G 15  
AC1 3  PRO G 117 ? ASP G 125 ? PRO G 117 ASP G 125 
AC1 4  MET G 193 ? VAL G 204 ? MET G 193 VAL G 204 
AC1 5  ILE G 245 ? PRO G 246 ? ILE G 245 PRO G 246 
AC2 1  ILE G 129 ? MET G 130 ? ILE G 129 MET G 130 
AC2 2  ALA G 153 ? LEU G 154 ? ALA G 153 LEU G 154 
AC3 1  VAL H 110 ? TRP H 115 ? VAL H 110 TRP H 115 
AC3 2  ILE H 7   ? ILE H 15  ? ILE H 7   ILE H 15  
AC3 3  MET H 74  ? TRP H 82  ? MET H 74  TRP H 82  
AC3 4  PHE H 42  ? ILE H 53  ? PHE H 42  ILE H 53  
AC3 5  LEU H 290 ? GLN H 305 ? LEU H 290 GLN H 305 
AC3 6  THR H 159 ? VAL H 167 ? THR H 159 VAL H 167 
AC3 7  THR H 251 ? TRP H 259 ? THR H 251 TRP H 259 
AC3 8  MET H 193 ? VAL H 204 ? MET H 193 VAL H 204 
AC3 9  ILE H 245 ? PRO H 246 ? ILE H 245 PRO H 246 
AC4 1  VAL H 110 ? TRP H 115 ? VAL H 110 TRP H 115 
AC4 2  ILE H 7   ? ILE H 15  ? ILE H 7   ILE H 15  
AC4 3  PRO H 117 ? ASP H 125 ? PRO H 117 ASP H 125 
AC4 4  MET H 193 ? VAL H 204 ? MET H 193 VAL H 204 
AC4 5  ILE H 245 ? PRO H 246 ? ILE H 245 PRO H 246 
AC5 1  ILE H 129 ? MET H 130 ? ILE H 129 MET H 130 
AC5 2  ALA H 153 ? LEU H 154 ? ALA H 153 LEU H 154 
AC6 1  ILE I 245 ? PRO I 246 ? ILE I 245 PRO I 246 
AC6 2  MET I 193 ? SER I 205 ? MET I 193 SER I 205 
AC6 3  THR I 251 ? TRP I 259 ? THR I 251 TRP I 259 
AC6 4  THR I 159 ? VAL I 167 ? THR I 159 VAL I 167 
AC6 5  LEU I 290 ? GLN I 305 ? LEU I 290 GLN I 305 
AC6 6  PHE I 42  ? ILE I 53  ? PHE I 42  ILE I 53  
AC6 7  MET I 74  ? TRP I 82  ? MET I 74  TRP I 82  
AC6 8  ILE I 7   ? ILE I 15  ? ILE I 7   ILE I 15  
AC6 9  VAL I 110 ? ASP I 125 ? VAL I 110 ASP I 125 
AC6 10 MET I 193 ? SER I 205 ? MET I 193 SER I 205 
AC7 1  ILE I 129 ? MET I 130 ? ILE I 129 MET I 130 
AC7 2  ALA I 153 ? LEU I 154 ? ALA I 153 LEU I 154 
AC8 1  VAL J 110 ? TRP J 115 ? VAL J 110 TRP J 115 
AC8 2  ILE J 7   ? ILE J 15  ? ILE J 7   ILE J 15  
AC8 3  MET J 74  ? TRP J 82  ? MET J 74  TRP J 82  
AC8 4  PHE J 42  ? ILE J 53  ? PHE J 42  ILE J 53  
AC8 5  LEU J 290 ? GLN J 305 ? LEU J 290 GLN J 305 
AC8 6  THR J 159 ? VAL J 167 ? THR J 159 VAL J 167 
AC8 7  GLN J 252 ? TRP J 259 ? GLN J 252 TRP J 259 
AC8 8  MET J 193 ? VAL J 204 ? MET J 193 VAL J 204 
AC8 9  ILE J 245 ? PRO J 246 ? ILE J 245 PRO J 246 
AC9 1  VAL J 110 ? TRP J 115 ? VAL J 110 TRP J 115 
AC9 2  ILE J 7   ? ILE J 15  ? ILE J 7   ILE J 15  
AC9 3  PRO J 117 ? ASP J 125 ? PRO J 117 ASP J 125 
AC9 4  MET J 193 ? VAL J 204 ? MET J 193 VAL J 204 
AC9 5  ILE J 245 ? PRO J 246 ? ILE J 245 PRO J 246 
AD1 1  ILE J 129 ? MET J 130 ? ILE J 129 MET J 130 
AD1 2  ALA J 153 ? LEU J 154 ? ALA J 153 LEU J 154 
AD2 1  VAL K 110 ? TRP K 115 ? VAL K 110 TRP K 115 
AD2 2  ILE K 7   ? ILE K 15  ? ILE K 7   ILE K 15  
AD2 3  MET K 74  ? TRP K 82  ? MET K 74  TRP K 82  
AD2 4  PHE K 42  ? ILE K 53  ? PHE K 42  ILE K 53  
AD2 5  LEU K 290 ? GLN K 305 ? LEU K 290 GLN K 305 
AD2 6  THR K 159 ? VAL K 167 ? THR K 159 VAL K 167 
AD2 7  GLN K 252 ? TRP K 259 ? GLN K 252 TRP K 259 
AD2 8  MET K 193 ? VAL K 204 ? MET K 193 VAL K 204 
AD2 9  ILE K 245 ? PRO K 246 ? ILE K 245 PRO K 246 
AD3 1  VAL K 110 ? TRP K 115 ? VAL K 110 TRP K 115 
AD3 2  ILE K 7   ? ILE K 15  ? ILE K 7   ILE K 15  
AD3 3  PRO K 117 ? ASP K 125 ? PRO K 117 ASP K 125 
AD3 4  MET K 193 ? VAL K 204 ? MET K 193 VAL K 204 
AD3 5  ILE K 245 ? PRO K 246 ? ILE K 245 PRO K 246 
AD4 1  ILE K 129 ? MET K 130 ? ILE K 129 MET K 130 
AD4 2  ALA K 153 ? LEU K 154 ? ALA K 153 LEU K 154 
AD5 1  VAL L 110 ? TRP L 115 ? VAL L 110 TRP L 115 
AD5 2  ILE L 7   ? ILE L 15  ? ILE L 7   ILE L 15  
AD5 3  MET L 74  ? TRP L 82  ? MET L 74  TRP L 82  
AD5 4  PHE L 42  ? ILE L 53  ? PHE L 42  ILE L 53  
AD5 5  LEU L 290 ? GLN L 305 ? LEU L 290 GLN L 305 
AD5 6  THR L 159 ? VAL L 167 ? THR L 159 VAL L 167 
AD5 7  THR L 251 ? TRP L 259 ? THR L 251 TRP L 259 
AD5 8  MET L 193 ? VAL L 204 ? MET L 193 VAL L 204 
AD5 9  ILE L 245 ? PRO L 246 ? ILE L 245 PRO L 246 
AD6 1  VAL L 110 ? TRP L 115 ? VAL L 110 TRP L 115 
AD6 2  ILE L 7   ? ILE L 15  ? ILE L 7   ILE L 15  
AD6 3  PRO L 117 ? ASP L 125 ? PRO L 117 ASP L 125 
AD6 4  MET L 193 ? VAL L 204 ? MET L 193 VAL L 204 
AD6 5  ILE L 245 ? PRO L 246 ? ILE L 245 PRO L 246 
AD7 1  ILE L 129 ? MET L 130 ? ILE L 129 MET L 130 
AD7 2  ALA L 153 ? LEU L 154 ? ALA L 153 LEU L 154 
AD8 1  VAL M 110 ? TRP M 115 ? VAL M 110 TRP M 115 
AD8 2  ILE M 7   ? ILE M 15  ? ILE M 7   ILE M 15  
AD8 3  MET M 74  ? TRP M 82  ? MET M 74  TRP M 82  
AD8 4  PHE M 42  ? ILE M 53  ? PHE M 42  ILE M 53  
AD8 5  LEU M 290 ? GLN M 305 ? LEU M 290 GLN M 305 
AD8 6  THR M 159 ? VAL M 167 ? THR M 159 VAL M 167 
AD8 7  THR M 251 ? TRP M 259 ? THR M 251 TRP M 259 
AD8 8  MET M 193 ? VAL M 204 ? MET M 193 VAL M 204 
AD8 9  ILE M 245 ? PRO M 246 ? ILE M 245 PRO M 246 
AD9 1  VAL M 110 ? TRP M 115 ? VAL M 110 TRP M 115 
AD9 2  ILE M 7   ? ILE M 15  ? ILE M 7   ILE M 15  
AD9 3  PRO M 117 ? ASP M 125 ? PRO M 117 ASP M 125 
AD9 4  MET M 193 ? VAL M 204 ? MET M 193 VAL M 204 
AD9 5  ILE M 245 ? PRO M 246 ? ILE M 245 PRO M 246 
AE1 1  ILE M 129 ? MET M 130 ? ILE M 129 MET M 130 
AE1 2  ALA M 153 ? LEU M 154 ? ALA M 153 LEU M 154 
AE2 1  VAL N 110 ? TRP N 115 ? VAL N 110 TRP N 115 
AE2 2  ILE N 7   ? ILE N 15  ? ILE N 7   ILE N 15  
AE2 3  MET N 74  ? TRP N 82  ? MET N 74  TRP N 82  
AE2 4  PHE N 42  ? ILE N 53  ? PHE N 42  ILE N 53  
AE2 5  LEU N 290 ? GLN N 305 ? LEU N 290 GLN N 305 
AE2 6  THR N 159 ? VAL N 167 ? THR N 159 VAL N 167 
AE2 7  THR N 251 ? TRP N 259 ? THR N 251 TRP N 259 
AE2 8  MET N 193 ? VAL N 204 ? MET N 193 VAL N 204 
AE2 9  ILE N 245 ? PRO N 246 ? ILE N 245 PRO N 246 
AE3 1  VAL N 110 ? TRP N 115 ? VAL N 110 TRP N 115 
AE3 2  ILE N 7   ? ILE N 15  ? ILE N 7   ILE N 15  
AE3 3  PRO N 117 ? ASP N 125 ? PRO N 117 ASP N 125 
AE3 4  MET N 193 ? VAL N 204 ? MET N 193 VAL N 204 
AE3 5  ILE N 245 ? PRO N 246 ? ILE N 245 PRO N 246 
AE4 1  ILE N 129 ? MET N 130 ? ILE N 129 MET N 130 
AE4 2  ALA N 153 ? LEU N 154 ? ALA N 153 LEU N 154 
AE5 1  VAL O 110 ? TRP O 115 ? VAL O 110 TRP O 115 
AE5 2  ILE O 7   ? ILE O 15  ? ILE O 7   ILE O 15  
AE5 3  MET O 74  ? TRP O 82  ? MET O 74  TRP O 82  
AE5 4  PHE O 42  ? ILE O 53  ? PHE O 42  ILE O 53  
AE5 5  LEU O 290 ? GLN O 305 ? LEU O 290 GLN O 305 
AE5 6  THR O 159 ? VAL O 167 ? THR O 159 VAL O 167 
AE5 7  THR O 251 ? TRP O 259 ? THR O 251 TRP O 259 
AE5 8  MET O 193 ? VAL O 204 ? MET O 193 VAL O 204 
AE5 9  ILE O 245 ? PRO O 246 ? ILE O 245 PRO O 246 
AE6 1  VAL O 110 ? TRP O 115 ? VAL O 110 TRP O 115 
AE6 2  ILE O 7   ? ILE O 15  ? ILE O 7   ILE O 15  
AE6 3  PRO O 117 ? ASP O 125 ? PRO O 117 ASP O 125 
AE6 4  MET O 193 ? VAL O 204 ? MET O 193 VAL O 204 
AE6 5  ILE O 245 ? PRO O 246 ? ILE O 245 PRO O 246 
AE7 1  ILE O 129 ? MET O 130 ? ILE O 129 MET O 130 
AE7 2  ALA O 153 ? LEU O 154 ? ALA O 153 LEU O 154 
AE8 1  VAL P 110 ? TRP P 115 ? VAL P 110 TRP P 115 
AE8 2  ILE P 7   ? ILE P 15  ? ILE P 7   ILE P 15  
AE8 3  MET P 74  ? TRP P 82  ? MET P 74  TRP P 82  
AE8 4  PHE P 42  ? ILE P 53  ? PHE P 42  ILE P 53  
AE8 5  LEU P 290 ? GLN P 305 ? LEU P 290 GLN P 305 
AE8 6  THR P 159 ? VAL P 167 ? THR P 159 VAL P 167 
AE8 7  THR P 251 ? TRP P 259 ? THR P 251 TRP P 259 
AE8 8  MET P 193 ? VAL P 204 ? MET P 193 VAL P 204 
AE8 9  ILE P 245 ? PRO P 246 ? ILE P 245 PRO P 246 
AE9 1  VAL P 110 ? TRP P 115 ? VAL P 110 TRP P 115 
AE9 2  ILE P 7   ? ILE P 15  ? ILE P 7   ILE P 15  
AE9 3  PRO P 117 ? ASP P 125 ? PRO P 117 ASP P 125 
AE9 4  MET P 193 ? VAL P 204 ? MET P 193 VAL P 204 
AE9 5  ILE P 245 ? PRO P 246 ? ILE P 245 PRO P 246 
AF1 1  ILE P 129 ? MET P 130 ? ILE P 129 MET P 130 
AF1 2  ALA P 153 ? LEU P 154 ? ALA P 153 LEU P 154 
AF2 1  VAL Q 110 ? TRP Q 115 ? VAL Q 110 TRP Q 115 
AF2 2  ILE Q 7   ? ILE Q 15  ? ILE Q 7   ILE Q 15  
AF2 3  MET Q 74  ? TRP Q 82  ? MET Q 74  TRP Q 82  
AF2 4  PHE Q 42  ? ILE Q 53  ? PHE Q 42  ILE Q 53  
AF2 5  LEU Q 290 ? GLN Q 305 ? LEU Q 290 GLN Q 305 
AF2 6  THR Q 159 ? VAL Q 167 ? THR Q 159 VAL Q 167 
AF2 7  GLN Q 252 ? TRP Q 259 ? GLN Q 252 TRP Q 259 
AF2 8  MET Q 193 ? VAL Q 204 ? MET Q 193 VAL Q 204 
AF2 9  ILE Q 245 ? PRO Q 246 ? ILE Q 245 PRO Q 246 
AF3 1  VAL Q 110 ? TRP Q 115 ? VAL Q 110 TRP Q 115 
AF3 2  ILE Q 7   ? ILE Q 15  ? ILE Q 7   ILE Q 15  
AF3 3  PRO Q 117 ? ASP Q 125 ? PRO Q 117 ASP Q 125 
AF3 4  MET Q 193 ? VAL Q 204 ? MET Q 193 VAL Q 204 
AF3 5  ILE Q 245 ? PRO Q 246 ? ILE Q 245 PRO Q 246 
AF4 1  ILE Q 129 ? MET Q 130 ? ILE Q 129 MET Q 130 
AF4 2  ALA Q 153 ? LEU Q 154 ? ALA Q 153 LEU Q 154 
AF5 1  ILE R 245 ? PRO R 246 ? ILE R 245 PRO R 246 
AF5 2  MET R 193 ? SER R 205 ? MET R 193 SER R 205 
AF5 3  THR R 251 ? TRP R 259 ? THR R 251 TRP R 259 
AF5 4  THR R 159 ? VAL R 167 ? THR R 159 VAL R 167 
AF5 5  LEU R 290 ? GLN R 305 ? LEU R 290 GLN R 305 
AF5 6  PHE R 42  ? ILE R 53  ? PHE R 42  ILE R 53  
AF5 7  MET R 74  ? TRP R 82  ? MET R 74  TRP R 82  
AF5 8  ILE R 7   ? ILE R 15  ? ILE R 7   ILE R 15  
AF5 9  VAL R 110 ? ASP R 125 ? VAL R 110 ASP R 125 
AF5 10 MET R 193 ? SER R 205 ? MET R 193 SER R 205 
AF6 1  ILE R 129 ? MET R 130 ? ILE R 129 MET R 130 
AF6 2  ALA R 153 ? LEU R 154 ? ALA R 153 LEU R 154 
AF7 1  VAL S 110 ? TRP S 115 ? VAL T 110 TRP T 115 
AF7 2  ILE S 7   ? ILE S 15  ? ILE T 7   ILE T 15  
AF7 3  MET S 74  ? TRP S 82  ? MET T 74  TRP T 82  
AF7 4  PHE S 42  ? ILE S 53  ? PHE T 42  ILE T 53  
AF7 5  LEU S 290 ? GLN S 305 ? LEU T 290 GLN T 305 
AF7 6  THR S 159 ? VAL S 167 ? THR T 159 VAL T 167 
AF7 7  GLN S 252 ? TRP S 259 ? GLN T 252 TRP T 259 
AF7 8  MET S 193 ? VAL S 204 ? MET T 193 VAL T 204 
AF7 9  ILE S 245 ? PRO S 246 ? ILE T 245 PRO T 246 
AF8 1  VAL S 110 ? TRP S 115 ? VAL T 110 TRP T 115 
AF8 2  ILE S 7   ? ILE S 15  ? ILE T 7   ILE T 15  
AF8 3  PRO S 117 ? ASP S 125 ? PRO T 117 ASP T 125 
AF8 4  MET S 193 ? VAL S 204 ? MET T 193 VAL T 204 
AF8 5  ILE S 245 ? PRO S 246 ? ILE T 245 PRO T 246 
AF9 1  ILE S 129 ? MET S 130 ? ILE T 129 MET T 130 
AF9 2  ALA S 153 ? LEU S 154 ? ALA T 153 LEU T 154 
AG1 1  VAL T 110 ? TRP T 115 ? VAL U 110 TRP U 115 
AG1 2  ILE T 7   ? ILE T 15  ? ILE U 7   ILE U 15  
AG1 3  MET T 74  ? TRP T 82  ? MET U 74  TRP U 82  
AG1 4  PHE T 42  ? ILE T 53  ? PHE U 42  ILE U 53  
AG1 5  LEU T 290 ? GLN T 305 ? LEU U 290 GLN U 305 
AG1 6  THR T 159 ? VAL T 167 ? THR U 159 VAL U 167 
AG1 7  THR T 251 ? TRP T 259 ? THR U 251 TRP U 259 
AG1 8  MET T 193 ? VAL T 204 ? MET U 193 VAL U 204 
AG1 9  ILE T 245 ? PRO T 246 ? ILE U 245 PRO U 246 
AG2 1  VAL T 110 ? TRP T 115 ? VAL U 110 TRP U 115 
AG2 2  ILE T 7   ? ILE T 15  ? ILE U 7   ILE U 15  
AG2 3  PRO T 117 ? ASP T 125 ? PRO U 117 ASP U 125 
AG2 4  MET T 193 ? VAL T 204 ? MET U 193 VAL U 204 
AG2 5  ILE T 245 ? PRO T 246 ? ILE U 245 PRO U 246 
AG3 1  ILE T 129 ? MET T 130 ? ILE U 129 MET U 130 
AG3 2  ALA T 153 ? LEU T 154 ? ALA U 153 LEU U 154 
AG4 1  VAL U 110 ? TRP U 115 ? VAL V 110 TRP V 115 
AG4 2  ILE U 7   ? ILE U 15  ? ILE V 7   ILE V 15  
AG4 3  MET U 74  ? TRP U 82  ? MET V 74  TRP V 82  
AG4 4  PHE U 42  ? ILE U 53  ? PHE V 42  ILE V 53  
AG4 5  LEU U 290 ? GLN U 305 ? LEU V 290 GLN V 305 
AG4 6  THR U 159 ? VAL U 167 ? THR V 159 VAL V 167 
AG4 7  THR U 251 ? TRP U 259 ? THR V 251 TRP V 259 
AG4 8  MET U 193 ? VAL U 204 ? MET V 193 VAL V 204 
AG4 9  ILE U 245 ? PRO U 246 ? ILE V 245 PRO V 246 
AG5 1  VAL U 110 ? TRP U 115 ? VAL V 110 TRP V 115 
AG5 2  ILE U 7   ? ILE U 15  ? ILE V 7   ILE V 15  
AG5 3  PRO U 117 ? ASP U 125 ? PRO V 117 ASP V 125 
AG5 4  MET U 193 ? VAL U 204 ? MET V 193 VAL V 204 
AG5 5  ILE U 245 ? PRO U 246 ? ILE V 245 PRO V 246 
AG6 1  ILE U 129 ? MET U 130 ? ILE V 129 MET V 130 
AG6 2  ALA U 153 ? LEU U 154 ? ALA V 153 LEU V 154 
AG7 1  VAL V 110 ? TRP V 115 ? VAL W 110 TRP W 115 
AG7 2  ILE V 7   ? ILE V 15  ? ILE W 7   ILE W 15  
AG7 3  MET V 74  ? TRP V 82  ? MET W 74  TRP W 82  
AG7 4  PHE V 42  ? ILE V 53  ? PHE W 42  ILE W 53  
AG7 5  LEU V 290 ? GLN V 305 ? LEU W 290 GLN W 305 
AG7 6  THR V 159 ? VAL V 167 ? THR W 159 VAL W 167 
AG7 7  GLN V 252 ? TRP V 259 ? GLN W 252 TRP W 259 
AG7 8  MET V 193 ? VAL V 204 ? MET W 193 VAL W 204 
AG7 9  ILE V 245 ? PRO V 246 ? ILE W 245 PRO W 246 
AG8 1  VAL V 110 ? TRP V 115 ? VAL W 110 TRP W 115 
AG8 2  ILE V 7   ? ILE V 15  ? ILE W 7   ILE W 15  
AG8 3  PRO V 117 ? ASP V 125 ? PRO W 117 ASP W 125 
AG8 4  MET V 193 ? VAL V 204 ? MET W 193 VAL W 204 
AG8 5  ILE V 245 ? PRO V 246 ? ILE W 245 PRO W 246 
AG9 1  ILE V 129 ? MET V 130 ? ILE W 129 MET W 130 
AG9 2  ALA V 153 ? LEU V 154 ? ALA W 153 LEU W 154 
AH1 1  VAL W 110 ? TRP W 115 ? VAL Y 110 TRP Y 115 
AH1 2  ILE W 7   ? ILE W 15  ? ILE Y 7   ILE Y 15  
AH1 3  MET W 74  ? TRP W 82  ? MET Y 74  TRP Y 82  
AH1 4  PHE W 42  ? ILE W 53  ? PHE Y 42  ILE Y 53  
AH1 5  LEU W 290 ? GLN W 305 ? LEU Y 290 GLN Y 305 
AH1 6  THR W 159 ? VAL W 167 ? THR Y 159 VAL Y 167 
AH1 7  THR W 251 ? TRP W 259 ? THR Y 251 TRP Y 259 
AH1 8  MET W 193 ? VAL W 204 ? MET Y 193 VAL Y 204 
AH1 9  ILE W 245 ? PRO W 246 ? ILE Y 245 PRO Y 246 
AH2 1  VAL W 110 ? TRP W 115 ? VAL Y 110 TRP Y 115 
AH2 2  ILE W 7   ? ILE W 15  ? ILE Y 7   ILE Y 15  
AH2 3  PRO W 117 ? ASP W 125 ? PRO Y 117 ASP Y 125 
AH2 4  MET W 193 ? VAL W 204 ? MET Y 193 VAL Y 204 
AH2 5  ILE W 245 ? PRO W 246 ? ILE Y 245 PRO Y 246 
AH3 1  ILE W 129 ? MET W 130 ? ILE Y 129 MET Y 130 
AH3 2  ALA W 153 ? LEU W 154 ? ALA Y 153 LEU Y 154 
AH4 1  VAL X 110 ? TRP X 115 ? VAL Z 110 TRP Z 115 
AH4 2  ILE X 7   ? ILE X 15  ? ILE Z 7   ILE Z 15  
AH4 3  MET X 74  ? TRP X 82  ? MET Z 74  TRP Z 82  
AH4 4  PHE X 42  ? ILE X 53  ? PHE Z 42  ILE Z 53  
AH4 5  LEU X 290 ? GLN X 305 ? LEU Z 290 GLN Z 305 
AH4 6  THR X 159 ? VAL X 167 ? THR Z 159 VAL Z 167 
AH4 7  THR X 251 ? TRP X 259 ? THR Z 251 TRP Z 259 
AH4 8  MET X 193 ? VAL X 204 ? MET Z 193 VAL Z 204 
AH4 9  ILE X 245 ? PRO X 246 ? ILE Z 245 PRO Z 246 
AH5 1  VAL X 110 ? TRP X 115 ? VAL Z 110 TRP Z 115 
AH5 2  ILE X 7   ? ILE X 15  ? ILE Z 7   ILE Z 15  
AH5 3  PRO X 117 ? ASP X 125 ? PRO Z 117 ASP Z 125 
AH5 4  MET X 193 ? VAL X 204 ? MET Z 193 VAL Z 204 
AH5 5  ILE X 245 ? PRO X 246 ? ILE Z 245 PRO Z 246 
AH6 1  ILE X 129 ? MET X 130 ? ILE Z 129 MET Z 130 
AH6 2  ALA X 153 ? LEU X 154 ? ALA Z 153 LEU Z 154 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O ILE A 111 ? O ILE A 111 N LYS A 14  ? N LYS A 14  
AA1 2 3  N ALA A 9   ? N ALA A 9   O THR A 80  ? O THR A 80  
AA1 3 4  O VAL A 81  ? O VAL A 81  N LEU A 43  ? N LEU A 43  
AA1 4 5  N GLN A 47  ? N GLN A 47  O MET A 302 ? O MET A 302 
AA1 5 6  O TYR A 295 ? O TYR A 295 N ASP A 164 ? N ASP A 164 
AA1 6 7  N HIS A 165 ? N HIS A 165 O TYR A 253 ? O TYR A 253 
AA1 7 8  O LEU A 254 ? O LEU A 254 N MET A 199 ? N MET A 199 
AA1 8 9  N VAL A 204 ? N VAL A 204 O ILE A 245 ? O ILE A 245 
AA2 1 2  O ILE A 111 ? O ILE A 111 N LYS A 14  ? N LYS A 14  
AA2 2 3  N ILE A 8   ? N ILE A 8   O PHE A 119 ? O PHE A 119 
AA2 3 4  N TYR A 118 ? N TYR A 118 O GLY A 203 ? O GLY A 203 
AA2 4 5  N VAL A 204 ? N VAL A 204 O ILE A 245 ? O ILE A 245 
AA3 1 2  N MET A 130 ? N MET A 130 O ALA A 153 ? O ALA A 153 
AA4 1 2  O ILE B 111 ? O ILE B 111 N LYS B 14  ? N LYS B 14  
AA4 2 3  N ASN B 11  ? N ASN B 11  O GLN B 78  ? O GLN B 78  
AA4 3 4  O PHE B 77  ? O PHE B 77  N LEU B 48  ? N LEU B 48  
AA4 4 5  N THR B 51  ? N THR B 51  O PHE B 298 ? O PHE B 298 
AA4 5 6  O PHE B 299 ? O PHE B 299 N VAL B 160 ? N VAL B 160 
AA4 6 7  N HIS B 165 ? N HIS B 165 O TYR B 253 ? O TYR B 253 
AA4 7 8  O GLU B 258 ? O GLU B 258 N GLY B 195 ? N GLY B 195 
AA4 8 9  N VAL B 204 ? N VAL B 204 O ILE B 245 ? O ILE B 245 
AA5 1 2  O ILE B 111 ? O ILE B 111 N LYS B 14  ? N LYS B 14  
AA5 2 3  N ILE B 8   ? N ILE B 8   O PHE B 119 ? O PHE B 119 
AA5 3 4  N TYR B 118 ? N TYR B 118 O GLY B 203 ? O GLY B 203 
AA5 4 5  N VAL B 204 ? N VAL B 204 O ILE B 245 ? O ILE B 245 
AA6 1 2  N MET B 130 ? N MET B 130 O ALA B 153 ? O ALA B 153 
AA7 1 2  O ILE C 111 ? O ILE C 111 N LYS C 14  ? N LYS C 14  
AA7 2 3  N ALA C 9   ? N ALA C 9   O THR C 80  ? O THR C 80  
AA7 3 4  O PHE C 77  ? O PHE C 77  N LEU C 48  ? N LEU C 48  
AA7 4 5  N LEU C 49  ? N LEU C 49  O SER C 300 ? O SER C 300 
AA7 5 6  O TYR C 295 ? O TYR C 295 N ASP C 164 ? N ASP C 164 
AA7 6 7  N THR C 159 ? N THR C 159 O TRP C 259 ? O TRP C 259 
AA7 7 8  O GLU C 258 ? O GLU C 258 N GLY C 195 ? N GLY C 195 
AA7 8 9  N VAL C 204 ? N VAL C 204 O ILE C 245 ? O ILE C 245 
AA8 1 2  O ILE C 111 ? O ILE C 111 N LYS C 14  ? N LYS C 14  
AA8 2 3  N ILE C 8   ? N ILE C 8   O PHE C 119 ? O PHE C 119 
AA8 3 4  N LYS C 123 ? N LYS C 123 O ILE C 198 ? O ILE C 198 
AA8 4 5  N VAL C 204 ? N VAL C 204 O ILE C 245 ? O ILE C 245 
AA9 1 2  N MET C 130 ? N MET C 130 O ALA C 153 ? O ALA C 153 
AB1 1 2  O ILE D 111 ? O ILE D 111 N LYS D 14  ? N LYS D 14  
AB1 2 3  N ALA D 13  ? N ALA D 13  O MET D 76  ? O MET D 76  
AB1 3 4  O PHE D 77  ? O PHE D 77  N LEU D 48  ? N LEU D 48  
AB1 4 5  N LEU D 49  ? N LEU D 49  O SER D 300 ? O SER D 300 
AB1 5 6  O PHE D 299 ? O PHE D 299 N VAL D 160 ? N VAL D 160 
AB1 6 7  N VAL D 161 ? N VAL D 161 O ILE D 257 ? O ILE D 257 
AB1 7 8  O HIS D 256 ? O HIS D 256 N MET D 197 ? N MET D 197 
AB1 8 9  N VAL D 204 ? N VAL D 204 O ILE D 245 ? O ILE D 245 
AB2 1 2  O ILE D 111 ? O ILE D 111 N LYS D 14  ? N LYS D 14  
AB2 2 3  N ILE D 8   ? N ILE D 8   O PHE D 119 ? O PHE D 119 
AB2 3 4  N TYR D 118 ? N TYR D 118 O GLY D 203 ? O GLY D 203 
AB2 4 5  N VAL D 204 ? N VAL D 204 O ILE D 245 ? O ILE D 245 
AB3 1 2  N MET D 130 ? N MET D 130 O ALA D 153 ? O ALA D 153 
AB4 1 2  O ILE E 111 ? O ILE E 111 N LYS E 14  ? N LYS E 14  
AB4 2 3  N ILE E 7   ? N ILE E 7   O TRP E 82  ? O TRP E 82  
AB4 3 4  O VAL E 81  ? O VAL E 81  N LEU E 43  ? N LEU E 43  
AB4 4 5  N THR E 51  ? N THR E 51  O PHE E 298 ? O PHE E 298 
AB4 5 6  O TYR E 295 ? O TYR E 295 N ASP E 164 ? N ASP E 164 
AB4 6 7  N VAL E 161 ? N VAL E 161 O ILE E 257 ? O ILE E 257 
AB4 7 8  O GLU E 258 ? O GLU E 258 N GLY E 195 ? N GLY E 195 
AB4 8 9  N VAL E 204 ? N VAL E 204 O ILE E 245 ? O ILE E 245 
AB5 1 2  O ILE E 111 ? O ILE E 111 N LYS E 14  ? N LYS E 14  
AB5 2 3  N ILE E 8   ? N ILE E 8   O PHE E 119 ? O PHE E 119 
AB5 3 4  N TYR E 118 ? N TYR E 118 O GLY E 203 ? O GLY E 203 
AB5 4 5  N VAL E 204 ? N VAL E 204 O ILE E 245 ? O ILE E 245 
AB6 1 2  N MET E 130 ? N MET E 130 O ALA E 153 ? O ALA E 153 
AB7 1 2  O ILE F 245 ? O ILE F 245 N VAL F 204 ? N VAL F 204 
AB7 2 3  N GLY F 195 ? N GLY F 195 O GLU F 258 ? O GLU F 258 
AB7 3 4  O TYR F 253 ? O TYR F 253 N HIS F 165 ? N HIS F 165 
AB7 4 5  N TRP F 166 ? N TRP F 166 O ASP F 291 ? O ASP F 291 
AB7 5 6  O PHE F 298 ? O PHE F 298 N GLY F 52  ? N GLY F 52  
AB7 6 7  N LEU F 43  ? N LEU F 43  O VAL F 81  ? O VAL F 81  
AB7 7 8  O GLN F 78  ? O GLN F 78  N ASN F 11  ? N ASN F 11  
AB7 8 9  N LYS F 14  ? N LYS F 14  O ILE F 111 ? O ILE F 111 
AB7 9 10 N TYR F 118 ? N TYR F 118 O GLY F 203 ? O GLY F 203 
AB8 1 2  N MET F 130 ? N MET F 130 O ALA F 153 ? O ALA F 153 
AB9 1 2  O ILE G 111 ? O ILE G 111 N LYS G 14  ? N LYS G 14  
AB9 2 3  N ILE G 15  ? N ILE G 15  O MET G 74  ? O MET G 74  
AB9 3 4  O VAL G 81  ? O VAL G 81  N LEU G 43  ? N LEU G 43  
AB9 4 5  N LEU G 49  ? N LEU G 49  O SER G 300 ? O SER G 300 
AB9 5 6  O TYR G 295 ? O TYR G 295 N ASP G 164 ? N ASP G 164 
AB9 6 7  N VAL G 161 ? N VAL G 161 O ILE G 257 ? O ILE G 257 
AB9 7 8  O HIS G 256 ? O HIS G 256 N MET G 197 ? N MET G 197 
AB9 8 9  N VAL G 204 ? N VAL G 204 O ILE G 245 ? O ILE G 245 
AC1 1 2  O ILE G 111 ? O ILE G 111 N LYS G 14  ? N LYS G 14  
AC1 2 3  N ILE G 8   ? N ILE G 8   O PHE G 119 ? O PHE G 119 
AC1 3 4  N GLU G 120 ? N GLU G 120 O LYS G 200 ? O LYS G 200 
AC1 4 5  N VAL G 204 ? N VAL G 204 O ILE G 245 ? O ILE G 245 
AC2 1 2  N MET G 130 ? N MET G 130 O ALA G 153 ? O ALA G 153 
AC3 1 2  O ILE H 111 ? O ILE H 111 N LYS H 14  ? N LYS H 14  
AC3 2 3  N ASN H 11  ? N ASN H 11  O GLN H 78  ? O GLN H 78  
AC3 3 4  O VAL H 81  ? O VAL H 81  N LEU H 43  ? N LEU H 43  
AC3 4 5  N LEU H 49  ? N LEU H 49  O SER H 300 ? O SER H 300 
AC3 5 6  O TYR H 295 ? O TYR H 295 N ASP H 164 ? N ASP H 164 
AC3 6 7  N VAL H 161 ? N VAL H 161 O ILE H 257 ? O ILE H 257 
AC3 7 8  O HIS H 256 ? O HIS H 256 N MET H 197 ? N MET H 197 
AC3 8 9  N VAL H 204 ? N VAL H 204 O ILE H 245 ? O ILE H 245 
AC4 1 2  O ILE H 111 ? O ILE H 111 N LYS H 14  ? N LYS H 14  
AC4 2 3  N ILE H 8   ? N ILE H 8   O PHE H 119 ? O PHE H 119 
AC4 3 4  N TYR H 118 ? N TYR H 118 O GLY H 203 ? O GLY H 203 
AC4 4 5  N VAL H 204 ? N VAL H 204 O ILE H 245 ? O ILE H 245 
AC5 1 2  N MET H 130 ? N MET H 130 O ALA H 153 ? O ALA H 153 
AC6 1 2  O ILE I 245 ? O ILE I 245 N VAL I 204 ? N VAL I 204 
AC6 2 3  N MET I 197 ? N MET I 197 O HIS I 256 ? O HIS I 256 
AC6 3 4  O ILE I 257 ? O ILE I 257 N VAL I 161 ? N VAL I 161 
AC6 4 5  N TRP I 166 ? N TRP I 166 O ASP I 291 ? O ASP I 291 
AC6 5 6  O MET I 303 ? O MET I 303 N GLN I 47  ? N GLN I 47  
AC6 6 7  N LEU I 48  ? N LEU I 48  O PHE I 77  ? O PHE I 77  
AC6 7 8  O THR I 80  ? O THR I 80  N ALA I 9   ? N ALA I 9   
AC6 8 9  N LYS I 14  ? N LYS I 14  O ILE I 111 ? O ILE I 111 
AC6 9 10 N TYR I 118 ? N TYR I 118 O GLY I 203 ? O GLY I 203 
AC7 1 2  N MET I 130 ? N MET I 130 O ALA I 153 ? O ALA I 153 
AC8 1 2  O ILE J 111 ? O ILE J 111 N LYS J 14  ? N LYS J 14  
AC8 2 3  N ILE J 7   ? N ILE J 7   O TRP J 82  ? O TRP J 82  
AC8 3 4  O PHE J 77  ? O PHE J 77  N LEU J 48  ? N LEU J 48  
AC8 4 5  N GLY J 52  ? N GLY J 52  O PHE J 298 ? O PHE J 298 
AC8 5 6  O PHE J 299 ? O PHE J 299 N VAL J 160 ? N VAL J 160 
AC8 6 7  N VAL J 161 ? N VAL J 161 O ILE J 257 ? O ILE J 257 
AC8 7 8  O GLU J 258 ? O GLU J 258 N GLY J 195 ? N GLY J 195 
AC8 8 9  N VAL J 204 ? N VAL J 204 O ILE J 245 ? O ILE J 245 
AC9 1 2  O ILE J 111 ? O ILE J 111 N LYS J 14  ? N LYS J 14  
AC9 2 3  N ILE J 8   ? N ILE J 8   O PHE J 119 ? O PHE J 119 
AC9 3 4  N TYR J 118 ? N TYR J 118 O GLY J 203 ? O GLY J 203 
AC9 4 5  N VAL J 204 ? N VAL J 204 O ILE J 245 ? O ILE J 245 
AD1 1 2  N MET J 130 ? N MET J 130 O ALA J 153 ? O ALA J 153 
AD2 1 2  O ILE K 111 ? O ILE K 111 N LYS K 14  ? N LYS K 14  
AD2 2 3  N ALA K 9   ? N ALA K 9   O THR K 80  ? O THR K 80  
AD2 3 4  O VAL K 81  ? O VAL K 81  N LEU K 43  ? N LEU K 43  
AD2 4 5  N GLN K 47  ? N GLN K 47  O MET K 303 ? O MET K 303 
AD2 5 6  O TYR K 295 ? O TYR K 295 N ASP K 164 ? N ASP K 164 
AD2 6 7  N VAL K 161 ? N VAL K 161 O ILE K 257 ? O ILE K 257 
AD2 7 8  O GLU K 258 ? O GLU K 258 N GLY K 195 ? N GLY K 195 
AD2 8 9  N VAL K 204 ? N VAL K 204 O ILE K 245 ? O ILE K 245 
AD3 1 2  O ILE K 111 ? O ILE K 111 N LYS K 14  ? N LYS K 14  
AD3 2 3  N ILE K 8   ? N ILE K 8   O PHE K 119 ? O PHE K 119 
AD3 3 4  N TYR K 118 ? N TYR K 118 O GLY K 203 ? O GLY K 203 
AD3 4 5  N VAL K 204 ? N VAL K 204 O ILE K 245 ? O ILE K 245 
AD4 1 2  N MET K 130 ? N MET K 130 O ALA K 153 ? O ALA K 153 
AD5 1 2  O ILE L 111 ? O ILE L 111 N LYS L 14  ? N LYS L 14  
AD5 2 3  N ASN L 11  ? N ASN L 11  O GLN L 78  ? O GLN L 78  
AD5 3 4  O VAL L 81  ? O VAL L 81  N LEU L 43  ? N LEU L 43  
AD5 4 5  N THR L 51  ? N THR L 51  O PHE L 298 ? O PHE L 298 
AD5 5 6  O PHE L 299 ? O PHE L 299 N VAL L 160 ? N VAL L 160 
AD5 6 7  N HIS L 165 ? N HIS L 165 O TYR L 253 ? O TYR L 253 
AD5 7 8  O HIS L 256 ? O HIS L 256 N MET L 197 ? N MET L 197 
AD5 8 9  N VAL L 204 ? N VAL L 204 O ILE L 245 ? O ILE L 245 
AD6 1 2  O ILE L 111 ? O ILE L 111 N LYS L 14  ? N LYS L 14  
AD6 2 3  N ILE L 8   ? N ILE L 8   O PHE L 119 ? O PHE L 119 
AD6 3 4  N TYR L 118 ? N TYR L 118 O GLY L 203 ? O GLY L 203 
AD6 4 5  N VAL L 204 ? N VAL L 204 O ILE L 245 ? O ILE L 245 
AD7 1 2  N MET L 130 ? N MET L 130 O ALA L 153 ? O ALA L 153 
AD8 1 2  O ILE M 111 ? O ILE M 111 N LYS M 14  ? N LYS M 14  
AD8 2 3  N ILE M 15  ? N ILE M 15  O MET M 74  ? O MET M 74  
AD8 3 4  O PHE M 77  ? O PHE M 77  N LEU M 48  ? N LEU M 48  
AD8 4 5  N GLN M 47  ? N GLN M 47  O MET M 303 ? O MET M 303 
AD8 5 6  O TYR M 295 ? O TYR M 295 N ASP M 164 ? N ASP M 164 
AD8 6 7  N VAL M 161 ? N VAL M 161 O ILE M 257 ? O ILE M 257 
AD8 7 8  O GLN M 252 ? O GLN M 252 N GLN M 201 ? N GLN M 201 
AD8 8 9  N VAL M 204 ? N VAL M 204 O ILE M 245 ? O ILE M 245 
AD9 1 2  O ILE M 111 ? O ILE M 111 N LYS M 14  ? N LYS M 14  
AD9 2 3  N ILE M 8   ? N ILE M 8   O PHE M 119 ? O PHE M 119 
AD9 3 4  N TYR M 118 ? N TYR M 118 O GLY M 203 ? O GLY M 203 
AD9 4 5  N VAL M 204 ? N VAL M 204 O ILE M 245 ? O ILE M 245 
AE1 1 2  N MET M 130 ? N MET M 130 O ALA M 153 ? O ALA M 153 
AE2 1 2  O ILE N 111 ? O ILE N 111 N LYS N 14  ? N LYS N 14  
AE2 2 3  N ILE N 7   ? N ILE N 7   O TRP N 82  ? O TRP N 82  
AE2 3 4  O VAL N 81  ? O VAL N 81  N LEU N 43  ? N LEU N 43  
AE2 4 5  N GLN N 47  ? N GLN N 47  O MET N 303 ? O MET N 303 
AE2 5 6  O PHE N 299 ? O PHE N 299 N VAL N 160 ? N VAL N 160 
AE2 6 7  N HIS N 165 ? N HIS N 165 O TYR N 253 ? O TYR N 253 
AE2 7 8  O GLU N 258 ? O GLU N 258 N GLY N 195 ? N GLY N 195 
AE2 8 9  N VAL N 204 ? N VAL N 204 O ILE N 245 ? O ILE N 245 
AE3 1 2  O ILE N 111 ? O ILE N 111 N LYS N 14  ? N LYS N 14  
AE3 2 3  N ILE N 8   ? N ILE N 8   O PHE N 119 ? O PHE N 119 
AE3 3 4  N TYR N 118 ? N TYR N 118 O GLY N 203 ? O GLY N 203 
AE3 4 5  N VAL N 204 ? N VAL N 204 O ILE N 245 ? O ILE N 245 
AE4 1 2  N MET N 130 ? N MET N 130 O ALA N 153 ? O ALA N 153 
AE5 1 2  O ILE O 111 ? O ILE O 111 N LYS O 14  ? N LYS O 14  
AE5 2 3  N ILE O 15  ? N ILE O 15  O MET O 74  ? O MET O 74  
AE5 3 4  O VAL O 81  ? O VAL O 81  N LEU O 43  ? N LEU O 43  
AE5 4 5  N THR O 51  ? N THR O 51  O PHE O 298 ? O PHE O 298 
AE5 5 6  O TYR O 295 ? O TYR O 295 N ASP O 164 ? N ASP O 164 
AE5 6 7  N HIS O 165 ? N HIS O 165 O TYR O 253 ? O TYR O 253 
AE5 7 8  O GLU O 258 ? O GLU O 258 N GLY O 195 ? N GLY O 195 
AE5 8 9  N VAL O 204 ? N VAL O 204 O ILE O 245 ? O ILE O 245 
AE6 1 2  O ILE O 111 ? O ILE O 111 N LYS O 14  ? N LYS O 14  
AE6 2 3  N ILE O 8   ? N ILE O 8   O PHE O 119 ? O PHE O 119 
AE6 3 4  N TYR O 118 ? N TYR O 118 O GLY O 203 ? O GLY O 203 
AE6 4 5  N VAL O 204 ? N VAL O 204 O ILE O 245 ? O ILE O 245 
AE7 1 2  N MET O 130 ? N MET O 130 O ALA O 153 ? O ALA O 153 
AE8 1 2  O ILE P 111 ? O ILE P 111 N LYS P 14  ? N LYS P 14  
AE8 2 3  N ALA P 9   ? N ALA P 9   O THR P 80  ? O THR P 80  
AE8 3 4  O PHE P 77  ? O PHE P 77  N LEU P 48  ? N LEU P 48  
AE8 4 5  N GLN P 47  ? N GLN P 47  O MET P 303 ? O MET P 303 
AE8 5 6  O ASP P 291 ? O ASP P 291 N TRP P 166 ? N TRP P 166 
AE8 6 7  N HIS P 165 ? N HIS P 165 O TYR P 253 ? O TYR P 253 
AE8 7 8  O GLU P 258 ? O GLU P 258 N GLY P 195 ? N GLY P 195 
AE8 8 9  N VAL P 204 ? N VAL P 204 O ILE P 245 ? O ILE P 245 
AE9 1 2  O ILE P 111 ? O ILE P 111 N LYS P 14  ? N LYS P 14  
AE9 2 3  N ILE P 8   ? N ILE P 8   O PHE P 119 ? O PHE P 119 
AE9 3 4  N TYR P 118 ? N TYR P 118 O GLY P 203 ? O GLY P 203 
AE9 4 5  N VAL P 204 ? N VAL P 204 O ILE P 245 ? O ILE P 245 
AF1 1 2  N MET P 130 ? N MET P 130 O ALA P 153 ? O ALA P 153 
AF2 1 2  O ILE Q 111 ? O ILE Q 111 N LYS Q 14  ? N LYS Q 14  
AF2 2 3  N ALA Q 13  ? N ALA Q 13  O MET Q 76  ? O MET Q 76  
AF2 3 4  O VAL Q 81  ? O VAL Q 81  N LEU Q 43  ? N LEU Q 43  
AF2 4 5  N LEU Q 49  ? N LEU Q 49  O SER Q 300 ? O SER Q 300 
AF2 5 6  O TYR Q 295 ? O TYR Q 295 N ASP Q 164 ? N ASP Q 164 
AF2 6 7  N VAL Q 161 ? N VAL Q 161 O ILE Q 257 ? O ILE Q 257 
AF2 7 8  O GLU Q 258 ? O GLU Q 258 N GLY Q 195 ? N GLY Q 195 
AF2 8 9  N VAL Q 204 ? N VAL Q 204 O ILE Q 245 ? O ILE Q 245 
AF3 1 2  O ILE Q 111 ? O ILE Q 111 N LYS Q 14  ? N LYS Q 14  
AF3 2 3  N ILE Q 8   ? N ILE Q 8   O PHE Q 119 ? O PHE Q 119 
AF3 3 4  N TYR Q 118 ? N TYR Q 118 O GLY Q 203 ? O GLY Q 203 
AF3 4 5  N VAL Q 204 ? N VAL Q 204 O ILE Q 245 ? O ILE Q 245 
AF4 1 2  N MET Q 130 ? N MET Q 130 O ALA Q 153 ? O ALA Q 153 
AF5 1 2  O ILE R 245 ? O ILE R 245 N VAL R 204 ? N VAL R 204 
AF5 2 3  N GLY R 195 ? N GLY R 195 O GLU R 258 ? O GLU R 258 
AF5 3 4  O ILE R 257 ? O ILE R 257 N VAL R 161 ? N VAL R 161 
AF5 4 5  N TRP R 166 ? N TRP R 166 O ASP R 291 ? O ASP R 291 
AF5 5 6  O SER R 300 ? O SER R 300 N LEU R 49  ? N LEU R 49  
AF5 6 7  N LEU R 43  ? N LEU R 43  O VAL R 81  ? O VAL R 81  
AF5 7 8  O THR R 80  ? O THR R 80  N ALA R 9   ? N ALA R 9   
AF5 8 9  N LYS R 14  ? N LYS R 14  O ILE R 111 ? O ILE R 111 
AF5 9 10 N TYR R 118 ? N TYR R 118 O GLY R 203 ? O GLY R 203 
AF6 1 2  N MET R 130 ? N MET R 130 O ALA R 153 ? O ALA R 153 
AF7 1 2  O ILE S 111 ? O ILE T 111 N LYS S 14  ? N LYS T 14  
AF7 2 3  N ILE S 7   ? N ILE T 7   O TRP S 82  ? O TRP T 82  
AF7 3 4  O VAL S 81  ? O VAL T 81  N LEU S 43  ? N LEU T 43  
AF7 4 5  N GLN S 47  ? N GLN T 47  O MET S 303 ? O MET T 303 
AF7 5 6  O TYR S 295 ? O TYR T 295 N ASP S 164 ? N ASP T 164 
AF7 6 7  N VAL S 161 ? N VAL T 161 O ILE S 257 ? O ILE T 257 
AF7 7 8  O HIS S 256 ? O HIS T 256 N MET S 197 ? N MET T 197 
AF7 8 9  N VAL S 204 ? N VAL T 204 O ILE S 245 ? O ILE T 245 
AF8 1 2  O ILE S 111 ? O ILE T 111 N LYS S 14  ? N LYS T 14  
AF8 2 3  N ILE S 8   ? N ILE T 8   O PHE S 119 ? O PHE T 119 
AF8 3 4  N ASP S 125 ? N ASP T 125 O TRP S 196 ? O TRP T 196 
AF8 4 5  N VAL S 204 ? N VAL T 204 O ILE S 245 ? O ILE T 245 
AF9 1 2  N MET S 130 ? N MET T 130 O ALA S 153 ? O ALA T 153 
AG1 1 2  O ILE T 111 ? O ILE U 111 N LYS T 14  ? N LYS U 14  
AG1 2 3  N ILE T 7   ? N ILE U 7   O TRP T 82  ? O TRP U 82  
AG1 3 4  O PHE T 77  ? O PHE U 77  N LEU T 48  ? N LEU U 48  
AG1 4 5  N GLN T 47  ? N GLN U 47  O MET T 303 ? O MET U 303 
AG1 5 6  O TYR T 295 ? O TYR U 295 N ASP T 164 ? N ASP U 164 
AG1 6 7  N VAL T 161 ? N VAL U 161 O ILE T 257 ? O ILE U 257 
AG1 7 8  O GLU T 258 ? O GLU U 258 N GLY T 195 ? N GLY U 195 
AG1 8 9  N VAL T 204 ? N VAL U 204 O ILE T 245 ? O ILE U 245 
AG2 1 2  O ILE T 111 ? O ILE U 111 N LYS T 14  ? N LYS U 14  
AG2 2 3  N ILE T 8   ? N ILE U 8   O PHE T 119 ? O PHE U 119 
AG2 3 4  N TYR T 118 ? N TYR U 118 O GLY T 203 ? O GLY U 203 
AG2 4 5  N VAL T 204 ? N VAL U 204 O ILE T 245 ? O ILE U 245 
AG3 1 2  N MET T 130 ? N MET U 130 O ALA T 153 ? O ALA U 153 
AG4 1 2  O ILE U 111 ? O ILE V 111 N LYS U 14  ? N LYS V 14  
AG4 2 3  N ASN U 11  ? N ASN V 11  O GLN U 78  ? O GLN V 78  
AG4 3 4  O VAL U 81  ? O VAL V 81  N LEU U 43  ? N LEU V 43  
AG4 4 5  N GLY U 52  ? N GLY V 52  O PHE U 298 ? O PHE V 298 
AG4 5 6  O TYR U 295 ? O TYR V 295 N ASP U 164 ? N ASP V 164 
AG4 6 7  N VAL U 161 ? N VAL V 161 O ILE U 257 ? O ILE V 257 
AG4 7 8  O HIS U 256 ? O HIS V 256 N MET U 197 ? N MET V 197 
AG4 8 9  N VAL U 204 ? N VAL V 204 O ILE U 245 ? O ILE V 245 
AG5 1 2  O ILE U 111 ? O ILE V 111 N LYS U 14  ? N LYS V 14  
AG5 2 3  N ILE U 8   ? N ILE V 8   O PHE U 119 ? O PHE V 119 
AG5 3 4  N TYR U 118 ? N TYR V 118 O GLY U 203 ? O GLY V 203 
AG5 4 5  N VAL U 204 ? N VAL V 204 O ILE U 245 ? O ILE V 245 
AG6 1 2  N MET U 130 ? N MET V 130 O ALA U 153 ? O ALA V 153 
AG7 1 2  O ILE V 111 ? O ILE W 111 N LYS V 14  ? N LYS W 14  
AG7 2 3  N ASN V 11  ? N ASN W 11  O GLN V 78  ? O GLN W 78  
AG7 3 4  O PHE V 77  ? O PHE W 77  N LEU V 48  ? N LEU W 48  
AG7 4 5  N THR V 51  ? N THR W 51  O PHE V 298 ? O PHE W 298 
AG7 5 6  O ASP V 291 ? O ASP W 291 N TRP V 166 ? N TRP W 166 
AG7 6 7  N VAL V 161 ? N VAL W 161 O ILE V 257 ? O ILE W 257 
AG7 7 8  O LEU V 254 ? O LEU W 254 N MET V 199 ? N MET W 199 
AG7 8 9  N VAL V 204 ? N VAL W 204 O ILE V 245 ? O ILE W 245 
AG8 1 2  O ILE V 111 ? O ILE W 111 N LYS V 14  ? N LYS W 14  
AG8 2 3  N ILE V 8   ? N ILE W 8   O PHE V 119 ? O PHE W 119 
AG8 3 4  N TYR V 118 ? N TYR W 118 O GLY V 203 ? O GLY W 203 
AG8 4 5  N VAL V 204 ? N VAL W 204 O ILE V 245 ? O ILE W 245 
AG9 1 2  N MET V 130 ? N MET W 130 O ALA V 153 ? O ALA W 153 
AH1 1 2  O ILE W 111 ? O ILE Y 111 N LYS W 14  ? N LYS Y 14  
AH1 2 3  N ILE W 7   ? N ILE Y 7   O TRP W 82  ? O TRP Y 82  
AH1 3 4  O VAL W 81  ? O VAL Y 81  N LEU W 43  ? N LEU Y 43  
AH1 4 5  N LEU W 49  ? N LEU Y 49  O SER W 300 ? O SER Y 300 
AH1 5 6  O ASP W 291 ? O ASP Y 291 N TRP W 166 ? N TRP Y 166 
AH1 6 7  N GLY W 163 ? N GLY Y 163 O VAL W 255 ? O VAL Y 255 
AH1 7 8  O GLU W 258 ? O GLU Y 258 N GLY W 195 ? N GLY Y 195 
AH1 8 9  N VAL W 204 ? N VAL Y 204 O ILE W 245 ? O ILE Y 245 
AH2 1 2  O ILE W 111 ? O ILE Y 111 N LYS W 14  ? N LYS Y 14  
AH2 2 3  N ILE W 8   ? N ILE Y 8   O PHE W 119 ? O PHE Y 119 
AH2 3 4  N TYR W 118 ? N TYR Y 118 O GLY W 203 ? O GLY Y 203 
AH2 4 5  N VAL W 204 ? N VAL Y 204 O ILE W 245 ? O ILE Y 245 
AH3 1 2  N MET W 130 ? N MET Y 130 O ALA W 153 ? O ALA Y 153 
AH4 1 2  O ILE X 111 ? O ILE Z 111 N LYS X 14  ? N LYS Z 14  
AH4 2 3  N ILE X 7   ? N ILE Z 7   O TRP X 82  ? O TRP Z 82  
AH4 3 4  O VAL X 81  ? O VAL Z 81  N LEU X 43  ? N LEU Z 43  
AH4 4 5  N LEU X 49  ? N LEU Z 49  O SER X 300 ? O SER Z 300 
AH4 5 6  O ASP X 291 ? O ASP Z 291 N TRP X 166 ? N TRP Z 166 
AH4 6 7  N THR X 159 ? N THR Z 159 O TRP X 259 ? O TRP Z 259 
AH4 7 8  O LEU X 254 ? O LEU Z 254 N MET X 199 ? N MET Z 199 
AH4 8 9  N VAL X 204 ? N VAL Z 204 O ILE X 245 ? O ILE Z 245 
AH5 1 2  O ILE X 111 ? O ILE Z 111 N LYS X 14  ? N LYS Z 14  
AH5 2 3  N ILE X 8   ? N ILE Z 8   O PHE X 119 ? O PHE Z 119 
AH5 3 4  N TYR X 118 ? N TYR Z 118 O GLY X 203 ? O GLY Z 203 
AH5 4 5  N VAL X 204 ? N VAL Z 204 O ILE X 245 ? O ILE Z 245 
AH6 1 2  N MET X 130 ? N MET Z 130 O ALA X 153 ? O ALA Z 153 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A FE  401 ? 5 'binding site for residue FE A 401'  
AC2 Software A SO4 402 ? 3 'binding site for residue SO4 A 402' 
AC3 Software A SO4 403 ? 5 'binding site for residue SO4 A 403' 
AC4 Software A SO4 404 ? 6 'binding site for residue SO4 A 404' 
AC5 Software B FE  401 ? 5 'binding site for residue FE B 401'  
AC6 Software B SO4 402 ? 5 'binding site for residue SO4 B 402' 
AC7 Software B SO4 403 ? 6 'binding site for residue SO4 B 403' 
AC8 Software C FE  401 ? 4 'binding site for residue FE C 401'  
AC9 Software C SO4 402 ? 3 'binding site for residue SO4 C 402' 
AD1 Software C SO4 403 ? 7 'binding site for residue SO4 C 403' 
AD2 Software C SO4 404 ? 6 'binding site for residue SO4 C 404' 
AD3 Software D FE  401 ? 4 'binding site for residue FE D 401'  
AD4 Software D SO4 402 ? 3 'binding site for residue SO4 D 402' 
AD5 Software D SO4 403 ? 5 'binding site for residue SO4 D 403' 
AD6 Software E FE  401 ? 4 'binding site for residue FE E 401'  
AD7 Software E SO4 402 ? 3 'binding site for residue SO4 E 402' 
AD8 Software E SO4 403 ? 8 'binding site for residue SO4 E 403' 
AD9 Software F FE  401 ? 5 'binding site for residue FE F 401'  
AE1 Software F SO4 402 ? 3 'binding site for residue SO4 F 402' 
AE2 Software F SO4 403 ? 7 'binding site for residue SO4 F 403' 
AE3 Software F SO4 404 ? 5 'binding site for residue SO4 F 404' 
AE4 Software G FE  401 ? 5 'binding site for residue FE G 401'  
AE5 Software G SO4 402 ? 3 'binding site for residue SO4 G 402' 
AE6 Software G SO4 403 ? 5 'binding site for residue SO4 G 403' 
AE7 Software H FE  401 ? 4 'binding site for residue FE H 401'  
AE8 Software H SO4 402 ? 3 'binding site for residue SO4 H 402' 
AE9 Software H SO4 403 ? 6 'binding site for residue SO4 H 403' 
AF1 Software I FE  401 ? 5 'binding site for residue FE I 401'  
AF2 Software I SO4 402 ? 4 'binding site for residue SO4 I 402' 
AF3 Software I SO4 403 ? 6 'binding site for residue SO4 I 403' 
AF4 Software J FE  401 ? 5 'binding site for residue FE J 401'  
AF5 Software J SO4 402 ? 3 'binding site for residue SO4 J 402' 
AF6 Software J SO4 403 ? 7 'binding site for residue SO4 J 403' 
AF7 Software K FE  401 ? 5 'binding site for residue FE K 401'  
AF8 Software K SO4 402 ? 3 'binding site for residue SO4 K 402' 
AF9 Software K SO4 403 ? 6 'binding site for residue SO4 K 403' 
AG1 Software L FE  401 ? 4 'binding site for residue FE L 401'  
AG2 Software L SO4 402 ? 3 'binding site for residue SO4 L 402' 
AG3 Software L SO4 403 ? 7 'binding site for residue SO4 L 403' 
AG4 Software M FE  401 ? 5 'binding site for residue FE M 401'  
AG5 Software M SO4 402 ? 4 'binding site for residue SO4 M 402' 
AG6 Software M SO4 403 ? 5 'binding site for residue SO4 M 403' 
AG7 Software N FE  401 ? 5 'binding site for residue FE N 401'  
AG8 Software N SO4 402 ? 3 'binding site for residue SO4 N 402' 
AG9 Software N SO4 403 ? 5 'binding site for residue SO4 N 403' 
AH1 Software O FE  401 ? 4 'binding site for residue FE O 401'  
AH2 Software O SO4 402 ? 3 'binding site for residue SO4 O 402' 
AH3 Software O SO4 403 ? 8 'binding site for residue SO4 O 403' 
AH4 Software P FE  401 ? 5 'binding site for residue FE P 401'  
AH5 Software P SO4 402 ? 4 'binding site for residue SO4 P 402' 
AH6 Software P SO4 403 ? 6 'binding site for residue SO4 P 403' 
AH7 Software Q FE  401 ? 5 'binding site for residue FE Q 401'  
AH8 Software Q SO4 402 ? 3 'binding site for residue SO4 Q 402' 
AH9 Software Q SO4 403 ? 5 'binding site for residue SO4 Q 403' 
AI1 Software R FE  401 ? 5 'binding site for residue FE R 401'  
AI2 Software R SO4 402 ? 5 'binding site for residue SO4 R 402' 
AI3 Software T FE  401 ? 4 'binding site for residue FE T 401'  
AI4 Software T SO4 402 ? 4 'binding site for residue SO4 T 402' 
AI5 Software U FE  401 ? 5 'binding site for residue FE U 401'  
AI6 Software U SO4 402 ? 3 'binding site for residue SO4 U 402' 
AI7 Software U SO4 403 ? 6 'binding site for residue SO4 U 403' 
AI8 Software V SO4 401 ? 3 'binding site for residue SO4 V 401' 
AI9 Software V FE  402 ? 4 'binding site for residue FE V 402'  
AJ1 Software V SO4 403 ? 4 'binding site for residue SO4 V 403' 
AJ2 Software V SO4 404 ? 5 'binding site for residue SO4 V 404' 
AJ3 Software W FE  401 ? 5 'binding site for residue FE W 401'  
AJ4 Software W SO4 402 ? 3 'binding site for residue SO4 W 402' 
AJ5 Software W SO4 403 ? 7 'binding site for residue SO4 W 403' 
AJ6 Software Y FE  401 ? 4 'binding site for residue FE Y 401'  
AJ7 Software Y SO4 402 ? 5 'binding site for residue SO4 Y 402' 
AJ8 Software Z FE  401 ? 4 'binding site for residue FE Z 401'  
AJ9 Software Z SO4 402 ? 5 'binding site for residue SO4 Z 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5 HIS A  88  ? HIS A 88   . ? 1_555 ? 
2   AC1 5 HIS A  92  ? HIS A 92   . ? 1_555 ? 
3   AC1 5 GLU A  116 ? GLU A 116  . ? 1_555 ? 
4   AC1 5 HOH SC .   ? HOH A 564  . ? 1_555 ? 
5   AC1 5 HOH SC .   ? HOH A 659  . ? 1_555 ? 
6   AC2 3 HIS A  240 ? HIS A 240  . ? 1_555 ? 
7   AC2 3 ASP A  241 ? ASP A 241  . ? 1_555 ? 
8   AC2 3 LYS A  242 ? LYS A 242  . ? 1_555 ? 
9   AC3 5 ILE A  129 ? ILE A 129  . ? 1_555 ? 
10  AC3 5 MET A  130 ? MET A 130  . ? 1_555 ? 
11  AC3 5 ASP A  134 ? ASP A 134  . ? 1_555 ? 
12  AC3 5 ALA M  188 ? ALA M 188  . ? 1_555 ? 
13  AC3 5 HOH ED .   ? HOH M 521  . ? 1_555 ? 
14  AC4 6 ALA A  188 ? ALA A 188  . ? 1_555 ? 
15  AC4 6 VAL A  190 ? VAL A 190  . ? 1_555 ? 
16  AC4 6 PRO A  191 ? PRO A 191  . ? 1_555 ? 
17  AC4 6 GLN X  128 ? GLN Z 128  . ? 1_555 ? 
18  AC4 6 ILE X  129 ? ILE Z 129  . ? 1_555 ? 
19  AC4 6 MET X  130 ? MET Z 130  . ? 1_555 ? 
20  AC5 5 HIS B  88  ? HIS B 88   . ? 1_555 ? 
21  AC5 5 HIS B  92  ? HIS B 92   . ? 1_555 ? 
22  AC5 5 GLU B  116 ? GLU B 116  . ? 1_555 ? 
23  AC5 5 HOH TC .   ? HOH B 609  . ? 1_555 ? 
24  AC5 5 HOH TC .   ? HOH B 633  . ? 1_555 ? 
25  AC6 5 LYS B  238 ? LYS B 238  . ? 1_555 ? 
26  AC6 5 HIS B  240 ? HIS B 240  . ? 1_555 ? 
27  AC6 5 ASP B  241 ? ASP B 241  . ? 1_555 ? 
28  AC6 5 LYS B  242 ? LYS B 242  . ? 1_555 ? 
29  AC6 5 HOH TC .   ? HOH B 634  . ? 1_555 ? 
30  AC7 6 ILE B  129 ? ILE B 129  . ? 1_555 ? 
31  AC7 6 ASP B  134 ? ASP B 134  . ? 1_555 ? 
32  AC7 6 ALA E  188 ? ALA E 188  . ? 1_555 ? 
33  AC7 6 ASN E  189 ? ASN E 189  . ? 1_555 ? 
34  AC7 6 PRO E  191 ? PRO E 191  . ? 1_555 ? 
35  AC7 6 HOH WC .   ? HOH E 502  . ? 1_555 ? 
36  AC8 4 HIS C  88  ? HIS C 88   . ? 1_555 ? 
37  AC8 4 HIS C  92  ? HIS C 92   . ? 1_555 ? 
38  AC8 4 GLU C  116 ? GLU C 116  . ? 1_555 ? 
39  AC8 4 HOH UC .   ? HOH C 608  . ? 1_555 ? 
40  AC9 3 HIS C  240 ? HIS C 240  . ? 1_555 ? 
41  AC9 3 ASP C  241 ? ASP C 241  . ? 1_555 ? 
42  AC9 3 LYS C  242 ? LYS C 242  . ? 1_555 ? 
43  AD1 7 GLN C  128 ? GLN C 128  . ? 1_555 ? 
44  AD1 7 ILE C  129 ? ILE C 129  . ? 1_555 ? 
45  AD1 7 MET C  130 ? MET C 130  . ? 1_555 ? 
46  AD1 7 ASP C  134 ? ASP C 134  . ? 1_555 ? 
47  AD1 7 ALA S  188 ? ALA T 188  . ? 1_555 ? 
48  AD1 7 ASN S  189 ? ASN T 189  . ? 1_555 ? 
49  AD1 7 HOH KD .   ? HOH T 545  . ? 1_555 ? 
50  AD2 6 ALA C  188 ? ALA C 188  . ? 1_555 ? 
51  AD2 6 ASN C  189 ? ASN C 189  . ? 1_555 ? 
52  AD2 6 PRO C  191 ? PRO C 191  . ? 1_555 ? 
53  AD2 6 ILE W  129 ? ILE Y 129  . ? 1_555 ? 
54  AD2 6 MET W  130 ? MET Y 130  . ? 1_555 ? 
55  AD2 6 ASP W  134 ? ASP Y 134  . ? 1_555 ? 
56  AD3 4 HIS D  88  ? HIS D 88   . ? 1_555 ? 
57  AD3 4 HIS D  92  ? HIS D 92   . ? 1_555 ? 
58  AD3 4 GLU D  116 ? GLU D 116  . ? 1_555 ? 
59  AD3 4 HOH VC .   ? HOH D 598  . ? 1_555 ? 
60  AD4 3 HIS D  240 ? HIS D 240  . ? 1_555 ? 
61  AD4 3 ASP D  241 ? ASP D 241  . ? 1_555 ? 
62  AD4 3 LYS D  242 ? LYS D 242  . ? 1_555 ? 
63  AD5 5 ILE D  129 ? ILE D 129  . ? 1_555 ? 
64  AD5 5 ASP D  134 ? ASP D 134  . ? 1_555 ? 
65  AD5 5 ALA T  188 ? ALA U 188  . ? 1_555 ? 
66  AD5 5 ASN T  189 ? ASN U 189  . ? 1_555 ? 
67  AD5 5 PRO T  191 ? PRO U 191  . ? 1_555 ? 
68  AD6 4 HIS E  88  ? HIS E 88   . ? 1_555 ? 
69  AD6 4 HIS E  92  ? HIS E 92   . ? 1_555 ? 
70  AD6 4 GLU E  116 ? GLU E 116  . ? 1_555 ? 
71  AD6 4 HOH WC .   ? HOH E 623  . ? 1_555 ? 
72  AD7 3 HIS E  240 ? HIS E 240  . ? 1_555 ? 
73  AD7 3 ASP E  241 ? ASP E 241  . ? 1_555 ? 
74  AD7 3 LYS E  242 ? LYS E 242  . ? 1_555 ? 
75  AD8 8 GLN E  128 ? GLN E 128  . ? 1_555 ? 
76  AD8 8 ILE E  129 ? ILE E 129  . ? 1_555 ? 
77  AD8 8 MET E  130 ? MET E 130  . ? 1_555 ? 
78  AD8 8 ASP E  134 ? ASP E 134  . ? 1_555 ? 
79  AD8 8 ALA P  188 ? ALA P 188  . ? 1_555 ? 
80  AD8 8 ASN P  189 ? ASN P 189  . ? 1_555 ? 
81  AD8 8 PRO P  191 ? PRO P 191  . ? 1_555 ? 
82  AD8 8 HOH HD .   ? HOH P 516  . ? 1_555 ? 
83  AD9 5 HIS F  88  ? HIS F 88   . ? 1_555 ? 
84  AD9 5 HIS F  92  ? HIS F 92   . ? 1_555 ? 
85  AD9 5 GLU F  116 ? GLU F 116  . ? 1_555 ? 
86  AD9 5 HOH XC .   ? HOH F 598  . ? 1_555 ? 
87  AD9 5 HOH XC .   ? HOH F 600  . ? 1_555 ? 
88  AE1 3 HIS F  240 ? HIS F 240  . ? 1_555 ? 
89  AE1 3 ASP F  241 ? ASP F 241  . ? 1_555 ? 
90  AE1 3 LYS F  242 ? LYS F 242  . ? 1_555 ? 
91  AE2 7 GLN F  128 ? GLN F 128  . ? 1_555 ? 
92  AE2 7 ILE F  129 ? ILE F 129  . ? 1_555 ? 
93  AE2 7 MET F  130 ? MET F 130  . ? 1_555 ? 
94  AE2 7 ASP F  134 ? ASP F 134  . ? 1_555 ? 
95  AE2 7 ALA V  188 ? ALA W 188  . ? 1_555 ? 
96  AE2 7 ASN V  189 ? ASN W 189  . ? 1_555 ? 
97  AE2 7 PRO V  191 ? PRO W 191  . ? 1_555 ? 
98  AE3 5 ALA F  188 ? ALA F 188  . ? 1_555 ? 
99  AE3 5 PRO F  191 ? PRO F 191  . ? 1_555 ? 
100 AE3 5 ILE R  129 ? ILE R 129  . ? 1_555 ? 
101 AE3 5 MET R  130 ? MET R 130  . ? 1_555 ? 
102 AE3 5 ASP R  134 ? ASP R 134  . ? 1_555 ? 
103 AE4 5 HIS G  88  ? HIS G 88   . ? 1_555 ? 
104 AE4 5 HIS G  92  ? HIS G 92   . ? 1_555 ? 
105 AE4 5 GLU G  116 ? GLU G 116  . ? 1_555 ? 
106 AE4 5 HOH YC .   ? HOH G 663  . ? 1_555 ? 
107 AE4 5 HOH YC .   ? HOH G 683  . ? 1_555 ? 
108 AE5 3 HIS G  240 ? HIS G 240  . ? 1_555 ? 
109 AE5 3 ASP G  241 ? ASP G 241  . ? 1_555 ? 
110 AE5 3 LYS G  242 ? LYS G 242  . ? 1_555 ? 
111 AE6 5 ILE G  129 ? ILE G 129  . ? 1_555 ? 
112 AE6 5 MET G  130 ? MET G 130  . ? 1_555 ? 
113 AE6 5 ASP G  134 ? ASP G 134  . ? 1_555 ? 
114 AE6 5 ALA X  188 ? ALA Z 188  . ? 1_555 ? 
115 AE6 5 PRO X  191 ? PRO Z 191  . ? 1_555 ? 
116 AE7 4 HIS H  88  ? HIS H 88   . ? 1_555 ? 
117 AE7 4 HIS H  92  ? HIS H 92   . ? 1_555 ? 
118 AE7 4 GLU H  116 ? GLU H 116  . ? 1_555 ? 
119 AE7 4 HOH ZC .   ? HOH H 637  . ? 1_555 ? 
120 AE8 3 HIS H  240 ? HIS H 240  . ? 1_555 ? 
121 AE8 3 ASP H  241 ? ASP H 241  . ? 1_555 ? 
122 AE8 3 LYS H  242 ? LYS H 242  . ? 1_555 ? 
123 AE9 6 ILE H  129 ? ILE H 129  . ? 1_555 ? 
124 AE9 6 MET H  130 ? MET H 130  . ? 1_555 ? 
125 AE9 6 ASP H  134 ? ASP H 134  . ? 1_555 ? 
126 AE9 6 ALA K  188 ? ALA K 188  . ? 1_555 ? 
127 AE9 6 PRO K  191 ? PRO K 191  . ? 1_555 ? 
128 AE9 6 HOH CD .   ? HOH K 508  . ? 1_555 ? 
129 AF1 5 HIS I  88  ? HIS I 88   . ? 1_555 ? 
130 AF1 5 HIS I  92  ? HIS I 92   . ? 1_555 ? 
131 AF1 5 GLU I  116 ? GLU I 116  . ? 1_555 ? 
132 AF1 5 HOH AD .   ? HOH I 621  . ? 1_555 ? 
133 AF1 5 HOH AD .   ? HOH I 680  . ? 1_555 ? 
134 AF2 4 LYS I  238 ? LYS I 238  . ? 1_555 ? 
135 AF2 4 HIS I  240 ? HIS I 240  . ? 1_555 ? 
136 AF2 4 ASP I  241 ? ASP I 241  . ? 1_555 ? 
137 AF2 4 LYS I  242 ? LYS I 242  . ? 1_555 ? 
138 AF3 6 GLN I  128 ? GLN I 128  . ? 1_555 ? 
139 AF3 6 ILE I  129 ? ILE I 129  . ? 1_555 ? 
140 AF3 6 ASP I  134 ? ASP I 134  . ? 1_555 ? 
141 AF3 6 LYS I  310 ? LYS I 310  . ? 1_555 ? 
142 AF3 6 ALA N  188 ? ALA N 188  . ? 1_555 ? 
143 AF3 6 PRO N  191 ? PRO N 191  . ? 1_555 ? 
144 AF4 5 HIS J  88  ? HIS J 88   . ? 1_555 ? 
145 AF4 5 HIS J  92  ? HIS J 92   . ? 1_555 ? 
146 AF4 5 GLU J  116 ? GLU J 116  . ? 1_555 ? 
147 AF4 5 HOH BD .   ? HOH J 646  . ? 1_555 ? 
148 AF4 5 HOH BD .   ? HOH J 687  . ? 1_555 ? 
149 AF5 3 HIS J  240 ? HIS J 240  . ? 1_555 ? 
150 AF5 3 ASP J  241 ? ASP J 241  . ? 1_555 ? 
151 AF5 3 LYS J  242 ? LYS J 242  . ? 1_555 ? 
152 AF6 7 ALA I  188 ? ALA I 188  . ? 1_555 ? 
153 AF6 7 ASN I  189 ? ASN I 189  . ? 1_555 ? 
154 AF6 7 HOH AD .   ? HOH I 503  . ? 1_555 ? 
155 AF6 7 GLN J  128 ? GLN J 128  . ? 1_555 ? 
156 AF6 7 ILE J  129 ? ILE J 129  . ? 1_555 ? 
157 AF6 7 MET J  130 ? MET J 130  . ? 1_555 ? 
158 AF6 7 ASP J  134 ? ASP J 134  . ? 1_555 ? 
159 AF7 5 HIS K  88  ? HIS K 88   . ? 1_555 ? 
160 AF7 5 HIS K  92  ? HIS K 92   . ? 1_555 ? 
161 AF7 5 GLU K  116 ? GLU K 116  . ? 1_555 ? 
162 AF7 5 HOH CD .   ? HOH K 655  . ? 1_555 ? 
163 AF7 5 HOH CD .   ? HOH K 658  . ? 1_555 ? 
164 AF8 3 HIS K  240 ? HIS K 240  . ? 1_555 ? 
165 AF8 3 ASP K  241 ? ASP K 241  . ? 1_555 ? 
166 AF8 3 LYS K  242 ? LYS K 242  . ? 1_555 ? 
167 AF9 6 ALA D  188 ? ALA D 188  . ? 1_555 ? 
168 AF9 6 ASN D  189 ? ASN D 189  . ? 1_555 ? 
169 AF9 6 HOH VC .   ? HOH D 541  . ? 1_555 ? 
170 AF9 6 ILE K  129 ? ILE K 129  . ? 1_555 ? 
171 AF9 6 MET K  130 ? MET K 130  . ? 1_555 ? 
172 AF9 6 ASP K  134 ? ASP K 134  . ? 1_555 ? 
173 AG1 4 HIS L  88  ? HIS L 88   . ? 1_555 ? 
174 AG1 4 HIS L  92  ? HIS L 92   . ? 1_555 ? 
175 AG1 4 GLU L  116 ? GLU L 116  . ? 1_555 ? 
176 AG1 4 HOH DD .   ? HOH L 584  . ? 1_555 ? 
177 AG2 3 HIS L  240 ? HIS L 240  . ? 1_555 ? 
178 AG2 3 ASP L  241 ? ASP L 241  . ? 1_555 ? 
179 AG2 3 LYS L  242 ? LYS L 242  . ? 1_555 ? 
180 AG3 7 GLN L  128 ? GLN L 128  . ? 1_555 ? 
181 AG3 7 ILE L  129 ? ILE L 129  . ? 1_555 ? 
182 AG3 7 MET L  130 ? MET L 130  . ? 1_555 ? 
183 AG3 7 ASP L  134 ? ASP L 134  . ? 1_555 ? 
184 AG3 7 LYS L  310 ? LYS L 310  . ? 1_555 ? 
185 AG3 7 ALA R  188 ? ALA R 188  . ? 1_555 ? 
186 AG3 7 ASN R  189 ? ASN R 189  . ? 1_555 ? 
187 AG4 5 HIS M  88  ? HIS M 88   . ? 1_555 ? 
188 AG4 5 HIS M  92  ? HIS M 92   . ? 1_555 ? 
189 AG4 5 GLU M  116 ? GLU M 116  . ? 1_555 ? 
190 AG4 5 HOH ED .   ? HOH M 665  . ? 1_555 ? 
191 AG4 5 HOH ED .   ? HOH M 670  . ? 1_555 ? 
192 AG5 4 HIS M  240 ? HIS M 240  . ? 1_555 ? 
193 AG5 4 ASP M  241 ? ASP M 241  . ? 1_555 ? 
194 AG5 4 LYS M  242 ? LYS M 242  . ? 1_555 ? 
195 AG5 4 HOH ED .   ? HOH M 636  . ? 1_555 ? 
196 AG6 5 ALA G  188 ? ALA G 188  . ? 1_555 ? 
197 AG6 5 ILE M  129 ? ILE M 129  . ? 1_555 ? 
198 AG6 5 MET M  130 ? MET M 130  . ? 1_555 ? 
199 AG6 5 ASP M  134 ? ASP M 134  . ? 1_555 ? 
200 AG6 5 HOH ED .   ? HOH M 531  . ? 1_555 ? 
201 AG7 5 HIS N  88  ? HIS N 88   . ? 1_555 ? 
202 AG7 5 HIS N  92  ? HIS N 92   . ? 1_555 ? 
203 AG7 5 GLU N  116 ? GLU N 116  . ? 1_555 ? 
204 AG7 5 HOH FD .   ? HOH N 675  . ? 1_555 ? 
205 AG7 5 HOH FD .   ? HOH N 694  . ? 1_555 ? 
206 AG8 3 HIS N  240 ? HIS N 240  . ? 1_555 ? 
207 AG8 3 ASP N  241 ? ASP N 241  . ? 1_555 ? 
208 AG8 3 LYS N  242 ? LYS N 242  . ? 1_555 ? 
209 AG9 5 GLN N  128 ? GLN N 128  . ? 1_555 ? 
210 AG9 5 MET N  130 ? MET N 130  . ? 1_555 ? 
211 AG9 5 ASP N  134 ? ASP N 134  . ? 1_555 ? 
212 AG9 5 HOH FD .   ? HOH N 550  . ? 1_555 ? 
213 AG9 5 ALA Q  188 ? ALA Q 188  . ? 1_555 ? 
214 AH1 4 HIS O  88  ? HIS O 88   . ? 1_555 ? 
215 AH1 4 HIS O  92  ? HIS O 92   . ? 1_555 ? 
216 AH1 4 GLU O  116 ? GLU O 116  . ? 1_555 ? 
217 AH1 4 HOH GD .   ? HOH O 1457 . ? 1_555 ? 
218 AH2 3 HIS O  240 ? HIS O 240  . ? 1_555 ? 
219 AH2 3 ASP O  241 ? ASP O 241  . ? 1_555 ? 
220 AH2 3 LYS O  242 ? LYS O 242  . ? 1_555 ? 
221 AH3 8 ALA B  188 ? ALA B 188  . ? 1_555 ? 
222 AH3 8 ASN B  189 ? ASN B 189  . ? 1_555 ? 
223 AH3 8 PRO B  191 ? PRO B 191  . ? 1_555 ? 
224 AH3 8 GLN O  128 ? GLN O 128  . ? 1_555 ? 
225 AH3 8 ILE O  129 ? ILE O 129  . ? 1_555 ? 
226 AH3 8 MET O  130 ? MET O 130  . ? 1_555 ? 
227 AH3 8 ASP O  134 ? ASP O 134  . ? 1_555 ? 
228 AH3 8 LYS O  310 ? LYS O 310  . ? 1_555 ? 
229 AH4 5 HIS P  88  ? HIS P 88   . ? 1_555 ? 
230 AH4 5 HIS P  92  ? HIS P 92   . ? 1_555 ? 
231 AH4 5 GLU P  116 ? GLU P 116  . ? 1_555 ? 
232 AH4 5 HOH HD .   ? HOH P 585  . ? 1_555 ? 
233 AH4 5 HOH HD .   ? HOH P 635  . ? 1_555 ? 
234 AH5 4 HIS P  240 ? HIS P 240  . ? 1_555 ? 
235 AH5 4 ASP P  241 ? ASP P 241  . ? 1_555 ? 
236 AH5 4 LYS P  242 ? LYS P 242  . ? 1_555 ? 
237 AH5 4 HOH HD .   ? HOH P 609  . ? 1_555 ? 
238 AH6 6 ALA O  188 ? ALA O 188  . ? 1_555 ? 
239 AH6 6 PRO O  191 ? PRO O 191  . ? 1_555 ? 
240 AH6 6 HOH GD .   ? HOH O 1339 . ? 1_555 ? 
241 AH6 6 GLN P  128 ? GLN P 128  . ? 1_555 ? 
242 AH6 6 ILE P  129 ? ILE P 129  . ? 1_555 ? 
243 AH6 6 ASP P  134 ? ASP P 134  . ? 1_555 ? 
244 AH7 5 HIS Q  88  ? HIS Q 88   . ? 1_555 ? 
245 AH7 5 HIS Q  92  ? HIS Q 92   . ? 1_555 ? 
246 AH7 5 GLU Q  116 ? GLU Q 116  . ? 1_555 ? 
247 AH7 5 HOH ID .   ? HOH Q 671  . ? 1_555 ? 
248 AH7 5 HOH ID .   ? HOH Q 695  . ? 1_555 ? 
249 AH8 3 HIS Q  240 ? HIS Q 240  . ? 1_555 ? 
250 AH8 3 ASP Q  241 ? ASP Q 241  . ? 1_555 ? 
251 AH8 3 LYS Q  242 ? LYS Q 242  . ? 1_555 ? 
252 AH9 5 ALA J  188 ? ALA J 188  . ? 1_555 ? 
253 AH9 5 GLN Q  128 ? GLN Q 128  . ? 1_555 ? 
254 AH9 5 ILE Q  129 ? ILE Q 129  . ? 1_555 ? 
255 AH9 5 MET Q  130 ? MET Q 130  . ? 1_555 ? 
256 AH9 5 ASP Q  134 ? ASP Q 134  . ? 1_555 ? 
257 AI1 5 HIS R  88  ? HIS R 88   . ? 1_555 ? 
258 AI1 5 HIS R  92  ? HIS R 92   . ? 1_555 ? 
259 AI1 5 GLU R  116 ? GLU R 116  . ? 1_555 ? 
260 AI1 5 HOH JD .   ? HOH R 520  . ? 1_555 ? 
261 AI1 5 HOH JD .   ? HOH R 608  . ? 1_555 ? 
262 AI2 5 LYS R  238 ? LYS R 238  . ? 1_555 ? 
263 AI2 5 HIS R  240 ? HIS R 240  . ? 1_555 ? 
264 AI2 5 ASP R  241 ? ASP R 241  . ? 1_555 ? 
265 AI2 5 LYS R  242 ? LYS R 242  . ? 1_555 ? 
266 AI2 5 HOH JD .   ? HOH R 511  . ? 1_555 ? 
267 AI3 4 HIS S  88  ? HIS T 88   . ? 1_555 ? 
268 AI3 4 HIS S  92  ? HIS T 92   . ? 1_555 ? 
269 AI3 4 GLU S  116 ? GLU T 116  . ? 1_555 ? 
270 AI3 4 HOH KD .   ? HOH T 647  . ? 1_555 ? 
271 AI4 4 LYS S  238 ? LYS T 238  . ? 1_555 ? 
272 AI4 4 HIS S  240 ? HIS T 240  . ? 1_555 ? 
273 AI4 4 ASP S  241 ? ASP T 241  . ? 1_555 ? 
274 AI4 4 LYS S  242 ? LYS T 242  . ? 1_555 ? 
275 AI5 5 HIS T  88  ? HIS U 88   . ? 1_555 ? 
276 AI5 5 HIS T  92  ? HIS U 92   . ? 1_555 ? 
277 AI5 5 GLU T  116 ? GLU U 116  . ? 1_555 ? 
278 AI5 5 HOH LD .   ? HOH U 557  . ? 1_555 ? 
279 AI5 5 HOH LD .   ? HOH U 605  . ? 1_555 ? 
280 AI6 3 HIS T  240 ? HIS U 240  . ? 1_555 ? 
281 AI6 3 ASP T  241 ? ASP U 241  . ? 1_555 ? 
282 AI6 3 LYS T  242 ? LYS U 242  . ? 1_555 ? 
283 AI7 6 ALA H  188 ? ALA H 188  . ? 1_555 ? 
284 AI7 6 HOH ZC .   ? HOH H 511  . ? 1_555 ? 
285 AI7 6 GLN T  128 ? GLN U 128  . ? 1_555 ? 
286 AI7 6 ILE T  129 ? ILE U 129  . ? 1_555 ? 
287 AI7 6 MET T  130 ? MET U 130  . ? 1_555 ? 
288 AI7 6 ASP T  134 ? ASP U 134  . ? 1_555 ? 
289 AI8 3 ASP S  134 ? ASP T 134  . ? 1_555 ? 
290 AI8 3 ALA U  188 ? ALA V 188  . ? 1_555 ? 
291 AI8 3 PRO U  191 ? PRO V 191  . ? 1_555 ? 
292 AI9 4 HIS U  88  ? HIS V 88   . ? 1_555 ? 
293 AI9 4 HIS U  92  ? HIS V 92   . ? 1_555 ? 
294 AI9 4 GLU U  116 ? GLU V 116  . ? 1_555 ? 
295 AI9 4 HOH MD .   ? HOH V 599  . ? 1_555 ? 
296 AJ1 4 LYS U  238 ? LYS V 238  . ? 1_555 ? 
297 AJ1 4 HIS U  240 ? HIS V 240  . ? 1_555 ? 
298 AJ1 4 ASP U  241 ? ASP V 241  . ? 1_555 ? 
299 AJ1 4 LYS U  242 ? LYS V 242  . ? 1_555 ? 
300 AJ2 5 ILE U  129 ? ILE V 129  . ? 1_555 ? 
301 AJ2 5 MET U  130 ? MET V 130  . ? 1_555 ? 
302 AJ2 5 ASP U  134 ? ASP V 134  . ? 1_555 ? 
303 AJ2 5 ALA W  188 ? ALA Y 188  . ? 1_555 ? 
304 AJ2 5 PRO W  191 ? PRO Y 191  . ? 1_555 ? 
305 AJ3 5 HIS V  88  ? HIS W 88   . ? 1_555 ? 
306 AJ3 5 HIS V  92  ? HIS W 92   . ? 1_555 ? 
307 AJ3 5 GLU V  116 ? GLU W 116  . ? 1_555 ? 
308 AJ3 5 HOH ND .   ? HOH W 564  . ? 1_555 ? 
309 AJ3 5 HOH ND .   ? HOH W 569  . ? 1_555 ? 
310 AJ4 3 HIS V  240 ? HIS W 240  . ? 1_555 ? 
311 AJ4 3 ASP V  241 ? ASP W 241  . ? 1_555 ? 
312 AJ4 3 LYS V  242 ? LYS W 242  . ? 1_555 ? 
313 AJ5 7 ALA L  188 ? ALA L 188  . ? 1_555 ? 
314 AJ5 7 ASN L  189 ? ASN L 189  . ? 1_555 ? 
315 AJ5 7 PRO L  191 ? PRO L 191  . ? 1_555 ? 
316 AJ5 7 HOH DD .   ? HOH L 502  . ? 1_555 ? 
317 AJ5 7 ILE V  129 ? ILE W 129  . ? 1_555 ? 
318 AJ5 7 MET V  130 ? MET W 130  . ? 1_555 ? 
319 AJ5 7 ASP V  134 ? ASP W 134  . ? 1_555 ? 
320 AJ6 4 HIS W  88  ? HIS Y 88   . ? 1_555 ? 
321 AJ6 4 HIS W  92  ? HIS Y 92   . ? 1_555 ? 
322 AJ6 4 GLU W  116 ? GLU Y 116  . ? 1_555 ? 
323 AJ6 4 HOH OD .   ? HOH Y 588  . ? 1_555 ? 
324 AJ7 5 LYS W  238 ? LYS Y 238  . ? 1_555 ? 
325 AJ7 5 HIS W  240 ? HIS Y 240  . ? 1_555 ? 
326 AJ7 5 ASP W  241 ? ASP Y 241  . ? 1_555 ? 
327 AJ7 5 LYS W  242 ? LYS Y 242  . ? 1_555 ? 
328 AJ7 5 HOH OD .   ? HOH Y 542  . ? 1_555 ? 
329 AJ8 4 HIS X  88  ? HIS Z 88   . ? 1_555 ? 
330 AJ8 4 HIS X  92  ? HIS Z 92   . ? 1_555 ? 
331 AJ8 4 GLU X  116 ? GLU Z 116  . ? 1_555 ? 
332 AJ8 4 HOH PD .   ? HOH Z 644  . ? 1_555 ? 
333 AJ9 5 HIS X  240 ? HIS Z 240  . ? 1_555 ? 
334 AJ9 5 ASP X  241 ? ASP Z 241  . ? 1_555 ? 
335 AJ9 5 LYS X  242 ? LYS Z 242  . ? 1_555 ? 
336 AJ9 5 HOH PD .   ? HOH Z 517  . ? 1_555 ? 
337 AJ9 5 HOH PD .   ? HOH Z 527  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6QPA 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.004979 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004707 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004630 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
FE 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . GLU A  1 4   ? -33.995 140.939 165.898 1.00 93.16  ? 4    GLU A N   1 
ATOM   2     C  CA  . GLU A  1 4   ? -33.015 141.566 165.008 1.00 93.94  ? 4    GLU A CA  1 
ATOM   3     C  C   . GLU A  1 4   ? -33.484 141.554 163.542 1.00 88.99  ? 4    GLU A C   1 
ATOM   4     O  O   . GLU A  1 4   ? -33.820 140.495 162.989 1.00 91.72  ? 4    GLU A O   1 
ATOM   5     C  CB  . GLU A  1 4   ? -31.649 140.869 165.153 1.00 86.92  ? 4    GLU A CB  1 
ATOM   6     C  CG  . GLU A  1 4   ? -30.613 141.165 164.058 1.00 84.61  ? 4    GLU A CG  1 
ATOM   7     C  CD  . GLU A  1 4   ? -29.626 142.281 164.420 1.00 83.30  ? 4    GLU A CD  1 
ATOM   8     O  OE1 . GLU A  1 4   ? -29.659 143.358 163.765 1.00 66.34  ? 4    GLU A OE1 1 
ATOM   9     O  OE2 . GLU A  1 4   ? -28.810 142.070 165.349 1.00 87.26  ? 4    GLU A OE2 1 
ATOM   10    N  N   . ASN A  1 5   ? -33.534 142.742 162.929 1.00 69.20  ? 5    ASN A N   1 
ATOM   11    C  CA  . ASN A  1 5   ? -33.781 142.892 161.495 1.00 56.31  ? 5    ASN A CA  1 
ATOM   12    C  C   . ASN A  1 5   ? -32.516 143.477 160.882 1.00 47.77  ? 5    ASN A C   1 
ATOM   13    O  O   . ASN A  1 5   ? -32.369 144.707 160.786 1.00 43.55  ? 5    ASN A O   1 
ATOM   14    C  CB  . ASN A  1 5   ? -34.999 143.775 161.219 1.00 62.53  ? 5    ASN A CB  1 
ATOM   15    C  CG  . ASN A  1 5   ? -35.372 144.657 162.405 1.00 77.98  ? 5    ASN A CG  1 
ATOM   16    O  OD1 . ASN A  1 5   ? -35.124 144.304 163.561 1.00 80.89  ? 5    ASN A OD1 1 
ATOM   17    N  ND2 . ASN A  1 5   ? -35.986 145.809 162.123 1.00 78.27  ? 5    ASN A ND2 1 
ATOM   18    N  N   . PRO A  1 6   ? -31.563 142.647 160.470 1.00 44.26  ? 6    PRO A N   1 
ATOM   19    C  CA  . PRO A  1 6   ? -30.338 143.190 159.871 1.00 36.32  ? 6    PRO A CA  1 
ATOM   20    C  C   . PRO A  1 6   ? -30.583 143.701 158.462 1.00 39.39  ? 6    PRO A C   1 
ATOM   21    O  O   . PRO A  1 6   ? -31.597 143.422 157.818 1.00 45.33  ? 6    PRO A O   1 
ATOM   22    C  CB  . PRO A  1 6   ? -29.375 142.000 159.892 1.00 41.78  ? 6    PRO A CB  1 
ATOM   23    C  CG  . PRO A  1 6   ? -30.264 140.802 159.830 1.00 48.53  ? 6    PRO A CG  1 
ATOM   24    C  CD  . PRO A  1 6   ? -31.505 141.180 160.616 1.00 41.02  ? 6    PRO A CD  1 
ATOM   25    N  N   . ILE A  1 7   ? -29.593 144.439 157.985 1.00 28.44  ? 7    ILE A N   1 
ATOM   26    C  CA  . ILE A  1 7   ? -29.530 144.985 156.639 1.00 30.91  ? 7    ILE A CA  1 
ATOM   27    C  C   . ILE A  1 7   ? -28.614 144.084 155.816 1.00 35.97  ? 7    ILE A C   1 
ATOM   28    O  O   . ILE A  1 7   ? -27.572 143.634 156.306 1.00 32.25  ? 7    ILE A O   1 
ATOM   29    C  CB  . ILE A  1 7   ? -28.987 146.434 156.699 1.00 35.15  ? 7    ILE A CB  1 
ATOM   30    C  CG1 . ILE A  1 7   ? -29.925 147.354 157.493 1.00 48.80  ? 7    ILE A CG1 1 
ATOM   31    C  CG2 . ILE A  1 7   ? -28.679 146.986 155.332 1.00 36.33  ? 7    ILE A CG2 1 
ATOM   32    C  CD1 . ILE A  1 7   ? -31.339 147.285 157.075 1.00 40.41  ? 7    ILE A CD1 1 
ATOM   33    N  N   . ILE A  1 8   ? -28.961 143.843 154.560 1.00 38.90  ? 8    ILE A N   1 
ATOM   34    C  CA  . ILE A  1 8   ? -28.127 143.015 153.700 1.00 32.69  ? 8    ILE A CA  1 
ATOM   35    C  C   . ILE A  1 8   ? -27.696 143.877 152.534 1.00 34.35  ? 8    ILE A C   1 
ATOM   36    O  O   . ILE A  1 8   ? -28.542 144.426 151.818 1.00 33.44  ? 8    ILE A O   1 
ATOM   37    C  CB  . ILE A  1 8   ? -28.847 141.749 153.212 1.00 27.98  ? 8    ILE A CB  1 
ATOM   38    C  CG1 . ILE A  1 8   ? -29.344 140.931 154.399 1.00 28.04  ? 8    ILE A CG1 1 
ATOM   39    C  CG2 . ILE A  1 8   ? -27.862 140.841 152.402 1.00 27.28  ? 8    ILE A CG2 1 
ATOM   40    C  CD1 . ILE A  1 8   ? -30.002 139.625 153.980 1.00 28.35  ? 8    ILE A CD1 1 
ATOM   41    N  N   . ALA A  1 9   ? -26.386 144.030 152.370 1.00 25.93  ? 9    ALA A N   1 
ATOM   42    C  CA  . ALA A  1 9   ? -25.825 144.625 151.169 1.00 30.27  ? 9    ALA A CA  1 
ATOM   43    C  C   . ALA A  1 9   ? -25.472 143.504 150.206 1.00 27.57  ? 9    ALA A C   1 
ATOM   44    O  O   . ALA A  1 9   ? -24.827 142.520 150.595 1.00 30.69  ? 9    ALA A O   1 
ATOM   45    C  CB  . ALA A  1 9   ? -24.597 145.492 151.489 1.00 25.69  ? 9    ALA A CB  1 
ATOM   46    N  N   . ILE A  1 10  ? -25.942 143.613 148.969 1.00 29.78  ? 10   ILE A N   1 
ATOM   47    C  CA  . ILE A  1 10  ? -25.678 142.594 147.962 1.00 32.46  ? 10   ILE A CA  1 
ATOM   48    C  C   . ILE A  1 10  ? -24.790 143.211 146.906 1.00 32.02  ? 10   ILE A C   1 
ATOM   49    O  O   . ILE A  1 10  ? -25.248 144.020 146.096 1.00 33.36  ? 10   ILE A O   1 
ATOM   50    C  CB  . ILE A  1 10  ? -26.958 142.024 147.341 1.00 29.11  ? 10   ILE A CB  1 
ATOM   51    C  CG1 . ILE A  1 10  ? -27.831 141.442 148.450 1.00 24.91  ? 10   ILE A CG1 1 
ATOM   52    C  CG2 . ILE A  1 10  ? -26.573 140.961 146.307 1.00 27.13  ? 10   ILE A CG2 1 
ATOM   53    C  CD1 . ILE A  1 10  ? -29.180 140.852 147.968 1.00 25.98  ? 10   ILE A CD1 1 
ATOM   54    N  N   . ASN A  1 11  ? -23.517 142.826 146.915 1.00 29.82  ? 11   ASN A N   1 
ATOM   55    C  CA  . ASN A  1 11  ? -22.584 143.238 145.881 1.00 31.19  ? 11   ASN A CA  1 
ATOM   56    C  C   . ASN A  1 11  ? -22.823 142.356 144.659 1.00 33.30  ? 11   ASN A C   1 
ATOM   57    O  O   . ASN A  1 11  ? -22.566 141.148 144.698 1.00 32.41  ? 11   ASN A O   1 
ATOM   58    C  CB  . ASN A  1 11  ? -21.152 143.118 146.396 1.00 32.52  ? 11   ASN A CB  1 
ATOM   59    C  CG  . ASN A  1 11  ? -20.172 143.824 145.519 1.00 43.39  ? 11   ASN A CG  1 
ATOM   60    O  OD1 . ASN A  1 11  ? -19.858 143.355 144.433 1.00 46.22  ? 11   ASN A OD1 1 
ATOM   61    N  ND2 . ASN A  1 11  ? -19.683 144.975 145.979 1.00 51.61  ? 11   ASN A ND2 1 
ATOM   62    N  N   . MET A  1 12  ? -23.323 142.954 143.583 1.00 34.25  ? 12   MET A N   1 
ATOM   63    C  CA  . MET A  1 12  ? -23.697 142.246 142.364 1.00 33.78  ? 12   MET A CA  1 
ATOM   64    C  C   . MET A  1 12  ? -22.673 142.558 141.288 1.00 37.29  ? 12   MET A C   1 
ATOM   65    O  O   . MET A  1 12  ? -22.418 143.734 140.996 1.00 38.11  ? 12   MET A O   1 
ATOM   66    C  CB  . MET A  1 12  ? -25.089 142.657 141.902 1.00 28.49  ? 12   MET A CB  1 
ATOM   67    C  CG  . MET A  1 12  ? -26.181 142.421 142.922 1.00 30.68  ? 12   MET A CG  1 
ATOM   68    S  SD  . MET A  1 12  ? -27.672 143.302 142.433 1.00 41.16  ? 12   MET A SD  1 
ATOM   69    C  CE  . MET A  1 12  ? -28.828 142.641 143.628 1.00 38.09  ? 12   MET A CE  1 
ATOM   70    N  N   . ALA A  1 13  ? -22.076 141.509 140.723 1.00 29.86  ? 13   ALA A N   1 
ATOM   71    C  CA  . ALA A  1 13  ? -21.123 141.625 139.632 1.00 34.52  ? 13   ALA A CA  1 
ATOM   72    C  C   . ALA A  1 13  ? -21.347 140.484 138.653 1.00 34.80  ? 13   ALA A C   1 
ATOM   73    O  O   . ALA A  1 13  ? -21.952 139.466 138.987 1.00 38.92  ? 13   ALA A O   1 
ATOM   74    C  CB  . ALA A  1 13  ? -19.676 141.582 140.134 1.00 30.16  ? 13   ALA A CB  1 
ATOM   75    N  N   . LYS A  1 14  ? -20.855 140.662 137.433 1.00 30.58  ? 14   LYS A N   1 
ATOM   76    C  CA  . LYS A  1 14  ? -20.802 139.590 136.444 1.00 28.35  ? 14   LYS A CA  1 
ATOM   77    C  C   . LYS A  1 14  ? -19.348 139.404 136.047 1.00 35.08  ? 14   LYS A C   1 
ATOM   78    O  O   . LYS A  1 14  ? -18.674 140.369 135.674 1.00 37.11  ? 14   LYS A O   1 
ATOM   79    C  CB  . LYS A  1 14  ? -21.698 139.877 135.243 1.00 38.48  ? 14   LYS A CB  1 
ATOM   80    C  CG  . LYS A  1 14  ? -23.186 139.843 135.603 1.00 46.17  ? 14   LYS A CG  1 
ATOM   81    C  CD  . LYS A  1 14  ? -24.061 140.092 134.395 1.00 62.95  ? 14   LYS A CD  1 
ATOM   82    C  CE  . LYS A  1 14  ? -25.536 139.925 134.737 1.00 73.39  ? 14   LYS A CE  1 
ATOM   83    N  NZ  . LYS A  1 14  ? -25.826 138.519 135.195 1.00 84.09  ? 14   LYS A NZ  1 
ATOM   84    N  N   . ILE A  1 15  ? -18.853 138.177 136.186 1.00 30.32  ? 15   ILE A N   1 
ATOM   85    C  CA  . ILE A  1 15  ? -17.440 137.905 136.043 1.00 30.92  ? 15   ILE A CA  1 
ATOM   86    C  C   . ILE A  1 15  ? -17.231 136.873 134.946 1.00 35.04  ? 15   ILE A C   1 
ATOM   87    O  O   . ILE A  1 15  ? -18.122 136.078 134.611 1.00 35.27  ? 15   ILE A O   1 
ATOM   88    C  CB  . ILE A  1 15  ? -16.817 137.436 137.372 1.00 40.07  ? 15   ILE A CB  1 
ATOM   89    C  CG1 . ILE A  1 15  ? -17.346 136.049 137.746 1.00 35.32  ? 15   ILE A CG1 1 
ATOM   90    C  CG2 . ILE A  1 15  ? -17.157 138.451 138.490 1.00 28.84  ? 15   ILE A CG2 1 
ATOM   91    C  CD1 . ILE A  1 15  ? -16.785 135.522 139.005 1.00 36.47  ? 15   ILE A CD1 1 
ATOM   92    N  N   . ALA A  1 16  ? -16.014 136.883 134.404 1.00 28.09  ? 16   ALA A N   1 
ATOM   93    C  CA  . ALA A  1 16  ? -15.649 135.972 133.333 1.00 29.18  ? 16   ALA A CA  1 
ATOM   94    C  C   . ALA A  1 16  ? -15.638 134.537 133.836 1.00 34.00  ? 16   ALA A C   1 
ATOM   95    O  O   . ALA A  1 16  ? -15.138 134.244 134.919 1.00 35.13  ? 16   ALA A O   1 
ATOM   96    C  CB  . ALA A  1 16  ? -14.278 136.346 132.753 1.00 31.18  ? 16   ALA A CB  1 
ATOM   97    N  N   . ASN A  1 17  ? -16.210 133.641 133.042 1.00 30.79  ? 17   ASN A N   1 
ATOM   98    C  CA  . ASN A  1 17  ? -16.293 132.229 133.390 1.00 39.64  ? 17   ASN A CA  1 
ATOM   99    C  C   . ASN A  1 17  ? -15.093 131.520 132.766 1.00 38.13  ? 17   ASN A C   1 
ATOM   100   O  O   . ASN A  1 17  ? -15.148 130.980 131.664 1.00 43.92  ? 17   ASN A O   1 
ATOM   101   C  CB  . ASN A  1 17  ? -17.619 131.650 132.913 1.00 39.64  ? 17   ASN A CB  1 
ATOM   102   C  CG  . ASN A  1 17  ? -17.793 130.205 133.297 1.00 47.12  ? 17   ASN A CG  1 
ATOM   103   O  OD1 . ASN A  1 17  ? -16.920 129.614 133.929 1.00 43.15  ? 17   ASN A OD1 1 
ATOM   104   N  ND2 . ASN A  1 17  ? -18.934 129.629 132.939 1.00 43.27  ? 17   ASN A ND2 1 
ATOM   105   N  N   . LYS A  1 18  ? -13.977 131.560 133.481 1.00 41.30  ? 18   LYS A N   1 
ATOM   106   C  CA  . LYS A  1 18  ? -12.748 130.920 133.035 1.00 49.43  ? 18   LYS A CA  1 
ATOM   107   C  C   . LYS A  1 18  ? -11.900 130.618 134.259 1.00 47.78  ? 18   LYS A C   1 
ATOM   108   O  O   . LYS A  1 18  ? -12.102 131.221 135.320 1.00 43.48  ? 18   LYS A O   1 
ATOM   109   C  CB  . LYS A  1 18  ? -12.006 131.782 131.996 1.00 55.79  ? 18   LYS A CB  1 
ATOM   110   C  CG  . LYS A  1 18  ? -11.589 133.186 132.403 1.00 63.14  ? 18   LYS A CG  1 
ATOM   111   C  CD  . LYS A  1 18  ? -11.021 133.917 131.170 1.00 73.48  ? 18   LYS A CD  1 
ATOM   112   C  CE  . LYS A  1 18  ? -10.431 135.292 131.498 1.00 85.21  ? 18   LYS A CE  1 
ATOM   113   N  NZ  . LYS A  1 18  ? -9.147  135.245 132.277 1.00 93.07  ? 18   LYS A NZ  1 
ATOM   114   N  N   . PRO A  1 19  ? -10.967 129.661 134.157 1.00 55.41  ? 19   PRO A N   1 
ATOM   115   C  CA  . PRO A  1 19  ? -10.211 129.232 135.354 1.00 57.44  ? 19   PRO A CA  1 
ATOM   116   C  C   . PRO A  1 19  ? -9.544  130.358 136.140 1.00 61.94  ? 19   PRO A C   1 
ATOM   117   O  O   . PRO A  1 19  ? -9.495  130.286 137.377 1.00 54.28  ? 19   PRO A O   1 
ATOM   118   C  CB  . PRO A  1 19  ? -9.184  128.254 134.768 1.00 55.37  ? 19   PRO A CB  1 
ATOM   119   C  CG  . PRO A  1 19  ? -9.873  127.678 133.577 1.00 51.38  ? 19   PRO A CG  1 
ATOM   120   C  CD  . PRO A  1 19  ? -10.683 128.806 132.991 1.00 55.35  ? 19   PRO A CD  1 
ATOM   121   N  N   . ASP A  1 20  ? -9.046  131.399 135.461 1.00 63.01  ? 20   ASP A N   1 
ATOM   122   C  CA  . ASP A  1 20  ? -8.389  132.502 136.159 1.00 70.94  ? 20   ASP A CA  1 
ATOM   123   C  C   . ASP A  1 20  ? -9.322  133.139 137.181 1.00 67.12  ? 20   ASP A C   1 
ATOM   124   O  O   . ASP A  1 20  ? -8.889  133.516 138.273 1.00 59.54  ? 20   ASP A O   1 
ATOM   125   C  CB  . ASP A  1 20  ? -7.921  133.556 135.153 1.00 84.73  ? 20   ASP A CB  1 
ATOM   126   C  CG  . ASP A  1 20  ? -6.999  132.986 134.091 1.00 100.39 ? 20   ASP A CG  1 
ATOM   127   O  OD1 . ASP A  1 20  ? -7.507  132.315 133.157 1.00 104.63 ? 20   ASP A OD1 1 
ATOM   128   O  OD2 . ASP A  1 20  ? -5.773  133.214 134.186 1.00 102.17 ? 20   ASP A OD2 1 
ATOM   129   N  N   . SER A  1 21  ? -10.616 133.236 136.848 1.00 62.27  ? 21   SER A N   1 
ATOM   130   C  CA  . SER A  1 21  ? -11.593 133.843 137.748 1.00 54.28  ? 21   SER A CA  1 
ATOM   131   C  C   . SER A  1 21  ? -11.813 132.989 138.989 1.00 56.51  ? 21   SER A C   1 
ATOM   132   O  O   . SER A  1 21  ? -11.937 133.520 140.103 1.00 52.50  ? 21   SER A O   1 
ATOM   133   C  CB  . SER A  1 21  ? -12.920 134.034 137.018 1.00 46.74  ? 21   SER A CB  1 
ATOM   134   O  OG  . SER A  1 21  ? -12.768 134.876 135.898 1.00 48.94  ? 21   SER A OG  1 
ATOM   135   N  N   . TYR A  1 22  ? -11.898 131.664 138.809 1.00 57.08  ? 22   TYR A N   1 
ATOM   136   C  CA  . TYR A  1 22  ? -12.032 130.771 139.957 1.00 63.20  ? 22   TYR A CA  1 
ATOM   137   C  C   . TYR A  1 22  ? -10.800 130.839 140.844 1.00 65.51  ? 22   TYR A C   1 
ATOM   138   O  O   . TYR A  1 22  ? -10.906 130.772 142.074 1.00 60.60  ? 22   TYR A O   1 
ATOM   139   C  CB  . TYR A  1 22  ? -12.298 129.332 139.491 1.00 62.93  ? 22   TYR A CB  1 
ATOM   140   C  CG  . TYR A  1 22  ? -13.620 129.170 138.762 1.00 64.55  ? 22   TYR A CG  1 
ATOM   141   C  CD1 . TYR A  1 22  ? -14.794 128.899 139.466 1.00 63.63  ? 22   TYR A CD1 1 
ATOM   142   C  CD2 . TYR A  1 22  ? -13.701 129.309 137.381 1.00 66.20  ? 22   TYR A CD2 1 
ATOM   143   C  CE1 . TYR A  1 22  ? -16.004 128.762 138.814 1.00 60.27  ? 22   TYR A CE1 1 
ATOM   144   C  CE2 . TYR A  1 22  ? -14.914 129.182 136.718 1.00 65.63  ? 22   TYR A CE2 1 
ATOM   145   C  CZ  . TYR A  1 22  ? -16.062 128.909 137.440 1.00 64.97  ? 22   TYR A CZ  1 
ATOM   146   O  OH  . TYR A  1 22  ? -17.271 128.777 136.788 1.00 67.09  ? 22   TYR A OH  1 
ATOM   147   N  N   . GLU A  1 23  ? -9.624  130.993 140.237 1.00 71.13  ? 23   GLU A N   1 
ATOM   148   C  CA  . GLU A  1 23  ? -8.407  131.100 141.027 1.00 79.10  ? 23   GLU A CA  1 
ATOM   149   C  C   . GLU A  1 23  ? -8.413  132.376 141.863 1.00 78.15  ? 23   GLU A C   1 
ATOM   150   O  O   . GLU A  1 23  ? -8.166  132.333 143.075 1.00 79.50  ? 23   GLU A O   1 
ATOM   151   C  CB  . GLU A  1 23  ? -7.173  131.025 140.127 1.00 83.46  ? 23   GLU A CB  1 
ATOM   152   C  CG  . GLU A  1 23  ? -5.868  130.977 140.910 1.00 95.17  ? 23   GLU A CG  1 
ATOM   153   C  CD  . GLU A  1 23  ? -5.752  129.724 141.776 1.00 105.62 ? 23   GLU A CD  1 
ATOM   154   O  OE1 . GLU A  1 23  ? -6.351  128.685 141.416 1.00 107.87 ? 23   GLU A OE1 1 
ATOM   155   O  OE2 . GLU A  1 23  ? -5.072  129.781 142.825 1.00 109.25 ? 23   GLU A OE2 1 
ATOM   156   N  N   . THR A  1 24  ? -8.699  133.525 141.236 1.00 71.83  ? 24   THR A N   1 
ATOM   157   C  CA  . THR A  1 24  ? -8.691  134.771 142.002 1.00 75.69  ? 24   THR A CA  1 
ATOM   158   C  C   . THR A  1 24  ? -9.821  134.839 143.027 1.00 66.81  ? 24   THR A C   1 
ATOM   159   O  O   . THR A  1 24  ? -9.663  135.516 144.047 1.00 66.16  ? 24   THR A O   1 
ATOM   160   C  CB  . THR A  1 24  ? -8.762  136.002 141.081 1.00 73.32  ? 24   THR A CB  1 
ATOM   161   O  OG1 . THR A  1 24  ? -10.110 136.214 140.656 1.00 84.68  ? 24   THR A OG1 1 
ATOM   162   C  CG2 . THR A  1 24  ? -7.852  135.850 139.866 1.00 63.38  ? 24   THR A CG2 1 
ATOM   163   N  N   . MET A  1 25  ? -10.927 134.117 142.814 1.00 68.01  ? 25   MET A N   1 
ATOM   164   C  CA  . MET A  1 25  ? -12.012 134.115 143.794 1.00 70.71  ? 25   MET A CA  1 
ATOM   165   C  C   . MET A  1 25  ? -11.626 133.427 145.101 1.00 82.39  ? 25   MET A C   1 
ATOM   166   O  O   . MET A  1 25  ? -12.117 133.825 146.166 1.00 87.82  ? 25   MET A O   1 
ATOM   167   C  CB  . MET A  1 25  ? -13.249 133.439 143.209 1.00 65.56  ? 25   MET A CB  1 
ATOM   168   C  CG  . MET A  1 25  ? -14.169 134.365 142.459 1.00 66.07  ? 25   MET A CG  1 
ATOM   169   S  SD  . MET A  1 25  ? -15.724 133.544 142.076 1.00 67.34  ? 25   MET A SD  1 
ATOM   170   C  CE  . MET A  1 25  ? -15.167 132.149 141.104 1.00 54.22  ? 25   MET A CE  1 
ATOM   171   N  N   . MET A  1 26  ? -10.802 132.374 145.058 1.00 83.84  ? 26   MET A N   1 
ATOM   172   C  CA  . MET A  1 26  ? -10.366 131.772 146.313 1.00 87.85  ? 26   MET A CA  1 
ATOM   173   C  C   . MET A  1 26  ? -9.128  132.443 146.902 1.00 80.71  ? 26   MET A C   1 
ATOM   174   O  O   . MET A  1 26  ? -8.869  132.282 148.099 1.00 85.65  ? 26   MET A O   1 
ATOM   175   C  CB  . MET A  1 26  ? -10.094 130.265 146.186 1.00 92.75  ? 26   MET A CB  1 
ATOM   176   C  CG  . MET A  1 26  ? -8.987  129.855 145.241 1.00 96.77  ? 26   MET A CG  1 
ATOM   177   S  SD  . MET A  1 26  ? -9.077  128.087 144.863 1.00 99.05  ? 26   MET A SD  1 
ATOM   178   C  CE  . MET A  1 26  ? -8.319  127.419 146.349 1.00 96.14  ? 26   MET A CE  1 
ATOM   179   N  N   . LYS A  1 27  ? -8.357  133.184 146.103 1.00 69.38  ? 27   LYS A N   1 
ATOM   180   C  CA  . LYS A  1 27  ? -7.163  133.850 146.612 1.00 70.95  ? 27   LYS A CA  1 
ATOM   181   C  C   . LYS A  1 27  ? -7.459  135.251 147.147 1.00 69.26  ? 27   LYS A C   1 
ATOM   182   O  O   . LYS A  1 27  ? -6.869  135.663 148.154 1.00 68.03  ? 27   LYS A O   1 
ATOM   183   C  CB  . LYS A  1 27  ? -6.085  133.915 145.518 1.00 83.19  ? 27   LYS A CB  1 
ATOM   184   C  CG  . LYS A  1 27  ? -5.377  135.280 145.358 1.00 96.53  ? 27   LYS A CG  1 
ATOM   185   C  CD  . LYS A  1 27  ? -3.985  135.304 145.989 1.00 102.26 ? 27   LYS A CD  1 
ATOM   186   C  CE  . LYS A  1 27  ? -3.139  136.481 145.482 1.00 103.74 ? 27   LYS A CE  1 
ATOM   187   N  NZ  . LYS A  1 27  ? -3.769  137.289 144.382 1.00 103.34 ? 27   LYS A NZ  1 
ATOM   188   N  N   . VAL A  1 28  ? -8.354  135.994 146.499 1.00 64.24  ? 28   VAL A N   1 
ATOM   189   C  CA  . VAL A  1 28  ? -8.648  137.371 146.882 1.00 61.59  ? 28   VAL A CA  1 
ATOM   190   C  C   . VAL A  1 28  ? -9.930  137.468 147.706 1.00 61.68  ? 28   VAL A C   1 
ATOM   191   O  O   . VAL A  1 28  ? -10.017 138.288 148.621 1.00 61.80  ? 28   VAL A O   1 
ATOM   192   C  CB  . VAL A  1 28  ? -8.713  138.276 145.630 1.00 65.45  ? 28   VAL A CB  1 
ATOM   193   C  CG1 . VAL A  1 28  ? -9.078  139.700 146.015 1.00 70.89  ? 28   VAL A CG1 1 
ATOM   194   C  CG2 . VAL A  1 28  ? -7.377  138.267 144.897 1.00 63.72  ? 28   VAL A CG2 1 
ATOM   195   N  N   . GLY A  1 29  ? -10.926 136.632 147.402 1.00 65.90  ? 29   GLY A N   1 
ATOM   196   C  CA  . GLY A  1 29  ? -12.195 136.616 148.103 1.00 67.17  ? 29   GLY A CA  1 
ATOM   197   C  C   . GLY A  1 29  ? -12.103 136.578 149.620 1.00 63.09  ? 29   GLY A C   1 
ATOM   198   O  O   . GLY A  1 29  ? -12.632 137.454 150.314 1.00 62.11  ? 29   GLY A O   1 
ATOM   199   N  N   . PRO A  1 30  ? -11.427 135.556 150.170 1.00 65.01  ? 30   PRO A N   1 
ATOM   200   C  CA  . PRO A  1 30  ? -11.241 135.517 151.633 1.00 63.39  ? 30   PRO A CA  1 
ATOM   201   C  C   . PRO A  1 30  ? -10.598 136.778 152.195 1.00 60.17  ? 30   PRO A C   1 
ATOM   202   O  O   . PRO A  1 30  ? -10.962 137.213 153.296 1.00 60.88  ? 30   PRO A O   1 
ATOM   203   C  CB  . PRO A  1 30  ? -10.371 134.266 151.845 1.00 49.57  ? 30   PRO A CB  1 
ATOM   204   C  CG  . PRO A  1 30  ? -10.688 133.400 150.681 1.00 57.04  ? 30   PRO A CG  1 
ATOM   205   C  CD  . PRO A  1 30  ? -10.951 134.320 149.522 1.00 63.73  ? 30   PRO A CD  1 
ATOM   206   N  N   . LYS A  1 31  ? -9.672  137.396 151.461 1.00 48.76  ? 31   LYS A N   1 
ATOM   207   C  CA  . LYS A  1 31  ? -9.026  138.592 151.982 1.00 45.24  ? 31   LYS A CA  1 
ATOM   208   C  C   . LYS A  1 31  ? -10.032 139.730 152.148 1.00 48.24  ? 31   LYS A C   1 
ATOM   209   O  O   . LYS A  1 31  ? -9.947  140.508 153.105 1.00 48.92  ? 31   LYS A O   1 
ATOM   210   C  CB  . LYS A  1 31  ? -7.873  138.994 151.068 1.00 50.27  ? 31   LYS A CB  1 
ATOM   211   C  CG  . LYS A  1 31  ? -6.768  137.950 151.018 1.00 48.41  ? 31   LYS A CG  1 
ATOM   212   C  CD  . LYS A  1 31  ? -5.544  138.477 150.291 1.00 49.08  ? 31   LYS A CD  1 
ATOM   213   C  CE  . LYS A  1 31  ? -4.294  137.775 150.773 1.00 48.62  ? 31   LYS A CE  1 
ATOM   214   N  NZ  . LYS A  1 31  ? -4.355  136.344 150.483 1.00 51.66  ? 31   LYS A NZ  1 
ATOM   215   N  N   . VAL A  1 32  ? -11.007 139.828 151.251 1.00 45.44  ? 32   VAL A N   1 
ATOM   216   C  CA  . VAL A  1 32  ? -12.044 140.837 151.379 1.00 43.27  ? 32   VAL A CA  1 
ATOM   217   C  C   . VAL A  1 32  ? -12.915 140.572 152.623 1.00 45.32  ? 32   VAL A C   1 
ATOM   218   O  O   . VAL A  1 32  ? -13.262 141.497 153.355 1.00 43.72  ? 32   VAL A O   1 
ATOM   219   C  CB  . VAL A  1 32  ? -12.906 140.898 150.102 1.00 46.62  ? 32   VAL A CB  1 
ATOM   220   C  CG1 . VAL A  1 32  ? -14.077 141.872 150.290 1.00 39.48  ? 32   VAL A CG1 1 
ATOM   221   C  CG2 . VAL A  1 32  ? -12.051 141.307 148.909 1.00 45.14  ? 32   VAL A CG2 1 
HETATM 222   N  N   . CSS A  1 33  ? -13.258 139.308 152.860 1.00 42.43  ? 33   CSS A N   1 
HETATM 223   C  CA  . CSS A  1 33  ? -14.061 138.952 154.000 1.00 46.58  ? 33   CSS A CA  1 
HETATM 224   C  CB  . CSS A  1 33  ? -14.503 137.522 153.919 1.00 56.35  ? 33   CSS A CB  1 
HETATM 225   S  SG  . CSS A  1 33  ? -15.637 137.304 152.580 1.00 65.76  ? 33   CSS A SG  1 
HETATM 226   S  SD  . CSS A  1 33  ? -16.994 138.797 152.672 0.50 59.71  ? 33   CSS A SD  1 
HETATM 227   C  C   . CSS A  1 33  ? -13.304 139.177 155.270 1.00 44.65  ? 33   CSS A C   1 
HETATM 228   O  O   . CSS A  1 33  ? -13.899 139.582 156.295 1.00 41.19  ? 33   CSS A O   1 
ATOM   229   N  N   . ILE A  1 34  ? -11.996 138.941 155.257 1.00 36.82  ? 34   ILE A N   1 
ATOM   230   C  CA  . ILE A  1 34  ? -11.213 139.162 156.465 1.00 35.16  ? 34   ILE A CA  1 
ATOM   231   C  C   . ILE A  1 34  ? -11.245 140.656 156.794 1.00 38.32  ? 34   ILE A C   1 
ATOM   232   O  O   . ILE A  1 34  ? -11.446 141.065 157.946 1.00 38.48  ? 34   ILE A O   1 
ATOM   233   C  CB  . ILE A  1 34  ? -9.792  138.622 156.300 1.00 39.28  ? 34   ILE A CB  1 
ATOM   234   C  CG1 . ILE A  1 34  ? -9.841  137.095 156.196 1.00 38.98  ? 34   ILE A CG1 1 
ATOM   235   C  CG2 . ILE A  1 34  ? -8.931  139.037 157.476 1.00 32.78  ? 34   ILE A CG2 1 
ATOM   236   C  CD1 . ILE A  1 34  ? -8.514  136.461 155.799 1.00 43.78  ? 34   ILE A CD1 1 
ATOM   237   N  N   . THR A  1 35  ? -11.110 141.475 155.754 1.00 39.49  ? 35   THR A N   1 
ATOM   238   C  CA  . THR A  1 35  ? -11.222 142.915 155.935 1.00 42.45  ? 35   THR A CA  1 
ATOM   239   C  C   . THR A  1 35  ? -12.595 143.298 156.479 1.00 43.45  ? 35   THR A C   1 
ATOM   240   O  O   . THR A  1 35  ? -12.700 144.049 157.453 1.00 39.70  ? 35   THR A O   1 
ATOM   241   C  CB  . THR A  1 35  ? -10.948 143.615 154.604 1.00 37.83  ? 35   THR A CB  1 
ATOM   242   O  OG1 . THR A  1 35  ? -9.629  143.273 154.152 1.00 47.77  ? 35   THR A OG1 1 
ATOM   243   C  CG2 . THR A  1 35  ? -11.054 145.090 154.773 1.00 34.58  ? 35   THR A CG2 1 
ATOM   244   N  N   . THR A  1 36  ? -13.657 142.732 155.895 1.00 45.34  ? 36   THR A N   1 
ATOM   245   C  CA  . THR A  1 36  ? -15.019 143.069 156.299 1.00 48.66  ? 36   THR A CA  1 
ATOM   246   C  C   . THR A  1 36  ? -15.271 142.744 157.768 1.00 45.45  ? 36   THR A C   1 
ATOM   247   O  O   . THR A  1 36  ? -15.844 143.558 158.504 1.00 41.63  ? 36   THR A O   1 
ATOM   248   C  CB  . THR A  1 36  ? -16.008 142.298 155.430 1.00 52.31  ? 36   THR A CB  1 
ATOM   249   O  OG1 . THR A  1 36  ? -15.695 142.508 154.052 1.00 54.43  ? 36   THR A OG1 1 
ATOM   250   C  CG2 . THR A  1 36  ? -17.390 142.818 155.664 1.00 53.77  ? 36   THR A CG2 1 
ATOM   251   N  N   . ALA A  1 37  ? -14.814 141.576 158.223 1.00 40.56  ? 37   ALA A N   1 
ATOM   252   C  CA  . ALA A  1 37  ? -15.068 141.105 159.590 1.00 30.45  ? 37   ALA A CA  1 
ATOM   253   C  C   . ALA A  1 37  ? -14.243 141.833 160.661 1.00 39.11  ? 37   ALA A C   1 
ATOM   254   O  O   . ALA A  1 37  ? -14.243 141.382 161.818 1.00 33.69  ? 37   ALA A O   1 
ATOM   255   C  CB  . ALA A  1 37  ? -14.829 139.603 159.689 1.00 33.78  ? 37   ALA A CB  1 
ATOM   256   N  N   . SER A  1 38  ? -13.480 142.881 160.343 1.00 38.36  ? 38   SER A N   1 
ATOM   257   C  CA  . SER A  1 38  ? -12.918 143.712 161.397 1.00 37.50  ? 38   SER A CA  1 
ATOM   258   C  C   . SER A  1 38  ? -13.968 144.613 162.038 1.00 38.93  ? 38   SER A C   1 
ATOM   259   O  O   . SER A  1 38  ? -13.696 145.211 163.083 1.00 42.33  ? 38   SER A O   1 
ATOM   260   C  CB  . SER A  1 38  ? -11.782 144.576 160.850 1.00 41.20  ? 38   SER A CB  1 
ATOM   261   O  OG  . SER A  1 38  ? -12.269 145.499 159.888 1.00 39.95  ? 38   SER A OG  1 
ATOM   262   N  N   . HIS A  1 39  ? -15.171 144.722 161.444 1.00 39.71  ? 39   HIS A N   1 
ATOM   263   C  CA  . HIS A  1 39  ? -16.104 145.716 161.963 1.00 38.45  ? 39   HIS A CA  1 
ATOM   264   C  C   . HIS A  1 39  ? -17.119 145.074 162.894 1.00 36.59  ? 39   HIS A C   1 
ATOM   265   O  O   . HIS A  1 39  ? -17.706 144.041 162.545 1.00 37.82  ? 39   HIS A O   1 
ATOM   266   C  CB  . HIS A  1 39  ? -16.826 146.420 160.817 1.00 35.80  ? 39   HIS A CB  1 
ATOM   267   C  CG  . HIS A  1 39  ? -17.551 147.651 161.248 1.00 38.78  ? 39   HIS A CG  1 
ATOM   268   N  ND1 . HIS A  1 39  ? -18.737 147.604 161.950 1.00 34.01  ? 39   HIS A ND1 1 
ATOM   269   C  CD2 . HIS A  1 39  ? -17.242 148.964 161.108 1.00 33.60  ? 39   HIS A CD2 1 
ATOM   270   C  CE1 . HIS A  1 39  ? -19.134 148.836 162.215 1.00 36.91  ? 39   HIS A CE1 1 
ATOM   271   N  NE2 . HIS A  1 39  ? -18.241 149.678 161.720 1.00 35.09  ? 39   HIS A NE2 1 
ATOM   272   N  N   . PRO A  1 40  ? -17.381 145.674 164.059 1.00 41.48  ? 40   PRO A N   1 
ATOM   273   C  CA  . PRO A  1 40  ? -18.293 145.040 165.029 1.00 32.35  ? 40   PRO A CA  1 
ATOM   274   C  C   . PRO A  1 40  ? -19.737 144.950 164.562 1.00 39.47  ? 40   PRO A C   1 
ATOM   275   O  O   . PRO A  1 40  ? -20.507 144.173 165.147 1.00 39.90  ? 40   PRO A O   1 
ATOM   276   C  CB  . PRO A  1 40  ? -18.196 145.956 166.260 1.00 37.41  ? 40   PRO A CB  1 
ATOM   277   C  CG  . PRO A  1 40  ? -17.784 147.300 165.695 1.00 33.63  ? 40   PRO A CG  1 
ATOM   278   C  CD  . PRO A  1 40  ? -16.869 146.977 164.528 1.00 36.34  ? 40   PRO A CD  1 
ATOM   279   N  N   . GLY A  1 41  ? -20.140 145.724 163.555 1.00 36.05  ? 41   GLY A N   1 
ATOM   280   C  CA  . GLY A  1 41  ? -21.472 145.596 163.000 1.00 31.92  ? 41   GLY A CA  1 
ATOM   281   C  C   . GLY A  1 41  ? -21.642 144.513 161.948 1.00 37.49  ? 41   GLY A C   1 
ATOM   282   O  O   . GLY A  1 41  ? -22.768 144.262 161.497 1.00 30.98  ? 41   GLY A O   1 
ATOM   283   N  N   . PHE A  1 42  ? -20.561 143.819 161.590 1.00 30.73  ? 42   PHE A N   1 
ATOM   284   C  CA  . PHE A  1 42  ? -20.605 142.793 160.555 1.00 30.90  ? 42   PHE A CA  1 
ATOM   285   C  C   . PHE A  1 42  ? -21.125 141.480 161.120 1.00 31.40  ? 42   PHE A C   1 
ATOM   286   O  O   . PHE A  1 42  ? -20.597 140.969 162.110 1.00 34.76  ? 42   PHE A O   1 
ATOM   287   C  CB  . PHE A  1 42  ? -19.221 142.576 159.961 1.00 30.80  ? 42   PHE A CB  1 
ATOM   288   C  CG  . PHE A  1 42  ? -19.157 141.435 158.973 1.00 34.06  ? 42   PHE A CG  1 
ATOM   289   C  CD1 . PHE A  1 42  ? -19.778 141.530 157.736 1.00 31.15  ? 42   PHE A CD1 1 
ATOM   290   C  CD2 . PHE A  1 42  ? -18.476 140.262 159.288 1.00 40.53  ? 42   PHE A CD2 1 
ATOM   291   C  CE1 . PHE A  1 42  ? -19.718 140.489 156.822 1.00 31.32  ? 42   PHE A CE1 1 
ATOM   292   C  CE2 . PHE A  1 42  ? -18.416 139.204 158.380 1.00 40.25  ? 42   PHE A CE2 1 
ATOM   293   C  CZ  . PHE A  1 42  ? -19.038 139.319 157.140 1.00 32.98  ? 42   PHE A CZ  1 
ATOM   294   N  N   . LEU A  1 43  ? -22.160 140.929 160.482 1.00 33.32  ? 43   LEU A N   1 
ATOM   295   C  CA  . LEU A  1 43  ? -22.862 139.768 161.010 1.00 31.38  ? 43   LEU A CA  1 
ATOM   296   C  C   . LEU A  1 43  ? -22.682 138.487 160.200 1.00 33.01  ? 43   LEU A C   1 
ATOM   297   O  O   . LEU A  1 43  ? -22.906 137.399 160.746 1.00 31.61  ? 43   LEU A O   1 
ATOM   298   C  CB  . LEU A  1 43  ? -24.359 140.075 161.118 1.00 34.48  ? 43   LEU A CB  1 
ATOM   299   C  CG  . LEU A  1 43  ? -24.726 141.322 161.912 1.00 37.29  ? 43   LEU A CG  1 
ATOM   300   C  CD1 . LEU A  1 43  ? -26.249 141.567 161.861 1.00 35.91  ? 43   LEU A CD1 1 
ATOM   301   C  CD2 . LEU A  1 43  ? -24.236 141.182 163.344 1.00 39.87  ? 43   LEU A CD2 1 
ATOM   302   N  N   . GLY A  1 44  ? -22.262 138.574 158.948 1.00 33.08  ? 44   GLY A N   1 
ATOM   303   C  CA  . GLY A  1 44  ? -22.074 137.380 158.150 1.00 32.52  ? 44   GLY A CA  1 
ATOM   304   C  C   . GLY A  1 44  ? -22.130 137.697 156.671 1.00 34.84  ? 44   GLY A C   1 
ATOM   305   O  O   . GLY A  1 44  ? -22.275 138.851 156.262 1.00 32.78  ? 44   GLY A O   1 
ATOM   306   N  N   . PHE A  1 45  ? -21.965 136.642 155.870 1.00 32.02  ? 45   PHE A N   1 
ATOM   307   C  CA  . PHE A  1 45  ? -21.907 136.831 154.430 1.00 32.14  ? 45   PHE A CA  1 
ATOM   308   C  C   . PHE A  1 45  ? -22.323 135.558 153.699 1.00 36.74  ? 45   PHE A C   1 
ATOM   309   O  O   . PHE A  1 45  ? -22.362 134.464 154.273 1.00 32.43  ? 45   PHE A O   1 
ATOM   310   C  CB  . PHE A  1 45  ? -20.510 137.301 153.980 1.00 36.42  ? 45   PHE A CB  1 
ATOM   311   C  CG  . PHE A  1 45  ? -19.445 136.250 154.056 1.00 34.92  ? 45   PHE A CG  1 
ATOM   312   C  CD1 . PHE A  1 45  ? -19.240 135.360 152.999 1.00 47.17  ? 45   PHE A CD1 1 
ATOM   313   C  CD2 . PHE A  1 45  ? -18.625 136.158 155.174 1.00 38.63  ? 45   PHE A CD2 1 
ATOM   314   C  CE1 . PHE A  1 45  ? -18.245 134.371 153.064 1.00 48.43  ? 45   PHE A CE1 1 
ATOM   315   C  CE2 . PHE A  1 45  ? -17.605 135.173 155.247 1.00 44.02  ? 45   PHE A CE2 1 
ATOM   316   C  CZ  . PHE A  1 45  ? -17.426 134.280 154.193 1.00 46.85  ? 45   PHE A CZ  1 
ATOM   317   N  N   . GLU A  1 46  ? -22.653 135.733 152.416 1.00 32.54  ? 46   GLU A N   1 
ATOM   318   C  CA  . GLU A  1 46  ? -22.980 134.647 151.495 1.00 37.21  ? 46   GLU A CA  1 
ATOM   319   C  C   . GLU A  1 46  ? -22.279 134.953 150.187 1.00 33.99  ? 46   GLU A C   1 
ATOM   320   O  O   . GLU A  1 46  ? -22.493 136.024 149.622 1.00 35.13  ? 46   GLU A O   1 
ATOM   321   C  CB  . GLU A  1 46  ? -24.491 134.536 151.241 1.00 33.57  ? 46   GLU A CB  1 
ATOM   322   C  CG  . GLU A  1 46  ? -25.342 134.431 152.471 1.00 37.27  ? 46   GLU A CG  1 
ATOM   323   C  CD  . GLU A  1 46  ? -25.420 133.014 152.991 1.00 45.08  ? 46   GLU A CD  1 
ATOM   324   O  OE1 . GLU A  1 46  ? -24.918 132.118 152.299 1.00 45.38  ? 46   GLU A OE1 1 
ATOM   325   O  OE2 . GLU A  1 46  ? -25.975 132.799 154.087 1.00 47.56  ? 46   GLU A OE2 1 
ATOM   326   N  N   . GLN A  1 47  ? -21.417 134.055 149.728 1.00 32.84  ? 47   GLN A N   1 
ATOM   327   C  CA  . GLN A  1 47  ? -20.800 134.188 148.415 1.00 32.89  ? 47   GLN A CA  1 
ATOM   328   C  C   . GLN A  1 47  ? -21.543 133.265 147.451 1.00 35.27  ? 47   GLN A C   1 
ATOM   329   O  O   . GLN A  1 47  ? -21.482 132.033 147.573 1.00 33.29  ? 47   GLN A O   1 
ATOM   330   C  CB  . GLN A  1 47  ? -19.302 133.882 148.458 1.00 38.33  ? 47   GLN A CB  1 
ATOM   331   C  CG  . GLN A  1 47  ? -18.578 134.265 147.154 1.00 54.80  ? 47   GLN A CG  1 
ATOM   332   C  CD  . GLN A  1 47  ? -17.112 133.857 147.129 1.00 70.79  ? 47   GLN A CD  1 
ATOM   333   O  OE1 . GLN A  1 47  ? -16.768 132.712 147.427 1.00 71.92  ? 47   GLN A OE1 1 
ATOM   334   N  NE2 . GLN A  1 47  ? -16.241 134.794 146.760 1.00 80.09  ? 47   GLN A NE2 1 
ATOM   335   N  N   . LEU A  1 48  ? -22.277 133.859 146.514 1.00 26.54  ? 48   LEU A N   1 
ATOM   336   C  CA  . LEU A  1 48  ? -23.138 133.110 145.611 1.00 28.44  ? 48   LEU A CA  1 
ATOM   337   C  C   . LEU A  1 48  ? -22.592 133.213 144.194 1.00 36.68  ? 48   LEU A C   1 
ATOM   338   O  O   . LEU A  1 48  ? -22.378 134.318 143.687 1.00 31.14  ? 48   LEU A O   1 
ATOM   339   C  CB  . LEU A  1 48  ? -24.562 133.649 145.671 1.00 22.96  ? 48   LEU A CB  1 
ATOM   340   C  CG  . LEU A  1 48  ? -25.254 133.711 147.030 1.00 39.83  ? 48   LEU A CG  1 
ATOM   341   C  CD1 . LEU A  1 48  ? -26.641 134.344 146.882 1.00 37.35  ? 48   LEU A CD1 1 
ATOM   342   C  CD2 . LEU A  1 48  ? -25.394 132.309 147.608 1.00 33.75  ? 48   LEU A CD2 1 
ATOM   343   N  N   . LEU A  1 49  ? -22.367 132.068 143.559 1.00 32.29  ? 49   LEU A N   1 
ATOM   344   C  CA  . LEU A  1 49  ? -21.923 132.009 142.174 1.00 24.20  ? 49   LEU A CA  1 
ATOM   345   C  C   . LEU A  1 49  ? -23.063 131.483 141.310 1.00 26.20  ? 49   LEU A C   1 
ATOM   346   O  O   . LEU A  1 49  ? -23.644 130.439 141.616 1.00 29.32  ? 49   LEU A O   1 
ATOM   347   C  CB  . LEU A  1 49  ? -20.676 131.120 142.030 1.00 30.86  ? 49   LEU A CB  1 
ATOM   348   C  CG  . LEU A  1 49  ? -20.082 131.117 140.619 1.00 38.63  ? 49   LEU A CG  1 
ATOM   349   C  CD1 . LEU A  1 49  ? -19.613 132.529 140.258 1.00 41.57  ? 49   LEU A CD1 1 
ATOM   350   C  CD2 . LEU A  1 49  ? -18.925 130.117 140.503 1.00 39.28  ? 49   LEU A CD2 1 
ATOM   351   N  N   . GLN A  1 50  ? -23.401 132.198 140.243 1.00 31.76  ? 50   GLN A N   1 
ATOM   352   C  CA  . GLN A  1 50  ? -24.527 131.755 139.421 1.00 29.48  ? 50   GLN A CA  1 
ATOM   353   C  C   . GLN A  1 50  ? -24.194 130.460 138.688 1.00 31.59  ? 50   GLN A C   1 
ATOM   354   O  O   . GLN A  1 50  ? -23.089 130.294 138.166 1.00 25.64  ? 50   GLN A O   1 
ATOM   355   C  CB  . GLN A  1 50  ? -24.930 132.824 138.411 1.00 25.40  ? 50   GLN A CB  1 
ATOM   356   C  CG  . GLN A  1 50  ? -26.098 132.400 137.545 1.00 26.91  ? 50   GLN A CG  1 
ATOM   357   C  CD  . GLN A  1 50  ? -26.486 133.487 136.569 1.00 36.02  ? 50   GLN A CD  1 
ATOM   358   O  OE1 . GLN A  1 50  ? -25.726 134.423 136.331 1.00 29.73  ? 50   GLN A OE1 1 
ATOM   359   N  NE2 . GLN A  1 50  ? -27.664 133.370 136.003 1.00 25.52  ? 50   GLN A NE2 1 
ATOM   360   N  N   . THR A  1 51  ? -25.156 129.526 138.681 1.00 30.86  ? 51   THR A N   1 
ATOM   361   C  CA  . THR A  1 51  ? -25.048 128.269 137.956 1.00 29.17  ? 51   THR A CA  1 
ATOM   362   C  C   . THR A  1 51  ? -26.033 128.148 136.806 1.00 34.93  ? 51   THR A C   1 
ATOM   363   O  O   . THR A  1 51  ? -25.839 127.292 135.938 1.00 33.41  ? 51   THR A O   1 
ATOM   364   C  CB  . THR A  1 51  ? -25.290 127.086 138.906 1.00 30.26  ? 51   THR A CB  1 
ATOM   365   O  OG1 . THR A  1 51  ? -26.559 127.259 139.555 1.00 30.75  ? 51   THR A OG1 1 
ATOM   366   C  CG2 . THR A  1 51  ? -24.186 127.003 139.944 1.00 26.35  ? 51   THR A CG2 1 
ATOM   367   N  N   . GLY A  1 52  ? -27.064 128.986 136.765 1.00 27.63  ? 52   GLY A N   1 
ATOM   368   C  CA  . GLY A  1 52  ? -28.044 128.903 135.697 1.00 29.08  ? 52   GLY A CA  1 
ATOM   369   C  C   . GLY A  1 52  ? -29.240 129.791 136.000 1.00 35.80  ? 52   GLY A C   1 
ATOM   370   O  O   . GLY A  1 52  ? -29.146 130.733 136.792 1.00 30.87  ? 52   GLY A O   1 
ATOM   371   N  N   . ILE A  1 53  ? -30.364 129.478 135.350 1.00 28.58  ? 53   ILE A N   1 
ATOM   372   C  CA  . ILE A  1 53  ? -31.614 130.213 135.535 1.00 29.79  ? 53   ILE A CA  1 
ATOM   373   C  C   . ILE A  1 53  ? -32.766 129.218 135.526 1.00 32.53  ? 53   ILE A C   1 
ATOM   374   O  O   . ILE A  1 53  ? -32.602 128.035 135.211 1.00 30.57  ? 53   ILE A O   1 
ATOM   375   C  CB  . ILE A  1 53  ? -31.870 131.272 134.441 1.00 26.51  ? 53   ILE A CB  1 
ATOM   376   C  CG1 . ILE A  1 53  ? -32.165 130.565 133.102 1.00 32.35  ? 53   ILE A CG1 1 
ATOM   377   C  CG2 . ILE A  1 53  ? -30.739 132.294 134.339 1.00 25.70  ? 53   ILE A CG2 1 
ATOM   378   C  CD1 . ILE A  1 53  ? -32.761 131.476 132.025 1.00 28.93  ? 53   ILE A CD1 1 
ATOM   379   N  N   . HIS A  1 54  ? -33.949 129.715 135.883 1.00 28.42  ? 54   HIS A N   1 
ATOM   380   C  CA  . HIS A  1 54  ? -35.164 128.955 135.647 1.00 32.01  ? 54   HIS A CA  1 
ATOM   381   C  C   . HIS A  1 54  ? -35.729 129.333 134.281 1.00 26.34  ? 54   HIS A C   1 
ATOM   382   O  O   . HIS A  1 54  ? -36.090 130.492 134.076 1.00 33.99  ? 54   HIS A O   1 
ATOM   383   C  CB  . HIS A  1 54  ? -36.205 129.204 136.725 1.00 34.88  ? 54   HIS A CB  1 
ATOM   384   C  CG  . HIS A  1 54  ? -37.244 128.122 136.791 1.00 45.59  ? 54   HIS A CG  1 
ATOM   385   N  ND1 . HIS A  1 54  ? -38.095 127.844 135.743 1.00 42.70  ? 54   HIS A ND1 1 
ATOM   386   C  CD2 . HIS A  1 54  ? -37.533 127.216 137.759 1.00 45.62  ? 54   HIS A CD2 1 
ATOM   387   C  CE1 . HIS A  1 54  ? -38.873 126.825 136.068 1.00 49.34  ? 54   HIS A CE1 1 
ATOM   388   N  NE2 . HIS A  1 54  ? -38.551 126.423 137.286 1.00 44.96  ? 54   HIS A NE2 1 
ATOM   389   N  N   . PRO A  1 55  ? -35.801 128.407 133.325 1.00 35.85  ? 55   PRO A N   1 
ATOM   390   C  CA  . PRO A  1 55  ? -36.335 128.745 131.994 1.00 39.13  ? 55   PRO A CA  1 
ATOM   391   C  C   . PRO A  1 55  ? -37.837 129.031 131.984 1.00 42.13  ? 55   PRO A C   1 
ATOM   392   O  O   . PRO A  1 55  ? -38.341 129.523 130.963 1.00 38.32  ? 55   PRO A O   1 
ATOM   393   C  CB  . PRO A  1 55  ? -36.014 127.496 131.154 1.00 33.14  ? 55   PRO A CB  1 
ATOM   394   C  CG  . PRO A  1 55  ? -35.058 126.698 131.976 1.00 31.35  ? 55   PRO A CG  1 
ATOM   395   C  CD  . PRO A  1 55  ? -35.360 127.006 133.403 1.00 30.51  ? 55   PRO A CD  1 
ATOM   396   N  N   . MET A  1 56  ? -38.549 128.715 133.069 1.00 34.19  ? 56   MET A N   1 
ATOM   397   C  CA  . MET A  1 56  ? -39.973 129.009 133.245 1.00 42.85  ? 56   MET A CA  1 
ATOM   398   C  C   . MET A  1 56  ? -40.798 128.514 132.056 1.00 36.71  ? 56   MET A C   1 
ATOM   399   O  O   . MET A  1 56  ? -41.547 129.261 131.422 1.00 38.56  ? 56   MET A O   1 
ATOM   400   C  CB  . MET A  1 56  ? -40.202 130.506 133.508 1.00 38.17  ? 56   MET A CB  1 
ATOM   401   C  CG  . MET A  1 56  ? -39.991 130.864 134.973 1.00 55.19  ? 56   MET A CG  1 
ATOM   402   S  SD  . MET A  1 56  ? -40.127 132.626 135.357 1.00 72.26  ? 56   MET A SD  1 
ATOM   403   C  CE  . MET A  1 56  ? -41.812 132.971 134.828 1.00 69.27  ? 56   MET A CE  1 
ATOM   404   N  N   . ALA A  1 57  ? -40.642 127.214 131.775 1.00 32.71  ? 57   ALA A N   1 
ATOM   405   C  CA  . ALA A  1 57  ? -41.448 126.519 130.784 1.00 37.16  ? 57   ALA A CA  1 
ATOM   406   C  C   . ALA A  1 57  ? -41.294 127.156 129.404 1.00 43.87  ? 57   ALA A C   1 
ATOM   407   O  O   . ALA A  1 57  ? -42.246 127.236 128.621 1.00 44.16  ? 57   ALA A O   1 
ATOM   408   C  CB  . ALA A  1 57  ? -42.920 126.459 131.220 1.00 33.02  ? 57   ALA A CB  1 
ATOM   409   N  N   . GLY A  1 58  ? -40.078 127.610 129.100 1.00 41.60  ? 58   GLY A N   1 
ATOM   410   C  CA  . GLY A  1 58  ? -39.743 128.121 127.783 1.00 35.80  ? 58   GLY A CA  1 
ATOM   411   C  C   . GLY A  1 58  ? -39.761 129.629 127.640 1.00 38.53  ? 58   GLY A C   1 
ATOM   412   O  O   . GLY A  1 58  ? -39.386 130.134 126.572 1.00 40.15  ? 58   GLY A O   1 
ATOM   413   N  N   . ARG A  1 59  ? -40.221 130.357 128.664 1.00 39.13  ? 59   ARG A N   1 
ATOM   414   C  CA  . ARG A  1 59  ? -40.161 131.817 128.633 1.00 39.25  ? 59   ARG A CA  1 
ATOM   415   C  C   . ARG A  1 59  ? -38.722 132.297 128.480 1.00 41.28  ? 59   ARG A C   1 
ATOM   416   O  O   . ARG A  1 59  ? -38.464 133.273 127.775 1.00 49.27  ? 59   ARG A O   1 
ATOM   417   C  CB  . ARG A  1 59  ? -40.800 132.379 129.900 1.00 42.74  ? 59   ARG A CB  1 
ATOM   418   C  CG  . ARG A  1 59  ? -40.592 133.850 130.159 1.00 45.70  ? 59   ARG A CG  1 
ATOM   419   C  CD  . ARG A  1 59  ? -41.321 134.728 129.177 1.00 41.21  ? 59   ARG A CD  1 
ATOM   420   N  NE  . ARG A  1 59  ? -41.119 136.127 129.526 1.00 45.60  ? 59   ARG A NE  1 
ATOM   421   C  CZ  . ARG A  1 59  ? -40.097 136.865 129.108 1.00 55.53  ? 59   ARG A CZ  1 
ATOM   422   N  NH1 . ARG A  1 59  ? -39.178 136.331 128.303 1.00 49.85  ? 59   ARG A NH1 1 
ATOM   423   N  NH2 . ARG A  1 59  ? -39.993 138.136 129.499 1.00 56.29  ? 59   ARG A NH2 1 
ATOM   424   N  N   . TYR A  1 60  ? -37.766 131.584 129.083 1.00 36.85  ? 60   TYR A N   1 
ATOM   425   C  CA  . TYR A  1 60  ? -36.355 131.850 128.837 1.00 36.58  ? 60   TYR A CA  1 
ATOM   426   C  C   . TYR A  1 60  ? -35.705 130.586 128.308 1.00 38.92  ? 60   TYR A C   1 
ATOM   427   O  O   . TYR A  1 60  ? -34.797 130.022 128.941 1.00 39.47  ? 60   TYR A O   1 
ATOM   428   C  CB  . TYR A  1 60  ? -35.659 132.333 130.107 1.00 33.79  ? 60   TYR A CB  1 
ATOM   429   C  CG  . TYR A  1 60  ? -36.372 133.494 130.720 1.00 40.34  ? 60   TYR A CG  1 
ATOM   430   C  CD1 . TYR A  1 60  ? -36.287 134.760 130.149 1.00 41.07  ? 60   TYR A CD1 1 
ATOM   431   C  CD2 . TYR A  1 60  ? -37.162 133.332 131.847 1.00 38.16  ? 60   TYR A CD2 1 
ATOM   432   C  CE1 . TYR A  1 60  ? -36.957 135.839 130.689 1.00 39.15  ? 60   TYR A CE1 1 
ATOM   433   C  CE2 . TYR A  1 60  ? -37.844 134.413 132.400 1.00 36.27  ? 60   TYR A CE2 1 
ATOM   434   C  CZ  . TYR A  1 60  ? -37.732 135.663 131.806 1.00 40.76  ? 60   TYR A CZ  1 
ATOM   435   O  OH  . TYR A  1 60  ? -38.381 136.742 132.337 1.00 39.48  ? 60   TYR A OH  1 
ATOM   436   N  N   . GLY A  1 61  ? -36.178 130.140 127.141 1.00 37.39  ? 61   GLY A N   1 
ATOM   437   C  CA  . GLY A  1 61  ? -35.778 128.871 126.565 1.00 31.02  ? 61   GLY A CA  1 
ATOM   438   C  C   . GLY A  1 61  ? -34.334 128.812 126.123 1.00 40.19  ? 61   GLY A C   1 
ATOM   439   O  O   . GLY A  1 61  ? -33.825 127.712 125.877 1.00 45.37  ? 61   GLY A O   1 
ATOM   440   N  N   . GLY A  1 62  ? -33.664 129.962 126.002 1.00 40.36  ? 62   GLY A N   1 
ATOM   441   C  CA  . GLY A  1 62  ? -32.242 129.942 125.719 1.00 42.27  ? 62   GLY A CA  1 
ATOM   442   C  C   . GLY A  1 62  ? -31.382 129.618 126.919 1.00 38.99  ? 62   GLY A C   1 
ATOM   443   O  O   . GLY A  1 62  ? -30.206 129.304 126.755 1.00 34.55  ? 62   GLY A O   1 
ATOM   444   N  N   . GLY A  1 63  ? -31.940 129.694 128.127 1.00 41.04  ? 63   GLY A N   1 
ATOM   445   C  CA  . GLY A  1 63  ? -31.210 129.371 129.329 1.00 34.68  ? 63   GLY A CA  1 
ATOM   446   C  C   . GLY A  1 63  ? -31.502 127.950 129.775 1.00 33.46  ? 63   GLY A C   1 
ATOM   447   O  O   . GLY A  1 63  ? -32.199 127.184 129.108 1.00 34.38  ? 63   GLY A O   1 
ATOM   448   N  N   . ALA A  1 64  ? -30.943 127.608 130.932 1.00 32.01  ? 64   ALA A N   1 
ATOM   449   C  CA  . ALA A  1 64  ? -31.086 126.269 131.488 1.00 35.43  ? 64   ALA A CA  1 
ATOM   450   C  C   . ALA A  1 64  ? -30.798 126.339 132.974 1.00 28.99  ? 64   ALA A C   1 
ATOM   451   O  O   . ALA A  1 64  ? -30.145 127.266 133.453 1.00 31.07  ? 64   ALA A O   1 
ATOM   452   C  CB  . ALA A  1 64  ? -30.142 125.252 130.821 1.00 27.71  ? 64   ALA A CB  1 
ATOM   453   N  N   . VAL A  1 65  ? -31.299 125.336 133.696 1.00 27.75  ? 65   VAL A N   1 
ATOM   454   C  CA  . VAL A  1 65  ? -31.000 125.222 135.119 1.00 29.41  ? 65   VAL A CA  1 
ATOM   455   C  C   . VAL A  1 65  ? -29.493 125.186 135.339 1.00 34.44  ? 65   VAL A C   1 
ATOM   456   O  O   . VAL A  1 65  ? -28.951 125.902 136.188 1.00 31.12  ? 65   VAL A O   1 
ATOM   457   C  CB  . VAL A  1 65  ? -31.682 123.971 135.698 1.00 30.64  ? 65   VAL A CB  1 
ATOM   458   C  CG1 . VAL A  1 65  ? -31.134 123.659 137.094 1.00 29.29  ? 65   VAL A CG1 1 
ATOM   459   C  CG2 . VAL A  1 65  ? -33.212 124.134 135.675 1.00 26.87  ? 65   VAL A CG2 1 
ATOM   460   N  N   . ASP A  1 66  ? -28.790 124.380 134.549 1.00 31.68  ? 66   ASP A N   1 
ATOM   461   C  CA  . ASP A  1 66  ? -27.344 124.217 134.674 1.00 31.71  ? 66   ASP A CA  1 
ATOM   462   C  C   . ASP A  1 66  ? -26.697 124.842 133.450 1.00 33.71  ? 66   ASP A C   1 
ATOM   463   O  O   . ASP A  1 66  ? -26.678 124.240 132.371 1.00 34.68  ? 66   ASP A O   1 
ATOM   464   C  CB  . ASP A  1 66  ? -26.967 122.743 134.797 1.00 31.97  ? 66   ASP A CB  1 
ATOM   465   C  CG  . ASP A  1 66  ? -25.471 122.532 134.962 1.00 41.94  ? 66   ASP A CG  1 
ATOM   466   O  OD1 . ASP A  1 66  ? -24.709 123.525 135.032 1.00 40.66  ? 66   ASP A OD1 1 
ATOM   467   O  OD2 . ASP A  1 66  ? -25.057 121.353 135.015 1.00 45.67  ? 66   ASP A OD2 1 
ATOM   468   N  N   . MET A  1 67  ? -26.162 126.050 133.624 1.00 34.31  ? 67   MET A N   1 
ATOM   469   C  CA  . MET A  1 67  ? -25.402 126.718 132.580 1.00 32.21  ? 67   MET A CA  1 
ATOM   470   C  C   . MET A  1 67  ? -23.934 126.874 132.969 1.00 35.90  ? 67   MET A C   1 
ATOM   471   O  O   . MET A  1 67  ? -23.248 127.752 132.431 1.00 36.86  ? 67   MET A O   1 
ATOM   472   C  CB  . MET A  1 67  ? -26.019 128.088 132.267 1.00 26.74  ? 67   MET A CB  1 
ATOM   473   C  CG  . MET A  1 67  ? -27.488 128.048 131.841 1.00 30.74  ? 67   MET A CG  1 
ATOM   474   S  SD  . MET A  1 67  ? -28.271 129.693 131.748 1.00 36.01  ? 67   MET A SD  1 
ATOM   475   C  CE  . MET A  1 67  ? -27.466 130.350 130.277 1.00 33.72  ? 67   MET A CE  1 
ATOM   476   N  N   . ARG A  1 68  ? -23.438 126.045 133.901 1.00 35.58  ? 68   ARG A N   1 
ATOM   477   C  CA  . ARG A  1 68  ? -22.106 126.283 134.468 1.00 41.15  ? 68   ARG A CA  1 
ATOM   478   C  C   . ARG A  1 68  ? -21.018 126.277 133.402 1.00 38.73  ? 68   ARG A C   1 
ATOM   479   O  O   . ARG A  1 68  ? -20.005 126.959 133.559 1.00 41.18  ? 68   ARG A O   1 
ATOM   480   C  CB  . ARG A  1 68  ? -21.781 125.253 135.552 1.00 36.37  ? 68   ARG A CB  1 
ATOM   481   C  CG  . ARG A  1 68  ? -22.546 125.473 136.858 1.00 35.42  ? 68   ARG A CG  1 
ATOM   482   C  CD  . ARG A  1 68  ? -22.336 124.315 137.814 1.00 32.09  ? 68   ARG A CD  1 
ATOM   483   N  NE  . ARG A  1 68  ? -22.882 123.079 137.240 1.00 38.72  ? 68   ARG A NE  1 
ATOM   484   C  CZ  . ARG A  1 68  ? -22.768 121.877 137.794 1.00 49.63  ? 68   ARG A CZ  1 
ATOM   485   N  NH1 . ARG A  1 68  ? -22.133 121.741 138.948 1.00 60.12  ? 68   ARG A NH1 1 
ATOM   486   N  NH2 . ARG A  1 68  ? -23.281 120.807 137.194 1.00 45.43  ? 68   ARG A NH2 1 
ATOM   487   N  N   . GLU A  1 69  ? -21.212 125.545 132.307 1.00 42.09  ? 69   GLU A N   1 
ATOM   488   C  CA  . GLU A  1 69  ? -20.190 125.464 131.270 1.00 52.69  ? 69   GLU A CA  1 
ATOM   489   C  C   . GLU A  1 69  ? -20.256 126.589 130.243 1.00 53.50  ? 69   GLU A C   1 
ATOM   490   O  O   . GLU A  1 69  ? -19.266 126.820 129.543 1.00 60.30  ? 69   GLU A O   1 
ATOM   491   C  CB  . GLU A  1 69  ? -20.295 124.125 130.528 1.00 66.65  ? 69   GLU A CB  1 
ATOM   492   C  CG  . GLU A  1 69  ? -20.095 122.879 131.386 1.00 83.71  ? 69   GLU A CG  1 
ATOM   493   C  CD  . GLU A  1 69  ? -18.691 122.764 131.956 1.00 94.65  ? 69   GLU A CD  1 
ATOM   494   O  OE1 . GLU A  1 69  ? -17.717 122.850 131.175 1.00 100.70 ? 69   GLU A OE1 1 
ATOM   495   O  OE2 . GLU A  1 69  ? -18.558 122.592 133.185 1.00 98.69  ? 69   GLU A OE2 1 
ATOM   496   N  N   . THR A  1 70  ? -21.396 127.268 130.110 1.00 47.81  ? 70   THR A N   1 
ATOM   497   C  CA  . THR A  1 70  ? -21.642 128.177 128.997 1.00 41.79  ? 70   THR A CA  1 
ATOM   498   C  C   . THR A  1 70  ? -21.899 129.620 129.399 1.00 35.48  ? 70   THR A C   1 
ATOM   499   O  O   . THR A  1 70  ? -21.746 130.505 128.559 1.00 37.75  ? 70   THR A O   1 
ATOM   500   C  CB  . THR A  1 70  ? -22.842 127.684 128.183 1.00 45.31  ? 70   THR A CB  1 
ATOM   501   O  OG1 . THR A  1 70  ? -23.971 127.607 129.051 1.00 50.73  ? 70   THR A OG1 1 
ATOM   502   C  CG2 . THR A  1 70  ? -22.576 126.298 127.634 1.00 51.13  ? 70   THR A CG2 1 
ATOM   503   N  N   . LEU A  1 71  ? -22.284 129.880 130.638 1.00 32.56  ? 71   LEU A N   1 
ATOM   504   C  CA  . LEU A  1 71  ? -22.621 131.224 131.071 1.00 38.04  ? 71   LEU A CA  1 
ATOM   505   C  C   . LEU A  1 71  ? -21.355 132.060 131.094 1.00 39.63  ? 71   LEU A C   1 
ATOM   506   O  O   . LEU A  1 71  ? -20.380 131.690 131.752 1.00 38.82  ? 71   LEU A O   1 
ATOM   507   C  CB  . LEU A  1 71  ? -23.267 131.149 132.448 1.00 30.30  ? 71   LEU A CB  1 
ATOM   508   C  CG  . LEU A  1 71  ? -24.064 132.238 133.125 1.00 37.23  ? 71   LEU A CG  1 
ATOM   509   C  CD1 . LEU A  1 71  ? -25.124 132.820 132.224 1.00 27.96  ? 71   LEU A CD1 1 
ATOM   510   C  CD2 . LEU A  1 71  ? -24.711 131.593 134.338 1.00 34.30  ? 71   LEU A CD2 1 
ATOM   511   N  N   . ASN A  1 72  ? -21.345 133.158 130.343 1.00 32.54  ? 72   ASN A N   1 
ATOM   512   C  CA  . ASN A  1 72  ? -20.200 134.061 130.402 1.00 34.35  ? 72   ASN A CA  1 
ATOM   513   C  C   . ASN A  1 72  ? -20.590 135.456 129.931 1.00 38.31  ? 72   ASN A C   1 
ATOM   514   O  O   . ASN A  1 72  ? -20.812 135.659 128.730 1.00 41.39  ? 72   ASN A O   1 
ATOM   515   C  CB  . ASN A  1 72  ? -19.045 133.564 129.538 1.00 33.63  ? 72   ASN A CB  1 
ATOM   516   C  CG  . ASN A  1 72  ? -17.853 134.496 129.619 1.00 47.91  ? 72   ASN A CG  1 
ATOM   517   O  OD1 . ASN A  1 72  ? -17.266 134.659 130.688 1.00 36.44  ? 72   ASN A OD1 1 
ATOM   518   N  ND2 . ASN A  1 72  ? -17.530 135.165 128.509 1.00 47.98  ? 72   ASN A ND2 1 
ATOM   519   N  N   . PRO A  1 73  ? -20.647 136.450 130.825 1.00 34.42  ? 73   PRO A N   1 
ATOM   520   C  CA  . PRO A  1 73  ? -20.284 136.342 132.238 1.00 32.23  ? 73   PRO A CA  1 
ATOM   521   C  C   . PRO A  1 73  ? -21.297 135.570 133.083 1.00 31.23  ? 73   PRO A C   1 
ATOM   522   O  O   . PRO A  1 73  ? -22.419 135.301 132.666 1.00 33.79  ? 73   PRO A O   1 
ATOM   523   C  CB  . PRO A  1 73  ? -20.243 137.803 132.689 1.00 35.03  ? 73   PRO A CB  1 
ATOM   524   C  CG  . PRO A  1 73  ? -21.325 138.441 131.870 1.00 34.31  ? 73   PRO A CG  1 
ATOM   525   C  CD  . PRO A  1 73  ? -21.231 137.771 130.515 1.00 31.02  ? 73   PRO A CD  1 
ATOM   526   N  N   . MET A  1 74  ? -20.878 135.210 134.281 1.00 29.54  ? 74   MET A N   1 
ATOM   527   C  CA  . MET A  1 74  ? -21.739 134.573 135.261 1.00 38.06  ? 74   MET A CA  1 
ATOM   528   C  C   . MET A  1 74  ? -21.945 135.531 136.421 1.00 35.12  ? 74   MET A C   1 
ATOM   529   O  O   . MET A  1 74  ? -21.047 136.307 136.759 1.00 37.91  ? 74   MET A O   1 
ATOM   530   C  CB  . MET A  1 74  ? -21.122 133.254 135.727 1.00 35.24  ? 74   MET A CB  1 
ATOM   531   C  CG  . MET A  1 74  ? -19.785 133.414 136.404 1.00 46.26  ? 74   MET A CG  1 
ATOM   532   S  SD  . MET A  1 74  ? -18.836 131.864 136.340 1.00 45.37  ? 74   MET A SD  1 
ATOM   533   C  CE  . MET A  1 74  ? -20.117 130.671 136.647 1.00 50.02  ? 74   MET A CE  1 
ATOM   534   N  N   . GLY A  1 75  ? -23.140 135.509 136.997 1.00 33.50  ? 75   GLY A N   1 
ATOM   535   C  CA  . GLY A  1 75  ? -23.414 136.363 138.135 1.00 30.38  ? 75   GLY A CA  1 
ATOM   536   C  C   . GLY A  1 75  ? -22.607 135.930 139.347 1.00 27.37  ? 75   GLY A C   1 
ATOM   537   O  O   . GLY A  1 75  ? -22.344 134.746 139.557 1.00 28.15  ? 75   GLY A O   1 
ATOM   538   N  N   . MET A  1 76  ? -22.178 136.909 140.133 1.00 37.30  ? 76   MET A N   1 
ATOM   539   C  CA  . MET A  1 76  ? -21.512 136.644 141.405 1.00 38.18  ? 76   MET A CA  1 
ATOM   540   C  C   . MET A  1 76  ? -22.076 137.636 142.406 1.00 35.92  ? 76   MET A C   1 
ATOM   541   O  O   . MET A  1 76  ? -21.881 138.842 142.255 1.00 34.72  ? 76   MET A O   1 
ATOM   542   C  CB  . MET A  1 76  ? -19.999 136.767 141.292 1.00 40.58  ? 76   MET A CB  1 
ATOM   543   C  CG  . MET A  1 76  ? -19.267 135.764 142.162 1.00 58.02  ? 76   MET A CG  1 
ATOM   544   S  SD  . MET A  1 76  ? -18.700 136.570 143.643 1.00 76.89  ? 76   MET A SD  1 
ATOM   545   C  CE  . MET A  1 76  ? -17.324 137.516 142.960 1.00 66.14  ? 76   MET A CE  1 
ATOM   546   N  N   . PHE A  1 77  ? -22.832 137.139 143.376 1.00 34.73  ? 77   PHE A N   1 
ATOM   547   C  CA  . PHE A  1 77  ? -23.496 137.968 144.375 1.00 34.23  ? 77   PHE A CA  1 
ATOM   548   C  C   . PHE A  1 77  ? -22.861 137.692 145.722 1.00 34.14  ? 77   PHE A C   1 
ATOM   549   O  O   . PHE A  1 77  ? -22.816 136.538 146.158 1.00 39.12  ? 77   PHE A O   1 
ATOM   550   C  CB  . PHE A  1 77  ? -24.994 137.663 144.485 1.00 34.39  ? 77   PHE A CB  1 
ATOM   551   C  CG  . PHE A  1 77  ? -25.833 138.193 143.356 1.00 37.88  ? 77   PHE A CG  1 
ATOM   552   C  CD1 . PHE A  1 77  ? -25.272 138.548 142.143 1.00 35.23  ? 77   PHE A CD1 1 
ATOM   553   C  CD2 . PHE A  1 77  ? -27.210 138.330 143.524 1.00 40.82  ? 77   PHE A CD2 1 
ATOM   554   C  CE1 . PHE A  1 77  ? -26.063 139.021 141.102 1.00 36.64  ? 77   PHE A CE1 1 
ATOM   555   C  CE2 . PHE A  1 77  ? -28.009 138.814 142.500 1.00 38.04  ? 77   PHE A CE2 1 
ATOM   556   C  CZ  . PHE A  1 77  ? -27.429 139.162 141.277 1.00 34.62  ? 77   PHE A CZ  1 
ATOM   557   N  N   . GLN A  1 78  ? -22.410 138.732 146.395 1.00 29.09  ? 78   GLN A N   1 
ATOM   558   C  CA  . GLN A  1 78  ? -21.865 138.587 147.739 1.00 34.03  ? 78   GLN A CA  1 
ATOM   559   C  C   . GLN A  1 78  ? -22.808 139.298 148.702 1.00 31.17  ? 78   GLN A C   1 
ATOM   560   O  O   . GLN A  1 78  ? -22.944 140.521 148.646 1.00 34.69  ? 78   GLN A O   1 
ATOM   561   C  CB  . GLN A  1 78  ? -20.436 139.134 147.826 1.00 37.02  ? 78   GLN A CB  1 
ATOM   562   C  CG  . GLN A  1 78  ? -19.390 138.289 147.078 1.00 58.96  ? 78   GLN A CG  1 
ATOM   563   C  CD  . GLN A  1 78  ? -17.985 138.915 147.035 1.00 72.21  ? 78   GLN A CD  1 
ATOM   564   O  OE1 . GLN A  1 78  ? -17.829 140.116 146.819 1.00 75.63  ? 78   GLN A OE1 1 
ATOM   565   N  NE2 . GLN A  1 78  ? -16.962 138.090 147.248 1.00 75.98  ? 78   GLN A NE2 1 
ATOM   566   N  N   . TYR A  1 79  ? -23.504 138.538 149.544 1.00 31.75  ? 79   TYR A N   1 
ATOM   567   C  CA  . TYR A  1 79  ? -24.246 139.150 150.637 1.00 36.11  ? 79   TYR A CA  1 
ATOM   568   C  C   . TYR A  1 79  ? -23.277 139.501 151.742 1.00 33.86  ? 79   TYR A C   1 
ATOM   569   O  O   . TYR A  1 79  ? -22.514 138.643 152.178 1.00 32.33  ? 79   TYR A O   1 
ATOM   570   C  CB  . TYR A  1 79  ? -25.296 138.220 151.247 1.00 32.37  ? 79   TYR A CB  1 
ATOM   571   C  CG  . TYR A  1 79  ? -26.451 137.776 150.395 1.00 29.04  ? 79   TYR A CG  1 
ATOM   572   C  CD1 . TYR A  1 79  ? -26.434 137.901 149.016 1.00 28.68  ? 79   TYR A CD1 1 
ATOM   573   C  CD2 . TYR A  1 79  ? -27.560 137.189 150.993 1.00 28.71  ? 79   TYR A CD2 1 
ATOM   574   C  CE1 . TYR A  1 79  ? -27.498 137.464 148.252 1.00 31.97  ? 79   TYR A CE1 1 
ATOM   575   C  CE2 . TYR A  1 79  ? -28.633 136.753 150.248 1.00 34.20  ? 79   TYR A CE2 1 
ATOM   576   C  CZ  . TYR A  1 79  ? -28.604 136.886 148.877 1.00 35.44  ? 79   TYR A CZ  1 
ATOM   577   O  OH  . TYR A  1 79  ? -29.687 136.432 148.143 1.00 30.18  ? 79   TYR A OH  1 
ATOM   578   N  N   . THR A  1 80  ? -23.329 140.728 152.231 1.00 28.60  ? 80   THR A N   1 
ATOM   579   C  CA  . THR A  1 80  ? -22.759 141.035 153.534 1.00 28.66  ? 80   THR A CA  1 
ATOM   580   C  C   . THR A  1 80  ? -23.880 141.564 154.407 1.00 33.59  ? 80   THR A C   1 
ATOM   581   O  O   . THR A  1 80  ? -24.724 142.331 153.944 1.00 30.34  ? 80   THR A O   1 
ATOM   582   C  CB  . THR A  1 80  ? -21.589 142.038 153.477 1.00 31.76  ? 80   THR A CB  1 
ATOM   583   O  OG1 . THR A  1 80  ? -22.005 143.222 152.806 1.00 28.26  ? 80   THR A OG1 1 
ATOM   584   C  CG2 . THR A  1 80  ? -20.375 141.409 152.739 1.00 36.86  ? 80   THR A CG2 1 
ATOM   585   N  N   . VAL A  1 81  ? -23.922 141.083 155.639 1.00 28.52  ? 81   VAL A N   1 
ATOM   586   C  CA  . VAL A  1 81  ? -25.045 141.293 156.545 1.00 31.93  ? 81   VAL A CA  1 
ATOM   587   C  C   . VAL A  1 81  ? -24.577 142.158 157.713 1.00 28.22  ? 81   VAL A C   1 
ATOM   588   O  O   . VAL A  1 81  ? -23.512 141.906 158.298 1.00 30.64  ? 81   VAL A O   1 
ATOM   589   C  CB  . VAL A  1 81  ? -25.607 139.934 157.000 1.00 34.36  ? 81   VAL A CB  1 
ATOM   590   C  CG1 . VAL A  1 81  ? -26.885 140.114 157.818 1.00 30.65  ? 81   VAL A CG1 1 
ATOM   591   C  CG2 . VAL A  1 81  ? -25.853 139.053 155.733 1.00 28.68  ? 81   VAL A CG2 1 
ATOM   592   N  N   . TRP A  1 82  ? -25.370 143.177 158.048 1.00 30.36  ? 82   TRP A N   1 
ATOM   593   C  CA  . TRP A  1 82  ? -24.933 144.283 158.891 1.00 33.31  ? 82   TRP A CA  1 
ATOM   594   C  C   . TRP A  1 82  ? -26.002 144.643 159.909 1.00 35.78  ? 82   TRP A C   1 
ATOM   595   O  O   . TRP A  1 82  ? -27.202 144.531 159.638 1.00 30.42  ? 82   TRP A O   1 
ATOM   596   C  CB  . TRP A  1 82  ? -24.628 145.540 158.048 1.00 31.50  ? 82   TRP A CB  1 
ATOM   597   C  CG  . TRP A  1 82  ? -23.572 145.275 157.059 1.00 33.70  ? 82   TRP A CG  1 
ATOM   598   C  CD1 . TRP A  1 82  ? -23.735 144.845 155.764 1.00 32.53  ? 82   TRP A CD1 1 
ATOM   599   C  CD2 . TRP A  1 82  ? -22.171 145.342 157.291 1.00 33.13  ? 82   TRP A CD2 1 
ATOM   600   N  NE1 . TRP A  1 82  ? -22.508 144.680 155.172 1.00 27.90  ? 82   TRP A NE1 1 
ATOM   601   C  CE2 . TRP A  1 82  ? -21.530 144.965 156.091 1.00 36.86  ? 82   TRP A CE2 1 
ATOM   602   C  CE3 . TRP A  1 82  ? -21.386 145.701 158.396 1.00 39.54  ? 82   TRP A CE3 1 
ATOM   603   C  CZ2 . TRP A  1 82  ? -20.133 144.936 155.966 1.00 30.68  ? 82   TRP A CZ2 1 
ATOM   604   C  CZ3 . TRP A  1 82  ? -19.996 145.679 158.268 1.00 35.55  ? 82   TRP A CZ3 1 
ATOM   605   C  CH2 . TRP A  1 82  ? -19.390 145.307 157.061 1.00 31.14  ? 82   TRP A CH2 1 
ATOM   606   N  N   . LYS A  1 83  ? -25.548 145.139 161.062 1.00 37.66  ? 83   LYS A N   1 
ATOM   607   C  CA  . LYS A  1 83  ? -26.482 145.690 162.037 1.00 41.66  ? 83   LYS A CA  1 
ATOM   608   C  C   . LYS A  1 83  ? -27.250 146.863 161.450 1.00 37.80  ? 83   LYS A C   1 
ATOM   609   O  O   . LYS A  1 83  ? -28.429 147.053 161.765 1.00 40.45  ? 83   LYS A O   1 
ATOM   610   C  CB  . LYS A  1 83  ? -25.747 146.131 163.303 1.00 38.14  ? 83   LYS A CB  1 
ATOM   611   C  CG  . LYS A  1 83  ? -25.149 144.996 164.109 1.00 44.32  ? 83   LYS A CG  1 
ATOM   612   C  CD  . LYS A  1 83  ? -24.460 145.513 165.376 1.00 44.11  ? 83   LYS A CD  1 
ATOM   613   C  CE  . LYS A  1 83  ? -23.823 144.375 166.178 1.00 50.39  ? 83   LYS A CE  1 
ATOM   614   N  NZ  . LYS A  1 83  ? -23.037 144.907 167.344 1.00 58.98  ? 83   LYS A NZ  1 
ATOM   615   N  N   . ASP A  1 84  ? -26.602 147.656 160.591 1.00 35.19  ? 84   ASP A N   1 
ATOM   616   C  CA  . ASP A  1 84  ? -27.225 148.828 159.998 1.00 30.89  ? 84   ASP A CA  1 
ATOM   617   C  C   . ASP A  1 84  ? -26.394 149.287 158.816 1.00 37.53  ? 84   ASP A C   1 
ATOM   618   O  O   . ASP A  1 84  ? -25.268 148.826 158.605 1.00 38.03  ? 84   ASP A O   1 
ATOM   619   C  CB  . ASP A  1 84  ? -27.380 149.957 161.022 1.00 31.02  ? 84   ASP A CB  1 
ATOM   620   C  CG  . ASP A  1 84  ? -26.113 150.193 161.820 1.00 40.24  ? 84   ASP A CG  1 
ATOM   621   O  OD1 . ASP A  1 84  ? -25.012 150.289 161.232 1.00 39.31  ? 84   ASP A OD1 1 
ATOM   622   O  OD2 . ASP A  1 84  ? -26.214 150.248 163.055 1.00 44.19  ? 84   ASP A OD2 1 
ATOM   623   N  N   . VAL A  1 85  ? -26.958 150.240 158.066 1.00 36.73  ? 85   VAL A N   1 
ATOM   624   C  CA  . VAL A  1 85  ? -26.264 150.798 156.913 1.00 30.35  ? 85   VAL A CA  1 
ATOM   625   C  C   . VAL A  1 85  ? -24.953 151.437 157.344 1.00 30.70  ? 85   VAL A C   1 
ATOM   626   O  O   . VAL A  1 85  ? -23.913 151.234 156.711 1.00 30.80  ? 85   VAL A O   1 
ATOM   627   C  CB  . VAL A  1 85  ? -27.177 151.810 156.196 1.00 39.28  ? 85   VAL A CB  1 
ATOM   628   C  CG1 . VAL A  1 85  ? -26.381 152.684 155.223 1.00 35.91  ? 85   VAL A CG1 1 
ATOM   629   C  CG2 . VAL A  1 85  ? -28.288 151.088 155.469 1.00 34.10  ? 85   VAL A CG2 1 
ATOM   630   N  N   . HIS A  1 86  ? -24.973 152.181 158.458 1.00 35.42  ? 86   HIS A N   1 
ATOM   631   C  CA  . HIS A  1 86  ? -23.790 152.927 158.875 1.00 34.49  ? 86   HIS A CA  1 
ATOM   632   C  C   . HIS A  1 86  ? -22.605 152.005 159.099 1.00 36.45  ? 86   HIS A C   1 
ATOM   633   O  O   . HIS A  1 86  ? -21.465 152.365 158.792 1.00 35.08  ? 86   HIS A O   1 
ATOM   634   C  CB  . HIS A  1 86  ? -24.056 153.717 160.162 1.00 36.29  ? 86   HIS A CB  1 
ATOM   635   C  CG  . HIS A  1 86  ? -22.863 154.504 160.626 1.00 42.09  ? 86   HIS A CG  1 
ATOM   636   N  ND1 . HIS A  1 86  ? -21.943 154.009 161.529 1.00 43.75  ? 86   HIS A ND1 1 
ATOM   637   C  CD2 . HIS A  1 86  ? -22.411 155.732 160.272 1.00 43.11  ? 86   HIS A CD2 1 
ATOM   638   C  CE1 . HIS A  1 86  ? -20.995 154.905 161.732 1.00 39.33  ? 86   HIS A CE1 1 
ATOM   639   N  NE2 . HIS A  1 86  ? -21.259 155.963 160.985 1.00 41.33  ? 86   HIS A NE2 1 
ATOM   640   N  N   . SER A  1 87  ? -22.853 150.821 159.659 1.00 31.69  ? 87   SER A N   1 
ATOM   641   C  CA  . SER A  1 87  ? -21.761 149.890 159.903 1.00 37.06  ? 87   SER A CA  1 
ATOM   642   C  C   . SER A  1 87  ? -21.081 149.493 158.603 1.00 37.33  ? 87   SER A C   1 
ATOM   643   O  O   . SER A  1 87  ? -19.848 149.450 158.527 1.00 34.69  ? 87   SER A O   1 
ATOM   644   C  CB  . SER A  1 87  ? -22.272 148.672 160.662 1.00 32.15  ? 87   SER A CB  1 
ATOM   645   O  OG  . SER A  1 87  ? -22.728 149.082 161.944 1.00 33.49  ? 87   SER A OG  1 
ATOM   646   N  N   . HIS A  1 88  ? -21.863 149.215 157.566 1.00 31.54  ? 88   HIS A N   1 
ATOM   647   C  CA  . HIS A  1 88  ? -21.263 148.847 156.291 1.00 37.91  ? 88   HIS A CA  1 
ATOM   648   C  C   . HIS A  1 88  ? -20.484 150.013 155.693 1.00 34.43  ? 88   HIS A C   1 
ATOM   649   O  O   . HIS A  1 88  ? -19.347 149.845 155.234 1.00 34.05  ? 88   HIS A O   1 
ATOM   650   C  CB  . HIS A  1 88  ? -22.349 148.355 155.334 1.00 37.05  ? 88   HIS A CB  1 
ATOM   651   C  CG  . HIS A  1 88  ? -21.843 147.965 153.976 1.00 36.07  ? 88   HIS A CG  1 
ATOM   652   N  ND1 . HIS A  1 88  ? -22.189 148.651 152.830 1.00 40.82  ? 88   HIS A ND1 1 
ATOM   653   C  CD2 . HIS A  1 88  ? -21.021 146.967 153.580 1.00 38.93  ? 88   HIS A CD2 1 
ATOM   654   C  CE1 . HIS A  1 88  ? -21.610 148.085 151.786 1.00 40.52  ? 88   HIS A CE1 1 
ATOM   655   N  NE2 . HIS A  1 88  ? -20.901 147.055 152.213 1.00 41.09  ? 88   HIS A NE2 1 
ATOM   656   N  N   . GLU A  1 89  ? -21.077 151.209 155.697 1.00 35.53  ? 89   GLU A N   1 
ATOM   657   C  CA  . GLU A  1 89  ? -20.401 152.376 155.138 1.00 31.77  ? 89   GLU A CA  1 
ATOM   658   C  C   . GLU A  1 89  ? -19.132 152.701 155.908 1.00 42.07  ? 89   GLU A C   1 
ATOM   659   O  O   . GLU A  1 89  ? -18.130 153.127 155.324 1.00 31.72  ? 89   GLU A O   1 
ATOM   660   C  CB  . GLU A  1 89  ? -21.346 153.579 155.139 1.00 30.94  ? 89   GLU A CB  1 
ATOM   661   C  CG  . GLU A  1 89  ? -22.540 153.443 154.189 1.00 30.48  ? 89   GLU A CG  1 
ATOM   662   C  CD  . GLU A  1 89  ? -22.129 153.446 152.726 1.00 33.03  ? 89   GLU A CD  1 
ATOM   663   O  OE1 . GLU A  1 89  ? -21.168 154.172 152.365 1.00 34.79  ? 89   GLU A OE1 1 
ATOM   664   O  OE2 . GLU A  1 89  ? -22.747 152.712 151.927 1.00 35.17  ? 89   GLU A OE2 1 
ATOM   665   N  N   . GLU A  1 90  ? -19.162 152.522 157.226 1.00 31.92  ? 90   GLU A N   1 
ATOM   666   C  CA  . GLU A  1 90  ? -17.986 152.817 158.023 1.00 32.36  ? 90   GLU A CA  1 
ATOM   667   C  C   . GLU A  1 90  ? -16.871 151.817 157.751 1.00 40.26  ? 90   GLU A C   1 
ATOM   668   O  O   . GLU A  1 90  ? -15.701 152.199 157.614 1.00 34.99  ? 90   GLU A O   1 
ATOM   669   C  CB  . GLU A  1 90  ? -18.364 152.821 159.497 1.00 32.60  ? 90   GLU A CB  1 
ATOM   670   C  CG  . GLU A  1 90  ? -17.241 153.224 160.388 1.00 43.24  ? 90   GLU A CG  1 
ATOM   671   C  CD  . GLU A  1 90  ? -17.701 153.399 161.815 1.00 49.56  ? 90   GLU A CD  1 
ATOM   672   O  OE1 . GLU A  1 90  ? -18.160 152.399 162.413 1.00 45.76  ? 90   GLU A OE1 1 
ATOM   673   O  OE2 . GLU A  1 90  ? -17.640 154.546 162.320 1.00 49.17  ? 90   GLU A OE2 1 
ATOM   674   N  N   . MET A  1 91  ? -17.214 150.533 157.657 1.00 41.82  ? 91   MET A N   1 
ATOM   675   C  CA  . MET A  1 91  ? -16.213 149.533 157.314 1.00 32.78  ? 91   MET A CA  1 
ATOM   676   C  C   . MET A  1 91  ? -15.547 149.871 155.984 1.00 38.15  ? 91   MET A C   1 
ATOM   677   O  O   . MET A  1 91  ? -14.316 149.862 155.880 1.00 38.87  ? 91   MET A O   1 
ATOM   678   C  CB  . MET A  1 91  ? -16.854 148.144 157.284 1.00 34.40  ? 91   MET A CB  1 
ATOM   679   C  CG  . MET A  1 91  ? -15.870 146.984 157.051 1.00 43.30  ? 91   MET A CG  1 
ATOM   680   S  SD  . MET A  1 91  ? -15.365 146.784 155.311 1.00 53.22  ? 91   MET A SD  1 
ATOM   681   C  CE  . MET A  1 91  ? -16.968 146.652 154.478 1.00 44.11  ? 91   MET A CE  1 
ATOM   682   N  N   . HIS A  1 92  ? -16.348 150.186 154.953 1.00 32.20  ? 92   HIS A N   1 
ATOM   683   C  CA  . HIS A  1 92  ? -15.776 150.578 153.663 1.00 35.58  ? 92   HIS A CA  1 
ATOM   684   C  C   . HIS A  1 92  ? -14.876 151.802 153.792 1.00 38.40  ? 92   HIS A C   1 
ATOM   685   O  O   . HIS A  1 92  ? -13.838 151.891 153.131 1.00 37.15  ? 92   HIS A O   1 
ATOM   686   C  CB  . HIS A  1 92  ? -16.876 150.879 152.644 1.00 31.56  ? 92   HIS A CB  1 
ATOM   687   C  CG  . HIS A  1 92  ? -17.245 149.717 151.781 1.00 47.59  ? 92   HIS A CG  1 
ATOM   688   N  ND1 . HIS A  1 92  ? -16.368 149.158 150.878 1.00 51.98  ? 92   HIS A ND1 1 
ATOM   689   C  CD2 . HIS A  1 92  ? -18.409 149.038 151.648 1.00 52.19  ? 92   HIS A CD2 1 
ATOM   690   C  CE1 . HIS A  1 92  ? -16.967 148.164 150.244 1.00 57.70  ? 92   HIS A CE1 1 
ATOM   691   N  NE2 . HIS A  1 92  ? -18.207 148.070 150.693 1.00 57.69  ? 92   HIS A NE2 1 
ATOM   692   N  N   . HIS A  1 93  ? -15.269 152.768 154.616 1.00 32.26  ? 93   HIS A N   1 
ATOM   693   C  CA  . HIS A  1 93  ? -14.440 153.946 154.810 1.00 34.84  ? 93   HIS A CA  1 
ATOM   694   C  C   . HIS A  1 93  ? -13.147 153.593 155.530 1.00 34.81  ? 93   HIS A C   1 
ATOM   695   O  O   . HIS A  1 93  ? -12.057 153.972 155.091 1.00 36.75  ? 93   HIS A O   1 
ATOM   696   C  CB  . HIS A  1 93  ? -15.216 155.014 155.586 1.00 34.59  ? 93   HIS A CB  1 
ATOM   697   C  CG  . HIS A  1 93  ? -14.351 156.144 156.040 1.00 44.82  ? 93   HIS A CG  1 
ATOM   698   N  ND1 . HIS A  1 93  ? -14.092 157.250 155.256 1.00 44.79  ? 93   HIS A ND1 1 
ATOM   699   C  CD2 . HIS A  1 93  ? -13.653 156.321 157.186 1.00 42.11  ? 93   HIS A CD2 1 
ATOM   700   C  CE1 . HIS A  1 93  ? -13.282 158.061 155.905 1.00 38.95  ? 93   HIS A CE1 1 
ATOM   701   N  NE2 . HIS A  1 93  ? -12.996 157.520 157.074 1.00 43.46  ? 93   HIS A NE2 1 
ATOM   702   N  N   . ASP A  1 94  ? -13.253 152.868 156.646 1.00 33.81  ? 94   ASP A N   1 
ATOM   703   C  CA  . ASP A  1 94  ? -12.089 152.575 157.467 1.00 36.97  ? 94   ASP A CA  1 
ATOM   704   C  C   . ASP A  1 94  ? -11.091 151.666 156.761 1.00 42.59  ? 94   ASP A C   1 
ATOM   705   O  O   . ASP A  1 94  ? -9.908  151.682 157.106 1.00 47.38  ? 94   ASP A O   1 
ATOM   706   C  CB  . ASP A  1 94  ? -12.520 151.944 158.798 1.00 38.83  ? 94   ASP A CB  1 
ATOM   707   C  CG  . ASP A  1 94  ? -13.282 152.919 159.711 1.00 43.17  ? 94   ASP A CG  1 
ATOM   708   O  OD1 . ASP A  1 94  ? -13.342 154.131 159.422 1.00 44.73  ? 94   ASP A OD1 1 
ATOM   709   O  OD2 . ASP A  1 94  ? -13.820 152.459 160.740 1.00 49.22  ? 94   ASP A OD2 1 
ATOM   710   N  N   . ASN A  1 95  ? -11.530 150.867 155.796 1.00 36.25  ? 95   ASN A N   1 
ATOM   711   C  CA  . ASN A  1 95  ? -10.643 149.936 155.120 1.00 38.18  ? 95   ASN A CA  1 
ATOM   712   C  C   . ASN A  1 95  ? -10.557 150.260 153.635 1.00 33.31  ? 95   ASN A C   1 
ATOM   713   O  O   . ASN A  1 95  ? -10.311 149.379 152.803 1.00 36.48  ? 95   ASN A O   1 
ATOM   714   C  CB  . ASN A  1 95  ? -11.119 148.504 155.348 1.00 42.22  ? 95   ASN A CB  1 
ATOM   715   C  CG  . ASN A  1 95  ? -11.223 148.156 156.828 1.00 48.21  ? 95   ASN A CG  1 
ATOM   716   O  OD1 . ASN A  1 95  ? -12.321 148.057 157.368 1.00 52.38  ? 95   ASN A OD1 1 
ATOM   717   N  ND2 . ASN A  1 95  ? -10.086 147.977 157.486 1.00 45.53  ? 95   ASN A ND2 1 
ATOM   718   N  N   . PHE A  1 96  ? -10.759 151.532 153.290 1.00 33.12  ? 96   PHE A N   1 
ATOM   719   C  CA  . PHE A  1 96  ? -10.935 151.885 151.886 1.00 36.06  ? 96   PHE A CA  1 
ATOM   720   C  C   . PHE A  1 96  ? -9.697  151.537 151.058 1.00 33.77  ? 96   PHE A C   1 
ATOM   721   O  O   . PHE A  1 96  ? -9.811  150.996 149.951 1.00 33.87  ? 96   PHE A O   1 
ATOM   722   C  CB  . PHE A  1 96  ? -11.289 153.364 151.750 1.00 33.51  ? 96   PHE A CB  1 
ATOM   723   C  CG  . PHE A  1 96  ? -11.599 153.766 150.334 1.00 38.15  ? 96   PHE A CG  1 
ATOM   724   C  CD1 . PHE A  1 96  ? -12.775 153.359 149.729 1.00 36.19  ? 96   PHE A CD1 1 
ATOM   725   C  CD2 . PHE A  1 96  ? -10.689 154.502 149.592 1.00 39.03  ? 96   PHE A CD2 1 
ATOM   726   C  CE1 . PHE A  1 96  ? -13.058 153.707 148.419 1.00 39.63  ? 96   PHE A CE1 1 
ATOM   727   C  CE2 . PHE A  1 96  ? -10.960 154.852 148.283 1.00 38.14  ? 96   PHE A CE2 1 
ATOM   728   C  CZ  . PHE A  1 96  ? -12.147 154.455 147.695 1.00 36.94  ? 96   PHE A CZ  1 
ATOM   729   N  N   . LYS A  1 97  ? -8.505  151.869 151.565 1.00 33.59  ? 97   LYS A N   1 
ATOM   730   C  CA  . LYS A  1 97  ? -7.282  151.585 150.815 1.00 39.00  ? 97   LYS A CA  1 
ATOM   731   C  C   . LYS A  1 97  ? -7.119  150.098 150.549 1.00 38.54  ? 97   LYS A C   1 
ATOM   732   O  O   . LYS A  1 97  ? -6.733  149.701 149.440 1.00 35.78  ? 97   LYS A O   1 
ATOM   733   C  CB  . LYS A  1 97  ? -6.044  152.113 151.550 1.00 35.49  ? 97   LYS A CB  1 
ATOM   734   C  CG  . LYS A  1 97  ? -5.880  153.629 151.568 1.00 55.64  ? 97   LYS A CG  1 
ATOM   735   C  CD  . LYS A  1 97  ? -5.088  154.074 152.806 1.00 57.51  ? 97   LYS A CD  1 
ATOM   736   C  CE  . LYS A  1 97  ? -4.164  152.948 153.291 1.00 63.99  ? 97   LYS A CE  1 
ATOM   737   N  NZ  . LYS A  1 97  ? -4.015  152.902 154.779 1.00 70.47  ? 97   LYS A NZ  1 
ATOM   738   N  N   . GLU A  1 98  ? -7.364  149.261 151.566 1.00 38.72  ? 98   GLU A N   1 
ATOM   739   C  CA  . GLU A  1 98  ? -7.116  147.829 151.405 1.00 43.66  ? 98   GLU A CA  1 
ATOM   740   C  C   . GLU A  1 98  ? -8.185  147.179 150.537 1.00 36.38  ? 98   GLU A C   1 
ATOM   741   O  O   . GLU A  1 98  ? -7.871  146.347 149.675 1.00 34.45  ? 98   GLU A O   1 
ATOM   742   C  CB  . GLU A  1 98  ? -6.994  147.122 152.763 1.00 50.58  ? 98   GLU A CB  1 
ATOM   743   C  CG  . GLU A  1 98  ? -7.730  147.728 153.927 1.00 58.94  ? 98   GLU A CG  1 
ATOM   744   C  CD  . GLU A  1 98  ? -7.037  148.953 154.509 1.00 52.18  ? 98   GLU A CD  1 
ATOM   745   O  OE1 . GLU A  1 98  ? -5.883  148.849 154.967 1.00 53.66  ? 98   GLU A OE1 1 
ATOM   746   O  OE2 . GLU A  1 98  ? -7.650  150.030 154.488 1.00 47.17  ? 98   GLU A OE2 1 
ATOM   747   N  N   . ILE A  1 99  ? -9.447  147.568 150.716 1.00 39.23  ? 99   ILE A N   1 
ATOM   748   C  CA  . ILE A  1 99  ? -10.483 147.045 149.835 1.00 38.19  ? 99   ILE A CA  1 
ATOM   749   C  C   . ILE A  1 99  ? -10.193 147.446 148.403 1.00 32.48  ? 99   ILE A C   1 
ATOM   750   O  O   . ILE A  1 99  ? -10.307 146.634 147.479 1.00 34.22  ? 99   ILE A O   1 
ATOM   751   C  CB  . ILE A  1 99  ? -11.865 147.532 150.282 1.00 35.11  ? 99   ILE A CB  1 
ATOM   752   C  CG1 . ILE A  1 99  ? -12.274 146.821 151.572 1.00 41.37  ? 99   ILE A CG1 1 
ATOM   753   C  CG2 . ILE A  1 99  ? -12.874 147.276 149.187 1.00 32.00  ? 99   ILE A CG2 1 
ATOM   754   C  CD1 . ILE A  1 99  ? -13.488 147.407 152.206 1.00 47.53  ? 99   ILE A CD1 1 
ATOM   755   N  N   . PHE A  1 100 ? -9.739  148.681 148.202 1.00 36.70  ? 100  PHE A N   1 
ATOM   756   C  CA  . PHE A  1 100 ? -9.383  149.095 146.854 1.00 32.27  ? 100  PHE A CA  1 
ATOM   757   C  C   . PHE A  1 100 ? -8.262  148.224 146.300 1.00 34.22  ? 100  PHE A C   1 
ATOM   758   O  O   . PHE A  1 100 ? -8.292  147.834 145.129 1.00 36.92  ? 100  PHE A O   1 
ATOM   759   C  CB  . PHE A  1 100 ? -8.985  150.577 146.823 1.00 33.94  ? 100  PHE A CB  1 
ATOM   760   C  CG  . PHE A  1 100 ? -8.646  151.051 145.450 1.00 41.01  ? 100  PHE A CG  1 
ATOM   761   C  CD1 . PHE A  1 100 ? -9.662  151.414 144.569 1.00 37.81  ? 100  PHE A CD1 1 
ATOM   762   C  CD2 . PHE A  1 100 ? -7.324  151.091 145.014 1.00 40.40  ? 100  PHE A CD2 1 
ATOM   763   C  CE1 . PHE A  1 100 ? -9.373  151.822 143.284 1.00 35.21  ? 100  PHE A CE1 1 
ATOM   764   C  CE2 . PHE A  1 100 ? -7.024  151.499 143.724 1.00 42.99  ? 100  PHE A CE2 1 
ATOM   765   C  CZ  . PHE A  1 100 ? -8.050  151.869 142.860 1.00 40.07  ? 100  PHE A CZ  1 
ATOM   766   N  N   . GLU A  1 101 ? -7.247  147.935 147.117 1.00 36.30  ? 101  GLU A N   1 
ATOM   767   C  CA  . GLU A  1 101 ? -6.150  147.093 146.652 1.00 33.67  ? 101  GLU A CA  1 
ATOM   768   C  C   . GLU A  1 101 ? -6.658  145.710 146.254 1.00 38.75  ? 101  GLU A C   1 
ATOM   769   O  O   . GLU A  1 101 ? -6.311  145.192 145.188 1.00 36.66  ? 101  GLU A O   1 
ATOM   770   C  CB  . GLU A  1 101 ? -5.077  146.972 147.734 1.00 33.65  ? 101  GLU A CB  1 
ATOM   771   C  CG  . GLU A  1 101 ? -3.914  146.080 147.319 1.00 38.54  ? 101  GLU A CG  1 
ATOM   772   C  CD  . GLU A  1 101 ? -3.083  145.586 148.500 1.00 37.57  ? 101  GLU A CD  1 
ATOM   773   O  OE1 . GLU A  1 101 ? -3.499  145.775 149.663 1.00 35.27  ? 101  GLU A OE1 1 
ATOM   774   O  OE2 . GLU A  1 101 ? -2.024  144.981 148.261 1.00 34.69  ? 101  GLU A OE2 1 
ATOM   775   N  N   . LEU A  1 102 ? -7.512  145.117 147.084 1.00 38.47  ? 102  LEU A N   1 
ATOM   776   C  CA  . LEU A  1 102 ? -7.996  143.762 146.845 1.00 42.94  ? 102  LEU A CA  1 
ATOM   777   C  C   . LEU A  1 102 ? -8.872  143.728 145.602 1.00 43.93  ? 102  LEU A C   1 
ATOM   778   O  O   . LEU A  1 102 ? -8.696  142.881 144.726 1.00 51.72  ? 102  LEU A O   1 
ATOM   779   C  CB  . LEU A  1 102 ? -8.788  143.250 148.053 1.00 36.75  ? 102  LEU A CB  1 
ATOM   780   C  CG  . LEU A  1 102 ? -7.939  143.163 149.319 1.00 37.14  ? 102  LEU A CG  1 
ATOM   781   C  CD1 . LEU A  1 102 ? -8.787  142.807 150.542 1.00 33.59  ? 102  LEU A CD1 1 
ATOM   782   C  CD2 . LEU A  1 102 ? -6.803  142.171 149.119 1.00 40.94  ? 102  LEU A CD2 1 
HETATM 783   N  N   . CSS A  1 103 ? -9.795  144.679 145.518 1.00 46.28  ? 103  CSS A N   1 
HETATM 784   C  CA  . CSS A  1 103 ? -10.755 144.708 144.448 1.00 54.30  ? 103  CSS A CA  1 
HETATM 785   C  CB  . CSS A  1 103 ? -11.900 145.610 144.809 1.00 58.58  ? 103  CSS A CB  1 
HETATM 786   S  SG  . CSS A  1 103 ? -12.943 144.780 145.998 1.00 69.94  ? 103  CSS A SG  1 
HETATM 787   S  SD  . CSS A  1 103 ? -13.409 142.903 145.393 0.50 61.17  ? 103  CSS A SD  1 
HETATM 788   C  C   . CSS A  1 103 ? -10.112 145.115 143.152 1.00 59.97  ? 103  CSS A C   1 
HETATM 789   O  O   . CSS A  1 103 ? -10.673 144.781 142.076 1.00 55.86  ? 103  CSS A O   1 
ATOM   790   N  N   . SER A  1 104 ? -8.948  145.769 143.194 1.00 59.02  ? 104  SER A N   1 
ATOM   791   C  CA  . SER A  1 104 ? -8.211  146.082 141.969 1.00 55.69  ? 104  SER A CA  1 
ATOM   792   C  C   . SER A  1 104 ? -7.749  144.822 141.268 1.00 53.99  ? 104  SER A C   1 
ATOM   793   O  O   . SER A  1 104 ? -7.761  144.754 140.041 1.00 59.69  ? 104  SER A O   1 
ATOM   794   C  CB  . SER A  1 104 ? -7.000  146.965 142.256 1.00 60.01  ? 104  SER A CB  1 
ATOM   795   O  OG  . SER A  1 104 ? -7.376  148.324 142.299 1.00 62.19  ? 104  SER A OG  1 
ATOM   796   N  N   . GLY A  1 105 ? -7.340  143.821 142.047 1.00 56.70  ? 105  GLY A N   1 
ATOM   797   C  CA  . GLY A  1 105 ? -7.036  142.527 141.456 1.00 64.94  ? 105  GLY A CA  1 
ATOM   798   C  C   . GLY A  1 105 ? -8.259  141.868 140.843 1.00 69.15  ? 105  GLY A C   1 
ATOM   799   O  O   . GLY A  1 105 ? -8.176  141.267 139.769 1.00 77.72  ? 105  GLY A O   1 
ATOM   800   N  N   . CYS A  1 106 ? -9.421  142.012 141.490 1.00 65.35  ? 106  CYS A N   1 
ATOM   801   C  CA  . CYS A  1 106 ? -10.631 141.350 141.007 1.00 67.81  ? 106  CYS A CA  1 
ATOM   802   C  C   . CYS A  1 106 ? -11.145 141.966 139.710 1.00 66.79  ? 106  CYS A C   1 
ATOM   803   O  O   . CYS A  1 106 ? -11.796 141.274 138.922 1.00 62.10  ? 106  CYS A O   1 
ATOM   804   C  CB  . CYS A  1 106 ? -11.734 141.423 142.066 1.00 69.09  ? 106  CYS A CB  1 
ATOM   805   S  SG  . CYS A  1 106 ? -11.425 140.476 143.559 1.00 75.86  ? 106  CYS A SG  1 
ATOM   806   N  N   . LEU A  1 107 ? -10.851 143.249 139.456 1.00 67.31  ? 107  LEU A N   1 
ATOM   807   C  CA  . LEU A  1 107 ? -11.414 143.927 138.290 1.00 56.42  ? 107  LEU A CA  1 
ATOM   808   C  C   . LEU A  1 107 ? -10.957 143.303 136.976 1.00 49.16  ? 107  LEU A C   1 
ATOM   809   O  O   . LEU A  1 107 ? -11.646 143.460 135.963 1.00 51.88  ? 107  LEU A O   1 
ATOM   810   C  CB  . LEU A  1 107 ? -11.075 145.429 138.307 1.00 53.55  ? 107  LEU A CB  1 
ATOM   811   C  CG  . LEU A  1 107 ? -11.826 146.355 139.292 1.00 53.74  ? 107  LEU A CG  1 
ATOM   812   C  CD1 . LEU A  1 107 ? -11.414 147.820 139.136 1.00 59.50  ? 107  LEU A CD1 1 
ATOM   813   C  CD2 . LEU A  1 107 ? -13.355 146.245 139.198 1.00 56.96  ? 107  LEU A CD2 1 
ATOM   814   N  N   . GLY A  1 108 ? -9.830  142.588 136.969 1.00 41.34  ? 108  GLY A N   1 
ATOM   815   C  CA  . GLY A  1 108 ? -9.376  141.876 135.783 1.00 39.67  ? 108  GLY A CA  1 
ATOM   816   C  C   . GLY A  1 108 ? -10.280 140.735 135.347 1.00 50.35  ? 108  GLY A C   1 
ATOM   817   O  O   . GLY A  1 108 ? -10.088 140.190 134.254 1.00 52.73  ? 108  GLY A O   1 
ATOM   818   N  N   . MET A  1 109 ? -11.245 140.350 136.175 1.00 42.91  ? 109  MET A N   1 
ATOM   819   C  CA  . MET A  1 109 ? -12.213 139.342 135.785 1.00 39.72  ? 109  MET A CA  1 
ATOM   820   C  C   . MET A  1 109 ? -13.632 139.901 135.711 1.00 34.81  ? 109  MET A C   1 
ATOM   821   O  O   . MET A  1 109 ? -14.561 139.144 135.424 1.00 34.20  ? 109  MET A O   1 
ATOM   822   C  CB  . MET A  1 109 ? -12.175 138.158 136.759 1.00 41.82  ? 109  MET A CB  1 
ATOM   823   C  CG  . MET A  1 109 ? -12.859 138.454 138.090 1.00 45.49  ? 109  MET A CG  1 
ATOM   824   S  SD  . MET A  1 109 ? -12.811 137.029 139.179 1.00 52.84  ? 109  MET A SD  1 
ATOM   825   C  CE  . MET A  1 109 ? -13.656 137.604 140.652 1.00 45.61  ? 109  MET A CE  1 
ATOM   826   N  N   . VAL A  1 110 ? -13.825 141.198 135.970 1.00 35.60  ? 110  VAL A N   1 
ATOM   827   C  CA  . VAL A  1 110 ? -15.153 141.808 136.024 1.00 32.28  ? 110  VAL A CA  1 
ATOM   828   C  C   . VAL A  1 110 ? -15.560 142.270 134.627 1.00 32.10  ? 110  VAL A C   1 
ATOM   829   O  O   . VAL A  1 110 ? -14.804 142.960 133.932 1.00 34.45  ? 110  VAL A O   1 
ATOM   830   C  CB  . VAL A  1 110 ? -15.185 142.973 137.035 1.00 39.59  ? 110  VAL A CB  1 
ATOM   831   C  CG1 . VAL A  1 110 ? -16.478 143.766 136.922 1.00 31.80  ? 110  VAL A CG1 1 
ATOM   832   C  CG2 . VAL A  1 110 ? -15.034 142.435 138.455 1.00 38.37  ? 110  VAL A CG2 1 
ATOM   833   N  N   . ILE A  1 111 ? -16.753 141.865 134.214 1.00 28.92  ? 111  ILE A N   1 
ATOM   834   C  CA  . ILE A  1 111 ? -17.341 142.297 132.963 1.00 34.90  ? 111  ILE A CA  1 
ATOM   835   C  C   . ILE A  1 111 ? -18.458 143.306 133.192 1.00 35.04  ? 111  ILE A C   1 
ATOM   836   O  O   . ILE A  1 111 ? -18.679 144.172 132.341 1.00 35.71  ? 111  ILE A O   1 
ATOM   837   C  CB  . ILE A  1 111 ? -17.846 141.067 132.168 1.00 37.49  ? 111  ILE A CB  1 
ATOM   838   C  CG1 . ILE A  1 111 ? -16.645 140.272 131.628 1.00 35.16  ? 111  ILE A CG1 1 
ATOM   839   C  CG2 . ILE A  1 111 ? -18.837 141.440 131.044 1.00 28.41  ? 111  ILE A CG2 1 
ATOM   840   C  CD1 . ILE A  1 111 ? -16.981 138.892 131.164 1.00 28.06  ? 111  ILE A CD1 1 
ATOM   841   N  N   . GLU A  1 112 ? -19.141 143.239 134.329 1.00 33.91  ? 112  GLU A N   1 
ATOM   842   C  CA  . GLU A  1 112 ? -20.217 144.157 134.664 1.00 42.20  ? 112  GLU A CA  1 
ATOM   843   C  C   . GLU A  1 112 ? -20.264 144.283 136.183 1.00 42.79  ? 112  GLU A C   1 
ATOM   844   O  O   . GLU A  1 112 ? -19.965 143.326 136.905 1.00 34.67  ? 112  GLU A O   1 
ATOM   845   C  CB  . GLU A  1 112 ? -21.542 143.641 134.087 1.00 45.19  ? 112  GLU A CB  1 
ATOM   846   C  CG  . GLU A  1 112 ? -22.667 144.635 133.983 1.00 65.18  ? 112  GLU A CG  1 
ATOM   847   C  CD  . GLU A  1 112 ? -23.859 144.051 133.236 1.00 75.45  ? 112  GLU A CD  1 
ATOM   848   O  OE1 . GLU A  1 112 ? -23.780 142.881 132.773 1.00 68.61  ? 112  GLU A OE1 1 
ATOM   849   O  OE2 . GLU A  1 112 ? -24.878 144.768 133.125 1.00 83.91  ? 112  GLU A OE2 1 
ATOM   850   N  N   . GLY A  1 113 ? -20.613 145.474 136.667 1.00 40.68  ? 113  GLY A N   1 
ATOM   851   C  CA  . GLY A  1 113 ? -20.628 145.723 138.094 1.00 35.72  ? 113  GLY A CA  1 
ATOM   852   C  C   . GLY A  1 113 ? -19.308 146.281 138.602 1.00 38.57  ? 113  GLY A C   1 
ATOM   853   O  O   . GLY A  1 113 ? -18.428 146.629 137.815 1.00 45.42  ? 113  GLY A O   1 
ATOM   854   N  N   . PRO A  1 114 ? -19.129 146.361 139.939 1.00 35.66  ? 114  PRO A N   1 
ATOM   855   C  CA  . PRO A  1 114 ? -20.097 145.936 140.957 1.00 32.97  ? 114  PRO A CA  1 
ATOM   856   C  C   . PRO A  1 114 ? -21.209 146.965 141.134 1.00 38.65  ? 114  PRO A C   1 
ATOM   857   O  O   . PRO A  1 114 ? -21.013 148.139 140.828 1.00 38.86  ? 114  PRO A O   1 
ATOM   858   C  CB  . PRO A  1 114 ? -19.251 145.835 142.227 1.00 29.48  ? 114  PRO A CB  1 
ATOM   859   C  CG  . PRO A  1 114 ? -18.285 146.947 142.069 1.00 34.37  ? 114  PRO A CG  1 
ATOM   860   C  CD  . PRO A  1 114 ? -17.945 146.975 140.565 1.00 32.19  ? 114  PRO A CD  1 
ATOM   861   N  N   . TRP A  1 115 ? -22.378 146.498 141.555 1.00 34.90  ? 115  TRP A N   1 
ATOM   862   C  CA  . TRP A  1 115 ? -23.481 147.352 141.970 1.00 33.31  ? 115  TRP A CA  1 
ATOM   863   C  C   . TRP A  1 115 ? -23.951 146.782 143.294 1.00 32.22  ? 115  TRP A C   1 
ATOM   864   O  O   . TRP A  1 115 ? -24.243 145.589 143.378 1.00 32.49  ? 115  TRP A O   1 
ATOM   865   C  CB  . TRP A  1 115 ? -24.592 147.363 140.918 1.00 32.15  ? 115  TRP A CB  1 
ATOM   866   C  CG  . TRP A  1 115 ? -25.717 148.315 141.165 1.00 34.42  ? 115  TRP A CG  1 
ATOM   867   C  CD1 . TRP A  1 115 ? -27.025 147.991 141.402 1.00 33.85  ? 115  TRP A CD1 1 
ATOM   868   C  CD2 . TRP A  1 115 ? -25.652 149.759 141.163 1.00 35.20  ? 115  TRP A CD2 1 
ATOM   869   N  NE1 . TRP A  1 115 ? -27.777 149.142 141.546 1.00 36.39  ? 115  TRP A NE1 1 
ATOM   870   C  CE2 . TRP A  1 115 ? -26.955 150.236 141.416 1.00 34.28  ? 115  TRP A CE2 1 
ATOM   871   C  CE3 . TRP A  1 115 ? -24.609 150.691 140.982 1.00 32.07  ? 115  TRP A CE3 1 
ATOM   872   C  CZ2 . TRP A  1 115 ? -27.254 151.603 141.475 1.00 31.36  ? 115  TRP A CZ2 1 
ATOM   873   C  CZ3 . TRP A  1 115 ? -24.899 152.049 141.066 1.00 34.12  ? 115  TRP A CZ3 1 
ATOM   874   C  CH2 . TRP A  1 115 ? -26.217 152.493 141.302 1.00 31.89  ? 115  TRP A CH2 1 
ATOM   875   N  N   . GLU A  1 116 ? -23.964 147.599 144.347 1.00 33.55  ? 116  GLU A N   1 
ATOM   876   C  CA  . GLU A  1 116 ? -24.184 147.078 145.695 1.00 36.62  ? 116  GLU A CA  1 
ATOM   877   C  C   . GLU A  1 116 ? -25.378 147.764 146.350 1.00 35.47  ? 116  GLU A C   1 
ATOM   878   O  O   . GLU A  1 116 ? -25.206 148.723 147.122 1.00 29.30  ? 116  GLU A O   1 
ATOM   879   C  CB  . GLU A  1 116 ? -22.941 147.235 146.566 1.00 28.64  ? 116  GLU A CB  1 
ATOM   880   C  CG  . GLU A  1 116 ? -23.041 146.402 147.840 1.00 33.15  ? 116  GLU A CG  1 
ATOM   881   C  CD  . GLU A  1 116 ? -21.857 146.576 148.750 1.00 36.07  ? 116  GLU A CD  1 
ATOM   882   O  OE1 . GLU A  1 116 ? -21.369 147.712 148.863 1.00 41.27  ? 116  GLU A OE1 1 
ATOM   883   O  OE2 . GLU A  1 116 ? -21.425 145.586 149.366 1.00 50.21  ? 116  GLU A OE2 1 
ATOM   884   N  N   . PRO A  1 117 ? -26.592 147.289 146.090 1.00 25.65  ? 117  PRO A N   1 
ATOM   885   C  CA  . PRO A  1 117 ? -27.771 147.852 146.758 1.00 25.86  ? 117  PRO A CA  1 
ATOM   886   C  C   . PRO A  1 117 ? -27.922 147.306 148.170 1.00 30.58  ? 117  PRO A C   1 
ATOM   887   O  O   . PRO A  1 117 ? -27.429 146.228 148.515 1.00 28.32  ? 117  PRO A O   1 
ATOM   888   C  CB  . PRO A  1 117 ? -28.945 147.391 145.875 1.00 29.87  ? 117  PRO A CB  1 
ATOM   889   C  CG  . PRO A  1 117 ? -28.315 146.733 144.652 1.00 27.79  ? 117  PRO A CG  1 
ATOM   890   C  CD  . PRO A  1 117 ? -26.969 146.264 145.100 1.00 26.44  ? 117  PRO A CD  1 
ATOM   891   N  N   . TYR A  1 118 ? -28.638 148.072 148.978 1.00 26.23  ? 118  TYR A N   1 
ATOM   892   C  CA  . TYR A  1 118 ? -29.014 147.704 150.337 1.00 31.13  ? 118  TYR A CA  1 
ATOM   893   C  C   . TYR A  1 118 ? -30.428 147.124 150.358 1.00 37.65  ? 118  TYR A C   1 
ATOM   894   O  O   . TYR A  1 118 ? -31.330 147.632 149.674 1.00 29.66  ? 118  TYR A O   1 
ATOM   895   C  CB  . TYR A  1 118 ? -28.962 148.922 151.256 1.00 29.92  ? 118  TYR A CB  1 
ATOM   896   C  CG  . TYR A  1 118 ? -27.579 149.397 151.653 1.00 30.44  ? 118  TYR A CG  1 
ATOM   897   C  CD1 . TYR A  1 118 ? -26.835 148.702 152.600 1.00 30.78  ? 118  TYR A CD1 1 
ATOM   898   C  CD2 . TYR A  1 118 ? -27.039 150.582 151.129 1.00 28.15  ? 118  TYR A CD2 1 
ATOM   899   C  CE1 . TYR A  1 118 ? -25.576 149.142 153.006 1.00 33.15  ? 118  TYR A CE1 1 
ATOM   900   C  CE2 . TYR A  1 118 ? -25.771 151.032 151.534 1.00 30.63  ? 118  TYR A CE2 1 
ATOM   901   C  CZ  . TYR A  1 118 ? -25.053 150.300 152.473 1.00 29.09  ? 118  TYR A CZ  1 
ATOM   902   O  OH  . TYR A  1 118 ? -23.821 150.707 152.896 1.00 35.10  ? 118  TYR A OH  1 
ATOM   903   N  N   . PHE A  1 119 ? -30.620 146.059 151.150 1.00 30.67  ? 119  PHE A N   1 
ATOM   904   C  CA  . PHE A  1 119 ? -31.894 145.360 151.207 1.00 28.78  ? 119  PHE A CA  1 
ATOM   905   C  C   . PHE A  1 119 ? -32.385 145.229 152.636 1.00 34.35  ? 119  PHE A C   1 
ATOM   906   O  O   . PHE A  1 119 ? -31.626 144.914 153.557 1.00 31.39  ? 119  PHE A O   1 
ATOM   907   C  CB  . PHE A  1 119 ? -31.813 143.962 150.569 1.00 29.04  ? 119  PHE A CB  1 
ATOM   908   C  CG  . PHE A  1 119 ? -31.616 144.014 149.099 1.00 31.63  ? 119  PHE A CG  1 
ATOM   909   C  CD1 . PHE A  1 119 ? -30.351 144.172 148.578 1.00 27.77  ? 119  PHE A CD1 1 
ATOM   910   C  CD2 . PHE A  1 119 ? -32.700 143.970 148.240 1.00 31.55  ? 119  PHE A CD2 1 
ATOM   911   C  CE1 . PHE A  1 119 ? -30.162 144.259 147.216 1.00 29.18  ? 119  PHE A CE1 1 
ATOM   912   C  CE2 . PHE A  1 119 ? -32.525 144.064 146.880 1.00 31.77  ? 119  PHE A CE2 1 
ATOM   913   C  CZ  . PHE A  1 119 ? -31.239 144.201 146.363 1.00 30.94  ? 119  PHE A CZ  1 
ATOM   914   N  N   . GLU A  1 120 ? -33.671 145.452 152.791 1.00 27.60  ? 120  GLU A N   1 
ATOM   915   C  CA  . GLU A  1 120 ? -34.376 145.162 154.015 1.00 27.94  ? 120  GLU A CA  1 
ATOM   916   C  C   . GLU A  1 120 ? -34.953 143.755 153.946 1.00 28.12  ? 120  GLU A C   1 
ATOM   917   O  O   . GLU A  1 120 ? -35.477 143.334 152.910 1.00 31.62  ? 120  GLU A O   1 
ATOM   918   C  CB  . GLU A  1 120 ? -35.483 146.202 154.220 1.00 32.28  ? 120  GLU A CB  1 
ATOM   919   C  CG  . GLU A  1 120 ? -36.494 145.827 155.269 1.00 45.87  ? 120  GLU A CG  1 
ATOM   920   C  CD  . GLU A  1 120 ? -37.690 146.768 155.297 1.00 50.00  ? 120  GLU A CD  1 
ATOM   921   O  OE1 . GLU A  1 120 ? -37.666 147.811 154.597 1.00 48.85  ? 120  GLU A OE1 1 
ATOM   922   O  OE2 . GLU A  1 120 ? -38.649 146.451 156.027 1.00 54.87  ? 120  GLU A OE2 1 
ATOM   923   N  N   . VAL A  1 121 ? -34.836 143.022 155.047 1.00 31.84  ? 121  VAL A N   1 
ATOM   924   C  CA  . VAL A  1 121 ? -35.442 141.704 155.157 1.00 30.62  ? 121  VAL A CA  1 
ATOM   925   C  C   . VAL A  1 121 ? -36.881 141.924 155.607 1.00 36.14  ? 121  VAL A C   1 
ATOM   926   O  O   . VAL A  1 121 ? -37.144 142.158 156.781 1.00 39.01  ? 121  VAL A O   1 
ATOM   927   C  CB  . VAL A  1 121 ? -34.668 140.796 156.112 1.00 32.18  ? 121  VAL A CB  1 
ATOM   928   C  CG1 . VAL A  1 121 ? -35.344 139.419 156.189 1.00 33.01  ? 121  VAL A CG1 1 
ATOM   929   C  CG2 . VAL A  1 121 ? -33.234 140.639 155.620 1.00 34.79  ? 121  VAL A CG2 1 
ATOM   930   N  N   . VAL A  1 122 ? -37.809 141.860 154.652 1.00 34.98  ? 122  VAL A N   1 
ATOM   931   C  CA  . VAL A  1 122 ? -39.227 142.102 154.924 1.00 37.72  ? 122  VAL A CA  1 
ATOM   932   C  C   . VAL A  1 122 ? -39.806 140.979 155.771 1.00 36.98  ? 122  VAL A C   1 
ATOM   933   O  O   . VAL A  1 122 ? -40.558 141.213 156.722 1.00 33.94  ? 122  VAL A O   1 
ATOM   934   C  CB  . VAL A  1 122 ? -39.998 142.233 153.596 1.00 41.71  ? 122  VAL A CB  1 
ATOM   935   C  CG1 . VAL A  1 122 ? -41.474 142.308 153.851 1.00 45.53  ? 122  VAL A CG1 1 
ATOM   936   C  CG2 . VAL A  1 122 ? -39.501 143.442 152.796 1.00 34.64  ? 122  VAL A CG2 1 
ATOM   937   N  N   . LYS A  1 123 ? -39.505 139.741 155.398 1.00 31.61  ? 123  LYS A N   1 
ATOM   938   C  CA  . LYS A  1 123 ? -39.937 138.572 156.129 1.00 30.09  ? 123  LYS A CA  1 
ATOM   939   C  C   . LYS A  1 123 ? -39.031 137.418 155.723 1.00 37.84  ? 123  LYS A C   1 
ATOM   940   O  O   . LYS A  1 123 ? -38.488 137.400 154.613 1.00 33.07  ? 123  LYS A O   1 
ATOM   941   C  CB  . LYS A  1 123 ? -41.403 138.246 155.842 1.00 47.02  ? 123  LYS A CB  1 
ATOM   942   C  CG  . LYS A  1 123 ? -42.046 137.517 156.981 1.00 57.82  ? 123  LYS A CG  1 
ATOM   943   C  CD  . LYS A  1 123 ? -43.459 137.992 157.253 1.00 69.17  ? 123  LYS A CD  1 
ATOM   944   C  CE  . LYS A  1 123 ? -44.004 137.282 158.492 1.00 75.92  ? 123  LYS A CE  1 
ATOM   945   N  NZ  . LYS A  1 123 ? -43.879 135.792 158.381 1.00 76.77  ? 123  LYS A NZ  1 
ATOM   946   N  N   . SER A  1 124 ? -38.886 136.443 156.613 1.00 32.84  ? 124  SER A N   1 
ATOM   947   C  CA  . SER A  1 124 ? -38.002 135.330 156.308 1.00 30.20  ? 124  SER A CA  1 
ATOM   948   C  C   . SER A  1 124 ? -38.461 134.105 157.078 1.00 32.54  ? 124  SER A C   1 
ATOM   949   O  O   . SER A  1 124 ? -39.179 134.205 158.078 1.00 34.32  ? 124  SER A O   1 
ATOM   950   C  CB  . SER A  1 124 ? -36.549 135.639 156.658 1.00 29.80  ? 124  SER A CB  1 
ATOM   951   O  OG  . SER A  1 124 ? -36.381 135.609 158.064 1.00 39.06  ? 124  SER A OG  1 
ATOM   952   N  N   . ASP A  1 125 ? -38.084 132.946 156.547 1.00 34.73  ? 125  ASP A N   1 
ATOM   953   C  CA  . ASP A  1 125 ? -38.143 131.662 157.235 1.00 36.25  ? 125  ASP A CA  1 
ATOM   954   C  C   . ASP A  1 125 ? -36.900 130.913 156.751 1.00 39.46  ? 125  ASP A C   1 
ATOM   955   O  O   . ASP A  1 125 ? -36.964 130.076 155.840 1.00 36.56  ? 125  ASP A O   1 
ATOM   956   C  CB  . ASP A  1 125 ? -39.434 130.900 156.942 1.00 31.30  ? 125  ASP A CB  1 
ATOM   957   C  CG  . ASP A  1 125 ? -39.527 129.598 157.721 1.00 36.05  ? 125  ASP A CG  1 
ATOM   958   O  OD1 . ASP A  1 125 ? -38.609 129.289 158.510 1.00 39.64  ? 125  ASP A OD1 1 
ATOM   959   O  OD2 . ASP A  1 125 ? -40.503 128.859 157.511 1.00 47.68  ? 125  ASP A OD2 1 
ATOM   960   N  N   . LEU A  1 126 ? -35.755 131.272 157.328 1.00 30.47  ? 126  LEU A N   1 
ATOM   961   C  CA  . LEU A  1 126 ? -34.450 130.765 156.920 1.00 31.64  ? 126  LEU A CA  1 
ATOM   962   C  C   . LEU A  1 126 ? -33.852 129.965 158.062 1.00 34.73  ? 126  LEU A C   1 
ATOM   963   O  O   . LEU A  1 126 ? -33.605 130.534 159.135 1.00 38.96  ? 126  LEU A O   1 
ATOM   964   C  CB  . LEU A  1 126 ? -33.500 131.894 156.566 1.00 29.73  ? 126  LEU A CB  1 
ATOM   965   C  CG  . LEU A  1 126 ? -33.341 132.366 155.134 1.00 52.56  ? 126  LEU A CG  1 
ATOM   966   C  CD1 . LEU A  1 126 ? -32.137 133.319 155.076 1.00 41.73  ? 126  LEU A CD1 1 
ATOM   967   C  CD2 . LEU A  1 126 ? -33.172 131.188 154.178 1.00 29.25  ? 126  LEU A CD2 1 
ATOM   968   N  N   . PRO A  1 127 ? -33.567 128.682 157.882 1.00 32.77  ? 127  PRO A N   1 
ATOM   969   C  CA  . PRO A  1 127 ? -32.917 127.905 158.944 1.00 33.02  ? 127  PRO A CA  1 
ATOM   970   C  C   . PRO A  1 127 ? -31.427 128.214 159.050 1.00 31.67  ? 127  PRO A C   1 
ATOM   971   O  O   . PRO A  1 127 ? -30.799 128.725 158.118 1.00 34.13  ? 127  PRO A O   1 
ATOM   972   C  CB  . PRO A  1 127 ? -33.116 126.449 158.501 1.00 31.18  ? 127  PRO A CB  1 
ATOM   973   C  CG  . PRO A  1 127 ? -33.335 126.504 157.018 1.00 32.23  ? 127  PRO A CG  1 
ATOM   974   C  CD  . PRO A  1 127 ? -33.709 127.931 156.623 1.00 30.51  ? 127  PRO A CD  1 
ATOM   975   N  N   . GLN A  1 128 ? -30.862 127.855 160.206 1.00 32.83  ? 128  GLN A N   1 
ATOM   976   C  CA  . GLN A  1 128 ? -29.409 127.873 160.393 1.00 43.28  ? 128  GLN A CA  1 
ATOM   977   C  C   . GLN A  1 128 ? -28.732 126.863 159.471 1.00 41.29  ? 128  GLN A C   1 
ATOM   978   O  O   . GLN A  1 128 ? -29.260 125.779 159.199 1.00 34.74  ? 128  GLN A O   1 
ATOM   979   C  CB  . GLN A  1 128 ? -29.048 127.565 161.857 1.00 48.54  ? 128  GLN A CB  1 
ATOM   980   C  CG  . GLN A  1 128 ? -29.559 128.607 162.857 1.00 75.26  ? 128  GLN A CG  1 
ATOM   981   C  CD  . GLN A  1 128 ? -29.241 128.260 164.319 1.00 86.05  ? 128  GLN A CD  1 
ATOM   982   O  OE1 . GLN A  1 128 ? -28.605 127.246 164.609 1.00 91.72  ? 128  GLN A OE1 1 
ATOM   983   N  NE2 . GLN A  1 128 ? -29.748 129.076 165.241 1.00 85.47  ? 128  GLN A NE2 1 
ATOM   984   N  N   . ILE A  1 129 ? -27.539 127.204 158.996 1.00 27.01  ? 129  ILE A N   1 
ATOM   985   C  CA  . ILE A  1 129 ? -26.850 126.235 158.152 1.00 32.00  ? 129  ILE A CA  1 
ATOM   986   C  C   . ILE A  1 129 ? -26.125 125.220 159.032 1.00 34.46  ? 129  ILE A C   1 
ATOM   987   O  O   . ILE A  1 129 ? -25.800 125.478 160.194 1.00 27.56  ? 129  ILE A O   1 
ATOM   988   C  CB  . ILE A  1 129 ? -25.896 126.903 157.142 1.00 37.95  ? 129  ILE A CB  1 
ATOM   989   C  CG1 . ILE A  1 129 ? -24.784 127.666 157.837 1.00 33.38  ? 129  ILE A CG1 1 
ATOM   990   C  CG2 . ILE A  1 129 ? -26.688 127.834 156.199 1.00 36.58  ? 129  ILE A CG2 1 
ATOM   991   C  CD1 . ILE A  1 129 ? -23.758 128.191 156.836 1.00 36.12  ? 129  ILE A CD1 1 
ATOM   992   N  N   . MET A  1 130 ? -25.932 124.020 158.501 1.00 30.35  ? 130  MET A N   1 
ATOM   993   C  CA  . MET A  1 130 ? -25.318 122.940 159.267 1.00 32.58  ? 130  MET A CA  1 
ATOM   994   C  C   . MET A  1 130 ? -24.748 121.933 158.288 1.00 32.57  ? 130  MET A C   1 
ATOM   995   O  O   . MET A  1 130 ? -24.820 122.106 157.069 1.00 33.56  ? 130  MET A O   1 
ATOM   996   C  CB  . MET A  1 130 ? -26.320 122.267 160.208 1.00 25.26  ? 130  MET A CB  1 
ATOM   997   C  CG  . MET A  1 130 ? -27.513 121.659 159.456 1.00 31.41  ? 130  MET A CG  1 
ATOM   998   S  SD  . MET A  1 130 ? -28.746 120.874 160.533 1.00 36.85  ? 130  MET A SD  1 
ATOM   999   C  CE  . MET A  1 130 ? -29.644 122.296 161.129 1.00 46.26  ? 130  MET A CE  1 
ATOM   1000  N  N   . SER A  1 131 ? -24.179 120.874 158.830 1.00 27.29  ? 131  SER A N   1 
ATOM   1001  C  CA  . SER A  1 131 ? -23.718 119.787 157.991 1.00 30.36  ? 131  SER A CA  1 
ATOM   1002  C  C   . SER A  1 131 ? -24.409 118.497 158.419 1.00 25.79  ? 131  SER A C   1 
ATOM   1003  O  O   . SER A  1 131 ? -25.102 118.451 159.443 1.00 26.34  ? 131  SER A O   1 
ATOM   1004  C  CB  . SER A  1 131 ? -22.195 119.668 158.051 1.00 30.36  ? 131  SER A CB  1 
ATOM   1005  O  OG  . SER A  1 131 ? -21.825 119.050 159.262 1.00 34.95  ? 131  SER A OG  1 
ATOM   1006  N  N   . MET A  1 132 ? -24.218 117.456 157.599 1.00 29.66  ? 132  MET A N   1 
ATOM   1007  C  CA  . MET A  1 132 ? -24.821 116.144 157.851 1.00 32.76  ? 132  MET A CA  1 
ATOM   1008  C  C   . MET A  1 132 ? -24.481 115.613 159.243 1.00 28.34  ? 132  MET A C   1 
ATOM   1009  O  O   . MET A  1 132 ? -25.345 115.067 159.939 1.00 26.09  ? 132  MET A O   1 
ATOM   1010  C  CB  . MET A  1 132 ? -24.360 115.133 156.793 1.00 38.58  ? 132  MET A CB  1 
ATOM   1011  C  CG  . MET A  1 132 ? -24.905 115.322 155.385 1.00 53.02  ? 132  MET A CG  1 
ATOM   1012  S  SD  . MET A  1 132 ? -26.664 114.914 155.229 1.00 79.99  ? 132  MET A SD  1 
ATOM   1013  C  CE  . MET A  1 132 ? -26.825 114.654 153.456 1.00 82.45  ? 132  MET A CE  1 
ATOM   1014  N  N   . THR A  1 133 ? -23.206 115.697 159.639 1.00 30.40  ? 133  THR A N   1 
ATOM   1015  C  CA  . THR A  1 133 ? -22.824 115.149 160.935 1.00 31.66  ? 133  THR A CA  1 
ATOM   1016  C  C   . THR A  1 133 ? -23.370 115.968 162.099 1.00 32.26  ? 133  THR A C   1 
ATOM   1017  O  O   . THR A  1 133 ? -23.278 115.515 163.249 1.00 27.97  ? 133  THR A O   1 
ATOM   1018  C  CB  . THR A  1 133 ? -21.293 115.007 161.040 1.00 35.06  ? 133  THR A CB  1 
ATOM   1019  O  OG1 . THR A  1 133 ? -20.662 116.249 160.738 1.00 32.41  ? 133  THR A OG1 1 
ATOM   1020  C  CG2 . THR A  1 133 ? -20.782 113.935 160.073 1.00 28.10  ? 133  THR A CG2 1 
ATOM   1021  N  N   . ASP A  1 134 ? -23.952 117.147 161.831 1.00 30.89  ? 134  ASP A N   1 
ATOM   1022  C  CA  . ASP A  1 134 ? -24.652 117.917 162.855 1.00 27.79  ? 134  ASP A CA  1 
ATOM   1023  C  C   . ASP A  1 134 ? -26.107 117.496 163.031 1.00 27.86  ? 134  ASP A C   1 
ATOM   1024  O  O   . ASP A  1 134 ? -26.738 117.863 164.034 1.00 27.79  ? 134  ASP A O   1 
ATOM   1025  C  CB  . ASP A  1 134 ? -24.633 119.411 162.518 1.00 30.70  ? 134  ASP A CB  1 
ATOM   1026  C  CG  . ASP A  1 134 ? -23.220 119.963 162.380 1.00 34.11  ? 134  ASP A CG  1 
ATOM   1027  O  OD1 . ASP A  1 134 ? -22.323 119.473 163.087 1.00 40.75  ? 134  ASP A OD1 1 
ATOM   1028  O  OD2 . ASP A  1 134 ? -23.004 120.888 161.567 1.00 37.61  ? 134  ASP A OD2 1 
ATOM   1029  N  N   . VAL A  1 135 ? -26.674 116.767 162.078 1.00 32.13  ? 135  VAL A N   1 
ATOM   1030  C  CA  . VAL A  1 135 ? -28.128 116.600 162.056 1.00 31.99  ? 135  VAL A CA  1 
ATOM   1031  C  C   . VAL A  1 135 ? -28.643 115.810 163.265 1.00 29.70  ? 135  VAL A C   1 
ATOM   1032  O  O   . VAL A  1 135 ? -29.652 116.221 163.861 1.00 29.17  ? 135  VAL A O   1 
ATOM   1033  C  CB  . VAL A  1 135 ? -28.571 116.009 160.708 1.00 30.01  ? 135  VAL A CB  1 
ATOM   1034  C  CG1 . VAL A  1 135 ? -30.049 115.623 160.736 1.00 30.52  ? 135  VAL A CG1 1 
ATOM   1035  C  CG2 . VAL A  1 135 ? -28.316 117.053 159.629 1.00 30.49  ? 135  VAL A CG2 1 
ATOM   1036  N  N   . PRO A  1 136 ? -28.028 114.692 163.689 1.00 33.36  ? 136  PRO A N   1 
ATOM   1037  C  CA  . PRO A  1 136 ? -28.570 114.023 164.890 1.00 31.98  ? 136  PRO A CA  1 
ATOM   1038  C  C   . PRO A  1 136 ? -28.591 114.922 166.112 1.00 27.40  ? 136  PRO A C   1 
ATOM   1039  O  O   . PRO A  1 136 ? -29.566 114.898 166.871 1.00 33.02  ? 136  PRO A O   1 
ATOM   1040  C  CB  . PRO A  1 136 ? -27.662 112.792 165.067 1.00 28.83  ? 136  PRO A CB  1 
ATOM   1041  C  CG  . PRO A  1 136 ? -27.184 112.494 163.661 1.00 30.24  ? 136  PRO A CG  1 
ATOM   1042  C  CD  . PRO A  1 136 ? -26.963 113.884 163.055 1.00 32.35  ? 136  PRO A CD  1 
ATOM   1043  N  N   . GLN A  1 137 ? -27.560 115.738 166.325 1.00 32.45  ? 137  GLN A N   1 
ATOM   1044  C  CA  . GLN A  1 137 ? -27.576 116.608 167.498 1.00 36.52  ? 137  GLN A CA  1 
ATOM   1045  C  C   . GLN A  1 137 ? -28.628 117.713 167.375 1.00 42.13  ? 137  GLN A C   1 
ATOM   1046  O  O   . GLN A  1 137 ? -29.276 118.083 168.371 1.00 38.07  ? 137  GLN A O   1 
ATOM   1047  C  CB  . GLN A  1 137 ? -26.194 117.201 167.726 1.00 24.93  ? 137  GLN A CB  1 
ATOM   1048  C  CG  . GLN A  1 137 ? -26.210 118.301 168.741 1.00 34.99  ? 137  GLN A CG  1 
ATOM   1049  C  CD  . GLN A  1 137 ? -24.824 118.671 169.206 1.00 36.49  ? 137  GLN A CD  1 
ATOM   1050  O  OE1 . GLN A  1 137 ? -24.318 119.733 168.873 1.00 42.09  ? 137  GLN A OE1 1 
ATOM   1051  N  NE2 . GLN A  1 137 ? -24.220 117.810 170.017 1.00 30.26  ? 137  GLN A NE2 1 
ATOM   1052  N  N   . VAL A  1 138 ? -28.798 118.270 166.174 1.00 35.94  ? 138  VAL A N   1 
ATOM   1053  C  CA  . VAL A  1 138 ? -29.855 119.261 165.964 1.00 40.34  ? 138  VAL A CA  1 
ATOM   1054  C  C   . VAL A  1 138 ? -31.216 118.643 166.256 1.00 39.48  ? 138  VAL A C   1 
ATOM   1055  O  O   . VAL A  1 138 ? -32.066 119.245 166.926 1.00 39.33  ? 138  VAL A O   1 
ATOM   1056  C  CB  . VAL A  1 138 ? -29.783 119.828 164.530 1.00 39.02  ? 138  VAL A CB  1 
ATOM   1057  C  CG1 . VAL A  1 138 ? -31.080 120.594 164.180 1.00 39.55  ? 138  VAL A CG1 1 
ATOM   1058  C  CG2 . VAL A  1 138 ? -28.583 120.746 164.389 1.00 31.65  ? 138  VAL A CG2 1 
ATOM   1059  N  N   . LEU A  1 139 ? -31.420 117.410 165.804 1.00 38.44  ? 139  LEU A N   1 
ATOM   1060  C  CA  . LEU A  1 139 ? -32.664 116.709 166.089 1.00 40.01  ? 139  LEU A CA  1 
ATOM   1061  C  C   . LEU A  1 139 ? -32.852 116.522 167.592 1.00 44.66  ? 139  LEU A C   1 
ATOM   1062  O  O   . LEU A  1 139 ? -33.906 116.859 168.153 1.00 39.64  ? 139  LEU A O   1 
ATOM   1063  C  CB  . LEU A  1 139 ? -32.652 115.368 165.361 1.00 44.58  ? 139  LEU A CB  1 
ATOM   1064  C  CG  . LEU A  1 139 ? -33.907 114.523 165.229 1.00 45.82  ? 139  LEU A CG  1 
ATOM   1065  C  CD1 . LEU A  1 139 ? -34.934 115.268 164.465 1.00 45.59  ? 139  LEU A CD1 1 
ATOM   1066  C  CD2 . LEU A  1 139 ? -33.531 113.294 164.464 1.00 54.66  ? 139  LEU A CD2 1 
ATOM   1067  N  N   . GLY A  1 140 ? -31.827 115.998 168.266 1.00 37.22  ? 140  GLY A N   1 
ATOM   1068  C  CA  . GLY A  1 140 ? -31.933 115.790 169.702 1.00 33.87  ? 140  GLY A CA  1 
ATOM   1069  C  C   . GLY A  1 140 ? -32.168 117.081 170.464 1.00 44.90  ? 140  GLY A C   1 
ATOM   1070  O  O   . GLY A  1 140 ? -32.978 117.125 171.396 1.00 40.57  ? 140  GLY A O   1 
ATOM   1071  N  N   . ASP A  1 141 ? -31.466 118.153 170.081 1.00 40.77  ? 141  ASP A N   1 
ATOM   1072  C  CA  . ASP A  1 141 ? -31.651 119.425 170.771 1.00 43.95  ? 141  ASP A CA  1 
ATOM   1073  C  C   . ASP A  1 141 ? -33.054 119.965 170.541 1.00 50.24  ? 141  ASP A C   1 
ATOM   1074  O  O   . ASP A  1 141 ? -33.674 120.515 171.459 1.00 47.66  ? 141  ASP A O   1 
ATOM   1075  C  CB  . ASP A  1 141 ? -30.616 120.438 170.288 1.00 47.16  ? 141  ASP A CB  1 
ATOM   1076  C  CG  . ASP A  1 141 ? -29.199 120.078 170.707 1.00 49.11  ? 141  ASP A CG  1 
ATOM   1077  O  OD1 . ASP A  1 141 ? -29.009 119.102 171.474 1.00 48.09  ? 141  ASP A OD1 1 
ATOM   1078  O  OD2 . ASP A  1 141 ? -28.268 120.754 170.218 1.00 48.27  ? 141  ASP A OD2 1 
ATOM   1079  N  N   . SER A  1 142 ? -33.578 119.790 169.327 1.00 51.31  ? 142  SER A N   1 
ATOM   1080  C  CA  . SER A  1 142 ? -34.928 120.250 169.027 1.00 46.73  ? 142  SER A CA  1 
ATOM   1081  C  C   . SER A  1 142 ? -35.952 119.528 169.889 1.00 50.11  ? 142  SER A C   1 
ATOM   1082  O  O   . SER A  1 142 ? -36.865 120.159 170.432 1.00 48.17  ? 142  SER A O   1 
ATOM   1083  C  CB  . SER A  1 142 ? -35.233 120.057 167.542 1.00 39.68  ? 142  SER A CB  1 
ATOM   1084  O  OG  . SER A  1 142 ? -34.458 120.945 166.752 1.00 44.37  ? 142  SER A OG  1 
ATOM   1085  N  N   . PHE A  1 143 ? -35.812 118.210 170.048 1.00 45.15  ? 143  PHE A N   1 
ATOM   1086  C  CA  . PHE A  1 143 ? -36.753 117.498 170.907 1.00 53.90  ? 143  PHE A CA  1 
ATOM   1087  C  C   . PHE A  1 143 ? -36.647 117.971 172.349 1.00 55.15  ? 143  PHE A C   1 
ATOM   1088  O  O   . PHE A  1 143 ? -37.663 118.256 172.993 1.00 59.93  ? 143  PHE A O   1 
ATOM   1089  C  CB  . PHE A  1 143 ? -36.525 115.991 170.825 1.00 61.50  ? 143  PHE A CB  1 
ATOM   1090  C  CG  . PHE A  1 143 ? -36.956 115.398 169.527 1.00 77.77  ? 143  PHE A CG  1 
ATOM   1091  C  CD1 . PHE A  1 143 ? -37.747 116.126 168.655 1.00 88.74  ? 143  PHE A CD1 1 
ATOM   1092  C  CD2 . PHE A  1 143 ? -36.597 114.115 169.180 1.00 80.35  ? 143  PHE A CD2 1 
ATOM   1093  C  CE1 . PHE A  1 143 ? -38.154 115.591 167.450 1.00 91.97  ? 143  PHE A CE1 1 
ATOM   1094  C  CE2 . PHE A  1 143 ? -37.002 113.572 167.976 1.00 85.04  ? 143  PHE A CE2 1 
ATOM   1095  C  CZ  . PHE A  1 143 ? -37.780 114.313 167.110 1.00 88.23  ? 143  PHE A CZ  1 
ATOM   1096  N  N   . ALA A  1 144 ? -35.419 118.120 172.849 1.00 48.10  ? 144  ALA A N   1 
ATOM   1097  C  CA  . ALA A  1 144 ? -35.213 118.552 174.227 1.00 50.51  ? 144  ALA A CA  1 
ATOM   1098  C  C   . ALA A  1 144 ? -35.877 119.902 174.497 1.00 59.63  ? 144  ALA A C   1 
ATOM   1099  O  O   . ALA A  1 144 ? -36.586 120.068 175.497 1.00 64.27  ? 144  ALA A O   1 
ATOM   1100  C  CB  . ALA A  1 144 ? -33.713 118.610 174.525 1.00 52.03  ? 144  ALA A CB  1 
ATOM   1101  N  N   . LYS A  1 145 ? -35.666 120.877 173.612 1.00 58.10  ? 145  LYS A N   1 
ATOM   1102  C  CA  . LYS A  1 145 ? -36.237 122.213 173.747 1.00 55.86  ? 145  LYS A CA  1 
ATOM   1103  C  C   . LYS A  1 145 ? -37.693 122.283 173.298 1.00 57.78  ? 145  LYS A C   1 
ATOM   1104  O  O   . LYS A  1 145 ? -38.243 123.385 173.228 1.00 63.69  ? 145  LYS A O   1 
ATOM   1105  C  CB  . LYS A  1 145 ? -35.406 123.222 172.943 1.00 52.45  ? 145  LYS A CB  1 
ATOM   1106  C  CG  . LYS A  1 145 ? -34.096 123.642 173.581 1.00 60.19  ? 145  LYS A CG  1 
ATOM   1107  C  CD  . LYS A  1 145 ? -32.953 123.683 172.546 1.00 72.89  ? 145  LYS A CD  1 
ATOM   1108  C  CE  . LYS A  1 145 ? -33.123 124.748 171.469 1.00 76.99  ? 145  LYS A CE  1 
ATOM   1109  N  NZ  . LYS A  1 145 ? -32.077 124.631 170.397 1.00 79.29  ? 145  LYS A NZ  1 
ATOM   1110  N  N   . GLN A  1 146 ? -38.317 121.146 172.982 1.00 63.87  ? 146  GLN A N   1 
ATOM   1111  C  CA  . GLN A  1 146 ? -39.703 121.110 172.506 1.00 72.37  ? 146  GLN A CA  1 
ATOM   1112  C  C   . GLN A  1 146 ? -39.914 122.004 171.283 1.00 71.51  ? 146  GLN A C   1 
ATOM   1113  O  O   . GLN A  1 146 ? -41.014 122.508 171.050 1.00 71.39  ? 146  GLN A O   1 
ATOM   1114  C  CB  . GLN A  1 146 ? -40.679 121.494 173.619 1.00 84.75  ? 146  GLN A CB  1 
ATOM   1115  C  CG  . GLN A  1 146 ? -40.635 120.585 174.820 1.00 95.96  ? 146  GLN A CG  1 
ATOM   1116  C  CD  . GLN A  1 146 ? -41.275 119.256 174.524 1.00 106.61 ? 146  GLN A CD  1 
ATOM   1117  O  OE1 . GLN A  1 146 ? -40.591 118.262 174.276 1.00 113.04 ? 146  GLN A OE1 1 
ATOM   1118  N  NE2 . GLN A  1 146 ? -42.602 119.229 174.534 1.00 107.95 ? 146  GLN A NE2 1 
ATOM   1119  N  N   . GLU A  1 147 ? -38.868 122.215 170.487 1.00 64.32  ? 147  GLU A N   1 
ATOM   1120  C  CA  . GLU A  1 147 ? -38.954 123.085 169.324 1.00 54.66  ? 147  GLU A CA  1 
ATOM   1121  C  C   . GLU A  1 147 ? -39.011 122.260 168.045 1.00 53.04  ? 147  GLU A C   1 
ATOM   1122  O  O   . GLU A  1 147 ? -38.638 121.081 168.011 1.00 52.40  ? 147  GLU A O   1 
ATOM   1123  C  CB  . GLU A  1 147 ? -37.777 124.059 169.292 1.00 59.39  ? 147  GLU A CB  1 
ATOM   1124  C  CG  . GLU A  1 147 ? -37.809 125.043 170.450 1.00 74.14  ? 147  GLU A CG  1 
ATOM   1125  C  CD  . GLU A  1 147 ? -36.576 125.926 170.533 1.00 86.79  ? 147  GLU A CD  1 
ATOM   1126  O  OE1 . GLU A  1 147 ? -35.658 125.768 169.693 1.00 84.71  ? 147  GLU A OE1 1 
ATOM   1127  O  OE2 . GLU A  1 147 ? -36.534 126.787 171.442 1.00 92.67  ? 147  GLU A OE2 1 
ATOM   1128  N  N   . ARG A  1 148 ? -39.475 122.903 166.978 1.00 45.21  ? 148  ARG A N   1 
ATOM   1129  C  CA  . ARG A  1 148 ? -39.608 122.206 165.707 1.00 41.17  ? 148  ARG A CA  1 
ATOM   1130  C  C   . ARG A  1 148 ? -38.244 121.958 165.067 1.00 38.54  ? 148  ARG A C   1 
ATOM   1131  O  O   . ARG A  1 148 ? -37.335 122.789 165.142 1.00 41.43  ? 148  ARG A O   1 
ATOM   1132  C  CB  . ARG A  1 148 ? -40.501 122.998 164.756 1.00 42.93  ? 148  ARG A CB  1 
ATOM   1133  C  CG  . ARG A  1 148 ? -40.968 122.169 163.590 1.00 47.38  ? 148  ARG A CG  1 
ATOM   1134  C  CD  . ARG A  1 148 ? -41.923 122.923 162.713 1.00 49.32  ? 148  ARG A CD  1 
ATOM   1135  N  NE  . ARG A  1 148 ? -42.451 122.069 161.658 1.00 43.33  ? 148  ARG A NE  1 
ATOM   1136  C  CZ  . ARG A  1 148 ? -43.034 122.533 160.560 1.00 47.63  ? 148  ARG A CZ  1 
ATOM   1137  N  NH1 . ARG A  1 148 ? -43.159 123.841 160.371 1.00 47.80  ? 148  ARG A NH1 1 
ATOM   1138  N  NH2 . ARG A  1 148 ? -43.475 121.693 159.642 1.00 52.77  ? 148  ARG A NH2 1 
ATOM   1139  N  N   . VAL A  1 149 ? -38.089 120.781 164.484 1.00 40.99  ? 149  VAL A N   1 
ATOM   1140  C  CA  . VAL A  1 149 ? -36.868 120.498 163.727 1.00 35.05  ? 149  VAL A CA  1 
ATOM   1141  C  C   . VAL A  1 149 ? -36.895 121.296 162.431 1.00 34.13  ? 149  VAL A C   1 
ATOM   1142  O  O   . VAL A  1 149 ? -37.924 121.304 161.736 1.00 37.15  ? 149  VAL A O   1 
ATOM   1143  C  CB  . VAL A  1 149 ? -36.744 119.005 163.441 1.00 35.31  ? 149  VAL A CB  1 
ATOM   1144  C  CG1 . VAL A  1 149 ? -35.428 118.739 162.689 1.00 29.19  ? 149  VAL A CG1 1 
ATOM   1145  C  CG2 . VAL A  1 149 ? -36.818 118.215 164.740 1.00 34.18  ? 149  VAL A CG2 1 
ATOM   1146  N  N   . PRO A  1 150 ? -35.821 121.988 162.073 1.00 34.68  ? 150  PRO A N   1 
ATOM   1147  C  CA  . PRO A  1 150 ? -35.819 122.768 160.836 1.00 29.53  ? 150  PRO A CA  1 
ATOM   1148  C  C   . PRO A  1 150 ? -35.596 121.889 159.609 1.00 36.37  ? 150  PRO A C   1 
ATOM   1149  O  O   . PRO A  1 150 ? -35.207 120.716 159.693 1.00 33.16  ? 150  PRO A O   1 
ATOM   1150  C  CB  . PRO A  1 150 ? -34.646 123.728 161.041 1.00 38.05  ? 150  PRO A CB  1 
ATOM   1151  C  CG  . PRO A  1 150 ? -33.699 122.939 161.901 1.00 36.75  ? 150  PRO A CG  1 
ATOM   1152  C  CD  . PRO A  1 150 ? -34.578 122.172 162.846 1.00 36.74  ? 150  PRO A CD  1 
ATOM   1153  N  N   . LYS A  1 151 ? -35.870 122.486 158.449 1.00 27.64  ? 151  LYS A N   1 
ATOM   1154  C  CA  . LYS A  1 151 ? -35.325 121.966 157.201 1.00 31.00  ? 151  LYS A CA  1 
ATOM   1155  C  C   . LYS A  1 151 ? -33.795 121.981 157.256 1.00 29.00  ? 151  LYS A C   1 
ATOM   1156  O  O   . LYS A  1 151 ? -33.177 122.863 157.869 1.00 33.14  ? 151  LYS A O   1 
ATOM   1157  C  CB  . LYS A  1 151 ? -35.825 122.812 156.024 1.00 24.11  ? 151  LYS A CB  1 
ATOM   1158  C  CG  . LYS A  1 151 ? -37.365 122.839 155.838 1.00 26.46  ? 151  LYS A CG  1 
ATOM   1159  C  CD  . LYS A  1 151 ? -37.925 121.388 155.719 1.00 28.97  ? 151  LYS A CD  1 
ATOM   1160  C  CE  . LYS A  1 151 ? -39.348 121.339 155.134 1.00 34.41  ? 151  LYS A CE  1 
ATOM   1161  N  NZ  . LYS A  1 151 ? -39.267 121.552 153.650 1.00 35.97  ? 151  LYS A NZ  1 
ATOM   1162  N  N   . VAL A  1 152 ? -33.167 121.002 156.620 1.00 27.80  ? 152  VAL A N   1 
ATOM   1163  C  CA  . VAL A  1 152 ? -31.707 120.891 156.674 1.00 36.09  ? 152  VAL A CA  1 
ATOM   1164  C  C   . VAL A  1 152 ? -31.093 121.751 155.574 1.00 31.37  ? 152  VAL A C   1 
ATOM   1165  O  O   . VAL A  1 152 ? -31.247 121.451 154.387 1.00 27.19  ? 152  VAL A O   1 
ATOM   1166  C  CB  . VAL A  1 152 ? -31.231 119.439 156.564 1.00 32.55  ? 152  VAL A CB  1 
ATOM   1167  C  CG1 . VAL A  1 152 ? -29.714 119.425 156.524 1.00 29.61  ? 152  VAL A CG1 1 
ATOM   1168  C  CG2 . VAL A  1 152 ? -31.724 118.638 157.760 1.00 36.29  ? 152  VAL A CG2 1 
ATOM   1169  N  N   . ALA A  1 153 ? -30.387 122.821 155.976 1.00 29.48  ? 153  ALA A N   1 
ATOM   1170  C  CA  . ALA A  1 153 ? -29.681 123.726 155.055 1.00 31.59  ? 153  ALA A CA  1 
ATOM   1171  C  C   . ALA A  1 153 ? -28.193 123.393 155.133 1.00 27.32  ? 153  ALA A C   1 
ATOM   1172  O  O   . ALA A  1 153 ? -27.504 123.821 156.061 1.00 32.48  ? 153  ALA A O   1 
ATOM   1173  C  CB  . ALA A  1 153 ? -29.943 125.199 155.397 1.00 25.72  ? 153  ALA A CB  1 
ATOM   1174  N  N   . LEU A  1 154 ? -27.701 122.608 154.173 1.00 28.92  ? 154  LEU A N   1 
ATOM   1175  C  CA  . LEU A  1 154 ? -26.329 122.112 154.226 1.00 33.15  ? 154  LEU A CA  1 
ATOM   1176  C  C   . LEU A  1 154 ? -25.359 123.218 153.830 1.00 28.66  ? 154  LEU A C   1 
ATOM   1177  O  O   . LEU A  1 154 ? -25.487 123.807 152.750 1.00 33.87  ? 154  LEU A O   1 
ATOM   1178  C  CB  . LEU A  1 154 ? -26.152 120.890 153.323 1.00 27.57  ? 154  LEU A CB  1 
ATOM   1179  C  CG  . LEU A  1 154 ? -26.927 119.654 153.796 1.00 29.74  ? 154  LEU A CG  1 
ATOM   1180  C  CD1 . LEU A  1 154 ? -26.770 118.524 152.795 1.00 27.09  ? 154  LEU A CD1 1 
ATOM   1181  C  CD2 . LEU A  1 154 ? -26.476 119.199 155.165 1.00 27.22  ? 154  LEU A CD2 1 
ATOM   1182  N  N   . SER A  1 155 ? -24.396 123.492 154.712 1.00 30.40  ? 155  SER A N   1 
ATOM   1183  C  CA  . SER A  1 155 ? -23.386 124.531 154.496 1.00 27.64  ? 155  SER A CA  1 
ATOM   1184  C  C   . SER A  1 155 ? -22.647 124.296 153.186 1.00 31.07  ? 155  SER A C   1 
ATOM   1185  O  O   . SER A  1 155 ? -22.093 123.216 152.969 1.00 31.57  ? 155  SER A O   1 
ATOM   1186  C  CB  . SER A  1 155 ? -22.403 124.542 155.668 1.00 28.39  ? 155  SER A CB  1 
ATOM   1187  O  OG  . SER A  1 155 ? -21.458 125.589 155.528 1.00 39.79  ? 155  SER A OG  1 
ATOM   1188  N  N   . SER A  1 156 ? -22.671 125.302 152.307 1.00 30.48  ? 156  SER A N   1 
ATOM   1189  C  CA  . SER A  1 156 ? -22.008 125.251 151.003 1.00 28.88  ? 156  SER A CA  1 
ATOM   1190  C  C   . SER A  1 156 ? -22.387 124.018 150.180 1.00 34.96  ? 156  SER A C   1 
ATOM   1191  O  O   . SER A  1 156 ? -21.583 123.555 149.372 1.00 37.80  ? 156  SER A O   1 
ATOM   1192  C  CB  . SER A  1 156 ? -20.480 125.303 151.171 1.00 37.95  ? 156  SER A CB  1 
ATOM   1193  O  OG  . SER A  1 156 ? -20.063 126.536 151.716 1.00 35.79  ? 156  SER A OG  1 
ATOM   1194  N  N   . GLN A  1 157 ? -23.594 123.475 150.369 1.00 33.31  ? 157  GLN A N   1 
ATOM   1195  C  CA  . GLN A  1 157 ? -24.024 122.247 149.685 1.00 33.55  ? 157  GLN A CA  1 
ATOM   1196  C  C   . GLN A  1 157 ? -25.532 122.280 149.420 1.00 33.17  ? 157  GLN A C   1 
ATOM   1197  O  O   . GLN A  1 157 ? -26.268 121.359 149.780 1.00 32.81  ? 157  GLN A O   1 
ATOM   1198  C  CB  . GLN A  1 157 ? -23.684 120.991 150.493 1.00 31.89  ? 157  GLN A CB  1 
ATOM   1199  C  CG  . GLN A  1 157 ? -22.227 120.555 150.510 1.00 58.64  ? 157  GLN A CG  1 
ATOM   1200  C  CD  . GLN A  1 157 ? -21.962 119.375 151.478 1.00 71.06  ? 157  GLN A CD  1 
ATOM   1201  O  OE1 . GLN A  1 157 ? -22.885 118.647 151.880 1.00 71.70  ? 157  GLN A OE1 1 
ATOM   1202  N  NE2 . GLN A  1 157 ? -20.690 119.186 151.841 1.00 66.46  ? 157  GLN A NE2 1 
ATOM   1203  N  N   . ARG A  1 158 ? -26.019 123.347 148.796 1.00 34.23  ? 158  ARG A N   1 
ATOM   1204  C  CA  . ARG A  1 158 ? -27.427 123.427 148.421 1.00 33.05  ? 158  ARG A CA  1 
ATOM   1205  C  C   . ARG A  1 158 ? -27.544 124.485 147.335 1.00 33.01  ? 158  ARG A C   1 
ATOM   1206  O  O   . ARG A  1 158 ? -26.546 125.049 146.884 1.00 32.21  ? 158  ARG A O   1 
ATOM   1207  C  CB  . ARG A  1 158 ? -28.326 123.717 149.633 1.00 29.75  ? 158  ARG A CB  1 
ATOM   1208  C  CG  . ARG A  1 158 ? -28.186 125.127 150.221 1.00 27.47  ? 158  ARG A CG  1 
ATOM   1209  C  CD  . ARG A  1 158 ? -28.679 125.225 151.650 1.00 28.49  ? 158  ARG A CD  1 
ATOM   1210  N  NE  . ARG A  1 158 ? -28.617 126.618 152.108 1.00 29.67  ? 158  ARG A NE  1 
ATOM   1211  C  CZ  . ARG A  1 158 ? -27.494 127.228 152.490 1.00 34.74  ? 158  ARG A CZ  1 
ATOM   1212  N  NH1 . ARG A  1 158 ? -26.334 126.559 152.516 1.00 29.95  ? 158  ARG A NH1 1 
ATOM   1213  N  NH2 . ARG A  1 158 ? -27.531 128.505 152.859 1.00 31.90  ? 158  ARG A NH2 1 
ATOM   1214  N  N   . THR A  1 159 ? -28.770 124.743 146.906 1.00 27.34  ? 159  THR A N   1 
ATOM   1215  C  CA  . THR A  1 159 ? -29.028 125.665 145.816 1.00 30.12  ? 159  THR A CA  1 
ATOM   1216  C  C   . THR A  1 159 ? -29.717 126.906 146.369 1.00 31.35  ? 159  THR A C   1 
ATOM   1217  O  O   . THR A  1 159 ? -30.622 126.806 147.208 1.00 28.71  ? 159  THR A O   1 
ATOM   1218  C  CB  . THR A  1 159 ? -29.885 124.995 144.738 1.00 30.15  ? 159  THR A CB  1 
ATOM   1219  O  OG1 . THR A  1 159 ? -29.130 123.947 144.139 1.00 36.05  ? 159  THR A OG1 1 
ATOM   1220  C  CG2 . THR A  1 159 ? -30.314 126.019 143.648 1.00 29.63  ? 159  THR A CG2 1 
ATOM   1221  N  N   . VAL A  1 160 ? -29.254 128.074 145.947 1.00 27.18  ? 160  VAL A N   1 
ATOM   1222  C  CA  . VAL A  1 160 ? -29.922 129.327 146.273 1.00 31.51  ? 160  VAL A CA  1 
ATOM   1223  C  C   . VAL A  1 160 ? -30.469 129.909 144.983 1.00 34.66  ? 160  VAL A C   1 
ATOM   1224  O  O   . VAL A  1 160 ? -29.755 130.019 143.976 1.00 32.96  ? 160  VAL A O   1 
ATOM   1225  C  CB  . VAL A  1 160 ? -28.998 130.315 147.008 1.00 33.99  ? 160  VAL A CB  1 
ATOM   1226  C  CG1 . VAL A  1 160 ? -29.708 131.672 147.210 1.00 28.41  ? 160  VAL A CG1 1 
ATOM   1227  C  CG2 . VAL A  1 160 ? -28.590 129.733 148.366 1.00 27.90  ? 160  VAL A CG2 1 
ATOM   1228  N  N   . VAL A  1 161 ? -31.742 130.257 145.010 1.00 30.39  ? 161  VAL A N   1 
ATOM   1229  C  CA  . VAL A  1 161 ? -32.423 130.853 143.877 1.00 30.43  ? 161  VAL A CA  1 
ATOM   1230  C  C   . VAL A  1 161 ? -32.845 132.262 144.271 1.00 29.94  ? 161  VAL A C   1 
ATOM   1231  O  O   . VAL A  1 161 ? -33.290 132.480 145.403 1.00 30.57  ? 161  VAL A O   1 
ATOM   1232  C  CB  . VAL A  1 161 ? -33.622 129.962 143.501 1.00 34.27  ? 161  VAL A CB  1 
ATOM   1233  C  CG1 . VAL A  1 161 ? -34.670 130.744 142.862 1.00 42.04  ? 161  VAL A CG1 1 
ATOM   1234  C  CG2 . VAL A  1 161 ? -33.146 128.809 142.605 1.00 27.82  ? 161  VAL A CG2 1 
ATOM   1235  N  N   . ILE A  1 162 ? -32.675 133.224 143.365 1.00 26.60  ? 162  ILE A N   1 
ATOM   1236  C  CA  . ILE A  1 162 ? -33.086 134.607 143.621 1.00 30.57  ? 162  ILE A CA  1 
ATOM   1237  C  C   . ILE A  1 162 ? -34.055 135.042 142.527 1.00 30.45  ? 162  ILE A C   1 
ATOM   1238  O  O   . ILE A  1 162 ? -33.694 135.053 141.340 1.00 32.29  ? 162  ILE A O   1 
ATOM   1239  C  CB  . ILE A  1 162 ? -31.893 135.569 143.687 1.00 33.32  ? 162  ILE A CB  1 
ATOM   1240  C  CG1 . ILE A  1 162 ? -30.898 135.115 144.766 1.00 33.32  ? 162  ILE A CG1 1 
ATOM   1241  C  CG2 . ILE A  1 162 ? -32.401 136.998 143.981 1.00 26.39  ? 162  ILE A CG2 1 
ATOM   1242  C  CD1 . ILE A  1 162 ? -29.656 136.011 144.865 1.00 35.31  ? 162  ILE A CD1 1 
ATOM   1243  N  N   . GLY A  1 163 ? -35.275 135.391 142.924 1.00 29.19  ? 163  GLY A N   1 
ATOM   1244  C  CA  . GLY A  1 163 ? -36.285 135.872 142.004 1.00 26.82  ? 163  GLY A CA  1 
ATOM   1245  C  C   . GLY A  1 163 ? -36.359 137.388 142.000 1.00 27.41  ? 163  GLY A C   1 
ATOM   1246  O  O   . GLY A  1 163 ? -36.639 138.007 143.025 1.00 27.17  ? 163  GLY A O   1 
ATOM   1247  N  N   . ASP A  1 164 ? -36.094 137.982 140.832 1.00 26.47  ? 164  ASP A N   1 
ATOM   1248  C  CA  . ASP A  1 164 ? -36.077 139.427 140.665 1.00 27.96  ? 164  ASP A CA  1 
ATOM   1249  C  C   . ASP A  1 164 ? -37.484 139.925 140.314 1.00 30.22  ? 164  ASP A C   1 
ATOM   1250  O  O   . ASP A  1 164 ? -38.063 139.522 139.299 1.00 29.90  ? 164  ASP A O   1 
ATOM   1251  C  CB  . ASP A  1 164 ? -35.069 139.807 139.579 1.00 28.44  ? 164  ASP A CB  1 
ATOM   1252  C  CG  . ASP A  1 164 ? -34.697 141.279 139.621 1.00 38.36  ? 164  ASP A CG  1 
ATOM   1253  O  OD1 . ASP A  1 164 ? -35.446 142.054 140.236 1.00 34.21  ? 164  ASP A OD1 1 
ATOM   1254  O  OD2 . ASP A  1 164 ? -33.650 141.668 139.068 1.00 37.28  ? 164  ASP A OD2 1 
ATOM   1255  N  N   . HIS A  1 165 ? -38.026 140.812 141.140 1.00 28.11  ? 165  HIS A N   1 
ATOM   1256  C  CA  . HIS A  1 165 ? -39.355 141.366 140.927 1.00 28.43  ? 165  HIS A CA  1 
ATOM   1257  C  C   . HIS A  1 165 ? -39.279 142.883 140.995 1.00 35.61  ? 165  HIS A C   1 
ATOM   1258  O  O   . HIS A  1 165 ? -38.703 143.430 141.943 1.00 33.57  ? 165  HIS A O   1 
ATOM   1259  C  CB  . HIS A  1 165 ? -40.348 140.881 141.985 1.00 28.15  ? 165  HIS A CB  1 
ATOM   1260  C  CG  . HIS A  1 165 ? -40.469 139.395 142.091 1.00 30.38  ? 165  HIS A CG  1 
ATOM   1261  N  ND1 . HIS A  1 165 ? -39.483 138.599 142.636 1.00 30.67  ? 165  HIS A ND1 1 
ATOM   1262  C  CD2 . HIS A  1 165 ? -41.480 138.560 141.744 1.00 28.69  ? 165  HIS A CD2 1 
ATOM   1263  C  CE1 . HIS A  1 165 ? -39.871 137.335 142.603 1.00 30.62  ? 165  HIS A CE1 1 
ATOM   1264  N  NE2 . HIS A  1 165 ? -41.082 137.283 142.072 1.00 31.12  ? 165  HIS A NE2 1 
ATOM   1265  N  N   . TRP A  1 166 ? -39.858 143.560 140.004 1.00 33.85  ? 166  TRP A N   1 
ATOM   1266  C  CA  . TRP A  1 166 ? -40.110 144.995 140.091 1.00 29.66  ? 166  TRP A CA  1 
ATOM   1267  C  C   . TRP A  1 166 ? -41.603 145.191 140.301 1.00 28.14  ? 166  TRP A C   1 
ATOM   1268  O  O   . TRP A  1 166 ? -42.406 144.759 139.469 1.00 29.14  ? 166  TRP A O   1 
ATOM   1269  C  CB  . TRP A  1 166 ? -39.660 145.746 138.841 1.00 30.14  ? 166  TRP A CB  1 
ATOM   1270  C  CG  . TRP A  1 166 ? -38.200 145.701 138.523 1.00 32.92  ? 166  TRP A CG  1 
ATOM   1271  C  CD1 . TRP A  1 166 ? -37.243 144.876 139.069 1.00 33.30  ? 166  TRP A CD1 1 
ATOM   1272  C  CD2 . TRP A  1 166 ? -37.520 146.517 137.559 1.00 34.91  ? 166  TRP A CD2 1 
ATOM   1273  N  NE1 . TRP A  1 166 ? -36.021 145.137 138.500 1.00 29.38  ? 166  TRP A NE1 1 
ATOM   1274  C  CE2 . TRP A  1 166 ? -36.159 146.139 137.575 1.00 31.85  ? 166  TRP A CE2 1 
ATOM   1275  C  CE3 . TRP A  1 166 ? -37.930 147.535 136.691 1.00 37.01  ? 166  TRP A CE3 1 
ATOM   1276  C  CZ2 . TRP A  1 166 ? -35.206 146.742 136.755 1.00 31.55  ? 166  TRP A CZ2 1 
ATOM   1277  C  CZ3 . TRP A  1 166 ? -36.985 148.134 135.878 1.00 38.60  ? 166  TRP A CZ3 1 
ATOM   1278  C  CH2 . TRP A  1 166 ? -35.640 147.728 135.907 1.00 35.88  ? 166  TRP A CH2 1 
ATOM   1279  N  N   . VAL A  1 167 ? -41.967 145.873 141.392 1.00 33.29  ? 167  VAL A N   1 
ATOM   1280  C  CA  . VAL A  1 167 ? -43.345 145.960 141.855 1.00 29.54  ? 167  VAL A CA  1 
ATOM   1281  C  C   . VAL A  1 167 ? -43.945 147.295 141.436 1.00 34.27  ? 167  VAL A C   1 
ATOM   1282  O  O   . VAL A  1 167 ? -43.269 148.334 141.497 1.00 31.10  ? 167  VAL A O   1 
ATOM   1283  C  CB  . VAL A  1 167 ? -43.414 145.754 143.386 1.00 31.72  ? 167  VAL A CB  1 
ATOM   1284  C  CG1 . VAL A  1 167 ? -44.816 146.087 143.933 1.00 29.21  ? 167  VAL A CG1 1 
ATOM   1285  C  CG2 . VAL A  1 167 ? -43.044 144.300 143.721 1.00 31.87  ? 167  VAL A CG2 1 
ATOM   1286  N  N   . MET A  1 168 ? -45.207 147.257 140.971 1.00 27.37  ? 168  MET A N   1 
ATOM   1287  C  CA  . MET A  1 168 ? -45.921 148.472 140.584 1.00 25.86  ? 168  MET A CA  1 
ATOM   1288  C  C   . MET A  1 168 ? -46.019 149.436 141.753 1.00 32.75  ? 168  MET A C   1 
ATOM   1289  O  O   . MET A  1 168 ? -46.251 149.034 142.895 1.00 30.86  ? 168  MET A O   1 
ATOM   1290  C  CB  . MET A  1 168 ? -47.328 148.155 140.082 1.00 29.17  ? 168  MET A CB  1 
ATOM   1291  C  CG  . MET A  1 168 ? -47.317 147.200 138.888 1.00 32.81  ? 168  MET A CG  1 
ATOM   1292  S  SD  . MET A  1 168 ? -48.941 146.466 138.581 1.00 38.85  ? 168  MET A SD  1 
ATOM   1293  C  CE  . MET A  1 168 ? -49.867 147.903 138.004 1.00 40.44  ? 168  MET A CE  1 
ATOM   1294  N  N   . ASP A  1 169 ? -45.813 150.718 141.449 1.00 36.33  ? 169  ASP A N   1 
ATOM   1295  C  CA  . ASP A  1 169 ? -45.951 151.785 142.431 1.00 28.09  ? 169  ASP A CA  1 
ATOM   1296  C  C   . ASP A  1 169 ? -47.277 151.670 143.166 1.00 34.24  ? 169  ASP A C   1 
ATOM   1297  O  O   . ASP A  1 169 ? -48.343 151.637 142.548 1.00 38.33  ? 169  ASP A O   1 
ATOM   1298  C  CB  . ASP A  1 169 ? -45.846 153.134 141.727 1.00 37.46  ? 169  ASP A CB  1 
ATOM   1299  C  CG  . ASP A  1 169 ? -45.907 154.311 142.686 1.00 40.14  ? 169  ASP A CG  1 
ATOM   1300  O  OD1 . ASP A  1 169 ? -45.767 154.136 143.909 1.00 45.34  ? 169  ASP A OD1 1 
ATOM   1301  O  OD2 . ASP A  1 169 ? -46.064 155.429 142.187 1.00 52.79  ? 169  ASP A OD2 1 
ATOM   1302  N  N   . GLY A  1 170 ? -47.198 151.617 144.492 1.00 35.63  ? 170  GLY A N   1 
ATOM   1303  C  CA  . GLY A  1 170 ? -48.359 151.471 145.336 1.00 33.35  ? 170  GLY A CA  1 
ATOM   1304  C  C   . GLY A  1 170 ? -48.766 150.041 145.635 1.00 44.92  ? 170  GLY A C   1 
ATOM   1305  O  O   . GLY A  1 170 ? -49.611 149.835 146.508 1.00 43.36  ? 170  GLY A O   1 
ATOM   1306  N  N   . HIS A  1 171 ? -48.149 149.042 144.997 1.00 39.86  ? 171  HIS A N   1 
ATOM   1307  C  CA  . HIS A  1 171 ? -48.499 147.645 145.229 1.00 34.61  ? 171  HIS A CA  1 
ATOM   1308  C  C   . HIS A  1 171 ? -47.538 146.938 146.180 1.00 37.78  ? 171  HIS A C   1 
ATOM   1309  O  O   . HIS A  1 171 ? -47.623 145.716 146.333 1.00 36.23  ? 171  HIS A O   1 
ATOM   1310  C  CB  . HIS A  1 171 ? -48.547 146.895 143.898 1.00 33.20  ? 171  HIS A CB  1 
ATOM   1311  C  CG  . HIS A  1 171 ? -49.651 147.341 142.994 1.00 38.33  ? 171  HIS A CG  1 
ATOM   1312  N  ND1 . HIS A  1 171 ? -50.552 146.460 142.434 1.00 35.23  ? 171  HIS A ND1 1 
ATOM   1313  C  CD2 . HIS A  1 171 ? -50.018 148.580 142.570 1.00 34.39  ? 171  HIS A CD2 1 
ATOM   1314  C  CE1 . HIS A  1 171 ? -51.414 147.131 141.688 1.00 36.89  ? 171  HIS A CE1 1 
ATOM   1315  N  NE2 . HIS A  1 171 ? -51.115 148.419 141.757 1.00 35.28  ? 171  HIS A NE2 1 
ATOM   1316  N  N   . GLU A  1 172 ? -46.631 147.679 146.825 1.00 29.91  ? 172  GLU A N   1 
ATOM   1317  C  CA  . GLU A  1 172 ? -45.566 147.044 147.597 1.00 34.36  ? 172  GLU A CA  1 
ATOM   1318  C  C   . GLU A  1 172 ? -46.137 146.163 148.703 1.00 38.02  ? 172  GLU A C   1 
ATOM   1319  O  O   . GLU A  1 172 ? -45.756 144.995 148.853 1.00 34.45  ? 172  GLU A O   1 
ATOM   1320  C  CB  . GLU A  1 172 ? -44.627 148.106 148.172 1.00 33.53  ? 172  GLU A CB  1 
ATOM   1321  C  CG  . GLU A  1 172 ? -43.606 148.672 147.174 1.00 38.01  ? 172  GLU A CG  1 
ATOM   1322  C  CD  . GLU A  1 172 ? -44.159 149.867 146.378 1.00 42.86  ? 172  GLU A CD  1 
ATOM   1323  O  OE1 . GLU A  1 172 ? -45.369 150.154 146.507 1.00 41.28  ? 172  GLU A OE1 1 
ATOM   1324  O  OE2 . GLU A  1 172 ? -43.382 150.522 145.639 1.00 38.22  ? 172  GLU A OE2 1 
ATOM   1325  N  N   . LYS A  1 173 ? -47.081 146.697 149.467 1.00 34.53  ? 173  LYS A N   1 
ATOM   1326  C  CA  . LYS A  1 173 ? -47.604 145.955 150.605 1.00 38.09  ? 173  LYS A CA  1 
ATOM   1327  C  C   . LYS A  1 173 ? -48.355 144.712 150.156 1.00 32.51  ? 173  LYS A C   1 
ATOM   1328  O  O   . LYS A  1 173 ? -48.235 143.652 150.781 1.00 40.88  ? 173  LYS A O   1 
ATOM   1329  C  CB  . LYS A  1 173 ? -48.521 146.861 151.438 1.00 48.10  ? 173  LYS A CB  1 
ATOM   1330  C  CG  . LYS A  1 173 ? -49.120 146.169 152.650 1.00 65.01  ? 173  LYS A CG  1 
ATOM   1331  C  CD  . LYS A  1 173 ? -50.100 147.060 153.410 1.00 81.44  ? 173  LYS A CD  1 
ATOM   1332  C  CE  . LYS A  1 173 ? -50.661 146.318 154.619 1.00 87.12  ? 173  LYS A CE  1 
ATOM   1333  N  NZ  . LYS A  1 173 ? -51.612 147.138 155.416 1.00 89.58  ? 173  LYS A NZ  1 
ATOM   1334  N  N   . ALA A  1 174 ? -49.163 144.836 149.101 1.00 33.49  ? 174  ALA A N   1 
ATOM   1335  C  CA  . ALA A  1 174 ? -49.876 143.681 148.561 1.00 37.22  ? 174  ALA A CA  1 
ATOM   1336  C  C   . ALA A  1 174 ? -48.904 142.622 148.051 1.00 37.18  ? 174  ALA A C   1 
ATOM   1337  O  O   . ALA A  1 174 ? -49.128 141.421 148.248 1.00 32.99  ? 174  ALA A O   1 
ATOM   1338  C  CB  . ALA A  1 174 ? -50.849 144.118 147.457 1.00 30.32  ? 174  ALA A CB  1 
ATOM   1339  N  N   . PHE A  1 175 ? -47.832 143.045 147.375 1.00 38.95  ? 175  PHE A N   1 
ATOM   1340  C  CA  . PHE A  1 175 ? -46.815 142.096 146.927 1.00 33.36  ? 175  PHE A CA  1 
ATOM   1341  C  C   . PHE A  1 175 ? -46.204 141.360 148.110 1.00 33.61  ? 175  PHE A C   1 
ATOM   1342  O  O   . PHE A  1 175 ? -46.037 140.132 148.079 1.00 32.87  ? 175  PHE A O   1 
ATOM   1343  C  CB  . PHE A  1 175 ? -45.708 142.807 146.137 1.00 36.14  ? 175  PHE A CB  1 
ATOM   1344  C  CG  . PHE A  1 175 ? -44.503 141.944 145.890 1.00 30.18  ? 175  PHE A CG  1 
ATOM   1345  C  CD1 . PHE A  1 175 ? -44.444 141.108 144.775 1.00 30.71  ? 175  PHE A CD1 1 
ATOM   1346  C  CD2 . PHE A  1 175 ? -43.453 141.914 146.801 1.00 34.78  ? 175  PHE A CD2 1 
ATOM   1347  C  CE1 . PHE A  1 175 ? -43.340 140.272 144.557 1.00 32.15  ? 175  PHE A CE1 1 
ATOM   1348  C  CE2 . PHE A  1 175 ? -42.349 141.083 146.599 1.00 34.60  ? 175  PHE A CE2 1 
ATOM   1349  C  CZ  . PHE A  1 175 ? -42.281 140.269 145.481 1.00 33.91  ? 175  PHE A CZ  1 
ATOM   1350  N  N   . GLU A  1 176 ? -45.838 142.105 149.157 1.00 31.82  ? 176  GLU A N   1 
ATOM   1351  C  CA  . GLU A  1 176 ? -45.208 141.483 150.315 1.00 31.51  ? 176  GLU A CA  1 
ATOM   1352  C  C   . GLU A  1 176 ? -46.114 140.421 150.919 1.00 39.16  ? 176  GLU A C   1 
ATOM   1353  O  O   . GLU A  1 176 ? -45.666 139.306 151.219 1.00 34.25  ? 176  GLU A O   1 
ATOM   1354  C  CB  . GLU A  1 176 ? -44.852 142.558 151.347 1.00 29.06  ? 176  GLU A CB  1 
ATOM   1355  C  CG  . GLU A  1 176 ? -43.738 143.471 150.863 1.00 26.05  ? 176  GLU A CG  1 
ATOM   1356  C  CD  . GLU A  1 176 ? -43.406 144.622 151.812 1.00 40.65  ? 176  GLU A CD  1 
ATOM   1357  O  OE1 . GLU A  1 176 ? -43.958 144.648 152.932 1.00 38.77  ? 176  GLU A OE1 1 
ATOM   1358  O  OE2 . GLU A  1 176 ? -42.564 145.480 151.446 1.00 32.60  ? 176  GLU A OE2 1 
ATOM   1359  N  N   . GLN A  1 177 ? -47.411 140.734 151.046 1.00 36.84  ? 177  GLN A N   1 
ATOM   1360  C  CA  . GLN A  1 177 ? -48.359 139.768 151.588 1.00 36.77  ? 177  GLN A CA  1 
ATOM   1361  C  C   . GLN A  1 177 ? -48.535 138.577 150.652 1.00 31.23  ? 177  GLN A C   1 
ATOM   1362  O  O   . GLN A  1 177 ? -48.600 137.433 151.109 1.00 34.66  ? 177  GLN A O   1 
ATOM   1363  C  CB  . GLN A  1 177 ? -49.709 140.448 151.854 1.00 32.26  ? 177  GLN A CB  1 
ATOM   1364  C  CG  . GLN A  1 177 ? -49.643 141.460 152.975 1.00 64.15  ? 177  GLN A CG  1 
ATOM   1365  C  CD  . GLN A  1 177 ? -50.935 142.263 153.124 1.00 80.94  ? 177  GLN A CD  1 
ATOM   1366  O  OE1 . GLN A  1 177 ? -51.444 142.839 152.157 1.00 88.48  ? 177  GLN A OE1 1 
ATOM   1367  N  NE2 . GLN A  1 177 ? -51.467 142.299 154.337 1.00 82.02  ? 177  GLN A NE2 1 
ATOM   1368  N  N   . GLY A  1 178 ? -48.643 138.828 149.346 1.00 32.43  ? 178  GLY A N   1 
ATOM   1369  C  CA  . GLY A  1 178 ? -48.826 137.731 148.406 1.00 32.69  ? 178  GLY A CA  1 
ATOM   1370  C  C   . GLY A  1 178 ? -47.600 136.844 148.289 1.00 33.80  ? 178  GLY A C   1 
ATOM   1371  O  O   . GLY A  1 178 ? -47.714 135.623 148.199 1.00 32.96  ? 178  GLY A O   1 
ATOM   1372  N  N   . ALA A  1 179 ? -46.411 137.451 148.255 1.00 36.22  ? 179  ALA A N   1 
ATOM   1373  C  CA  . ALA A  1 179 ? -45.179 136.667 148.225 1.00 36.07  ? 179  ALA A CA  1 
ATOM   1374  C  C   . ALA A  1 179 ? -45.031 135.843 149.496 1.00 32.77  ? 179  ALA A C   1 
ATOM   1375  O  O   . ALA A  1 179 ? -44.655 134.662 149.446 1.00 31.60  ? 179  ALA A O   1 
ATOM   1376  C  CB  . ALA A  1 179 ? -43.965 137.587 148.048 1.00 30.45  ? 179  ALA A CB  1 
ATOM   1377  N  N   . THR A  1 180 ? -45.344 136.451 150.644 1.00 28.87  ? 180  THR A N   1 
ATOM   1378  C  CA  . THR A  1 180 ? -45.312 135.721 151.901 1.00 29.08  ? 180  THR A CA  1 
ATOM   1379  C  C   . THR A  1 180 ? -46.229 134.512 151.848 1.00 32.61  ? 180  THR A C   1 
ATOM   1380  O  O   . THR A  1 180 ? -45.831 133.405 152.223 1.00 36.35  ? 180  THR A O   1 
ATOM   1381  C  CB  . THR A  1 180 ? -45.716 136.638 153.050 1.00 32.62  ? 180  THR A CB  1 
ATOM   1382  O  OG1 . THR A  1 180 ? -44.733 137.665 153.221 1.00 37.56  ? 180  THR A OG1 1 
ATOM   1383  C  CG2 . THR A  1 180 ? -45.890 135.850 154.339 1.00 27.18  ? 180  THR A CG2 1 
ATOM   1384  N  N   . GLU A  1 181 ? -47.467 134.699 151.383 1.00 30.07  ? 181  GLU A N   1 
ATOM   1385  C  CA  . GLU A  1 181 ? -48.386 133.563 151.337 1.00 27.99  ? 181  GLU A CA  1 
ATOM   1386  C  C   . GLU A  1 181 ? -47.891 132.485 150.378 1.00 29.32  ? 181  GLU A C   1 
ATOM   1387  O  O   . GLU A  1 181 ? -47.963 131.292 150.688 1.00 40.40  ? 181  GLU A O   1 
ATOM   1388  C  CB  . GLU A  1 181 ? -49.801 134.037 150.964 1.00 28.15  ? 181  GLU A CB  1 
ATOM   1389  C  CG  . GLU A  1 181 ? -50.821 132.905 151.081 1.00 40.73  ? 181  GLU A CG  1 
ATOM   1390  C  CD  . GLU A  1 181 ? -52.266 133.315 150.777 1.00 51.20  ? 181  GLU A CD  1 
ATOM   1391  O  OE1 . GLU A  1 181 ? -52.533 134.508 150.478 1.00 53.99  ? 181  GLU A OE1 1 
ATOM   1392  O  OE2 . GLU A  1 181 ? -53.133 132.414 150.842 1.00 50.04  ? 181  GLU A OE2 1 
ATOM   1393  N  N   . THR A  1 182 ? -47.355 132.892 149.219 1.00 32.22  ? 182  THR A N   1 
ATOM   1394  C  CA  . THR A  1 182 ? -46.805 131.937 148.257 1.00 34.75  ? 182  THR A CA  1 
ATOM   1395  C  C   . THR A  1 182 ? -45.696 131.102 148.887 1.00 38.82  ? 182  THR A C   1 
ATOM   1396  O  O   . THR A  1 182 ? -45.677 129.868 148.769 1.00 37.03  ? 182  THR A O   1 
ATOM   1397  C  CB  . THR A  1 182 ? -46.240 132.678 147.037 1.00 32.38  ? 182  THR A CB  1 
ATOM   1398  O  OG1 . THR A  1 182 ? -47.253 133.473 146.424 1.00 30.54  ? 182  THR A OG1 1 
ATOM   1399  C  CG2 . THR A  1 182 ? -45.702 131.663 145.986 1.00 31.34  ? 182  THR A CG2 1 
ATOM   1400  N  N   . LEU A  1 183 ? -44.750 131.774 149.552 1.00 36.68  ? 183  LEU A N   1 
ATOM   1401  C  CA  . LEU A  1 183 ? -43.556 131.112 150.072 1.00 34.22  ? 183  LEU A CA  1 
ATOM   1402  C  C   . LEU A  1 183 ? -43.882 130.201 151.249 1.00 37.03  ? 183  LEU A C   1 
ATOM   1403  O  O   . LEU A  1 183 ? -43.295 129.121 151.391 1.00 28.71  ? 183  LEU A O   1 
ATOM   1404  C  CB  . LEU A  1 183 ? -42.521 132.173 150.462 1.00 31.01  ? 183  LEU A CB  1 
ATOM   1405  C  CG  . LEU A  1 183 ? -41.920 132.909 149.266 1.00 26.08  ? 183  LEU A CG  1 
ATOM   1406  C  CD1 . LEU A  1 183 ? -41.229 134.206 149.665 1.00 25.99  ? 183  LEU A CD1 1 
ATOM   1407  C  CD2 . LEU A  1 183 ? -40.944 131.949 148.517 1.00 25.84  ? 183  LEU A CD2 1 
ATOM   1408  N  N   . GLU A  1 184 ? -44.819 130.621 152.099 1.00 33.54  ? 184  GLU A N   1 
ATOM   1409  C  CA  . GLU A  1 184 ? -45.255 129.776 153.200 1.00 37.38  ? 184  GLU A CA  1 
ATOM   1410  C  C   . GLU A  1 184 ? -45.938 128.513 152.692 1.00 39.37  ? 184  GLU A C   1 
ATOM   1411  O  O   . GLU A  1 184 ? -45.784 127.437 153.283 1.00 38.60  ? 184  GLU A O   1 
ATOM   1412  C  CB  . GLU A  1 184 ? -46.193 130.568 154.107 1.00 33.57  ? 184  GLU A CB  1 
ATOM   1413  C  CG  . GLU A  1 184 ? -45.448 131.620 154.901 1.00 40.03  ? 184  GLU A CG  1 
ATOM   1414  C  CD  . GLU A  1 184 ? -46.353 132.452 155.795 1.00 44.94  ? 184  GLU A CD  1 
ATOM   1415  O  OE1 . GLU A  1 184 ? -47.572 132.499 155.536 1.00 46.16  ? 184  GLU A OE1 1 
ATOM   1416  O  OE2 . GLU A  1 184 ? -45.838 133.055 156.760 1.00 48.50  ? 184  GLU A OE2 1 
ATOM   1417  N  N   . TRP A  1 185 ? -46.737 128.635 151.626 1.00 35.75  ? 185  TRP A N   1 
ATOM   1418  C  CA  . TRP A  1 185 ? -47.344 127.452 151.028 1.00 37.19  ? 185  TRP A CA  1 
ATOM   1419  C  C   . TRP A  1 185 ? -46.265 126.504 150.525 1.00 34.65  ? 185  TRP A C   1 
ATOM   1420  O  O   . TRP A  1 185 ? -46.309 125.295 150.784 1.00 37.54  ? 185  TRP A O   1 
ATOM   1421  C  CB  . TRP A  1 185 ? -48.279 127.863 149.890 1.00 36.38  ? 185  TRP A CB  1 
ATOM   1422  C  CG  . TRP A  1 185 ? -49.242 126.789 149.368 1.00 34.21  ? 185  TRP A CG  1 
ATOM   1423  C  CD1 . TRP A  1 185 ? -50.570 126.681 149.671 1.00 36.14  ? 185  TRP A CD1 1 
ATOM   1424  C  CD2 . TRP A  1 185 ? -48.964 125.723 148.435 1.00 29.64  ? 185  TRP A CD2 1 
ATOM   1425  N  NE1 . TRP A  1 185 ? -51.137 125.624 148.994 1.00 33.53  ? 185  TRP A NE1 1 
ATOM   1426  C  CE2 . TRP A  1 185 ? -50.180 125.018 148.228 1.00 36.66  ? 185  TRP A CE2 1 
ATOM   1427  C  CE3 . TRP A  1 185 ? -47.821 125.307 147.748 1.00 33.41  ? 185  TRP A CE3 1 
ATOM   1428  C  CZ2 . TRP A  1 185 ? -50.282 123.903 147.371 1.00 34.29  ? 185  TRP A CZ2 1 
ATOM   1429  C  CZ3 . TRP A  1 185 ? -47.919 124.175 146.883 1.00 32.27  ? 185  TRP A CZ3 1 
ATOM   1430  C  CH2 . TRP A  1 185 ? -49.153 123.508 146.700 1.00 26.87  ? 185  TRP A CH2 1 
ATOM   1431  N  N   . MET A  1 186 ? -45.268 127.051 149.827 1.00 33.96  ? 186  MET A N   1 
ATOM   1432  C  CA  . MET A  1 186 ? -44.208 126.221 149.262 1.00 33.42  ? 186  MET A CA  1 
ATOM   1433  C  C   . MET A  1 186 ? -43.409 125.517 150.346 1.00 35.80  ? 186  MET A C   1 
ATOM   1434  O  O   . MET A  1 186 ? -43.124 124.320 150.227 1.00 33.01  ? 186  MET A O   1 
ATOM   1435  C  CB  . MET A  1 186 ? -43.294 127.073 148.386 1.00 33.88  ? 186  MET A CB  1 
ATOM   1436  C  CG  . MET A  1 186 ? -43.991 127.568 147.128 1.00 37.29  ? 186  MET A CG  1 
ATOM   1437  S  SD  . MET A  1 186 ? -43.046 128.744 146.132 1.00 40.11  ? 186  MET A SD  1 
ATOM   1438  C  CE  . MET A  1 186 ? -41.677 127.753 145.676 1.00 37.32  ? 186  MET A CE  1 
ATOM   1439  N  N   . LYS A  1 187 ? -43.062 126.227 151.428 1.00 36.72  ? 187  LYS A N   1 
ATOM   1440  C  CA  . LYS A  1 187 ? -42.260 125.584 152.464 1.00 40.31  ? 187  LYS A CA  1 
ATOM   1441  C  C   . LYS A  1 187 ? -43.056 124.494 153.157 1.00 39.54  ? 187  LYS A C   1 
ATOM   1442  O  O   . LYS A  1 187 ? -42.485 123.499 153.595 1.00 40.95  ? 187  LYS A O   1 
ATOM   1443  C  CB  . LYS A  1 187 ? -41.736 126.608 153.483 1.00 39.25  ? 187  LYS A CB  1 
ATOM   1444  C  CG  . LYS A  1 187 ? -40.699 126.041 154.472 1.00 38.30  ? 187  LYS A CG  1 
ATOM   1445  C  CD  . LYS A  1 187 ? -39.662 127.094 154.873 1.00 38.94  ? 187  LYS A CD  1 
ATOM   1446  C  CE  . LYS A  1 187 ? -38.636 126.583 155.905 1.00 36.76  ? 187  LYS A CE  1 
ATOM   1447  N  NZ  . LYS A  1 187 ? -39.276 126.103 157.159 1.00 51.49  ? 187  LYS A NZ  1 
ATOM   1448  N  N   . ALA A  1 188 ? -44.372 124.655 153.239 1.00 41.28  ? 188  ALA A N   1 
ATOM   1449  C  CA  . ALA A  1 188 ? -45.215 123.638 153.842 1.00 38.00  ? 188  ALA A CA  1 
ATOM   1450  C  C   . ALA A  1 188 ? -45.475 122.452 152.916 1.00 37.45  ? 188  ALA A C   1 
ATOM   1451  O  O   . ALA A  1 188 ? -45.721 121.349 153.401 1.00 39.18  ? 188  ALA A O   1 
ATOM   1452  C  CB  . ALA A  1 188 ? -46.545 124.257 154.272 1.00 37.97  ? 188  ALA A CB  1 
ATOM   1453  N  N   . ASN A  1 189 ? -45.438 122.636 151.598 1.00 29.55  ? 189  ASN A N   1 
ATOM   1454  C  CA  . ASN A  1 189 ? -46.002 121.637 150.693 1.00 29.56  ? 189  ASN A CA  1 
ATOM   1455  C  C   . ASN A  1 189 ? -45.084 121.127 149.587 1.00 34.47  ? 189  ASN A C   1 
ATOM   1456  O  O   . ASN A  1 189 ? -45.478 120.195 148.881 1.00 29.97  ? 189  ASN A O   1 
ATOM   1457  C  CB  . ASN A  1 189 ? -47.281 122.181 150.039 1.00 27.81  ? 189  ASN A CB  1 
ATOM   1458  C  CG  . ASN A  1 189 ? -48.413 122.349 151.045 1.00 36.03  ? 189  ASN A CG  1 
ATOM   1459  O  OD1 . ASN A  1 189 ? -48.794 121.401 151.718 1.00 40.07  ? 189  ASN A OD1 1 
ATOM   1460  N  ND2 . ASN A  1 189 ? -48.923 123.562 151.171 1.00 35.48  ? 189  ASN A ND2 1 
ATOM   1461  N  N   . VAL A  1 190 ? -43.929 121.725 149.352 1.00 29.26  ? 190  VAL A N   1 
ATOM   1462  C  CA  . VAL A  1 190 ? -43.123 121.404 148.175 1.00 30.39  ? 190  VAL A CA  1 
ATOM   1463  C  C   . VAL A  1 190 ? -41.858 120.697 148.636 1.00 30.47  ? 190  VAL A C   1 
ATOM   1464  O  O   . VAL A  1 190 ? -41.175 121.201 149.541 1.00 32.54  ? 190  VAL A O   1 
ATOM   1465  C  CB  . VAL A  1 190 ? -42.790 122.662 147.352 1.00 32.23  ? 190  VAL A CB  1 
ATOM   1466  C  CG1 . VAL A  1 190 ? -41.976 122.291 146.119 1.00 33.36  ? 190  VAL A CG1 1 
ATOM   1467  C  CG2 . VAL A  1 190 ? -44.075 123.359 146.957 1.00 29.52  ? 190  VAL A CG2 1 
ATOM   1468  N  N   . PRO A  1 191 ? -41.520 119.532 148.072 1.00 32.64  ? 191  PRO A N   1 
ATOM   1469  C  CA  . PRO A  1 191 ? -40.346 118.795 148.566 1.00 33.82  ? 191  PRO A CA  1 
ATOM   1470  C  C   . PRO A  1 191 ? -39.067 119.580 148.345 1.00 27.07  ? 191  PRO A C   1 
ATOM   1471  O  O   . PRO A  1 191 ? -38.904 120.264 147.332 1.00 28.97  ? 191  PRO A O   1 
ATOM   1472  C  CB  . PRO A  1 191 ? -40.356 117.483 147.760 1.00 34.57  ? 191  PRO A CB  1 
ATOM   1473  C  CG  . PRO A  1 191 ? -41.410 117.643 146.705 1.00 43.98  ? 191  PRO A CG  1 
ATOM   1474  C  CD  . PRO A  1 191 ? -42.327 118.747 147.113 1.00 34.53  ? 191  PRO A CD  1 
ATOM   1475  N  N   . GLY A  1 192 ? -38.165 119.486 149.317 1.00 26.70  ? 192  GLY A N   1 
ATOM   1476  C  CA  . GLY A  1 192 ? -36.840 120.059 149.169 1.00 33.38  ? 192  GLY A CA  1 
ATOM   1477  C  C   . GLY A  1 192 ? -36.750 121.546 149.398 1.00 38.69  ? 192  GLY A C   1 
ATOM   1478  O  O   . GLY A  1 192 ? -35.693 122.131 149.130 1.00 30.83  ? 192  GLY A O   1 
ATOM   1479  N  N   . MET A  1 193 ? -37.827 122.176 149.872 1.00 33.69  ? 193  MET A N   1 
ATOM   1480  C  CA  . MET A  1 193 ? -37.843 123.613 150.151 1.00 27.35  ? 193  MET A CA  1 
ATOM   1481  C  C   . MET A  1 193 ? -37.160 123.879 151.484 1.00 24.60  ? 193  MET A C   1 
ATOM   1482  O  O   . MET A  1 193 ? -37.714 123.576 152.539 1.00 32.98  ? 193  MET A O   1 
ATOM   1483  C  CB  . MET A  1 193 ? -39.289 124.093 150.189 1.00 30.98  ? 193  MET A CB  1 
ATOM   1484  C  CG  . MET A  1 193 ? -39.542 125.404 149.522 1.00 43.25  ? 193  MET A CG  1 
ATOM   1485  S  SD  . MET A  1 193 ? -39.110 126.717 150.635 1.00 48.83  ? 193  MET A SD  1 
ATOM   1486  C  CE  . MET A  1 193 ? -40.171 128.019 149.964 1.00 43.05  ? 193  MET A CE  1 
ATOM   1487  N  N   . VAL A  1 194 ? -35.993 124.508 151.445 1.00 30.10  ? 194  VAL A N   1 
ATOM   1488  C  CA  . VAL A  1 194 ? -35.192 124.670 152.651 1.00 30.55  ? 194  VAL A CA  1 
ATOM   1489  C  C   . VAL A  1 194 ? -35.549 125.947 153.403 1.00 32.14  ? 194  VAL A C   1 
ATOM   1490  O  O   . VAL A  1 194 ? -35.663 125.941 154.633 1.00 32.51  ? 194  VAL A O   1 
ATOM   1491  C  CB  . VAL A  1 194 ? -33.700 124.638 152.275 1.00 29.99  ? 194  VAL A CB  1 
ATOM   1492  C  CG1 . VAL A  1 194 ? -32.865 125.048 153.476 1.00 24.36  ? 194  VAL A CG1 1 
ATOM   1493  C  CG2 . VAL A  1 194 ? -33.320 123.235 151.785 1.00 24.28  ? 194  VAL A CG2 1 
ATOM   1494  N  N   . GLY A  1 195 ? -35.759 127.049 152.695 1.00 27.44  ? 195  GLY A N   1 
ATOM   1495  C  CA  . GLY A  1 195 ? -36.059 128.295 153.381 1.00 29.29  ? 195  GLY A CA  1 
ATOM   1496  C  C   . GLY A  1 195 ? -36.237 129.429 152.399 1.00 25.20  ? 195  GLY A C   1 
ATOM   1497  O  O   . GLY A  1 195 ? -36.082 129.264 151.190 1.00 31.30  ? 195  GLY A O   1 
ATOM   1498  N  N   . TRP A  1 196 ? -36.580 130.600 152.935 1.00 30.93  ? 196  TRP A N   1 
ATOM   1499  C  CA  . TRP A  1 196 ? -36.824 131.724 152.048 1.00 28.77  ? 196  TRP A CA  1 
ATOM   1500  C  C   . TRP A  1 196 ? -36.666 133.040 152.793 1.00 27.15  ? 196  TRP A C   1 
ATOM   1501  O  O   . TRP A  1 196 ? -36.712 133.106 154.023 1.00 25.95  ? 196  TRP A O   1 
ATOM   1502  C  CB  . TRP A  1 196 ? -38.214 131.637 151.403 1.00 26.24  ? 196  TRP A CB  1 
ATOM   1503  C  CG  . TRP A  1 196 ? -39.347 131.591 152.390 1.00 28.16  ? 196  TRP A CG  1 
ATOM   1504  C  CD1 . TRP A  1 196 ? -39.982 130.477 152.873 1.00 27.36  ? 196  TRP A CD1 1 
ATOM   1505  C  CD2 . TRP A  1 196 ? -39.979 132.719 153.017 1.00 27.24  ? 196  TRP A CD2 1 
ATOM   1506  N  NE1 . TRP A  1 196 ? -40.983 130.845 153.756 1.00 28.96  ? 196  TRP A NE1 1 
ATOM   1507  C  CE2 . TRP A  1 196 ? -41.001 132.215 153.855 1.00 30.20  ? 196  TRP A CE2 1 
ATOM   1508  C  CE3 . TRP A  1 196 ? -39.794 134.106 152.929 1.00 29.07  ? 196  TRP A CE3 1 
ATOM   1509  C  CZ2 . TRP A  1 196 ? -41.827 133.052 154.614 1.00 35.25  ? 196  TRP A CZ2 1 
ATOM   1510  C  CZ3 . TRP A  1 196 ? -40.615 134.943 153.696 1.00 34.99  ? 196  TRP A CZ3 1 
ATOM   1511  C  CH2 . TRP A  1 196 ? -41.621 134.411 154.525 1.00 30.82  ? 196  TRP A CH2 1 
ATOM   1512  N  N   . MET A  1 197 ? -36.578 134.105 152.007 1.00 26.30  ? 197  MET A N   1 
ATOM   1513  C  CA  . MET A  1 197 ? -36.409 135.456 152.522 1.00 28.09  ? 197  MET A CA  1 
ATOM   1514  C  C   . MET A  1 197 ? -36.909 136.424 151.458 1.00 28.72  ? 197  MET A C   1 
ATOM   1515  O  O   . MET A  1 197 ? -36.655 136.221 150.268 1.00 31.83  ? 197  MET A O   1 
ATOM   1516  C  CB  . MET A  1 197 ? -34.924 135.687 152.878 1.00 32.84  ? 197  MET A CB  1 
ATOM   1517  C  CG  . MET A  1 197 ? -34.491 137.052 153.275 1.00 42.88  ? 197  MET A CG  1 
ATOM   1518  S  SD  . MET A  1 197 ? -32.804 136.994 153.975 1.00 42.54  ? 197  MET A SD  1 
ATOM   1519  C  CE  . MET A  1 197 ? -31.844 136.417 152.567 1.00 32.45  ? 197  MET A CE  1 
ATOM   1520  N  N   . ILE A  1 198 ? -37.663 137.438 151.880 1.00 31.33  ? 198  ILE A N   1 
ATOM   1521  C  CA  . ILE A  1 198 ? -38.130 138.499 150.994 1.00 27.37  ? 198  ILE A CA  1 
ATOM   1522  C  C   . ILE A  1 198 ? -37.290 139.739 151.266 1.00 25.95  ? 198  ILE A C   1 
ATOM   1523  O  O   . ILE A  1 198 ? -37.279 140.252 152.389 1.00 28.17  ? 198  ILE A O   1 
ATOM   1524  C  CB  . ILE A  1 198 ? -39.618 138.804 151.212 1.00 28.30  ? 198  ILE A CB  1 
ATOM   1525  C  CG1 . ILE A  1 198 ? -40.473 137.582 150.867 1.00 30.50  ? 198  ILE A CG1 1 
ATOM   1526  C  CG2 . ILE A  1 198 ? -40.019 140.045 150.387 1.00 28.23  ? 198  ILE A CG2 1 
ATOM   1527  C  CD1 . ILE A  1 198 ? -41.899 137.689 151.345 1.00 28.67  ? 198  ILE A CD1 1 
ATOM   1528  N  N   . MET A  1 199 ? -36.608 140.242 150.246 1.00 28.40  ? 199  MET A N   1 
ATOM   1529  C  CA  . MET A  1 199 ? -35.689 141.364 150.410 1.00 26.39  ? 199  MET A CA  1 
ATOM   1530  C  C   . MET A  1 199 ? -36.143 142.514 149.533 1.00 33.25  ? 199  MET A C   1 
ATOM   1531  O  O   . MET A  1 199 ? -36.346 142.327 148.326 1.00 29.38  ? 199  MET A O   1 
ATOM   1532  C  CB  . MET A  1 199 ? -34.269 140.957 150.039 1.00 24.47  ? 199  MET A CB  1 
ATOM   1533  C  CG  . MET A  1 199 ? -33.709 139.834 150.877 1.00 42.70  ? 199  MET A CG  1 
ATOM   1534  S  SD  . MET A  1 199 ? -31.984 139.424 150.454 1.00 39.22  ? 199  MET A SD  1 
ATOM   1535  C  CE  . MET A  1 199 ? -32.208 138.728 148.832 1.00 25.61  ? 199  MET A CE  1 
ATOM   1536  N  N   . LYS A  1 200 ? -36.212 143.710 150.121 1.00 29.95  ? 200  LYS A N   1 
ATOM   1537  C  CA  . LYS A  1 200 ? -36.704 144.918 149.456 1.00 25.84  ? 200  LYS A CA  1 
ATOM   1538  C  C   . LYS A  1 200 ? -35.552 145.906 149.328 1.00 28.05  ? 200  LYS A C   1 
ATOM   1539  O  O   . LYS A  1 200 ? -34.956 146.287 150.337 1.00 33.06  ? 200  LYS A O   1 
ATOM   1540  C  CB  . LYS A  1 200 ? -37.835 145.552 150.271 1.00 25.47  ? 200  LYS A CB  1 
ATOM   1541  C  CG  . LYS A  1 200 ? -38.469 146.800 149.640 1.00 29.77  ? 200  LYS A CG  1 
ATOM   1542  C  CD  . LYS A  1 200 ? -39.392 147.465 150.634 1.00 28.30  ? 200  LYS A CD  1 
ATOM   1543  C  CE  . LYS A  1 200 ? -40.086 148.690 150.047 1.00 29.40  ? 200  LYS A CE  1 
ATOM   1544  N  NZ  . LYS A  1 200 ? -40.796 149.366 151.177 1.00 33.62  ? 200  LYS A NZ  1 
ATOM   1545  N  N   . GLN A  1 201 ? -35.248 146.329 148.106 1.00 27.77  ? 201  GLN A N   1 
ATOM   1546  C  CA  . GLN A  1 201 ? -34.181 147.304 147.908 1.00 26.32  ? 201  GLN A CA  1 
ATOM   1547  C  C   . GLN A  1 201 ? -34.643 148.685 148.366 1.00 34.37  ? 201  GLN A C   1 
ATOM   1548  O  O   . GLN A  1 201 ? -35.693 149.159 147.933 1.00 30.88  ? 201  GLN A O   1 
ATOM   1549  C  CB  . GLN A  1 201 ? -33.762 147.357 146.437 1.00 25.14  ? 201  GLN A CB  1 
ATOM   1550  C  CG  . GLN A  1 201 ? -32.692 148.440 146.215 1.00 37.84  ? 201  GLN A CG  1 
ATOM   1551  C  CD  . GLN A  1 201 ? -32.341 148.721 144.761 1.00 33.94  ? 201  GLN A CD  1 
ATOM   1552  O  OE1 . GLN A  1 201 ? -32.050 149.865 144.415 1.00 34.12  ? 201  GLN A OE1 1 
ATOM   1553  N  NE2 . GLN A  1 201 ? -32.363 147.684 143.904 1.00 28.36  ? 201  GLN A NE2 1 
ATOM   1554  N  N   . PHE A  1 202 ? -33.863 149.337 149.243 1.00 37.36  ? 202  PHE A N   1 
ATOM   1555  C  CA  . PHE A  1 202 ? -34.200 150.684 149.693 1.00 32.51  ? 202  PHE A CA  1 
ATOM   1556  C  C   . PHE A  1 202 ? -33.062 151.680 149.497 1.00 35.95  ? 202  PHE A C   1 
ATOM   1557  O  O   . PHE A  1 202 ? -33.205 152.831 149.900 1.00 35.34  ? 202  PHE A O   1 
ATOM   1558  C  CB  . PHE A  1 202 ? -34.656 150.689 151.173 1.00 33.37  ? 202  PHE A CB  1 
ATOM   1559  C  CG  . PHE A  1 202 ? -33.560 150.335 152.165 1.00 35.25  ? 202  PHE A CG  1 
ATOM   1560  C  CD1 . PHE A  1 202 ? -33.275 149.008 152.480 1.00 30.84  ? 202  PHE A CD1 1 
ATOM   1561  C  CD2 . PHE A  1 202 ? -32.821 151.331 152.782 1.00 32.92  ? 202  PHE A CD2 1 
ATOM   1562  C  CE1 . PHE A  1 202 ? -32.267 148.681 153.389 1.00 32.38  ? 202  PHE A CE1 1 
ATOM   1563  C  CE2 . PHE A  1 202 ? -31.807 151.019 153.697 1.00 34.55  ? 202  PHE A CE2 1 
ATOM   1564  C  CZ  . PHE A  1 202 ? -31.524 149.686 153.995 1.00 33.35  ? 202  PHE A CZ  1 
ATOM   1565  N  N   . GLY A  1 203 ? -31.955 151.286 148.881 1.00 32.15  ? 203  GLY A N   1 
ATOM   1566  C  CA  . GLY A  1 203 ? -30.873 152.217 148.618 1.00 31.95  ? 203  GLY A CA  1 
ATOM   1567  C  C   . GLY A  1 203 ? -29.683 151.475 148.048 1.00 33.53  ? 203  GLY A C   1 
ATOM   1568  O  O   . GLY A  1 203 ? -29.698 150.243 147.921 1.00 29.80  ? 203  GLY A O   1 
ATOM   1569  N  N   . VAL A  1 204 ? -28.645 152.248 147.698 1.00 29.98  ? 204  VAL A N   1 
ATOM   1570  C  CA  . VAL A  1 204 ? -27.425 151.707 147.090 1.00 33.06  ? 204  VAL A CA  1 
ATOM   1571  C  C   . VAL A  1 204 ? -26.205 152.345 147.738 1.00 32.84  ? 204  VAL A C   1 
ATOM   1572  O  O   . VAL A  1 204 ? -26.209 153.540 148.046 1.00 31.08  ? 204  VAL A O   1 
ATOM   1573  C  CB  . VAL A  1 204 ? -27.382 151.934 145.564 1.00 28.69  ? 204  VAL A CB  1 
ATOM   1574  C  CG1 . VAL A  1 204 ? -26.091 151.340 144.968 1.00 26.15  ? 204  VAL A CG1 1 
ATOM   1575  C  CG2 . VAL A  1 204 ? -28.602 151.286 144.895 1.00 35.69  ? 204  VAL A CG2 1 
ATOM   1576  N  N   . SER A  1 205 ? -25.154 151.548 147.945 1.00 27.93  ? 205  SER A N   1 
ATOM   1577  C  CA  . SER A  1 205 ? -23.894 152.085 148.449 1.00 33.52  ? 205  SER A CA  1 
ATOM   1578  C  C   . SER A  1 205 ? -23.077 152.611 147.274 1.00 30.78  ? 205  SER A C   1 
ATOM   1579  O  O   . SER A  1 205 ? -22.791 151.872 146.329 1.00 34.65  ? 205  SER A O   1 
ATOM   1580  C  CB  . SER A  1 205 ? -23.109 151.026 149.220 1.00 33.70  ? 205  SER A CB  1 
ATOM   1581  O  OG  . SER A  1 205 ? -21.835 151.537 149.585 1.00 34.45  ? 205  SER A OG  1 
ATOM   1582  N  N   . ALA A  1 206 ? -22.709 153.889 147.323 1.00 29.07  ? 206  ALA A N   1 
ATOM   1583  C  CA  . ALA A  1 206 ? -21.903 154.450 146.247 1.00 29.63  ? 206  ALA A CA  1 
ATOM   1584  C  C   . ALA A  1 206 ? -20.498 153.859 146.269 1.00 30.11  ? 206  ALA A C   1 
ATOM   1585  O  O   . ALA A  1 206 ? -19.986 153.383 145.249 1.00 28.80  ? 206  ALA A O   1 
ATOM   1586  C  CB  . ALA A  1 206 ? -21.867 155.975 146.384 1.00 34.35  ? 206  ALA A CB  1 
ATOM   1587  N  N   . ILE A  1 207 ? -19.877 153.869 147.443 1.00 28.16  ? 207  ILE A N   1 
ATOM   1588  C  CA  . ILE A  1 207 ? -18.537 153.331 147.593 1.00 32.04  ? 207  ILE A CA  1 
ATOM   1589  C  C   . ILE A  1 207 ? -18.531 151.851 147.232 1.00 32.98  ? 207  ILE A C   1 
ATOM   1590  O  O   . ILE A  1 207 ? -17.676 151.387 146.476 1.00 33.18  ? 207  ILE A O   1 
ATOM   1591  C  CB  . ILE A  1 207 ? -18.033 153.577 149.027 1.00 30.73  ? 207  ILE A CB  1 
ATOM   1592  C  CG1 . ILE A  1 207 ? -17.826 155.068 149.288 1.00 35.87  ? 207  ILE A CG1 1 
ATOM   1593  C  CG2 . ILE A  1 207 ? -16.736 152.817 149.284 1.00 30.82  ? 207  ILE A CG2 1 
ATOM   1594  C  CD1 . ILE A  1 207 ? -16.610 155.651 148.585 1.00 34.92  ? 207  ILE A CD1 1 
ATOM   1595  N  N   . GLY A  1 208 ? -19.517 151.094 147.724 1.00 36.80  ? 208  GLY A N   1 
ATOM   1596  C  CA  . GLY A  1 208 ? -19.551 149.669 147.411 1.00 31.59  ? 208  GLY A CA  1 
ATOM   1597  C  C   . GLY A  1 208 ? -19.768 149.379 145.940 1.00 38.11  ? 208  GLY A C   1 
ATOM   1598  O  O   . GLY A  1 208 ? -19.384 148.308 145.458 1.00 35.65  ? 208  GLY A O   1 
ATOM   1599  N  N   . SER A  1 209 ? -20.355 150.322 145.212 1.00 39.76  ? 209  SER A N   1 
ATOM   1600  C  CA  . SER A  1 209 ? -20.584 150.195 143.784 1.00 35.31  ? 209  SER A CA  1 
ATOM   1601  C  C   . SER A  1 209 ? -19.463 150.795 142.967 1.00 32.46  ? 209  SER A C   1 
ATOM   1602  O  O   . SER A  1 209 ? -19.599 150.918 141.744 1.00 30.97  ? 209  SER A O   1 
ATOM   1603  C  CB  . SER A  1 209 ? -21.907 150.862 143.407 1.00 31.61  ? 209  SER A CB  1 
ATOM   1604  O  OG  . SER A  1 209 ? -22.956 150.286 144.150 1.00 30.55  ? 209  SER A OG  1 
ATOM   1605  N  N   . PHE A  1 210 ? -18.369 151.183 143.616 1.00 33.63  ? 210  PHE A N   1 
ATOM   1606  C  CA  . PHE A  1 210 ? -17.235 151.791 142.930 1.00 39.28  ? 210  PHE A CA  1 
ATOM   1607  C  C   . PHE A  1 210 ? -17.648 153.054 142.163 1.00 38.30  ? 210  PHE A C   1 
ATOM   1608  O  O   . PHE A  1 210 ? -17.107 153.364 141.098 1.00 38.35  ? 210  PHE A O   1 
ATOM   1609  C  CB  . PHE A  1 210 ? -16.565 150.774 142.004 1.00 47.68  ? 210  PHE A CB  1 
ATOM   1610  C  CG  . PHE A  1 210 ? -15.092 150.931 141.918 1.00 67.71  ? 210  PHE A CG  1 
ATOM   1611  C  CD1 . PHE A  1 210 ? -14.300 150.678 143.025 1.00 79.13  ? 210  PHE A CD1 1 
ATOM   1612  C  CD2 . PHE A  1 210 ? -14.491 151.335 140.738 1.00 74.47  ? 210  PHE A CD2 1 
ATOM   1613  C  CE1 . PHE A  1 210 ? -12.933 150.821 142.954 1.00 83.82  ? 210  PHE A CE1 1 
ATOM   1614  C  CE2 . PHE A  1 210 ? -13.121 151.481 140.658 1.00 76.60  ? 210  PHE A CE2 1 
ATOM   1615  C  CZ  . PHE A  1 210 ? -12.341 151.226 141.766 1.00 82.26  ? 210  PHE A CZ  1 
ATOM   1616  N  N   . GLN A  1 211 ? -18.633 153.783 142.683 1.00 35.97  ? 211  GLN A N   1 
ATOM   1617  C  CA  . GLN A  1 211 ? -19.135 155.000 142.043 1.00 36.99  ? 211  GLN A CA  1 
ATOM   1618  C  C   . GLN A  1 211 ? -18.519 156.190 142.773 1.00 35.16  ? 211  GLN A C   1 
ATOM   1619  O  O   . GLN A  1 211 ? -19.104 156.732 143.706 1.00 35.50  ? 211  GLN A O   1 
ATOM   1620  C  CB  . GLN A  1 211 ? -20.663 155.041 142.065 1.00 32.16  ? 211  GLN A CB  1 
ATOM   1621  C  CG  . GLN A  1 211 ? -21.319 153.980 141.182 1.00 37.29  ? 211  GLN A CG  1 
ATOM   1622  C  CD  . GLN A  1 211 ? -21.132 154.205 139.670 1.00 42.61  ? 211  GLN A CD  1 
ATOM   1623  O  OE1 . GLN A  1 211 ? -21.407 153.309 138.874 1.00 38.54  ? 211  GLN A OE1 1 
ATOM   1624  N  NE2 . GLN A  1 211 ? -20.690 155.399 139.275 1.00 40.45  ? 211  GLN A NE2 1 
ATOM   1625  N  N   . LEU A  1 212 ? -17.315 156.586 142.347 1.00 32.77  ? 212  LEU A N   1 
ATOM   1626  C  CA  . LEU A  1 212 ? -16.580 157.661 143.004 1.00 37.44  ? 212  LEU A CA  1 
ATOM   1627  C  C   . LEU A  1 212 ? -16.907 159.018 142.373 1.00 43.59  ? 212  LEU A C   1 
ATOM   1628  O  O   . LEU A  1 212 ? -17.655 159.116 141.396 1.00 42.23  ? 212  LEU A O   1 
ATOM   1629  C  CB  . LEU A  1 212 ? -15.078 157.383 142.963 1.00 32.63  ? 212  LEU A CB  1 
ATOM   1630  C  CG  . LEU A  1 212 ? -14.651 156.011 143.494 1.00 37.58  ? 212  LEU A CG  1 
ATOM   1631  C  CD1 . LEU A  1 212 ? -13.143 155.836 143.416 1.00 33.34  ? 212  LEU A CD1 1 
ATOM   1632  C  CD2 . LEU A  1 212 ? -15.112 155.867 144.916 1.00 39.04  ? 212  LEU A CD2 1 
ATOM   1633  N  N   . ASP A  1 213 ? -16.365 160.093 142.971 1.00 38.20  ? 213  ASP A N   1 
ATOM   1634  C  CA  . ASP A  1 213 ? -16.388 161.403 142.341 1.00 34.51  ? 213  ASP A CA  1 
ATOM   1635  C  C   . ASP A  1 213 ? -15.542 161.344 141.065 1.00 37.05  ? 213  ASP A C   1 
ATOM   1636  O  O   . ASP A  1 213 ? -14.764 160.399 140.876 1.00 34.11  ? 213  ASP A O   1 
ATOM   1637  C  CB  . ASP A  1 213 ? -15.840 162.455 143.307 1.00 38.16  ? 213  ASP A CB  1 
ATOM   1638  C  CG  . ASP A  1 213 ? -14.361 162.298 143.522 1.00 46.78  ? 213  ASP A CG  1 
ATOM   1639  O  OD1 . ASP A  1 213 ? -13.959 161.222 143.997 1.00 58.82  ? 213  ASP A OD1 1 
ATOM   1640  O  OD2 . ASP A  1 213 ? -13.603 163.232 143.202 1.00 60.32  ? 213  ASP A OD2 1 
ATOM   1641  N  N   . PRO A  1 214 ? -15.674 162.338 140.169 1.00 38.66  ? 214  PRO A N   1 
ATOM   1642  C  CA  . PRO A  1 214 ? -14.954 162.245 138.884 1.00 35.41  ? 214  PRO A CA  1 
ATOM   1643  C  C   . PRO A  1 214 ? -13.446 162.130 139.026 1.00 45.40  ? 214  PRO A C   1 
ATOM   1644  O  O   . PRO A  1 214 ? -12.819 161.356 138.286 1.00 41.63  ? 214  PRO A O   1 
ATOM   1645  C  CB  . PRO A  1 214 ? -15.359 163.542 138.165 1.00 36.08  ? 214  PRO A CB  1 
ATOM   1646  C  CG  . PRO A  1 214 ? -16.681 163.871 138.724 1.00 35.56  ? 214  PRO A CG  1 
ATOM   1647  C  CD  . PRO A  1 214 ? -16.592 163.491 140.187 1.00 34.77  ? 214  PRO A CD  1 
ATOM   1648  N  N   . GLU A  1 215 ? -12.833 162.892 139.938 1.00 39.86  ? 215  GLU A N   1 
ATOM   1649  C  CA  . GLU A  1 215 ? -11.384 162.788 140.088 1.00 49.42  ? 215  GLU A CA  1 
ATOM   1650  C  C   . GLU A  1 215 ? -10.984 161.419 140.619 1.00 45.25  ? 215  GLU A C   1 
ATOM   1651  O  O   . GLU A  1 215 ? -9.987  160.846 140.171 1.00 37.45  ? 215  GLU A O   1 
ATOM   1652  C  CB  . GLU A  1 215 ? -10.851 163.898 140.996 1.00 55.50  ? 215  GLU A CB  1 
ATOM   1653  C  CG  . GLU A  1 215 ? -10.752 165.261 140.322 1.00 70.73  ? 215  GLU A CG  1 
ATOM   1654  C  CD  . GLU A  1 215 ? -9.765  165.256 139.150 1.00 83.67  ? 215  GLU A CD  1 
ATOM   1655  O  OE1 . GLU A  1 215 ? -8.785  164.474 139.189 1.00 88.15  ? 215  GLU A OE1 1 
ATOM   1656  O  OE2 . GLU A  1 215 ? -9.972  166.028 138.187 1.00 88.34  ? 215  GLU A OE2 1 
ATOM   1657  N  N   . GLY A  1 216 ? -11.763 160.883 141.560 1.00 43.40  ? 216  GLY A N   1 
ATOM   1658  C  CA  . GLY A  1 216 ? -11.524 159.535 142.047 1.00 51.02  ? 216  GLY A CA  1 
ATOM   1659  C  C   . GLY A  1 216 ? -11.652 158.475 140.969 1.00 46.31  ? 216  GLY A C   1 
ATOM   1660  O  O   . GLY A  1 216 ? -10.937 157.468 140.987 1.00 45.70  ? 216  GLY A O   1 
ATOM   1661  N  N   . ALA A  1 217 ? -12.605 158.648 140.055 1.00 43.07  ? 217  ALA A N   1 
ATOM   1662  C  CA  . ALA A  1 217 ? -12.732 157.696 138.958 1.00 44.48  ? 217  ALA A CA  1 
ATOM   1663  C  C   . ALA A  1 217 ? -11.468 157.687 138.119 1.00 46.70  ? 217  ALA A C   1 
ATOM   1664  O  O   . ALA A  1 217 ? -10.957 156.616 137.759 1.00 46.63  ? 217  ALA A O   1 
ATOM   1665  C  CB  . ALA A  1 217 ? -13.939 158.043 138.090 1.00 36.75  ? 217  ALA A CB  1 
ATOM   1666  N  N   . MET A  1 218 ? -10.922 158.879 137.851 1.00 42.32  ? 218  MET A N   1 
ATOM   1667  C  CA  . MET A  1 218 ? -9.667  158.991 137.115 1.00 43.61  ? 218  MET A CA  1 
ATOM   1668  C  C   . MET A  1 218 ? -8.533  158.291 137.859 1.00 48.63  ? 218  MET A C   1 
ATOM   1669  O  O   . MET A  1 218 ? -7.815  157.466 137.285 1.00 49.45  ? 218  MET A O   1 
ATOM   1670  C  CB  . MET A  1 218 ? -9.316  160.470 136.906 1.00 55.48  ? 218  MET A CB  1 
ATOM   1671  C  CG  . MET A  1 218 ? -10.278 161.295 136.070 1.00 57.74  ? 218  MET A CG  1 
ATOM   1672  S  SD  . MET A  1 218 ? -10.535 160.635 134.423 1.00 57.64  ? 218  MET A SD  1 
ATOM   1673  C  CE  . MET A  1 218 ? -12.151 159.869 134.585 1.00 48.77  ? 218  MET A CE  1 
ATOM   1674  N  N   . LYS A  1 219 ? -8.365  158.601 139.153 1.00 49.60  ? 219  LYS A N   1 
ATOM   1675  C  CA  . LYS A  1 219 ? -7.273  158.015 139.934 1.00 48.97  ? 219  LYS A CA  1 
ATOM   1676  C  C   . LYS A  1 219 ? -7.438  156.504 140.086 1.00 43.90  ? 219  LYS A C   1 
ATOM   1677  O  O   . LYS A  1 219 ? -6.442  155.782 140.209 1.00 49.97  ? 219  LYS A O   1 
ATOM   1678  C  CB  . LYS A  1 219 ? -7.176  158.677 141.320 1.00 47.04  ? 219  LYS A CB  1 
ATOM   1679  C  CG  . LYS A  1 219 ? -6.755  160.164 141.325 1.00 63.91  ? 219  LYS A CG  1 
ATOM   1680  C  CD  . LYS A  1 219 ? -5.370  160.427 140.721 1.00 84.53  ? 219  LYS A CD  1 
ATOM   1681  C  CE  . LYS A  1 219 ? -5.058  161.939 140.661 1.00 85.66  ? 219  LYS A CE  1 
ATOM   1682  N  NZ  . LYS A  1 219 ? -3.822  162.264 139.891 1.00 89.49  ? 219  LYS A NZ  1 
ATOM   1683  N  N   . ALA A  1 220 ? -8.681  156.013 140.096 1.00 41.25  ? 220  ALA A N   1 
ATOM   1684  C  CA  . ALA A  1 220 ? -8.930  154.584 140.262 1.00 38.36  ? 220  ALA A CA  1 
ATOM   1685  C  C   . ALA A  1 220 ? -8.301  153.765 139.143 1.00 45.71  ? 220  ALA A C   1 
ATOM   1686  O  O   . ALA A  1 220 ? -7.895  152.620 139.371 1.00 41.58  ? 220  ALA A O   1 
ATOM   1687  C  CB  . ALA A  1 220 ? -10.435 154.307 140.341 1.00 33.33  ? 220  ALA A CB  1 
ATOM   1688  N  N   . VAL A  1 221 ? -8.232  154.313 137.929 1.00 42.01  ? 221  VAL A N   1 
ATOM   1689  C  CA  . VAL A  1 221 ? -7.595  153.618 136.817 1.00 49.60  ? 221  VAL A CA  1 
ATOM   1690  C  C   . VAL A  1 221 ? -6.185  154.133 136.534 1.00 52.40  ? 221  VAL A C   1 
ATOM   1691  O  O   . VAL A  1 221 ? -5.582  153.722 135.546 1.00 57.01  ? 221  VAL A O   1 
ATOM   1692  C  CB  . VAL A  1 221 ? -8.462  153.674 135.549 1.00 48.77  ? 221  VAL A CB  1 
ATOM   1693  C  CG1 . VAL A  1 221 ? -9.645  152.740 135.684 1.00 41.03  ? 221  VAL A CG1 1 
ATOM   1694  C  CG2 . VAL A  1 221 ? -8.927  155.102 135.274 1.00 41.35  ? 221  VAL A CG2 1 
ATOM   1695  N  N   . SER A  1 222 ? -5.649  155.034 137.361 1.00 50.81  ? 222  SER A N   1 
ATOM   1696  C  CA  . SER A  1 222 ? -4.255  155.464 137.250 1.00 49.80  ? 222  SER A CA  1 
ATOM   1697  C  C   . SER A  1 222 ? -3.321  154.648 138.141 1.00 46.91  ? 222  SER A C   1 
ATOM   1698  O  O   . SER A  1 222 ? -2.190  155.072 138.403 1.00 50.17  ? 222  SER A O   1 
ATOM   1699  C  CB  . SER A  1 222 ? -4.112  156.951 137.601 1.00 50.92  ? 222  SER A CB  1 
ATOM   1700  O  OG  . SER A  1 222 ? -4.930  157.771 136.796 1.00 53.90  ? 222  SER A OG  1 
ATOM   1701  N  N   . THR A  1 223 ? -3.777  153.494 138.613 1.00 38.04  ? 223  THR A N   1 
ATOM   1702  C  CA  . THR A  1 223 ? -3.050  152.681 139.571 1.00 41.50  ? 223  THR A CA  1 
ATOM   1703  C  C   . THR A  1 223 ? -3.391  151.218 139.312 1.00 43.40  ? 223  THR A C   1 
ATOM   1704  O  O   . THR A  1 223 ? -4.407  150.894 138.687 1.00 43.00  ? 223  THR A O   1 
ATOM   1705  C  CB  . THR A  1 223 ? -3.405  153.083 141.016 1.00 34.75  ? 223  THR A CB  1 
ATOM   1706  O  OG1 . THR A  1 223 ? -2.762  152.206 141.955 1.00 34.22  ? 223  THR A OG1 1 
ATOM   1707  C  CG2 . THR A  1 223 ? -4.913  153.025 141.241 1.00 34.16  ? 223  THR A CG2 1 
ATOM   1708  N  N   . LEU A  1 224 ? -2.523  150.336 139.789 1.00 38.65  ? 224  LEU A N   1 
ATOM   1709  C  CA  . LEU A  1 224 ? -2.787  148.903 139.785 1.00 39.07  ? 224  LEU A CA  1 
ATOM   1710  C  C   . LEU A  1 224 ? -3.294  148.411 141.130 1.00 38.36  ? 224  LEU A C   1 
ATOM   1711  O  O   . LEU A  1 224 ? -3.496  147.207 141.291 1.00 40.93  ? 224  LEU A O   1 
ATOM   1712  C  CB  . LEU A  1 224 ? -1.524  148.133 139.382 1.00 41.19  ? 224  LEU A CB  1 
ATOM   1713  C  CG  . LEU A  1 224 ? -1.002  148.501 137.988 1.00 39.78  ? 224  LEU A CG  1 
ATOM   1714  C  CD1 . LEU A  1 224 ? 0.379   147.960 137.748 1.00 47.10  ? 224  LEU A CD1 1 
ATOM   1715  C  CD2 . LEU A  1 224 ? -1.951  147.946 136.942 1.00 41.97  ? 224  LEU A CD2 1 
ATOM   1716  N  N   . GLY A  1 225 ? -3.484  149.316 142.099 1.00 32.98  ? 225  GLY A N   1 
ATOM   1717  C  CA  . GLY A  1 225 ? -4.036  148.973 143.396 1.00 33.20  ? 225  GLY A CA  1 
ATOM   1718  C  C   . GLY A  1 225 ? -3.301  149.580 144.575 1.00 39.71  ? 225  GLY A C   1 
ATOM   1719  O  O   . GLY A  1 225 ? -3.845  149.645 145.685 1.00 40.47  ? 225  GLY A O   1 
ATOM   1720  N  N   . ALA A  1 226 ? -2.055  150.012 144.361 1.00 34.31  ? 226  ALA A N   1 
ATOM   1721  C  CA  . ALA A  1 226 ? -1.230  150.492 145.462 1.00 33.19  ? 226  ALA A CA  1 
ATOM   1722  C  C   . ALA A  1 226 ? -1.445  151.965 145.782 1.00 32.81  ? 226  ALA A C   1 
ATOM   1723  O  O   . ALA A  1 226 ? -1.132  152.384 146.902 1.00 41.41  ? 226  ALA A O   1 
ATOM   1724  C  CB  . ALA A  1 226 ? 0.259   150.261 145.156 1.00 35.82  ? 226  ALA A CB  1 
ATOM   1725  N  N   . ASN A  1 227 ? -2.021  152.753 144.867 1.00 33.31  ? 227  ASN A N   1 
ATOM   1726  C  CA  . ASN A  1 227 ? -2.207  154.191 145.076 1.00 33.64  ? 227  ASN A CA  1 
ATOM   1727  C  C   . ASN A  1 227 ? -3.682  154.523 144.916 1.00 39.28  ? 227  ASN A C   1 
ATOM   1728  O  O   . ASN A  1 227 ? -4.124  155.004 143.858 1.00 39.94  ? 227  ASN A O   1 
ATOM   1729  C  CB  . ASN A  1 227 ? -1.342  155.009 144.128 1.00 37.68  ? 227  ASN A CB  1 
ATOM   1730  C  CG  . ASN A  1 227 ? 0.121   154.831 144.420 1.00 40.28  ? 227  ASN A CG  1 
ATOM   1731  O  OD1 . ASN A  1 227 ? 0.618   155.307 145.430 1.00 47.91  ? 227  ASN A OD1 1 
ATOM   1732  N  ND2 . ASN A  1 227 ? 0.818   154.132 143.541 1.00 38.78  ? 227  ASN A ND2 1 
ATOM   1733  N  N   . PRO A  1 228 ? -4.471  154.281 145.952 1.00 37.11  ? 228  PRO A N   1 
ATOM   1734  C  CA  . PRO A  1 228 ? -5.927  154.416 145.840 1.00 39.05  ? 228  PRO A CA  1 
ATOM   1735  C  C   . PRO A  1 228 ? -6.336  155.870 145.714 1.00 44.87  ? 228  PRO A C   1 
ATOM   1736  O  O   . PRO A  1 228 ? -5.600  156.772 146.140 1.00 35.76  ? 228  PRO A O   1 
ATOM   1737  C  CB  . PRO A  1 228 ? -6.433  153.816 147.161 1.00 42.03  ? 228  PRO A CB  1 
ATOM   1738  C  CG  . PRO A  1 228 ? -5.294  154.082 148.131 1.00 48.69  ? 228  PRO A CG  1 
ATOM   1739  C  CD  . PRO A  1 228 ? -4.028  153.925 147.311 1.00 44.87  ? 228  PRO A CD  1 
ATOM   1740  N  N   . PRO A  1 229 ? -7.509  156.143 145.152 1.00 42.04  ? 229  PRO A N   1 
ATOM   1741  C  CA  . PRO A  1 229 ? -8.053  157.505 145.209 1.00 42.84  ? 229  PRO A CA  1 
ATOM   1742  C  C   . PRO A  1 229 ? -8.453  157.860 146.633 1.00 43.80  ? 229  PRO A C   1 
ATOM   1743  O  O   . PRO A  1 229 ? -8.495  157.012 147.525 1.00 39.72  ? 229  PRO A O   1 
ATOM   1744  C  CB  . PRO A  1 229 ? -9.275  157.442 144.287 1.00 42.94  ? 229  PRO A CB  1 
ATOM   1745  C  CG  . PRO A  1 229 ? -9.712  156.013 144.361 1.00 40.23  ? 229  PRO A CG  1 
ATOM   1746  C  CD  . PRO A  1 229 ? -8.429  155.202 144.486 1.00 38.45  ? 229  PRO A CD  1 
ATOM   1747  N  N   . GLU A  1 230 ? -8.728  159.147 146.841 1.00 43.25  ? 230  GLU A N   1 
ATOM   1748  C  CA  . GLU A  1 230 ? -9.341  159.595 148.088 1.00 46.86  ? 230  GLU A CA  1 
ATOM   1749  C  C   . GLU A  1 230 ? -10.774 159.081 148.211 1.00 42.92  ? 230  GLU A C   1 
ATOM   1750  O  O   . GLU A  1 230 ? -11.500 158.961 147.222 1.00 41.51  ? 230  GLU A O   1 
ATOM   1751  C  CB  . GLU A  1 230 ? -9.327  161.124 148.173 1.00 50.79  ? 230  GLU A CB  1 
ATOM   1752  C  CG  . GLU A  1 230 ? -7.944  161.729 148.306 1.00 60.94  ? 230  GLU A CG  1 
ATOM   1753  C  CD  . GLU A  1 230 ? -7.184  161.168 149.499 1.00 67.45  ? 230  GLU A CD  1 
ATOM   1754  O  OE1 . GLU A  1 230 ? -6.184  160.449 149.286 1.00 70.98  ? 230  GLU A OE1 1 
ATOM   1755  O  OE2 . GLU A  1 230 ? -7.608  161.419 150.650 1.00 72.53  ? 230  GLU A OE2 1 
ATOM   1756  N  N   . TYR A  1 231 ? -11.175 158.768 149.438 1.00 40.78  ? 231  TYR A N   1 
ATOM   1757  C  CA  . TYR A  1 231 ? -12.554 158.398 149.718 1.00 39.51  ? 231  TYR A CA  1 
ATOM   1758  C  C   . TYR A  1 231 ? -13.467 159.582 149.406 1.00 43.82  ? 231  TYR A C   1 
ATOM   1759  O  O   . TYR A  1 231 ? -13.459 160.586 150.125 1.00 43.34  ? 231  TYR A O   1 
ATOM   1760  C  CB  . TYR A  1 231 ? -12.664 157.947 151.178 1.00 35.51  ? 231  TYR A CB  1 
ATOM   1761  C  CG  . TYR A  1 231 ? -14.043 157.559 151.645 1.00 36.79  ? 231  TYR A CG  1 
ATOM   1762  C  CD1 . TYR A  1 231 ? -14.921 158.513 152.146 1.00 28.87  ? 231  TYR A CD1 1 
ATOM   1763  C  CD2 . TYR A  1 231 ? -14.476 156.225 151.586 1.00 38.56  ? 231  TYR A CD2 1 
ATOM   1764  C  CE1 . TYR A  1 231 ? -16.215 158.151 152.579 1.00 34.07  ? 231  TYR A CE1 1 
ATOM   1765  C  CE2 . TYR A  1 231 ? -15.743 155.861 152.021 1.00 32.69  ? 231  TYR A CE2 1 
ATOM   1766  C  CZ  . TYR A  1 231 ? -16.612 156.836 152.513 1.00 35.41  ? 231  TYR A CZ  1 
ATOM   1767  O  OH  . TYR A  1 231 ? -17.872 156.485 152.939 1.00 36.41  ? 231  TYR A OH  1 
ATOM   1768  N  N   . ASN A  1 232 ? -14.252 159.479 148.336 1.00 39.30  ? 232  ASN A N   1 
ATOM   1769  C  CA  . ASN A  1 232 ? -15.127 160.570 147.932 1.00 36.81  ? 232  ASN A CA  1 
ATOM   1770  C  C   . ASN A  1 232 ? -16.088 160.064 146.865 1.00 43.72  ? 232  ASN A C   1 
ATOM   1771  O  O   . ASN A  1 232 ? -15.789 159.104 146.147 1.00 39.40  ? 232  ASN A O   1 
ATOM   1772  C  CB  . ASN A  1 232 ? -14.326 161.773 147.432 1.00 36.01  ? 232  ASN A CB  1 
ATOM   1773  C  CG  . ASN A  1 232 ? -15.140 163.086 147.471 1.00 36.92  ? 232  ASN A CG  1 
ATOM   1774  O  OD1 . ASN A  1 232 ? -16.216 163.150 148.042 1.00 42.27  ? 232  ASN A OD1 1 
ATOM   1775  N  ND2 . ASN A  1 232 ? -14.607 164.121 146.865 1.00 44.02  ? 232  ASN A ND2 1 
ATOM   1776  N  N   . THR A  1 233 ? -17.274 160.674 146.816 1.00 38.70  ? 233  THR A N   1 
ATOM   1777  C  CA  . THR A  1 233 ? -18.317 160.262 145.880 1.00 43.14  ? 233  THR A CA  1 
ATOM   1778  C  C   . THR A  1 233 ? -19.034 161.509 145.379 1.00 39.16  ? 233  THR A C   1 
ATOM   1779  O  O   . THR A  1 233 ? -18.770 162.619 145.840 1.00 36.62  ? 233  THR A O   1 
ATOM   1780  C  CB  . THR A  1 233 ? -19.338 159.306 146.528 1.00 37.49  ? 233  THR A CB  1 
ATOM   1781  O  OG1 . THR A  1 233 ? -20.085 160.019 147.515 1.00 36.98  ? 233  THR A OG1 1 
ATOM   1782  C  CG2 . THR A  1 233 ? -18.676 158.101 147.189 1.00 33.04  ? 233  THR A CG2 1 
ATOM   1783  N  N   . ASN A  1 234 ? -19.980 161.322 144.454 1.00 38.83  ? 234  ASN A N   1 
ATOM   1784  C  CA  . ASN A  1 234 ? -20.831 162.442 144.065 1.00 34.87  ? 234  ASN A CA  1 
ATOM   1785  C  C   . ASN A  1 234 ? -21.765 162.864 145.195 1.00 39.85  ? 234  ASN A C   1 
ATOM   1786  O  O   . ASN A  1 234 ? -22.476 163.860 145.060 1.00 39.54  ? 234  ASN A O   1 
ATOM   1787  C  CB  . ASN A  1 234 ? -21.628 162.090 142.799 1.00 34.02  ? 234  ASN A CB  1 
ATOM   1788  C  CG  . ASN A  1 234 ? -20.763 162.090 141.537 1.00 34.68  ? 234  ASN A CG  1 
ATOM   1789  O  OD1 . ASN A  1 234 ? -19.721 162.750 141.489 1.00 33.76  ? 234  ASN A OD1 1 
ATOM   1790  N  ND2 . ASN A  1 234 ? -21.181 161.334 140.519 1.00 28.31  ? 234  ASN A ND2 1 
ATOM   1791  N  N   . TYR A  1 235 ? -21.764 162.134 146.307 1.00 38.77  ? 235  TYR A N   1 
ATOM   1792  C  CA  . TYR A  1 235 ? -22.507 162.492 147.507 1.00 40.02  ? 235  TYR A CA  1 
ATOM   1793  C  C   . TYR A  1 235 ? -21.593 162.978 148.632 1.00 42.21  ? 235  TYR A C   1 
ATOM   1794  O  O   . TYR A  1 235 ? -21.983 162.939 149.804 1.00 46.92  ? 235  TYR A O   1 
ATOM   1795  C  CB  . TYR A  1 235 ? -23.336 161.285 147.950 1.00 32.02  ? 235  TYR A CB  1 
ATOM   1796  C  CG  . TYR A  1 235 ? -24.463 160.969 146.995 1.00 37.91  ? 235  TYR A CG  1 
ATOM   1797  C  CD1 . TYR A  1 235 ? -25.676 161.687 147.036 1.00 40.76  ? 235  TYR A CD1 1 
ATOM   1798  C  CD2 . TYR A  1 235 ? -24.292 160.026 145.990 1.00 34.89  ? 235  TYR A CD2 1 
ATOM   1799  C  CE1 . TYR A  1 235 ? -26.710 161.406 146.134 1.00 36.00  ? 235  TYR A CE1 1 
ATOM   1800  C  CE2 . TYR A  1 235 ? -25.300 159.744 145.085 1.00 39.27  ? 235  TYR A CE2 1 
ATOM   1801  C  CZ  . TYR A  1 235 ? -26.502 160.430 145.157 1.00 42.57  ? 235  TYR A CZ  1 
ATOM   1802  O  OH  . TYR A  1 235 ? -27.472 160.124 144.241 1.00 35.57  ? 235  TYR A OH  1 
ATOM   1803  N  N   . GLY A  1 236 ? -20.383 163.433 148.306 1.00 32.69  ? 236  GLY A N   1 
ATOM   1804  C  CA  . GLY A  1 236 ? -19.458 163.912 149.327 1.00 30.39  ? 236  GLY A CA  1 
ATOM   1805  C  C   . GLY A  1 236 ? -18.640 162.779 149.920 1.00 37.26  ? 236  GLY A C   1 
ATOM   1806  O  O   . GLY A  1 236 ? -18.707 161.630 149.467 1.00 35.80  ? 236  GLY A O   1 
ATOM   1807  N  N   . ASN A  1 237 ? -17.882 163.100 150.984 1.00 35.66  ? 237  ASN A N   1 
ATOM   1808  C  CA  . ASN A  1 237 ? -16.905 162.169 151.553 1.00 39.06  ? 237  ASN A CA  1 
ATOM   1809  C  C   . ASN A  1 237 ? -17.225 161.757 152.990 1.00 38.90  ? 237  ASN A C   1 
ATOM   1810  O  O   . ASN A  1 237 ? -16.346 161.251 153.694 1.00 41.18  ? 237  ASN A O   1 
ATOM   1811  C  CB  . ASN A  1 237 ? -15.479 162.736 151.458 1.00 39.17  ? 237  ASN A CB  1 
ATOM   1812  C  CG  . ASN A  1 237 ? -15.228 163.945 152.380 1.00 44.27  ? 237  ASN A CG  1 
ATOM   1813  O  OD1 . ASN A  1 237 ? -16.135 164.477 153.027 1.00 36.84  ? 237  ASN A OD1 1 
ATOM   1814  N  ND2 . ASN A  1 237 ? -13.974 164.405 152.396 1.00 43.09  ? 237  ASN A ND2 1 
ATOM   1815  N  N   . LYS A  1 238 ? -18.455 161.943 153.448 1.00 35.02  ? 238  LYS A N   1 
ATOM   1816  C  CA  . LYS A  1 238 ? -18.785 161.522 154.804 1.00 30.59  ? 238  LYS A CA  1 
ATOM   1817  C  C   . LYS A  1 238 ? -19.280 160.078 154.821 1.00 36.57  ? 238  LYS A C   1 
ATOM   1818  O  O   . LYS A  1 238 ? -19.679 159.518 153.800 1.00 37.10  ? 238  LYS A O   1 
ATOM   1819  C  CB  . LYS A  1 238 ? -19.831 162.447 155.424 1.00 44.15  ? 238  LYS A CB  1 
ATOM   1820  C  CG  . LYS A  1 238 ? -19.321 163.887 155.551 1.00 65.04  ? 238  LYS A CG  1 
ATOM   1821  C  CD  . LYS A  1 238 ? -17.995 163.940 156.336 1.00 72.53  ? 238  LYS A CD  1 
ATOM   1822  C  CE  . LYS A  1 238 ? -17.476 165.358 156.457 1.00 76.80  ? 238  LYS A CE  1 
ATOM   1823  N  NZ  . LYS A  1 238 ? -17.071 165.928 155.136 1.00 76.32  ? 238  LYS A NZ  1 
ATOM   1824  N  N   . VAL A  1 239 ? -19.213 159.473 156.003 1.00 32.23  ? 239  VAL A N   1 
ATOM   1825  C  CA  . VAL A  1 239 ? -19.738 158.133 156.230 1.00 40.82  ? 239  VAL A CA  1 
ATOM   1826  C  C   . VAL A  1 239 ? -21.239 158.265 156.464 1.00 40.34  ? 239  VAL A C   1 
ATOM   1827  O  O   . VAL A  1 239 ? -21.673 158.905 157.426 1.00 39.91  ? 239  VAL A O   1 
ATOM   1828  C  CB  . VAL A  1 239 ? -19.050 157.467 157.431 1.00 44.61  ? 239  VAL A CB  1 
ATOM   1829  C  CG1 . VAL A  1 239 ? -19.632 156.077 157.687 1.00 44.37  ? 239  VAL A CG1 1 
ATOM   1830  C  CG2 . VAL A  1 239 ? -17.540 157.432 157.241 1.00 39.66  ? 239  VAL A CG2 1 
ATOM   1831  N  N   . HIS A  1 240 ? -22.031 157.677 155.578 1.00 41.34  ? 240  HIS A N   1 
ATOM   1832  C  CA  . HIS A  1 240 ? -23.476 157.862 155.608 1.00 47.07  ? 240  HIS A CA  1 
ATOM   1833  C  C   . HIS A  1 240 ? -24.171 156.916 156.577 1.00 40.43  ? 240  HIS A C   1 
ATOM   1834  O  O   . HIS A  1 240 ? -23.759 155.767 156.750 1.00 39.99  ? 240  HIS A O   1 
ATOM   1835  C  CB  . HIS A  1 240 ? -24.049 157.681 154.208 1.00 48.83  ? 240  HIS A CB  1 
ATOM   1836  C  CG  . HIS A  1 240 ? -23.754 158.829 153.307 1.00 51.48  ? 240  HIS A CG  1 
ATOM   1837  N  ND1 . HIS A  1 240 ? -22.531 159.002 152.698 1.00 52.43  ? 240  HIS A ND1 1 
ATOM   1838  C  CD2 . HIS A  1 240 ? -24.514 159.883 152.935 1.00 51.05  ? 240  HIS A CD2 1 
ATOM   1839  C  CE1 . HIS A  1 240 ? -22.553 160.110 151.980 1.00 52.67  ? 240  HIS A CE1 1 
ATOM   1840  N  NE2 . HIS A  1 240 ? -23.744 160.666 152.111 1.00 55.40  ? 240  HIS A NE2 1 
ATOM   1841  N  N   . ASP A  1 241 ? -25.224 157.437 157.219 1.00 37.23  ? 241  ASP A N   1 
ATOM   1842  C  CA  . ASP A  1 241 ? -26.162 156.666 158.031 1.00 38.41  ? 241  ASP A CA  1 
ATOM   1843  C  C   . ASP A  1 241 ? -27.238 155.999 157.184 1.00 38.20  ? 241  ASP A C   1 
ATOM   1844  O  O   . ASP A  1 241 ? -27.806 154.978 157.589 1.00 37.52  ? 241  ASP A O   1 
ATOM   1845  C  CB  . ASP A  1 241 ? -26.871 157.592 159.017 1.00 52.53  ? 241  ASP A CB  1 
ATOM   1846  C  CG  . ASP A  1 241 ? -26.044 157.910 160.217 1.00 70.93  ? 241  ASP A CG  1 
ATOM   1847  O  OD1 . ASP A  1 241 ? -25.006 157.251 160.427 1.00 77.92  ? 241  ASP A OD1 1 
ATOM   1848  O  OD2 . ASP A  1 241 ? -26.432 158.839 160.948 1.00 78.21  ? 241  ASP A OD2 1 
ATOM   1849  N  N   . LYS A  1 242 ? -27.582 156.606 156.057 1.00 30.51  ? 242  LYS A N   1 
ATOM   1850  C  CA  . LYS A  1 242 ? -28.560 156.133 155.101 1.00 34.34  ? 242  LYS A CA  1 
ATOM   1851  C  C   . LYS A  1 242 ? -27.878 155.956 153.754 1.00 32.79  ? 242  LYS A C   1 
ATOM   1852  O  O   . LYS A  1 242 ? -26.892 156.643 153.476 1.00 34.24  ? 242  LYS A O   1 
ATOM   1853  C  CB  . LYS A  1 242 ? -29.716 157.137 154.980 1.00 35.35  ? 242  LYS A CB  1 
ATOM   1854  C  CG  . LYS A  1 242 ? -30.481 157.333 156.272 1.00 46.27  ? 242  LYS A CG  1 
ATOM   1855  C  CD  . LYS A  1 242 ? -31.550 158.401 156.133 1.00 62.02  ? 242  LYS A CD  1 
ATOM   1856  C  CE  . LYS A  1 242 ? -32.320 158.576 157.437 1.00 77.12  ? 242  LYS A CE  1 
ATOM   1857  N  NZ  . LYS A  1 242 ? -33.372 159.634 157.318 1.00 86.55  ? 242  LYS A NZ  1 
ATOM   1858  N  N   . PRO A  1 243 ? -28.360 155.057 152.903 1.00 37.30  ? 243  PRO A N   1 
ATOM   1859  C  CA  . PRO A  1 243 ? -27.720 154.872 151.594 1.00 34.89  ? 243  PRO A CA  1 
ATOM   1860  C  C   . PRO A  1 243 ? -27.626 156.200 150.872 1.00 32.93  ? 243  PRO A C   1 
ATOM   1861  O  O   . PRO A  1 243 ? -28.587 156.982 150.886 1.00 33.62  ? 243  PRO A O   1 
ATOM   1862  C  CB  . PRO A  1 243 ? -28.666 153.903 150.866 1.00 31.36  ? 243  PRO A CB  1 
ATOM   1863  C  CG  . PRO A  1 243 ? -29.357 153.139 152.005 1.00 28.85  ? 243  PRO A CG  1 
ATOM   1864  C  CD  . PRO A  1 243 ? -29.520 154.161 153.096 1.00 34.53  ? 243  PRO A CD  1 
ATOM   1865  N  N   . PRO A  1 244 ? -26.458 156.536 150.313 1.00 37.56  ? 244  PRO A N   1 
ATOM   1866  C  CA  . PRO A  1 244 ? -26.366 157.792 149.547 1.00 35.55  ? 244  PRO A CA  1 
ATOM   1867  C  C   . PRO A  1 244 ? -27.211 157.766 148.286 1.00 36.53  ? 244  PRO A C   1 
ATOM   1868  O  O   . PRO A  1 244 ? -27.852 158.764 147.936 1.00 43.22  ? 244  PRO A O   1 
ATOM   1869  C  CB  . PRO A  1 244 ? -24.874 157.882 149.187 1.00 43.70  ? 244  PRO A CB  1 
ATOM   1870  C  CG  . PRO A  1 244 ? -24.206 156.714 149.850 1.00 38.87  ? 244  PRO A CG  1 
ATOM   1871  C  CD  . PRO A  1 244 ? -25.232 155.729 150.224 1.00 34.03  ? 244  PRO A CD  1 
ATOM   1872  N  N   . ILE A  1 245 ? -27.224 156.637 147.589 1.00 34.95  ? 245  ILE A N   1 
ATOM   1873  C  CA  . ILE A  1 245 ? -27.938 156.515 146.325 1.00 32.69  ? 245  ILE A CA  1 
ATOM   1874  C  C   . ILE A  1 245 ? -29.336 155.998 146.649 1.00 33.46  ? 245  ILE A C   1 
ATOM   1875  O  O   . ILE A  1 245 ? -29.469 155.021 147.392 1.00 30.47  ? 245  ILE A O   1 
ATOM   1876  C  CB  . ILE A  1 245 ? -27.183 155.587 145.363 1.00 35.20  ? 245  ILE A CB  1 
ATOM   1877  C  CG1 . ILE A  1 245 ? -25.816 156.177 145.024 1.00 33.76  ? 245  ILE A CG1 1 
ATOM   1878  C  CG2 . ILE A  1 245 ? -27.985 155.333 144.084 1.00 24.78  ? 245  ILE A CG2 1 
ATOM   1879  C  CD1 . ILE A  1 245 ? -24.927 155.173 144.269 1.00 34.00  ? 245  ILE A CD1 1 
ATOM   1880  N  N   . PRO A  1 246 ? -30.394 156.659 146.178 1.00 33.50  ? 246  PRO A N   1 
ATOM   1881  C  CA  . PRO A  1 246 ? -31.762 156.189 146.462 1.00 30.32  ? 246  PRO A CA  1 
ATOM   1882  C  C   . PRO A  1 246 ? -32.018 154.807 145.876 1.00 35.67  ? 246  PRO A C   1 
ATOM   1883  O  O   . PRO A  1 246 ? -31.403 154.407 144.883 1.00 32.83  ? 246  PRO A O   1 
ATOM   1884  C  CB  . PRO A  1 246 ? -32.652 157.238 145.784 1.00 30.53  ? 246  PRO A CB  1 
ATOM   1885  C  CG  . PRO A  1 246 ? -31.769 158.436 145.599 1.00 42.92  ? 246  PRO A CG  1 
ATOM   1886  C  CD  . PRO A  1 246 ? -30.375 157.915 145.414 1.00 35.07  ? 246  PRO A CD  1 
ATOM   1887  N  N   . GLY A  1 247 ? -32.944 154.078 146.497 1.00 37.12  ? 247  GLY A N   1 
ATOM   1888  C  CA  . GLY A  1 247 ? -33.407 152.835 145.902 1.00 39.55  ? 247  GLY A CA  1 
ATOM   1889  C  C   . GLY A  1 247 ? -34.041 153.077 144.546 1.00 38.17  ? 247  GLY A C   1 
ATOM   1890  O  O   . GLY A  1 247 ? -34.616 154.137 144.278 1.00 36.33  ? 247  GLY A O   1 
ATOM   1891  N  N   . GLN A  1 248 ? -33.917 152.097 143.662 1.00 34.18  ? 248  GLN A N   1 
ATOM   1892  C  CA  . GLN A  1 248 ? -34.520 152.296 142.359 1.00 28.12  ? 248  GLN A CA  1 
ATOM   1893  C  C   . GLN A  1 248 ? -36.042 152.278 142.471 1.00 37.72  ? 248  GLN A C   1 
ATOM   1894  O  O   . GLN A  1 248 ? -36.612 151.716 143.413 1.00 34.46  ? 248  GLN A O   1 
ATOM   1895  C  CB  . GLN A  1 248 ? -34.089 151.210 141.393 1.00 30.72  ? 248  GLN A CB  1 
ATOM   1896  C  CG  . GLN A  1 248 ? -34.761 149.869 141.682 1.00 33.39  ? 248  GLN A CG  1 
ATOM   1897  C  CD  . GLN A  1 248 ? -34.638 148.955 140.496 1.00 47.81  ? 248  GLN A CD  1 
ATOM   1898  O  OE1 . GLN A  1 248 ? -33.532 148.538 140.142 1.00 50.32  ? 248  GLN A OE1 1 
ATOM   1899  N  NE2 . GLN A  1 248 ? -35.770 148.680 139.833 1.00 48.57  ? 248  GLN A NE2 1 
ATOM   1900  N  N   . THR A  1 249 ? -36.699 152.934 141.507 1.00 35.93  ? 249  THR A N   1 
ATOM   1901  C  CA  . THR A  1 249 ? -38.117 152.690 141.273 1.00 39.32  ? 249  THR A CA  1 
ATOM   1902  C  C   . THR A  1 249 ? -38.287 152.231 139.826 1.00 32.66  ? 249  THR A C   1 
ATOM   1903  O  O   . THR A  1 249 ? -37.501 152.623 138.958 1.00 32.29  ? 249  THR A O   1 
ATOM   1904  C  CB  . THR A  1 249 ? -39.033 153.911 141.527 1.00 36.97  ? 249  THR A CB  1 
ATOM   1905  O  OG1 . THR A  1 249 ? -38.893 154.871 140.476 1.00 35.46  ? 249  THR A OG1 1 
ATOM   1906  C  CG2 . THR A  1 249 ? -38.714 154.589 142.880 1.00 31.19  ? 249  THR A CG2 1 
ATOM   1907  N  N   . PRO A  1 250 ? -39.249 151.339 139.542 1.00 35.13  ? 250  PRO A N   1 
ATOM   1908  C  CA  . PRO A  1 250 ? -40.155 150.629 140.458 1.00 37.79  ? 250  PRO A CA  1 
ATOM   1909  C  C   . PRO A  1 250 ? -39.390 149.828 141.512 1.00 37.03  ? 250  PRO A C   1 
ATOM   1910  O  O   . PRO A  1 250 ? -38.282 149.390 141.246 1.00 30.31  ? 250  PRO A O   1 
ATOM   1911  C  CB  . PRO A  1 250 ? -40.933 149.682 139.528 1.00 37.08  ? 250  PRO A CB  1 
ATOM   1912  C  CG  . PRO A  1 250 ? -40.843 150.306 138.186 1.00 40.18  ? 250  PRO A CG  1 
ATOM   1913  C  CD  . PRO A  1 250 ? -39.492 150.972 138.137 1.00 34.41  ? 250  PRO A CD  1 
ATOM   1914  N  N   . THR A  1 251 ? -39.975 149.687 142.695 1.00 37.47  ? 251  THR A N   1 
ATOM   1915  C  CA  . THR A  1 251 ? -39.311 149.013 143.796 1.00 30.78  ? 251  THR A CA  1 
ATOM   1916  C  C   . THR A  1 251 ? -38.893 147.610 143.412 1.00 32.75  ? 251  THR A C   1 
ATOM   1917  O  O   . THR A  1 251 ? -39.706 146.813 142.918 1.00 27.92  ? 251  THR A O   1 
ATOM   1918  C  CB  . THR A  1 251 ? -40.241 148.950 145.001 1.00 33.96  ? 251  THR A CB  1 
ATOM   1919  O  OG1 . THR A  1 251 ? -40.676 150.275 145.337 1.00 36.30  ? 251  THR A OG1 1 
ATOM   1920  C  CG2 . THR A  1 251 ? -39.530 148.309 146.170 1.00 30.39  ? 251  THR A CG2 1 
ATOM   1921  N  N   . GLN A  1 252 ? -37.629 147.294 143.670 1.00 31.08  ? 252  GLN A N   1 
ATOM   1922  C  CA  . GLN A  1 252 ? -37.132 145.949 143.424 1.00 29.98  ? 252  GLN A CA  1 
ATOM   1923  C  C   . GLN A  1 252 ? -37.265 145.106 144.676 1.00 31.59  ? 252  GLN A C   1 
ATOM   1924  O  O   . GLN A  1 252 ? -36.862 145.530 145.764 1.00 30.67  ? 252  GLN A O   1 
ATOM   1925  C  CB  . GLN A  1 252 ? -35.668 145.959 142.986 1.00 34.80  ? 252  GLN A CB  1 
ATOM   1926  C  CG  . GLN A  1 252 ? -35.104 144.556 142.842 1.00 30.81  ? 252  GLN A CG  1 
ATOM   1927  C  CD  . GLN A  1 252 ? -33.642 144.580 142.493 1.00 33.88  ? 252  GLN A CD  1 
ATOM   1928  O  OE1 . GLN A  1 252 ? -32.843 145.139 143.231 1.00 30.93  ? 252  GLN A OE1 1 
ATOM   1929  N  NE2 . GLN A  1 252 ? -33.285 143.994 141.356 1.00 32.80  ? 252  GLN A NE2 1 
ATOM   1930  N  N   . TYR A  1 253 ? -37.813 143.908 144.517 1.00 30.52  ? 253  TYR A N   1 
ATOM   1931  C  CA  . TYR A  1 253 ? -37.772 142.883 145.549 1.00 29.77  ? 253  TYR A CA  1 
ATOM   1932  C  C   . TYR A  1 253 ? -36.995 141.690 145.031 1.00 31.31  ? 253  TYR A C   1 
ATOM   1933  O  O   . TYR A  1 253 ? -37.228 141.244 143.900 1.00 30.27  ? 253  TYR A O   1 
ATOM   1934  C  CB  . TYR A  1 253 ? -39.179 142.432 145.950 1.00 29.84  ? 253  TYR A CB  1 
ATOM   1935  C  CG  . TYR A  1 253 ? -39.967 143.432 146.785 1.00 25.33  ? 253  TYR A CG  1 
ATOM   1936  C  CD1 . TYR A  1 253 ? -40.638 144.486 146.195 1.00 26.71  ? 253  TYR A CD1 1 
ATOM   1937  C  CD2 . TYR A  1 253 ? -40.070 143.282 148.166 1.00 26.43  ? 253  TYR A CD2 1 
ATOM   1938  C  CE1 . TYR A  1 253 ? -41.379 145.393 146.964 1.00 31.08  ? 253  TYR A CE1 1 
ATOM   1939  C  CE2 . TYR A  1 253 ? -40.811 144.177 148.949 1.00 28.61  ? 253  TYR A CE2 1 
ATOM   1940  C  CZ  . TYR A  1 253 ? -41.458 145.230 148.343 1.00 34.23  ? 253  TYR A CZ  1 
ATOM   1941  O  OH  . TYR A  1 253 ? -42.205 146.094 149.116 1.00 33.17  ? 253  TYR A OH  1 
ATOM   1942  N  N   . LEU A  1 254 ? -36.090 141.167 145.858 1.00 29.72  ? 254  LEU A N   1 
ATOM   1943  C  CA  . LEU A  1 254 ? -35.404 139.911 145.583 1.00 24.24  ? 254  LEU A CA  1 
ATOM   1944  C  C   . LEU A  1 254 ? -35.986 138.838 146.481 1.00 33.74  ? 254  LEU A C   1 
ATOM   1945  O  O   . LEU A  1 254 ? -35.960 138.974 147.709 1.00 33.24  ? 254  LEU A O   1 
ATOM   1946  C  CB  . LEU A  1 254 ? -33.906 140.024 145.823 1.00 22.87  ? 254  LEU A CB  1 
ATOM   1947  C  CG  . LEU A  1 254 ? -33.258 141.032 144.895 1.00 25.94  ? 254  LEU A CG  1 
ATOM   1948  C  CD1 . LEU A  1 254 ? -31.738 141.013 145.087 1.00 23.09  ? 254  LEU A CD1 1 
ATOM   1949  C  CD2 . LEU A  1 254 ? -33.638 140.671 143.471 1.00 21.96  ? 254  LEU A CD2 1 
ATOM   1950  N  N   . VAL A  1 255 ? -36.496 137.772 145.874 1.00 31.45  ? 255  VAL A N   1 
ATOM   1951  C  CA  . VAL A  1 255 ? -37.060 136.659 146.621 1.00 32.21  ? 255  VAL A CA  1 
ATOM   1952  C  C   . VAL A  1 255 ? -36.006 135.557 146.680 1.00 26.71  ? 255  VAL A C   1 
ATOM   1953  O  O   . VAL A  1 255 ? -35.723 134.893 145.679 1.00 27.72  ? 255  VAL A O   1 
ATOM   1954  C  CB  . VAL A  1 255 ? -38.373 136.180 145.991 1.00 31.47  ? 255  VAL A CB  1 
ATOM   1955  C  CG1 . VAL A  1 255 ? -38.870 134.913 146.698 1.00 28.28  ? 255  VAL A CG1 1 
ATOM   1956  C  CG2 . VAL A  1 255 ? -39.421 137.309 146.062 1.00 27.78  ? 255  VAL A CG2 1 
ATOM   1957  N  N   . HIS A  1 256 ? -35.445 135.345 147.867 1.00 30.53  ? 256  HIS A N   1 
ATOM   1958  C  CA  . HIS A  1 256 ? -34.342 134.409 148.087 1.00 29.08  ? 256  HIS A CA  1 
ATOM   1959  C  C   . HIS A  1 256 ? -34.933 133.085 148.566 1.00 28.26  ? 256  HIS A C   1 
ATOM   1960  O  O   . HIS A  1 256 ? -35.614 133.054 149.592 1.00 29.81  ? 256  HIS A O   1 
ATOM   1961  C  CB  . HIS A  1 256 ? -33.379 135.022 149.106 1.00 24.19  ? 256  HIS A CB  1 
ATOM   1962  C  CG  . HIS A  1 256 ? -32.324 134.096 149.638 1.00 30.71  ? 256  HIS A CG  1 
ATOM   1963  N  ND1 . HIS A  1 256 ? -30.979 134.364 149.511 1.00 30.17  ? 256  HIS A ND1 1 
ATOM   1964  C  CD2 . HIS A  1 256 ? -32.411 132.972 150.388 1.00 30.52  ? 256  HIS A CD2 1 
ATOM   1965  C  CE1 . HIS A  1 256 ? -30.281 133.422 150.117 1.00 27.71  ? 256  HIS A CE1 1 
ATOM   1966  N  NE2 . HIS A  1 256 ? -31.127 132.569 150.666 1.00 33.59  ? 256  HIS A NE2 1 
ATOM   1967  N  N   . ILE A  1 257 ? -34.740 132.014 147.794 1.00 29.21  ? 257  ILE A N   1 
ATOM   1968  C  CA  . ILE A  1 257 ? -35.279 130.701 148.152 1.00 29.24  ? 257  ILE A CA  1 
ATOM   1969  C  C   . ILE A  1 257 ? -34.168 129.664 148.105 1.00 30.62  ? 257  ILE A C   1 
ATOM   1970  O  O   . ILE A  1 257 ? -33.473 129.529 147.091 1.00 27.69  ? 257  ILE A O   1 
ATOM   1971  C  CB  . ILE A  1 257 ? -36.432 130.266 147.231 1.00 26.13  ? 257  ILE A CB  1 
ATOM   1972  C  CG1 . ILE A  1 257 ? -37.404 131.431 146.987 1.00 33.34  ? 257  ILE A CG1 1 
ATOM   1973  C  CG2 . ILE A  1 257 ? -37.154 129.079 147.860 1.00 28.47  ? 257  ILE A CG2 1 
ATOM   1974  C  CD1 . ILE A  1 257 ? -38.466 131.123 145.971 1.00 33.68  ? 257  ILE A CD1 1 
ATOM   1975  N  N   . GLU A  1 258 ? -34.050 128.888 149.174 1.00 28.01  ? 258  GLU A N   1 
ATOM   1976  C  CA  . GLU A  1 258 ? -33.056 127.837 149.261 1.00 26.91  ? 258  GLU A CA  1 
ATOM   1977  C  C   . GLU A  1 258 ? -33.726 126.491 149.053 1.00 31.16  ? 258  GLU A C   1 
ATOM   1978  O  O   . GLU A  1 258 ? -34.856 126.261 149.508 1.00 28.70  ? 258  GLU A O   1 
ATOM   1979  C  CB  . GLU A  1 258 ? -32.321 127.883 150.603 1.00 26.82  ? 258  GLU A CB  1 
ATOM   1980  C  CG  . GLU A  1 258 ? -31.773 129.262 150.851 1.00 33.11  ? 258  GLU A CG  1 
ATOM   1981  C  CD  . GLU A  1 258 ? -30.736 129.361 151.955 1.00 33.20  ? 258  GLU A CD  1 
ATOM   1982  O  OE1 . GLU A  1 258 ? -30.102 130.427 152.012 1.00 33.69  ? 258  GLU A OE1 1 
ATOM   1983  O  OE2 . GLU A  1 258 ? -30.545 128.415 152.751 1.00 32.06  ? 258  GLU A OE2 1 
ATOM   1984  N  N   . TRP A  1 259 ? -33.032 125.627 148.318 1.00 29.34  ? 259  TRP A N   1 
ATOM   1985  C  CA  . TRP A  1 259 ? -33.543 124.331 147.909 1.00 30.66  ? 259  TRP A CA  1 
ATOM   1986  C  C   . TRP A  1 259 ? -32.451 123.290 148.090 1.00 30.00  ? 259  TRP A C   1 
ATOM   1987  O  O   . TRP A  1 259 ? -31.256 123.602 148.040 1.00 29.89  ? 259  TRP A O   1 
ATOM   1988  C  CB  . TRP A  1 259 ? -33.989 124.338 146.441 1.00 21.98  ? 259  TRP A CB  1 
ATOM   1989  C  CG  . TRP A  1 259 ? -35.093 125.291 146.119 1.00 36.24  ? 259  TRP A CG  1 
ATOM   1990  C  CD1 . TRP A  1 259 ? -34.965 126.580 145.693 1.00 36.42  ? 259  TRP A CD1 1 
ATOM   1991  C  CD2 . TRP A  1 259 ? -36.500 125.026 146.173 1.00 32.52  ? 259  TRP A CD2 1 
ATOM   1992  N  NE1 . TRP A  1 259 ? -36.200 127.137 145.477 1.00 36.99  ? 259  TRP A NE1 1 
ATOM   1993  C  CE2 . TRP A  1 259 ? -37.164 126.205 145.765 1.00 40.41  ? 259  TRP A CE2 1 
ATOM   1994  C  CE3 . TRP A  1 259 ? -37.264 123.918 146.545 1.00 28.39  ? 259  TRP A CE3 1 
ATOM   1995  C  CZ2 . TRP A  1 259 ? -38.570 126.305 145.712 1.00 35.05  ? 259  TRP A CZ2 1 
ATOM   1996  C  CZ3 . TRP A  1 259 ? -38.672 124.015 146.479 1.00 32.13  ? 259  TRP A CZ3 1 
ATOM   1997  C  CH2 . TRP A  1 259 ? -39.300 125.200 146.058 1.00 28.27  ? 259  TRP A CH2 1 
ATOM   1998  N  N   . GLU A  1 260 ? -32.876 122.033 148.224 1.00 27.55  ? 260  GLU A N   1 
ATOM   1999  C  CA  . GLU A  1 260 ? -31.921 120.943 148.404 1.00 27.14  ? 260  GLU A CA  1 
ATOM   2000  C  C   . GLU A  1 260 ? -30.933 120.850 147.246 1.00 35.04  ? 260  GLU A C   1 
ATOM   2001  O  O   . GLU A  1 260 ? -29.751 120.550 147.460 1.00 29.64  ? 260  GLU A O   1 
ATOM   2002  C  CB  . GLU A  1 260 ? -32.654 119.615 148.566 1.00 32.56  ? 260  GLU A CB  1 
ATOM   2003  C  CG  . GLU A  1 260 ? -31.702 118.412 148.634 1.00 30.14  ? 260  GLU A CG  1 
ATOM   2004  C  CD  . GLU A  1 260 ? -32.390 117.119 149.034 1.00 31.36  ? 260  GLU A CD  1 
ATOM   2005  O  OE1 . GLU A  1 260 ? -32.139 116.100 148.371 1.00 33.61  ? 260  GLU A OE1 1 
ATOM   2006  O  OE2 . GLU A  1 260 ? -33.153 117.108 150.031 1.00 29.94  ? 260  GLU A OE2 1 
ATOM   2007  N  N   . SER A  1 261 ? -31.399 121.081 146.019 1.00 27.35  ? 261  SER A N   1 
ATOM   2008  C  CA  . SER A  1 261 ? -30.612 120.823 144.817 1.00 32.04  ? 261  SER A CA  1 
ATOM   2009  C  C   . SER A  1 261 ? -31.206 121.646 143.679 1.00 27.69  ? 261  SER A C   1 
ATOM   2010  O  O   . SER A  1 261 ? -32.316 122.168 143.802 1.00 27.29  ? 261  SER A O   1 
ATOM   2011  C  CB  . SER A  1 261 ? -30.627 119.329 144.461 1.00 33.58  ? 261  SER A CB  1 
ATOM   2012  O  OG  . SER A  1 261 ? -31.895 118.978 143.904 1.00 32.88  ? 261  SER A OG  1 
ATOM   2013  N  N   . PRO A  1 262 ? -30.496 121.778 142.554 1.00 29.82  ? 262  PRO A N   1 
ATOM   2014  C  CA  . PRO A  1 262 ? -31.106 122.495 141.416 1.00 34.05  ? 262  PRO A CA  1 
ATOM   2015  C  C   . PRO A  1 262 ? -32.385 121.836 140.910 1.00 32.90  ? 262  PRO A C   1 
ATOM   2016  O  O   . PRO A  1 262 ? -33.325 122.541 140.529 1.00 32.88  ? 262  PRO A O   1 
ATOM   2017  C  CB  . PRO A  1 262 ? -29.989 122.504 140.359 1.00 32.18  ? 262  PRO A CB  1 
ATOM   2018  C  CG  . PRO A  1 262 ? -28.702 122.403 141.185 1.00 33.46  ? 262  PRO A CG  1 
ATOM   2019  C  CD  . PRO A  1 262 ? -29.076 121.456 142.309 1.00 32.92  ? 262  PRO A CD  1 
ATOM   2020  N  N   . GLU A  1 263 ? -32.456 120.502 140.933 1.00 33.49  ? 263  GLU A N   1 
ATOM   2021  C  CA  . GLU A  1 263 ? -33.656 119.788 140.491 1.00 28.68  ? 263  GLU A CA  1 
ATOM   2022  C  C   . GLU A  1 263 ? -34.851 120.083 141.402 1.00 29.82  ? 263  GLU A C   1 
ATOM   2023  O  O   . GLU A  1 263 ? -35.969 120.306 140.916 1.00 29.60  ? 263  GLU A O   1 
ATOM   2024  C  CB  . GLU A  1 263 ? -33.371 118.286 140.429 1.00 35.04  ? 263  GLU A CB  1 
ATOM   2025  C  CG  . GLU A  1 263 ? -32.252 117.867 139.433 1.00 54.02  ? 263  GLU A CG  1 
ATOM   2026  C  CD  . GLU A  1 263 ? -30.777 118.215 139.857 1.00 56.82  ? 263  GLU A CD  1 
ATOM   2027  O  OE1 . GLU A  1 263 ? -30.450 118.343 141.058 1.00 44.07  ? 263  GLU A OE1 1 
ATOM   2028  O  OE2 . GLU A  1 263 ? -29.932 118.371 138.946 1.00 60.36  ? 263  GLU A OE2 1 
ATOM   2029  N  N   . HIS A  1 264 ? -34.641 120.105 142.725 1.00 28.25  ? 264  HIS A N   1 
ATOM   2030  C  CA  . HIS A  1 264 ? -35.730 120.468 143.628 1.00 32.14  ? 264  HIS A CA  1 
ATOM   2031  C  C   . HIS A  1 264 ? -36.168 121.909 143.406 1.00 32.57  ? 264  HIS A C   1 
ATOM   2032  O  O   . HIS A  1 264 ? -37.361 122.222 143.508 1.00 28.18  ? 264  HIS A O   1 
ATOM   2033  C  CB  . HIS A  1 264 ? -35.304 120.263 145.076 1.00 34.30  ? 264  HIS A CB  1 
ATOM   2034  C  CG  . HIS A  1 264 ? -35.103 118.828 145.426 1.00 33.72  ? 264  HIS A CG  1 
ATOM   2035  N  ND1 . HIS A  1 264 ? -33.868 118.223 145.379 1.00 35.37  ? 264  HIS A ND1 1 
ATOM   2036  C  CD2 . HIS A  1 264 ? -35.985 117.865 145.780 1.00 35.09  ? 264  HIS A CD2 1 
ATOM   2037  C  CE1 . HIS A  1 264 ? -33.994 116.949 145.710 1.00 39.73  ? 264  HIS A CE1 1 
ATOM   2038  N  NE2 . HIS A  1 264 ? -35.268 116.708 145.958 1.00 34.04  ? 264  HIS A NE2 1 
ATOM   2039  N  N   . ALA A  1 265 ? -35.209 122.801 143.118 1.00 28.38  ? 265  ALA A N   1 
ATOM   2040  C  CA  . ALA A  1 265 ? -35.529 124.205 142.849 1.00 31.06  ? 265  ALA A CA  1 
ATOM   2041  C  C   . ALA A  1 265 ? -36.360 124.349 141.577 1.00 36.17  ? 265  ALA A C   1 
ATOM   2042  O  O   . ALA A  1 265 ? -37.333 125.120 141.532 1.00 28.93  ? 265  ALA A O   1 
ATOM   2043  C  CB  . ALA A  1 265 ? -34.233 125.023 142.728 1.00 28.43  ? 265  ALA A CB  1 
ATOM   2044  N  N   . HIS A  1 266 ? -35.951 123.652 140.515 1.00 26.86  ? 266  HIS A N   1 
ATOM   2045  C  CA  . HIS A  1 266 ? -36.642 123.760 139.236 1.00 30.82  ? 266  HIS A CA  1 
ATOM   2046  C  C   . HIS A  1 266 ? -38.065 123.238 139.347 1.00 33.48  ? 266  HIS A C   1 
ATOM   2047  O  O   . HIS A  1 266 ? -39.036 123.931 139.000 1.00 35.79  ? 266  HIS A O   1 
ATOM   2048  C  CB  . HIS A  1 266 ? -35.869 122.996 138.158 1.00 27.08  ? 266  HIS A CB  1 
ATOM   2049  C  CG  . HIS A  1 266 ? -36.505 123.063 136.807 1.00 41.10  ? 266  HIS A CG  1 
ATOM   2050  N  ND1 . HIS A  1 266 ? -36.945 121.943 136.128 1.00 45.41  ? 266  HIS A ND1 1 
ATOM   2051  C  CD2 . HIS A  1 266 ? -36.802 124.123 136.018 1.00 38.96  ? 266  HIS A CD2 1 
ATOM   2052  C  CE1 . HIS A  1 266 ? -37.467 122.315 134.973 1.00 47.02  ? 266  HIS A CE1 1 
ATOM   2053  N  NE2 . HIS A  1 266 ? -37.389 123.632 134.881 1.00 41.92  ? 266  HIS A NE2 1 
ATOM   2054  N  N   . GLN A  1 267 ? -38.202 122.017 139.853 1.00 27.98  ? 267  GLN A N   1 
ATOM   2055  C  CA  . GLN A  1 267 ? -39.518 121.432 140.040 1.00 32.85  ? 267  GLN A CA  1 
ATOM   2056  C  C   . GLN A  1 267 ? -40.313 122.216 141.082 1.00 37.25  ? 267  GLN A C   1 
ATOM   2057  O  O   . GLN A  1 267 ? -41.531 122.393 140.951 1.00 30.95  ? 267  GLN A O   1 
ATOM   2058  C  CB  . GLN A  1 267 ? -39.350 119.964 140.451 1.00 33.85  ? 267  GLN A CB  1 
ATOM   2059  C  CG  . GLN A  1 267 ? -40.633 119.152 140.516 1.00 58.79  ? 267  GLN A CG  1 
ATOM   2060  C  CD  . GLN A  1 267 ? -40.413 117.653 140.262 1.00 63.62  ? 267  GLN A CD  1 
ATOM   2061  O  OE1 . GLN A  1 267 ? -41.353 116.931 139.937 1.00 58.04  ? 267  GLN A OE1 1 
ATOM   2062  N  NE2 . GLN A  1 267 ? -39.172 117.187 140.427 1.00 63.18  ? 267  GLN A NE2 1 
ATOM   2063  N  N   . GLY A  1 268 ? -39.633 122.719 142.111 1.00 31.03  ? 268  GLY A N   1 
ATOM   2064  C  CA  . GLY A  1 268 ? -40.339 123.396 143.178 1.00 32.49  ? 268  GLY A CA  1 
ATOM   2065  C  C   . GLY A  1 268 ? -40.942 124.707 142.724 1.00 38.92  ? 268  GLY A C   1 
ATOM   2066  O  O   . GLY A  1 268 ? -42.140 124.945 142.907 1.00 41.06  ? 268  GLY A O   1 
ATOM   2067  N  N   . LEU A  1 269 ? -40.134 125.550 142.072 1.00 36.48  ? 269  LEU A N   1 
ATOM   2068  C  CA  . LEU A  1 269 ? -40.655 126.823 141.575 1.00 36.53  ? 269  LEU A CA  1 
ATOM   2069  C  C   . LEU A  1 269 ? -41.798 126.611 140.592 1.00 32.30  ? 269  LEU A C   1 
ATOM   2070  O  O   . LEU A  1 269 ? -42.741 127.406 140.566 1.00 33.18  ? 269  LEU A O   1 
ATOM   2071  C  CB  . LEU A  1 269 ? -39.528 127.634 140.918 1.00 26.71  ? 269  LEU A CB  1 
ATOM   2072  C  CG  . LEU A  1 269 ? -38.490 128.299 141.835 1.00 38.43  ? 269  LEU A CG  1 
ATOM   2073  C  CD1 . LEU A  1 269 ? -37.289 128.797 141.050 1.00 41.93  ? 269  LEU A CD1 1 
ATOM   2074  C  CD2 . LEU A  1 269 ? -39.108 129.481 142.540 1.00 38.66  ? 269  LEU A CD2 1 
ATOM   2075  N  N   . GLY A  1 270 ? -41.762 125.516 139.822 1.00 32.67  ? 270  GLY A N   1 
ATOM   2076  C  CA  . GLY A  1 270 ? -42.805 125.233 138.848 1.00 29.47  ? 270  GLY A CA  1 
ATOM   2077  C  C   . GLY A  1 270 ? -44.184 125.005 139.452 1.00 33.27  ? 270  GLY A C   1 
ATOM   2078  O  O   . GLY A  1 270 ? -45.183 125.082 138.730 1.00 30.49  ? 270  GLY A O   1 
ATOM   2079  N  N   . HIS A  1 271 ? -44.263 124.737 140.762 1.00 33.12  ? 271  HIS A N   1 
ATOM   2080  C  CA  . HIS A  1 271 ? -45.558 124.522 141.397 1.00 30.46  ? 271  HIS A CA  1 
ATOM   2081  C  C   . HIS A  1 271 ? -46.450 125.757 141.317 1.00 33.11  ? 271  HIS A C   1 
ATOM   2082  O  O   . HIS A  1 271 ? -47.674 125.613 141.368 1.00 37.20  ? 271  HIS A O   1 
ATOM   2083  C  CB  . HIS A  1 271 ? -45.393 124.124 142.874 1.00 28.55  ? 271  HIS A CB  1 
ATOM   2084  C  CG  . HIS A  1 271 ? -45.152 122.660 143.108 1.00 32.18  ? 271  HIS A CG  1 
ATOM   2085  N  ND1 . HIS A  1 271 ? -44.051 121.988 142.619 1.00 38.13  ? 271  HIS A ND1 1 
ATOM   2086  C  CD2 . HIS A  1 271 ? -45.865 121.745 143.809 1.00 38.44  ? 271  HIS A CD2 1 
ATOM   2087  C  CE1 . HIS A  1 271 ? -44.107 120.719 142.990 1.00 38.74  ? 271  HIS A CE1 1 
ATOM   2088  N  NE2 . HIS A  1 271 ? -45.200 120.544 143.714 1.00 40.04  ? 271  HIS A NE2 1 
ATOM   2089  N  N   . VAL A  1 272 ? -45.888 126.967 141.182 1.00 35.36  ? 272  VAL A N   1 
ATOM   2090  C  CA  . VAL A  1 272 ? -46.767 128.130 141.035 1.00 36.18  ? 272  VAL A CA  1 
ATOM   2091  C  C   . VAL A  1 272 ? -47.518 128.088 139.723 1.00 38.38  ? 272  VAL A C   1 
ATOM   2092  O  O   . VAL A  1 272 ? -48.448 128.865 139.529 1.00 38.22  ? 272  VAL A O   1 
ATOM   2093  C  CB  . VAL A  1 272 ? -46.058 129.497 141.142 1.00 30.15  ? 272  VAL A CB  1 
ATOM   2094  C  CG1 . VAL A  1 272 ? -45.329 129.621 142.466 1.00 34.95  ? 272  VAL A CG1 1 
ATOM   2095  C  CG2 . VAL A  1 272 ? -45.111 129.760 139.947 1.00 25.24  ? 272  VAL A CG2 1 
ATOM   2096  N  N   . MET A  1 273 ? -47.161 127.172 138.833 1.00 38.66  ? 273  MET A N   1 
ATOM   2097  C  CA  . MET A  1 273 ? -47.907 127.010 137.606 1.00 40.45  ? 273  MET A CA  1 
ATOM   2098  C  C   . MET A  1 273 ? -48.671 125.703 137.529 1.00 45.32  ? 273  MET A C   1 
ATOM   2099  O  O   . MET A  1 273 ? -49.701 125.673 136.858 1.00 37.58  ? 273  MET A O   1 
ATOM   2100  C  CB  . MET A  1 273 ? -46.987 127.146 136.389 1.00 44.84  ? 273  MET A CB  1 
ATOM   2101  C  CG  . MET A  1 273 ? -46.462 128.569 136.215 1.00 58.22  ? 273  MET A CG  1 
ATOM   2102  S  SD  . MET A  1 273 ? -45.478 128.790 134.723 1.00 71.02  ? 273  MET A SD  1 
ATOM   2103  C  CE  . MET A  1 273 ? -44.062 127.743 135.059 1.00 65.44  ? 273  MET A CE  1 
ATOM   2104  N  N   . VAL A  1 274 ? -48.221 124.634 138.201 1.00 42.26  ? 274  VAL A N   1 
ATOM   2105  C  CA  . VAL A  1 274 ? -48.843 123.314 138.038 1.00 38.06  ? 274  VAL A CA  1 
ATOM   2106  C  C   . VAL A  1 274 ? -49.609 122.842 139.272 1.00 39.83  ? 274  VAL A C   1 
ATOM   2107  O  O   . VAL A  1 274 ? -50.126 121.714 139.262 1.00 43.75  ? 274  VAL A O   1 
ATOM   2108  C  CB  . VAL A  1 274 ? -47.825 122.243 137.593 1.00 39.13  ? 274  VAL A CB  1 
ATOM   2109  C  CG1 . VAL A  1 274 ? -47.262 122.582 136.209 1.00 33.21  ? 274  VAL A CG1 1 
ATOM   2110  C  CG2 . VAL A  1 274 ? -46.689 122.109 138.607 1.00 29.18  ? 274  VAL A CG2 1 
ATOM   2111  N  N   . ASP A  1 275 ? -49.719 123.653 140.319 1.00 29.48  ? 275  ASP A N   1 
ATOM   2112  C  CA  . ASP A  1 275 ? -50.654 123.383 141.413 1.00 38.04  ? 275  ASP A CA  1 
ATOM   2113  C  C   . ASP A  1 275 ? -51.730 124.462 141.383 1.00 35.46  ? 275  ASP A C   1 
ATOM   2114  O  O   . ASP A  1 275 ? -51.412 125.653 141.405 1.00 34.86  ? 275  ASP A O   1 
ATOM   2115  C  CB  . ASP A  1 275 ? -49.958 123.349 142.775 1.00 33.83  ? 275  ASP A CB  1 
ATOM   2116  C  CG  . ASP A  1 275 ? -50.930 123.079 143.925 1.00 42.16  ? 275  ASP A CG  1 
ATOM   2117  O  OD1 . ASP A  1 275 ? -51.703 123.990 144.324 1.00 38.73  ? 275  ASP A OD1 1 
ATOM   2118  O  OD2 . ASP A  1 275 ? -50.925 121.940 144.433 1.00 45.24  ? 275  ASP A OD2 1 
ATOM   2119  N  N   . TYR A  1 276 ? -52.992 124.046 141.273 1.00 38.65  ? 276  TYR A N   1 
ATOM   2120  C  CA  . TYR A  1 276 ? -54.073 125.010 141.089 1.00 41.68  ? 276  TYR A CA  1 
ATOM   2121  C  C   . TYR A  1 276 ? -54.131 126.012 142.244 1.00 41.07  ? 276  TYR A C   1 
ATOM   2122  O  O   . TYR A  1 276 ? -54.270 127.224 142.037 1.00 45.14  ? 276  TYR A O   1 
ATOM   2123  C  CB  . TYR A  1 276 ? -55.416 124.276 140.942 1.00 36.16  ? 276  TYR A CB  1 
ATOM   2124  C  CG  . TYR A  1 276 ? -56.568 125.249 140.836 1.00 39.25  ? 276  TYR A CG  1 
ATOM   2125  C  CD1 . TYR A  1 276 ? -56.920 125.796 139.602 1.00 41.86  ? 276  TYR A CD1 1 
ATOM   2126  C  CD2 . TYR A  1 276 ? -57.280 125.646 141.963 1.00 35.00  ? 276  TYR A CD2 1 
ATOM   2127  C  CE1 . TYR A  1 276 ? -57.948 126.710 139.488 1.00 47.05  ? 276  TYR A CE1 1 
ATOM   2128  C  CE2 . TYR A  1 276 ? -58.323 126.578 141.860 1.00 38.71  ? 276  TYR A CE2 1 
ATOM   2129  C  CZ  . TYR A  1 276 ? -58.640 127.106 140.619 1.00 46.54  ? 276  TYR A CZ  1 
ATOM   2130  O  OH  . TYR A  1 276 ? -59.661 128.011 140.481 1.00 58.25  ? 276  TYR A OH  1 
ATOM   2131  N  N   . GLU A  1 277 ? -54.043 125.516 143.471 1.00 38.44  ? 277  GLU A N   1 
ATOM   2132  C  CA  . GLU A  1 277 ? -54.213 126.380 144.631 1.00 40.88  ? 277  GLU A CA  1 
ATOM   2133  C  C   . GLU A  1 277 ? -53.067 127.386 144.745 1.00 38.16  ? 277  GLU A C   1 
ATOM   2134  O  O   . GLU A  1 277 ? -53.300 128.585 144.923 1.00 34.63  ? 277  GLU A O   1 
ATOM   2135  C  CB  . GLU A  1 277 ? -54.336 125.512 145.881 1.00 43.04  ? 277  GLU A CB  1 
ATOM   2136  C  CG  . GLU A  1 277 ? -54.487 126.253 147.190 1.00 51.13  ? 277  GLU A CG  1 
ATOM   2137  C  CD  . GLU A  1 277 ? -54.638 125.287 148.358 1.00 55.87  ? 277  GLU A CD  1 
ATOM   2138  O  OE1 . GLU A  1 277 ? -53.615 124.776 148.875 1.00 51.30  ? 277  GLU A OE1 1 
ATOM   2139  O  OE2 . GLU A  1 277 ? -55.793 125.011 148.739 1.00 56.31  ? 277  GLU A OE2 1 
ATOM   2140  N  N   . LEU A  1 278 ? -51.818 126.917 144.637 1.00 28.71  ? 278  LEU A N   1 
ATOM   2141  C  CA  . LEU A  1 278 ? -50.683 127.834 144.692 1.00 31.06  ? 278  LEU A CA  1 
ATOM   2142  C  C   . LEU A  1 278 ? -50.708 128.812 143.530 1.00 33.13  ? 278  LEU A C   1 
ATOM   2143  O  O   . LEU A  1 278 ? -50.315 129.978 143.676 1.00 31.81  ? 278  LEU A O   1 
ATOM   2144  C  CB  . LEU A  1 278 ? -49.374 127.057 144.696 1.00 30.63  ? 278  LEU A CB  1 
ATOM   2145  C  CG  . LEU A  1 278 ? -48.132 127.955 144.809 1.00 33.35  ? 278  LEU A CG  1 
ATOM   2146  C  CD1 . LEU A  1 278 ? -48.151 128.756 146.106 1.00 31.77  ? 278  LEU A CD1 1 
ATOM   2147  C  CD2 . LEU A  1 278 ? -46.849 127.116 144.714 1.00 36.01  ? 278  LEU A CD2 1 
ATOM   2148  N  N   . ARG A  1 279 ? -51.160 128.345 142.364 1.00 31.83  ? 279  ARG A N   1 
ATOM   2149  C  CA  . ARG A  1 279 ? -51.265 129.212 141.198 1.00 34.96  ? 279  ARG A CA  1 
ATOM   2150  C  C   . ARG A  1 279 ? -52.174 130.419 141.456 1.00 37.66  ? 279  ARG A C   1 
ATOM   2151  O  O   . ARG A  1 279 ? -51.830 131.542 141.075 1.00 33.75  ? 279  ARG A O   1 
ATOM   2152  C  CB  . ARG A  1 279 ? -51.749 128.387 140.015 1.00 33.50  ? 279  ARG A CB  1 
ATOM   2153  C  CG  . ARG A  1 279 ? -52.004 129.131 138.731 1.00 32.33  ? 279  ARG A CG  1 
ATOM   2154  C  CD  . ARG A  1 279 ? -52.044 128.105 137.640 1.00 38.78  ? 279  ARG A CD  1 
ATOM   2155  N  NE  . ARG A  1 279 ? -52.737 128.525 136.437 1.00 39.94  ? 279  ARG A NE  1 
ATOM   2156  C  CZ  . ARG A  1 279 ? -52.595 127.918 135.263 1.00 39.06  ? 279  ARG A CZ  1 
ATOM   2157  N  NH1 . ARG A  1 279 ? -51.758 126.894 135.145 1.00 31.06  ? 279  ARG A NH1 1 
ATOM   2158  N  NH2 . ARG A  1 279 ? -53.277 128.333 134.209 1.00 39.96  ? 279  ARG A NH2 1 
ATOM   2159  N  N   . GLN A  1 280 ? -53.320 130.215 142.126 1.00 34.22  ? 280  GLN A N   1 
ATOM   2160  C  CA  . GLN A  1 280 ? -54.201 131.344 142.439 1.00 37.51  ? 280  GLN A CA  1 
ATOM   2161  C  C   . GLN A  1 280 ? -53.528 132.314 143.402 1.00 37.37  ? 280  GLN A C   1 
ATOM   2162  O  O   . GLN A  1 280 ? -53.582 133.532 143.206 1.00 39.84  ? 280  GLN A O   1 
ATOM   2163  C  CB  . GLN A  1 280 ? -55.516 130.855 143.057 1.00 34.76  ? 280  GLN A CB  1 
ATOM   2164  C  CG  . GLN A  1 280 ? -56.271 129.804 142.261 1.00 37.78  ? 280  GLN A CG  1 
ATOM   2165  C  CD  . GLN A  1 280 ? -56.308 130.115 140.794 1.00 43.90  ? 280  GLN A CD  1 
ATOM   2166  O  OE1 . GLN A  1 280 ? -56.753 131.182 140.400 1.00 47.26  ? 280  GLN A OE1 1 
ATOM   2167  N  NE2 . GLN A  1 280 ? -55.844 129.178 139.969 1.00 46.29  ? 280  GLN A NE2 1 
ATOM   2168  N  N   . ILE A  1 281 ? -52.885 131.781 144.443 1.00 35.76  ? 281  ILE A N   1 
ATOM   2169  C  CA  . ILE A  1 281 ? -52.176 132.606 145.417 1.00 37.81  ? 281  ILE A CA  1 
ATOM   2170  C  C   . ILE A  1 281 ? -51.096 133.430 144.728 1.00 35.26  ? 281  ILE A C   1 
ATOM   2171  O  O   . ILE A  1 281 ? -51.012 134.649 144.911 1.00 38.48  ? 281  ILE A O   1 
ATOM   2172  C  CB  . ILE A  1 281 ? -51.575 131.714 146.517 1.00 32.51  ? 281  ILE A CB  1 
ATOM   2173  C  CG1 . ILE A  1 281 ? -52.688 131.050 147.343 1.00 35.95  ? 281  ILE A CG1 1 
ATOM   2174  C  CG2 . ILE A  1 281 ? -50.545 132.486 147.361 1.00 28.55  ? 281  ILE A CG2 1 
ATOM   2175  C  CD1 . ILE A  1 281 ? -52.203 129.916 148.228 1.00 38.96  ? 281  ILE A CD1 1 
ATOM   2176  N  N   . HIS A  1 282 ? -50.283 132.783 143.888 1.00 30.00  ? 282  HIS A N   1 
ATOM   2177  C  CA  . HIS A  1 282 ? -49.159 133.480 143.263 1.00 33.46  ? 282  HIS A CA  1 
ATOM   2178  C  C   . HIS A  1 282 ? -49.646 134.433 142.177 1.00 30.70  ? 282  HIS A C   1 
ATOM   2179  O  O   . HIS A  1 282 ? -49.160 135.564 142.080 1.00 30.00  ? 282  HIS A O   1 
ATOM   2180  C  CB  . HIS A  1 282 ? -48.149 132.463 142.694 1.00 32.12  ? 282  HIS A CB  1 
ATOM   2181  C  CG  . HIS A  1 282 ? -46.875 133.076 142.162 1.00 26.14  ? 282  HIS A CG  1 
ATOM   2182  N  ND1 . HIS A  1 282 ? -46.547 133.074 140.820 1.00 30.92  ? 282  HIS A ND1 1 
ATOM   2183  C  CD2 . HIS A  1 282 ? -45.836 133.670 142.796 1.00 26.98  ? 282  HIS A CD2 1 
ATOM   2184  C  CE1 . HIS A  1 282 ? -45.367 133.647 140.647 1.00 28.72  ? 282  HIS A CE1 1 
ATOM   2185  N  NE2 . HIS A  1 282 ? -44.917 134.029 141.831 1.00 32.70  ? 282  HIS A NE2 1 
ATOM   2186  N  N   . ASN A  1 283 ? -50.618 133.998 141.361 1.00 29.01  ? 283  ASN A N   1 
ATOM   2187  C  CA  . ASN A  1 283 ? -51.159 134.885 140.336 1.00 33.01  ? 283  ASN A CA  1 
ATOM   2188  C  C   . ASN A  1 283 ? -51.715 136.157 140.961 1.00 36.83  ? 283  ASN A C   1 
ATOM   2189  O  O   . ASN A  1 283 ? -51.375 137.264 140.537 1.00 32.34  ? 283  ASN A O   1 
ATOM   2190  C  CB  . ASN A  1 283 ? -52.256 134.178 139.520 1.00 30.39  ? 283  ASN A CB  1 
ATOM   2191  C  CG  . ASN A  1 283 ? -51.679 133.241 138.469 1.00 34.32  ? 283  ASN A CG  1 
ATOM   2192  O  OD1 . ASN A  1 283 ? -50.467 133.070 138.389 1.00 31.45  ? 283  ASN A OD1 1 
ATOM   2193  N  ND2 . ASN A  1 283 ? -52.540 132.640 137.660 1.00 31.16  ? 283  ASN A ND2 1 
ATOM   2194  N  N   . ASN A  1 284 ? -52.561 136.016 141.985 1.00 35.08  ? 284  ASN A N   1 
ATOM   2195  C  CA  . ASN A  1 284 ? -53.237 137.181 142.547 1.00 37.11  ? 284  ASN A CA  1 
ATOM   2196  C  C   . ASN A  1 284 ? -52.371 137.963 143.528 1.00 40.28  ? 284  ASN A C   1 
ATOM   2197  O  O   . ASN A  1 284 ? -52.496 139.189 143.618 1.00 39.82  ? 284  ASN A O   1 
ATOM   2198  C  CB  . ASN A  1 284 ? -54.536 136.736 143.206 1.00 31.31  ? 284  ASN A CB  1 
ATOM   2199  C  CG  . ASN A  1 284 ? -55.494 136.145 142.205 1.00 37.89  ? 284  ASN A CG  1 
ATOM   2200  O  OD1 . ASN A  1 284 ? -55.645 136.671 141.101 1.00 45.83  ? 284  ASN A OD1 1 
ATOM   2201  N  ND2 . ASN A  1 284 ? -56.132 135.047 142.565 1.00 43.59  ? 284  ASN A ND2 1 
ATOM   2202  N  N   . GLY A  1 285 ? -51.489 137.289 144.246 1.00 36.26  ? 285  GLY A N   1 
ATOM   2203  C  CA  . GLY A  1 285 ? -50.705 137.940 145.264 1.00 37.76  ? 285  GLY A CA  1 
ATOM   2204  C  C   . GLY A  1 285 ? -49.349 138.425 144.791 1.00 33.92  ? 285  GLY A C   1 
ATOM   2205  O  O   . GLY A  1 285 ? -48.772 139.298 145.439 1.00 36.71  ? 285  GLY A O   1 
ATOM   2206  N  N   . VAL A  1 286 ? -48.827 137.887 143.685 1.00 32.79  ? 286  VAL A N   1 
ATOM   2207  C  CA  . VAL A  1 286 ? -47.495 138.274 143.221 1.00 35.67  ? 286  VAL A CA  1 
ATOM   2208  C  C   . VAL A  1 286 ? -47.565 138.806 141.790 1.00 36.29  ? 286  VAL A C   1 
ATOM   2209  O  O   . VAL A  1 286 ? -47.255 139.974 141.543 1.00 32.03  ? 286  VAL A O   1 
ATOM   2210  C  CB  . VAL A  1 286 ? -46.489 137.111 143.324 1.00 34.92  ? 286  VAL A CB  1 
ATOM   2211  C  CG1 . VAL A  1 286 ? -45.135 137.517 142.702 1.00 25.53  ? 286  VAL A CG1 1 
ATOM   2212  C  CG2 . VAL A  1 286 ? -46.306 136.687 144.777 1.00 33.37  ? 286  VAL A CG2 1 
ATOM   2213  N  N   . LEU A  1 287 ? -47.984 137.966 140.840 1.00 34.82  ? 287  LEU A N   1 
ATOM   2214  C  CA  . LEU A  1 287 ? -47.908 138.360 139.434 1.00 28.95  ? 287  LEU A CA  1 
ATOM   2215  C  C   . LEU A  1 287 ? -48.731 139.608 139.132 1.00 35.77  ? 287  LEU A C   1 
ATOM   2216  O  O   . LEU A  1 287 ? -48.359 140.395 138.253 1.00 36.71  ? 287  LEU A O   1 
ATOM   2217  C  CB  . LEU A  1 287 ? -48.348 137.206 138.527 1.00 34.65  ? 287  LEU A CB  1 
ATOM   2218  C  CG  . LEU A  1 287 ? -47.453 135.944 138.491 1.00 34.42  ? 287  LEU A CG  1 
ATOM   2219  C  CD1 . LEU A  1 287 ? -47.914 134.958 137.430 1.00 34.54  ? 287  LEU A CD1 1 
ATOM   2220  C  CD2 . LEU A  1 287 ? -46.003 136.302 138.262 1.00 28.22  ? 287  LEU A CD2 1 
ATOM   2221  N  N   . ALA A  1 288 ? -49.864 139.784 139.819 1.00 30.27  ? 288  ALA A N   1 
ATOM   2222  C  CA  . ALA A  1 288 ? -50.750 140.914 139.595 1.00 32.24  ? 288  ALA A CA  1 
ATOM   2223  C  C   . ALA A  1 288 ? -50.133 142.250 139.984 1.00 32.35  ? 288  ALA A C   1 
ATOM   2224  O  O   . ALA A  1 288 ? -50.684 143.287 139.612 1.00 32.70  ? 288  ALA A O   1 
ATOM   2225  C  CB  . ALA A  1 288 ? -52.060 140.721 140.375 1.00 33.14  ? 288  ALA A CB  1 
ATOM   2226  N  N   . HIS A  1 289 ? -49.011 142.263 140.708 1.00 31.47  ? 289  HIS A N   1 
ATOM   2227  C  CA  . HIS A  1 289 ? -48.474 143.510 141.234 1.00 33.14  ? 289  HIS A CA  1 
ATOM   2228  C  C   . HIS A  1 289 ? -47.145 143.904 140.619 1.00 31.07  ? 289  HIS A C   1 
ATOM   2229  O  O   . HIS A  1 289 ? -46.495 144.830 141.116 1.00 34.39  ? 289  HIS A O   1 
ATOM   2230  C  CB  . HIS A  1 289 ? -48.350 143.401 142.748 1.00 33.76  ? 289  HIS A CB  1 
ATOM   2231  C  CG  . HIS A  1 289 ? -49.637 143.022 143.406 1.00 37.18  ? 289  HIS A CG  1 
ATOM   2232  N  ND1 . HIS A  1 289 ? -50.789 143.767 143.253 1.00 39.84  ? 289  HIS A ND1 1 
ATOM   2233  C  CD2 . HIS A  1 289 ? -49.959 141.992 144.222 1.00 36.46  ? 289  HIS A CD2 1 
ATOM   2234  C  CE1 . HIS A  1 289 ? -51.767 143.207 143.941 1.00 37.29  ? 289  HIS A CE1 1 
ATOM   2235  N  NE2 . HIS A  1 289 ? -51.292 142.125 144.533 1.00 36.40  ? 289  HIS A NE2 1 
ATOM   2236  N  N   . LEU A  1 290 ? -46.734 143.240 139.547 1.00 32.50  ? 290  LEU A N   1 
ATOM   2237  C  CA  . LEU A  1 290 ? -45.395 143.381 139.006 1.00 33.01  ? 290  LEU A CA  1 
ATOM   2238  C  C   . LEU A  1 290 ? -45.373 144.262 137.770 1.00 35.39  ? 290  LEU A C   1 
ATOM   2239  O  O   . LEU A  1 290 ? -46.230 144.145 136.889 1.00 35.49  ? 290  LEU A O   1 
ATOM   2240  C  CB  . LEU A  1 290 ? -44.816 142.018 138.642 1.00 25.93  ? 290  LEU A CB  1 
ATOM   2241  C  CG  . LEU A  1 290 ? -44.697 141.013 139.775 1.00 32.87  ? 290  LEU A CG  1 
ATOM   2242  C  CD1 . LEU A  1 290 ? -44.010 139.742 139.221 1.00 33.14  ? 290  LEU A CD1 1 
ATOM   2243  C  CD2 . LEU A  1 290 ? -43.908 141.618 140.931 1.00 30.75  ? 290  LEU A CD2 1 
ATOM   2244  N  N   . ASP A  1 291 ? -44.372 145.137 137.712 1.00 31.99  ? 291  ASP A N   1 
ATOM   2245  C  CA  . ASP A  1 291 ? -43.966 145.738 136.447 1.00 28.17  ? 291  ASP A CA  1 
ATOM   2246  C  C   . ASP A  1 291 ? -43.012 144.845 135.675 1.00 30.81  ? 291  ASP A C   1 
ATOM   2247  O  O   . ASP A  1 291 ? -42.985 144.884 134.441 1.00 32.13  ? 291  ASP A O   1 
ATOM   2248  C  CB  . ASP A  1 291 ? -43.291 147.079 136.692 1.00 25.08  ? 291  ASP A CB  1 
ATOM   2249  C  CG  . ASP A  1 291 ? -44.283 148.198 136.844 1.00 35.19  ? 291  ASP A CG  1 
ATOM   2250  O  OD1 . ASP A  1 291 ? -45.337 148.127 136.192 1.00 37.27  ? 291  ASP A OD1 1 
ATOM   2251  O  OD2 . ASP A  1 291 ? -44.020 149.134 137.621 1.00 33.30  ? 291  ASP A OD2 1 
ATOM   2252  N  N   . LYS A  1 292 ? -42.196 144.076 136.375 1.00 30.48  ? 292  LYS A N   1 
ATOM   2253  C  CA  . LYS A  1 292 ? -41.176 143.279 135.716 1.00 32.97  ? 292  LYS A CA  1 
ATOM   2254  C  C   . LYS A  1 292 ? -40.967 141.981 136.477 1.00 26.75  ? 292  LYS A C   1 
ATOM   2255  O  O   . LYS A  1 292 ? -40.956 141.972 137.711 1.00 27.58  ? 292  LYS A O   1 
ATOM   2256  C  CB  . LYS A  1 292 ? -39.855 144.061 135.627 1.00 38.82  ? 292  LYS A CB  1 
ATOM   2257  C  CG  . LYS A  1 292 ? -38.758 143.358 134.814 1.00 40.36  ? 292  LYS A CG  1 
ATOM   2258  C  CD  . LYS A  1 292 ? -37.528 144.262 134.644 1.00 38.61  ? 292  LYS A CD  1 
ATOM   2259  C  CE  . LYS A  1 292 ? -36.534 143.646 133.657 1.00 40.68  ? 292  LYS A CE  1 
ATOM   2260  N  NZ  . LYS A  1 292 ? -35.430 144.586 133.408 1.00 49.27  ? 292  LYS A NZ  1 
ATOM   2261  N  N   . GLY A  1 293 ? -40.747 140.900 135.742 1.00 30.99  ? 293  GLY A N   1 
ATOM   2262  C  CA  . GLY A  1 293 ? -40.450 139.632 136.362 1.00 27.76  ? 293  GLY A CA  1 
ATOM   2263  C  C   . GLY A  1 293 ? -41.668 138.731 136.430 1.00 37.67  ? 293  GLY A C   1 
ATOM   2264  O  O   . GLY A  1 293 ? -42.713 139.006 135.826 1.00 34.63  ? 293  GLY A O   1 
ATOM   2265  N  N   . PRO A  1 294 ? -41.556 137.625 137.185 1.00 37.02  ? 294  PRO A N   1 
ATOM   2266  C  CA  . PRO A  1 294 ? -40.340 137.264 137.928 1.00 31.85  ? 294  PRO A CA  1 
ATOM   2267  C  C   . PRO A  1 294 ? -39.249 136.664 137.042 1.00 32.84  ? 294  PRO A C   1 
ATOM   2268  O  O   . PRO A  1 294 ? -39.551 136.099 136.002 1.00 32.43  ? 294  PRO A O   1 
ATOM   2269  C  CB  . PRO A  1 294 ? -40.835 136.222 138.935 1.00 34.44  ? 294  PRO A CB  1 
ATOM   2270  C  CG  . PRO A  1 294 ? -42.039 135.623 138.292 1.00 40.57  ? 294  PRO A CG  1 
ATOM   2271  C  CD  . PRO A  1 294 ? -42.651 136.662 137.398 1.00 34.36  ? 294  PRO A CD  1 
ATOM   2272  N  N   . TYR A  1 295 ? -37.992 136.829 137.452 1.00 32.96  ? 295  TYR A N   1 
ATOM   2273  C  CA  . TYR A  1 295 ? -36.848 136.205 136.800 1.00 34.00  ? 295  TYR A CA  1 
ATOM   2274  C  C   . TYR A  1 295 ? -36.010 135.533 137.882 1.00 34.53  ? 295  TYR A C   1 
ATOM   2275  O  O   . TYR A  1 295 ? -35.600 136.184 138.849 1.00 28.40  ? 295  TYR A O   1 
ATOM   2276  C  CB  . TYR A  1 295 ? -36.017 137.239 136.031 1.00 33.25  ? 295  TYR A CB  1 
ATOM   2277  C  CG  . TYR A  1 295 ? -34.883 136.637 135.199 1.00 39.25  ? 295  TYR A CG  1 
ATOM   2278  C  CD1 . TYR A  1 295 ? -35.141 136.020 133.982 1.00 32.11  ? 295  TYR A CD1 1 
ATOM   2279  C  CD2 . TYR A  1 295 ? -33.556 136.715 135.627 1.00 34.43  ? 295  TYR A CD2 1 
ATOM   2280  C  CE1 . TYR A  1 295 ? -34.107 135.485 133.207 1.00 33.66  ? 295  TYR A CE1 1 
ATOM   2281  C  CE2 . TYR A  1 295 ? -32.526 136.195 134.868 1.00 37.53  ? 295  TYR A CE2 1 
ATOM   2282  C  CZ  . TYR A  1 295 ? -32.802 135.572 133.665 1.00 37.52  ? 295  TYR A CZ  1 
ATOM   2283  O  OH  . TYR A  1 295 ? -31.764 135.064 132.923 1.00 36.18  ? 295  TYR A OH  1 
ATOM   2284  N  N   . TYR A  1 296 ? -35.774 134.234 137.739 1.00 26.99  ? 296  TYR A N   1 
ATOM   2285  C  CA  . TYR A  1 296 ? -35.107 133.449 138.768 1.00 28.33  ? 296  TYR A CA  1 
ATOM   2286  C  C   . TYR A  1 296 ? -33.719 133.038 138.290 1.00 37.04  ? 296  TYR A C   1 
ATOM   2287  O  O   . TYR A  1 296 ? -33.597 132.319 137.293 1.00 31.69  ? 296  TYR A O   1 
ATOM   2288  C  CB  . TYR A  1 296 ? -35.950 132.224 139.115 1.00 29.26  ? 296  TYR A CB  1 
ATOM   2289  C  CG  . TYR A  1 296 ? -37.079 132.569 140.075 1.00 35.90  ? 296  TYR A CG  1 
ATOM   2290  C  CD1 . TYR A  1 296 ? -36.848 132.615 141.434 1.00 40.90  ? 296  TYR A CD1 1 
ATOM   2291  C  CD2 . TYR A  1 296 ? -38.348 132.880 139.621 1.00 37.43  ? 296  TYR A CD2 1 
ATOM   2292  C  CE1 . TYR A  1 296 ? -37.827 132.924 142.330 1.00 48.27  ? 296  TYR A CE1 1 
ATOM   2293  C  CE2 . TYR A  1 296 ? -39.359 133.208 140.524 1.00 43.19  ? 296  TYR A CE2 1 
ATOM   2294  C  CZ  . TYR A  1 296 ? -39.080 133.231 141.882 1.00 51.48  ? 296  TYR A CZ  1 
ATOM   2295  O  OH  . TYR A  1 296 ? -40.031 133.553 142.832 1.00 60.65  ? 296  TYR A OH  1 
ATOM   2296  N  N   . MET A  1 297 ? -32.682 133.494 138.999 1.00 31.63  ? 297  MET A N   1 
ATOM   2297  C  CA  . MET A  1 297 ? -31.312 133.038 138.782 1.00 28.80  ? 297  MET A CA  1 
ATOM   2298  C  C   . MET A  1 297 ? -30.946 131.967 139.809 1.00 27.32  ? 297  MET A C   1 
ATOM   2299  O  O   . MET A  1 297 ? -31.295 132.078 140.986 1.00 27.66  ? 297  MET A O   1 
ATOM   2300  C  CB  . MET A  1 297 ? -30.321 134.206 138.873 1.00 32.67  ? 297  MET A CB  1 
ATOM   2301  C  CG  . MET A  1 297 ? -30.562 135.300 137.838 1.00 35.86  ? 297  MET A CG  1 
ATOM   2302  S  SD  . MET A  1 297 ? -29.660 136.815 138.219 1.00 39.37  ? 297  MET A SD  1 
ATOM   2303  C  CE  . MET A  1 297 ? -27.966 136.243 138.005 1.00 44.58  ? 297  MET A CE  1 
ATOM   2304  N  N   . PHE A  1 298 ? -30.241 130.929 139.355 1.00 28.29  ? 298  PHE A N   1 
ATOM   2305  C  CA  . PHE A  1 298 ? -29.773 129.847 140.214 1.00 30.90  ? 298  PHE A CA  1 
ATOM   2306  C  C   . PHE A  1 298 ? -28.327 130.108 140.636 1.00 27.14  ? 298  PHE A C   1 
ATOM   2307  O  O   . PHE A  1 298 ? -27.499 130.486 139.810 1.00 27.11  ? 298  PHE A O   1 
ATOM   2308  C  CB  . PHE A  1 298 ? -29.841 128.492 139.494 1.00 24.68  ? 298  PHE A CB  1 
ATOM   2309  C  CG  . PHE A  1 298 ? -31.221 127.888 139.422 1.00 28.48  ? 298  PHE A CG  1 
ATOM   2310  C  CD1 . PHE A  1 298 ? -32.345 128.690 139.217 1.00 34.74  ? 298  PHE A CD1 1 
ATOM   2311  C  CD2 . PHE A  1 298 ? -31.393 126.501 139.543 1.00 27.08  ? 298  PHE A CD2 1 
ATOM   2312  C  CE1 . PHE A  1 298 ? -33.620 128.124 139.129 1.00 39.21  ? 298  PHE A CE1 1 
ATOM   2313  C  CE2 . PHE A  1 298 ? -32.658 125.926 139.465 1.00 25.04  ? 298  PHE A CE2 1 
ATOM   2314  C  CZ  . PHE A  1 298 ? -33.779 126.741 139.247 1.00 30.87  ? 298  PHE A CZ  1 
ATOM   2315  N  N   . PHE A  1 299 ? -28.032 129.876 141.918 1.00 23.37  ? 299  PHE A N   1 
ATOM   2316  C  CA  . PHE A  1 299 ? -26.704 130.067 142.486 1.00 26.72  ? 299  PHE A CA  1 
ATOM   2317  C  C   . PHE A  1 299 ? -26.275 128.886 143.351 1.00 27.28  ? 299  PHE A C   1 
ATOM   2318  O  O   . PHE A  1 299 ? -27.095 128.212 143.986 1.00 28.39  ? 299  PHE A O   1 
ATOM   2319  C  CB  . PHE A  1 299 ? -26.634 131.279 143.398 1.00 23.01  ? 299  PHE A CB  1 
ATOM   2320  C  CG  . PHE A  1 299 ? -26.882 132.583 142.725 1.00 27.19  ? 299  PHE A CG  1 
ATOM   2321  C  CD1 . PHE A  1 299 ? -28.178 133.050 142.560 1.00 29.53  ? 299  PHE A CD1 1 
ATOM   2322  C  CD2 . PHE A  1 299 ? -25.824 133.372 142.306 1.00 31.31  ? 299  PHE A CD2 1 
ATOM   2323  C  CE1 . PHE A  1 299 ? -28.422 134.274 141.980 1.00 31.49  ? 299  PHE A CE1 1 
ATOM   2324  C  CE2 . PHE A  1 299 ? -26.054 134.608 141.721 1.00 30.87  ? 299  PHE A CE2 1 
ATOM   2325  C  CZ  . PHE A  1 299 ? -27.366 135.057 141.553 1.00 28.93  ? 299  PHE A CZ  1 
ATOM   2326  N  N   . SER A  1 300 ? -24.959 128.711 143.448 1.00 27.59  ? 300  SER A N   1 
ATOM   2327  C  CA  . SER A  1 300 ? -24.379 127.847 144.445 1.00 27.90  ? 300  SER A CA  1 
ATOM   2328  C  C   . SER A  1 300 ? -23.700 128.697 145.505 1.00 32.42  ? 300  SER A C   1 
ATOM   2329  O  O   . SER A  1 300 ? -22.949 129.614 145.158 1.00 34.71  ? 300  SER A O   1 
ATOM   2330  C  CB  . SER A  1 300 ? -23.365 126.898 143.818 1.00 34.98  ? 300  SER A CB  1 
ATOM   2331  O  OG  . SER A  1 300 ? -22.750 126.176 144.856 1.00 46.37  ? 300  SER A OG  1 
ATOM   2332  N  N   . PRO A  1 301 ? -23.975 128.483 146.783 1.00 32.68  ? 301  PRO A N   1 
ATOM   2333  C  CA  . PRO A  1 301 ? -23.232 129.215 147.816 1.00 35.65  ? 301  PRO A CA  1 
ATOM   2334  C  C   . PRO A  1 301 ? -21.819 128.654 147.948 1.00 41.60  ? 301  PRO A C   1 
ATOM   2335  O  O   . PRO A  1 301 ? -21.632 127.512 148.372 1.00 38.78  ? 301  PRO A O   1 
ATOM   2336  C  CB  . PRO A  1 301 ? -24.069 128.984 149.084 1.00 36.36  ? 301  PRO A CB  1 
ATOM   2337  C  CG  . PRO A  1 301 ? -24.756 127.679 148.844 1.00 42.70  ? 301  PRO A CG  1 
ATOM   2338  C  CD  . PRO A  1 301 ? -25.012 127.606 147.354 1.00 33.77  ? 301  PRO A CD  1 
ATOM   2339  N  N   . MET A  1 302 ? -20.819 129.429 147.531 1.00 42.15  ? 302  MET A N   1 
ATOM   2340  C  CA  . MET A  1 302 ? -19.447 128.944 147.566 1.00 44.54  ? 302  MET A CA  1 
ATOM   2341  C  C   . MET A  1 302 ? -18.907 128.939 148.988 1.00 46.65  ? 302  MET A C   1 
ATOM   2342  O  O   . MET A  1 302 ? -18.315 127.954 149.438 1.00 48.19  ? 302  MET A O   1 
ATOM   2343  C  CB  . MET A  1 302 ? -18.558 129.810 146.675 1.00 42.14  ? 302  MET A CB  1 
ATOM   2344  C  CG  . MET A  1 302 ? -18.746 129.660 145.189 1.00 53.09  ? 302  MET A CG  1 
ATOM   2345  S  SD  A MET A  1 302 ? -19.280 127.982 144.693 0.53 52.14  ? 302  MET A SD  1 
ATOM   2346  S  SD  B MET A  1 302 ? -17.671 130.900 144.408 0.47 59.31  ? 302  MET A SD  1 
ATOM   2347  C  CE  A MET A  1 302 ? -17.702 127.129 144.546 0.53 42.79  ? 302  MET A CE  1 
ATOM   2348  C  CE  B MET A  1 302 ? -16.051 130.455 145.050 0.47 56.19  ? 302  MET A CE  1 
ATOM   2349  N  N   . MET A  1 303 ? -19.060 130.055 149.693 1.00 41.27  ? 303  MET A N   1 
ATOM   2350  C  CA  . MET A  1 303 ? -18.555 130.226 151.046 1.00 42.54  ? 303  MET A CA  1 
ATOM   2351  C  C   . MET A  1 303 ? -19.665 130.897 151.819 1.00 37.20  ? 303  MET A C   1 
ATOM   2352  O  O   . MET A  1 303 ? -20.407 131.698 151.252 1.00 34.30  ? 303  MET A O   1 
ATOM   2353  C  CB  . MET A  1 303 ? -17.285 131.097 151.109 1.00 47.44  ? 303  MET A CB  1 
ATOM   2354  C  CG  . MET A  1 303 ? -16.134 130.608 150.244 1.00 73.96  ? 303  MET A CG  1 
ATOM   2355  S  SD  . MET A  1 303 ? -14.585 131.478 150.580 1.00 97.31  ? 303  MET A SD  1 
ATOM   2356  C  CE  . MET A  1 303 ? -14.014 131.824 148.907 1.00 98.94  ? 303  MET A CE  1 
ATOM   2357  N  N   . GLU A  1 304 ? -19.816 130.534 153.083 1.00 32.09  ? 304  GLU A N   1 
ATOM   2358  C  CA  . GLU A  1 304 ? -20.841 131.147 153.911 1.00 35.83  ? 304  GLU A CA  1 
ATOM   2359  C  C   . GLU A  1 304 ? -20.295 131.324 155.308 1.00 33.51  ? 304  GLU A C   1 
ATOM   2360  O  O   . GLU A  1 304 ? -19.588 130.448 155.819 1.00 33.17  ? 304  GLU A O   1 
ATOM   2361  C  CB  . GLU A  1 304 ? -22.101 130.294 154.003 1.00 34.16  ? 304  GLU A CB  1 
ATOM   2362  C  CG  . GLU A  1 304 ? -22.643 129.818 152.689 1.00 41.33  ? 304  GLU A CG  1 
ATOM   2363  C  CD  . GLU A  1 304 ? -23.905 129.007 152.890 1.00 35.64  ? 304  GLU A CD  1 
ATOM   2364  O  OE1 . GLU A  1 304 ? -23.798 127.761 152.901 1.00 28.95  ? 304  GLU A OE1 1 
ATOM   2365  O  OE2 . GLU A  1 304 ? -24.983 129.624 153.064 1.00 31.60  ? 304  GLU A OE2 1 
ATOM   2366  N  N   . GLN A  1 305 ? -20.595 132.464 155.912 1.00 34.52  ? 305  GLN A N   1 
ATOM   2367  C  CA  . GLN A  1 305 ? -20.483 132.598 157.363 1.00 40.19  ? 305  GLN A CA  1 
ATOM   2368  C  C   . GLN A  1 305 ? -21.903 132.951 157.791 1.00 37.06  ? 305  GLN A C   1 
ATOM   2369  O  O   . GLN A  1 305 ? -22.370 134.087 157.615 1.00 33.17  ? 305  GLN A O   1 
ATOM   2370  C  CB  . GLN A  1 305 ? -19.370 133.577 157.786 1.00 42.88  ? 305  GLN A CB  1 
ATOM   2371  C  CG  . GLN A  1 305 ? -19.727 134.836 158.552 1.00 63.58  ? 305  GLN A CG  1 
ATOM   2372  C  CD  . GLN A  1 305 ? -20.142 134.629 159.996 1.00 55.61  ? 305  GLN A CD  1 
ATOM   2373  O  OE1 . GLN A  1 305 ? -20.929 133.736 160.331 1.00 48.23  ? 305  GLN A OE1 1 
ATOM   2374  N  NE2 . GLN A  1 305 ? -19.640 135.501 160.861 1.00 54.46  ? 305  GLN A NE2 1 
ATOM   2375  N  N   . GLY A  1 306 ? -22.617 131.932 158.281 1.00 34.13  ? 306  GLY A N   1 
ATOM   2376  C  CA  . GLY A  1 306 ? -24.055 132.017 158.404 1.00 31.38  ? 306  GLY A CA  1 
ATOM   2377  C  C   . GLY A  1 306 ? -24.591 132.394 159.771 1.00 37.55  ? 306  GLY A C   1 
ATOM   2378  O  O   . GLY A  1 306 ? -25.790 132.236 160.005 1.00 38.66  ? 306  GLY A O   1 
ATOM   2379  N  N   . LEU A  1 307 ? -23.758 132.926 160.676 1.00 32.51  ? 307  LEU A N   1 
ATOM   2380  C  CA  . LEU A  1 307 ? -24.278 133.227 162.009 1.00 47.31  ? 307  LEU A CA  1 
ATOM   2381  C  C   . LEU A  1 307 ? -25.325 134.337 162.007 1.00 44.48  ? 307  LEU A C   1 
ATOM   2382  O  O   . LEU A  1 307 ? -26.133 134.415 162.936 1.00 37.77  ? 307  LEU A O   1 
ATOM   2383  C  CB  . LEU A  1 307 ? -23.147 133.543 162.980 1.00 50.57  ? 307  LEU A CB  1 
ATOM   2384  C  CG  . LEU A  1 307 ? -22.638 132.190 163.508 1.00 56.06  ? 307  LEU A CG  1 
ATOM   2385  C  CD1 . LEU A  1 307 ? -21.333 131.725 162.828 1.00 52.20  ? 307  LEU A CD1 1 
ATOM   2386  C  CD2 . LEU A  1 307 ? -22.582 132.131 165.038 1.00 51.63  ? 307  LEU A CD2 1 
ATOM   2387  N  N   . TRP A  1 308 ? -25.344 135.185 160.985 1.00 37.23  ? 308  TRP A N   1 
ATOM   2388  C  CA  . TRP A  1 308 ? -26.400 136.182 160.886 1.00 37.76  ? 308  TRP A CA  1 
ATOM   2389  C  C   . TRP A  1 308 ? -27.790 135.548 160.846 1.00 43.31  ? 308  TRP A C   1 
ATOM   2390  O  O   . TRP A  1 308 ? -28.768 136.167 161.273 1.00 44.55  ? 308  TRP A O   1 
ATOM   2391  C  CB  . TRP A  1 308 ? -26.164 137.021 159.644 1.00 37.18  ? 308  TRP A CB  1 
ATOM   2392  C  CG  . TRP A  1 308 ? -26.278 136.243 158.371 1.00 37.74  ? 308  TRP A CG  1 
ATOM   2393  C  CD1 . TRP A  1 308 ? -25.305 135.510 157.761 1.00 39.35  ? 308  TRP A CD1 1 
ATOM   2394  C  CD2 . TRP A  1 308 ? -27.447 136.128 157.549 1.00 31.69  ? 308  TRP A CD2 1 
ATOM   2395  N  NE1 . TRP A  1 308 ? -25.797 134.951 156.600 1.00 35.88  ? 308  TRP A NE1 1 
ATOM   2396  C  CE2 . TRP A  1 308 ? -27.105 135.329 156.447 1.00 30.80  ? 308  TRP A CE2 1 
ATOM   2397  C  CE3 . TRP A  1 308 ? -28.741 136.650 157.630 1.00 38.86  ? 308  TRP A CE3 1 
ATOM   2398  C  CZ2 . TRP A  1 308 ? -28.018 135.018 155.444 1.00 40.17  ? 308  TRP A CZ2 1 
ATOM   2399  C  CZ3 . TRP A  1 308 ? -29.642 136.345 156.637 1.00 30.77  ? 308  TRP A CZ3 1 
ATOM   2400  C  CH2 . TRP A  1 308 ? -29.278 135.545 155.553 1.00 33.43  ? 308  TRP A CH2 1 
ATOM   2401  N  N   . ARG A  1 309 ? -27.908 134.328 160.315 1.00 34.51  ? 309  ARG A N   1 
ATOM   2402  C  CA  . ARG A  1 309 ? -29.217 133.689 160.259 1.00 39.59  ? 309  ARG A CA  1 
ATOM   2403  C  C   . ARG A  1 309 ? -29.774 133.423 161.642 1.00 49.34  ? 309  ARG A C   1 
ATOM   2404  O  O   . ARG A  1 309 ? -30.995 133.431 161.823 1.00 46.06  ? 309  ARG A O   1 
ATOM   2405  C  CB  . ARG A  1 309 ? -29.146 132.371 159.514 1.00 34.64  ? 309  ARG A CB  1 
ATOM   2406  C  CG  . ARG A  1 309 ? -28.621 132.456 158.126 1.00 42.20  ? 309  ARG A CG  1 
ATOM   2407  C  CD  . ARG A  1 309 ? -28.399 131.031 157.591 1.00 46.21  ? 309  ARG A CD  1 
ATOM   2408  N  NE  . ARG A  1 309 ? -28.338 131.149 156.162 1.00 48.91  ? 309  ARG A NE  1 
ATOM   2409  C  CZ  . ARG A  1 309 ? -29.128 130.539 155.297 1.00 41.73  ? 309  ARG A CZ  1 
ATOM   2410  N  NH1 . ARG A  1 309 ? -30.060 129.653 155.675 1.00 36.10  ? 309  ARG A NH1 1 
ATOM   2411  N  NH2 . ARG A  1 309 ? -28.945 130.825 154.020 1.00 43.94  ? 309  ARG A NH2 1 
ATOM   2412  N  N   . LYS A  1 310 ? -28.895 133.198 162.625 1.00 55.04  ? 310  LYS A N   1 
ATOM   2413  C  CA  . LYS A  1 310 ? -29.327 132.795 163.956 1.00 61.21  ? 310  LYS A CA  1 
ATOM   2414  C  C   . LYS A  1 310 ? -30.172 133.863 164.633 1.00 64.11  ? 310  LYS A C   1 
ATOM   2415  O  O   . LYS A  1 310 ? -30.979 133.531 165.507 1.00 76.51  ? 310  LYS A O   1 
ATOM   2416  C  CB  . LYS A  1 310 ? -28.116 132.449 164.834 1.00 64.44  ? 310  LYS A CB  1 
ATOM   2417  C  CG  . LYS A  1 310 ? -27.394 131.152 164.457 1.00 74.22  ? 310  LYS A CG  1 
ATOM   2418  C  CD  . LYS A  1 310 ? -26.655 130.494 165.649 1.00 76.69  ? 310  LYS A CD  1 
ATOM   2419  C  CE  . LYS A  1 310 ? -25.902 129.204 165.218 1.00 76.71  ? 310  LYS A CE  1 
ATOM   2420  N  NZ  . LYS A  1 310 ? -25.484 128.287 166.343 1.00 66.14  ? 310  LYS A NZ  1 
ATOM   2421  N  N   . HIS A  1 311 ? -30.029 135.127 164.248 1.00 64.15  ? 311  HIS A N   1 
ATOM   2422  C  CA  . HIS A  1 311 ? -30.855 136.199 164.796 1.00 78.39  ? 311  HIS A CA  1 
ATOM   2423  C  C   . HIS A  1 311 ? -31.602 136.887 163.652 1.00 83.50  ? 311  HIS A C   1 
ATOM   2424  O  O   . HIS A  1 311 ? -31.251 137.986 163.218 1.00 89.86  ? 311  HIS A O   1 
ATOM   2425  C  CB  . HIS A  1 311 ? -30.025 137.191 165.630 1.00 93.62  ? 311  HIS A CB  1 
ATOM   2426  C  CG  . HIS A  1 311 ? -28.637 137.419 165.118 1.00 106.38 ? 311  HIS A CG  1 
ATOM   2427  N  ND1 . HIS A  1 311 ? -28.353 138.318 164.110 1.00 108.15 ? 311  HIS A ND1 1 
ATOM   2428  C  CD2 . HIS A  1 311 ? -27.449 136.889 165.497 1.00 107.84 ? 311  HIS A CD2 1 
ATOM   2429  C  CE1 . HIS A  1 311 ? -27.052 138.319 163.880 1.00 109.09 ? 311  HIS A CE1 1 
ATOM   2430  N  NE2 . HIS A  1 311 ? -26.480 137.462 164.708 1.00 108.11 ? 311  HIS A NE2 1 
ATOM   2431  N  N   . LEU A  1 312 ? -32.646 136.221 163.173 1.00 76.93  ? 312  LEU A N   1 
ATOM   2432  C  CA  . LEU A  1 312 ? -33.645 136.788 162.284 1.00 73.08  ? 312  LEU A CA  1 
ATOM   2433  C  C   . LEU A  1 312 ? -34.991 136.809 163.015 1.00 78.74  ? 312  LEU A C   1 
ATOM   2434  O  O   . LEU A  1 312 ? -35.061 136.595 164.228 1.00 76.39  ? 312  LEU A O   1 
ATOM   2435  C  CB  . LEU A  1 312 ? -33.726 135.992 160.978 1.00 61.01  ? 312  LEU A CB  1 
ATOM   2436  C  CG  . LEU A  1 312 ? -32.619 136.232 159.960 1.00 55.93  ? 312  LEU A CG  1 
ATOM   2437  C  CD1 . LEU A  1 312 ? -32.718 135.244 158.831 1.00 42.83  ? 312  LEU A CD1 1 
ATOM   2438  C  CD2 . LEU A  1 312 ? -32.711 137.655 159.437 1.00 59.26  ? 312  LEU A CD2 1 
ATOM   2439  N  N   . LYS A  1 313 ? -36.062 137.049 162.257 1.00 82.40  ? 313  LYS A N   1 
ATOM   2440  C  CA  . LYS A  1 313 ? -37.429 137.112 162.779 1.00 66.30  ? 313  LYS A CA  1 
ATOM   2441  C  C   . LYS A  1 313 ? -37.505 138.192 163.845 1.00 68.45  ? 313  LYS A C   1 
ATOM   2442  O  O   . LYS A  1 313 ? -36.682 139.108 163.860 1.00 73.11  ? 313  LYS A O   1 
ATOM   2443  C  CB  . LYS A  1 313 ? -37.887 135.762 163.350 1.00 53.50  ? 313  LYS A CB  1 
ATOM   2444  C  CG  . LYS A  1 313 ? -37.898 134.593 162.356 1.00 67.84  ? 313  LYS A CG  1 
ATOM   2445  C  CD  . LYS A  1 313 ? -39.271 133.924 162.283 1.00 73.66  ? 313  LYS A CD  1 
ATOM   2446  C  CE  . LYS A  1 313 ? -40.146 134.216 163.509 1.00 71.14  ? 313  LYS A CE  1 
ATOM   2447  N  NZ  . LYS A  1 313 ? -39.713 133.467 164.723 1.00 73.66  ? 313  LYS A NZ  1 
ATOM   2448  N  N   . GLU B  1 4   ? 36.213  139.189 165.464 1.00 91.22  ? 4    GLU B N   1 
ATOM   2449  C  CA  . GLU B  1 4   ? 34.787  139.461 165.292 1.00 91.49  ? 4    GLU B CA  1 
ATOM   2450  C  C   . GLU B  1 4   ? 33.989  138.164 165.163 1.00 90.85  ? 4    GLU B C   1 
ATOM   2451  O  O   . GLU B  1 4   ? 34.176  137.410 164.202 1.00 96.71  ? 4    GLU B O   1 
ATOM   2452  C  CB  . GLU B  1 4   ? 34.556  140.357 164.062 1.00 87.77  ? 4    GLU B CB  1 
ATOM   2453  C  CG  . GLU B  1 4   ? 33.177  140.225 163.394 1.00 85.59  ? 4    GLU B CG  1 
ATOM   2454  C  CD  . GLU B  1 4   ? 32.328  141.491 163.501 1.00 81.59  ? 4    GLU B CD  1 
ATOM   2455  O  OE1 . GLU B  1 4   ? 31.392  141.514 164.343 1.00 72.75  ? 4    GLU B OE1 1 
ATOM   2456  O  OE2 . GLU B  1 4   ? 32.602  142.455 162.738 1.00 77.02  ? 4    GLU B OE2 1 
ATOM   2457  N  N   . ASN B  1 5   ? 33.123  137.881 166.143 1.00 76.65  ? 5    ASN B N   1 
ATOM   2458  C  CA  . ASN B  1 5   ? 32.153  136.806 165.963 1.00 66.11  ? 5    ASN B CA  1 
ATOM   2459  C  C   . ASN B  1 5   ? 30.797  137.444 165.741 1.00 51.13  ? 5    ASN B C   1 
ATOM   2460  O  O   . ASN B  1 5   ? 30.160  137.945 166.689 1.00 39.10  ? 5    ASN B O   1 
ATOM   2461  C  CB  . ASN B  1 5   ? 32.109  135.823 167.134 1.00 69.78  ? 5    ASN B CB  1 
ATOM   2462  C  CG  . ASN B  1 5   ? 32.146  136.510 168.462 1.00 81.63  ? 5    ASN B CG  1 
ATOM   2463  O  OD1 . ASN B  1 5   ? 32.758  137.574 168.604 1.00 79.38  ? 5    ASN B OD1 1 
ATOM   2464  N  ND2 . ASN B  1 5   ? 31.494  135.907 169.460 1.00 89.40  ? 5    ASN B ND2 1 
ATOM   2465  N  N   . PRO B  1 6   ? 30.331  137.473 164.515 1.00 39.29  ? 6    PRO B N   1 
ATOM   2466  C  CA  . PRO B  1 6   ? 29.016  138.037 164.230 1.00 39.54  ? 6    PRO B CA  1 
ATOM   2467  C  C   . PRO B  1 6   ? 27.937  137.063 164.677 1.00 43.63  ? 6    PRO B C   1 
ATOM   2468  O  O   . PRO B  1 6   ? 28.211  135.922 165.053 1.00 42.85  ? 6    PRO B O   1 
ATOM   2469  C  CB  . PRO B  1 6   ? 29.045  138.189 162.713 1.00 34.76  ? 6    PRO B CB  1 
ATOM   2470  C  CG  . PRO B  1 6   ? 29.933  137.065 162.265 1.00 41.31  ? 6    PRO B CG  1 
ATOM   2471  C  CD  . PRO B  1 6   ? 30.997  136.938 163.322 1.00 41.63  ? 6    PRO B CD  1 
ATOM   2472  N  N   . ILE B  1 7   ? 26.701  137.538 164.671 1.00 38.15  ? 7    ILE B N   1 
ATOM   2473  C  CA  . ILE B  1 7   ? 25.570  136.660 164.944 1.00 38.40  ? 7    ILE B CA  1 
ATOM   2474  C  C   . ILE B  1 7   ? 24.901  136.339 163.612 1.00 37.83  ? 7    ILE B C   1 
ATOM   2475  O  O   . ILE B  1 7   ? 24.972  137.124 162.656 1.00 29.60  ? 7    ILE B O   1 
ATOM   2476  C  CB  . ILE B  1 7   ? 24.595  137.259 165.983 1.00 43.49  ? 7    ILE B CB  1 
ATOM   2477  C  CG1 . ILE B  1 7   ? 23.952  138.528 165.452 1.00 46.70  ? 7    ILE B CG1 1 
ATOM   2478  C  CG2 . ILE B  1 7   ? 25.332  137.502 167.326 1.00 34.15  ? 7    ILE B CG2 1 
ATOM   2479  C  CD1 . ILE B  1 7   ? 22.577  138.291 164.914 1.00 44.58  ? 7    ILE B CD1 1 
ATOM   2480  N  N   . ILE B  1 8   ? 24.310  135.149 163.515 1.00 31.07  ? 8    ILE B N   1 
ATOM   2481  C  CA  . ILE B  1 8   ? 23.678  134.685 162.281 1.00 27.89  ? 8    ILE B CA  1 
ATOM   2482  C  C   . ILE B  1 8   ? 22.204  134.458 162.544 1.00 32.94  ? 8    ILE B C   1 
ATOM   2483  O  O   . ILE B  1 8   ? 21.841  133.713 163.462 1.00 34.86  ? 8    ILE B O   1 
ATOM   2484  C  CB  . ILE B  1 8   ? 24.330  133.405 161.734 1.00 26.70  ? 8    ILE B CB  1 
ATOM   2485  C  CG1 . ILE B  1 8   ? 25.829  133.651 161.504 1.00 33.50  ? 8    ILE B CG1 1 
ATOM   2486  C  CG2 . ILE B  1 8   ? 23.617  132.968 160.460 1.00 26.83  ? 8    ILE B CG2 1 
ATOM   2487  C  CD1 . ILE B  1 8   ? 26.605  132.482 160.911 1.00 33.31  ? 8    ILE B CD1 1 
ATOM   2488  N  N   . ALA B  1 9   ? 21.361  135.148 161.777 1.00 33.58  ? 9    ALA B N   1 
ATOM   2489  C  CA  . ALA B  1 9   ? 19.941  134.871 161.714 1.00 32.90  ? 9    ALA B CA  1 
ATOM   2490  C  C   . ALA B  1 9   ? 19.706  133.927 160.546 1.00 35.17  ? 9    ALA B C   1 
ATOM   2491  O  O   . ALA B  1 9   ? 20.144  134.204 159.425 1.00 29.74  ? 9    ALA B O   1 
ATOM   2492  C  CB  . ALA B  1 9   ? 19.136  136.157 161.522 1.00 26.42  ? 9    ALA B CB  1 
ATOM   2493  N  N   . ILE B  1 10  ? 19.037  132.813 160.800 1.00 27.14  ? 10   ILE B N   1 
ATOM   2494  C  CA  . ILE B  1 10  ? 18.765  131.844 159.744 1.00 25.09  ? 10   ILE B CA  1 
ATOM   2495  C  C   . ILE B  1 10  ? 17.277  131.824 159.525 1.00 29.24  ? 10   ILE B C   1 
ATOM   2496  O  O   . ILE B  1 10  ? 16.528  131.286 160.350 1.00 33.24  ? 10   ILE B O   1 
ATOM   2497  C  CB  . ILE B  1 10  ? 19.277  130.439 160.068 1.00 29.06  ? 10   ILE B CB  1 
ATOM   2498  C  CG1 . ILE B  1 10  ? 20.773  130.476 160.347 1.00 29.82  ? 10   ILE B CG1 1 
ATOM   2499  C  CG2 . ILE B  1 10  ? 18.926  129.501 158.904 1.00 24.49  ? 10   ILE B CG2 1 
ATOM   2500  C  CD1 . ILE B  1 10  ? 21.384  129.120 160.683 1.00 29.60  ? 10   ILE B CD1 1 
ATOM   2501  N  N   . ASN B  1 11  ? 16.852  132.397 158.408 1.00 30.64  ? 11   ASN B N   1 
ATOM   2502  C  CA  . ASN B  1 11  ? 15.455  132.341 158.012 1.00 31.00  ? 11   ASN B CA  1 
ATOM   2503  C  C   . ASN B  1 11  ? 15.165  130.973 157.412 1.00 32.13  ? 11   ASN B C   1 
ATOM   2504  O  O   . ASN B  1 11  ? 15.643  130.660 156.319 1.00 33.46  ? 11   ASN B O   1 
ATOM   2505  C  CB  . ASN B  1 11  ? 15.138  133.433 156.999 1.00 28.49  ? 11   ASN B CB  1 
ATOM   2506  C  CG  . ASN B  1 11  ? 13.660  133.577 156.791 1.00 40.30  ? 11   ASN B CG  1 
ATOM   2507  O  OD1 . ASN B  1 11  ? 13.031  132.735 156.144 1.00 41.79  ? 11   ASN B OD1 1 
ATOM   2508  N  ND2 . ASN B  1 11  ? 13.080  134.619 157.378 1.00 55.79  ? 11   ASN B ND2 1 
ATOM   2509  N  N   . MET B  1 12  ? 14.345  130.181 158.097 1.00 27.49  ? 12   MET B N   1 
ATOM   2510  C  CA  . MET B  1 12  ? 14.038  128.811 157.708 1.00 27.30  ? 12   MET B CA  1 
ATOM   2511  C  C   . MET B  1 12  ? 12.626  128.756 157.159 1.00 35.72  ? 12   MET B C   1 
ATOM   2512  O  O   . MET B  1 12  ? 11.683  129.188 157.826 1.00 32.71  ? 12   MET B O   1 
ATOM   2513  C  CB  . MET B  1 12  ? 14.176  127.860 158.895 1.00 29.97  ? 12   MET B CB  1 
ATOM   2514  C  CG  . MET B  1 12  ? 15.577  127.851 159.529 1.00 24.96  ? 12   MET B CG  1 
ATOM   2515  S  SD  . MET B  1 12  ? 15.539  127.018 161.125 1.00 39.70  ? 12   MET B SD  1 
ATOM   2516  C  CE  . MET B  1 12  ? 17.293  126.887 161.483 1.00 37.72  ? 12   MET B CE  1 
ATOM   2517  N  N   . ALA B  1 13  ? 12.491  128.253 155.940 1.00 29.99  ? 13   ALA B N   1 
ATOM   2518  C  CA  . ALA B  1 13  ? 11.200  128.060 155.318 1.00 29.96  ? 13   ALA B CA  1 
ATOM   2519  C  C   . ALA B  1 13  ? 11.228  126.762 154.533 1.00 33.20  ? 13   ALA B C   1 
ATOM   2520  O  O   . ALA B  1 13  ? 12.291  126.237 154.186 1.00 34.42  ? 13   ALA B O   1 
ATOM   2521  C  CB  . ALA B  1 13  ? 10.835  129.221 154.390 1.00 31.91  ? 13   ALA B CB  1 
ATOM   2522  N  N   . LYS B  1 14  ? 10.043  126.246 154.247 1.00 28.71  ? 14   LYS B N   1 
ATOM   2523  C  CA  . LYS B  1 14  ? 9.895   125.124 153.338 1.00 32.87  ? 14   LYS B CA  1 
ATOM   2524  C  C   . LYS B  1 14  ? 9.006   125.591 152.196 1.00 35.03  ? 14   LYS B C   1 
ATOM   2525  O  O   . LYS B  1 14  ? 7.914   126.114 152.439 1.00 31.81  ? 14   LYS B O   1 
ATOM   2526  C  CB  . LYS B  1 14  ? 9.308   123.913 154.071 1.00 36.79  ? 14   LYS B CB  1 
ATOM   2527  C  CG  . LYS B  1 14  ? 10.212  123.409 155.196 1.00 46.69  ? 14   LYS B CG  1 
ATOM   2528  C  CD  . LYS B  1 14  ? 9.606   122.174 155.865 1.00 68.75  ? 14   LYS B CD  1 
ATOM   2529  C  CE  . LYS B  1 14  ? 10.529  121.588 156.916 1.00 70.71  ? 14   LYS B CE  1 
ATOM   2530  N  NZ  . LYS B  1 14  ? 11.823  121.159 156.320 1.00 65.26  ? 14   LYS B NZ  1 
ATOM   2531  N  N   . ILE B  1 15  ? 9.491   125.448 150.960 1.00 30.43  ? 15   ILE B N   1 
ATOM   2532  C  CA  . ILE B  1 15  ? 8.823   126.032 149.807 1.00 29.18  ? 15   ILE B CA  1 
ATOM   2533  C  C   . ILE B  1 15  ? 8.466   124.947 148.806 1.00 33.12  ? 15   ILE B C   1 
ATOM   2534  O  O   . ILE B  1 15  ? 9.032   123.844 148.796 1.00 32.83  ? 15   ILE B O   1 
ATOM   2535  C  CB  . ILE B  1 15  ? 9.674   127.123 149.133 1.00 30.67  ? 15   ILE B CB  1 
ATOM   2536  C  CG1 . ILE B  1 15  ? 10.916  126.496 148.496 1.00 33.87  ? 15   ILE B CG1 1 
ATOM   2537  C  CG2 . ILE B  1 15  ? 10.037  128.207 150.176 1.00 33.43  ? 15   ILE B CG2 1 
ATOM   2538  C  CD1 . ILE B  1 15  ? 11.841  127.489 147.783 1.00 32.63  ? 15   ILE B CD1 1 
ATOM   2539  N  N   . ALA B  1 16  ? 7.491   125.280 147.962 1.00 28.48  ? 16   ALA B N   1 
ATOM   2540  C  CA  . ALA B  1 16  ? 7.023   124.357 146.951 1.00 34.52  ? 16   ALA B CA  1 
ATOM   2541  C  C   . ALA B  1 16  ? 8.115   124.117 145.927 1.00 36.05  ? 16   ALA B C   1 
ATOM   2542  O  O   . ALA B  1 16  ? 8.781   125.050 145.475 1.00 33.17  ? 16   ALA B O   1 
ATOM   2543  C  CB  . ALA B  1 16  ? 5.759   124.890 146.266 1.00 28.67  ? 16   ALA B CB  1 
ATOM   2544  N  N   . ASN B  1 17  ? 8.296   122.853 145.566 1.00 29.51  ? 17   ASN B N   1 
ATOM   2545  C  CA  . ASN B  1 17  ? 9.295   122.452 144.586 1.00 36.58  ? 17   ASN B CA  1 
ATOM   2546  C  C   . ASN B  1 17  ? 8.601   122.381 143.229 1.00 37.98  ? 17   ASN B C   1 
ATOM   2547  O  O   . ASN B  1 17  ? 8.114   121.338 142.799 1.00 39.22  ? 17   ASN B O   1 
ATOM   2548  C  CB  . ASN B  1 17  ? 9.928   121.137 145.007 1.00 38.09  ? 17   ASN B CB  1 
ATOM   2549  C  CG  . ASN B  1 17  ? 11.040  120.705 144.085 1.00 42.22  ? 17   ASN B CG  1 
ATOM   2550  O  OD1 . ASN B  1 17  ? 11.362  121.384 143.108 1.00 44.14  ? 17   ASN B OD1 1 
ATOM   2551  N  ND2 . ASN B  1 17  ? 11.662  119.585 144.411 1.00 34.91  ? 17   ASN B ND2 1 
ATOM   2552  N  N   . LYS B  1 18  ? 8.535   123.521 142.555 1.00 39.49  ? 18   LYS B N   1 
ATOM   2553  C  CA  . LYS B  1 18  ? 7.884   123.629 141.258 1.00 41.98  ? 18   LYS B CA  1 
ATOM   2554  C  C   . LYS B  1 18  ? 8.526   124.784 140.506 1.00 41.43  ? 18   LYS B C   1 
ATOM   2555  O  O   . LYS B  1 18  ? 9.158   125.650 141.123 1.00 46.33  ? 18   LYS B O   1 
ATOM   2556  C  CB  . LYS B  1 18  ? 6.369   123.837 141.413 1.00 52.01  ? 18   LYS B CB  1 
ATOM   2557  C  CG  . LYS B  1 18  ? 5.975   125.086 142.175 1.00 63.58  ? 18   LYS B CG  1 
ATOM   2558  C  CD  . LYS B  1 18  ? 4.464   125.154 142.405 1.00 75.55  ? 18   LYS B CD  1 
ATOM   2559  C  CE  . LYS B  1 18  ? 3.693   125.357 141.111 1.00 82.96  ? 18   LYS B CE  1 
ATOM   2560  N  NZ  . LYS B  1 18  ? 2.240   125.552 141.376 1.00 87.63  ? 18   LYS B NZ  1 
ATOM   2561  N  N   . PRO B  1 19  ? 8.429   124.800 139.171 1.00 66.35  ? 19   PRO B N   1 
ATOM   2562  C  CA  . PRO B  1 19  ? 9.139   125.845 138.408 1.00 63.15  ? 19   PRO B CA  1 
ATOM   2563  C  C   . PRO B  1 19  ? 8.835   127.271 138.857 1.00 66.78  ? 19   PRO B C   1 
ATOM   2564  O  O   . PRO B  1 19  ? 9.743   128.113 138.868 1.00 63.60  ? 19   PRO B O   1 
ATOM   2565  C  CB  . PRO B  1 19  ? 8.683   125.583 136.964 1.00 63.79  ? 19   PRO B CB  1 
ATOM   2566  C  CG  . PRO B  1 19  ? 8.420   124.114 136.926 1.00 63.35  ? 19   PRO B CG  1 
ATOM   2567  C  CD  . PRO B  1 19  ? 7.845   123.774 138.287 1.00 63.47  ? 19   PRO B CD  1 
ATOM   2568  N  N   . ASP B  1 20  ? 7.592   127.561 139.250 1.00 72.82  ? 20   ASP B N   1 
ATOM   2569  C  CA  . ASP B  1 20  ? 7.242   128.910 139.690 1.00 74.58  ? 20   ASP B CA  1 
ATOM   2570  C  C   . ASP B  1 20  ? 8.072   129.365 140.881 1.00 74.32  ? 20   ASP B C   1 
ATOM   2571  O  O   . ASP B  1 20  ? 8.400   130.551 140.982 1.00 63.86  ? 20   ASP B O   1 
ATOM   2572  C  CB  . ASP B  1 20  ? 5.761   128.976 140.039 1.00 81.99  ? 20   ASP B CB  1 
ATOM   2573  C  CG  . ASP B  1 20  ? 4.889   128.594 138.882 1.00 94.75  ? 20   ASP B CG  1 
ATOM   2574  O  OD1 . ASP B  1 20  ? 4.626   127.380 138.716 1.00 101.52 ? 20   ASP B OD1 1 
ATOM   2575  O  OD2 . ASP B  1 20  ? 4.496   129.507 138.123 1.00 95.62  ? 20   ASP B OD2 1 
ATOM   2576  N  N   . SER B  1 21  ? 8.417   128.444 141.785 1.00 62.76  ? 21   SER B N   1 
ATOM   2577  C  CA  . SER B  1 21  ? 9.161   128.814 142.986 1.00 67.48  ? 21   SER B CA  1 
ATOM   2578  C  C   . SER B  1 21  ? 10.577  129.270 142.659 1.00 62.16  ? 21   SER B C   1 
ATOM   2579  O  O   . SER B  1 21  ? 11.091  130.199 143.289 1.00 62.09  ? 21   SER B O   1 
ATOM   2580  C  CB  . SER B  1 21  ? 9.208   127.642 143.965 1.00 61.33  ? 21   SER B CB  1 
ATOM   2581  O  OG  . SER B  1 21  ? 7.910   127.274 144.371 1.00 61.33  ? 21   SER B OG  1 
ATOM   2582  N  N   . TYR B  1 22  ? 11.245  128.589 141.721 1.00 62.17  ? 22   TYR B N   1 
ATOM   2583  C  CA  . TYR B  1 22  ? 12.571  129.028 141.302 1.00 62.20  ? 22   TYR B CA  1 
ATOM   2584  C  C   . TYR B  1 22  ? 12.489  130.397 140.641 1.00 65.89  ? 22   TYR B C   1 
ATOM   2585  O  O   . TYR B  1 22  ? 13.364  131.248 140.838 1.00 63.00  ? 22   TYR B O   1 
ATOM   2586  C  CB  . TYR B  1 22  ? 13.209  128.021 140.353 1.00 62.11  ? 22   TYR B CB  1 
ATOM   2587  C  CG  . TYR B  1 22  ? 13.473  126.686 140.991 1.00 70.78  ? 22   TYR B CG  1 
ATOM   2588  C  CD1 . TYR B  1 22  ? 14.661  126.455 141.677 1.00 69.52  ? 22   TYR B CD1 1 
ATOM   2589  C  CD2 . TYR B  1 22  ? 12.541  125.656 140.926 1.00 69.86  ? 22   TYR B CD2 1 
ATOM   2590  C  CE1 . TYR B  1 22  ? 14.912  125.226 142.270 1.00 73.49  ? 22   TYR B CE1 1 
ATOM   2591  C  CE2 . TYR B  1 22  ? 12.776  124.429 141.518 1.00 71.75  ? 22   TYR B CE2 1 
ATOM   2592  C  CZ  . TYR B  1 22  ? 13.968  124.217 142.191 1.00 72.67  ? 22   TYR B CZ  1 
ATOM   2593  O  OH  . TYR B  1 22  ? 14.228  123.001 142.789 1.00 70.64  ? 22   TYR B OH  1 
ATOM   2594  N  N   . GLU B  1 23  ? 11.421  130.646 139.878 1.00 68.92  ? 23   GLU B N   1 
ATOM   2595  C  CA  . GLU B  1 23  ? 11.263  131.945 139.221 1.00 77.15  ? 23   GLU B CA  1 
ATOM   2596  C  C   . GLU B  1 23  ? 11.077  133.072 140.241 1.00 72.32  ? 23   GLU B C   1 
ATOM   2597  O  O   . GLU B  1 23  ? 11.714  134.123 140.138 1.00 70.34  ? 23   GLU B O   1 
ATOM   2598  C  CB  . GLU B  1 23  ? 10.114  131.904 138.231 1.00 88.10  ? 23   GLU B CB  1 
ATOM   2599  C  CG  . GLU B  1 23  ? 9.992   133.180 137.386 1.00 101.10 ? 23   GLU B CG  1 
ATOM   2600  C  CD  . GLU B  1 23  ? 11.227  133.405 136.500 1.00 110.10 ? 23   GLU B CD  1 
ATOM   2601  O  OE1 . GLU B  1 23  ? 11.891  132.407 136.112 1.00 110.55 ? 23   GLU B OE1 1 
ATOM   2602  O  OE2 . GLU B  1 23  ? 11.521  134.581 136.167 1.00 118.36 ? 23   GLU B OE2 1 
ATOM   2603  N  N   . THR B  1 24  ? 10.177  132.891 141.214 1.00 64.81  ? 24   THR B N   1 
ATOM   2604  C  CA  . THR B  1 24  ? 9.959   133.959 142.190 1.00 68.33  ? 24   THR B CA  1 
ATOM   2605  C  C   . THR B  1 24  ? 11.180  134.158 143.088 1.00 71.68  ? 24   THR B C   1 
ATOM   2606  O  O   . THR B  1 24  ? 11.403  135.273 143.587 1.00 63.69  ? 24   THR B O   1 
ATOM   2607  C  CB  . THR B  1 24  ? 8.697   133.707 143.016 1.00 69.49  ? 24   THR B CB  1 
ATOM   2608  O  OG1 . THR B  1 24  ? 8.975   132.760 144.058 1.00 76.04  ? 24   THR B OG1 1 
ATOM   2609  C  CG2 . THR B  1 24  ? 7.550   133.212 142.163 1.00 64.49  ? 24   THR B CG2 1 
ATOM   2610  N  N   . MET B  1 25  ? 11.990  133.110 143.281 1.00 62.92  ? 25   MET B N   1 
ATOM   2611  C  CA  . MET B  1 25  ? 13.239  133.265 144.022 1.00 70.34  ? 25   MET B CA  1 
ATOM   2612  C  C   . MET B  1 25  ? 14.234  134.132 143.256 1.00 76.77  ? 25   MET B C   1 
ATOM   2613  O  O   . MET B  1 25  ? 15.024  134.865 143.866 1.00 79.87  ? 25   MET B O   1 
ATOM   2614  C  CB  . MET B  1 25  ? 13.879  131.911 144.318 1.00 61.60  ? 25   MET B CB  1 
ATOM   2615  C  CG  . MET B  1 25  ? 13.406  131.267 145.585 1.00 60.92  ? 25   MET B CG  1 
ATOM   2616  S  SD  . MET B  1 25  ? 14.462  129.885 146.014 1.00 71.39  ? 25   MET B SD  1 
ATOM   2617  C  CE  . MET B  1 25  ? 14.289  128.851 144.567 1.00 67.56  ? 25   MET B CE  1 
ATOM   2618  N  N   . MET B  1 26  ? 14.198  134.069 141.928 1.00 76.17  ? 26   MET B N   1 
ATOM   2619  C  CA  . MET B  1 26  ? 15.087  134.853 141.088 1.00 76.15  ? 26   MET B CA  1 
ATOM   2620  C  C   . MET B  1 26  ? 14.600  136.282 140.907 1.00 67.25  ? 26   MET B C   1 
ATOM   2621  O  O   . MET B  1 26  ? 15.416  137.165 140.638 1.00 73.78  ? 26   MET B O   1 
ATOM   2622  C  CB  . MET B  1 26  ? 15.214  134.155 139.732 1.00 76.08  ? 26   MET B CB  1 
ATOM   2623  C  CG  . MET B  1 26  ? 15.984  132.854 139.784 1.00 87.71  ? 26   MET B CG  1 
ATOM   2624  S  SD  . MET B  1 26  ? 16.574  132.341 138.162 1.00 108.37 ? 26   MET B SD  1 
ATOM   2625  C  CE  . MET B  1 26  ? 15.079  131.607 137.485 1.00 107.12 ? 26   MET B CE  1 
ATOM   2626  N  N   . LYS B  1 27  ? 13.303  136.526 141.113 1.00 70.34  ? 27   LYS B N   1 
ATOM   2627  C  CA  . LYS B  1 27  ? 12.641  137.823 140.993 1.00 73.66  ? 27   LYS B CA  1 
ATOM   2628  C  C   . LYS B  1 27  ? 12.629  138.622 142.292 1.00 72.83  ? 27   LYS B C   1 
ATOM   2629  O  O   . LYS B  1 27  ? 12.855  139.837 142.274 1.00 76.42  ? 27   LYS B O   1 
ATOM   2630  C  CB  . LYS B  1 27  ? 11.186  137.618 140.549 1.00 80.89  ? 27   LYS B CB  1 
ATOM   2631  C  CG  . LYS B  1 27  ? 10.270  138.848 140.747 1.00 89.60  ? 27   LYS B CG  1 
ATOM   2632  C  CD  . LYS B  1 27  ? 9.221   139.033 139.645 1.00 88.52  ? 27   LYS B CD  1 
ATOM   2633  C  CE  . LYS B  1 27  ? 8.090   139.946 140.135 1.00 77.09  ? 27   LYS B CE  1 
ATOM   2634  N  NZ  . LYS B  1 27  ? 7.131   139.254 141.071 1.00 67.33  ? 27   LYS B NZ  1 
ATOM   2635  N  N   . VAL B  1 28  ? 12.381  137.970 143.425 1.00 66.28  ? 28   VAL B N   1 
ATOM   2636  C  CA  . VAL B  1 28  ? 12.213  138.695 144.676 1.00 70.36  ? 28   VAL B CA  1 
ATOM   2637  C  C   . VAL B  1 28  ? 13.479  138.601 145.521 1.00 75.83  ? 28   VAL B C   1 
ATOM   2638  O  O   . VAL B  1 28  ? 13.845  139.560 146.212 1.00 72.59  ? 28   VAL B O   1 
ATOM   2639  C  CB  . VAL B  1 28  ? 10.978  138.179 145.438 1.00 67.47  ? 28   VAL B CB  1 
ATOM   2640  C  CG1 . VAL B  1 28  ? 10.809  138.932 146.749 1.00 64.82  ? 28   VAL B CG1 1 
ATOM   2641  C  CG2 . VAL B  1 28  ? 9.731   138.310 144.572 1.00 66.57  ? 28   VAL B CG2 1 
ATOM   2642  N  N   . GLY B  1 29  ? 14.161  137.455 145.455 1.00 53.34  ? 29   GLY B N   1 
ATOM   2643  C  CA  . GLY B  1 29  ? 15.351  137.200 146.242 1.00 62.87  ? 29   GLY B CA  1 
ATOM   2644  C  C   . GLY B  1 29  ? 16.391  138.309 146.244 1.00 69.15  ? 29   GLY B C   1 
ATOM   2645  O  O   . GLY B  1 29  ? 16.768  138.835 147.302 1.00 64.36  ? 29   GLY B O   1 
ATOM   2646  N  N   . PRO B  1 30  ? 16.885  138.687 145.061 1.00 72.05  ? 30   PRO B N   1 
ATOM   2647  C  CA  . PRO B  1 30  ? 17.834  139.811 145.019 1.00 67.47  ? 30   PRO B CA  1 
ATOM   2648  C  C   . PRO B  1 30  ? 17.277  141.071 145.656 1.00 61.23  ? 30   PRO B C   1 
ATOM   2649  O  O   . PRO B  1 30  ? 18.015  141.783 146.349 1.00 58.02  ? 30   PRO B O   1 
ATOM   2650  C  CB  . PRO B  1 30  ? 18.107  139.984 143.517 1.00 63.12  ? 30   PRO B CB  1 
ATOM   2651  C  CG  . PRO B  1 30  ? 17.844  138.638 142.939 1.00 65.56  ? 30   PRO B CG  1 
ATOM   2652  C  CD  . PRO B  1 30  ? 16.735  138.037 143.747 1.00 68.34  ? 30   PRO B CD  1 
ATOM   2653  N  N   . LYS B  1 31  ? 15.977  141.339 145.483 1.00 55.17  ? 31   LYS B N   1 
ATOM   2654  C  CA  . LYS B  1 31  ? 15.397  142.559 146.037 1.00 53.53  ? 31   LYS B CA  1 
ATOM   2655  C  C   . LYS B  1 31  ? 15.397  142.530 147.564 1.00 50.54  ? 31   LYS B C   1 
ATOM   2656  O  O   . LYS B  1 31  ? 15.638  143.559 148.208 1.00 47.44  ? 31   LYS B O   1 
ATOM   2657  C  CB  . LYS B  1 31  ? 13.983  142.771 145.489 1.00 50.71  ? 31   LYS B CB  1 
ATOM   2658  C  CG  . LYS B  1 31  ? 13.917  142.976 143.973 1.00 44.19  ? 31   LYS B CG  1 
ATOM   2659  C  CD  . LYS B  1 31  ? 12.520  143.387 143.585 1.00 49.18  ? 31   LYS B CD  1 
ATOM   2660  C  CE  . LYS B  1 31  ? 12.464  144.175 142.294 1.00 52.67  ? 31   LYS B CE  1 
ATOM   2661  N  NZ  . LYS B  1 31  ? 12.871  143.408 141.125 1.00 54.56  ? 31   LYS B NZ  1 
ATOM   2662  N  N   . VAL B  1 32  ? 15.162  141.368 148.166 1.00 42.47  ? 32   VAL B N   1 
ATOM   2663  C  CA  . VAL B  1 32  ? 15.214  141.284 149.620 1.00 45.59  ? 32   VAL B CA  1 
ATOM   2664  C  C   . VAL B  1 32  ? 16.645  141.526 150.130 1.00 48.45  ? 32   VAL B C   1 
ATOM   2665  O  O   . VAL B  1 32  ? 16.846  142.216 151.124 1.00 48.70  ? 32   VAL B O   1 
ATOM   2666  C  CB  . VAL B  1 32  ? 14.683  139.940 150.121 1.00 46.85  ? 32   VAL B CB  1 
ATOM   2667  C  CG1 . VAL B  1 32  ? 14.871  139.843 151.618 1.00 43.48  ? 32   VAL B CG1 1 
ATOM   2668  C  CG2 . VAL B  1 32  ? 13.229  139.796 149.766 1.00 41.07  ? 32   VAL B CG2 1 
HETATM 2669  N  N   . CSS B  1 33  ? 17.635  140.961 149.446 1.00 50.35  ? 33   CSS B N   1 
HETATM 2670  C  CA  . CSS B  1 33  ? 19.020  141.138 149.827 1.00 48.29  ? 33   CSS B CA  1 
HETATM 2671  C  CB  . CSS B  1 33  ? 19.914  140.299 148.966 1.00 54.51  ? 33   CSS B CB  1 
HETATM 2672  S  SG  . CSS B  1 33  ? 19.608  138.595 149.331 1.00 63.99  ? 33   CSS B SG  1 
HETATM 2673  S  SD  . CSS B  1 33  ? 19.654  138.409 151.339 0.50 70.59  ? 33   CSS B SD  1 
HETATM 2674  C  C   . CSS B  1 33  ? 19.423  142.571 149.732 1.00 48.81  ? 33   CSS B C   1 
HETATM 2675  O  O   . CSS B  1 33  ? 20.233  143.058 150.573 1.00 52.54  ? 33   CSS B O   1 
ATOM   2676  N  N   . ILE B  1 34  ? 18.872  143.283 148.752 1.00 50.43  ? 34   ILE B N   1 
ATOM   2677  C  CA  . ILE B  1 34  ? 19.197  144.693 148.549 1.00 47.65  ? 34   ILE B CA  1 
ATOM   2678  C  C   . ILE B  1 34  ? 18.654  145.560 149.678 1.00 42.02  ? 34   ILE B C   1 
ATOM   2679  O  O   . ILE B  1 34  ? 19.348  146.449 150.157 1.00 44.15  ? 34   ILE B O   1 
ATOM   2680  C  CB  . ILE B  1 34  ? 18.671  145.197 147.201 1.00 46.12  ? 34   ILE B CB  1 
ATOM   2681  C  CG1 . ILE B  1 34  ? 19.394  144.490 146.056 1.00 49.21  ? 34   ILE B CG1 1 
ATOM   2682  C  CG2 . ILE B  1 34  ? 18.909  146.683 147.075 1.00 37.10  ? 34   ILE B CG2 1 
ATOM   2683  C  CD1 . ILE B  1 34  ? 18.784  144.779 144.714 1.00 47.44  ? 34   ILE B CD1 1 
ATOM   2684  N  N   . THR B  1 35  ? 17.414  145.324 150.110 1.00 39.55  ? 35   THR B N   1 
ATOM   2685  C  CA  . THR B  1 35  ? 16.929  146.073 151.266 1.00 43.89  ? 35   THR B CA  1 
ATOM   2686  C  C   . THR B  1 35  ? 17.767  145.748 152.501 1.00 38.21  ? 35   THR B C   1 
ATOM   2687  O  O   . THR B  1 35  ? 18.117  146.642 153.274 1.00 43.28  ? 35   THR B O   1 
ATOM   2688  C  CB  . THR B  1 35  ? 15.421  145.842 151.519 1.00 47.60  ? 35   THR B CB  1 
ATOM   2689  O  OG1 . THR B  1 35  ? 15.219  144.823 152.498 1.00 57.29  ? 35   THR B OG1 1 
ATOM   2690  C  CG2 . THR B  1 35  ? 14.679  145.480 150.248 1.00 35.61  ? 35   THR B CG2 1 
ATOM   2691  N  N   . THR B  1 36  ? 18.098  144.469 152.702 1.00 34.86  ? 36   THR B N   1 
ATOM   2692  C  CA  . THR B  1 36  ? 18.890  144.080 153.864 1.00 37.98  ? 36   THR B CA  1 
ATOM   2693  C  C   . THR B  1 36  ? 20.242  144.794 153.869 1.00 43.79  ? 36   THR B C   1 
ATOM   2694  O  O   . THR B  1 36  ? 20.706  145.257 154.918 1.00 49.36  ? 36   THR B O   1 
ATOM   2695  C  CB  . THR B  1 36  ? 19.036  142.553 153.890 1.00 45.90  ? 36   THR B CB  1 
ATOM   2696  O  OG1 . THR B  1 36  ? 17.729  141.964 153.908 1.00 54.03  ? 36   THR B OG1 1 
ATOM   2697  C  CG2 . THR B  1 36  ? 19.776  142.085 155.103 1.00 43.63  ? 36   THR B CG2 1 
ATOM   2698  N  N   . ALA B  1 37  ? 20.872  144.930 152.702 1.00 37.99  ? 37   ALA B N   1 
ATOM   2699  C  CA  . ALA B  1 37  ? 22.193  145.553 152.650 1.00 38.49  ? 37   ALA B CA  1 
ATOM   2700  C  C   . ALA B  1 37  ? 22.154  147.068 152.822 1.00 37.67  ? 37   ALA B C   1 
ATOM   2701  O  O   . ALA B  1 37  ? 23.203  147.715 152.729 1.00 43.79  ? 37   ALA B O   1 
ATOM   2702  C  CB  . ALA B  1 37  ? 22.897  145.192 151.333 1.00 38.58  ? 37   ALA B CB  1 
ATOM   2703  N  N   . SER B  1 38  ? 20.990  147.657 153.087 1.00 40.12  ? 38   SER B N   1 
ATOM   2704  C  CA  . SER B  1 38  ? 20.936  149.077 153.429 1.00 37.04  ? 38   SER B CA  1 
ATOM   2705  C  C   . SER B  1 38  ? 21.443  149.367 154.841 1.00 42.56  ? 38   SER B C   1 
ATOM   2706  O  O   . SER B  1 38  ? 21.686  150.534 155.179 1.00 40.44  ? 38   SER B O   1 
ATOM   2707  C  CB  . SER B  1 38  ? 19.498  149.583 153.281 1.00 37.28  ? 38   SER B CB  1 
ATOM   2708  O  OG  . SER B  1 38  ? 18.628  148.928 154.210 1.00 39.88  ? 38   SER B OG  1 
ATOM   2709  N  N   . HIS B  1 39  ? 21.620  148.358 155.651 1.00 36.84  ? 39   HIS B N   1 
ATOM   2710  C  CA  . HIS B  1 39  ? 21.930  148.609 157.048 1.00 33.40  ? 39   HIS B CA  1 
ATOM   2711  C  C   . HIS B  1 39  ? 23.415  148.438 157.306 1.00 33.38  ? 39   HIS B C   1 
ATOM   2712  O  O   . HIS B  1 39  ? 24.009  147.447 156.854 1.00 35.87  ? 39   HIS B O   1 
ATOM   2713  C  CB  . HIS B  1 39  ? 21.143  147.665 157.941 1.00 34.80  ? 39   HIS B CB  1 
ATOM   2714  C  CG  . HIS B  1 39  ? 21.179  148.051 159.377 1.00 37.74  ? 39   HIS B CG  1 
ATOM   2715  N  ND1 . HIS B  1 39  ? 22.295  147.862 160.163 1.00 39.47  ? 39   HIS B ND1 1 
ATOM   2716  C  CD2 . HIS B  1 39  ? 20.244  148.622 160.173 1.00 33.35  ? 39   HIS B CD2 1 
ATOM   2717  C  CE1 . HIS B  1 39  ? 22.053  148.311 161.380 1.00 33.92  ? 39   HIS B CE1 1 
ATOM   2718  N  NE2 . HIS B  1 39  ? 20.813  148.768 161.416 1.00 42.82  ? 39   HIS B NE2 1 
ATOM   2719  N  N   . PRO B  1 40  ? 24.040  149.363 158.035 1.00 33.68  ? 40   PRO B N   1 
ATOM   2720  C  CA  . PRO B  1 40  ? 25.493  149.277 158.231 1.00 33.56  ? 40   PRO B CA  1 
ATOM   2721  C  C   . PRO B  1 40  ? 25.945  148.078 159.054 1.00 34.17  ? 40   PRO B C   1 
ATOM   2722  O  O   . PRO B  1 40  ? 27.113  147.692 158.951 1.00 34.46  ? 40   PRO B O   1 
ATOM   2723  C  CB  . PRO B  1 40  ? 25.829  150.603 158.942 1.00 33.28  ? 40   PRO B CB  1 
ATOM   2724  C  CG  . PRO B  1 40  ? 24.571  151.030 159.581 1.00 33.06  ? 40   PRO B CG  1 
ATOM   2725  C  CD  . PRO B  1 40  ? 23.458  150.567 158.657 1.00 34.12  ? 40   PRO B CD  1 
ATOM   2726  N  N   . GLY B  1 41  ? 25.065  147.442 159.807 1.00 34.38  ? 41   GLY B N   1 
ATOM   2727  C  CA  . GLY B  1 41  ? 25.449  146.253 160.523 1.00 34.96  ? 41   GLY B CA  1 
ATOM   2728  C  C   . GLY B  1 41  ? 25.421  144.955 159.737 1.00 37.09  ? 41   GLY B C   1 
ATOM   2729  O  O   . GLY B  1 41  ? 25.732  143.908 160.311 1.00 35.77  ? 41   GLY B O   1 
ATOM   2730  N  N   . PHE B  1 42  ? 25.048  144.993 158.455 1.00 35.46  ? 42   PHE B N   1 
ATOM   2731  C  CA  . PHE B  1 42  ? 24.884  143.784 157.649 1.00 33.03  ? 42   PHE B CA  1 
ATOM   2732  C  C   . PHE B  1 42  ? 26.219  143.323 157.076 1.00 32.80  ? 42   PHE B C   1 
ATOM   2733  O  O   . PHE B  1 42  ? 26.915  144.088 156.399 1.00 36.93  ? 42   PHE B O   1 
ATOM   2734  C  CB  . PHE B  1 42  ? 23.890  144.043 156.516 1.00 31.55  ? 42   PHE B CB  1 
ATOM   2735  C  CG  . PHE B  1 42  ? 23.726  142.887 155.567 1.00 30.33  ? 42   PHE B CG  1 
ATOM   2736  C  CD1 . PHE B  1 42  ? 23.087  141.725 155.975 1.00 36.45  ? 42   PHE B CD1 1 
ATOM   2737  C  CD2 . PHE B  1 42  ? 24.206  142.962 154.271 1.00 36.51  ? 42   PHE B CD2 1 
ATOM   2738  C  CE1 . PHE B  1 42  ? 22.920  140.644 155.102 1.00 32.25  ? 42   PHE B CE1 1 
ATOM   2739  C  CE2 . PHE B  1 42  ? 24.047  141.894 153.389 1.00 36.12  ? 42   PHE B CE2 1 
ATOM   2740  C  CZ  . PHE B  1 42  ? 23.401  140.729 153.808 1.00 34.39  ? 42   PHE B CZ  1 
ATOM   2741  N  N   . LEU B  1 43  ? 26.563  142.057 157.318 1.00 34.01  ? 43   LEU B N   1 
ATOM   2742  C  CA  . LEU B  1 43  ? 27.882  141.549 156.969 1.00 29.84  ? 43   LEU B CA  1 
ATOM   2743  C  C   . LEU B  1 43  ? 27.899  140.566 155.813 1.00 37.58  ? 43   LEU B C   1 
ATOM   2744  O  O   . LEU B  1 43  ? 28.970  140.355 155.231 1.00 38.10  ? 43   LEU B O   1 
ATOM   2745  C  CB  . LEU B  1 43  ? 28.528  140.881 158.187 1.00 29.05  ? 43   LEU B CB  1 
ATOM   2746  C  CG  . LEU B  1 43  ? 28.586  141.810 159.406 1.00 32.28  ? 43   LEU B CG  1 
ATOM   2747  C  CD1 . LEU B  1 43  ? 29.135  141.086 160.613 1.00 38.16  ? 43   LEU B CD1 1 
ATOM   2748  C  CD2 . LEU B  1 43  ? 29.421  143.050 159.093 1.00 32.69  ? 43   LEU B CD2 1 
ATOM   2749  N  N   . GLY B  1 44  ? 26.767  139.969 155.460 1.00 33.43  ? 44   GLY B N   1 
ATOM   2750  C  CA  . GLY B  1 44  ? 26.744  139.024 154.360 1.00 27.39  ? 44   GLY B CA  1 
ATOM   2751  C  C   . GLY B  1 44  ? 25.573  138.074 154.485 1.00 32.33  ? 44   GLY B C   1 
ATOM   2752  O  O   . GLY B  1 44  ? 24.770  138.154 155.413 1.00 30.22  ? 44   GLY B O   1 
ATOM   2753  N  N   . PHE B  1 45  ? 25.476  137.173 153.507 1.00 29.08  ? 45   PHE B N   1 
ATOM   2754  C  CA  . PHE B  1 45  ? 24.360  136.248 153.522 1.00 30.06  ? 45   PHE B CA  1 
ATOM   2755  C  C   . PHE B  1 45  ? 24.734  134.954 152.809 1.00 33.02  ? 45   PHE B C   1 
ATOM   2756  O  O   . PHE B  1 45  ? 25.685  134.897 152.033 1.00 33.12  ? 45   PHE B O   1 
ATOM   2757  C  CB  . PHE B  1 45  ? 23.100  136.887 152.901 1.00 31.78  ? 45   PHE B CB  1 
ATOM   2758  C  CG  . PHE B  1 45  ? 23.164  137.055 151.414 1.00 31.67  ? 45   PHE B CG  1 
ATOM   2759  C  CD1 . PHE B  1 45  ? 22.814  136.010 150.566 1.00 40.28  ? 45   PHE B CD1 1 
ATOM   2760  C  CD2 . PHE B  1 45  ? 23.530  138.263 150.859 1.00 33.98  ? 45   PHE B CD2 1 
ATOM   2761  C  CE1 . PHE B  1 45  ? 22.867  136.167 149.186 1.00 44.68  ? 45   PHE B CE1 1 
ATOM   2762  C  CE2 . PHE B  1 45  ? 23.569  138.435 149.485 1.00 35.46  ? 45   PHE B CE2 1 
ATOM   2763  C  CZ  . PHE B  1 45  ? 23.252  137.390 148.649 1.00 38.94  ? 45   PHE B CZ  1 
ATOM   2764  N  N   . GLU B  1 46  ? 23.950  133.915 153.083 1.00 28.35  ? 46   GLU B N   1 
ATOM   2765  C  CA  . GLU B  1 46  ? 24.046  132.628 152.399 1.00 35.03  ? 46   GLU B CA  1 
ATOM   2766  C  C   . GLU B  1 46  ? 22.626  132.216 152.073 1.00 29.89  ? 46   GLU B C   1 
ATOM   2767  O  O   . GLU B  1 46  ? 21.807  132.094 152.988 1.00 35.86  ? 46   GLU B O   1 
ATOM   2768  C  CB  . GLU B  1 46  ? 24.693  131.546 153.272 1.00 31.42  ? 46   GLU B CB  1 
ATOM   2769  C  CG  . GLU B  1 46  ? 26.010  131.922 153.869 1.00 40.79  ? 46   GLU B CG  1 
ATOM   2770  C  CD  . GLU B  1 46  ? 27.153  131.742 152.892 1.00 46.76  ? 46   GLU B CD  1 
ATOM   2771  O  OE1 . GLU B  1 46  ? 26.909  131.189 151.796 1.00 43.90  ? 46   GLU B OE1 1 
ATOM   2772  O  OE2 . GLU B  1 46  ? 28.281  132.166 153.223 1.00 48.12  ? 46   GLU B OE2 1 
ATOM   2773  N  N   . GLN B  1 47  ? 22.325  132.019 150.788 1.00 36.97  ? 47   GLN B N   1 
ATOM   2774  C  CA  . GLN B  1 47  ? 21.034  131.478 150.362 1.00 33.87  ? 47   GLN B CA  1 
ATOM   2775  C  C   . GLN B  1 47  ? 21.198  129.980 150.074 1.00 34.90  ? 47   GLN B C   1 
ATOM   2776  O  O   . GLN B  1 47  ? 21.836  129.592 149.087 1.00 30.89  ? 47   GLN B O   1 
ATOM   2777  C  CB  . GLN B  1 47  ? 20.499  132.211 149.134 1.00 32.08  ? 47   GLN B CB  1 
ATOM   2778  C  CG  . GLN B  1 47  ? 19.051  131.829 148.819 1.00 52.90  ? 47   GLN B CG  1 
ATOM   2779  C  CD  . GLN B  1 47  ? 18.531  132.413 147.508 1.00 76.37  ? 47   GLN B CD  1 
ATOM   2780  O  OE1 . GLN B  1 47  ? 19.175  132.291 146.460 1.00 81.21  ? 47   GLN B OE1 1 
ATOM   2781  N  NE2 . GLN B  1 47  ? 17.351  133.035 147.559 1.00 82.39  ? 47   GLN B NE2 1 
ATOM   2782  N  N   . LEU B  1 48  ? 20.614  129.138 150.927 1.00 29.53  ? 48   LEU B N   1 
ATOM   2783  C  CA  . LEU B  1 48  ? 20.798  127.696 150.853 1.00 27.04  ? 48   LEU B CA  1 
ATOM   2784  C  C   . LEU B  1 48  ? 19.491  127.009 150.450 1.00 33.60  ? 48   LEU B C   1 
ATOM   2785  O  O   . LEU B  1 48  ? 18.457  127.207 151.096 1.00 31.64  ? 48   LEU B O   1 
ATOM   2786  C  CB  . LEU B  1 48  ? 21.289  127.144 152.194 1.00 25.28  ? 48   LEU B CB  1 
ATOM   2787  C  CG  . LEU B  1 48  ? 22.542  127.735 152.827 1.00 33.09  ? 48   LEU B CG  1 
ATOM   2788  C  CD1 . LEU B  1 48  ? 22.829  127.000 154.130 1.00 34.58  ? 48   LEU B CD1 1 
ATOM   2789  C  CD2 . LEU B  1 48  ? 23.735  127.660 151.863 1.00 31.15  ? 48   LEU B CD2 1 
ATOM   2790  N  N   . LEU B  1 49  ? 19.544  126.193 149.394 1.00 26.74  ? 49   LEU B N   1 
ATOM   2791  C  CA  . LEU B  1 49  ? 18.392  125.421 148.934 1.00 28.80  ? 49   LEU B CA  1 
ATOM   2792  C  C   . LEU B  1 49  ? 18.634  123.941 149.206 1.00 29.11  ? 49   LEU B C   1 
ATOM   2793  O  O   . LEU B  1 49  ? 19.672  123.393 148.816 1.00 30.14  ? 49   LEU B O   1 
ATOM   2794  C  CB  . LEU B  1 49  ? 18.138  125.658 147.448 1.00 27.94  ? 49   LEU B CB  1 
ATOM   2795  C  CG  . LEU B  1 49  ? 16.885  125.026 146.858 1.00 42.66  ? 49   LEU B CG  1 
ATOM   2796  C  CD1 . LEU B  1 49  ? 15.638  125.602 147.554 1.00 34.37  ? 49   LEU B CD1 1 
ATOM   2797  C  CD2 . LEU B  1 49  ? 16.836  125.274 145.349 1.00 44.71  ? 49   LEU B CD2 1 
ATOM   2798  N  N   . GLN B  1 50  ? 17.684  123.304 149.881 1.00 26.53  ? 50   GLN B N   1 
ATOM   2799  C  CA  . GLN B  1 50  ? 17.859  121.911 150.257 1.00 27.65  ? 50   GLN B CA  1 
ATOM   2800  C  C   . GLN B  1 50  ? 17.872  121.038 149.014 1.00 35.78  ? 50   GLN B C   1 
ATOM   2801  O  O   . GLN B  1 50  ? 17.025  121.188 148.130 1.00 31.22  ? 50   GLN B O   1 
ATOM   2802  C  CB  . GLN B  1 50  ? 16.753  121.453 151.204 1.00 27.73  ? 50   GLN B CB  1 
ATOM   2803  C  CG  . GLN B  1 50  ? 16.927  119.968 151.624 1.00 24.70  ? 50   GLN B CG  1 
ATOM   2804  C  CD  . GLN B  1 50  ? 15.874  119.483 152.629 1.00 31.84  ? 50   GLN B CD  1 
ATOM   2805  O  OE1 . GLN B  1 50  ? 14.820  120.111 152.820 1.00 32.29  ? 50   GLN B OE1 1 
ATOM   2806  N  NE2 . GLN B  1 50  ? 16.175  118.363 153.294 1.00 32.94  ? 50   GLN B NE2 1 
ATOM   2807  N  N   . THR B  1 51  ? 18.838  120.123 148.953 1.00 30.37  ? 51   THR B N   1 
ATOM   2808  C  CA  . THR B  1 51  ? 18.926  119.151 147.876 1.00 29.81  ? 51   THR B CA  1 
ATOM   2809  C  C   . THR B  1 51  ? 18.704  117.731 148.349 1.00 33.91  ? 51   THR B C   1 
ATOM   2810  O  O   . THR B  1 51  ? 18.493  116.854 147.511 1.00 33.94  ? 51   THR B O   1 
ATOM   2811  C  CB  . THR B  1 51  ? 20.300  119.214 147.194 1.00 30.76  ? 51   THR B CB  1 
ATOM   2812  O  OG1 . THR B  1 51  ? 21.315  119.024 148.185 1.00 31.23  ? 51   THR B OG1 1 
ATOM   2813  C  CG2 . THR B  1 51  ? 20.504  120.562 146.556 1.00 27.74  ? 51   THR B CG2 1 
ATOM   2814  N  N   . GLY B  1 52  ? 18.752  117.480 149.656 1.00 30.87  ? 52   GLY B N   1 
ATOM   2815  C  CA  . GLY B  1 52  ? 18.557  116.129 150.157 1.00 26.63  ? 52   GLY B CA  1 
ATOM   2816  C  C   . GLY B  1 52  ? 18.874  116.044 151.640 1.00 34.98  ? 52   GLY B C   1 
ATOM   2817  O  O   . GLY B  1 52  ? 18.821  117.044 152.360 1.00 30.12  ? 52   GLY B O   1 
ATOM   2818  N  N   . ILE B  1 53  ? 19.162  114.817 152.086 1.00 31.06  ? 53   ILE B N   1 
ATOM   2819  C  CA  . ILE B  1 53  ? 19.512  114.524 153.471 1.00 31.22  ? 53   ILE B CA  1 
ATOM   2820  C  C   . ILE B  1 53  ? 20.610  113.471 153.471 1.00 33.89  ? 53   ILE B C   1 
ATOM   2821  O  O   . ILE B  1 53  ? 20.908  112.849 152.452 1.00 28.82  ? 53   ILE B O   1 
ATOM   2822  C  CB  . ILE B  1 53  ? 18.318  114.018 154.315 1.00 30.38  ? 53   ILE B CB  1 
ATOM   2823  C  CG1 . ILE B  1 53  ? 17.871  112.620 153.869 1.00 36.61  ? 53   ILE B CG1 1 
ATOM   2824  C  CG2 . ILE B  1 53  ? 17.152  114.994 154.304 1.00 27.12  ? 53   ILE B CG2 1 
ATOM   2825  C  CD1 . ILE B  1 53  ? 16.903  111.986 154.844 1.00 29.67  ? 53   ILE B CD1 1 
ATOM   2826  N  N   . HIS B  1 54  ? 21.202  113.267 154.638 1.00 34.66  ? 54   HIS B N   1 
ATOM   2827  C  CA  . HIS B  1 54  ? 22.058  112.114 154.830 1.00 32.97  ? 54   HIS B CA  1 
ATOM   2828  C  C   . HIS B  1 54  ? 21.206  110.953 155.340 1.00 30.30  ? 54   HIS B C   1 
ATOM   2829  O  O   . HIS B  1 54  ? 20.663  111.044 156.444 1.00 31.77  ? 54   HIS B O   1 
ATOM   2830  C  CB  . HIS B  1 54  ? 23.188  112.406 155.811 1.00 31.72  ? 54   HIS B CB  1 
ATOM   2831  C  CG  . HIS B  1 54  ? 24.313  111.420 155.705 1.00 41.50  ? 54   HIS B CG  1 
ATOM   2832  N  ND1 . HIS B  1 54  ? 24.142  110.076 155.959 1.00 39.32  ? 54   HIS B ND1 1 
ATOM   2833  C  CD2 . HIS B  1 54  ? 25.600  111.565 155.310 1.00 41.11  ? 54   HIS B CD2 1 
ATOM   2834  C  CE1 . HIS B  1 54  ? 25.280  109.438 155.747 1.00 39.86  ? 54   HIS B CE1 1 
ATOM   2835  N  NE2 . HIS B  1 54  ? 26.181  110.319 155.353 1.00 42.99  ? 54   HIS B NE2 1 
ATOM   2836  N  N   . PRO B  1 55  ? 21.066  109.859 154.591 1.00 29.61  ? 55   PRO B N   1 
ATOM   2837  C  CA  . PRO B  1 55  ? 20.236  108.743 155.076 1.00 38.59  ? 55   PRO B CA  1 
ATOM   2838  C  C   . PRO B  1 55  ? 20.819  108.034 156.284 1.00 43.04  ? 55   PRO B C   1 
ATOM   2839  O  O   . PRO B  1 55  ? 20.109  107.224 156.895 1.00 37.12  ? 55   PRO B O   1 
ATOM   2840  C  CB  . PRO B  1 55  ? 20.166  107.792 153.870 1.00 32.64  ? 55   PRO B CB  1 
ATOM   2841  C  CG  . PRO B  1 55  ? 20.668  108.565 152.709 1.00 30.40  ? 55   PRO B CG  1 
ATOM   2842  C  CD  . PRO B  1 55  ? 21.631  109.577 153.264 1.00 29.18  ? 55   PRO B CD  1 
ATOM   2843  N  N   . MET B  1 56  ? 22.083  108.291 156.625 1.00 41.74  ? 56   MET B N   1 
ATOM   2844  C  CA  . MET B  1 56  ? 22.734  107.751 157.825 1.00 39.83  ? 56   MET B CA  1 
ATOM   2845  C  C   . MET B  1 56  ? 22.563  106.232 157.919 1.00 40.68  ? 56   MET B C   1 
ATOM   2846  O  O   . MET B  1 56  ? 22.034  105.690 158.893 1.00 38.79  ? 56   MET B O   1 
ATOM   2847  C  CB  . MET B  1 56  ? 22.208  108.451 159.080 1.00 46.16  ? 56   MET B CB  1 
ATOM   2848  C  CG  . MET B  1 56  ? 22.887  109.777 159.347 1.00 54.47  ? 56   MET B CG  1 
ATOM   2849  S  SD  . MET B  1 56  ? 22.171  110.649 160.755 1.00 70.51  ? 56   MET B SD  1 
ATOM   2850  C  CE  . MET B  1 56  ? 22.408  109.445 162.069 1.00 66.12  ? 56   MET B CE  1 
ATOM   2851  N  N   . ALA B  1 57  ? 22.990  105.557 156.849 1.00 37.86  ? 57   ALA B N   1 
ATOM   2852  C  CA  . ALA B  1 57  ? 23.022  104.095 156.778 1.00 45.07  ? 57   ALA B CA  1 
ATOM   2853  C  C   . ALA B  1 57  ? 21.645  103.477 157.043 1.00 41.01  ? 57   ALA B C   1 
ATOM   2854  O  O   . ALA B  1 57  ? 21.527  102.432 157.687 1.00 36.87  ? 57   ALA B O   1 
ATOM   2855  C  CB  . ALA B  1 57  ? 24.077  103.506 157.718 1.00 43.39  ? 57   ALA B CB  1 
ATOM   2856  N  N   . GLY B  1 58  ? 20.589  104.127 156.557 1.00 43.10  ? 58   GLY B N   1 
ATOM   2857  C  CA  . GLY B  1 58  ? 19.246  103.583 156.648 1.00 31.21  ? 58   GLY B CA  1 
ATOM   2858  C  C   . GLY B  1 58  ? 18.445  104.111 157.816 1.00 37.15  ? 58   GLY B C   1 
ATOM   2859  O  O   . GLY B  1 58  ? 17.240  103.824 157.912 1.00 38.78  ? 58   GLY B O   1 
ATOM   2860  N  N   . ARG B  1 59  ? 19.078  104.862 158.720 1.00 35.03  ? 59   ARG B N   1 
ATOM   2861  C  CA  . ARG B  1 59  ? 18.312  105.471 159.799 1.00 36.27  ? 59   ARG B CA  1 
ATOM   2862  C  C   . ARG B  1 59  ? 17.210  106.372 159.242 1.00 44.24  ? 59   ARG B C   1 
ATOM   2863  O  O   . ARG B  1 59  ? 16.122  106.465 159.829 1.00 42.84  ? 59   ARG B O   1 
ATOM   2864  C  CB  . ARG B  1 59  ? 19.257  106.226 160.725 1.00 33.88  ? 59   ARG B CB  1 
ATOM   2865  C  CG  . ARG B  1 59  ? 18.582  107.146 161.733 1.00 43.94  ? 59   ARG B CG  1 
ATOM   2866  C  CD  . ARG B  1 59  ? 17.789  106.382 162.779 1.00 47.42  ? 59   ARG B CD  1 
ATOM   2867  N  NE  . ARG B  1 59  ? 17.199  107.322 163.732 1.00 53.30  ? 59   ARG B NE  1 
ATOM   2868  C  CZ  . ARG B  1 59  ? 16.024  107.931 163.558 1.00 49.56  ? 59   ARG B CZ  1 
ATOM   2869  N  NH1 . ARG B  1 59  ? 15.297  107.692 162.466 1.00 39.05  ? 59   ARG B NH1 1 
ATOM   2870  N  NH2 . ARG B  1 59  ? 15.570  108.776 164.480 1.00 51.49  ? 59   ARG B NH2 1 
ATOM   2871  N  N   . TYR B  1 60  ? 17.463  107.023 158.102 1.00 35.08  ? 60   TYR B N   1 
ATOM   2872  C  CA  . TYR B  1 60  ? 16.430  107.747 157.376 1.00 34.11  ? 60   TYR B CA  1 
ATOM   2873  C  C   . TYR B  1 60  ? 16.353  107.218 155.956 1.00 34.74  ? 60   TYR B C   1 
ATOM   2874  O  O   . TYR B  1 60  ? 16.573  107.959 154.988 1.00 34.10  ? 60   TYR B O   1 
ATOM   2875  C  CB  . TYR B  1 60  ? 16.707  109.251 157.396 1.00 33.02  ? 60   TYR B CB  1 
ATOM   2876  C  CG  . TYR B  1 60  ? 16.908  109.783 158.805 1.00 37.59  ? 60   TYR B CG  1 
ATOM   2877  C  CD1 . TYR B  1 60  ? 15.825  109.958 159.658 1.00 38.18  ? 60   TYR B CD1 1 
ATOM   2878  C  CD2 . TYR B  1 60  ? 18.182  110.101 159.284 1.00 34.45  ? 60   TYR B CD2 1 
ATOM   2879  C  CE1 . TYR B  1 60  ? 15.992  110.432 160.938 1.00 37.25  ? 60   TYR B CE1 1 
ATOM   2880  C  CE2 . TYR B  1 60  ? 18.356  110.586 160.577 1.00 39.47  ? 60   TYR B CE2 1 
ATOM   2881  C  CZ  . TYR B  1 60  ? 17.248  110.744 161.398 1.00 42.02  ? 60   TYR B CZ  1 
ATOM   2882  O  OH  . TYR B  1 60  ? 17.393  111.221 162.689 1.00 46.75  ? 60   TYR B OH  1 
ATOM   2883  N  N   . GLY B  1 61  ? 15.997  105.938 155.837 1.00 36.59  ? 61   GLY B N   1 
ATOM   2884  C  CA  . GLY B  1 61  ? 16.054  105.213 154.574 1.00 35.35  ? 61   GLY B CA  1 
ATOM   2885  C  C   . GLY B  1 61  ? 15.068  105.662 153.517 1.00 40.97  ? 61   GLY B C   1 
ATOM   2886  O  O   . GLY B  1 61  ? 15.225  105.293 152.346 1.00 36.62  ? 61   GLY B O   1 
ATOM   2887  N  N   . GLY B  1 62  ? 14.042  106.421 153.898 1.00 40.15  ? 62   GLY B N   1 
ATOM   2888  C  CA  . GLY B  1 62  ? 13.162  106.983 152.895 1.00 35.56  ? 62   GLY B CA  1 
ATOM   2889  C  C   . GLY B  1 62  ? 13.733  108.182 152.170 1.00 31.92  ? 62   GLY B C   1 
ATOM   2890  O  O   . GLY B  1 62  ? 13.198  108.575 151.131 1.00 32.73  ? 62   GLY B O   1 
ATOM   2891  N  N   . GLY B  1 63  ? 14.813  108.769 152.689 1.00 31.14  ? 63   GLY B N   1 
ATOM   2892  C  CA  . GLY B  1 63  ? 15.445  109.909 152.066 1.00 31.52  ? 63   GLY B CA  1 
ATOM   2893  C  C   . GLY B  1 63  ? 16.651  109.498 151.233 1.00 34.87  ? 63   GLY B C   1 
ATOM   2894  O  O   . GLY B  1 63  ? 16.968  108.324 151.064 1.00 35.48  ? 63   GLY B O   1 
ATOM   2895  N  N   . ALA B  1 64  ? 17.321  110.506 150.689 1.00 31.18  ? 64   ALA B N   1 
ATOM   2896  C  CA  . ALA B  1 64  ? 18.475  110.262 149.836 1.00 30.36  ? 64   ALA B CA  1 
ATOM   2897  C  C   . ALA B  1 64  ? 19.306  111.531 149.780 1.00 30.13  ? 64   ALA B C   1 
ATOM   2898  O  O   . ALA B  1 64  ? 18.809  112.632 150.053 1.00 27.74  ? 64   ALA B O   1 
ATOM   2899  C  CB  . ALA B  1 64  ? 18.060  109.831 148.431 1.00 31.08  ? 64   ALA B CB  1 
ATOM   2900  N  N   . VAL B  1 65  ? 20.583  111.353 149.416 1.00 28.72  ? 65   VAL B N   1 
ATOM   2901  C  CA  . VAL B  1 65  ? 21.495  112.480 149.234 1.00 29.03  ? 65   VAL B CA  1 
ATOM   2902  C  C   . VAL B  1 65  ? 20.926  113.482 148.241 1.00 32.32  ? 65   VAL B C   1 
ATOM   2903  O  O   . VAL B  1 65  ? 20.945  114.694 148.468 1.00 34.58  ? 65   VAL B O   1 
ATOM   2904  C  CB  . VAL B  1 65  ? 22.872  111.967 148.776 1.00 30.29  ? 65   VAL B CB  1 
ATOM   2905  C  CG1 . VAL B  1 65  ? 23.707  113.115 148.218 1.00 28.75  ? 65   VAL B CG1 1 
ATOM   2906  C  CG2 . VAL B  1 65  ? 23.583  111.323 149.940 1.00 31.58  ? 65   VAL B CG2 1 
ATOM   2907  N  N   . ASP B  1 66  ? 20.432  112.987 147.124 1.00 33.39  ? 66   ASP B N   1 
ATOM   2908  C  CA  . ASP B  1 66  ? 19.869  113.810 146.063 1.00 34.43  ? 66   ASP B CA  1 
ATOM   2909  C  C   . ASP B  1 66  ? 18.373  113.544 146.027 1.00 29.48  ? 66   ASP B C   1 
ATOM   2910  O  O   . ASP B  1 66  ? 17.931  112.534 145.481 1.00 31.86  ? 66   ASP B O   1 
ATOM   2911  C  CB  . ASP B  1 66  ? 20.511  113.479 144.718 1.00 32.17  ? 66   ASP B CB  1 
ATOM   2912  C  CG  . ASP B  1 66  ? 19.983  114.350 143.590 1.00 40.46  ? 66   ASP B CG  1 
ATOM   2913  O  OD1 . ASP B  1 66  ? 19.138  115.237 143.853 1.00 44.73  ? 66   ASP B OD1 1 
ATOM   2914  O  OD2 . ASP B  1 66  ? 20.414  114.147 142.435 1.00 44.55  ? 66   ASP B OD2 1 
ATOM   2915  N  N   . MET B  1 67  ? 17.594  114.457 146.593 1.00 34.01  ? 67   MET B N   1 
ATOM   2916  C  CA  . MET B  1 67  ? 16.143  114.383 146.514 1.00 33.94  ? 67   MET B CA  1 
ATOM   2917  C  C   . MET B  1 67  ? 15.564  115.541 145.714 1.00 38.46  ? 67   MET B C   1 
ATOM   2918  O  O   . MET B  1 67  ? 14.393  115.886 145.896 1.00 42.96  ? 67   MET B O   1 
ATOM   2919  C  CB  . MET B  1 67  ? 15.541  114.357 147.916 1.00 31.67  ? 67   MET B CB  1 
ATOM   2920  C  CG  . MET B  1 67  ? 16.006  113.197 148.785 1.00 31.20  ? 67   MET B CG  1 
ATOM   2921  S  SD  . MET B  1 67  ? 15.466  113.472 150.504 1.00 34.38  ? 67   MET B SD  1 
ATOM   2922  C  CE  . MET B  1 67  ? 13.694  113.149 150.369 1.00 29.65  ? 67   MET B CE  1 
ATOM   2923  N  N   . ARG B  1 68  ? 16.373  116.153 144.837 1.00 36.06  ? 68   ARG B N   1 
ATOM   2924  C  CA  . ARG B  1 68  ? 15.985  117.414 144.201 1.00 43.85  ? 68   ARG B CA  1 
ATOM   2925  C  C   . ARG B  1 68  ? 14.701  117.291 143.388 1.00 45.36  ? 68   ARG B C   1 
ATOM   2926  O  O   . ARG B  1 68  ? 13.963  118.271 143.254 1.00 46.15  ? 68   ARG B O   1 
ATOM   2927  C  CB  . ARG B  1 68  ? 17.128  117.925 143.317 1.00 37.51  ? 68   ARG B CB  1 
ATOM   2928  C  CG  . ARG B  1 68  ? 18.289  118.524 144.090 1.00 39.67  ? 68   ARG B CG  1 
ATOM   2929  C  CD  . ARG B  1 68  ? 19.478  118.791 143.177 1.00 42.81  ? 68   ARG B CD  1 
ATOM   2930  N  NE  . ARG B  1 68  ? 20.024  117.542 142.649 1.00 46.83  ? 68   ARG B NE  1 
ATOM   2931  C  CZ  . ARG B  1 68  ? 21.010  117.463 141.751 1.00 56.91  ? 68   ARG B CZ  1 
ATOM   2932  N  NH1 . ARG B  1 68  ? 21.567  118.567 141.269 1.00 52.27  ? 68   ARG B NH1 1 
ATOM   2933  N  NH2 . ARG B  1 68  ? 21.448  116.275 141.329 1.00 51.79  ? 68   ARG B NH2 1 
ATOM   2934  N  N   . GLU B  1 69  ? 14.422  116.108 142.843 1.00 40.80  ? 69   GLU B N   1 
ATOM   2935  C  CA  . GLU B  1 69  ? 13.246  115.886 142.012 1.00 47.99  ? 69   GLU B CA  1 
ATOM   2936  C  C   . GLU B  1 69  ? 12.003  115.522 142.806 1.00 46.73  ? 69   GLU B C   1 
ATOM   2937  O  O   . GLU B  1 69  ? 10.895  115.617 142.272 1.00 53.20  ? 69   GLU B O   1 
ATOM   2938  C  CB  . GLU B  1 69  ? 13.512  114.776 140.985 1.00 57.09  ? 69   GLU B CB  1 
ATOM   2939  C  CG  . GLU B  1 69  ? 14.615  115.085 139.993 1.00 77.62  ? 69   GLU B CG  1 
ATOM   2940  C  CD  . GLU B  1 69  ? 14.261  116.276 139.113 1.00 95.61  ? 69   GLU B CD  1 
ATOM   2941  O  OE1 . GLU B  1 69  ? 13.156  116.282 138.525 1.00 101.86 ? 69   GLU B OE1 1 
ATOM   2942  O  OE2 . GLU B  1 69  ? 15.081  117.213 139.016 1.00 102.76 ? 69   GLU B OE2 1 
ATOM   2943  N  N   . THR B  1 70  ? 12.156  115.065 144.037 1.00 38.01  ? 70   THR B N   1 
ATOM   2944  C  CA  . THR B  1 70  ? 11.045  114.506 144.786 1.00 36.28  ? 70   THR B CA  1 
ATOM   2945  C  C   . THR B  1 70  ? 10.712  115.297 146.037 1.00 36.92  ? 70   THR B C   1 
ATOM   2946  O  O   . THR B  1 70  ? 9.600   115.171 146.552 1.00 34.84  ? 70   THR B O   1 
ATOM   2947  C  CB  . THR B  1 70  ? 11.349  113.048 145.167 1.00 46.49  ? 70   THR B CB  1 
ATOM   2948  O  OG1 . THR B  1 70  ? 12.546  112.993 145.957 1.00 46.12  ? 70   THR B OG1 1 
ATOM   2949  C  CG2 . THR B  1 70  ? 11.571  112.223 143.913 1.00 45.73  ? 70   THR B CG2 1 
ATOM   2950  N  N   . LEU B  1 71  ? 11.625  116.114 146.528 1.00 38.22  ? 71   LEU B N   1 
ATOM   2951  C  CA  . LEU B  1 71  ? 11.385  116.837 147.769 1.00 35.18  ? 71   LEU B CA  1 
ATOM   2952  C  C   . LEU B  1 71  ? 10.307  117.884 147.551 1.00 34.17  ? 71   LEU B C   1 
ATOM   2953  O  O   . LEU B  1 71  ? 10.432  118.728 146.663 1.00 34.89  ? 71   LEU B O   1 
ATOM   2954  C  CB  . LEU B  1 71  ? 12.677  117.487 148.231 1.00 40.51  ? 71   LEU B CB  1 
ATOM   2955  C  CG  . LEU B  1 71  ? 12.820  117.996 149.652 1.00 40.69  ? 71   LEU B CG  1 
ATOM   2956  C  CD1 . LEU B  1 71  ? 12.425  116.927 150.669 1.00 34.97  ? 71   LEU B CD1 1 
ATOM   2957  C  CD2 . LEU B  1 71  ? 14.252  118.374 149.801 1.00 39.84  ? 71   LEU B CD2 1 
ATOM   2958  N  N   . ASN B  1 72  ? 9.230   117.808 148.324 1.00 35.23  ? 72   ASN B N   1 
ATOM   2959  C  CA  . ASN B  1 72  ? 8.220   118.856 148.286 1.00 39.83  ? 72   ASN B CA  1 
ATOM   2960  C  C   . ASN B  1 72  ? 7.416   118.837 149.584 1.00 38.51  ? 72   ASN B C   1 
ATOM   2961  O  O   . ASN B  1 72  ? 6.728   117.850 149.870 1.00 40.76  ? 72   ASN B O   1 
ATOM   2962  C  CB  . ASN B  1 72  ? 7.305   118.700 147.072 1.00 36.19  ? 72   ASN B CB  1 
ATOM   2963  C  CG  . ASN B  1 72  ? 6.300   119.806 146.997 1.00 46.90  ? 72   ASN B CG  1 
ATOM   2964  O  OD1 . ASN B  1 72  ? 6.682   120.966 146.884 1.00 39.46  ? 72   ASN B OD1 1 
ATOM   2965  N  ND2 . ASN B  1 72  ? 5.009   119.472 147.087 1.00 49.57  ? 72   ASN B ND2 1 
ATOM   2966  N  N   . PRO B  1 73  ? 7.521   119.872 150.432 1.00 31.80  ? 73   PRO B N   1 
ATOM   2967  C  CA  . PRO B  1 73  ? 8.313   121.088 150.191 1.00 34.35  ? 73   PRO B CA  1 
ATOM   2968  C  C   . PRO B  1 73  ? 9.809   120.838 150.336 1.00 32.42  ? 73   PRO B C   1 
ATOM   2969  O  O   . PRO B  1 73  ? 10.219  119.800 150.875 1.00 32.10  ? 73   PRO B O   1 
ATOM   2970  C  CB  . PRO B  1 73  ? 7.834   122.043 151.292 1.00 33.65  ? 73   PRO B CB  1 
ATOM   2971  C  CG  . PRO B  1 73  ? 7.539   121.106 152.448 1.00 34.68  ? 73   PRO B CG  1 
ATOM   2972  C  CD  . PRO B  1 73  ? 6.937   119.856 151.791 1.00 32.04  ? 73   PRO B CD  1 
ATOM   2973  N  N   . MET B  1 74  ? 10.615  121.772 149.857 1.00 31.23  ? 74   MET B N   1 
ATOM   2974  C  CA  . MET B  1 74  ? 12.056  121.705 150.045 1.00 36.87  ? 74   MET B CA  1 
ATOM   2975  C  C   . MET B  1 74  ? 12.487  122.827 150.986 1.00 31.30  ? 74   MET B C   1 
ATOM   2976  O  O   . MET B  1 74  ? 11.936  123.928 150.957 1.00 31.84  ? 74   MET B O   1 
ATOM   2977  C  CB  . MET B  1 74  ? 12.807  121.786 148.705 1.00 34.50  ? 74   MET B CB  1 
ATOM   2978  C  CG  . MET B  1 74  ? 12.618  123.074 147.937 1.00 42.32  ? 74   MET B CG  1 
ATOM   2979  S  SD  . MET B  1 74  ? 13.032  122.937 146.174 1.00 45.03  ? 74   MET B SD  1 
ATOM   2980  C  CE  . MET B  1 74  ? 14.491  121.899 146.248 1.00 59.97  ? 74   MET B CE  1 
ATOM   2981  N  N   . GLY B  1 75  ? 13.458  122.528 151.837 1.00 28.85  ? 75   GLY B N   1 
ATOM   2982  C  CA  . GLY B  1 75  ? 13.936  123.521 152.767 1.00 24.75  ? 75   GLY B CA  1 
ATOM   2983  C  C   . GLY B  1 75  ? 14.643  124.641 152.033 1.00 31.62  ? 75   GLY B C   1 
ATOM   2984  O  O   . GLY B  1 75  ? 15.276  124.445 150.993 1.00 28.23  ? 75   GLY B O   1 
ATOM   2985  N  N   . MET B  1 76  ? 14.493  125.839 152.559 1.00 32.17  ? 76   MET B N   1 
ATOM   2986  C  CA  . MET B  1 76  ? 15.193  126.983 152.011 1.00 28.67  ? 76   MET B CA  1 
ATOM   2987  C  C   . MET B  1 76  ? 15.649  127.792 153.212 1.00 37.60  ? 76   MET B C   1 
ATOM   2988  O  O   . MET B  1 76  ? 14.808  128.301 153.957 1.00 29.12  ? 76   MET B O   1 
ATOM   2989  C  CB  . MET B  1 76  ? 14.276  127.768 151.079 1.00 35.97  ? 76   MET B CB  1 
ATOM   2990  C  CG  . MET B  1 76  ? 14.996  128.334 149.890 1.00 56.12  ? 76   MET B CG  1 
ATOM   2991  S  SD  . MET B  1 76  ? 15.287  130.049 150.188 1.00 71.19  ? 76   MET B SD  1 
ATOM   2992  C  CE  . MET B  1 76  ? 13.599  130.630 149.940 1.00 56.44  ? 76   MET B CE  1 
ATOM   2993  N  N   . PHE B  1 77  ? 16.961  127.833 153.444 1.00 31.73  ? 77   PHE B N   1 
ATOM   2994  C  CA  . PHE B  1 77  ? 17.556  128.526 154.582 1.00 30.67  ? 77   PHE B CA  1 
ATOM   2995  C  C   . PHE B  1 77  ? 18.329  129.731 154.065 1.00 35.10  ? 77   PHE B C   1 
ATOM   2996  O  O   . PHE B  1 77  ? 19.219  129.579 153.220 1.00 34.11  ? 77   PHE B O   1 
ATOM   2997  C  CB  . PHE B  1 77  ? 18.530  127.631 155.367 1.00 28.36  ? 77   PHE B CB  1 
ATOM   2998  C  CG  . PHE B  1 77  ? 17.881  126.571 156.238 1.00 31.75  ? 77   PHE B CG  1 
ATOM   2999  C  CD1 . PHE B  1 77  ? 16.583  126.150 156.024 1.00 34.70  ? 77   PHE B CD1 1 
ATOM   3000  C  CD2 . PHE B  1 77  ? 18.592  126.027 157.308 1.00 32.69  ? 77   PHE B CD2 1 
ATOM   3001  C  CE1 . PHE B  1 77  ? 16.005  125.174 156.841 1.00 33.92  ? 77   PHE B CE1 1 
ATOM   3002  C  CE2 . PHE B  1 77  ? 18.028  125.050 158.117 1.00 32.36  ? 77   PHE B CE2 1 
ATOM   3003  C  CZ  . PHE B  1 77  ? 16.735  124.626 157.885 1.00 30.85  ? 77   PHE B CZ  1 
ATOM   3004  N  N   . GLN B  1 78  ? 18.015  130.917 154.595 1.00 31.76  ? 78   GLN B N   1 
ATOM   3005  C  CA  . GLN B  1 78  ? 18.724  132.150 154.263 1.00 29.36  ? 78   GLN B CA  1 
ATOM   3006  C  C   . GLN B  1 78  ? 19.471  132.628 155.502 1.00 31.89  ? 78   GLN B C   1 
ATOM   3007  O  O   . GLN B  1 78  ? 18.848  133.054 156.481 1.00 37.19  ? 78   GLN B O   1 
ATOM   3008  C  CB  . GLN B  1 78  ? 17.772  133.228 153.762 1.00 39.36  ? 78   GLN B CB  1 
ATOM   3009  C  CG  . GLN B  1 78  ? 17.192  132.898 152.401 1.00 64.24  ? 78   GLN B CG  1 
ATOM   3010  C  CD  . GLN B  1 78  ? 16.092  133.856 151.973 1.00 73.78  ? 78   GLN B CD  1 
ATOM   3011  O  OE1 . GLN B  1 78  ? 15.041  133.428 151.493 1.00 75.11  ? 78   GLN B OE1 1 
ATOM   3012  N  NE2 . GLN B  1 78  ? 16.328  135.157 152.141 1.00 82.61  ? 78   GLN B NE2 1 
ATOM   3013  N  N   . TYR B  1 79  ? 20.799  132.537 155.468 1.00 28.33  ? 79   TYR B N   1 
ATOM   3014  C  CA  . TYR B  1 79  ? 21.628  133.155 156.498 1.00 27.01  ? 79   TYR B CA  1 
ATOM   3015  C  C   . TYR B  1 79  ? 21.744  134.644 156.222 1.00 31.32  ? 79   TYR B C   1 
ATOM   3016  O  O   . TYR B  1 79  ? 22.048  135.037 155.098 1.00 30.73  ? 79   TYR B O   1 
ATOM   3017  C  CB  . TYR B  1 79  ? 23.055  132.598 156.525 1.00 29.12  ? 79   TYR B CB  1 
ATOM   3018  C  CG  . TYR B  1 79  ? 23.292  131.149 156.881 1.00 28.52  ? 79   TYR B CG  1 
ATOM   3019  C  CD1 . TYR B  1 79  ? 22.280  130.201 156.841 1.00 26.19  ? 79   TYR B CD1 1 
ATOM   3020  C  CD2 . TYR B  1 79  ? 24.569  130.734 157.272 1.00 26.74  ? 79   TYR B CD2 1 
ATOM   3021  C  CE1 . TYR B  1 79  ? 22.539  128.864 157.155 1.00 28.08  ? 79   TYR B CE1 1 
ATOM   3022  C  CE2 . TYR B  1 79  ? 24.834  129.422 157.598 1.00 32.37  ? 79   TYR B CE2 1 
ATOM   3023  C  CZ  . TYR B  1 79  ? 23.819  128.484 157.530 1.00 31.80  ? 79   TYR B CZ  1 
ATOM   3024  O  OH  . TYR B  1 79  ? 24.112  127.181 157.853 1.00 30.56  ? 79   TYR B OH  1 
ATOM   3025  N  N   . THR B  1 80  ? 21.499  135.473 157.229 1.00 26.80  ? 80   THR B N   1 
ATOM   3026  C  CA  . THR B  1 80  ? 21.980  136.845 157.204 1.00 29.82  ? 80   THR B CA  1 
ATOM   3027  C  C   . THR B  1 80  ? 22.865  137.041 158.429 1.00 31.72  ? 80   THR B C   1 
ATOM   3028  O  O   . THR B  1 80  ? 22.525  136.600 159.534 1.00 30.87  ? 80   THR B O   1 
ATOM   3029  C  CB  . THR B  1 80  ? 20.827  137.859 157.131 1.00 32.11  ? 80   THR B CB  1 
ATOM   3030  O  OG1 . THR B  1 80  ? 19.903  137.618 158.196 1.00 31.09  ? 80   THR B OG1 1 
ATOM   3031  C  CG2 . THR B  1 80  ? 20.092  137.726 155.768 1.00 25.81  ? 80   THR B CG2 1 
ATOM   3032  N  N   . VAL B  1 81  ? 24.021  137.645 158.215 1.00 30.16  ? 81   VAL B N   1 
ATOM   3033  C  CA  . VAL B  1 81  ? 25.072  137.736 159.220 1.00 31.51  ? 81   VAL B CA  1 
ATOM   3034  C  C   . VAL B  1 81  ? 25.205  139.193 159.649 1.00 32.49  ? 81   VAL B C   1 
ATOM   3035  O  O   . VAL B  1 81  ? 25.180  140.096 158.811 1.00 29.88  ? 81   VAL B O   1 
ATOM   3036  C  CB  . VAL B  1 81  ? 26.396  137.175 158.663 1.00 27.03  ? 81   VAL B CB  1 
ATOM   3037  C  CG1 . VAL B  1 81  ? 27.434  137.106 159.776 1.00 29.97  ? 81   VAL B CG1 1 
ATOM   3038  C  CG2 . VAL B  1 81  ? 26.141  135.773 158.061 1.00 29.71  ? 81   VAL B CG2 1 
ATOM   3039  N  N   . TRP B  1 82  ? 25.323  139.419 160.957 1.00 34.24  ? 82   TRP B N   1 
ATOM   3040  C  CA  . TRP B  1 82  ? 25.133  140.745 161.534 1.00 30.33  ? 82   TRP B CA  1 
ATOM   3041  C  C   . TRP B  1 82  ? 26.163  141.036 162.611 1.00 35.86  ? 82   TRP B C   1 
ATOM   3042  O  O   . TRP B  1 82  ? 26.674  140.123 163.270 1.00 31.06  ? 82   TRP B O   1 
ATOM   3043  C  CB  . TRP B  1 82  ? 23.730  140.876 162.138 1.00 27.29  ? 82   TRP B CB  1 
ATOM   3044  C  CG  . TRP B  1 82  ? 22.663  140.659 161.131 1.00 33.79  ? 82   TRP B CG  1 
ATOM   3045  C  CD1 . TRP B  1 82  ? 22.068  139.478 160.810 1.00 26.56  ? 82   TRP B CD1 1 
ATOM   3046  C  CD2 . TRP B  1 82  ? 22.071  141.658 160.286 1.00 32.46  ? 82   TRP B CD2 1 
ATOM   3047  N  NE1 . TRP B  1 82  ? 21.124  139.675 159.823 1.00 36.74  ? 82   TRP B NE1 1 
ATOM   3048  C  CE2 . TRP B  1 82  ? 21.110  141.004 159.479 1.00 36.64  ? 82   TRP B CE2 1 
ATOM   3049  C  CE3 . TRP B  1 82  ? 22.263  143.038 160.132 1.00 30.23  ? 82   TRP B CE3 1 
ATOM   3050  C  CZ2 . TRP B  1 82  ? 20.339  141.685 158.524 1.00 35.88  ? 82   TRP B CZ2 1 
ATOM   3051  C  CZ3 . TRP B  1 82  ? 21.483  143.719 159.197 1.00 33.81  ? 82   TRP B CZ3 1 
ATOM   3052  C  CH2 . TRP B  1 82  ? 20.533  143.039 158.404 1.00 32.46  ? 82   TRP B CH2 1 
ATOM   3053  N  N   . LYS B  1 83  ? 26.446  142.331 162.798 1.00 39.05  ? 83   LYS B N   1 
ATOM   3054  C  CA  . LYS B  1 83  ? 27.275  142.751 163.924 1.00 36.47  ? 83   LYS B CA  1 
ATOM   3055  C  C   . LYS B  1 83  ? 26.614  142.393 165.244 1.00 37.39  ? 83   LYS B C   1 
ATOM   3056  O  O   . LYS B  1 83  ? 27.292  141.985 166.195 1.00 36.89  ? 83   LYS B O   1 
ATOM   3057  C  CB  . LYS B  1 83  ? 27.555  144.259 163.861 1.00 35.55  ? 83   LYS B CB  1 
ATOM   3058  C  CG  . LYS B  1 83  ? 28.436  144.688 162.692 1.00 41.51  ? 83   LYS B CG  1 
ATOM   3059  C  CD  . LYS B  1 83  ? 28.708  146.208 162.694 1.00 44.07  ? 83   LYS B CD  1 
ATOM   3060  C  CE  . LYS B  1 83  ? 29.542  146.642 161.483 1.00 48.67  ? 83   LYS B CE  1 
ATOM   3061  N  NZ  . LYS B  1 83  ? 29.721  148.142 161.386 1.00 55.89  ? 83   LYS B NZ  1 
ATOM   3062  N  N   . ASP B  1 84  ? 25.290  142.493 165.310 1.00 32.75  ? 84   ASP B N   1 
ATOM   3063  C  CA  . ASP B  1 84  ? 24.580  142.223 166.551 1.00 32.50  ? 84   ASP B CA  1 
ATOM   3064  C  C   . ASP B  1 84  ? 23.107  141.988 166.227 1.00 34.51  ? 84   ASP B C   1 
ATOM   3065  O  O   . ASP B  1 84  ? 22.661  142.149 165.085 1.00 31.55  ? 84   ASP B O   1 
ATOM   3066  C  CB  . ASP B  1 84  ? 24.763  143.369 167.566 1.00 34.41  ? 84   ASP B CB  1 
ATOM   3067  C  CG  . ASP B  1 84  ? 24.523  144.728 166.949 1.00 41.18  ? 84   ASP B CG  1 
ATOM   3068  O  OD1 . ASP B  1 84  ? 23.520  144.894 166.224 1.00 37.72  ? 84   ASP B OD1 1 
ATOM   3069  O  OD2 . ASP B  1 84  ? 25.328  145.641 167.199 1.00 50.52  ? 84   ASP B OD2 1 
ATOM   3070  N  N   . VAL B  1 85  ? 22.366  141.548 167.245 1.00 31.55  ? 85   VAL B N   1 
ATOM   3071  C  CA  . VAL B  1 85  ? 20.931  141.303 167.077 1.00 28.61  ? 85   VAL B CA  1 
ATOM   3072  C  C   . VAL B  1 85  ? 20.204  142.590 166.711 1.00 32.90  ? 85   VAL B C   1 
ATOM   3073  O  O   . VAL B  1 85  ? 19.306  142.594 165.850 1.00 30.53  ? 85   VAL B O   1 
ATOM   3074  C  CB  . VAL B  1 85  ? 20.357  140.656 168.352 1.00 31.66  ? 85   VAL B CB  1 
ATOM   3075  C  CG1 . VAL B  1 85  ? 18.797  140.759 168.393 1.00 28.02  ? 85   VAL B CG1 1 
ATOM   3076  C  CG2 . VAL B  1 85  ? 20.802  139.194 168.428 1.00 27.94  ? 85   VAL B CG2 1 
ATOM   3077  N  N   . HIS B  1 86  ? 20.592  143.702 167.354 1.00 34.16  ? 86   HIS B N   1 
ATOM   3078  C  CA  . HIS B  1 86  ? 19.909  144.977 167.156 1.00 34.34  ? 86   HIS B CA  1 
ATOM   3079  C  C   . HIS B  1 86  ? 19.941  145.420 165.700 1.00 30.79  ? 86   HIS B C   1 
ATOM   3080  O  O   . HIS B  1 86  ? 18.940  145.925 165.185 1.00 34.53  ? 86   HIS B O   1 
ATOM   3081  C  CB  . HIS B  1 86  ? 20.529  146.055 168.046 1.00 31.91  ? 86   HIS B CB  1 
ATOM   3082  C  CG  . HIS B  1 86  ? 19.867  147.390 167.891 1.00 38.26  ? 86   HIS B CG  1 
ATOM   3083  N  ND1 . HIS B  1 86  ? 20.333  148.358 167.027 1.00 37.15  ? 86   HIS B ND1 1 
ATOM   3084  C  CD2 . HIS B  1 86  ? 18.736  147.892 168.444 1.00 37.78  ? 86   HIS B CD2 1 
ATOM   3085  C  CE1 . HIS B  1 86  ? 19.535  149.410 167.079 1.00 38.61  ? 86   HIS B CE1 1 
ATOM   3086  N  NE2 . HIS B  1 86  ? 18.552  149.149 167.923 1.00 38.47  ? 86   HIS B NE2 1 
ATOM   3087  N  N   . SER B  1 87  ? 21.071  145.200 165.012 1.00 28.38  ? 87   SER B N   1 
ATOM   3088  C  CA  . SER B  1 87  ? 21.195  145.599 163.609 1.00 31.75  ? 87   SER B CA  1 
ATOM   3089  C  C   . SER B  1 87  ? 20.174  144.879 162.746 1.00 32.68  ? 87   SER B C   1 
ATOM   3090  O  O   . SER B  1 87  ? 19.539  145.491 161.878 1.00 33.50  ? 87   SER B O   1 
ATOM   3091  C  CB  . SER B  1 87  ? 22.608  145.316 163.085 1.00 29.32  ? 87   SER B CB  1 
ATOM   3092  O  OG  . SER B  1 87  ? 23.587  146.096 163.773 1.00 35.88  ? 87   SER B OG  1 
ATOM   3093  N  N   . HIS B  1 88  ? 20.013  143.573 162.961 1.00 30.62  ? 88   HIS B N   1 
ATOM   3094  C  CA  . HIS B  1 88  ? 19.031  142.815 162.197 1.00 32.56  ? 88   HIS B CA  1 
ATOM   3095  C  C   . HIS B  1 88  ? 17.615  143.278 162.504 1.00 26.60  ? 88   HIS B C   1 
ATOM   3096  O  O   . HIS B  1 88  ? 16.811  143.476 161.591 1.00 31.68  ? 88   HIS B O   1 
ATOM   3097  C  CB  . HIS B  1 88  ? 19.167  141.326 162.494 1.00 26.44  ? 88   HIS B CB  1 
ATOM   3098  C  CG  . HIS B  1 88  ? 18.183  140.483 161.756 1.00 36.89  ? 88   HIS B CG  1 
ATOM   3099  N  ND1 . HIS B  1 88  ? 17.197  139.762 162.397 1.00 37.58  ? 88   HIS B ND1 1 
ATOM   3100  C  CD2 . HIS B  1 88  ? 18.024  140.248 160.432 1.00 32.86  ? 88   HIS B CD2 1 
ATOM   3101  C  CE1 . HIS B  1 88  ? 16.480  139.112 161.497 1.00 32.17  ? 88   HIS B CE1 1 
ATOM   3102  N  NE2 . HIS B  1 88  ? 16.967  139.383 160.299 1.00 38.49  ? 88   HIS B NE2 1 
ATOM   3103  N  N   . GLU B  1 89  ? 17.282  143.438 163.788 1.00 31.62  ? 89   GLU B N   1 
ATOM   3104  C  CA  . GLU B  1 89  ? 15.950  143.919 164.139 1.00 29.67  ? 89   GLU B CA  1 
ATOM   3105  C  C   . GLU B  1 89  ? 15.717  145.331 163.599 1.00 36.59  ? 89   GLU B C   1 
ATOM   3106  O  O   . GLU B  1 89  ? 14.605  145.670 163.169 1.00 29.93  ? 89   GLU B O   1 
ATOM   3107  C  CB  . GLU B  1 89  ? 15.756  143.884 165.662 1.00 29.04  ? 89   GLU B CB  1 
ATOM   3108  C  CG  . GLU B  1 89  ? 15.750  142.484 166.282 1.00 28.11  ? 89   GLU B CG  1 
ATOM   3109  C  CD  . GLU B  1 89  ? 14.534  141.648 165.887 1.00 27.59  ? 89   GLU B CD  1 
ATOM   3110  O  OE1 . GLU B  1 89  ? 13.415  142.194 165.776 1.00 28.58  ? 89   GLU B OE1 1 
ATOM   3111  O  OE2 . GLU B  1 89  ? 14.706  140.437 165.636 1.00 31.51  ? 89   GLU B OE2 1 
ATOM   3112  N  N   . GLU B  1 90  ? 16.752  146.177 163.614 1.00 31.19  ? 90   GLU B N   1 
ATOM   3113  C  CA  . GLU B  1 90  ? 16.557  147.553 163.152 1.00 31.78  ? 90   GLU B CA  1 
ATOM   3114  C  C   . GLU B  1 90  ? 16.351  147.603 161.646 1.00 34.88  ? 90   GLU B C   1 
ATOM   3115  O  O   . GLU B  1 90  ? 15.529  148.383 161.147 1.00 34.65  ? 90   GLU B O   1 
ATOM   3116  C  CB  . GLU B  1 90  ? 17.736  148.434 163.585 1.00 32.62  ? 90   GLU B CB  1 
ATOM   3117  C  CG  . GLU B  1 90  ? 17.597  149.904 163.227 1.00 33.24  ? 90   GLU B CG  1 
ATOM   3118  C  CD  . GLU B  1 90  ? 18.717  150.718 163.836 1.00 33.95  ? 90   GLU B CD  1 
ATOM   3119  O  OE1 . GLU B  1 90  ? 19.888  150.460 163.473 1.00 37.51  ? 90   GLU B OE1 1 
ATOM   3120  O  OE2 . GLU B  1 90  ? 18.437  151.555 164.718 1.00 35.17  ? 90   GLU B OE2 1 
ATOM   3121  N  N   . MET B  1 91  ? 17.115  146.802 160.906 1.00 33.67  ? 91   MET B N   1 
ATOM   3122  C  CA  . MET B  1 91  ? 16.907  146.682 159.467 1.00 33.59  ? 91   MET B CA  1 
ATOM   3123  C  C   . MET B  1 91  ? 15.474  146.253 159.156 1.00 32.71  ? 91   MET B C   1 
ATOM   3124  O  O   . MET B  1 91  ? 14.806  146.858 158.313 1.00 33.12  ? 91   MET B O   1 
ATOM   3125  C  CB  . MET B  1 91  ? 17.918  145.679 158.895 1.00 36.02  ? 91   MET B CB  1 
ATOM   3126  C  CG  . MET B  1 91  ? 17.918  145.536 157.380 1.00 34.46  ? 91   MET B CG  1 
ATOM   3127  S  SD  . MET B  1 91  ? 16.535  144.533 156.745 1.00 50.93  ? 91   MET B SD  1 
ATOM   3128  C  CE  . MET B  1 91  ? 16.668  142.959 157.636 1.00 41.13  ? 91   MET B CE  1 
ATOM   3129  N  N   . HIS B  1 92  ? 14.985  145.201 159.834 1.00 36.40  ? 92   HIS B N   1 
ATOM   3130  C  CA  . HIS B  1 92  ? 13.612  144.735 159.623 1.00 37.88  ? 92   HIS B CA  1 
ATOM   3131  C  C   . HIS B  1 92  ? 12.610  145.845 159.914 1.00 39.25  ? 92   HIS B C   1 
ATOM   3132  O  O   . HIS B  1 92  ? 11.620  146.005 159.198 1.00 35.29  ? 92   HIS B O   1 
ATOM   3133  C  CB  . HIS B  1 92  ? 13.310  143.540 160.535 1.00 29.56  ? 92   HIS B CB  1 
ATOM   3134  C  CG  . HIS B  1 92  ? 13.583  142.203 159.934 1.00 47.54  ? 92   HIS B CG  1 
ATOM   3135  N  ND1 . HIS B  1 92  ? 12.869  141.704 158.867 1.00 50.39  ? 92   HIS B ND1 1 
ATOM   3136  C  CD2 . HIS B  1 92  ? 14.471  141.239 160.278 1.00 55.97  ? 92   HIS B CD2 1 
ATOM   3137  C  CE1 . HIS B  1 92  ? 13.319  140.498 158.565 1.00 54.03  ? 92   HIS B CE1 1 
ATOM   3138  N  NE2 . HIS B  1 92  ? 14.289  140.190 159.409 1.00 54.00  ? 92   HIS B NE2 1 
ATOM   3139  N  N   . HIS B  1 93  ? 12.844  146.618 160.973 1.00 30.20  ? 93   HIS B N   1 
ATOM   3140  C  CA  . HIS B  1 93  ? 11.936  147.714 161.273 1.00 32.73  ? 93   HIS B CA  1 
ATOM   3141  C  C   . HIS B  1 93  ? 12.025  148.813 160.214 1.00 44.10  ? 93   HIS B C   1 
ATOM   3142  O  O   . HIS B  1 93  ? 11.000  149.292 159.719 1.00 30.64  ? 93   HIS B O   1 
ATOM   3143  C  CB  . HIS B  1 93  ? 12.219  148.293 162.659 1.00 31.18  ? 93   HIS B CB  1 
ATOM   3144  C  CG  . HIS B  1 93  ? 11.495  149.580 162.910 1.00 34.29  ? 93   HIS B CG  1 
ATOM   3145  N  ND1 . HIS B  1 93  ? 12.011  150.807 162.541 1.00 34.71  ? 93   HIS B ND1 1 
ATOM   3146  C  CD2 . HIS B  1 93  ? 10.276  149.830 163.444 1.00 33.55  ? 93   HIS B CD2 1 
ATOM   3147  C  CE1 . HIS B  1 93  ? 11.152  151.757 162.863 1.00 33.41  ? 93   HIS B CE1 1 
ATOM   3148  N  NE2 . HIS B  1 93  ? 10.091  151.192 163.411 1.00 34.41  ? 93   HIS B NE2 1 
ATOM   3149  N  N   . ASP B  1 94  ? 13.244  149.246 159.868 1.00 31.89  ? 94   ASP B N   1 
ATOM   3150  C  CA  . ASP B  1 94  ? 13.382  150.382 158.963 1.00 33.53  ? 94   ASP B CA  1 
ATOM   3151  C  C   . ASP B  1 94  ? 12.859  150.084 157.566 1.00 33.01  ? 94   ASP B C   1 
ATOM   3152  O  O   . ASP B  1 94  ? 12.537  151.016 156.829 1.00 41.01  ? 94   ASP B O   1 
ATOM   3153  C  CB  . ASP B  1 94  ? 14.852  150.838 158.882 1.00 36.11  ? 94   ASP B CB  1 
ATOM   3154  C  CG  . ASP B  1 94  ? 15.358  151.447 160.202 1.00 40.89  ? 94   ASP B CG  1 
ATOM   3155  O  OD1 . ASP B  1 94  ? 14.535  151.635 161.126 1.00 40.31  ? 94   ASP B OD1 1 
ATOM   3156  O  OD2 . ASP B  1 94  ? 16.563  151.783 160.296 1.00 45.55  ? 94   ASP B OD2 1 
ATOM   3157  N  N   . ASN B  1 95  ? 12.818  148.817 157.172 1.00 32.69  ? 95   ASN B N   1 
ATOM   3158  C  CA  . ASN B  1 95  ? 12.375  148.395 155.851 1.00 39.89  ? 95   ASN B CA  1 
ATOM   3159  C  C   . ASN B  1 95  ? 11.154  147.492 155.963 1.00 34.68  ? 95   ASN B C   1 
ATOM   3160  O  O   . ASN B  1 95  ? 10.950  146.621 155.121 1.00 34.06  ? 95   ASN B O   1 
ATOM   3161  C  CB  . ASN B  1 95  ? 13.496  147.674 155.101 1.00 38.90  ? 95   ASN B CB  1 
ATOM   3162  C  CG  . ASN B  1 95  ? 14.722  148.533 154.941 1.00 41.33  ? 95   ASN B CG  1 
ATOM   3163  O  OD1 . ASN B  1 95  ? 14.757  149.428 154.101 1.00 47.56  ? 95   ASN B OD1 1 
ATOM   3164  N  ND2 . ASN B  1 95  ? 15.721  148.298 155.784 1.00 35.16  ? 95   ASN B ND2 1 
ATOM   3165  N  N   . PHE B  1 96  ? 10.353  147.675 157.018 1.00 33.78  ? 96   PHE B N   1 
ATOM   3166  C  CA  . PHE B  1 96  ? 9.266   146.738 157.282 1.00 36.82  ? 96   PHE B CA  1 
ATOM   3167  C  C   . PHE B  1 96  ? 8.273   146.703 156.123 1.00 35.24  ? 96   PHE B C   1 
ATOM   3168  O  O   . PHE B  1 96  ? 7.899   145.624 155.650 1.00 29.66  ? 96   PHE B O   1 
ATOM   3169  C  CB  . PHE B  1 96  ? 8.563   147.095 158.585 1.00 40.24  ? 96   PHE B CB  1 
ATOM   3170  C  CG  . PHE B  1 96  ? 7.496   146.104 158.973 1.00 33.43  ? 96   PHE B CG  1 
ATOM   3171  C  CD1 . PHE B  1 96  ? 7.838   144.844 159.402 1.00 31.07  ? 96   PHE B CD1 1 
ATOM   3172  C  CD2 . PHE B  1 96  ? 6.156   146.441 158.885 1.00 34.93  ? 96   PHE B CD2 1 
ATOM   3173  C  CE1 . PHE B  1 96  ? 6.858   143.919 159.768 1.00 36.11  ? 96   PHE B CE1 1 
ATOM   3174  C  CE2 . PHE B  1 96  ? 5.177   145.534 159.239 1.00 30.44  ? 96   PHE B CE2 1 
ATOM   3175  C  CZ  . PHE B  1 96  ? 5.523   144.268 159.674 1.00 35.04  ? 96   PHE B CZ  1 
ATOM   3176  N  N   . LYS B  1 97  ? 7.867   147.882 155.629 1.00 30.11  ? 97   LYS B N   1 
ATOM   3177  C  CA  . LYS B  1 97  ? 6.909   147.956 154.525 1.00 33.07  ? 97   LYS B CA  1 
ATOM   3178  C  C   . LYS B  1 97  ? 7.454   147.300 153.265 1.00 31.61  ? 97   LYS B C   1 
ATOM   3179  O  O   . LYS B  1 97  ? 6.720   146.613 152.550 1.00 30.98  ? 97   LYS B O   1 
ATOM   3180  C  CB  . LYS B  1 97  ? 6.536   149.411 154.214 1.00 37.33  ? 97   LYS B CB  1 
ATOM   3181  C  CG  . LYS B  1 97  ? 5.761   150.152 155.286 1.00 47.42  ? 97   LYS B CG  1 
ATOM   3182  C  CD  . LYS B  1 97  ? 5.985   151.683 155.170 1.00 56.43  ? 97   LYS B CD  1 
ATOM   3183  C  CE  . LYS B  1 97  ? 6.291   152.098 153.724 1.00 61.69  ? 97   LYS B CE  1 
ATOM   3184  N  NZ  . LYS B  1 97  ? 7.241   153.238 153.534 1.00 60.46  ? 97   LYS B NZ  1 
ATOM   3185  N  N   . GLU B  1 98  ? 8.718   147.564 152.925 1.00 31.72  ? 98   GLU B N   1 
ATOM   3186  C  CA  . GLU B  1 98  ? 9.232   147.024 151.672 1.00 34.79  ? 98   GLU B CA  1 
ATOM   3187  C  C   . GLU B  1 98  ? 9.462   145.515 151.783 1.00 36.90  ? 98   GLU B C   1 
ATOM   3188  O  O   . GLU B  1 98  ? 9.113   144.760 150.870 1.00 31.87  ? 98   GLU B O   1 
ATOM   3189  C  CB  . GLU B  1 98  ? 10.513  147.760 151.229 1.00 37.84  ? 98   GLU B CB  1 
ATOM   3190  C  CG  . GLU B  1 98  ? 11.298  148.485 152.302 1.00 56.71  ? 98   GLU B CG  1 
ATOM   3191  C  CD  . GLU B  1 98  ? 10.652  149.783 152.776 1.00 46.84  ? 98   GLU B CD  1 
ATOM   3192  O  OE1 . GLU B  1 98  ? 10.648  150.798 152.043 1.00 53.57  ? 98   GLU B OE1 1 
ATOM   3193  O  OE2 . GLU B  1 98  ? 10.145  149.775 153.905 1.00 51.80  ? 98   GLU B OE2 1 
ATOM   3194  N  N   . ILE B  1 99  ? 9.996   145.049 152.912 1.00 36.46  ? 99   ILE B N   1 
ATOM   3195  C  CA  . ILE B  1 99  ? 10.140  143.609 153.097 1.00 38.92  ? 99   ILE B CA  1 
ATOM   3196  C  C   . ILE B  1 99  ? 8.773   142.936 153.090 1.00 40.36  ? 99   ILE B C   1 
ATOM   3197  O  O   . ILE B  1 99  ? 8.597   141.850 152.520 1.00 29.77  ? 99   ILE B O   1 
ATOM   3198  C  CB  . ILE B  1 99  ? 10.910  143.319 154.393 1.00 40.42  ? 99   ILE B CB  1 
ATOM   3199  C  CG1 . ILE B  1 99  ? 12.371  143.738 154.234 1.00 39.92  ? 99   ILE B CG1 1 
ATOM   3200  C  CG2 . ILE B  1 99  ? 10.833  141.832 154.717 1.00 33.82  ? 99   ILE B CG2 1 
ATOM   3201  C  CD1 . ILE B  1 99  ? 13.103  143.732 155.536 1.00 44.39  ? 99   ILE B CD1 1 
ATOM   3202  N  N   . PHE B  1 100 ? 7.779   143.568 153.710 1.00 38.01  ? 100  PHE B N   1 
ATOM   3203  C  CA  . PHE B  1 100 ? 6.448   142.983 153.666 1.00 39.40  ? 100  PHE B CA  1 
ATOM   3204  C  C   . PHE B  1 100 ? 5.940   142.882 152.232 1.00 36.32  ? 100  PHE B C   1 
ATOM   3205  O  O   . PHE B  1 100 ? 5.338   141.869 151.847 1.00 31.71  ? 100  PHE B O   1 
ATOM   3206  C  CB  . PHE B  1 100 ? 5.465   143.790 154.515 1.00 42.54  ? 100  PHE B CB  1 
ATOM   3207  C  CG  . PHE B  1 100 ? 4.073   143.204 154.510 1.00 42.18  ? 100  PHE B CG  1 
ATOM   3208  C  CD1 . PHE B  1 100 ? 3.748   142.158 155.369 1.00 36.05  ? 100  PHE B CD1 1 
ATOM   3209  C  CD2 . PHE B  1 100 ? 3.110   143.664 153.617 1.00 40.76  ? 100  PHE B CD2 1 
ATOM   3210  C  CE1 . PHE B  1 100 ? 2.479   141.594 155.351 1.00 35.24  ? 100  PHE B CE1 1 
ATOM   3211  C  CE2 . PHE B  1 100 ? 1.834   143.110 153.592 1.00 40.05  ? 100  PHE B CE2 1 
ATOM   3212  C  CZ  . PHE B  1 100 ? 1.519   142.068 154.462 1.00 37.86  ? 100  PHE B CZ  1 
ATOM   3213  N  N   . GLU B  1 101 ? 6.126   143.939 151.439 1.00 30.96  ? 101  GLU B N   1 
ATOM   3214  C  CA  . GLU B  1 101 ? 5.681   143.889 150.049 1.00 34.06  ? 101  GLU B CA  1 
ATOM   3215  C  C   . GLU B  1 101 ? 6.384   142.770 149.286 1.00 38.34  ? 101  GLU B C   1 
ATOM   3216  O  O   . GLU B  1 101 ? 5.746   142.006 148.547 1.00 36.13  ? 101  GLU B O   1 
ATOM   3217  C  CB  . GLU B  1 101 ? 5.921   145.234 149.357 1.00 32.56  ? 101  GLU B CB  1 
ATOM   3218  C  CG  . GLU B  1 101 ? 5.523   145.230 147.867 1.00 31.30  ? 101  GLU B CG  1 
ATOM   3219  C  CD  . GLU B  1 101 ? 6.149   146.386 147.074 1.00 33.16  ? 101  GLU B CD  1 
ATOM   3220  O  OE1 . GLU B  1 101 ? 7.021   147.108 147.624 1.00 38.67  ? 101  GLU B OE1 1 
ATOM   3221  O  OE2 . GLU B  1 101 ? 5.792   146.553 145.888 1.00 37.06  ? 101  GLU B OE2 1 
ATOM   3222  N  N   . LEU B  1 102 ? 7.689   142.646 149.465 1.00 37.51  ? 102  LEU B N   1 
ATOM   3223  C  CA  . LEU B  1 102 ? 8.469   141.661 148.726 1.00 38.78  ? 102  LEU B CA  1 
ATOM   3224  C  C   . LEU B  1 102 ? 8.078   140.249 149.163 1.00 42.05  ? 102  LEU B C   1 
ATOM   3225  O  O   . LEU B  1 102 ? 7.816   139.390 148.324 1.00 43.81  ? 102  LEU B O   1 
ATOM   3226  C  CB  . LEU B  1 102 ? 9.969   141.913 148.936 1.00 41.74  ? 102  LEU B CB  1 
ATOM   3227  C  CG  . LEU B  1 102 ? 10.453  143.263 148.391 1.00 40.66  ? 102  LEU B CG  1 
ATOM   3228  C  CD1 . LEU B  1 102 ? 11.898  143.620 148.825 1.00 41.06  ? 102  LEU B CD1 1 
ATOM   3229  C  CD2 . LEU B  1 102 ? 10.344  143.230 146.867 1.00 43.17  ? 102  LEU B CD2 1 
HETATM 3230  N  N   . CSS B  1 103 ? 7.986   140.015 150.468 1.00 45.53  ? 103  CSS B N   1 
HETATM 3231  C  CA  . CSS B  1 103 ? 7.700   138.686 150.942 1.00 52.36  ? 103  CSS B CA  1 
HETATM 3232  C  CB  . CSS B  1 103 ? 7.998   138.553 152.397 1.00 57.86  ? 103  CSS B CB  1 
HETATM 3233  S  SG  . CSS B  1 103 ? 9.754   138.441 152.594 1.00 70.13  ? 103  CSS B SG  1 
HETATM 3234  S  SD  . CSS B  1 103 ? 10.577  137.044 151.382 0.50 61.15  ? 103  CSS B SD  1 
HETATM 3235  C  C   . CSS B  1 103 ? 6.281   138.285 150.680 1.00 47.92  ? 103  CSS B C   1 
HETATM 3236  O  O   . CSS B  1 103 ? 6.025   137.060 150.589 1.00 46.68  ? 103  CSS B O   1 
ATOM   3237  N  N   . SER B  1 104 ? 5.346   139.226 150.584 1.00 47.98  ? 104  SER B N   1 
ATOM   3238  C  CA  . SER B  1 104 ? 3.983   138.866 150.191 1.00 50.16  ? 104  SER B CA  1 
ATOM   3239  C  C   . SER B  1 104 ? 3.988   138.144 148.856 1.00 50.09  ? 104  SER B C   1 
ATOM   3240  O  O   . SER B  1 104 ? 3.197   137.239 148.639 1.00 54.98  ? 104  SER B O   1 
ATOM   3241  C  CB  . SER B  1 104 ? 3.067   140.087 150.127 1.00 48.55  ? 104  SER B CB  1 
ATOM   3242  O  OG  . SER B  1 104 ? 2.519   140.351 151.399 1.00 54.82  ? 104  SER B OG  1 
ATOM   3243  N  N   . GLY B  1 105 ? 4.890   138.538 147.959 1.00 59.35  ? 105  GLY B N   1 
ATOM   3244  C  CA  . GLY B  1 105 ? 5.056   137.772 146.736 1.00 69.11  ? 105  GLY B CA  1 
ATOM   3245  C  C   . GLY B  1 105 ? 5.560   136.364 146.999 1.00 70.21  ? 105  GLY B C   1 
ATOM   3246  O  O   . GLY B  1 105 ? 5.143   135.411 146.339 1.00 80.96  ? 105  GLY B O   1 
ATOM   3247  N  N   . CYS B  1 106 ? 6.461   136.213 147.971 1.00 62.89  ? 106  CYS B N   1 
ATOM   3248  C  CA  . CYS B  1 106 ? 7.040   134.907 148.260 1.00 60.67  ? 106  CYS B CA  1 
ATOM   3249  C  C   . CYS B  1 106 ? 6.066   133.962 148.954 1.00 57.38  ? 106  CYS B C   1 
ATOM   3250  O  O   . CYS B  1 106 ? 6.245   132.744 148.858 1.00 49.48  ? 106  CYS B O   1 
ATOM   3251  C  CB  . CYS B  1 106 ? 8.293   135.063 149.121 1.00 70.77  ? 106  CYS B CB  1 
ATOM   3252  S  SG  . CYS B  1 106 ? 9.683   135.847 148.266 1.00 80.42  ? 106  CYS B SG  1 
ATOM   3253  N  N   . LEU B  1 107 ? 5.055   134.481 149.666 1.00 52.05  ? 107  LEU B N   1 
ATOM   3254  C  CA  . LEU B  1 107 ? 4.191   133.590 150.440 1.00 47.96  ? 107  LEU B CA  1 
ATOM   3255  C  C   . LEU B  1 107 ? 3.408   132.625 149.557 1.00 42.83  ? 107  LEU B C   1 
ATOM   3256  O  O   . LEU B  1 107 ? 3.027   131.550 150.030 1.00 48.78  ? 107  LEU B O   1 
ATOM   3257  C  CB  . LEU B  1 107 ? 3.234   134.390 151.327 1.00 47.32  ? 107  LEU B CB  1 
ATOM   3258  C  CG  . LEU B  1 107 ? 3.865   135.030 152.579 1.00 51.76  ? 107  LEU B CG  1 
ATOM   3259  C  CD1 . LEU B  1 107 ? 2.831   135.769 153.425 1.00 52.92  ? 107  LEU B CD1 1 
ATOM   3260  C  CD2 . LEU B  1 107 ? 4.636   134.032 153.440 1.00 52.40  ? 107  LEU B CD2 1 
ATOM   3261  N  N   . GLY B  1 108 ? 3.212   132.950 148.276 1.00 37.21  ? 108  GLY B N   1 
ATOM   3262  C  CA  . GLY B  1 108 ? 2.548   132.046 147.349 1.00 31.54  ? 108  GLY B CA  1 
ATOM   3263  C  C   . GLY B  1 108 ? 3.301   130.744 147.099 1.00 40.44  ? 108  GLY B C   1 
ATOM   3264  O  O   . GLY B  1 108 ? 2.737   129.824 146.492 1.00 41.50  ? 108  GLY B O   1 
ATOM   3265  N  N   . MET B  1 109 ? 4.554   130.640 147.547 1.00 35.46  ? 109  MET B N   1 
ATOM   3266  C  CA  . MET B  1 109 ? 5.299   129.402 147.411 1.00 44.45  ? 109  MET B CA  1 
ATOM   3267  C  C   . MET B  1 109 ? 5.648   128.778 148.751 1.00 41.62  ? 109  MET B C   1 
ATOM   3268  O  O   . MET B  1 109 ? 6.249   127.692 148.770 1.00 33.68  ? 109  MET B O   1 
ATOM   3269  C  CB  . MET B  1 109 ? 6.583   129.624 146.593 1.00 42.70  ? 109  MET B CB  1 
ATOM   3270  C  CG  . MET B  1 109 ? 7.669   130.356 147.333 1.00 42.13  ? 109  MET B CG  1 
ATOM   3271  S  SD  . MET B  1 109 ? 9.185   130.565 146.357 1.00 51.53  ? 109  MET B SD  1 
ATOM   3272  C  CE  . MET B  1 109 ? 10.178  131.547 147.499 1.00 54.20  ? 109  MET B CE  1 
ATOM   3273  N  N   . VAL B  1 110 ? 5.241   129.400 149.861 1.00 27.93  ? 110  VAL B N   1 
ATOM   3274  C  CA  . VAL B  1 110 ? 5.625   128.953 151.194 1.00 31.82  ? 110  VAL B CA  1 
ATOM   3275  C  C   . VAL B  1 110 ? 4.654   127.887 151.686 1.00 30.02  ? 110  VAL B C   1 
ATOM   3276  O  O   . VAL B  1 110 ? 3.430   128.087 151.682 1.00 31.82  ? 110  VAL B O   1 
ATOM   3277  C  CB  . VAL B  1 110 ? 5.678   130.130 152.177 1.00 37.17  ? 110  VAL B CB  1 
ATOM   3278  C  CG1 . VAL B  1 110 ? 5.838   129.596 153.611 1.00 36.66  ? 110  VAL B CG1 1 
ATOM   3279  C  CG2 . VAL B  1 110 ? 6.845   131.086 151.811 1.00 45.32  ? 110  VAL B CG2 1 
ATOM   3280  N  N   . ILE B  1 111 ? 5.202   126.764 152.142 1.00 30.87  ? 111  ILE B N   1 
ATOM   3281  C  CA  . ILE B  1 111 ? 4.406   125.708 152.750 1.00 31.57  ? 111  ILE B CA  1 
ATOM   3282  C  C   . ILE B  1 111 ? 4.582   125.678 154.265 1.00 32.77  ? 111  ILE B C   1 
ATOM   3283  O  O   . ILE B  1 111 ? 3.640   125.319 154.987 1.00 30.50  ? 111  ILE B O   1 
ATOM   3284  C  CB  . ILE B  1 111 ? 4.748   124.333 152.123 1.00 33.51  ? 111  ILE B CB  1 
ATOM   3285  C  CG1 . ILE B  1 111 ? 4.203   124.244 150.694 1.00 32.95  ? 111  ILE B CG1 1 
ATOM   3286  C  CG2 . ILE B  1 111 ? 4.206   123.152 152.958 1.00 32.26  ? 111  ILE B CG2 1 
ATOM   3287  C  CD1 . ILE B  1 111 ? 4.737   123.061 149.886 1.00 29.78  ? 111  ILE B CD1 1 
ATOM   3288  N  N   . GLU B  1 112 ? 5.749   126.073 154.764 1.00 30.19  ? 112  GLU B N   1 
ATOM   3289  C  CA  . GLU B  1 112 ? 5.990   126.126 156.197 1.00 35.91  ? 112  GLU B CA  1 
ATOM   3290  C  C   . GLU B  1 112 ? 7.021   127.214 156.474 1.00 34.67  ? 112  GLU B C   1 
ATOM   3291  O  O   . GLU B  1 112 ? 7.938   127.444 155.672 1.00 32.58  ? 112  GLU B O   1 
ATOM   3292  C  CB  . GLU B  1 112 ? 6.445   124.751 156.704 1.00 45.01  ? 112  GLU B CB  1 
ATOM   3293  C  CG  . GLU B  1 112 ? 6.299   124.570 158.194 1.00 58.57  ? 112  GLU B CG  1 
ATOM   3294  C  CD  . GLU B  1 112 ? 6.558   123.147 158.639 1.00 68.54  ? 112  GLU B CD  1 
ATOM   3295  O  OE1 . GLU B  1 112 ? 6.838   122.258 157.780 1.00 54.85  ? 112  GLU B OE1 1 
ATOM   3296  O  OE2 . GLU B  1 112 ? 6.462   122.933 159.868 1.00 77.36  ? 112  GLU B OE2 1 
ATOM   3297  N  N   . GLY B  1 113 ? 6.870   127.887 157.613 1.00 33.65  ? 113  GLY B N   1 
ATOM   3298  C  CA  . GLY B  1 113 ? 7.755   128.987 157.945 1.00 30.84  ? 113  GLY B CA  1 
ATOM   3299  C  C   . GLY B  1 113 ? 7.197   130.321 157.483 1.00 35.82  ? 113  GLY B C   1 
ATOM   3300  O  O   . GLY B  1 113 ? 6.037   130.411 157.079 1.00 38.98  ? 113  GLY B O   1 
ATOM   3301  N  N   . PRO B  1 114 ? 8.010   131.395 157.535 1.00 36.31  ? 114  PRO B N   1 
ATOM   3302  C  CA  . PRO B  1 114 ? 9.400   131.384 158.003 1.00 36.43  ? 114  PRO B CA  1 
ATOM   3303  C  C   . PRO B  1 114 ? 9.539   131.360 159.522 1.00 37.24  ? 114  PRO B C   1 
ATOM   3304  O  O   . PRO B  1 114 ? 8.691   131.835 160.270 1.00 37.24  ? 114  PRO B O   1 
ATOM   3305  C  CB  . PRO B  1 114 ? 9.964   132.684 157.433 1.00 34.99  ? 114  PRO B CB  1 
ATOM   3306  C  CG  . PRO B  1 114 ? 8.799   133.615 157.473 1.00 40.53  ? 114  PRO B CG  1 
ATOM   3307  C  CD  . PRO B  1 114 ? 7.592   132.745 157.117 1.00 42.41  ? 114  PRO B CD  1 
ATOM   3308  N  N   . TRP B  1 115 ? 10.639  130.774 159.967 1.00 38.39  ? 115  TRP B N   1 
ATOM   3309  C  CA  . TRP B  1 115 ? 11.035  130.775 161.364 1.00 30.97  ? 115  TRP B CA  1 
ATOM   3310  C  C   . TRP B  1 115 ? 12.489  131.204 161.359 1.00 31.43  ? 115  TRP B C   1 
ATOM   3311  O  O   . TRP B  1 115 ? 13.304  130.597 160.664 1.00 34.10  ? 115  TRP B O   1 
ATOM   3312  C  CB  . TRP B  1 115 ? 10.838  129.385 161.990 1.00 29.81  ? 115  TRP B CB  1 
ATOM   3313  C  CG  . TRP B  1 115 ? 11.068  129.316 163.462 1.00 35.68  ? 115  TRP B CG  1 
ATOM   3314  C  CD1 . TRP B  1 115 ? 12.045  128.615 164.103 1.00 34.19  ? 115  TRP B CD1 1 
ATOM   3315  C  CD2 . TRP B  1 115 ? 10.302  129.972 164.492 1.00 36.65  ? 115  TRP B CD2 1 
ATOM   3316  N  NE1 . TRP B  1 115 ? 11.941  128.806 165.469 1.00 35.15  ? 115  TRP B NE1 1 
ATOM   3317  C  CE2 . TRP B  1 115 ? 10.875  129.625 165.728 1.00 32.15  ? 115  TRP B CE2 1 
ATOM   3318  C  CE3 . TRP B  1 115 ? 9.184   130.811 164.484 1.00 31.02  ? 115  TRP B CE3 1 
ATOM   3319  C  CZ2 . TRP B  1 115 ? 10.375  130.095 166.943 1.00 29.24  ? 115  TRP B CZ2 1 
ATOM   3320  C  CZ3 . TRP B  1 115 ? 8.697   131.281 165.688 1.00 37.89  ? 115  TRP B CZ3 1 
ATOM   3321  C  CH2 . TRP B  1 115 ? 9.287   130.920 166.898 1.00 31.94  ? 115  TRP B CH2 1 
ATOM   3322  N  N   . GLU B  1 116 ? 12.814  132.274 162.083 1.00 31.98  ? 116  GLU B N   1 
ATOM   3323  C  CA  . GLU B  1 116 ? 14.131  132.897 161.971 1.00 34.07  ? 116  GLU B CA  1 
ATOM   3324  C  C   . GLU B  1 116 ? 14.829  132.970 163.323 1.00 28.10  ? 116  GLU B C   1 
ATOM   3325  O  O   . GLU B  1 116 ? 14.771  133.997 164.001 1.00 32.20  ? 116  GLU B O   1 
ATOM   3326  C  CB  . GLU B  1 116 ? 14.039  134.289 161.357 1.00 33.75  ? 116  GLU B CB  1 
ATOM   3327  C  CG  . GLU B  1 116 ? 15.424  134.761 160.936 1.00 34.87  ? 116  GLU B CG  1 
ATOM   3328  C  CD  . GLU B  1 116 ? 15.398  136.108 160.289 1.00 40.13  ? 116  GLU B CD  1 
ATOM   3329  O  OE1 . GLU B  1 116 ? 14.639  136.972 160.749 1.00 41.08  ? 116  GLU B OE1 1 
ATOM   3330  O  OE2 . GLU B  1 116 ? 16.115  136.287 159.288 1.00 49.45  ? 116  GLU B OE2 1 
ATOM   3331  N  N   . PRO B  1 117 ? 15.509  131.911 163.727 1.00 34.35  ? 117  PRO B N   1 
ATOM   3332  C  CA  . PRO B  1 117 ? 16.311  131.953 164.952 1.00 30.44  ? 117  PRO B CA  1 
ATOM   3333  C  C   . PRO B  1 117 ? 17.637  132.674 164.755 1.00 34.38  ? 117  PRO B C   1 
ATOM   3334  O  O   . PRO B  1 117 ? 18.155  132.813 163.643 1.00 31.43  ? 117  PRO B O   1 
ATOM   3335  C  CB  . PRO B  1 117 ? 16.555  130.462 165.279 1.00 28.28  ? 117  PRO B CB  1 
ATOM   3336  C  CG  . PRO B  1 117 ? 15.651  129.706 164.377 1.00 28.20  ? 117  PRO B CG  1 
ATOM   3337  C  CD  . PRO B  1 117 ? 15.417  130.548 163.175 1.00 35.10  ? 117  PRO B CD  1 
ATOM   3338  N  N   . TYR B  1 118 ? 18.159  133.144 165.887 1.00 28.37  ? 118  TYR B N   1 
ATOM   3339  C  CA  . TYR B  1 118 ? 19.478  133.739 166.024 1.00 28.39  ? 118  TYR B CA  1 
ATOM   3340  C  C   . TYR B  1 118 ? 20.473  132.705 166.538 1.00 33.82  ? 118  TYR B C   1 
ATOM   3341  O  O   . TYR B  1 118 ? 20.182  131.957 167.479 1.00 33.44  ? 118  TYR B O   1 
ATOM   3342  C  CB  . TYR B  1 118 ? 19.439  134.895 167.017 1.00 30.60  ? 118  TYR B CB  1 
ATOM   3343  C  CG  . TYR B  1 118 ? 18.768  136.138 166.509 1.00 31.68  ? 118  TYR B CG  1 
ATOM   3344  C  CD1 . TYR B  1 118 ? 19.411  136.968 165.601 1.00 31.24  ? 118  TYR B CD1 1 
ATOM   3345  C  CD2 . TYR B  1 118 ? 17.500  136.507 166.970 1.00 31.66  ? 118  TYR B CD2 1 
ATOM   3346  C  CE1 . TYR B  1 118 ? 18.815  138.129 165.152 1.00 32.04  ? 118  TYR B CE1 1 
ATOM   3347  C  CE2 . TYR B  1 118 ? 16.898  137.672 166.529 1.00 32.80  ? 118  TYR B CE2 1 
ATOM   3348  C  CZ  . TYR B  1 118 ? 17.572  138.476 165.625 1.00 30.81  ? 118  TYR B CZ  1 
ATOM   3349  O  OH  . TYR B  1 118 ? 16.990  139.623 165.171 1.00 36.85  ? 118  TYR B OH  1 
ATOM   3350  N  N   . PHE B  1 119 ? 21.660  132.701 165.950 1.00 30.75  ? 119  PHE B N   1 
ATOM   3351  C  CA  . PHE B  1 119 ? 22.689  131.732 166.297 1.00 31.05  ? 119  PHE B CA  1 
ATOM   3352  C  C   . PHE B  1 119 ? 23.971  132.447 166.649 1.00 34.23  ? 119  PHE B C   1 
ATOM   3353  O  O   . PHE B  1 119 ? 24.391  133.380 165.961 1.00 29.62  ? 119  PHE B O   1 
ATOM   3354  C  CB  . PHE B  1 119 ? 22.940  130.745 165.156 1.00 28.32  ? 119  PHE B CB  1 
ATOM   3355  C  CG  . PHE B  1 119 ? 21.802  129.803 164.946 1.00 28.40  ? 119  PHE B CG  1 
ATOM   3356  C  CD1 . PHE B  1 119 ? 20.700  130.193 164.190 1.00 28.15  ? 119  PHE B CD1 1 
ATOM   3357  C  CD2 . PHE B  1 119 ? 21.799  128.547 165.551 1.00 28.36  ? 119  PHE B CD2 1 
ATOM   3358  C  CE1 . PHE B  1 119 ? 19.620  129.340 164.014 1.00 28.13  ? 119  PHE B CE1 1 
ATOM   3359  C  CE2 . PHE B  1 119 ? 20.716  127.675 165.372 1.00 31.10  ? 119  PHE B CE2 1 
ATOM   3360  C  CZ  . PHE B  1 119 ? 19.615  128.095 164.604 1.00 30.88  ? 119  PHE B CZ  1 
ATOM   3361  N  N   . GLU B  1 120 ? 24.593  131.980 167.713 1.00 32.30  ? 120  GLU B N   1 
ATOM   3362  C  CA  . GLU B  1 120 ? 25.922  132.415 168.063 1.00 28.88  ? 120  GLU B CA  1 
ATOM   3363  C  C   . GLU B  1 120 ? 26.906  131.462 167.388 1.00 32.33  ? 120  GLU B C   1 
ATOM   3364  O  O   . GLU B  1 120 ? 26.674  130.251 167.326 1.00 31.06  ? 120  GLU B O   1 
ATOM   3365  C  CB  . GLU B  1 120 ? 26.080  132.416 169.585 1.00 29.14  ? 120  GLU B CB  1 
ATOM   3366  C  CG  . GLU B  1 120 ? 27.502  132.585 170.055 1.00 59.15  ? 120  GLU B CG  1 
ATOM   3367  C  CD  . GLU B  1 120 ? 27.688  132.243 171.523 1.00 64.00  ? 120  GLU B CD  1 
ATOM   3368  O  OE1 . GLU B  1 120 ? 26.678  131.984 172.218 1.00 67.07  ? 120  GLU B OE1 1 
ATOM   3369  O  OE2 . GLU B  1 120 ? 28.860  132.219 171.967 1.00 69.73  ? 120  GLU B OE2 1 
ATOM   3370  N  N   . VAL B  1 121 ? 27.971  132.020 166.820 1.00 32.78  ? 121  VAL B N   1 
ATOM   3371  C  CA  . VAL B  1 121 ? 29.034  131.217 166.221 1.00 40.16  ? 121  VAL B CA  1 
ATOM   3372  C  C   . VAL B  1 121 ? 29.950  130.780 167.360 1.00 40.60  ? 121  VAL B C   1 
ATOM   3373  O  O   . VAL B  1 121 ? 30.770  131.556 167.833 1.00 34.43  ? 121  VAL B O   1 
ATOM   3374  C  CB  . VAL B  1 121 ? 29.804  131.988 165.146 1.00 42.73  ? 121  VAL B CB  1 
ATOM   3375  C  CG1 . VAL B  1 121 ? 30.968  131.127 164.594 1.00 44.02  ? 121  VAL B CG1 1 
ATOM   3376  C  CG2 . VAL B  1 121 ? 28.867  132.403 164.022 1.00 41.47  ? 121  VAL B CG2 1 
ATOM   3377  N  N   . VAL B  1 122 ? 29.787  129.540 167.826 1.00 41.26  ? 122  VAL B N   1 
ATOM   3378  C  CA  . VAL B  1 122 ? 30.578  129.055 168.953 1.00 35.44  ? 122  VAL B CA  1 
ATOM   3379  C  C   . VAL B  1 122 ? 32.035  128.862 168.543 1.00 37.60  ? 122  VAL B C   1 
ATOM   3380  O  O   . VAL B  1 122 ? 32.960  129.229 169.275 1.00 38.32  ? 122  VAL B O   1 
ATOM   3381  C  CB  . VAL B  1 122 ? 29.949  127.760 169.492 1.00 44.31  ? 122  VAL B CB  1 
ATOM   3382  C  CG1 . VAL B  1 122 ? 30.818  127.174 170.567 1.00 46.96  ? 122  VAL B CG1 1 
ATOM   3383  C  CG2 . VAL B  1 122 ? 28.558  128.060 170.033 1.00 47.64  ? 122  VAL B CG2 1 
ATOM   3384  N  N   . LYS B  1 123 ? 32.263  128.259 167.379 1.00 35.09  ? 123  LYS B N   1 
ATOM   3385  C  CA  . LYS B  1 123 ? 33.596  128.039 166.833 1.00 38.16  ? 123  LYS B CA  1 
ATOM   3386  C  C   . LYS B  1 123 ? 33.452  127.794 165.337 1.00 42.93  ? 123  LYS B C   1 
ATOM   3387  O  O   . LYS B  1 123 ? 32.386  127.393 164.853 1.00 38.56  ? 123  LYS B O   1 
ATOM   3388  C  CB  . LYS B  1 123 ? 34.306  126.865 167.522 1.00 42.88  ? 123  LYS B CB  1 
ATOM   3389  C  CG  . LYS B  1 123 ? 35.818  126.924 167.430 1.00 61.95  ? 123  LYS B CG  1 
ATOM   3390  C  CD  . LYS B  1 123 ? 36.512  126.491 168.714 1.00 74.25  ? 123  LYS B CD  1 
ATOM   3391  C  CE  . LYS B  1 123 ? 38.041  126.620 168.576 1.00 78.68  ? 123  LYS B CE  1 
ATOM   3392  N  NZ  . LYS B  1 123 ? 38.589  125.879 167.384 1.00 72.46  ? 123  LYS B NZ  1 
ATOM   3393  N  N   . SER B  1 124 ? 34.524  128.061 164.601 1.00 33.05  ? 124  SER B N   1 
ATOM   3394  C  CA  . SER B  1 124 ? 34.440  127.887 163.160 1.00 35.30  ? 124  SER B CA  1 
ATOM   3395  C  C   . SER B  1 124 ? 35.833  127.661 162.598 1.00 42.60  ? 124  SER B C   1 
ATOM   3396  O  O   . SER B  1 124 ? 36.834  128.059 163.189 1.00 34.05  ? 124  SER B O   1 
ATOM   3397  C  CB  . SER B  1 124 ? 33.795  129.098 162.497 1.00 28.77  ? 124  SER B CB  1 
ATOM   3398  O  OG  . SER B  1 124 ? 34.692  130.180 162.512 1.00 34.68  ? 124  SER B OG  1 
ATOM   3399  N  N   . ASP B  1 125 ? 35.874  127.010 161.443 1.00 37.06  ? 125  ASP B N   1 
ATOM   3400  C  CA  . ASP B  1 125 ? 37.065  126.956 160.603 1.00 33.48  ? 125  ASP B CA  1 
ATOM   3401  C  C   . ASP B  1 125 ? 36.526  127.013 159.176 1.00 34.40  ? 125  ASP B C   1 
ATOM   3402  O  O   . ASP B  1 125 ? 36.425  125.984 158.488 1.00 31.24  ? 125  ASP B O   1 
ATOM   3403  C  CB  . ASP B  1 125 ? 37.904  125.709 160.862 1.00 30.63  ? 125  ASP B CB  1 
ATOM   3404  C  CG  . ASP B  1 125 ? 39.199  125.690 160.050 1.00 37.25  ? 125  ASP B CG  1 
ATOM   3405  O  OD1 . ASP B  1 125 ? 39.461  126.643 159.286 1.00 39.03  ? 125  ASP B OD1 1 
ATOM   3406  O  OD2 . ASP B  1 125 ? 39.939  124.691 160.156 1.00 42.38  ? 125  ASP B OD2 1 
ATOM   3407  N  N   . LEU B  1 126 ? 36.176  128.230 158.754 1.00 32.32  ? 126  LEU B N   1 
ATOM   3408  C  CA  . LEU B  1 126 ? 35.497  128.505 157.491 1.00 39.68  ? 126  LEU B CA  1 
ATOM   3409  C  C   . LEU B  1 126 ? 36.403  129.319 156.590 1.00 36.76  ? 126  LEU B C   1 
ATOM   3410  O  O   . LEU B  1 126 ? 36.810  130.427 156.974 1.00 43.76  ? 126  LEU B O   1 
ATOM   3411  C  CB  . LEU B  1 126 ? 34.192  129.284 157.715 1.00 41.60  ? 126  LEU B CB  1 
ATOM   3412  C  CG  . LEU B  1 126 ? 32.846  128.585 157.800 1.00 45.70  ? 126  LEU B CG  1 
ATOM   3413  C  CD1 . LEU B  1 126 ? 31.751  129.633 157.783 1.00 45.43  ? 126  LEU B CD1 1 
ATOM   3414  C  CD2 . LEU B  1 126 ? 32.651  127.577 156.671 1.00 39.40  ? 126  LEU B CD2 1 
ATOM   3415  N  N   . PRO B  1 127 ? 36.760  128.840 155.411 1.00 38.03  ? 127  PRO B N   1 
ATOM   3416  C  CA  . PRO B  1 127 ? 37.557  129.663 154.502 1.00 38.78  ? 127  PRO B CA  1 
ATOM   3417  C  C   . PRO B  1 127 ? 36.699  130.689 153.775 1.00 41.49  ? 127  PRO B C   1 
ATOM   3418  O  O   . PRO B  1 127 ? 35.478  130.567 153.662 1.00 35.49  ? 127  PRO B O   1 
ATOM   3419  C  CB  . PRO B  1 127 ? 38.138  128.650 153.511 1.00 38.32  ? 127  PRO B CB  1 
ATOM   3420  C  CG  . PRO B  1 127 ? 37.215  127.456 153.578 1.00 33.93  ? 127  PRO B CG  1 
ATOM   3421  C  CD  . PRO B  1 127 ? 36.400  127.530 154.833 1.00 30.56  ? 127  PRO B CD  1 
ATOM   3422  N  N   . GLN B  1 128 ? 37.372  131.710 153.266 1.00 36.27  ? 128  GLN B N   1 
ATOM   3423  C  CA  . GLN B  1 128 ? 36.732  132.607 152.327 1.00 38.98  ? 128  GLN B CA  1 
ATOM   3424  C  C   . GLN B  1 128 ? 36.359  131.859 151.061 1.00 39.69  ? 128  GLN B C   1 
ATOM   3425  O  O   . GLN B  1 128 ? 37.051  130.932 150.646 1.00 40.90  ? 128  GLN B O   1 
ATOM   3426  C  CB  . GLN B  1 128 ? 37.681  133.743 151.972 1.00 52.54  ? 128  GLN B CB  1 
ATOM   3427  C  CG  . GLN B  1 128 ? 38.078  134.579 153.157 1.00 81.65  ? 128  GLN B CG  1 
ATOM   3428  C  CD  . GLN B  1 128 ? 39.076  135.670 152.772 1.00 90.68  ? 128  GLN B CD  1 
ATOM   3429  O  OE1 . GLN B  1 128 ? 39.336  135.884 151.592 1.00 91.27  ? 128  GLN B OE1 1 
ATOM   3430  N  NE2 . GLN B  1 128 ? 39.692  136.249 153.766 1.00 96.03  ? 128  GLN B NE2 1 
ATOM   3431  N  N   . ILE B  1 129 ? 35.265  132.276 150.442 1.00 36.74  ? 129  ILE B N   1 
ATOM   3432  C  CA  . ILE B  1 129 ? 34.881  131.715 149.154 1.00 35.33  ? 129  ILE B CA  1 
ATOM   3433  C  C   . ILE B  1 129 ? 35.694  132.378 148.050 1.00 38.98  ? 129  ILE B C   1 
ATOM   3434  O  O   . ILE B  1 129 ? 36.109  133.546 148.136 1.00 32.07  ? 129  ILE B O   1 
ATOM   3435  C  CB  . ILE B  1 129 ? 33.368  131.869 148.898 1.00 38.25  ? 129  ILE B CB  1 
ATOM   3436  C  CG1 . ILE B  1 129 ? 32.956  133.346 148.888 1.00 39.27  ? 129  ILE B CG1 1 
ATOM   3437  C  CG2 . ILE B  1 129 ? 32.555  131.085 149.939 1.00 38.97  ? 129  ILE B CG2 1 
ATOM   3438  C  CD1 . ILE B  1 129 ? 31.443  133.555 148.569 1.00 39.57  ? 129  ILE B CD1 1 
ATOM   3439  N  N   . MET B  1 130 ? 35.894  131.618 146.984 1.00 34.24  ? 130  MET B N   1 
ATOM   3440  C  CA  . MET B  1 130 ? 36.661  132.032 145.827 1.00 37.47  ? 130  MET B CA  1 
ATOM   3441  C  C   . MET B  1 130 ? 36.174  131.219 144.632 1.00 35.41  ? 130  MET B C   1 
ATOM   3442  O  O   . MET B  1 130 ? 35.335  130.321 144.764 1.00 34.43  ? 130  MET B O   1 
ATOM   3443  C  CB  . MET B  1 130 ? 38.159  131.826 146.061 1.00 32.54  ? 130  MET B CB  1 
ATOM   3444  C  CG  . MET B  1 130 ? 38.515  130.359 146.345 1.00 33.36  ? 130  MET B CG  1 
ATOM   3445  S  SD  . MET B  1 130 ? 40.259  130.095 146.736 1.00 45.43  ? 130  MET B SD  1 
ATOM   3446  C  CE  . MET B  1 130 ? 40.341  130.630 148.444 1.00 54.66  ? 130  MET B CE  1 
ATOM   3447  N  N   . SER B  1 131 ? 36.763  131.492 143.476 1.00 36.37  ? 131  SER B N   1 
ATOM   3448  C  CA  . SER B  1 131 ? 36.490  130.756 142.253 1.00 35.23  ? 131  SER B CA  1 
ATOM   3449  C  C   . SER B  1 131 ? 37.781  130.092 141.789 1.00 32.82  ? 131  SER B C   1 
ATOM   3450  O  O   . SER B  1 131 ? 38.860  130.374 142.316 1.00 33.61  ? 131  SER B O   1 
ATOM   3451  C  CB  . SER B  1 131 ? 35.953  131.686 141.163 1.00 37.63  ? 131  SER B CB  1 
ATOM   3452  O  OG  . SER B  1 131 ? 37.034  132.369 140.537 1.00 42.61  ? 131  SER B OG  1 
ATOM   3453  N  N   . MET B  1 132 ? 37.653  129.195 140.798 1.00 33.09  ? 132  MET B N   1 
ATOM   3454  C  CA  . MET B  1 132 ? 38.802  128.460 140.259 1.00 32.88  ? 132  MET B CA  1 
ATOM   3455  C  C   . MET B  1 132 ? 39.921  129.394 139.812 1.00 35.30  ? 132  MET B C   1 
ATOM   3456  O  O   . MET B  1 132 ? 41.091  129.176 140.136 1.00 40.81  ? 132  MET B O   1 
ATOM   3457  C  CB  . MET B  1 132 ? 38.368  127.609 139.064 1.00 38.90  ? 132  MET B CB  1 
ATOM   3458  C  CG  . MET B  1 132 ? 37.480  126.420 139.361 1.00 66.66  ? 132  MET B CG  1 
ATOM   3459  S  SD  . MET B  1 132 ? 38.306  125.048 140.177 1.00 86.77  ? 132  MET B SD  1 
ATOM   3460  C  CE  . MET B  1 132 ? 37.151  123.727 139.779 1.00 91.03  ? 132  MET B CE  1 
ATOM   3461  N  N   . THR B  1 133 ? 39.581  130.437 139.044 1.00 33.27  ? 133  THR B N   1 
ATOM   3462  C  CA  . THR B  1 133 ? 40.584  131.357 138.515 1.00 36.35  ? 133  THR B CA  1 
ATOM   3463  C  C   . THR B  1 133 ? 41.228  132.220 139.594 1.00 39.37  ? 133  THR B C   1 
ATOM   3464  O  O   . THR B  1 133 ? 42.199  132.929 139.295 1.00 39.46  ? 133  THR B O   1 
ATOM   3465  C  CB  . THR B  1 133 ? 39.965  132.255 137.432 1.00 37.55  ? 133  THR B CB  1 
ATOM   3466  O  OG1 . THR B  1 133 ? 38.798  132.912 137.945 1.00 33.24  ? 133  THR B OG1 1 
ATOM   3467  C  CG2 . THR B  1 133 ? 39.570  131.415 136.226 1.00 35.16  ? 133  THR B CG2 1 
ATOM   3468  N  N   . ASP B  1 134 ? 40.714  132.187 140.830 1.00 33.15  ? 134  ASP B N   1 
ATOM   3469  C  CA  . ASP B  1 134 ? 41.353  132.863 141.951 1.00 28.22  ? 134  ASP B CA  1 
ATOM   3470  C  C   . ASP B  1 134 ? 42.421  132.014 142.621 1.00 37.51  ? 134  ASP B C   1 
ATOM   3471  O  O   . ASP B  1 134 ? 43.220  132.542 143.400 1.00 36.47  ? 134  ASP B O   1 
ATOM   3472  C  CB  . ASP B  1 134 ? 40.324  133.245 143.022 1.00 31.31  ? 134  ASP B CB  1 
ATOM   3473  C  CG  . ASP B  1 134 ? 39.223  134.152 142.493 1.00 38.92  ? 134  ASP B CG  1 
ATOM   3474  O  OD1 . ASP B  1 134 ? 39.488  134.956 141.570 1.00 41.16  ? 134  ASP B OD1 1 
ATOM   3475  O  OD2 . ASP B  1 134 ? 38.091  134.071 143.024 1.00 33.90  ? 134  ASP B OD2 1 
ATOM   3476  N  N   . VAL B  1 135 ? 42.419  130.713 142.373 1.00 34.46  ? 135  VAL B N   1 
ATOM   3477  C  CA  . VAL B  1 135 ? 43.202  129.779 143.167 1.00 30.17  ? 135  VAL B CA  1 
ATOM   3478  C  C   . VAL B  1 135 ? 44.704  130.005 143.002 1.00 34.66  ? 135  VAL B C   1 
ATOM   3479  O  O   . VAL B  1 135 ? 45.414  130.031 144.021 1.00 37.89  ? 135  VAL B O   1 
ATOM   3480  C  CB  . VAL B  1 135 ? 42.773  128.333 142.858 1.00 28.08  ? 135  VAL B CB  1 
ATOM   3481  C  CG1 . VAL B  1 135 ? 43.733  127.361 143.464 1.00 35.43  ? 135  VAL B CG1 1 
ATOM   3482  C  CG2 . VAL B  1 135 ? 41.361  128.098 143.434 1.00 29.55  ? 135  VAL B CG2 1 
ATOM   3483  N  N   . PRO B  1 136 ? 45.249  130.197 141.792 1.00 33.65  ? 136  PRO B N   1 
ATOM   3484  C  CA  . PRO B  1 136 ? 46.703  130.442 141.721 1.00 33.57  ? 136  PRO B CA  1 
ATOM   3485  C  C   . PRO B  1 136 ? 47.154  131.634 142.550 1.00 40.57  ? 136  PRO B C   1 
ATOM   3486  O  O   . PRO B  1 136 ? 48.171  131.550 143.257 1.00 42.69  ? 136  PRO B O   1 
ATOM   3487  C  CB  . PRO B  1 136 ? 46.950  130.656 140.226 1.00 29.59  ? 136  PRO B CB  1 
ATOM   3488  C  CG  . PRO B  1 136 ? 45.862  129.852 139.571 1.00 34.34  ? 136  PRO B CG  1 
ATOM   3489  C  CD  . PRO B  1 136 ? 44.658  130.072 140.448 1.00 37.18  ? 136  PRO B CD  1 
ATOM   3490  N  N   . GLN B  1 137 ? 46.401  132.733 142.520 1.00 42.52  ? 137  GLN B N   1 
ATOM   3491  C  CA  . GLN B  1 137 ? 46.807  133.921 143.271 1.00 43.23  ? 137  GLN B CA  1 
ATOM   3492  C  C   . GLN B  1 137 ? 46.667  133.712 144.773 1.00 41.48  ? 137  GLN B C   1 
ATOM   3493  O  O   . GLN B  1 137 ? 47.516  134.167 145.550 1.00 40.41  ? 137  GLN B O   1 
ATOM   3494  C  CB  . GLN B  1 137 ? 46.001  135.131 142.805 1.00 40.04  ? 137  GLN B CB  1 
ATOM   3495  C  CG  . GLN B  1 137 ? 46.112  136.361 143.717 1.00 49.65  ? 137  GLN B CG  1 
ATOM   3496  C  CD  . GLN B  1 137 ? 45.575  137.610 143.048 1.00 47.28  ? 137  GLN B CD  1 
ATOM   3497  O  OE1 . GLN B  1 137 ? 44.498  138.092 143.394 1.00 47.12  ? 137  GLN B OE1 1 
ATOM   3498  N  NE2 . GLN B  1 137 ? 46.343  138.157 142.099 1.00 37.74  ? 137  GLN B NE2 1 
ATOM   3499  N  N   . VAL B  1 138 ? 45.600  133.033 145.200 1.00 34.89  ? 138  VAL B N   1 
ATOM   3500  C  CA  . VAL B  1 138 ? 45.452  132.706 146.614 1.00 42.88  ? 138  VAL B CA  1 
ATOM   3501  C  C   . VAL B  1 138 ? 46.623  131.852 147.076 1.00 47.23  ? 138  VAL B C   1 
ATOM   3502  O  O   . VAL B  1 138 ? 47.182  132.061 148.158 1.00 45.92  ? 138  VAL B O   1 
ATOM   3503  C  CB  . VAL B  1 138 ? 44.101  132.006 146.852 1.00 42.93  ? 138  VAL B CB  1 
ATOM   3504  C  CG1 . VAL B  1 138 ? 44.030  131.400 148.250 1.00 37.65  ? 138  VAL B CG1 1 
ATOM   3505  C  CG2 . VAL B  1 138 ? 42.969  132.988 146.620 1.00 44.74  ? 138  VAL B CG2 1 
ATOM   3506  N  N   . LEU B  1 139 ? 47.025  130.892 146.252 1.00 47.11  ? 139  LEU B N   1 
ATOM   3507  C  CA  . LEU B  1 139 ? 48.179  130.069 146.572 1.00 50.84  ? 139  LEU B CA  1 
ATOM   3508  C  C   . LEU B  1 139 ? 49.429  130.933 146.685 1.00 51.43  ? 139  LEU B C   1 
ATOM   3509  O  O   . LEU B  1 139 ? 50.166  130.859 147.676 1.00 49.27  ? 139  LEU B O   1 
ATOM   3510  C  CB  . LEU B  1 139 ? 48.334  128.999 145.492 1.00 51.75  ? 139  LEU B CB  1 
ATOM   3511  C  CG  . LEU B  1 139 ? 49.255  127.802 145.634 1.00 60.02  ? 139  LEU B CG  1 
ATOM   3512  C  CD1 . LEU B  1 139 ? 48.838  126.944 146.801 1.00 60.48  ? 139  LEU B CD1 1 
ATOM   3513  C  CD2 . LEU B  1 139 ? 49.149  127.001 144.361 1.00 66.65  ? 139  LEU B CD2 1 
ATOM   3514  N  N   . GLY B  1 140 ? 49.661  131.783 145.682 1.00 51.54  ? 140  GLY B N   1 
ATOM   3515  C  CA  . GLY B  1 140 ? 50.820  132.663 145.703 1.00 47.03  ? 140  GLY B CA  1 
ATOM   3516  C  C   . GLY B  1 140 ? 50.820  133.629 146.876 1.00 52.54  ? 140  GLY B C   1 
ATOM   3517  O  O   . GLY B  1 140 ? 51.876  133.908 147.456 1.00 48.97  ? 140  GLY B O   1 
ATOM   3518  N  N   . ASP B  1 141 ? 49.646  134.199 147.203 1.00 48.73  ? 141  ASP B N   1 
ATOM   3519  C  CA  . ASP B  1 141 ? 49.534  135.115 148.344 1.00 46.56  ? 141  ASP B CA  1 
ATOM   3520  C  C   . ASP B  1 141 ? 49.768  134.392 149.664 1.00 56.36  ? 141  ASP B C   1 
ATOM   3521  O  O   . ASP B  1 141 ? 50.358  134.961 150.592 1.00 55.72  ? 141  ASP B O   1 
ATOM   3522  C  CB  . ASP B  1 141 ? 48.161  135.793 148.364 1.00 50.29  ? 141  ASP B CB  1 
ATOM   3523  C  CG  . ASP B  1 141 ? 47.988  136.814 147.257 1.00 52.58  ? 141  ASP B CG  1 
ATOM   3524  O  OD1 . ASP B  1 141 ? 48.976  137.103 146.550 1.00 53.35  ? 141  ASP B OD1 1 
ATOM   3525  O  OD2 . ASP B  1 141 ? 46.851  137.301 147.069 1.00 51.99  ? 141  ASP B OD2 1 
ATOM   3526  N  N   . SER B  1 142 ? 49.303  133.142 149.770 1.00 56.15  ? 142  SER B N   1 
ATOM   3527  C  CA  . SER B  1 142 ? 49.532  132.364 150.983 1.00 56.88  ? 142  SER B CA  1 
ATOM   3528  C  C   . SER B  1 142 ? 51.025  132.150 151.220 1.00 60.65  ? 142  SER B C   1 
ATOM   3529  O  O   . SER B  1 142 ? 51.521  132.335 152.338 1.00 55.58  ? 142  SER B O   1 
ATOM   3530  C  CB  . SER B  1 142 ? 48.817  131.017 150.883 1.00 58.56  ? 142  SER B CB  1 
ATOM   3531  O  OG  . SER B  1 142 ? 47.408  131.163 150.933 1.00 62.91  ? 142  SER B OG  1 
ATOM   3532  N  N   . PHE B  1 143 ? 51.761  131.780 150.166 1.00 56.64  ? 143  PHE B N   1 
ATOM   3533  C  CA  . PHE B  1 143 ? 53.198  131.567 150.300 1.00 59.99  ? 143  PHE B CA  1 
ATOM   3534  C  C   . PHE B  1 143 ? 53.922  132.856 150.661 1.00 72.22  ? 143  PHE B C   1 
ATOM   3535  O  O   . PHE B  1 143 ? 54.780  132.861 151.551 1.00 81.71  ? 143  PHE B O   1 
ATOM   3536  C  CB  . PHE B  1 143 ? 53.755  130.974 149.010 1.00 61.08  ? 143  PHE B CB  1 
ATOM   3537  C  CG  . PHE B  1 143 ? 53.377  129.540 148.802 1.00 77.41  ? 143  PHE B CG  1 
ATOM   3538  C  CD1 . PHE B  1 143 ? 52.901  128.784 149.857 1.00 87.18  ? 143  PHE B CD1 1 
ATOM   3539  C  CD2 . PHE B  1 143 ? 53.454  128.955 147.549 1.00 82.26  ? 143  PHE B CD2 1 
ATOM   3540  C  CE1 . PHE B  1 143 ? 52.543  127.464 149.677 1.00 91.95  ? 143  PHE B CE1 1 
ATOM   3541  C  CE2 . PHE B  1 143 ? 53.088  127.633 147.355 1.00 82.11  ? 143  PHE B CE2 1 
ATOM   3542  C  CZ  . PHE B  1 143 ? 52.632  126.887 148.421 1.00 87.02  ? 143  PHE B CZ  1 
ATOM   3543  N  N   . ALA B  1 144 ? 53.579  133.959 149.993 1.00 70.02  ? 144  ALA B N   1 
ATOM   3544  C  CA  . ALA B  1 144 ? 54.218  135.238 150.288 1.00 67.01  ? 144  ALA B CA  1 
ATOM   3545  C  C   . ALA B  1 144 ? 54.003  135.636 151.744 1.00 66.73  ? 144  ALA B C   1 
ATOM   3546  O  O   . ALA B  1 144 ? 54.942  136.054 152.428 1.00 64.10  ? 144  ALA B O   1 
ATOM   3547  C  CB  . ALA B  1 144 ? 53.692  136.319 149.345 1.00 68.39  ? 144  ALA B CB  1 
ATOM   3548  N  N   . LYS B  1 145 ? 52.770  135.525 152.231 1.00 66.12  ? 145  LYS B N   1 
ATOM   3549  C  CA  . LYS B  1 145 ? 52.431  135.891 153.602 1.00 63.00  ? 145  LYS B CA  1 
ATOM   3550  C  C   . LYS B  1 145 ? 52.778  134.804 154.616 1.00 62.48  ? 145  LYS B C   1 
ATOM   3551  O  O   . LYS B  1 145 ? 52.404  134.936 155.786 1.00 67.50  ? 145  LYS B O   1 
ATOM   3552  C  CB  . LYS B  1 145 ? 50.943  136.247 153.699 1.00 68.46  ? 145  LYS B CB  1 
ATOM   3553  C  CG  . LYS B  1 145 ? 50.609  137.624 153.120 1.00 77.32  ? 145  LYS B CG  1 
ATOM   3554  C  CD  . LYS B  1 145 ? 49.302  137.642 152.324 1.00 82.28  ? 145  LYS B CD  1 
ATOM   3555  C  CE  . LYS B  1 145 ? 48.082  137.426 153.203 1.00 86.12  ? 145  LYS B CE  1 
ATOM   3556  N  NZ  . LYS B  1 145 ? 46.838  137.293 152.384 1.00 90.16  ? 145  LYS B NZ  1 
ATOM   3557  N  N   . GLN B  1 146 ? 53.477  133.743 154.201 1.00 65.80  ? 146  GLN B N   1 
ATOM   3558  C  CA  . GLN B  1 146 ? 53.857  132.644 155.092 1.00 75.30  ? 146  GLN B CA  1 
ATOM   3559  C  C   . GLN B  1 146 ? 52.639  132.023 155.778 1.00 73.04  ? 146  GLN B C   1 
ATOM   3560  O  O   . GLN B  1 146 ? 52.753  131.460 156.871 1.00 69.92  ? 146  GLN B O   1 
ATOM   3561  C  CB  . GLN B  1 146 ? 54.863  133.121 156.151 1.00 91.65  ? 146  GLN B CB  1 
ATOM   3562  C  CG  . GLN B  1 146 ? 56.170  133.727 155.616 1.00 107.74 ? 146  GLN B CG  1 
ATOM   3563  C  CD  . GLN B  1 146 ? 57.148  132.697 155.077 1.00 119.32 ? 146  GLN B CD  1 
ATOM   3564  O  OE1 . GLN B  1 146 ? 57.251  132.493 153.866 1.00 123.95 ? 146  GLN B OE1 1 
ATOM   3565  N  NE2 . GLN B  1 146 ? 57.905  132.073 155.976 1.00 120.99 ? 146  GLN B NE2 1 
ATOM   3566  N  N   . GLU B  1 147 ? 51.469  132.104 155.140 1.00 66.58  ? 147  GLU B N   1 
ATOM   3567  C  CA  . GLU B  1 147 ? 50.217  131.621 155.704 1.00 60.25  ? 147  GLU B CA  1 
ATOM   3568  C  C   . GLU B  1 147 ? 49.787  130.320 155.043 1.00 59.86  ? 147  GLU B C   1 
ATOM   3569  O  O   . GLU B  1 147 ? 50.214  129.974 153.940 1.00 57.01  ? 147  GLU B O   1 
ATOM   3570  C  CB  . GLU B  1 147 ? 49.108  132.660 155.552 1.00 66.30  ? 147  GLU B CB  1 
ATOM   3571  C  CG  . GLU B  1 147 ? 49.378  133.916 156.339 1.00 79.73  ? 147  GLU B CG  1 
ATOM   3572  C  CD  . GLU B  1 147 ? 48.357  134.986 156.085 1.00 88.70  ? 147  GLU B CD  1 
ATOM   3573  O  OE1 . GLU B  1 147 ? 47.443  134.742 155.271 1.00 90.23  ? 147  GLU B OE1 1 
ATOM   3574  O  OE2 . GLU B  1 147 ? 48.468  136.066 156.706 1.00 95.42  ? 147  GLU B OE2 1 
ATOM   3575  N  N   . ARG B  1 148 ? 48.902  129.610 155.723 1.00 58.13  ? 148  ARG B N   1 
ATOM   3576  C  CA  . ARG B  1 148 ? 48.458  128.336 155.196 1.00 53.80  ? 148  ARG B CA  1 
ATOM   3577  C  C   . ARG B  1 148 ? 47.500  128.548 154.034 1.00 48.19  ? 148  ARG B C   1 
ATOM   3578  O  O   . ARG B  1 148 ? 46.647  129.438 154.060 1.00 48.14  ? 148  ARG B O   1 
ATOM   3579  C  CB  . ARG B  1 148 ? 47.801  127.511 156.296 1.00 54.67  ? 148  ARG B CB  1 
ATOM   3580  C  CG  . ARG B  1 148 ? 47.700  126.052 155.928 1.00 57.23  ? 148  ARG B CG  1 
ATOM   3581  C  CD  . ARG B  1 148 ? 47.156  125.227 157.058 1.00 52.48  ? 148  ARG B CD  1 
ATOM   3582  N  NE  . ARG B  1 148 ? 47.213  123.807 156.731 1.00 53.58  ? 148  ARG B NE  1 
ATOM   3583  C  CZ  . ARG B  1 148 ? 46.513  122.885 157.376 1.00 57.64  ? 148  ARG B CZ  1 
ATOM   3584  N  NH1 . ARG B  1 148 ? 45.711  123.253 158.372 1.00 54.98  ? 148  ARG B NH1 1 
ATOM   3585  N  NH2 . ARG B  1 148 ? 46.607  121.608 157.026 1.00 55.24  ? 148  ARG B NH2 1 
ATOM   3586  N  N   . VAL B  1 149 ? 47.664  127.738 152.998 1.00 49.89  ? 149  VAL B N   1 
ATOM   3587  C  CA  . VAL B  1 149 ? 46.692  127.744 151.902 1.00 48.08  ? 149  VAL B CA  1 
ATOM   3588  C  C   . VAL B  1 149 ? 45.388  127.137 152.411 1.00 48.20  ? 149  VAL B C   1 
ATOM   3589  O  O   . VAL B  1 149 ? 45.417  126.058 153.034 1.00 45.82  ? 149  VAL B O   1 
ATOM   3590  C  CB  . VAL B  1 149 ? 47.233  126.956 150.704 1.00 45.49  ? 149  VAL B CB  1 
ATOM   3591  C  CG1 . VAL B  1 149 ? 46.222  126.982 149.544 1.00 37.01  ? 149  VAL B CG1 1 
ATOM   3592  C  CG2 . VAL B  1 149 ? 48.606  127.482 150.279 1.00 40.64  ? 149  VAL B CG2 1 
ATOM   3593  N  N   . PRO B  1 150 ? 44.240  127.781 152.200 1.00 37.44  ? 150  PRO B N   1 
ATOM   3594  C  CA  . PRO B  1 150 ? 42.968  127.233 152.694 1.00 34.45  ? 150  PRO B CA  1 
ATOM   3595  C  C   . PRO B  1 150 ? 42.458  126.085 151.830 1.00 39.42  ? 150  PRO B C   1 
ATOM   3596  O  O   . PRO B  1 150 ? 42.914  125.859 150.711 1.00 36.78  ? 150  PRO B O   1 
ATOM   3597  C  CB  . PRO B  1 150 ? 42.014  128.433 152.611 1.00 34.26  ? 150  PRO B CB  1 
ATOM   3598  C  CG  . PRO B  1 150 ? 42.543  129.241 151.491 1.00 36.16  ? 150  PRO B CG  1 
ATOM   3599  C  CD  . PRO B  1 150 ? 44.069  129.113 151.596 1.00 37.50  ? 150  PRO B CD  1 
ATOM   3600  N  N   . LYS B  1 151 ? 41.490  125.350 152.379 1.00 34.20  ? 151  LYS B N   1 
ATOM   3601  C  CA  . LYS B  1 151 ? 40.652  124.527 151.521 1.00 37.41  ? 151  LYS B CA  1 
ATOM   3602  C  C   . LYS B  1 151 ? 39.946  125.441 150.531 1.00 37.12  ? 151  LYS B C   1 
ATOM   3603  O  O   . LYS B  1 151 ? 39.656  126.598 150.833 1.00 40.14  ? 151  LYS B O   1 
ATOM   3604  C  CB  . LYS B  1 151 ? 39.621  123.730 152.341 1.00 40.12  ? 151  LYS B CB  1 
ATOM   3605  C  CG  . LYS B  1 151 ? 40.186  122.703 153.332 1.00 36.42  ? 151  LYS B CG  1 
ATOM   3606  C  CD  . LYS B  1 151 ? 41.081  121.694 152.621 1.00 37.77  ? 151  LYS B CD  1 
ATOM   3607  C  CE  . LYS B  1 151 ? 41.349  120.471 153.495 1.00 40.86  ? 151  LYS B CE  1 
ATOM   3608  N  NZ  . LYS B  1 151 ? 40.153  119.559 153.515 1.00 43.92  ? 151  LYS B NZ  1 
ATOM   3609  N  N   . VAL B  1 152 ? 39.699  124.943 149.326 1.00 38.69  ? 152  VAL B N   1 
ATOM   3610  C  CA  . VAL B  1 152 ? 39.073  125.764 148.294 1.00 34.84  ? 152  VAL B CA  1 
ATOM   3611  C  C   . VAL B  1 152 ? 37.553  125.631 148.415 1.00 36.50  ? 152  VAL B C   1 
ATOM   3612  O  O   . VAL B  1 152 ? 36.984  124.562 148.162 1.00 33.97  ? 152  VAL B O   1 
ATOM   3613  C  CB  . VAL B  1 152 ? 39.568  125.387 146.894 1.00 34.52  ? 152  VAL B CB  1 
ATOM   3614  C  CG1 . VAL B  1 152 ? 38.899  126.273 145.845 1.00 32.65  ? 152  VAL B CG1 1 
ATOM   3615  C  CG2 . VAL B  1 152 ? 41.079  125.492 146.815 1.00 35.44  ? 152  VAL B CG2 1 
ATOM   3616  N  N   . ALA B  1 153 ? 36.898  126.729 148.798 1.00 30.29  ? 153  ALA B N   1 
ATOM   3617  C  CA  . ALA B  1 153 ? 35.439  126.837 148.911 1.00 33.98  ? 153  ALA B CA  1 
ATOM   3618  C  C   . ALA B  1 153 ? 34.911  127.602 147.696 1.00 31.15  ? 153  ALA B C   1 
ATOM   3619  O  O   . ALA B  1 153 ? 34.922  128.835 147.676 1.00 34.64  ? 153  ALA B O   1 
ATOM   3620  C  CB  . ALA B  1 153 ? 35.055  127.551 150.209 1.00 31.12  ? 153  ALA B CB  1 
ATOM   3621  N  N   . LEU B  1 154 ? 34.423  126.874 146.696 1.00 36.33  ? 154  LEU B N   1 
ATOM   3622  C  CA  . LEU B  1 154 ? 34.011  127.497 145.444 1.00 32.42  ? 154  LEU B CA  1 
ATOM   3623  C  C   . LEU B  1 154 ? 32.682  128.228 145.613 1.00 36.57  ? 154  LEU B C   1 
ATOM   3624  O  O   . LEU B  1 154 ? 31.685  127.646 146.058 1.00 32.39  ? 154  LEU B O   1 
ATOM   3625  C  CB  . LEU B  1 154 ? 33.902  126.450 144.335 1.00 32.84  ? 154  LEU B CB  1 
ATOM   3626  C  CG  . LEU B  1 154 ? 35.228  125.823 143.899 1.00 34.65  ? 154  LEU B CG  1 
ATOM   3627  C  CD1 . LEU B  1 154 ? 34.980  124.722 142.876 1.00 34.10  ? 154  LEU B CD1 1 
ATOM   3628  C  CD2 . LEU B  1 154 ? 36.141  126.890 143.336 1.00 36.75  ? 154  LEU B CD2 1 
ATOM   3629  N  N   . SER B  1 155 ? 32.687  129.507 145.260 1.00 36.88  ? 155  SER B N   1 
ATOM   3630  C  CA  . SER B  1 155 ? 31.503  130.350 145.350 1.00 34.53  ? 155  SER B CA  1 
ATOM   3631  C  C   . SER B  1 155 ? 30.352  129.744 144.562 1.00 30.15  ? 155  SER B C   1 
ATOM   3632  O  O   . SER B  1 155 ? 30.478  129.501 143.358 1.00 30.98  ? 155  SER B O   1 
ATOM   3633  C  CB  . SER B  1 155 ? 31.841  131.748 144.833 1.00 34.40  ? 155  SER B CB  1 
ATOM   3634  O  OG  . SER B  1 155 ? 30.713  132.601 144.950 1.00 57.59  ? 155  SER B OG  1 
ATOM   3635  N  N   . SER B  1 156 ? 29.235  129.487 145.254 1.00 36.78  ? 156  SER B N   1 
ATOM   3636  C  CA  . SER B  1 156 ? 28.026  128.882 144.674 1.00 37.72  ? 156  SER B CA  1 
ATOM   3637  C  C   . SER B  1 156 ? 28.318  127.588 143.916 1.00 40.25  ? 156  SER B C   1 
ATOM   3638  O  O   . SER B  1 156 ? 27.597  127.241 142.979 1.00 36.59  ? 156  SER B O   1 
ATOM   3639  C  CB  . SER B  1 156 ? 27.274  129.869 143.766 1.00 44.12  ? 156  SER B CB  1 
ATOM   3640  O  OG  . SER B  1 156 ? 26.728  130.949 144.511 1.00 46.15  ? 156  SER B OG  1 
ATOM   3641  N  N   . GLN B  1 157 ? 29.348  126.841 144.317 1.00 46.05  ? 157  GLN B N   1 
ATOM   3642  C  CA  . GLN B  1 157 ? 29.709  125.598 143.612 1.00 41.97  ? 157  GLN B CA  1 
ATOM   3643  C  C   . GLN B  1 157 ? 30.240  124.561 144.597 1.00 42.12  ? 157  GLN B C   1 
ATOM   3644  O  O   . GLN B  1 157 ? 31.335  124.012 144.430 1.00 41.40  ? 157  GLN B O   1 
ATOM   3645  C  CB  . GLN B  1 157 ? 30.766  125.827 142.530 1.00 45.08  ? 157  GLN B CB  1 
ATOM   3646  C  CG  . GLN B  1 157 ? 30.339  126.503 141.255 1.00 67.81  ? 157  GLN B CG  1 
ATOM   3647  C  CD  . GLN B  1 157 ? 31.527  126.785 140.324 1.00 78.86  ? 157  GLN B CD  1 
ATOM   3648  O  OE1 . GLN B  1 157 ? 32.584  126.153 140.427 1.00 78.89  ? 157  GLN B OE1 1 
ATOM   3649  N  NE2 . GLN B  1 157 ? 31.364  127.763 139.438 1.00 79.20  ? 157  GLN B NE2 1 
ATOM   3650  N  N   . ARG B  1 158 ? 29.481  124.282 145.643 1.00 28.21  ? 158  ARG B N   1 
ATOM   3651  C  CA  . ARG B  1 158 ? 29.902  123.280 146.617 1.00 30.18  ? 158  ARG B CA  1 
ATOM   3652  C  C   . ARG B  1 158 ? 28.667  122.869 147.407 1.00 32.80  ? 158  ARG B C   1 
ATOM   3653  O  O   . ARG B  1 158 ? 27.546  123.281 147.104 1.00 35.18  ? 158  ARG B O   1 
ATOM   3654  C  CB  . ARG B  1 158 ? 31.035  123.798 147.513 1.00 29.22  ? 158  ARG B CB  1 
ATOM   3655  C  CG  . ARG B  1 158 ? 30.639  124.880 148.533 1.00 28.16  ? 158  ARG B CG  1 
ATOM   3656  C  CD  . ARG B  1 158 ? 31.833  125.671 149.082 1.00 29.38  ? 158  ARG B CD  1 
ATOM   3657  N  NE  . ARG B  1 158 ? 31.387  126.564 150.154 1.00 28.73  ? 158  ARG B NE  1 
ATOM   3658  C  CZ  . ARG B  1 158 ? 30.725  127.698 149.937 1.00 36.19  ? 158  ARG B CZ  1 
ATOM   3659  N  NH1 . ARG B  1 158 ? 30.467  128.096 148.698 1.00 32.60  ? 158  ARG B NH1 1 
ATOM   3660  N  NH2 . ARG B  1 158 ? 30.315  128.436 150.959 1.00 31.58  ? 158  ARG B NH2 1 
ATOM   3661  N  N   . THR B  1 159 ? 28.871  122.015 148.392 1.00 36.03  ? 159  THR B N   1 
ATOM   3662  C  CA  . THR B  1 159 ? 27.778  121.453 149.165 1.00 30.24  ? 159  THR B CA  1 
ATOM   3663  C  C   . THR B  1 159 ? 27.855  121.958 150.599 1.00 31.49  ? 159  THR B C   1 
ATOM   3664  O  O   . THR B  1 159 ? 28.939  122.000 151.197 1.00 35.22  ? 159  THR B O   1 
ATOM   3665  C  CB  . THR B  1 159 ? 27.822  119.925 149.098 1.00 28.83  ? 159  THR B CB  1 
ATOM   3666  O  OG1 . THR B  1 159 ? 27.546  119.518 147.753 1.00 39.05  ? 159  THR B OG1 1 
ATOM   3667  C  CG2 . THR B  1 159 ? 26.788  119.290 150.033 1.00 27.43  ? 159  THR B CG2 1 
ATOM   3668  N  N   . VAL B  1 160 ? 26.717  122.394 151.124 1.00 29.42  ? 160  VAL B N   1 
ATOM   3669  C  CA  . VAL B  1 160 ? 26.588  122.771 152.526 1.00 33.05  ? 160  VAL B CA  1 
ATOM   3670  C  C   . VAL B  1 160 ? 25.677  121.761 153.206 1.00 35.67  ? 160  VAL B C   1 
ATOM   3671  O  O   . VAL B  1 160 ? 24.590  121.442 152.704 1.00 31.70  ? 160  VAL B O   1 
ATOM   3672  C  CB  . VAL B  1 160 ? 26.045  124.198 152.709 1.00 31.58  ? 160  VAL B CB  1 
ATOM   3673  C  CG1 . VAL B  1 160 ? 25.830  124.458 154.179 1.00 28.16  ? 160  VAL B CG1 1 
ATOM   3674  C  CG2 . VAL B  1 160 ? 27.015  125.246 152.124 1.00 25.91  ? 160  VAL B CG2 1 
ATOM   3675  N  N   . VAL B  1 161 ? 26.134  121.243 154.332 1.00 29.36  ? 161  VAL B N   1 
ATOM   3676  C  CA  . VAL B  1 161 ? 25.394  120.281 155.124 1.00 35.40  ? 161  VAL B CA  1 
ATOM   3677  C  C   . VAL B  1 161 ? 25.109  120.939 156.472 1.00 32.06  ? 161  VAL B C   1 
ATOM   3678  O  O   . VAL B  1 161 ? 25.965  121.651 156.999 1.00 30.91  ? 161  VAL B O   1 
ATOM   3679  C  CB  . VAL B  1 161 ? 26.232  118.986 155.227 1.00 40.91  ? 161  VAL B CB  1 
ATOM   3680  C  CG1 . VAL B  1 161 ? 25.943  118.234 156.462 1.00 52.53  ? 161  VAL B CG1 1 
ATOM   3681  C  CG2 . VAL B  1 161 ? 26.000  118.103 153.973 1.00 26.28  ? 161  VAL B CG2 1 
ATOM   3682  N  N   . ILE B  1 162 ? 23.895  120.775 156.993 1.00 28.78  ? 162  ILE B N   1 
ATOM   3683  C  CA  . ILE B  1 162 ? 23.529  121.315 158.306 1.00 28.83  ? 162  ILE B CA  1 
ATOM   3684  C  C   . ILE B  1 162 ? 23.028  120.173 159.190 1.00 30.16  ? 162  ILE B C   1 
ATOM   3685  O  O   . ILE B  1 162 ? 22.005  119.548 158.885 1.00 29.03  ? 162  ILE B O   1 
ATOM   3686  C  CB  . ILE B  1 162 ? 22.456  122.414 158.209 1.00 31.26  ? 162  ILE B CB  1 
ATOM   3687  C  CG1 . ILE B  1 162 ? 22.916  123.577 157.325 1.00 28.32  ? 162  ILE B CG1 1 
ATOM   3688  C  CG2 . ILE B  1 162 ? 22.118  122.932 159.587 1.00 26.26  ? 162  ILE B CG2 1 
ATOM   3689  C  CD1 . ILE B  1 162 ? 21.882  124.673 157.196 1.00 25.97  ? 162  ILE B CD1 1 
ATOM   3690  N  N   . GLY B  1 163 ? 23.721  119.933 160.302 1.00 26.40  ? 163  GLY B N   1 
ATOM   3691  C  CA  . GLY B  1 163 ? 23.344  118.905 161.243 1.00 28.95  ? 163  GLY B CA  1 
ATOM   3692  C  C   . GLY B  1 163 ? 22.626  119.470 162.449 1.00 34.35  ? 163  GLY B C   1 
ATOM   3693  O  O   . GLY B  1 163 ? 23.188  120.275 163.199 1.00 30.60  ? 163  GLY B O   1 
ATOM   3694  N  N   . ASP B  1 164 ? 21.378  119.033 162.639 1.00 28.62  ? 164  ASP B N   1 
ATOM   3695  C  CA  . ASP B  1 164 ? 20.518  119.509 163.716 1.00 25.65  ? 164  ASP B CA  1 
ATOM   3696  C  C   . ASP B  1 164 ? 20.733  118.651 164.960 1.00 31.31  ? 164  ASP B C   1 
ATOM   3697  O  O   . ASP B  1 164 ? 20.559  117.428 164.912 1.00 30.14  ? 164  ASP B O   1 
ATOM   3698  C  CB  . ASP B  1 164 ? 19.062  119.444 163.264 1.00 28.48  ? 164  ASP B CB  1 
ATOM   3699  C  CG  . ASP B  1 164 ? 18.144  120.292 164.110 1.00 34.54  ? 164  ASP B CG  1 
ATOM   3700  O  OD1 . ASP B  1 164 ? 18.515  120.661 165.247 1.00 36.02  ? 164  ASP B OD1 1 
ATOM   3701  O  OD2 . ASP B  1 164 ? 17.054  120.628 163.607 1.00 34.02  ? 164  ASP B OD2 1 
ATOM   3702  N  N   . HIS B  1 165 ? 21.117  119.287 166.068 1.00 29.11  ? 165  HIS B N   1 
ATOM   3703  C  CA  . HIS B  1 165 ? 21.356  118.607 167.341 1.00 27.78  ? 165  HIS B CA  1 
ATOM   3704  C  C   . HIS B  1 165 ? 20.579  119.338 168.437 1.00 35.21  ? 165  HIS B C   1 
ATOM   3705  O  O   . HIS B  1 165 ? 20.635  120.570 168.524 1.00 37.65  ? 165  HIS B O   1 
ATOM   3706  C  CB  . HIS B  1 165 ? 22.852  118.590 167.729 1.00 28.02  ? 165  HIS B CB  1 
ATOM   3707  C  CG  . HIS B  1 165 ? 23.771  118.022 166.683 1.00 29.85  ? 165  HIS B CG  1 
ATOM   3708  N  ND1 . HIS B  1 165 ? 24.088  118.692 165.519 1.00 30.47  ? 165  HIS B ND1 1 
ATOM   3709  C  CD2 . HIS B  1 165 ? 24.468  116.860 166.645 1.00 27.07  ? 165  HIS B CD2 1 
ATOM   3710  C  CE1 . HIS B  1 165 ? 24.933  117.965 164.806 1.00 29.50  ? 165  HIS B CE1 1 
ATOM   3711  N  NE2 . HIS B  1 165 ? 25.181  116.849 165.467 1.00 27.81  ? 165  HIS B NE2 1 
ATOM   3712  N  N   . TRP B  1 166 ? 19.837  118.593 169.253 1.00 28.49  ? 166  TRP B N   1 
ATOM   3713  C  CA  . TRP B  1 166 ? 19.282  119.125 170.491 1.00 31.34  ? 166  TRP B CA  1 
ATOM   3714  C  C   . TRP B  1 166 ? 20.085  118.532 171.634 1.00 30.23  ? 166  TRP B C   1 
ATOM   3715  O  O   . TRP B  1 166 ? 20.179  117.308 171.752 1.00 29.75  ? 166  TRP B O   1 
ATOM   3716  C  CB  . TRP B  1 166 ? 17.797  118.801 170.662 1.00 29.03  ? 166  TRP B CB  1 
ATOM   3717  C  CG  . TRP B  1 166 ? 16.885  119.383 169.643 1.00 31.53  ? 166  TRP B CG  1 
ATOM   3718  C  CD1 . TRP B  1 166 ? 17.227  119.974 168.450 1.00 33.59  ? 166  TRP B CD1 1 
ATOM   3719  C  CD2 . TRP B  1 166 ? 15.456  119.419 169.713 1.00 28.74  ? 166  TRP B CD2 1 
ATOM   3720  N  NE1 . TRP B  1 166 ? 16.090  120.373 167.778 1.00 28.93  ? 166  TRP B NE1 1 
ATOM   3721  C  CE2 . TRP B  1 166 ? 14.993  120.060 168.540 1.00 30.53  ? 166  TRP B CE2 1 
ATOM   3722  C  CE3 . TRP B  1 166 ? 14.523  118.994 170.662 1.00 31.50  ? 166  TRP B CE3 1 
ATOM   3723  C  CZ2 . TRP B  1 166 ? 13.634  120.266 168.289 1.00 27.28  ? 166  TRP B CZ2 1 
ATOM   3724  C  CZ3 . TRP B  1 166 ? 13.174  119.206 170.413 1.00 34.80  ? 166  TRP B CZ3 1 
ATOM   3725  C  CH2 . TRP B  1 166 ? 12.745  119.822 169.228 1.00 34.90  ? 166  TRP B CH2 1 
ATOM   3726  N  N   . VAL B  1 167 ? 20.653  119.390 172.470 1.00 32.72  ? 167  VAL B N   1 
ATOM   3727  C  CA  . VAL B  1 167 ? 21.600  118.965 173.492 1.00 30.53  ? 167  VAL B CA  1 
ATOM   3728  C  C   . VAL B  1 167 ? 20.918  118.926 174.852 1.00 32.32  ? 167  VAL B C   1 
ATOM   3729  O  O   . VAL B  1 167 ? 20.121  119.815 175.192 1.00 34.06  ? 167  VAL B O   1 
ATOM   3730  C  CB  . VAL B  1 167 ? 22.832  119.886 173.470 1.00 33.35  ? 167  VAL B CB  1 
ATOM   3731  C  CG1 . VAL B  1 167 ? 23.752  119.618 174.636 1.00 30.73  ? 167  VAL B CG1 1 
ATOM   3732  C  CG2 . VAL B  1 167 ? 23.557  119.681 172.137 1.00 31.76  ? 167  VAL B CG2 1 
ATOM   3733  N  N   . MET B  1 168 ? 21.204  117.867 175.612 1.00 30.02  ? 168  MET B N   1 
ATOM   3734  C  CA  . MET B  1 168 ? 20.650  117.693 176.951 1.00 33.22  ? 168  MET B CA  1 
ATOM   3735  C  C   . MET B  1 168 ? 20.998  118.876 177.850 1.00 39.03  ? 168  MET B C   1 
ATOM   3736  O  O   . MET B  1 168 ? 22.121  119.386 177.833 1.00 35.91  ? 168  MET B O   1 
ATOM   3737  C  CB  . MET B  1 168 ? 21.199  116.414 177.594 1.00 26.44  ? 168  MET B CB  1 
ATOM   3738  C  CG  . MET B  1 168 ? 20.881  115.138 176.831 1.00 33.37  ? 168  MET B CG  1 
ATOM   3739  S  SD  . MET B  1 168 ? 21.944  113.770 177.335 1.00 36.69  ? 168  MET B SD  1 
ATOM   3740  C  CE  . MET B  1 168 ? 21.348  113.510 179.005 1.00 33.88  ? 168  MET B CE  1 
ATOM   3741  N  N   . ASP B  1 169 ? 20.025  119.293 178.650 1.00 33.32  ? 169  ASP B N   1 
ATOM   3742  C  CA  . ASP B  1 169 ? 20.244  120.348 179.621 1.00 32.44  ? 169  ASP B CA  1 
ATOM   3743  C  C   . ASP B  1 169 ? 21.502  120.085 180.442 1.00 37.98  ? 169  ASP B C   1 
ATOM   3744  O  O   . ASP B  1 169 ? 21.647  119.023 181.067 1.00 36.20  ? 169  ASP B O   1 
ATOM   3745  C  CB  . ASP B  1 169 ? 19.018  120.434 180.529 1.00 31.34  ? 169  ASP B CB  1 
ATOM   3746  C  CG  . ASP B  1 169 ? 19.089  121.601 181.490 1.00 42.54  ? 169  ASP B CG  1 
ATOM   3747  O  OD1 . ASP B  1 169 ? 19.913  122.524 181.285 1.00 46.60  ? 169  ASP B OD1 1 
ATOM   3748  O  OD2 . ASP B  1 169 ? 18.315  121.590 182.453 1.00 46.53  ? 169  ASP B OD2 1 
ATOM   3749  N  N   . GLY B  1 170 ? 22.414  121.056 180.441 1.00 39.28  ? 170  GLY B N   1 
ATOM   3750  C  CA  . GLY B  1 170 ? 23.653  120.964 181.199 1.00 28.76  ? 170  GLY B CA  1 
ATOM   3751  C  C   . GLY B  1 170 ? 24.818  120.338 180.473 1.00 38.74  ? 170  GLY B C   1 
ATOM   3752  O  O   . GLY B  1 170 ? 25.908  120.261 181.049 1.00 41.65  ? 170  GLY B O   1 
ATOM   3753  N  N   . HIS B  1 171 ? 24.617  119.837 179.252 1.00 35.09  ? 171  HIS B N   1 
ATOM   3754  C  CA  . HIS B  1 171 ? 25.685  119.229 178.469 1.00 35.81  ? 171  HIS B CA  1 
ATOM   3755  C  C   . HIS B  1 171 ? 26.216  120.159 177.395 1.00 35.89  ? 171  HIS B C   1 
ATOM   3756  O  O   . HIS B  1 171 ? 27.004  119.717 176.555 1.00 35.00  ? 171  HIS B O   1 
ATOM   3757  C  CB  . HIS B  1 171 ? 25.199  117.936 177.815 1.00 36.21  ? 171  HIS B CB  1 
ATOM   3758  C  CG  . HIS B  1 171 ? 24.849  116.870 178.799 1.00 38.16  ? 171  HIS B CG  1 
ATOM   3759  N  ND1 . HIS B  1 171 ? 25.390  115.600 178.745 1.00 36.27  ? 171  HIS B ND1 1 
ATOM   3760  C  CD2 . HIS B  1 171 ? 24.015  116.884 179.869 1.00 33.04  ? 171  HIS B CD2 1 
ATOM   3761  C  CE1 . HIS B  1 171 ? 24.904  114.879 179.744 1.00 36.86  ? 171  HIS B CE1 1 
ATOM   3762  N  NE2 . HIS B  1 171 ? 24.067  115.633 180.438 1.00 37.18  ? 171  HIS B NE2 1 
ATOM   3763  N  N   . GLU B  1 172 ? 25.806  121.433 177.408 1.00 35.18  ? 172  GLU B N   1 
ATOM   3764  C  CA  . GLU B  1 172 ? 26.130  122.342 176.309 1.00 34.58  ? 172  GLU B CA  1 
ATOM   3765  C  C   . GLU B  1 172 ? 27.640  122.452 176.108 1.00 36.65  ? 172  GLU B C   1 
ATOM   3766  O  O   . GLU B  1 172 ? 28.142  122.310 174.988 1.00 37.38  ? 172  GLU B O   1 
ATOM   3767  C  CB  . GLU B  1 172 ? 25.518  123.720 176.578 1.00 32.62  ? 172  GLU B CB  1 
ATOM   3768  C  CG  . GLU B  1 172 ? 24.020  123.854 176.238 1.00 34.60  ? 172  GLU B CG  1 
ATOM   3769  C  CD  . GLU B  1 172 ? 23.076  123.447 177.372 1.00 46.34  ? 172  GLU B CD  1 
ATOM   3770  O  OE1 . GLU B  1 172 ? 23.568  122.914 178.385 1.00 41.30  ? 172  GLU B OE1 1 
ATOM   3771  O  OE2 . GLU B  1 172 ? 21.840  123.689 177.259 1.00 46.14  ? 172  GLU B OE2 1 
ATOM   3772  N  N   . LYS B  1 173 ? 28.388  122.679 177.191 1.00 34.34  ? 173  LYS B N   1 
ATOM   3773  C  CA  . LYS B  1 173 ? 29.834  122.842 177.060 1.00 37.98  ? 173  LYS B CA  1 
ATOM   3774  C  C   . LYS B  1 173 ? 30.503  121.549 176.588 1.00 38.92  ? 173  LYS B C   1 
ATOM   3775  O  O   . LYS B  1 173 ? 31.365  121.581 175.701 1.00 41.78  ? 173  LYS B O   1 
ATOM   3776  C  CB  . LYS B  1 173 ? 30.416  123.290 178.398 1.00 41.17  ? 173  LYS B CB  1 
ATOM   3777  C  CG  . LYS B  1 173 ? 31.916  123.493 178.400 1.00 62.39  ? 173  LYS B CG  1 
ATOM   3778  C  CD  . LYS B  1 173 ? 32.405  123.828 179.807 1.00 78.24  ? 173  LYS B CD  1 
ATOM   3779  C  CE  . LYS B  1 173 ? 33.906  124.046 179.868 1.00 81.34  ? 173  LYS B CE  1 
ATOM   3780  N  NZ  . LYS B  1 173 ? 34.361  124.370 181.247 1.00 85.10  ? 173  LYS B NZ  1 
ATOM   3781  N  N   . ALA B  1 174 ? 30.101  120.395 177.143 1.00 41.79  ? 174  ALA B N   1 
ATOM   3782  C  CA  . ALA B  1 174 ? 30.659  119.124 176.676 1.00 37.66  ? 174  ALA B CA  1 
ATOM   3783  C  C   . ALA B  1 174 ? 30.366  118.911 175.202 1.00 37.55  ? 174  ALA B C   1 
ATOM   3784  O  O   . ALA B  1 174 ? 31.257  118.529 174.437 1.00 41.56  ? 174  ALA B O   1 
ATOM   3785  C  CB  . ALA B  1 174 ? 30.109  117.950 177.488 1.00 30.83  ? 174  ALA B CB  1 
ATOM   3786  N  N   . PHE B  1 175 ? 29.134  119.198 174.771 1.00 34.25  ? 175  PHE B N   1 
ATOM   3787  C  CA  . PHE B  1 175 ? 28.822  119.083 173.350 1.00 35.18  ? 175  PHE B CA  1 
ATOM   3788  C  C   . PHE B  1 175 ? 29.710  120.002 172.518 1.00 31.96  ? 175  PHE B C   1 
ATOM   3789  O  O   . PHE B  1 175 ? 30.253  119.593 171.490 1.00 32.72  ? 175  PHE B O   1 
ATOM   3790  C  CB  . PHE B  1 175 ? 27.355  119.419 173.080 1.00 35.11  ? 175  PHE B CB  1 
ATOM   3791  C  CG  . PHE B  1 175 ? 27.046  119.554 171.620 1.00 35.44  ? 175  PHE B CG  1 
ATOM   3792  C  CD1 . PHE B  1 175 ? 26.681  118.447 170.881 1.00 29.75  ? 175  PHE B CD1 1 
ATOM   3793  C  CD2 . PHE B  1 175 ? 27.167  120.782 170.972 1.00 33.26  ? 175  PHE B CD2 1 
ATOM   3794  C  CE1 . PHE B  1 175 ? 26.412  118.554 169.520 1.00 28.90  ? 175  PHE B CE1 1 
ATOM   3795  C  CE2 . PHE B  1 175 ? 26.913  120.895 169.621 1.00 28.87  ? 175  PHE B CE2 1 
ATOM   3796  C  CZ  . PHE B  1 175 ? 26.532  119.780 168.893 1.00 27.26  ? 175  PHE B CZ  1 
ATOM   3797  N  N   . GLU B  1 176 ? 29.856  121.259 172.933 1.00 32.59  ? 176  GLU B N   1 
ATOM   3798  C  CA  . GLU B  1 176 ? 30.652  122.169 172.122 1.00 38.41  ? 176  GLU B CA  1 
ATOM   3799  C  C   . GLU B  1 176 ? 32.080  121.652 171.952 1.00 38.53  ? 176  GLU B C   1 
ATOM   3800  O  O   . GLU B  1 176 ? 32.642  121.713 170.855 1.00 33.07  ? 176  GLU B O   1 
ATOM   3801  C  CB  . GLU B  1 176 ? 30.629  123.570 172.746 1.00 35.23  ? 176  GLU B CB  1 
ATOM   3802  C  CG  . GLU B  1 176 ? 29.248  124.224 172.683 1.00 31.63  ? 176  GLU B CG  1 
ATOM   3803  C  CD  . GLU B  1 176 ? 29.192  125.572 173.386 1.00 40.78  ? 176  GLU B CD  1 
ATOM   3804  O  OE1 . GLU B  1 176 ? 30.257  126.091 173.777 1.00 43.35  ? 176  GLU B OE1 1 
ATOM   3805  O  OE2 . GLU B  1 176 ? 28.082  126.118 173.543 1.00 37.42  ? 176  GLU B OE2 1 
ATOM   3806  N  N   . GLN B  1 177 ? 32.660  121.111 173.026 1.00 32.82  ? 177  GLN B N   1 
ATOM   3807  C  CA  . GLN B  1 177 ? 34.017  120.583 172.967 1.00 35.70  ? 177  GLN B CA  1 
ATOM   3808  C  C   . GLN B  1 177 ? 34.077  119.341 172.085 1.00 36.23  ? 177  GLN B C   1 
ATOM   3809  O  O   . GLN B  1 177 ? 34.952  119.221 171.215 1.00 32.34  ? 177  GLN B O   1 
ATOM   3810  C  CB  . GLN B  1 177 ? 34.482  120.224 174.392 1.00 45.69  ? 177  GLN B CB  1 
ATOM   3811  C  CG  . GLN B  1 177 ? 34.644  121.418 175.362 1.00 76.27  ? 177  GLN B CG  1 
ATOM   3812  C  CD  . GLN B  1 177 ? 34.820  121.030 176.860 1.00 97.98  ? 177  GLN B CD  1 
ATOM   3813  O  OE1 . GLN B  1 177 ? 34.777  119.850 177.231 1.00 110.41 ? 177  GLN B OE1 1 
ATOM   3814  N  NE2 . GLN B  1 177 ? 34.979  122.038 177.717 1.00 99.94  ? 177  GLN B NE2 1 
ATOM   3815  N  N   . GLY B  1 178 ? 33.103  118.441 172.247 1.00 32.59  ? 178  GLY B N   1 
ATOM   3816  C  CA  . GLY B  1 178 ? 33.087  117.221 171.456 1.00 31.55  ? 178  GLY B CA  1 
ATOM   3817  C  C   . GLY B  1 178 ? 32.840  117.487 169.983 1.00 34.87  ? 178  GLY B C   1 
ATOM   3818  O  O   . GLY B  1 178 ? 33.471  116.879 169.115 1.00 32.38  ? 178  GLY B O   1 
ATOM   3819  N  N   . ALA B  1 179 ? 31.912  118.389 169.670 1.00 39.96  ? 179  ALA B N   1 
ATOM   3820  C  CA  . ALA B  1 179 ? 31.694  118.728 168.266 1.00 33.26  ? 179  ALA B CA  1 
ATOM   3821  C  C   . ALA B  1 179 ? 32.937  119.368 167.667 1.00 30.45  ? 179  ALA B C   1 
ATOM   3822  O  O   . ALA B  1 179 ? 33.324  119.042 166.541 1.00 30.99  ? 179  ALA B O   1 
ATOM   3823  C  CB  . ALA B  1 179 ? 30.492  119.661 168.131 1.00 29.21  ? 179  ALA B CB  1 
ATOM   3824  N  N   . THR B  1 180 ? 33.593  120.266 168.417 1.00 29.30  ? 180  THR B N   1 
ATOM   3825  C  CA  . THR B  1 180 ? 34.835  120.861 167.927 1.00 38.60  ? 180  THR B CA  1 
ATOM   3826  C  C   . THR B  1 180 ? 35.881  119.788 167.653 1.00 41.59  ? 180  THR B C   1 
ATOM   3827  O  O   . THR B  1 180 ? 36.503  119.764 166.583 1.00 35.78  ? 180  THR B O   1 
ATOM   3828  C  CB  . THR B  1 180 ? 35.373  121.880 168.923 1.00 41.59  ? 180  THR B CB  1 
ATOM   3829  O  OG1 . THR B  1 180 ? 34.437  122.953 169.052 1.00 38.01  ? 180  THR B OG1 1 
ATOM   3830  C  CG2 . THR B  1 180 ? 36.722  122.426 168.449 1.00 37.25  ? 180  THR B CG2 1 
ATOM   3831  N  N   . GLU B  1 181 ? 36.066  118.871 168.597 1.00 34.76  ? 181  GLU B N   1 
ATOM   3832  C  CA  . GLU B  1 181 ? 37.063  117.832 168.385 1.00 38.68  ? 181  GLU B CA  1 
ATOM   3833  C  C   . GLU B  1 181 ? 36.720  116.968 167.174 1.00 36.07  ? 181  GLU B C   1 
ATOM   3834  O  O   . GLU B  1 181 ? 37.605  116.642 166.377 1.00 36.54  ? 181  GLU B O   1 
ATOM   3835  C  CB  . GLU B  1 181 ? 37.209  116.984 169.644 1.00 52.03  ? 181  GLU B CB  1 
ATOM   3836  C  CG  . GLU B  1 181 ? 38.367  116.021 169.566 1.00 64.27  ? 181  GLU B CG  1 
ATOM   3837  C  CD  . GLU B  1 181 ? 38.520  115.192 170.815 1.00 70.21  ? 181  GLU B CD  1 
ATOM   3838  O  OE1 . GLU B  1 181 ? 37.705  115.386 171.752 1.00 71.93  ? 181  GLU B OE1 1 
ATOM   3839  O  OE2 . GLU B  1 181 ? 39.463  114.361 170.855 1.00 67.21  ? 181  GLU B OE2 1 
ATOM   3840  N  N   . THR B  1 182 ? 35.435  116.632 166.992 1.00 30.96  ? 182  THR B N   1 
ATOM   3841  C  CA  . THR B  1 182 ? 35.004  115.846 165.833 1.00 31.20  ? 182  THR B CA  1 
ATOM   3842  C  C   . THR B  1 182 ? 35.328  116.547 164.520 1.00 37.29  ? 182  THR B C   1 
ATOM   3843  O  O   . THR B  1 182 ? 35.840  115.925 163.578 1.00 37.88  ? 182  THR B O   1 
ATOM   3844  C  CB  . THR B  1 182 ? 33.499  115.569 165.921 1.00 30.88  ? 182  THR B CB  1 
ATOM   3845  O  OG1 . THR B  1 182 ? 33.223  114.807 167.100 1.00 39.22  ? 182  THR B OG1 1 
ATOM   3846  C  CG2 . THR B  1 182 ? 32.998  114.804 164.698 1.00 29.53  ? 182  THR B CG2 1 
ATOM   3847  N  N   . LEU B  1 183 ? 34.987  117.838 164.429 1.00 34.93  ? 183  LEU B N   1 
ATOM   3848  C  CA  . LEU B  1 183 ? 35.123  118.585 163.179 1.00 36.07  ? 183  LEU B CA  1 
ATOM   3849  C  C   . LEU B  1 183 ? 36.588  118.858 162.849 1.00 34.30  ? 183  LEU B C   1 
ATOM   3850  O  O   . LEU B  1 183 ? 37.002  118.787 161.684 1.00 37.57  ? 183  LEU B O   1 
ATOM   3851  C  CB  . LEU B  1 183 ? 34.329  119.894 163.275 1.00 32.20  ? 183  LEU B CB  1 
ATOM   3852  C  CG  . LEU B  1 183 ? 32.820  119.675 163.363 1.00 33.99  ? 183  LEU B CG  1 
ATOM   3853  C  CD1 . LEU B  1 183 ? 32.077  120.939 163.843 1.00 31.16  ? 183  LEU B CD1 1 
ATOM   3854  C  CD2 . LEU B  1 183 ? 32.272  119.177 162.010 1.00 27.31  ? 183  LEU B CD2 1 
ATOM   3855  N  N   . GLU B  1 184 ? 37.397  119.145 163.858 1.00 32.18  ? 184  GLU B N   1 
ATOM   3856  C  CA  . GLU B  1 184 ? 38.814  119.342 163.584 1.00 41.24  ? 184  GLU B CA  1 
ATOM   3857  C  C   . GLU B  1 184 ? 39.449  118.060 163.070 1.00 40.60  ? 184  GLU B C   1 
ATOM   3858  O  O   . GLU B  1 184 ? 40.242  118.092 162.121 1.00 38.80  ? 184  GLU B O   1 
ATOM   3859  C  CB  . GLU B  1 184 ? 39.519  119.865 164.835 1.00 39.16  ? 184  GLU B CB  1 
ATOM   3860  C  CG  . GLU B  1 184 ? 39.143  121.311 165.109 1.00 41.80  ? 184  GLU B CG  1 
ATOM   3861  C  CD  . GLU B  1 184 ? 39.798  121.866 166.341 1.00 47.04  ? 184  GLU B CD  1 
ATOM   3862  O  OE1 . GLU B  1 184 ? 40.220  121.054 167.189 1.00 49.36  ? 184  GLU B OE1 1 
ATOM   3863  O  OE2 . GLU B  1 184 ? 39.888  123.114 166.454 1.00 51.41  ? 184  GLU B OE2 1 
ATOM   3864  N  N   . TRP B  1 185 ? 39.065  116.918 163.646 1.00 35.67  ? 185  TRP B N   1 
ATOM   3865  C  CA  . TRP B  1 185 ? 39.555  115.642 163.139 1.00 36.67  ? 185  TRP B CA  1 
ATOM   3866  C  C   . TRP B  1 185 ? 39.142  115.460 161.692 1.00 39.87  ? 185  TRP B C   1 
ATOM   3867  O  O   . TRP B  1 185 ? 39.964  115.100 160.837 1.00 34.62  ? 185  TRP B O   1 
ATOM   3868  C  CB  . TRP B  1 185 ? 39.032  114.497 164.003 1.00 37.37  ? 185  TRP B CB  1 
ATOM   3869  C  CG  . TRP B  1 185 ? 39.681  113.170 163.738 1.00 40.67  ? 185  TRP B CG  1 
ATOM   3870  C  CD1 . TRP B  1 185 ? 40.656  112.563 164.490 1.00 34.98  ? 185  TRP B CD1 1 
ATOM   3871  C  CD2 . TRP B  1 185 ? 39.381  112.261 162.661 1.00 37.38  ? 185  TRP B CD2 1 
ATOM   3872  N  NE1 . TRP B  1 185 ? 40.984  111.347 163.937 1.00 39.22  ? 185  TRP B NE1 1 
ATOM   3873  C  CE2 . TRP B  1 185 ? 40.218  111.137 162.819 1.00 40.12  ? 185  TRP B CE2 1 
ATOM   3874  C  CE3 . TRP B  1 185 ? 38.494  112.297 161.576 1.00 40.30  ? 185  TRP B CE3 1 
ATOM   3875  C  CZ2 . TRP B  1 185 ? 40.196  110.062 161.933 1.00 38.26  ? 185  TRP B CZ2 1 
ATOM   3876  C  CZ3 . TRP B  1 185 ? 38.475  111.225 160.692 1.00 37.91  ? 185  TRP B CZ3 1 
ATOM   3877  C  CH2 . TRP B  1 185 ? 39.320  110.128 160.876 1.00 40.29  ? 185  TRP B CH2 1 
ATOM   3878  N  N   . MET B  1 186 ? 37.868  115.734 161.391 1.00 43.78  ? 186  MET B N   1 
ATOM   3879  C  CA  . MET B  1 186 ? 37.402  115.570 160.022 1.00 38.37  ? 186  MET B CA  1 
ATOM   3880  C  C   . MET B  1 186 ? 38.128  116.509 159.065 1.00 40.24  ? 186  MET B C   1 
ATOM   3881  O  O   . MET B  1 186 ? 38.429  116.126 157.931 1.00 37.53  ? 186  MET B O   1 
ATOM   3882  C  CB  . MET B  1 186 ? 35.896  115.795 159.940 1.00 36.71  ? 186  MET B CB  1 
ATOM   3883  C  CG  . MET B  1 186 ? 35.063  114.734 160.618 1.00 36.25  ? 186  MET B CG  1 
ATOM   3884  S  SD  . MET B  1 186 ? 33.301  115.158 160.623 1.00 41.46  ? 186  MET B SD  1 
ATOM   3885  C  CE  . MET B  1 186 ? 32.913  115.169 158.894 1.00 37.05  ? 186  MET B CE  1 
ATOM   3886  N  N   . LYS B  1 187 ? 38.376  117.764 159.473 1.00 37.71  ? 187  LYS B N   1 
ATOM   3887  C  CA  . LYS B  1 187 ? 39.029  118.672 158.535 1.00 37.13  ? 187  LYS B CA  1 
ATOM   3888  C  C   . LYS B  1 187 ? 40.470  118.260 158.270 1.00 39.21  ? 187  LYS B C   1 
ATOM   3889  O  O   . LYS B  1 187 ? 40.955  118.383 157.138 1.00 41.57  ? 187  LYS B O   1 
ATOM   3890  C  CB  . LYS B  1 187 ? 38.939  120.122 159.019 1.00 41.30  ? 187  LYS B CB  1 
ATOM   3891  C  CG  . LYS B  1 187 ? 39.408  121.125 157.969 1.00 47.68  ? 187  LYS B CG  1 
ATOM   3892  C  CD  . LYS B  1 187 ? 38.626  122.433 158.025 1.00 54.15  ? 187  LYS B CD  1 
ATOM   3893  C  CE  . LYS B  1 187 ? 39.146  123.444 157.017 1.00 58.18  ? 187  LYS B CE  1 
ATOM   3894  N  NZ  . LYS B  1 187 ? 40.587  123.735 157.262 1.00 66.92  ? 187  LYS B NZ  1 
ATOM   3895  N  N   . ALA B  1 188 ? 41.135  117.682 159.259 1.00 35.05  ? 188  ALA B N   1 
ATOM   3896  C  CA  . ALA B  1 188 ? 42.491  117.208 159.040 1.00 33.81  ? 188  ALA B CA  1 
ATOM   3897  C  C   . ALA B  1 188 ? 42.559  115.908 158.228 1.00 45.46  ? 188  ALA B C   1 
ATOM   3898  O  O   . ALA B  1 188 ? 43.603  115.620 157.639 1.00 48.10  ? 188  ALA B O   1 
ATOM   3899  C  CB  . ALA B  1 188 ? 43.195  117.026 160.385 1.00 36.09  ? 188  ALA B CB  1 
ATOM   3900  N  N   . ASN B  1 189 ? 41.504  115.089 158.201 1.00 41.06  ? 189  ASN B N   1 
ATOM   3901  C  CA  . ASN B  1 189 ? 41.681  113.710 157.751 1.00 34.97  ? 189  ASN B CA  1 
ATOM   3902  C  C   . ASN B  1 189 ? 40.747  113.226 156.646 1.00 42.17  ? 189  ASN B C   1 
ATOM   3903  O  O   . ASN B  1 189 ? 41.025  112.179 156.056 1.00 46.26  ? 189  ASN B O   1 
ATOM   3904  C  CB  . ASN B  1 189 ? 41.560  112.770 158.959 1.00 36.81  ? 189  ASN B CB  1 
ATOM   3905  C  CG  . ASN B  1 189 ? 42.697  112.978 159.949 1.00 40.28  ? 189  ASN B CG  1 
ATOM   3906  O  OD1 . ASN B  1 189 ? 43.856  112.881 159.574 1.00 45.70  ? 189  ASN B OD1 1 
ATOM   3907  N  ND2 . ASN B  1 189 ? 42.373  113.326 161.189 1.00 39.19  ? 189  ASN B ND2 1 
ATOM   3908  N  N   . VAL B  1 190 ? 39.682  113.939 156.324 1.00 34.12  ? 190  VAL B N   1 
ATOM   3909  C  CA  . VAL B  1 190 ? 38.628  113.437 155.440 1.00 35.55  ? 190  VAL B CA  1 
ATOM   3910  C  C   . VAL B  1 190 ? 38.684  114.212 154.128 1.00 34.99  ? 190  VAL B C   1 
ATOM   3911  O  O   . VAL B  1 190 ? 38.705  115.447 154.156 1.00 39.05  ? 190  VAL B O   1 
ATOM   3912  C  CB  . VAL B  1 190 ? 37.239  113.573 156.097 1.00 34.18  ? 190  VAL B CB  1 
ATOM   3913  C  CG1 . VAL B  1 190 ? 36.182  113.052 155.193 1.00 28.49  ? 190  VAL B CG1 1 
ATOM   3914  C  CG2 . VAL B  1 190 ? 37.212  112.845 157.447 1.00 35.34  ? 190  VAL B CG2 1 
ATOM   3915  N  N   . PRO B  1 191 ? 38.719  113.547 152.976 1.00 32.51  ? 191  PRO B N   1 
ATOM   3916  C  CA  . PRO B  1 191 ? 38.821  114.288 151.707 1.00 35.69  ? 191  PRO B CA  1 
ATOM   3917  C  C   . PRO B  1 191 ? 37.616  115.183 151.427 1.00 41.28  ? 191  PRO B C   1 
ATOM   3918  O  O   . PRO B  1 191 ? 36.456  114.834 151.688 1.00 39.02  ? 191  PRO B O   1 
ATOM   3919  C  CB  . PRO B  1 191 ? 38.957  113.184 150.644 1.00 40.75  ? 191  PRO B CB  1 
ATOM   3920  C  CG  . PRO B  1 191 ? 38.736  111.914 151.324 1.00 43.82  ? 191  PRO B CG  1 
ATOM   3921  C  CD  . PRO B  1 191 ? 38.918  112.100 152.795 1.00 41.07  ? 191  PRO B CD  1 
ATOM   3922  N  N   . GLY B  1 192 ? 37.907  116.351 150.870 1.00 35.81  ? 192  GLY B N   1 
ATOM   3923  C  CA  . GLY B  1 192 ? 36.848  117.208 150.399 1.00 35.27  ? 192  GLY B CA  1 
ATOM   3924  C  C   . GLY B  1 192 ? 36.146  117.997 151.473 1.00 36.09  ? 192  GLY B C   1 
ATOM   3925  O  O   . GLY B  1 192 ? 35.106  118.596 151.188 1.00 35.93  ? 192  GLY B O   1 
ATOM   3926  N  N   . MET B  1 193 ? 36.649  117.970 152.707 1.00 34.81  ? 193  MET B N   1 
ATOM   3927  C  CA  . MET B  1 193 ? 36.053  118.738 153.790 1.00 37.84  ? 193  MET B CA  1 
ATOM   3928  C  C   . MET B  1 193 ? 36.539  120.183 153.690 1.00 36.91  ? 193  MET B C   1 
ATOM   3929  O  O   . MET B  1 193 ? 37.717  120.484 153.909 1.00 32.85  ? 193  MET B O   1 
ATOM   3930  C  CB  . MET B  1 193 ? 36.391  118.092 155.127 1.00 38.37  ? 193  MET B CB  1 
ATOM   3931  C  CG  . MET B  1 193 ? 36.701  119.067 156.205 1.00 59.04  ? 193  MET B CG  1 
ATOM   3932  S  SD  . MET B  1 193 ? 35.308  119.640 157.111 1.00 54.94  ? 193  MET B SD  1 
ATOM   3933  C  CE  . MET B  1 193 ? 34.836  118.062 157.750 1.00 65.42  ? 193  MET B CE  1 
ATOM   3934  N  N   . VAL B  1 194 ? 35.624  121.085 153.379 1.00 33.00  ? 194  VAL B N   1 
ATOM   3935  C  CA  . VAL B  1 194 ? 36.009  122.452 153.081 1.00 33.54  ? 194  VAL B CA  1 
ATOM   3936  C  C   . VAL B  1 194 ? 36.074  123.316 154.338 1.00 35.46  ? 194  VAL B C   1 
ATOM   3937  O  O   . VAL B  1 194 ? 36.979  124.142 154.480 1.00 34.84  ? 194  VAL B O   1 
ATOM   3938  C  CB  . VAL B  1 194 ? 35.028  123.019 152.043 1.00 31.67  ? 194  VAL B CB  1 
ATOM   3939  C  CG1 . VAL B  1 194 ? 35.231  124.494 151.907 1.00 28.23  ? 194  VAL B CG1 1 
ATOM   3940  C  CG2 . VAL B  1 194 ? 35.256  122.330 150.706 1.00 28.14  ? 194  VAL B CG2 1 
ATOM   3941  N  N   . GLY B  1 195 ? 35.130  123.153 155.261 1.00 30.25  ? 195  GLY B N   1 
ATOM   3942  C  CA  . GLY B  1 195 ? 35.141  123.945 156.476 1.00 33.11  ? 195  GLY B CA  1 
ATOM   3943  C  C   . GLY B  1 195 ? 33.922  123.623 157.309 1.00 33.42  ? 195  GLY B C   1 
ATOM   3944  O  O   . GLY B  1 195 ? 33.063  122.823 156.917 1.00 30.40  ? 195  GLY B O   1 
ATOM   3945  N  N   . TRP B  1 196 ? 33.844  124.277 158.467 1.00 31.90  ? 196  TRP B N   1 
ATOM   3946  C  CA  . TRP B  1 196 ? 32.772  123.978 159.406 1.00 30.04  ? 196  TRP B CA  1 
ATOM   3947  C  C   . TRP B  1 196 ? 32.532  125.165 160.327 1.00 36.50  ? 196  TRP B C   1 
ATOM   3948  O  O   . TRP B  1 196 ? 33.378  126.053 160.470 1.00 32.08  ? 196  TRP B O   1 
ATOM   3949  C  CB  . TRP B  1 196 ? 33.102  122.737 160.232 1.00 27.01  ? 196  TRP B CB  1 
ATOM   3950  C  CG  . TRP B  1 196 ? 34.378  122.853 161.054 1.00 35.70  ? 196  TRP B CG  1 
ATOM   3951  C  CD1 . TRP B  1 196 ? 35.640  122.422 160.702 1.00 33.58  ? 196  TRP B CD1 1 
ATOM   3952  C  CD2 . TRP B  1 196 ? 34.505  123.422 162.372 1.00 36.75  ? 196  TRP B CD2 1 
ATOM   3953  N  NE1 . TRP B  1 196 ? 36.533  122.697 161.720 1.00 35.93  ? 196  TRP B NE1 1 
ATOM   3954  C  CE2 . TRP B  1 196 ? 35.863  123.303 162.753 1.00 34.36  ? 196  TRP B CE2 1 
ATOM   3955  C  CE3 . TRP B  1 196 ? 33.598  124.007 163.269 1.00 26.46  ? 196  TRP B CE3 1 
ATOM   3956  C  CZ2 . TRP B  1 196 ? 36.331  123.752 163.987 1.00 35.86  ? 196  TRP B CZ2 1 
ATOM   3957  C  CZ3 . TRP B  1 196 ? 34.059  124.444 164.480 1.00 28.70  ? 196  TRP B CZ3 1 
ATOM   3958  C  CH2 . TRP B  1 196 ? 35.420  124.327 164.831 1.00 33.90  ? 196  TRP B CH2 1 
ATOM   3959  N  N   . MET B  1 197 ? 31.379  125.126 161.000 1.00 32.17  ? 197  MET B N   1 
ATOM   3960  C  CA  . MET B  1 197 ? 30.971  126.165 161.933 1.00 30.90  ? 197  MET B CA  1 
ATOM   3961  C  C   . MET B  1 197 ? 29.991  125.525 162.907 1.00 33.07  ? 197  MET B C   1 
ATOM   3962  O  O   . MET B  1 197 ? 29.126  124.752 162.485 1.00 29.92  ? 197  MET B O   1 
ATOM   3963  C  CB  . MET B  1 197 ? 30.355  127.344 161.144 1.00 37.62  ? 197  MET B CB  1 
ATOM   3964  C  CG  . MET B  1 197 ? 29.715  128.454 161.898 1.00 47.97  ? 197  MET B CG  1 
ATOM   3965  S  SD  . MET B  1 197 ? 29.371  129.879 160.799 1.00 42.10  ? 197  MET B SD  1 
ATOM   3966  C  CE  . MET B  1 197 ? 28.180  129.232 159.630 1.00 29.47  ? 197  MET B CE  1 
ATOM   3967  N  N   . ILE B  1 198 ? 30.155  125.789 164.202 1.00 28.31  ? 198  ILE B N   1 
ATOM   3968  C  CA  . ILE B  1 198 ? 29.210  125.328 165.219 1.00 31.43  ? 198  ILE B CA  1 
ATOM   3969  C  C   . ILE B  1 198 ? 28.355  126.512 165.665 1.00 36.27  ? 198  ILE B C   1 
ATOM   3970  O  O   . ILE B  1 198 ? 28.886  127.516 166.149 1.00 37.83  ? 198  ILE B O   1 
ATOM   3971  C  CB  . ILE B  1 198 ? 29.930  124.711 166.421 1.00 29.92  ? 198  ILE B CB  1 
ATOM   3972  C  CG1 . ILE B  1 198 ? 30.700  123.457 166.002 1.00 30.51  ? 198  ILE B CG1 1 
ATOM   3973  C  CG2 . ILE B  1 198 ? 28.930  124.439 167.545 1.00 28.39  ? 198  ILE B CG2 1 
ATOM   3974  C  CD1 . ILE B  1 198 ? 31.643  122.952 167.081 1.00 30.49  ? 198  ILE B CD1 1 
ATOM   3975  N  N   . MET B  1 199 ? 27.032  126.394 165.526 1.00 37.45  ? 199  MET B N   1 
ATOM   3976  C  CA  . MET B  1 199 ? 26.110  127.489 165.809 1.00 34.58  ? 199  MET B CA  1 
ATOM   3977  C  C   . MET B  1 199 ? 25.155  127.116 166.940 1.00 36.77  ? 199  MET B C   1 
ATOM   3978  O  O   . MET B  1 199 ? 24.532  126.051 166.910 1.00 30.53  ? 199  MET B O   1 
ATOM   3979  C  CB  . MET B  1 199 ? 25.319  127.856 164.552 1.00 33.23  ? 199  MET B CB  1 
ATOM   3980  C  CG  . MET B  1 199 ? 26.205  128.276 163.388 1.00 39.06  ? 199  MET B CG  1 
ATOM   3981  S  SD  . MET B  1 199 ? 25.331  128.751 161.881 1.00 41.38  ? 199  MET B SD  1 
ATOM   3982  C  CE  . MET B  1 199 ? 24.626  127.200 161.329 1.00 39.88  ? 199  MET B CE  1 
ATOM   3983  N  N   . LYS B  1 200 ? 24.975  128.024 167.896 1.00 30.60  ? 200  LYS B N   1 
ATOM   3984  C  CA  . LYS B  1 200 ? 24.118  127.782 169.052 1.00 31.09  ? 200  LYS B CA  1 
ATOM   3985  C  C   . LYS B  1 200 ? 22.924  128.725 168.955 1.00 31.97  ? 200  LYS B C   1 
ATOM   3986  O  O   . LYS B  1 200 ? 23.102  129.945 168.897 1.00 28.48  ? 200  LYS B O   1 
ATOM   3987  C  CB  . LYS B  1 200 ? 24.892  128.011 170.353 1.00 29.05  ? 200  LYS B CB  1 
ATOM   3988  C  CG  . LYS B  1 200 ? 24.146  127.720 171.647 1.00 33.42  ? 200  LYS B CG  1 
ATOM   3989  C  CD  . LYS B  1 200 ? 24.983  128.165 172.863 1.00 31.94  ? 200  LYS B CD  1 
ATOM   3990  C  CE  . LYS B  1 200 ? 24.294  127.812 174.169 1.00 36.60  ? 200  LYS B CE  1 
ATOM   3991  N  NZ  . LYS B  1 200 ? 25.016  128.336 175.363 1.00 40.27  ? 200  LYS B NZ  1 
ATOM   3992  N  N   . GLN B  1 201 ? 21.713  128.163 168.914 1.00 27.15  ? 201  GLN B N   1 
ATOM   3993  C  CA  . GLN B  1 201 ? 20.521  129.002 168.900 1.00 30.55  ? 201  GLN B CA  1 
ATOM   3994  C  C   . GLN B  1 201 ? 20.334  129.652 170.262 1.00 31.09  ? 201  GLN B C   1 
ATOM   3995  O  O   . GLN B  1 201 ? 20.260  128.959 171.280 1.00 33.65  ? 201  GLN B O   1 
ATOM   3996  C  CB  . GLN B  1 201 ? 19.262  128.199 168.552 1.00 28.12  ? 201  GLN B CB  1 
ATOM   3997  C  CG  . GLN B  1 201 ? 17.993  129.078 168.707 1.00 27.13  ? 201  GLN B CG  1 
ATOM   3998  C  CD  . GLN B  1 201 ? 16.664  128.338 168.557 1.00 33.08  ? 201  GLN B CD  1 
ATOM   3999  O  OE1 . GLN B  1 201 ? 15.699  128.653 169.250 1.00 32.78  ? 201  GLN B OE1 1 
ATOM   4000  N  NE2 . GLN B  1 201 ? 16.597  127.389 167.621 1.00 28.32  ? 201  GLN B NE2 1 
ATOM   4001  N  N   . PHE B  1 202 ? 20.215  130.980 170.283 1.00 29.58  ? 202  PHE B N   1 
ATOM   4002  C  CA  . PHE B  1 202 ? 20.008  131.685 171.540 1.00 36.60  ? 202  PHE B CA  1 
ATOM   4003  C  C   . PHE B  1 202 ? 18.765  132.576 171.512 1.00 35.70  ? 202  PHE B C   1 
ATOM   4004  O  O   . PHE B  1 202 ? 18.513  133.298 172.480 1.00 34.21  ? 202  PHE B O   1 
ATOM   4005  C  CB  . PHE B  1 202 ? 21.260  132.491 171.937 1.00 29.62  ? 202  PHE B CB  1 
ATOM   4006  C  CG  . PHE B  1 202 ? 21.564  133.688 171.049 1.00 28.88  ? 202  PHE B CG  1 
ATOM   4007  C  CD1 . PHE B  1 202 ? 22.292  133.547 169.878 1.00 31.17  ? 202  PHE B CD1 1 
ATOM   4008  C  CD2 . PHE B  1 202 ? 21.199  134.974 171.452 1.00 30.66  ? 202  PHE B CD2 1 
ATOM   4009  C  CE1 . PHE B  1 202 ? 22.600  134.648 169.080 1.00 26.38  ? 202  PHE B CE1 1 
ATOM   4010  C  CE2 . PHE B  1 202 ? 21.501  136.087 170.664 1.00 28.21  ? 202  PHE B CE2 1 
ATOM   4011  C  CZ  . PHE B  1 202 ? 22.204  135.927 169.471 1.00 28.24  ? 202  PHE B CZ  1 
ATOM   4012  N  N   . GLY B  1 203 ? 17.975  132.534 170.447 1.00 32.16  ? 203  GLY B N   1 
ATOM   4013  C  CA  . GLY B  1 203 ? 16.764  133.322 170.406 1.00 29.83  ? 203  GLY B CA  1 
ATOM   4014  C  C   . GLY B  1 203 ? 16.153  133.282 169.025 1.00 25.94  ? 203  GLY B C   1 
ATOM   4015  O  O   . GLY B  1 203 ? 16.701  132.684 168.091 1.00 26.31  ? 203  GLY B O   1 
ATOM   4016  N  N   . VAL B  1 204 ? 15.003  133.954 168.894 1.00 27.38  ? 204  VAL B N   1 
ATOM   4017  C  CA  . VAL B  1 204 ? 14.300  133.991 167.613 1.00 28.65  ? 204  VAL B CA  1 
ATOM   4018  C  C   . VAL B  1 204 ? 13.812  135.409 167.338 1.00 32.01  ? 204  VAL B C   1 
ATOM   4019  O  O   . VAL B  1 204 ? 13.387  136.126 168.254 1.00 26.11  ? 204  VAL B O   1 
ATOM   4020  C  CB  . VAL B  1 204 ? 13.122  132.984 167.573 1.00 28.54  ? 204  VAL B CB  1 
ATOM   4021  C  CG1 . VAL B  1 204 ? 12.443  132.997 166.196 1.00 29.26  ? 204  VAL B CG1 1 
ATOM   4022  C  CG2 . VAL B  1 204 ? 13.594  131.565 167.900 1.00 27.70  ? 204  VAL B CG2 1 
ATOM   4023  N  N   . SER B  1 205 ? 13.851  135.812 166.069 1.00 30.62  ? 205  SER B N   1 
ATOM   4024  C  CA  . SER B  1 205 ? 13.269  137.096 165.683 1.00 27.17  ? 205  SER B CA  1 
ATOM   4025  C  C   . SER B  1 205 ? 11.771  136.917 165.462 1.00 27.02  ? 205  SER B C   1 
ATOM   4026  O  O   . SER B  1 205 ? 11.361  136.079 164.656 1.00 30.23  ? 205  SER B O   1 
ATOM   4027  C  CB  . SER B  1 205 ? 13.922  137.633 164.408 1.00 25.21  ? 205  SER B CB  1 
ATOM   4028  O  OG  . SER B  1 205 ? 13.235  138.809 163.975 1.00 28.26  ? 205  SER B OG  1 
ATOM   4029  N  N   . ALA B  1 206 ? 10.952  137.689 166.176 1.00 29.81  ? 206  ALA B N   1 
ATOM   4030  C  CA  . ALA B  1 206 ? 9.509   137.595 165.968 1.00 33.38  ? 206  ALA B CA  1 
ATOM   4031  C  C   . ALA B  1 206 ? 9.125   138.157 164.604 1.00 33.12  ? 206  ALA B C   1 
ATOM   4032  O  O   . ALA B  1 206 ? 8.407   137.509 163.823 1.00 27.24  ? 206  ALA B O   1 
ATOM   4033  C  CB  . ALA B  1 206 ? 8.755   138.324 167.091 1.00 25.84  ? 206  ALA B CB  1 
ATOM   4034  N  N   . ILE B  1 207 ? 9.626   139.357 164.296 1.00 34.43  ? 207  ILE B N   1 
ATOM   4035  C  CA  . ILE B  1 207 ? 9.325   140.006 163.027 1.00 28.28  ? 207  ILE B CA  1 
ATOM   4036  C  C   . ILE B  1 207 ? 9.816   139.158 161.866 1.00 31.97  ? 207  ILE B C   1 
ATOM   4037  O  O   . ILE B  1 207 ? 9.099   138.955 160.883 1.00 32.17  ? 207  ILE B O   1 
ATOM   4038  C  CB  . ILE B  1 207 ? 9.932   141.424 162.998 1.00 33.47  ? 207  ILE B CB  1 
ATOM   4039  C  CG1 . ILE B  1 207 ? 9.172   142.345 163.957 1.00 27.32  ? 207  ILE B CG1 1 
ATOM   4040  C  CG2 . ILE B  1 207 ? 9.946   142.000 161.583 1.00 28.08  ? 207  ILE B CG2 1 
ATOM   4041  C  CD1 . ILE B  1 207 ? 7.777   142.727 163.465 1.00 34.37  ? 207  ILE B CD1 1 
ATOM   4042  N  N   . GLY B  1 208 ? 11.051  138.649 161.963 1.00 30.97  ? 208  GLY B N   1 
ATOM   4043  C  CA  . GLY B  1 208 ? 11.593  137.817 160.899 1.00 32.78  ? 208  GLY B CA  1 
ATOM   4044  C  C   . GLY B  1 208 ? 10.864  136.506 160.718 1.00 35.32  ? 208  GLY B C   1 
ATOM   4045  O  O   . GLY B  1 208 ? 10.901  135.936 159.621 1.00 30.92  ? 208  GLY B O   1 
ATOM   4046  N  N   . SER B  1 209 ? 10.187  136.027 161.766 1.00 30.34  ? 209  SER B N   1 
ATOM   4047  C  CA  . SER B  1 209 ? 9.376   134.822 161.700 1.00 29.83  ? 209  SER B CA  1 
ATOM   4048  C  C   . SER B  1 209 ? 7.932   135.127 161.334 1.00 31.11  ? 209  SER B C   1 
ATOM   4049  O  O   . SER B  1 209 ? 7.079   134.233 161.404 1.00 29.49  ? 209  SER B O   1 
ATOM   4050  C  CB  . SER B  1 209 ? 9.414   134.082 163.042 1.00 25.16  ? 209  SER B CB  1 
ATOM   4051  O  OG  . SER B  1 209 ? 10.730  133.707 163.411 1.00 32.36  ? 209  SER B OG  1 
ATOM   4052  N  N   . PHE B  1 210 ? 7.636   136.381 160.982 1.00 33.20  ? 210  PHE B N   1 
ATOM   4053  C  CA  . PHE B  1 210 ? 6.276   136.795 160.634 1.00 40.10  ? 210  PHE B CA  1 
ATOM   4054  C  C   . PHE B  1 210 ? 5.299   136.515 161.777 1.00 33.56  ? 210  PHE B C   1 
ATOM   4055  O  O   . PHE B  1 210 ? 4.143   136.147 161.562 1.00 36.30  ? 210  PHE B O   1 
ATOM   4056  C  CB  . PHE B  1 210 ? 5.809   136.123 159.340 1.00 45.92  ? 210  PHE B CB  1 
ATOM   4057  C  CG  . PHE B  1 210 ? 4.893   136.974 158.506 1.00 60.49  ? 210  PHE B CG  1 
ATOM   4058  C  CD1 . PHE B  1 210 ? 5.357   138.135 157.909 1.00 71.85  ? 210  PHE B CD1 1 
ATOM   4059  C  CD2 . PHE B  1 210 ? 3.564   136.607 158.308 1.00 65.64  ? 210  PHE B CD2 1 
ATOM   4060  C  CE1 . PHE B  1 210 ? 4.503   138.921 157.135 1.00 74.94  ? 210  PHE B CE1 1 
ATOM   4061  C  CE2 . PHE B  1 210 ? 2.708   137.387 157.531 1.00 61.54  ? 210  PHE B CE2 1 
ATOM   4062  C  CZ  . PHE B  1 210 ? 3.174   138.538 156.947 1.00 63.50  ? 210  PHE B CZ  1 
ATOM   4063  N  N   . GLN B  1 211 ? 5.763   136.682 163.006 1.00 28.81  ? 211  GLN B N   1 
ATOM   4064  C  CA  . GLN B  1 211 ? 4.921   136.447 164.179 1.00 28.84  ? 211  GLN B CA  1 
ATOM   4065  C  C   . GLN B  1 211 ? 4.511   137.809 164.721 1.00 35.06  ? 211  GLN B C   1 
ATOM   4066  O  O   . GLN B  1 211 ? 5.189   138.408 165.570 1.00 29.41  ? 211  GLN B O   1 
ATOM   4067  C  CB  . GLN B  1 211 ? 5.636   135.608 165.229 1.00 27.00  ? 211  GLN B CB  1 
ATOM   4068  C  CG  . GLN B  1 211 ? 5.944   134.161 164.795 1.00 32.51  ? 211  GLN B CG  1 
ATOM   4069  C  CD  . GLN B  1 211 ? 4.726   133.213 164.773 1.00 32.12  ? 211  GLN B CD  1 
ATOM   4070  O  OE1 . GLN B  1 211 ? 4.806   132.147 164.186 1.00 34.07  ? 211  GLN B OE1 1 
ATOM   4071  N  NE2 . GLN B  1 211 ? 3.616   133.594 165.422 1.00 28.53  ? 211  GLN B NE2 1 
ATOM   4072  N  N   . LEU B  1 212 ? 3.381   138.290 164.231 1.00 31.79  ? 212  LEU B N   1 
ATOM   4073  C  CA  . LEU B  1 212 ? 2.892   139.606 164.601 1.00 33.78  ? 212  LEU B CA  1 
ATOM   4074  C  C   . LEU B  1 212 ? 1.920   139.513 165.775 1.00 35.47  ? 212  LEU B C   1 
ATOM   4075  O  O   . LEU B  1 212 ? 1.569   138.426 166.249 1.00 32.47  ? 212  LEU B O   1 
ATOM   4076  C  CB  . LEU B  1 212 ? 2.230   140.265 163.398 1.00 30.34  ? 212  LEU B CB  1 
ATOM   4077  C  CG  . LEU B  1 212 ? 3.150   140.215 162.180 1.00 31.14  ? 212  LEU B CG  1 
ATOM   4078  C  CD1 . LEU B  1 212 ? 2.483   140.930 161.013 1.00 34.62  ? 212  LEU B CD1 1 
ATOM   4079  C  CD2 . LEU B  1 212 ? 4.536   140.804 162.513 1.00 35.90  ? 212  LEU B CD2 1 
ATOM   4080  N  N   . ASP B  1 213 ? 1.517   140.683 166.263 1.00 30.93  ? 213  ASP B N   1 
ATOM   4081  C  CA  . ASP B  1 213 ? 0.398   140.792 167.178 1.00 32.92  ? 213  ASP B CA  1 
ATOM   4082  C  C   . ASP B  1 213 ? -0.872  140.338 166.457 1.00 32.07  ? 213  ASP B C   1 
ATOM   4083  O  O   . ASP B  1 213 ? -0.906  140.303 165.228 1.00 32.03  ? 213  ASP B O   1 
ATOM   4084  C  CB  . ASP B  1 213 ? 0.258   142.243 167.648 1.00 32.08  ? 213  ASP B CB  1 
ATOM   4085  C  CG  . ASP B  1 213 ? -0.177  143.164 166.528 1.00 36.45  ? 213  ASP B CG  1 
ATOM   4086  O  OD1 . ASP B  1 213 ? 0.560   143.270 165.531 1.00 45.02  ? 213  ASP B OD1 1 
ATOM   4087  O  OD2 . ASP B  1 213 ? -1.254  143.767 166.623 1.00 43.73  ? 213  ASP B OD2 1 
ATOM   4088  N  N   . PRO B  1 214 ? -1.946  140.022 167.196 1.00 32.58  ? 214  PRO B N   1 
ATOM   4089  C  CA  . PRO B  1 214 ? -3.132  139.444 166.525 1.00 33.83  ? 214  PRO B CA  1 
ATOM   4090  C  C   . PRO B  1 214 ? -3.708  140.356 165.462 1.00 33.91  ? 214  PRO B C   1 
ATOM   4091  O  O   . PRO B  1 214 ? -4.093  139.875 164.386 1.00 36.66  ? 214  PRO B O   1 
ATOM   4092  C  CB  . PRO B  1 214 ? -4.117  139.203 167.678 1.00 33.52  ? 214  PRO B CB  1 
ATOM   4093  C  CG  . PRO B  1 214 ? -3.214  139.004 168.868 1.00 34.30  ? 214  PRO B CG  1 
ATOM   4094  C  CD  . PRO B  1 214 ? -2.085  139.988 168.662 1.00 32.71  ? 214  PRO B CD  1 
ATOM   4095  N  N   . GLU B  1 215 ? -3.748  141.670 165.722 1.00 33.92  ? 215  GLU B N   1 
ATOM   4096  C  CA  . GLU B  1 215 ? -4.279  142.604 164.737 1.00 38.83  ? 215  GLU B CA  1 
ATOM   4097  C  C   . GLU B  1 215 ? -3.383  142.681 163.507 1.00 33.92  ? 215  GLU B C   1 
ATOM   4098  O  O   . GLU B  1 215 ? -3.874  142.760 162.376 1.00 38.53  ? 215  GLU B O   1 
ATOM   4099  C  CB  . GLU B  1 215 ? -4.412  143.993 165.357 1.00 55.13  ? 215  GLU B CB  1 
ATOM   4100  C  CG  . GLU B  1 215 ? -5.495  144.095 166.403 1.00 77.60  ? 215  GLU B CG  1 
ATOM   4101  C  CD  . GLU B  1 215 ? -6.852  143.776 165.847 1.00 93.01  ? 215  GLU B CD  1 
ATOM   4102  O  OE1 . GLU B  1 215 ? -7.072  144.027 164.642 1.00 96.87  ? 215  GLU B OE1 1 
ATOM   4103  O  OE2 . GLU B  1 215 ? -7.685  143.242 166.609 1.00 101.23 ? 215  GLU B OE2 1 
ATOM   4104  N  N   . GLY B  1 216 ? -2.066  142.679 163.710 1.00 33.24  ? 216  GLY B N   1 
ATOM   4105  C  CA  . GLY B  1 216 ? -1.158  142.632 162.576 1.00 36.94  ? 216  GLY B CA  1 
ATOM   4106  C  C   . GLY B  1 216 ? -1.312  141.356 161.771 1.00 40.60  ? 216  GLY B C   1 
ATOM   4107  O  O   . GLY B  1 216 ? -1.291  141.388 160.542 1.00 32.38  ? 216  GLY B O   1 
ATOM   4108  N  N   . ALA B  1 217 ? -1.515  140.222 162.452 1.00 34.96  ? 217  ALA B N   1 
ATOM   4109  C  CA  . ALA B  1 217 ? -1.728  138.968 161.729 1.00 33.91  ? 217  ALA B CA  1 
ATOM   4110  C  C   . ALA B  1 217 ? -2.953  139.067 160.815 1.00 34.12  ? 217  ALA B C   1 
ATOM   4111  O  O   . ALA B  1 217 ? -2.882  138.700 159.637 1.00 32.46  ? 217  ALA B O   1 
ATOM   4112  C  CB  . ALA B  1 217 ? -1.887  137.816 162.716 1.00 35.36  ? 217  ALA B CB  1 
ATOM   4113  N  N   . MET B  1 218 ? -4.043  139.667 161.311 1.00 33.37  ? 218  MET B N   1 
ATOM   4114  C  CA  . MET B  1 218 ? -5.238  139.877 160.489 1.00 37.54  ? 218  MET B CA  1 
ATOM   4115  C  C   . MET B  1 218 ? -4.943  140.783 159.293 1.00 41.93  ? 218  MET B C   1 
ATOM   4116  O  O   . MET B  1 218 ? -5.318  140.472 158.157 1.00 36.28  ? 218  MET B O   1 
ATOM   4117  C  CB  . MET B  1 218 ? -6.369  140.474 161.334 1.00 42.04  ? 218  MET B CB  1 
ATOM   4118  C  CG  . MET B  1 218 ? -6.917  139.629 162.505 1.00 47.39  ? 218  MET B CG  1 
ATOM   4119  S  SD  . MET B  1 218 ? -7.555  137.975 162.122 1.00 53.11  ? 218  MET B SD  1 
ATOM   4120  C  CE  . MET B  1 218 ? -6.088  136.967 162.387 1.00 43.71  ? 218  MET B CE  1 
ATOM   4121  N  N   . LYS B  1 219 ? -4.295  141.931 159.530 1.00 36.21  ? 219  LYS B N   1 
ATOM   4122  C  CA  . LYS B  1 219 ? -4.018  142.838 158.419 1.00 34.14  ? 219  LYS B CA  1 
ATOM   4123  C  C   . LYS B  1 219 ? -3.065  142.219 157.407 1.00 33.46  ? 219  LYS B C   1 
ATOM   4124  O  O   . LYS B  1 219 ? -3.184  142.486 156.204 1.00 33.88  ? 219  LYS B O   1 
ATOM   4125  C  CB  . LYS B  1 219 ? -3.477  144.178 158.933 1.00 43.38  ? 219  LYS B CB  1 
ATOM   4126  C  CG  . LYS B  1 219 ? -4.569  145.015 159.593 1.00 49.51  ? 219  LYS B CG  1 
ATOM   4127  C  CD  . LYS B  1 219 ? -4.119  146.416 159.923 1.00 66.46  ? 219  LYS B CD  1 
ATOM   4128  C  CE  . LYS B  1 219 ? -5.313  147.286 160.310 1.00 70.48  ? 219  LYS B CE  1 
ATOM   4129  N  NZ  . LYS B  1 219 ? -5.977  146.815 161.556 1.00 73.46  ? 219  LYS B NZ  1 
ATOM   4130  N  N   . ALA B  1 220 ? -2.143  141.367 157.864 1.00 32.76  ? 220  ALA B N   1 
ATOM   4131  C  CA  . ALA B  1 220 ? -1.183  140.758 156.951 1.00 36.87  ? 220  ALA B CA  1 
ATOM   4132  C  C   . ALA B  1 220 ? -1.872  139.964 155.845 1.00 36.97  ? 220  ALA B C   1 
ATOM   4133  O  O   . ALA B  1 220 ? -1.359  139.899 154.725 1.00 40.33  ? 220  ALA B O   1 
ATOM   4134  C  CB  . ALA B  1 220 ? -0.224  139.859 157.720 1.00 36.53  ? 220  ALA B CB  1 
ATOM   4135  N  N   . VAL B  1 221 ? -3.025  139.352 156.128 1.00 34.55  ? 221  VAL B N   1 
ATOM   4136  C  CA  . VAL B  1 221 ? -3.736  138.599 155.107 1.00 37.92  ? 221  VAL B CA  1 
ATOM   4137  C  C   . VAL B  1 221 ? -4.918  139.375 154.527 1.00 44.51  ? 221  VAL B C   1 
ATOM   4138  O  O   . VAL B  1 221 ? -5.690  138.810 153.756 1.00 53.01  ? 221  VAL B O   1 
ATOM   4139  C  CB  . VAL B  1 221 ? -4.154  137.209 155.627 1.00 41.61  ? 221  VAL B CB  1 
ATOM   4140  C  CG1 . VAL B  1 221 ? -2.886  136.333 155.785 1.00 31.79  ? 221  VAL B CG1 1 
ATOM   4141  C  CG2 . VAL B  1 221 ? -4.957  137.287 156.930 1.00 36.96  ? 221  VAL B CG2 1 
ATOM   4142  N  N   . SER B  1 222 ? -5.088  140.654 154.897 1.00 42.04  ? 222  SER B N   1 
ATOM   4143  C  CA  . SER B  1 222 ? -6.077  141.546 154.288 1.00 47.96  ? 222  SER B CA  1 
ATOM   4144  C  C   . SER B  1 222 ? -5.497  142.403 153.155 1.00 44.00  ? 222  SER B C   1 
ATOM   4145  O  O   . SER B  1 222 ? -6.064  143.452 152.824 1.00 50.26  ? 222  SER B O   1 
ATOM   4146  C  CB  . SER B  1 222 ? -6.694  142.475 155.342 1.00 45.05  ? 222  SER B CB  1 
ATOM   4147  O  OG  . SER B  1 222 ? -7.279  141.742 156.390 1.00 50.13  ? 222  SER B OG  1 
ATOM   4148  N  N   . THR B  1 223 ? -4.347  142.026 152.613 1.00 41.64  ? 223  THR B N   1 
ATOM   4149  C  CA  . THR B  1 223 ? -3.657  142.837 151.622 1.00 33.87  ? 223  THR B CA  1 
ATOM   4150  C  C   . THR B  1 223 ? -2.900  141.893 150.712 1.00 35.00  ? 223  THR B C   1 
ATOM   4151  O  O   . THR B  1 223 ? -2.629  140.749 151.074 1.00 37.96  ? 223  THR B O   1 
ATOM   4152  C  CB  . THR B  1 223 ? -2.691  143.839 152.291 1.00 33.65  ? 223  THR B CB  1 
ATOM   4153  O  OG1 . THR B  1 223 ? -1.941  144.554 151.298 1.00 33.77  ? 223  THR B OG1 1 
ATOM   4154  C  CG2 . THR B  1 223 ? -1.711  143.115 153.221 1.00 33.91  ? 223  THR B CG2 1 
ATOM   4155  N  N   . LEU B  1 224 ? -2.549  142.380 149.530 1.00 33.36  ? 224  LEU B N   1 
ATOM   4156  C  CA  . LEU B  1 224 ? -1.660  141.640 148.643 1.00 36.80  ? 224  LEU B CA  1 
ATOM   4157  C  C   . LEU B  1 224 ? -0.221  142.125 148.741 1.00 37.32  ? 224  LEU B C   1 
ATOM   4158  O  O   . LEU B  1 224 ? 0.629   141.661 147.980 1.00 40.35  ? 224  LEU B O   1 
ATOM   4159  C  CB  . LEU B  1 224 ? -2.151  141.727 147.191 1.00 35.41  ? 224  LEU B CB  1 
ATOM   4160  C  CG  . LEU B  1 224 ? -3.569  141.200 146.980 1.00 40.53  ? 224  LEU B CG  1 
ATOM   4161  C  CD1 . LEU B  1 224 ? -4.092  141.555 145.609 1.00 37.89  ? 224  LEU B CD1 1 
ATOM   4162  C  CD2 . LEU B  1 224 ? -3.616  139.694 147.196 1.00 41.08  ? 224  LEU B CD2 1 
ATOM   4163  N  N   . GLY B  1 225 ? 0.060   143.072 149.630 1.00 33.28  ? 225  GLY B N   1 
ATOM   4164  C  CA  . GLY B  1 225 ? 1.411   143.541 149.843 1.00 31.49  ? 225  GLY B CA  1 
ATOM   4165  C  C   . GLY B  1 225 ? 1.552   145.047 149.920 1.00 31.84  ? 225  GLY B C   1 
ATOM   4166  O  O   . GLY B  1 225 ? 2.555   145.556 150.437 1.00 32.16  ? 225  GLY B O   1 
ATOM   4167  N  N   . ALA B  1 226 ? 0.568   145.782 149.398 1.00 32.54  ? 226  ALA B N   1 
ATOM   4168  C  CA  . ALA B  1 226 ? 0.681   147.233 149.314 1.00 32.88  ? 226  ALA B CA  1 
ATOM   4169  C  C   . ALA B  1 226 ? 0.256   147.948 150.592 1.00 40.37  ? 226  ALA B C   1 
ATOM   4170  O  O   . ALA B  1 226 ? 0.611   149.113 150.775 1.00 38.11  ? 226  ALA B O   1 
ATOM   4171  C  CB  . ALA B  1 226 ? -0.143  147.759 148.132 1.00 33.44  ? 226  ALA B CB  1 
ATOM   4172  N  N   . ASN B  1 227 ? -0.467  147.278 151.487 1.00 36.81  ? 227  ASN B N   1 
ATOM   4173  C  CA  . ASN B  1 227 ? -0.979  147.887 152.711 1.00 33.90  ? 227  ASN B CA  1 
ATOM   4174  C  C   . ASN B  1 227 ? -0.510  147.047 153.889 1.00 36.43  ? 227  ASN B C   1 
ATOM   4175  O  O   . ASN B  1 227 ? -1.273  146.243 154.435 1.00 33.61  ? 227  ASN B O   1 
ATOM   4176  C  CB  . ASN B  1 227 ? -2.504  148.007 152.672 1.00 34.70  ? 227  ASN B CB  1 
ATOM   4177  C  CG  . ASN B  1 227 ? -2.981  149.007 151.625 1.00 43.05  ? 227  ASN B CG  1 
ATOM   4178  O  OD1 . ASN B  1 227 ? -2.830  150.218 151.799 1.00 35.48  ? 227  ASN B OD1 1 
ATOM   4179  N  ND2 . ASN B  1 227 ? -3.534  148.499 150.510 1.00 35.34  ? 227  ASN B ND2 1 
ATOM   4180  N  N   . PRO B  1 228 ? 0.737   147.223 154.321 1.00 37.58  ? 228  PRO B N   1 
ATOM   4181  C  CA  . PRO B  1 228 ? 1.299   146.341 155.355 1.00 36.77  ? 228  PRO B CA  1 
ATOM   4182  C  C   . PRO B  1 228 ? 0.647   146.602 156.702 1.00 42.02  ? 228  PRO B C   1 
ATOM   4183  O  O   . PRO B  1 228 ? 0.126   147.700 156.954 1.00 35.82  ? 228  PRO B O   1 
ATOM   4184  C  CB  . PRO B  1 228 ? 2.784   146.737 155.384 1.00 33.58  ? 228  PRO B CB  1 
ATOM   4185  C  CG  . PRO B  1 228 ? 2.748   148.222 154.993 1.00 37.21  ? 228  PRO B CG  1 
ATOM   4186  C  CD  . PRO B  1 228 ? 1.644   148.334 153.974 1.00 36.30  ? 228  PRO B CD  1 
ATOM   4187  N  N   . PRO B  1 229 ? 0.690   145.638 157.614 1.00 43.90  ? 229  PRO B N   1 
ATOM   4188  C  CA  . PRO B  1 229 ? 0.287   145.919 158.995 1.00 34.34  ? 229  PRO B CA  1 
ATOM   4189  C  C   . PRO B  1 229 ? 1.280   146.869 159.649 1.00 35.15  ? 229  PRO B C   1 
ATOM   4190  O  O   . PRO B  1 229 ? 2.370   147.103 159.134 1.00 34.26  ? 229  PRO B O   1 
ATOM   4191  C  CB  . PRO B  1 229 ? 0.340   144.546 159.664 1.00 33.95  ? 229  PRO B CB  1 
ATOM   4192  C  CG  . PRO B  1 229 ? 1.398   143.797 158.900 1.00 34.14  ? 229  PRO B CG  1 
ATOM   4193  C  CD  . PRO B  1 229 ? 1.262   144.283 157.461 1.00 37.96  ? 229  PRO B CD  1 
ATOM   4194  N  N   . GLU B  1 230 ? 0.889   147.405 160.804 1.00 32.99  ? 230  GLU B N   1 
ATOM   4195  C  CA  . GLU B  1 230 ? 1.829   148.124 161.651 1.00 39.03  ? 230  GLU B CA  1 
ATOM   4196  C  C   . GLU B  1 230 ? 2.888   147.172 162.197 1.00 34.71  ? 230  GLU B C   1 
ATOM   4197  O  O   . GLU B  1 230 ? 2.608   146.008 162.490 1.00 36.37  ? 230  GLU B O   1 
ATOM   4198  C  CB  . GLU B  1 230 ? 1.105   148.792 162.820 1.00 41.88  ? 230  GLU B CB  1 
ATOM   4199  C  CG  . GLU B  1 230 ? 0.159   149.906 162.417 1.00 53.41  ? 230  GLU B CG  1 
ATOM   4200  C  CD  . GLU B  1 230 ? 0.849   150.934 161.534 1.00 73.27  ? 230  GLU B CD  1 
ATOM   4201  O  OE1 . GLU B  1 230 ? 0.436   151.093 160.357 1.00 77.48  ? 230  GLU B OE1 1 
ATOM   4202  O  OE2 . GLU B  1 230 ? 1.805   151.584 162.022 1.00 78.65  ? 230  GLU B OE2 1 
ATOM   4203  N  N   . TYR B  1 231 ? 4.113   147.675 162.334 1.00 35.60  ? 231  TYR B N   1 
ATOM   4204  C  CA  . TYR B  1 231 ? 5.197   146.932 162.968 1.00 35.56  ? 231  TYR B CA  1 
ATOM   4205  C  C   . TYR B  1 231 ? 4.853   146.664 164.428 1.00 35.14  ? 231  TYR B C   1 
ATOM   4206  O  O   . TYR B  1 231 ? 4.794   147.602 165.237 1.00 32.84  ? 231  TYR B O   1 
ATOM   4207  C  CB  . TYR B  1 231 ? 6.504   147.719 162.826 1.00 30.38  ? 231  TYR B CB  1 
ATOM   4208  C  CG  . TYR B  1 231 ? 7.713   147.087 163.493 1.00 37.61  ? 231  TYR B CG  1 
ATOM   4209  C  CD1 . TYR B  1 231 ? 7.994   147.333 164.837 1.00 34.84  ? 231  TYR B CD1 1 
ATOM   4210  C  CD2 . TYR B  1 231 ? 8.606   146.297 162.770 1.00 28.92  ? 231  TYR B CD2 1 
ATOM   4211  C  CE1 . TYR B  1 231 ? 9.116   146.790 165.450 1.00 35.16  ? 231  TYR B CE1 1 
ATOM   4212  C  CE2 . TYR B  1 231 ? 9.735   145.757 163.379 1.00 30.99  ? 231  TYR B CE2 1 
ATOM   4213  C  CZ  . TYR B  1 231 ? 9.974   146.001 164.718 1.00 32.76  ? 231  TYR B CZ  1 
ATOM   4214  O  OH  . TYR B  1 231 ? 11.082  145.459 165.336 1.00 41.13  ? 231  TYR B OH  1 
ATOM   4215  N  N   . ASN B  1 232 ? 4.605   145.402 164.777 1.00 30.69  ? 232  ASN B N   1 
ATOM   4216  C  CA  . ASN B  1 232 ? 4.150   145.071 166.122 1.00 30.87  ? 232  ASN B CA  1 
ATOM   4217  C  C   . ASN B  1 232 ? 4.149   143.557 166.293 1.00 33.28  ? 232  ASN B C   1 
ATOM   4218  O  O   . ASN B  1 232 ? 3.937   142.814 165.327 1.00 31.05  ? 232  ASN B O   1 
ATOM   4219  C  CB  . ASN B  1 232 ? 2.749   145.630 166.369 1.00 31.75  ? 232  ASN B CB  1 
ATOM   4220  C  CG  . ASN B  1 232 ? 2.418   145.758 167.832 1.00 37.67  ? 232  ASN B CG  1 
ATOM   4221  O  OD1 . ASN B  1 232 ? 3.278   145.630 168.694 1.00 33.74  ? 232  ASN B OD1 1 
ATOM   4222  N  ND2 . ASN B  1 232 ? 1.151   146.012 168.119 1.00 43.93  ? 232  ASN B ND2 1 
ATOM   4223  N  N   . THR B  1 233 ? 4.370   143.116 167.537 1.00 30.10  ? 233  THR B N   1 
ATOM   4224  C  CA  . THR B  1 233 ? 4.492   141.703 167.893 1.00 32.09  ? 233  THR B CA  1 
ATOM   4225  C  C   . THR B  1 233 ? 3.839   141.495 169.256 1.00 33.57  ? 233  THR B C   1 
ATOM   4226  O  O   . THR B  1 233 ? 3.363   142.442 169.896 1.00 33.52  ? 233  THR B O   1 
ATOM   4227  C  CB  . THR B  1 233 ? 5.962   141.249 167.963 1.00 32.96  ? 233  THR B CB  1 
ATOM   4228  O  OG1 . THR B  1 233 ? 6.590   141.802 169.133 1.00 29.63  ? 233  THR B OG1 1 
ATOM   4229  C  CG2 . THR B  1 233 ? 6.738   141.754 166.761 1.00 25.48  ? 233  THR B CG2 1 
ATOM   4230  N  N   . ASN B  1 234 ? 3.813   140.240 169.707 1.00 30.49  ? 234  ASN B N   1 
ATOM   4231  C  CA  . ASN B  1 234 ? 3.376   139.954 171.068 1.00 32.23  ? 234  ASN B CA  1 
ATOM   4232  C  C   . ASN B  1 234 ? 4.394   140.407 172.099 1.00 34.44  ? 234  ASN B C   1 
ATOM   4233  O  O   . ASN B  1 234 ? 4.097   140.381 173.298 1.00 38.06  ? 234  ASN B O   1 
ATOM   4234  C  CB  . ASN B  1 234 ? 3.074   138.463 171.237 1.00 34.51  ? 234  ASN B CB  1 
ATOM   4235  C  CG  . ASN B  1 234 ? 1.791   138.051 170.539 1.00 32.32  ? 234  ASN B CG  1 
ATOM   4236  O  OD1 . ASN B  1 234 ? 0.905   138.883 170.293 1.00 32.31  ? 234  ASN B OD1 1 
ATOM   4237  N  ND2 . ASN B  1 234 ? 1.686   136.760 170.206 1.00 28.07  ? 234  ASN B ND2 1 
ATOM   4238  N  N   . TYR B  1 235 ? 5.569   140.849 171.664 1.00 29.29  ? 235  TYR B N   1 
ATOM   4239  C  CA  . TYR B  1 235 ? 6.522   141.499 172.545 1.00 32.85  ? 235  TYR B CA  1 
ATOM   4240  C  C   . TYR B  1 235 ? 6.550   143.017 172.319 1.00 39.44  ? 235  TYR B C   1 
ATOM   4241  O  O   . TYR B  1 235 ? 7.557   143.664 172.621 1.00 36.44  ? 235  TYR B O   1 
ATOM   4242  C  CB  . TYR B  1 235 ? 7.912   140.895 172.327 1.00 30.08  ? 235  TYR B CB  1 
ATOM   4243  C  CG  . TYR B  1 235 ? 8.009   139.440 172.728 1.00 34.63  ? 235  TYR B CG  1 
ATOM   4244  C  CD1 . TYR B  1 235 ? 8.215   139.072 174.054 1.00 35.68  ? 235  TYR B CD1 1 
ATOM   4245  C  CD2 . TYR B  1 235 ? 7.768   138.431 171.788 1.00 32.70  ? 235  TYR B CD2 1 
ATOM   4246  C  CE1 . TYR B  1 235 ? 8.286   137.736 174.424 1.00 37.38  ? 235  TYR B CE1 1 
ATOM   4247  C  CE2 . TYR B  1 235 ? 7.805   137.092 172.146 1.00 36.70  ? 235  TYR B CE2 1 
ATOM   4248  C  CZ  . TYR B  1 235 ? 8.067   136.751 173.467 1.00 38.50  ? 235  TYR B CZ  1 
ATOM   4249  O  OH  . TYR B  1 235 ? 8.108   135.432 173.838 1.00 29.57  ? 235  TYR B OH  1 
ATOM   4250  N  N   . GLY B  1 236 ? 5.482   143.588 171.747 1.00 32.76  ? 236  GLY B N   1 
ATOM   4251  C  CA  . GLY B  1 236 ? 5.417   145.029 171.534 1.00 31.07  ? 236  GLY B CA  1 
ATOM   4252  C  C   . GLY B  1 236 ? 6.071   145.468 170.232 1.00 33.77  ? 236  GLY B C   1 
ATOM   4253  O  O   . GLY B  1 236 ? 6.449   144.663 169.372 1.00 33.59  ? 236  GLY B O   1 
ATOM   4254  N  N   . ASN B  1 237 ? 6.223   146.786 170.090 1.00 31.07  ? 237  ASN B N   1 
ATOM   4255  C  CA  . ASN B  1 237 ? 6.664   147.352 168.821 1.00 26.67  ? 237  ASN B CA  1 
ATOM   4256  C  C   . ASN B  1 237 ? 8.049   147.976 168.924 1.00 28.40  ? 237  ASN B C   1 
ATOM   4257  O  O   . ASN B  1 237 ? 8.424   148.797 168.080 1.00 34.20  ? 237  ASN B O   1 
ATOM   4258  C  CB  . ASN B  1 237 ? 5.674   148.388 168.277 1.00 26.41  ? 237  ASN B CB  1 
ATOM   4259  C  CG  . ASN B  1 237 ? 5.658   149.676 169.084 1.00 37.06  ? 237  ASN B CG  1 
ATOM   4260  O  OD1 . ASN B  1 237 ? 6.218   149.752 170.172 1.00 35.61  ? 237  ASN B OD1 1 
ATOM   4261  N  ND2 . ASN B  1 237 ? 5.090   150.725 168.500 1.00 34.10  ? 237  ASN B ND2 1 
ATOM   4262  N  N   . LYS B  1 238 ? 8.824   147.615 169.931 1.00 31.91  ? 238  LYS B N   1 
ATOM   4263  C  CA  . LYS B  1 238 ? 10.146  148.207 169.973 1.00 37.14  ? 238  LYS B CA  1 
ATOM   4264  C  C   . LYS B  1 238 ? 11.110  147.381 169.135 1.00 33.96  ? 238  LYS B C   1 
ATOM   4265  O  O   . LYS B  1 238 ? 10.870  146.208 168.834 1.00 27.61  ? 238  LYS B O   1 
ATOM   4266  C  CB  . LYS B  1 238 ? 10.695  148.285 171.390 1.00 36.46  ? 238  LYS B CB  1 
ATOM   4267  C  CG  . LYS B  1 238 ? 11.171  146.951 172.001 1.00 38.74  ? 238  LYS B CG  1 
ATOM   4268  C  CD  . LYS B  1 238 ? 11.791  147.314 173.340 1.00 48.49  ? 238  LYS B CD  1 
ATOM   4269  C  CE  . LYS B  1 238 ? 12.434  146.192 174.074 1.00 57.75  ? 238  LYS B CE  1 
ATOM   4270  N  NZ  . LYS B  1 238 ? 12.942  146.731 175.376 1.00 61.17  ? 238  LYS B NZ  1 
ATOM   4271  N  N   . VAL B  1 239 ? 12.198  148.027 168.736 1.00 28.13  ? 239  VAL B N   1 
ATOM   4272  C  CA  . VAL B  1 239 ? 13.302  147.358 168.059 1.00 35.11  ? 239  VAL B CA  1 
ATOM   4273  C  C   . VAL B  1 239 ? 14.167  146.760 169.156 1.00 35.78  ? 239  VAL B C   1 
ATOM   4274  O  O   . VAL B  1 239 ? 14.771  147.502 169.938 1.00 30.85  ? 239  VAL B O   1 
ATOM   4275  C  CB  . VAL B  1 239 ? 14.103  148.351 167.207 1.00 37.58  ? 239  VAL B CB  1 
ATOM   4276  C  CG1 . VAL B  1 239 ? 15.273  147.666 166.512 1.00 34.58  ? 239  VAL B CG1 1 
ATOM   4277  C  CG2 . VAL B  1 239 ? 13.183  149.065 166.222 1.00 33.96  ? 239  VAL B CG2 1 
ATOM   4278  N  N   . HIS B  1 240 ? 14.257  145.428 169.199 1.00 31.26  ? 240  HIS B N   1 
ATOM   4279  C  CA  . HIS B  1 240 ? 14.897  144.746 170.323 1.00 28.29  ? 240  HIS B CA  1 
ATOM   4280  C  C   . HIS B  1 240 ? 16.421  144.690 170.195 1.00 31.16  ? 240  HIS B C   1 
ATOM   4281  O  O   . HIS B  1 240 ? 16.970  144.513 169.102 1.00 31.40  ? 240  HIS B O   1 
ATOM   4282  C  CB  . HIS B  1 240 ? 14.355  143.317 170.488 1.00 28.47  ? 240  HIS B CB  1 
ATOM   4283  C  CG  . HIS B  1 240 ? 12.981  143.233 171.081 1.00 35.13  ? 240  HIS B CG  1 
ATOM   4284  N  ND1 . HIS B  1 240 ? 11.827  143.432 170.349 1.00 36.58  ? 240  HIS B ND1 1 
ATOM   4285  C  CD2 . HIS B  1 240 ? 12.580  142.964 172.347 1.00 32.76  ? 240  HIS B CD2 1 
ATOM   4286  C  CE1 . HIS B  1 240 ? 10.777  143.293 171.137 1.00 24.44  ? 240  HIS B CE1 1 
ATOM   4287  N  NE2 . HIS B  1 240 ? 11.204  143.012 172.355 1.00 33.88  ? 240  HIS B NE2 1 
ATOM   4288  N  N   . ASP B  1 241 ? 17.093  144.806 171.349 1.00 31.40  ? 241  ASP B N   1 
ATOM   4289  C  CA  . ASP B  1 241 ? 18.540  144.622 171.462 1.00 40.26  ? 241  ASP B CA  1 
ATOM   4290  C  C   . ASP B  1 241 ? 18.931  143.164 171.571 1.00 30.42  ? 241  ASP B C   1 
ATOM   4291  O  O   . ASP B  1 241 ? 20.070  142.813 171.247 1.00 30.86  ? 241  ASP B O   1 
ATOM   4292  C  CB  . ASP B  1 241 ? 19.083  145.311 172.725 1.00 47.21  ? 241  ASP B CB  1 
ATOM   4293  C  CG  . ASP B  1 241 ? 19.281  146.765 172.547 1.00 75.44  ? 241  ASP B CG  1 
ATOM   4294  O  OD1 . ASP B  1 241 ? 19.205  147.223 171.391 1.00 91.72  ? 241  ASP B OD1 1 
ATOM   4295  O  OD2 . ASP B  1 241 ? 19.513  147.453 173.563 1.00 89.53  ? 241  ASP B OD2 1 
ATOM   4296  N  N   . LYS B  1 242 ? 18.058  142.350 172.146 1.00 32.17  ? 242  LYS B N   1 
ATOM   4297  C  CA  . LYS B  1 242 ? 18.147  140.921 172.382 1.00 35.73  ? 242  LYS B CA  1 
ATOM   4298  C  C   . LYS B  1 242 ? 16.993  140.228 171.677 1.00 30.43  ? 242  LYS B C   1 
ATOM   4299  O  O   . LYS B  1 242 ? 15.963  140.849 171.435 1.00 29.42  ? 242  LYS B O   1 
ATOM   4300  C  CB  . LYS B  1 242 ? 18.102  140.571 173.881 1.00 37.15  ? 242  LYS B CB  1 
ATOM   4301  C  CG  . LYS B  1 242 ? 19.276  141.058 174.698 1.00 48.07  ? 242  LYS B CG  1 
ATOM   4302  C  CD  . LYS B  1 242 ? 19.094  140.684 176.159 1.00 62.29  ? 242  LYS B CD  1 
ATOM   4303  C  CE  . LYS B  1 242 ? 20.289  141.116 177.013 1.00 70.00  ? 242  LYS B CE  1 
ATOM   4304  N  NZ  . LYS B  1 242 ? 20.134  140.743 178.456 1.00 71.36  ? 242  LYS B NZ  1 
ATOM   4305  N  N   . PRO B  1 243 ? 17.125  138.960 171.327 1.00 32.34  ? 243  PRO B N   1 
ATOM   4306  C  CA  . PRO B  1 243 ? 16.016  138.282 170.674 1.00 26.16  ? 243  PRO B CA  1 
ATOM   4307  C  C   . PRO B  1 243 ? 14.755  138.403 171.510 1.00 33.88  ? 243  PRO B C   1 
ATOM   4308  O  O   . PRO B  1 243 ? 14.775  138.162 172.728 1.00 37.44  ? 243  PRO B O   1 
ATOM   4309  C  CB  . PRO B  1 243 ? 16.494  136.820 170.584 1.00 28.36  ? 243  PRO B CB  1 
ATOM   4310  C  CG  . PRO B  1 243 ? 17.985  136.924 170.567 1.00 28.07  ? 243  PRO B CG  1 
ATOM   4311  C  CD  . PRO B  1 243 ? 18.298  138.088 171.489 1.00 29.11  ? 243  PRO B CD  1 
ATOM   4312  N  N   . PRO B  1 244 ? 13.636  138.800 170.896 1.00 31.68  ? 244  PRO B N   1 
ATOM   4313  C  CA  . PRO B  1 244 ? 12.378  138.842 171.657 1.00 33.12  ? 244  PRO B CA  1 
ATOM   4314  C  C   . PRO B  1 244 ? 11.917  137.468 172.100 1.00 32.77  ? 244  PRO B C   1 
ATOM   4315  O  O   . PRO B  1 244 ? 11.384  137.325 173.205 1.00 30.94  ? 244  PRO B O   1 
ATOM   4316  C  CB  . PRO B  1 244 ? 11.370  139.456 170.668 1.00 29.57  ? 244  PRO B CB  1 
ATOM   4317  C  CG  . PRO B  1 244 ? 12.128  139.823 169.469 1.00 35.15  ? 244  PRO B CG  1 
ATOM   4318  C  CD  . PRO B  1 244 ? 13.442  139.126 169.472 1.00 32.24  ? 244  PRO B CD  1 
ATOM   4319  N  N   . ILE B  1 245 ? 12.062  136.460 171.245 1.00 28.52  ? 245  ILE B N   1 
ATOM   4320  C  CA  . ILE B  1 245 ? 11.616  135.104 171.548 1.00 28.58  ? 245  ILE B CA  1 
ATOM   4321  C  C   . ILE B  1 245 ? 12.808  134.359 172.135 1.00 31.96  ? 245  ILE B C   1 
ATOM   4322  O  O   . ILE B  1 245 ? 13.894  134.362 171.533 1.00 35.73  ? 245  ILE B O   1 
ATOM   4323  C  CB  . ILE B  1 245 ? 11.068  134.404 170.289 1.00 32.44  ? 245  ILE B CB  1 
ATOM   4324  C  CG1 . ILE B  1 245 ? 9.821   135.117 169.752 1.00 31.22  ? 245  ILE B CG1 1 
ATOM   4325  C  CG2 . ILE B  1 245 ? 10.728  132.936 170.550 1.00 34.22  ? 245  ILE B CG2 1 
ATOM   4326  C  CD1 . ILE B  1 245 ? 9.404   134.625 168.342 1.00 27.34  ? 245  ILE B CD1 1 
ATOM   4327  N  N   . PRO B  1 246 ? 12.662  133.715 173.291 1.00 34.54  ? 246  PRO B N   1 
ATOM   4328  C  CA  . PRO B  1 246 ? 13.795  132.974 173.876 1.00 30.21  ? 246  PRO B CA  1 
ATOM   4329  C  C   . PRO B  1 246 ? 14.223  131.837 172.966 1.00 36.55  ? 246  PRO B C   1 
ATOM   4330  O  O   . PRO B  1 246 ? 13.418  131.290 172.204 1.00 28.54  ? 246  PRO B O   1 
ATOM   4331  C  CB  . PRO B  1 246 ? 13.236  132.429 175.195 1.00 36.09  ? 246  PRO B CB  1 
ATOM   4332  C  CG  . PRO B  1 246 ? 11.985  133.267 175.479 1.00 38.08  ? 246  PRO B CG  1 
ATOM   4333  C  CD  . PRO B  1 246 ? 11.446  133.659 174.119 1.00 33.47  ? 246  PRO B CD  1 
ATOM   4334  N  N   . GLY B  1 247 ? 15.506  131.482 173.054 1.00 34.03  ? 247  GLY B N   1 
ATOM   4335  C  CA  . GLY B  1 247 ? 15.963  130.275 172.398 1.00 34.81  ? 247  GLY B CA  1 
ATOM   4336  C  C   . GLY B  1 247 ? 15.225  129.070 172.944 1.00 34.82  ? 247  GLY B C   1 
ATOM   4337  O  O   . GLY B  1 247 ? 14.824  129.031 174.110 1.00 29.78  ? 247  GLY B O   1 
ATOM   4338  N  N   . GLN B  1 248 ? 15.002  128.094 172.084 1.00 33.13  ? 248  GLN B N   1 
ATOM   4339  C  CA  . GLN B  1 248 ? 14.296  126.902 172.528 1.00 34.00  ? 248  GLN B CA  1 
ATOM   4340  C  C   . GLN B  1 248 ? 15.180  126.099 173.481 1.00 35.74  ? 248  GLN B C   1 
ATOM   4341  O  O   . GLN B  1 248 ? 16.407  126.200 173.452 1.00 32.56  ? 248  GLN B O   1 
ATOM   4342  C  CB  . GLN B  1 248 ? 13.922  126.044 171.327 1.00 35.42  ? 248  GLN B CB  1 
ATOM   4343  C  CG  . GLN B  1 248 ? 15.130  125.368 170.719 1.00 27.99  ? 248  GLN B CG  1 
ATOM   4344  C  CD  . GLN B  1 248 ? 14.745  124.260 169.748 1.00 44.58  ? 248  GLN B CD  1 
ATOM   4345  O  OE1 . GLN B  1 248 ? 14.890  123.067 170.056 1.00 46.34  ? 248  GLN B OE1 1 
ATOM   4346  N  NE2 . GLN B  1 248 ? 14.266  124.650 168.562 1.00 42.85  ? 248  GLN B NE2 1 
ATOM   4347  N  N   . THR B  1 249 ? 14.540  125.329 174.358 1.00 30.38  ? 249  THR B N   1 
ATOM   4348  C  CA  . THR B  1 249 ? 15.201  124.271 175.087 1.00 33.12  ? 249  THR B CA  1 
ATOM   4349  C  C   . THR B  1 249 ? 14.488  122.965 174.758 1.00 35.76  ? 249  THR B C   1 
ATOM   4350  O  O   . THR B  1 249 ? 13.274  122.980 174.537 1.00 32.50  ? 249  THR B O   1 
ATOM   4351  C  CB  . THR B  1 249 ? 15.193  124.484 176.616 1.00 32.39  ? 249  THR B CB  1 
ATOM   4352  O  OG1 . THR B  1 249 ? 13.862  124.308 177.116 1.00 35.76  ? 249  THR B OG1 1 
ATOM   4353  C  CG2 . THR B  1 249 ? 15.743  125.879 177.024 1.00 28.66  ? 249  THR B CG2 1 
ATOM   4354  N  N   . PRO B  1 250 ? 15.204  121.825 174.673 1.00 35.54  ? 250  PRO B N   1 
ATOM   4355  C  CA  . PRO B  1 250 ? 16.659  121.661 174.791 1.00 32.80  ? 250  PRO B CA  1 
ATOM   4356  C  C   . PRO B  1 250 ? 17.386  122.511 173.756 1.00 35.06  ? 250  PRO B C   1 
ATOM   4357  O  O   . PRO B  1 250 ? 16.873  122.687 172.663 1.00 30.83  ? 250  PRO B O   1 
ATOM   4358  C  CB  . PRO B  1 250 ? 16.880  120.165 174.511 1.00 28.15  ? 250  PRO B CB  1 
ATOM   4359  C  CG  . PRO B  1 250 ? 15.575  119.516 174.788 1.00 28.71  ? 250  PRO B CG  1 
ATOM   4360  C  CD  . PRO B  1 250 ? 14.523  120.546 174.393 1.00 24.60  ? 250  PRO B CD  1 
ATOM   4361  N  N   . THR B  1 251 ? 18.566  123.012 174.108 1.00 34.57  ? 251  THR B N   1 
ATOM   4362  C  CA  . THR B  1 251 ? 19.309  123.914 173.234 1.00 29.66  ? 251  THR B CA  1 
ATOM   4363  C  C   . THR B  1 251 ? 19.560  123.304 171.862 1.00 32.00  ? 251  THR B C   1 
ATOM   4364  O  O   . THR B  1 251 ? 20.061  122.180 171.747 1.00 31.84  ? 251  THR B O   1 
ATOM   4365  C  CB  . THR B  1 251 ? 20.633  124.259 173.890 1.00 30.76  ? 251  THR B CB  1 
ATOM   4366  O  OG1 . THR B  1 251 ? 20.365  124.763 175.204 1.00 31.36  ? 251  THR B OG1 1 
ATOM   4367  C  CG2 . THR B  1 251 ? 21.367  125.300 173.080 1.00 31.53  ? 251  THR B CG2 1 
ATOM   4368  N  N   . GLN B  1 252 ? 19.242  124.060 170.814 1.00 27.09  ? 252  GLN B N   1 
ATOM   4369  C  CA  . GLN B  1 252 ? 19.533  123.606 169.466 1.00 27.10  ? 252  GLN B CA  1 
ATOM   4370  C  C   . GLN B  1 252 ? 20.919  124.079 169.062 1.00 31.66  ? 252  GLN B C   1 
ATOM   4371  O  O   . GLN B  1 252 ? 21.258  125.251 169.250 1.00 35.51  ? 252  GLN B O   1 
ATOM   4372  C  CB  . GLN B  1 252 ? 18.500  124.119 168.465 1.00 23.90  ? 252  GLN B CB  1 
ATOM   4373  C  CG  . GLN B  1 252 ? 18.878  123.736 167.017 1.00 27.58  ? 252  GLN B CG  1 
ATOM   4374  C  CD  . GLN B  1 252 ? 17.913  124.316 166.009 1.00 30.51  ? 252  GLN B CD  1 
ATOM   4375  O  OE1 . GLN B  1 252 ? 17.719  125.529 165.957 1.00 35.87  ? 252  GLN B OE1 1 
ATOM   4376  N  NE2 . GLN B  1 252 ? 17.264  123.445 165.233 1.00 30.54  ? 252  GLN B NE2 1 
ATOM   4377  N  N   . TYR B  1 253 ? 21.732  123.154 168.548 1.00 24.45  ? 253  TYR B N   1 
ATOM   4378  C  CA  . TYR B  1 253 ? 22.985  123.489 167.883 1.00 33.61  ? 253  TYR B CA  1 
ATOM   4379  C  C   . TYR B  1 253 ? 22.893  123.038 166.435 1.00 36.89  ? 253  TYR B C   1 
ATOM   4380  O  O   . TYR B  1 253 ? 22.506  121.896 166.168 1.00 31.44  ? 253  TYR B O   1 
ATOM   4381  C  CB  . TYR B  1 253 ? 24.176  122.814 168.555 1.00 28.70  ? 253  TYR B CB  1 
ATOM   4382  C  CG  . TYR B  1 253 ? 24.576  123.380 169.893 1.00 30.61  ? 253  TYR B CG  1 
ATOM   4383  C  CD1 . TYR B  1 253 ? 23.916  123.016 171.071 1.00 26.94  ? 253  TYR B CD1 1 
ATOM   4384  C  CD2 . TYR B  1 253 ? 25.653  124.257 169.989 1.00 29.08  ? 253  TYR B CD2 1 
ATOM   4385  C  CE1 . TYR B  1 253 ? 24.334  123.544 172.316 1.00 26.95  ? 253  TYR B CE1 1 
ATOM   4386  C  CE2 . TYR B  1 253 ? 26.065  124.778 171.204 1.00 32.31  ? 253  TYR B CE2 1 
ATOM   4387  C  CZ  . TYR B  1 253 ? 25.412  124.415 172.364 1.00 32.54  ? 253  TYR B CZ  1 
ATOM   4388  O  OH  . TYR B  1 253 ? 25.861  124.955 173.551 1.00 36.38  ? 253  TYR B OH  1 
ATOM   4389  N  N   . LEU B  1 254 ? 23.256  123.918 165.503 1.00 32.75  ? 254  LEU B N   1 
ATOM   4390  C  CA  . LEU B  1 254 ? 23.359  123.550 164.098 1.00 27.63  ? 254  LEU B CA  1 
ATOM   4391  C  C   . LEU B  1 254 ? 24.836  123.433 163.746 1.00 35.52  ? 254  LEU B C   1 
ATOM   4392  O  O   . LEU B  1 254 ? 25.602  124.385 163.935 1.00 31.66  ? 254  LEU B O   1 
ATOM   4393  C  CB  . LEU B  1 254 ? 22.670  124.569 163.199 1.00 32.12  ? 254  LEU B CB  1 
ATOM   4394  C  CG  . LEU B  1 254 ? 21.152  124.753 163.367 1.00 33.62  ? 254  LEU B CG  1 
ATOM   4395  C  CD1 . LEU B  1 254 ? 20.605  125.733 162.330 1.00 27.15  ? 254  LEU B CD1 1 
ATOM   4396  C  CD2 . LEU B  1 254 ? 20.397  123.425 163.334 1.00 26.95  ? 254  LEU B CD2 1 
ATOM   4397  N  N   . VAL B  1 255 ? 25.232  122.268 163.253 1.00 29.98  ? 255  VAL B N   1 
ATOM   4398  C  CA  . VAL B  1 255 ? 26.602  122.031 162.815 1.00 35.49  ? 255  VAL B CA  1 
ATOM   4399  C  C   . VAL B  1 255 ? 26.650  122.196 161.300 1.00 32.36  ? 255  VAL B C   1 
ATOM   4400  O  O   . VAL B  1 255 ? 26.119  121.368 160.549 1.00 38.00  ? 255  VAL B O   1 
ATOM   4401  C  CB  . VAL B  1 255 ? 27.105  120.652 163.249 1.00 34.64  ? 255  VAL B CB  1 
ATOM   4402  C  CG1 . VAL B  1 255 ? 28.479  120.386 162.618 1.00 30.59  ? 255  VAL B CG1 1 
ATOM   4403  C  CG2 . VAL B  1 255 ? 27.182  120.628 164.769 1.00 28.96  ? 255  VAL B CG2 1 
ATOM   4404  N  N   . HIS B  1 256 ? 27.299  123.273 160.868 1.00 32.76  ? 256  HIS B N   1 
ATOM   4405  C  CA  . HIS B  1 256 ? 27.397  123.683 159.473 1.00 28.52  ? 256  HIS B CA  1 
ATOM   4406  C  C   . HIS B  1 256 ? 28.721  123.151 158.932 1.00 28.19  ? 256  HIS B C   1 
ATOM   4407  O  O   . HIS B  1 256 ? 29.786  123.473 159.477 1.00 29.35  ? 256  HIS B O   1 
ATOM   4408  C  CB  . HIS B  1 256 ? 27.303  125.221 159.403 1.00 32.87  ? 256  HIS B CB  1 
ATOM   4409  C  CG  . HIS B  1 256 ? 27.618  125.828 158.067 1.00 33.88  ? 256  HIS B CG  1 
ATOM   4410  N  ND1 . HIS B  1 256 ? 26.704  126.592 157.372 1.00 30.63  ? 256  HIS B ND1 1 
ATOM   4411  C  CD2 . HIS B  1 256 ? 28.759  125.843 157.327 1.00 35.39  ? 256  HIS B CD2 1 
ATOM   4412  C  CE1 . HIS B  1 256 ? 27.250  127.014 156.243 1.00 31.97  ? 256  HIS B CE1 1 
ATOM   4413  N  NE2 . HIS B  1 256 ? 28.499  126.579 156.192 1.00 29.93  ? 256  HIS B NE2 1 
ATOM   4414  N  N   . ILE B  1 257 ? 28.654  122.272 157.924 1.00 27.60  ? 257  ILE B N   1 
ATOM   4415  C  CA  . ILE B  1 257 ? 29.852  121.682 157.321 1.00 30.11  ? 257  ILE B CA  1 
ATOM   4416  C  C   . ILE B  1 257 ? 29.794  121.855 155.812 1.00 29.41  ? 257  ILE B C   1 
ATOM   4417  O  O   . ILE B  1 257 ? 28.793  121.504 155.179 1.00 32.47  ? 257  ILE B O   1 
ATOM   4418  C  CB  . ILE B  1 257 ? 30.023  120.190 157.654 1.00 25.89  ? 257  ILE B CB  1 
ATOM   4419  C  CG1 . ILE B  1 257 ? 29.756  119.938 159.129 1.00 38.17  ? 257  ILE B CG1 1 
ATOM   4420  C  CG2 . ILE B  1 257 ? 31.432  119.714 157.241 1.00 28.95  ? 257  ILE B CG2 1 
ATOM   4421  C  CD1 . ILE B  1 257 ? 29.781  118.460 159.477 1.00 37.38  ? 257  ILE B CD1 1 
ATOM   4422  N  N   . GLU B  1 258 ? 30.876  122.354 155.233 1.00 26.92  ? 258  GLU B N   1 
ATOM   4423  C  CA  . GLU B  1 258 ? 30.948  122.530 153.790 1.00 25.00  ? 258  GLU B CA  1 
ATOM   4424  C  C   . GLU B  1 258 ? 31.825  121.441 153.185 1.00 34.46  ? 258  GLU B C   1 
ATOM   4425  O  O   . GLU B  1 258 ? 32.814  121.016 153.792 1.00 33.11  ? 258  GLU B O   1 
ATOM   4426  C  CB  . GLU B  1 258 ? 31.477  123.921 153.449 1.00 28.50  ? 258  GLU B CB  1 
ATOM   4427  C  CG  . GLU B  1 258 ? 30.682  124.987 154.199 1.00 32.96  ? 258  GLU B CG  1 
ATOM   4428  C  CD  . GLU B  1 258 ? 30.899  126.411 153.693 1.00 35.35  ? 258  GLU B CD  1 
ATOM   4429  O  OE1 . GLU B  1 258 ? 30.124  127.304 154.113 1.00 33.08  ? 258  GLU B OE1 1 
ATOM   4430  O  OE2 . GLU B  1 258 ? 31.826  126.640 152.891 1.00 30.17  ? 258  GLU B OE2 1 
ATOM   4431  N  N   . TRP B  1 259 ? 31.424  120.964 152.006 1.00 33.28  ? 259  TRP B N   1 
ATOM   4432  C  CA  . TRP B  1 259 ? 32.083  119.856 151.335 1.00 28.94  ? 259  TRP B CA  1 
ATOM   4433  C  C   . TRP B  1 259 ? 32.214  120.165 149.860 1.00 32.16  ? 259  TRP B C   1 
ATOM   4434  O  O   . TRP B  1 259 ? 31.477  120.983 149.308 1.00 34.71  ? 259  TRP B O   1 
ATOM   4435  C  CB  . TRP B  1 259 ? 31.310  118.552 151.480 1.00 31.55  ? 259  TRP B CB  1 
ATOM   4436  C  CG  . TRP B  1 259 ? 31.165  118.085 152.867 1.00 32.04  ? 259  TRP B CG  1 
ATOM   4437  C  CD1 . TRP B  1 259 ? 30.144  118.369 153.730 1.00 26.78  ? 259  TRP B CD1 1 
ATOM   4438  C  CD2 . TRP B  1 259 ? 32.056  117.213 153.562 1.00 27.26  ? 259  TRP B CD2 1 
ATOM   4439  N  NE1 . TRP B  1 259 ? 30.340  117.715 154.916 1.00 28.30  ? 259  TRP B NE1 1 
ATOM   4440  C  CE2 . TRP B  1 259 ? 31.513  117.003 154.843 1.00 30.97  ? 259  TRP B CE2 1 
ATOM   4441  C  CE3 . TRP B  1 259 ? 33.262  116.580 153.221 1.00 30.92  ? 259  TRP B CE3 1 
ATOM   4442  C  CZ2 . TRP B  1 259 ? 32.135  116.181 155.797 1.00 30.76  ? 259  TRP B CZ2 1 
ATOM   4443  C  CZ3 . TRP B  1 259 ? 33.881  115.773 154.169 1.00 35.59  ? 259  TRP B CZ3 1 
ATOM   4444  C  CH2 . TRP B  1 259 ? 33.319  115.585 155.445 1.00 33.72  ? 259  TRP B CH2 1 
ATOM   4445  N  N   . GLU B  1 260 ? 33.160  119.486 149.217 1.00 30.29  ? 260  GLU B N   1 
ATOM   4446  C  CA  . GLU B  1 260 ? 33.365  119.713 147.794 1.00 31.26  ? 260  GLU B CA  1 
ATOM   4447  C  C   . GLU B  1 260 ? 32.105  119.405 146.993 1.00 35.24  ? 260  GLU B C   1 
ATOM   4448  O  O   . GLU B  1 260 ? 31.758  120.145 146.056 1.00 29.30  ? 260  GLU B O   1 
ATOM   4449  C  CB  . GLU B  1 260 ? 34.520  118.860 147.285 1.00 29.65  ? 260  GLU B CB  1 
ATOM   4450  C  CG  . GLU B  1 260 ? 34.718  119.014 145.798 1.00 27.68  ? 260  GLU B CG  1 
ATOM   4451  C  CD  . GLU B  1 260 ? 35.978  118.325 145.289 1.00 34.88  ? 260  GLU B CD  1 
ATOM   4452  O  OE1 . GLU B  1 260 ? 35.865  117.629 144.264 1.00 37.02  ? 260  GLU B OE1 1 
ATOM   4453  O  OE2 . GLU B  1 260 ? 37.070  118.490 145.896 1.00 37.29  ? 260  GLU B OE2 1 
ATOM   4454  N  N   . SER B  1 261 ? 31.393  118.343 147.369 1.00 28.23  ? 261  SER B N   1 
ATOM   4455  C  CA  . SER B  1 261 ? 30.298  117.816 146.563 1.00 28.29  ? 261  SER B CA  1 
ATOM   4456  C  C   . SER B  1 261 ? 29.390  117.003 147.470 1.00 26.81  ? 261  SER B C   1 
ATOM   4457  O  O   . SER B  1 261 ? 29.747  116.715 148.618 1.00 31.46  ? 261  SER B O   1 
ATOM   4458  C  CB  . SER B  1 261 ? 30.830  116.942 145.413 1.00 28.26  ? 261  SER B CB  1 
ATOM   4459  O  OG  . SER B  1 261 ? 31.255  115.688 145.924 1.00 30.92  ? 261  SER B OG  1 
ATOM   4460  N  N   . PRO B  1 262 ? 28.188  116.640 146.997 1.00 30.13  ? 262  PRO B N   1 
ATOM   4461  C  CA  . PRO B  1 262 ? 27.315  115.788 147.834 1.00 29.46  ? 262  PRO B CA  1 
ATOM   4462  C  C   . PRO B  1 262 ? 27.930  114.431 148.145 1.00 28.83  ? 262  PRO B C   1 
ATOM   4463  O  O   . PRO B  1 262 ? 27.786  113.922 149.262 1.00 29.95  ? 262  PRO B O   1 
ATOM   4464  C  CB  . PRO B  1 262 ? 26.035  115.670 146.994 1.00 30.83  ? 262  PRO B CB  1 
ATOM   4465  C  CG  . PRO B  1 262 ? 26.035  116.944 146.128 1.00 35.59  ? 262  PRO B CG  1 
ATOM   4466  C  CD  . PRO B  1 262 ? 27.505  117.116 145.780 1.00 28.71  ? 262  PRO B CD  1 
ATOM   4467  N  N   . GLU B  1 263 ? 28.661  113.858 147.188 1.00 31.64  ? 263  GLU B N   1 
ATOM   4468  C  CA  . GLU B  1 263 ? 29.312  112.570 147.403 1.00 35.25  ? 263  GLU B CA  1 
ATOM   4469  C  C   . GLU B  1 263 ? 30.385  112.668 148.483 1.00 34.77  ? 263  GLU B C   1 
ATOM   4470  O  O   . GLU B  1 263 ? 30.484  111.786 149.344 1.00 31.96  ? 263  GLU B O   1 
ATOM   4471  C  CB  . GLU B  1 263 ? 29.910  112.064 146.081 1.00 39.86  ? 263  GLU B CB  1 
ATOM   4472  C  CG  . GLU B  1 263 ? 28.883  111.794 144.966 1.00 55.63  ? 263  GLU B CG  1 
ATOM   4473  C  CD  . GLU B  1 263 ? 28.246  113.065 144.360 1.00 72.84  ? 263  GLU B CD  1 
ATOM   4474  O  OE1 . GLU B  1 263 ? 28.868  114.157 144.415 1.00 60.22  ? 263  GLU B OE1 1 
ATOM   4475  O  OE2 . GLU B  1 263 ? 27.101  112.963 143.846 1.00 80.73  ? 263  GLU B OE2 1 
ATOM   4476  N  N   . HIS B  1 264 ? 31.192  113.738 148.465 1.00 31.08  ? 264  HIS B N   1 
ATOM   4477  C  CA  . HIS B  1 264 ? 32.180  113.909 149.527 1.00 26.77  ? 264  HIS B CA  1 
ATOM   4478  C  C   . HIS B  1 264 ? 31.513  114.116 150.878 1.00 30.36  ? 264  HIS B C   1 
ATOM   4479  O  O   . HIS B  1 264 ? 32.005  113.614 151.899 1.00 31.89  ? 264  HIS B O   1 
ATOM   4480  C  CB  . HIS B  1 264 ? 33.118  115.080 149.219 1.00 31.52  ? 264  HIS B CB  1 
ATOM   4481  C  CG  . HIS B  1 264 ? 34.023  114.833 148.058 1.00 34.96  ? 264  HIS B CG  1 
ATOM   4482  N  ND1 . HIS B  1 264 ? 33.744  115.287 146.786 1.00 33.77  ? 264  HIS B ND1 1 
ATOM   4483  C  CD2 . HIS B  1 264 ? 35.187  114.148 147.968 1.00 30.50  ? 264  HIS B CD2 1 
ATOM   4484  C  CE1 . HIS B  1 264 ? 34.715  114.919 145.970 1.00 35.71  ? 264  HIS B CE1 1 
ATOM   4485  N  NE2 . HIS B  1 264 ? 35.594  114.213 146.658 1.00 35.38  ? 264  HIS B NE2 1 
ATOM   4486  N  N   . ALA B  1 265 ? 30.402  114.871 150.911 1.00 31.72  ? 265  ALA B N   1 
ATOM   4487  C  CA  . ALA B  1 265 ? 29.672  115.067 152.164 1.00 27.70  ? 265  ALA B CA  1 
ATOM   4488  C  C   . ALA B  1 265 ? 29.085  113.753 152.663 1.00 31.68  ? 265  ALA B C   1 
ATOM   4489  O  O   . ALA B  1 265 ? 29.126  113.457 153.862 1.00 30.89  ? 265  ALA B O   1 
ATOM   4490  C  CB  . ALA B  1 265 ? 28.548  116.096 151.989 1.00 26.14  ? 265  ALA B CB  1 
ATOM   4491  N  N   . HIS B  1 266 ? 28.496  112.974 151.761 1.00 30.31  ? 266  HIS B N   1 
ATOM   4492  C  CA  . HIS B  1 266 ? 27.897  111.716 152.179 1.00 34.15  ? 266  HIS B CA  1 
ATOM   4493  C  C   . HIS B  1 266 ? 28.958  110.781 152.747 1.00 38.56  ? 266  HIS B C   1 
ATOM   4494  O  O   . HIS B  1 266 ? 28.841  110.288 153.876 1.00 32.22  ? 266  HIS B O   1 
ATOM   4495  C  CB  . HIS B  1 266 ? 27.197  111.042 151.002 1.00 29.79  ? 266  HIS B CB  1 
ATOM   4496  C  CG  . HIS B  1 266 ? 26.514  109.775 151.390 1.00 38.56  ? 266  HIS B CG  1 
ATOM   4497  N  ND1 . HIS B  1 266 ? 26.857  108.549 150.871 1.00 44.81  ? 266  HIS B ND1 1 
ATOM   4498  C  CD2 . HIS B  1 266 ? 25.531  109.543 152.291 1.00 41.69  ? 266  HIS B CD2 1 
ATOM   4499  C  CE1 . HIS B  1 266 ? 26.098  107.617 151.418 1.00 45.14  ? 266  HIS B CE1 1 
ATOM   4500  N  NE2 . HIS B  1 266 ? 25.282  108.195 152.281 1.00 41.12  ? 266  HIS B NE2 1 
ATOM   4501  N  N   . GLN B  1 267 ? 30.014  110.544 151.975 1.00 28.35  ? 267  GLN B N   1 
ATOM   4502  C  CA  . GLN B  1 267 ? 31.088  109.677 152.443 1.00 33.45  ? 267  GLN B CA  1 
ATOM   4503  C  C   . GLN B  1 267 ? 31.843  110.299 153.616 1.00 35.70  ? 267  GLN B C   1 
ATOM   4504  O  O   . GLN B  1 267 ? 32.235  109.581 154.542 1.00 39.87  ? 267  GLN B O   1 
ATOM   4505  C  CB  . GLN B  1 267 ? 31.980  109.328 151.255 1.00 36.95  ? 267  GLN B CB  1 
ATOM   4506  C  CG  . GLN B  1 267 ? 33.005  108.278 151.537 1.00 62.52  ? 267  GLN B CG  1 
ATOM   4507  C  CD  . GLN B  1 267 ? 33.288  107.427 150.313 1.00 64.84  ? 267  GLN B CD  1 
ATOM   4508  O  OE1 . GLN B  1 267 ? 33.836  106.342 150.437 1.00 65.07  ? 267  GLN B OE1 1 
ATOM   4509  N  NE2 . GLN B  1 267 ? 32.864  107.893 149.131 1.00 59.60  ? 267  GLN B NE2 1 
ATOM   4510  N  N   . GLY B  1 268 ? 31.996  111.628 153.639 1.00 33.64  ? 268  GLY B N   1 
ATOM   4511  C  CA  . GLY B  1 268 ? 32.742  112.258 154.722 1.00 27.90  ? 268  GLY B CA  1 
ATOM   4512  C  C   . GLY B  1 268 ? 32.058  112.133 156.073 1.00 33.56  ? 268  GLY B C   1 
ATOM   4513  O  O   . GLY B  1 268 ? 32.688  111.758 157.070 1.00 32.12  ? 268  GLY B O   1 
ATOM   4514  N  N   . LEU B  1 269 ? 30.758  112.450 156.126 1.00 33.51  ? 269  LEU B N   1 
ATOM   4515  C  CA  . LEU B  1 269 ? 29.990  112.325 157.362 1.00 34.95  ? 269  LEU B CA  1 
ATOM   4516  C  C   . LEU B  1 269 ? 29.955  110.893 157.863 1.00 31.43  ? 269  LEU B C   1 
ATOM   4517  O  O   . LEU B  1 269 ? 29.886  110.663 159.075 1.00 32.93  ? 269  LEU B O   1 
ATOM   4518  C  CB  . LEU B  1 269 ? 28.549  112.828 157.158 1.00 35.55  ? 269  LEU B CB  1 
ATOM   4519  C  CG  . LEU B  1 269 ? 28.309  114.334 157.026 1.00 44.09  ? 269  LEU B CG  1 
ATOM   4520  C  CD1 . LEU B  1 269 ? 26.875  114.635 156.608 1.00 44.74  ? 269  LEU B CD1 1 
ATOM   4521  C  CD2 . LEU B  1 269 ? 28.637  115.033 158.319 1.00 40.15  ? 269  LEU B CD2 1 
ATOM   4522  N  N   . GLY B  1 270 ? 29.986  109.916 156.955 1.00 28.08  ? 270  GLY B N   1 
ATOM   4523  C  CA  . GLY B  1 270 ? 29.973  108.526 157.377 1.00 25.92  ? 270  GLY B CA  1 
ATOM   4524  C  C   . GLY B  1 270 ? 31.192  108.127 158.185 1.00 38.23  ? 270  GLY B C   1 
ATOM   4525  O  O   . GLY B  1 270 ? 31.163  107.094 158.859 1.00 33.46  ? 270  GLY B O   1 
ATOM   4526  N  N   . HIS B  1 271 ? 32.268  108.927 158.145 1.00 36.34  ? 271  HIS B N   1 
ATOM   4527  C  CA  . HIS B  1 271 ? 33.468  108.580 158.910 1.00 30.42  ? 271  HIS B CA  1 
ATOM   4528  C  C   . HIS B  1 271 ? 33.207  108.537 160.413 1.00 33.29  ? 271  HIS B C   1 
ATOM   4529  O  O   . HIS B  1 271 ? 33.959  107.877 161.131 1.00 37.49  ? 271  HIS B O   1 
ATOM   4530  C  CB  . HIS B  1 271 ? 34.610  109.555 158.615 1.00 33.54  ? 271  HIS B CB  1 
ATOM   4531  C  CG  . HIS B  1 271 ? 35.385  109.235 157.372 1.00 40.64  ? 271  HIS B CG  1 
ATOM   4532  N  ND1 . HIS B  1 271 ? 34.816  109.226 156.116 1.00 40.19  ? 271  HIS B ND1 1 
ATOM   4533  C  CD2 . HIS B  1 271 ? 36.695  108.941 157.191 1.00 39.51  ? 271  HIS B CD2 1 
ATOM   4534  C  CE1 . HIS B  1 271 ? 35.737  108.933 155.216 1.00 38.13  ? 271  HIS B CE1 1 
ATOM   4535  N  NE2 . HIS B  1 271 ? 36.887  108.757 155.842 1.00 41.68  ? 271  HIS B NE2 1 
ATOM   4536  N  N   . VAL B  1 272 ? 32.172  109.223 160.914 1.00 32.78  ? 272  VAL B N   1 
ATOM   4537  C  CA  . VAL B  1 272 ? 31.844  109.105 162.334 1.00 35.53  ? 272  VAL B CA  1 
ATOM   4538  C  C   . VAL B  1 272 ? 31.343  107.718 162.693 1.00 37.34  ? 272  VAL B C   1 
ATOM   4539  O  O   . VAL B  1 272 ? 31.279  107.380 163.877 1.00 38.55  ? 272  VAL B O   1 
ATOM   4540  C  CB  . VAL B  1 272 ? 30.801  110.147 162.797 1.00 34.45  ? 272  VAL B CB  1 
ATOM   4541  C  CG1 . VAL B  1 272 ? 31.305  111.557 162.538 1.00 29.71  ? 272  VAL B CG1 1 
ATOM   4542  C  CG2 . VAL B  1 272 ? 29.398  109.886 162.145 1.00 26.98  ? 272  VAL B CG2 1 
ATOM   4543  N  N   . MET B  1 273 ? 31.058  106.883 161.698 1.00 40.54  ? 273  MET B N   1 
ATOM   4544  C  CA  . MET B  1 273 ? 30.649  105.511 161.941 1.00 36.73  ? 273  MET B CA  1 
ATOM   4545  C  C   . MET B  1 273 ? 31.669  104.475 161.495 1.00 38.42  ? 273  MET B C   1 
ATOM   4546  O  O   . MET B  1 273 ? 31.762  103.426 162.132 1.00 45.92  ? 273  MET B O   1 
ATOM   4547  C  CB  . MET B  1 273 ? 29.309  105.226 161.240 1.00 35.76  ? 273  MET B CB  1 
ATOM   4548  C  CG  . MET B  1 273 ? 28.117  106.023 161.819 1.00 41.70  ? 273  MET B CG  1 
ATOM   4549  S  SD  . MET B  1 273 ? 26.530  105.585 161.071 1.00 61.50  ? 273  MET B SD  1 
ATOM   4550  C  CE  . MET B  1 273 ? 26.720  106.149 159.372 1.00 59.60  ? 273  MET B CE  1 
ATOM   4551  N  N   . VAL B  1 274 ? 32.464  104.750 160.455 1.00 40.17  ? 274  VAL B N   1 
ATOM   4552  C  CA  . VAL B  1 274 ? 33.338  103.746 159.855 1.00 40.59  ? 274  VAL B CA  1 
ATOM   4553  C  C   . VAL B  1 274 ? 34.818  104.005 160.119 1.00 44.95  ? 274  VAL B C   1 
ATOM   4554  O  O   . VAL B  1 274 ? 35.659  103.259 159.602 1.00 46.14  ? 274  VAL B O   1 
ATOM   4555  C  CB  . VAL B  1 274 ? 33.077  103.602 158.341 1.00 41.92  ? 274  VAL B CB  1 
ATOM   4556  C  CG1 . VAL B  1 274 ? 31.648  103.191 158.107 1.00 42.96  ? 274  VAL B CG1 1 
ATOM   4557  C  CG2 . VAL B  1 274 ? 33.394  104.899 157.593 1.00 33.44  ? 274  VAL B CG2 1 
ATOM   4558  N  N   . ASP B  1 275 ? 35.168  105.016 160.912 1.00 39.47  ? 275  ASP B N   1 
ATOM   4559  C  CA  . ASP B  1 275 ? 36.531  105.175 161.408 1.00 41.01  ? 275  ASP B CA  1 
ATOM   4560  C  C   . ASP B  1 275 ? 36.519  104.988 162.919 1.00 41.36  ? 275  ASP B C   1 
ATOM   4561  O  O   . ASP B  1 275 ? 35.832  105.733 163.631 1.00 39.72  ? 275  ASP B O   1 
ATOM   4562  C  CB  . ASP B  1 275 ? 37.118  106.540 161.060 1.00 35.42  ? 275  ASP B CB  1 
ATOM   4563  C  CG  . ASP B  1 275 ? 38.551  106.691 161.562 1.00 45.50  ? 275  ASP B CG  1 
ATOM   4564  O  OD1 . ASP B  1 275 ? 38.753  106.873 162.787 1.00 48.92  ? 275  ASP B OD1 1 
ATOM   4565  O  OD2 . ASP B  1 275 ? 39.480  106.593 160.736 1.00 51.40  ? 275  ASP B OD2 1 
ATOM   4566  N  N   . TYR B  1 276 ? 37.286  104.006 163.407 1.00 30.49  ? 276  TYR B N   1 
ATOM   4567  C  CA  . TYR B  1 276 ? 37.202  103.663 164.823 1.00 33.26  ? 276  TYR B CA  1 
ATOM   4568  C  C   . TYR B  1 276 ? 37.514  104.873 165.693 1.00 37.39  ? 276  TYR B C   1 
ATOM   4569  O  O   . TYR B  1 276 ? 36.811  105.141 166.671 1.00 37.86  ? 276  TYR B O   1 
ATOM   4570  C  CB  . TYR B  1 276 ? 38.133  102.488 165.167 1.00 35.30  ? 276  TYR B CB  1 
ATOM   4571  C  CG  . TYR B  1 276 ? 38.110  102.201 166.656 1.00 32.31  ? 276  TYR B CG  1 
ATOM   4572  C  CD1 . TYR B  1 276 ? 37.110  101.399 167.207 1.00 36.81  ? 276  TYR B CD1 1 
ATOM   4573  C  CD2 . TYR B  1 276 ? 39.063  102.754 167.514 1.00 39.48  ? 276  TYR B CD2 1 
ATOM   4574  C  CE1 . TYR B  1 276 ? 37.057  101.141 168.566 1.00 40.79  ? 276  TYR B CE1 1 
ATOM   4575  C  CE2 . TYR B  1 276 ? 39.019  102.510 168.895 1.00 37.02  ? 276  TYR B CE2 1 
ATOM   4576  C  CZ  . TYR B  1 276 ? 38.009  101.702 169.406 1.00 47.17  ? 276  TYR B CZ  1 
ATOM   4577  O  OH  . TYR B  1 276 ? 37.946  101.434 170.752 1.00 55.17  ? 276  TYR B OH  1 
ATOM   4578  N  N   . GLU B  1 277 ? 38.556  105.624 165.338 1.00 35.32  ? 277  GLU B N   1 
ATOM   4579  C  CA  . GLU B  1 277 ? 38.984  106.751 166.159 1.00 36.29  ? 277  GLU B CA  1 
ATOM   4580  C  C   . GLU B  1 277 ? 37.951  107.883 166.161 1.00 34.94  ? 277  GLU B C   1 
ATOM   4581  O  O   . GLU B  1 277 ? 37.543  108.355 167.224 1.00 39.03  ? 277  GLU B O   1 
ATOM   4582  C  CB  . GLU B  1 277 ? 40.348  107.244 165.675 1.00 39.94  ? 277  GLU B CB  1 
ATOM   4583  C  CG  . GLU B  1 277 ? 40.908  108.439 166.442 1.00 53.40  ? 277  GLU B CG  1 
ATOM   4584  C  CD  . GLU B  1 277 ? 42.266  108.866 165.907 1.00 67.37  ? 277  GLU B CD  1 
ATOM   4585  O  OE1 . GLU B  1 277 ? 42.738  109.962 166.270 1.00 70.88  ? 277  GLU B OE1 1 
ATOM   4586  O  OE2 . GLU B  1 277 ? 42.846  108.121 165.090 1.00 73.14  ? 277  GLU B OE2 1 
ATOM   4587  N  N   . LEU B  1 278 ? 37.493  108.313 164.982 1.00 34.22  ? 278  LEU B N   1 
ATOM   4588  C  CA  . LEU B  1 278 ? 36.495  109.378 164.938 1.00 38.05  ? 278  LEU B CA  1 
ATOM   4589  C  C   . LEU B  1 278 ? 35.189  108.938 165.600 1.00 38.78  ? 278  LEU B C   1 
ATOM   4590  O  O   . LEU B  1 278 ? 34.497  109.745 166.241 1.00 36.21  ? 278  LEU B O   1 
ATOM   4591  C  CB  . LEU B  1 278 ? 36.254  109.823 163.491 1.00 33.74  ? 278  LEU B CB  1 
ATOM   4592  C  CG  . LEU B  1 278 ? 35.288  111.000 163.335 1.00 32.65  ? 278  LEU B CG  1 
ATOM   4593  C  CD1 . LEU B  1 278 ? 35.829  112.217 164.073 1.00 30.16  ? 278  LEU B CD1 1 
ATOM   4594  C  CD2 . LEU B  1 278 ? 35.047  111.341 161.889 1.00 29.54  ? 278  LEU B CD2 1 
ATOM   4595  N  N   . ARG B  1 279 ? 34.840  107.662 165.448 1.00 39.60  ? 279  ARG B N   1 
ATOM   4596  C  CA  . ARG B  1 279 ? 33.644  107.127 166.087 1.00 41.74  ? 279  ARG B CA  1 
ATOM   4597  C  C   . ARG B  1 279 ? 33.697  107.297 167.600 1.00 38.31  ? 279  ARG B C   1 
ATOM   4598  O  O   . ARG B  1 279 ? 32.695  107.654 168.222 1.00 40.43  ? 279  ARG B O   1 
ATOM   4599  C  CB  . ARG B  1 279 ? 33.486  105.661 165.703 1.00 41.17  ? 279  ARG B CB  1 
ATOM   4600  C  CG  . ARG B  1 279 ? 32.343  104.917 166.326 1.00 39.04  ? 279  ARG B CG  1 
ATOM   4601  C  CD  . ARG B  1 279 ? 32.163  103.644 165.525 1.00 46.86  ? 279  ARG B CD  1 
ATOM   4602  N  NE  . ARG B  1 279 ? 31.459  102.587 166.242 1.00 43.78  ? 279  ARG B NE  1 
ATOM   4603  C  CZ  . ARG B  1 279 ? 30.935  101.529 165.637 1.00 42.71  ? 279  ARG B CZ  1 
ATOM   4604  N  NH1 . ARG B  1 279 ? 31.037  101.415 164.318 1.00 38.71  ? 279  ARG B NH1 1 
ATOM   4605  N  NH2 . ARG B  1 279 ? 30.326  100.586 166.344 1.00 43.43  ? 279  ARG B NH2 1 
ATOM   4606  N  N   . GLN B  1 280 ? 34.856  107.043 168.214 1.00 31.63  ? 280  GLN B N   1 
ATOM   4607  C  CA  . GLN B  1 280 ? 34.967  107.261 169.653 1.00 35.08  ? 280  GLN B CA  1 
ATOM   4608  C  C   . GLN B  1 280 ? 34.845  108.742 169.999 1.00 36.12  ? 280  GLN B C   1 
ATOM   4609  O  O   . GLN B  1 280 ? 34.195  109.103 170.990 1.00 36.05  ? 280  GLN B O   1 
ATOM   4610  C  CB  . GLN B  1 280 ? 36.290  106.701 170.197 1.00 38.44  ? 280  GLN B CB  1 
ATOM   4611  C  CG  . GLN B  1 280 ? 36.556  105.209 169.881 1.00 42.13  ? 280  GLN B CG  1 
ATOM   4612  C  CD  . GLN B  1 280 ? 35.328  104.330 170.031 1.00 45.29  ? 280  GLN B CD  1 
ATOM   4613  O  OE1 . GLN B  1 280 ? 34.932  103.634 169.094 1.00 50.35  ? 280  GLN B OE1 1 
ATOM   4614  N  NE2 . GLN B  1 280 ? 34.711  104.367 171.204 1.00 47.84  ? 280  GLN B NE2 1 
ATOM   4615  N  N   . ILE B  1 281 ? 35.497  109.612 169.225 1.00 31.29  ? 281  ILE B N   1 
ATOM   4616  C  CA  . ILE B  1 281 ? 35.400  111.044 169.497 1.00 30.72  ? 281  ILE B CA  1 
ATOM   4617  C  C   . ILE B  1 281 ? 33.949  111.500 169.394 1.00 33.38  ? 281  ILE B C   1 
ATOM   4618  O  O   . ILE B  1 281 ? 33.424  112.201 170.273 1.00 36.61  ? 281  ILE B O   1 
ATOM   4619  C  CB  . ILE B  1 281 ? 36.317  111.828 168.536 1.00 29.90  ? 281  ILE B CB  1 
ATOM   4620  C  CG1 . ILE B  1 281 ? 37.788  111.509 168.816 1.00 32.27  ? 281  ILE B CG1 1 
ATOM   4621  C  CG2 . ILE B  1 281 ? 36.059  113.321 168.655 1.00 34.50  ? 281  ILE B CG2 1 
ATOM   4622  C  CD1 . ILE B  1 281 ? 38.720  111.965 167.705 1.00 36.78  ? 281  ILE B CD1 1 
ATOM   4623  N  N   . HIS B  1 282 ? 33.271  111.086 168.325 1.00 38.64  ? 282  HIS B N   1 
ATOM   4624  C  CA  . HIS B  1 282 ? 31.909  111.545 168.078 1.00 31.53  ? 282  HIS B CA  1 
ATOM   4625  C  C   . HIS B  1 282 ? 30.918  110.902 169.046 1.00 37.04  ? 282  HIS B C   1 
ATOM   4626  O  O   . HIS B  1 282 ? 29.986  111.567 169.518 1.00 35.05  ? 282  HIS B O   1 
ATOM   4627  C  CB  . HIS B  1 282 ? 31.538  111.251 166.614 1.00 32.20  ? 282  HIS B CB  1 
ATOM   4628  C  CG  . HIS B  1 282 ? 30.201  111.789 166.181 1.00 31.54  ? 282  HIS B CG  1 
ATOM   4629  N  ND1 . HIS B  1 282 ? 29.136  110.972 165.848 1.00 30.75  ? 282  HIS B ND1 1 
ATOM   4630  C  CD2 . HIS B  1 282 ? 29.773  113.060 165.991 1.00 25.97  ? 282  HIS B CD2 1 
ATOM   4631  C  CE1 . HIS B  1 282 ? 28.103  111.719 165.489 1.00 30.46  ? 282  HIS B CE1 1 
ATOM   4632  N  NE2 . HIS B  1 282 ? 28.465  112.991 165.565 1.00 33.55  ? 282  HIS B NE2 1 
ATOM   4633  N  N   . ASN B  1 283 ? 31.081  109.602 169.332 1.00 30.11  ? 283  ASN B N   1 
ATOM   4634  C  CA  . ASN B  1 283 ? 30.164  108.938 170.255 1.00 32.56  ? 283  ASN B CA  1 
ATOM   4635  C  C   . ASN B  1 283 ? 30.199  109.605 171.619 1.00 35.72  ? 283  ASN B C   1 
ATOM   4636  O  O   . ASN B  1 283 ? 29.158  109.960 172.181 1.00 35.57  ? 283  ASN B O   1 
ATOM   4637  C  CB  . ASN B  1 283 ? 30.519  107.454 170.387 1.00 33.91  ? 283  ASN B CB  1 
ATOM   4638  C  CG  . ASN B  1 283 ? 30.038  106.612 169.202 1.00 33.39  ? 283  ASN B CG  1 
ATOM   4639  O  OD1 . ASN B  1 283 ? 29.489  107.132 168.231 1.00 34.00  ? 283  ASN B OD1 1 
ATOM   4640  N  ND2 . ASN B  1 283 ? 30.266  105.302 169.280 1.00 37.81  ? 283  ASN B ND2 1 
ATOM   4641  N  N   . ASN B  1 284 ? 31.404  109.797 172.159 1.00 38.04  ? 284  ASN B N   1 
ATOM   4642  C  CA  . ASN B  1 284 ? 31.562  110.319 173.508 1.00 38.75  ? 284  ASN B CA  1 
ATOM   4643  C  C   . ASN B  1 284 ? 31.413  111.831 173.570 1.00 38.41  ? 284  ASN B C   1 
ATOM   4644  O  O   . ASN B  1 284 ? 30.944  112.359 174.581 1.00 38.19  ? 284  ASN B O   1 
ATOM   4645  C  CB  . ASN B  1 284 ? 32.928  109.901 174.039 1.00 41.90  ? 284  ASN B CB  1 
ATOM   4646  C  CG  . ASN B  1 284 ? 33.056  108.406 174.158 1.00 49.44  ? 284  ASN B CG  1 
ATOM   4647  O  OD1 . ASN B  1 284 ? 32.166  107.744 174.681 1.00 51.98  ? 284  ASN B OD1 1 
ATOM   4648  N  ND2 . ASN B  1 284 ? 34.108  107.855 173.578 1.00 48.55  ? 284  ASN B ND2 1 
ATOM   4649  N  N   . GLY B  1 285 ? 31.794  112.538 172.514 1.00 36.22  ? 285  GLY B N   1 
ATOM   4650  C  CA  . GLY B  1 285 ? 31.785  113.983 172.554 1.00 34.60  ? 285  GLY B CA  1 
ATOM   4651  C  C   . GLY B  1 285 ? 30.517  114.612 172.013 1.00 37.60  ? 285  GLY B C   1 
ATOM   4652  O  O   . GLY B  1 285 ? 30.253  115.779 172.300 1.00 42.68  ? 285  GLY B O   1 
ATOM   4653  N  N   . VAL B  1 286 ? 29.742  113.887 171.209 1.00 33.77  ? 286  VAL B N   1 
ATOM   4654  C  CA  . VAL B  1 286 ? 28.530  114.466 170.625 1.00 32.43  ? 286  VAL B CA  1 
ATOM   4655  C  C   . VAL B  1 286 ? 27.308  113.624 170.964 1.00 33.19  ? 286  VAL B C   1 
ATOM   4656  O  O   . VAL B  1 286 ? 26.431  114.070 171.711 1.00 33.23  ? 286  VAL B O   1 
ATOM   4657  C  CB  . VAL B  1 286 ? 28.683  114.649 169.105 1.00 35.25  ? 286  VAL B CB  1 
ATOM   4658  C  CG1 . VAL B  1 286 ? 27.351  115.063 168.478 1.00 25.59  ? 286  VAL B CG1 1 
ATOM   4659  C  CG2 . VAL B  1 286 ? 29.797  115.714 168.810 1.00 27.92  ? 286  VAL B CG2 1 
ATOM   4660  N  N   . LEU B  1 287 ? 27.270  112.375 170.482 1.00 35.94  ? 287  LEU B N   1 
ATOM   4661  C  CA  . LEU B  1 287 ? 26.064  111.554 170.618 1.00 34.80  ? 287  LEU B CA  1 
ATOM   4662  C  C   . LEU B  1 287 ? 25.652  111.368 172.079 1.00 35.68  ? 287  LEU B C   1 
ATOM   4663  O  O   . LEU B  1 287 ? 24.454  111.292 172.379 1.00 32.72  ? 287  LEU B O   1 
ATOM   4664  C  CB  . LEU B  1 287 ? 26.283  110.188 169.952 1.00 32.13  ? 287  LEU B CB  1 
ATOM   4665  C  CG  . LEU B  1 287 ? 26.470  110.183 168.435 1.00 30.96  ? 287  LEU B CG  1 
ATOM   4666  C  CD1 . LEU B  1 287 ? 26.558  108.742 167.904 1.00 27.92  ? 287  LEU B CD1 1 
ATOM   4667  C  CD2 . LEU B  1 287 ? 25.299  110.924 167.748 1.00 24.48  ? 287  LEU B CD2 1 
ATOM   4668  N  N   . ALA B  1 288 ? 26.624  111.287 172.999 1.00 30.29  ? 288  ALA B N   1 
ATOM   4669  C  CA  . ALA B  1 288 ? 26.330  111.095 174.412 1.00 32.70  ? 288  ALA B CA  1 
ATOM   4670  C  C   . ALA B  1 288 ? 25.614  112.282 175.048 1.00 36.85  ? 288  ALA B C   1 
ATOM   4671  O  O   . ALA B  1 288 ? 25.143  112.155 176.184 1.00 34.95  ? 288  ALA B O   1 
ATOM   4672  C  CB  . ALA B  1 288 ? 27.619  110.813 175.196 1.00 40.53  ? 288  ALA B CB  1 
ATOM   4673  N  N   . HIS B  1 289 ? 25.539  113.424 174.372 1.00 35.33  ? 289  HIS B N   1 
ATOM   4674  C  CA  . HIS B  1 289 ? 24.984  114.640 174.951 1.00 37.27  ? 289  HIS B CA  1 
ATOM   4675  C  C   . HIS B  1 289 ? 23.685  115.068 174.282 1.00 34.09  ? 289  HIS B C   1 
ATOM   4676  O  O   . HIS B  1 289 ? 23.208  116.182 174.533 1.00 34.74  ? 289  HIS B O   1 
ATOM   4677  C  CB  . HIS B  1 289 ? 26.010  115.764 174.865 1.00 33.18  ? 289  HIS B CB  1 
ATOM   4678  C  CG  . HIS B  1 289 ? 27.330  115.413 175.477 1.00 37.09  ? 289  HIS B CG  1 
ATOM   4679  N  ND1 . HIS B  1 289 ? 27.461  115.050 176.803 1.00 39.68  ? 289  HIS B ND1 1 
ATOM   4680  C  CD2 . HIS B  1 289 ? 28.578  115.382 174.952 1.00 36.31  ? 289  HIS B CD2 1 
ATOM   4681  C  CE1 . HIS B  1 289 ? 28.732  114.794 177.064 1.00 38.59  ? 289  HIS B CE1 1 
ATOM   4682  N  NE2 . HIS B  1 289 ? 29.432  114.993 175.960 1.00 39.04  ? 289  HIS B NE2 1 
ATOM   4683  N  N   . LEU B  1 290 ? 23.090  114.216 173.449 1.00 28.10  ? 290  LEU B N   1 
ATOM   4684  C  CA  . LEU B  1 290 ? 21.947  114.620 172.638 1.00 29.05  ? 290  LEU B CA  1 
ATOM   4685  C  C   . LEU B  1 290 ? 20.634  114.123 173.227 1.00 34.64  ? 290  LEU B C   1 
ATOM   4686  O  O   . LEU B  1 290 ? 20.530  112.970 173.662 1.00 35.40  ? 290  LEU B O   1 
ATOM   4687  C  CB  . LEU B  1 290 ? 22.079  114.102 171.206 1.00 30.10  ? 290  LEU B CB  1 
ATOM   4688  C  CG  . LEU B  1 290 ? 23.329  114.536 170.448 1.00 31.41  ? 290  LEU B CG  1 
ATOM   4689  C  CD1 . LEU B  1 290 ? 23.218  114.033 169.028 1.00 22.97  ? 290  LEU B CD1 1 
ATOM   4690  C  CD2 . LEU B  1 290 ? 23.453  116.061 170.506 1.00 31.86  ? 290  LEU B CD2 1 
ATOM   4691  N  N   . ASP B  1 291 ? 19.638  115.021 173.238 1.00 31.35  ? 291  ASP B N   1 
ATOM   4692  C  CA  . ASP B  1 291 ? 18.222  114.664 173.335 1.00 27.31  ? 291  ASP B CA  1 
ATOM   4693  C  C   . ASP B  1 291 ? 17.636  114.310 171.976 1.00 33.13  ? 291  ASP B C   1 
ATOM   4694  O  O   . ASP B  1 291 ? 16.716  113.490 171.900 1.00 34.48  ? 291  ASP B O   1 
ATOM   4695  C  CB  . ASP B  1 291 ? 17.393  115.825 173.909 1.00 32.63  ? 291  ASP B CB  1 
ATOM   4696  C  CG  . ASP B  1 291 ? 17.443  115.898 175.415 1.00 35.97  ? 291  ASP B CG  1 
ATOM   4697  O  OD1 . ASP B  1 291 ? 17.553  114.835 176.057 1.00 37.43  ? 291  ASP B OD1 1 
ATOM   4698  O  OD2 . ASP B  1 291 ? 17.354  117.020 175.954 1.00 30.52  ? 291  ASP B OD2 1 
ATOM   4699  N  N   . LYS B  1 292 ? 18.125  114.939 170.907 1.00 31.44  ? 292  LYS B N   1 
ATOM   4700  C  CA  . LYS B  1 292 ? 17.587  114.723 169.571 1.00 27.25  ? 292  LYS B CA  1 
ATOM   4701  C  C   . LYS B  1 292 ? 18.695  114.844 168.540 1.00 31.30  ? 292  LYS B C   1 
ATOM   4702  O  O   . LYS B  1 292 ? 19.616  115.658 168.689 1.00 32.33  ? 292  LYS B O   1 
ATOM   4703  C  CB  . LYS B  1 292 ? 16.490  115.730 169.241 1.00 26.92  ? 292  LYS B CB  1 
ATOM   4704  C  CG  . LYS B  1 292 ? 15.743  115.422 167.948 1.00 30.61  ? 292  LYS B CG  1 
ATOM   4705  C  CD  . LYS B  1 292 ? 14.561  116.376 167.779 1.00 37.55  ? 292  LYS B CD  1 
ATOM   4706  C  CE  . LYS B  1 292 ? 13.684  115.939 166.605 1.00 41.06  ? 292  LYS B CE  1 
ATOM   4707  N  NZ  . LYS B  1 292 ? 12.457  116.753 166.523 1.00 41.22  ? 292  LYS B NZ  1 
ATOM   4708  N  N   . GLY B  1 293 ? 18.597  114.031 167.493 1.00 28.43  ? 293  GLY B N   1 
ATOM   4709  C  CA  . GLY B  1 293 ? 19.524  114.108 166.392 1.00 28.04  ? 293  GLY B CA  1 
ATOM   4710  C  C   . GLY B  1 293 ? 20.637  113.084 166.523 1.00 34.09  ? 293  GLY B C   1 
ATOM   4711  O  O   . GLY B  1 293 ? 20.617  112.207 167.394 1.00 35.22  ? 293  GLY B O   1 
ATOM   4712  N  N   . PRO B  1 294 ? 21.666  113.206 165.684 1.00 34.45  ? 294  PRO B N   1 
ATOM   4713  C  CA  . PRO B  1 294 ? 21.800  114.252 164.668 1.00 25.16  ? 294  PRO B CA  1 
ATOM   4714  C  C   . PRO B  1 294 ? 20.986  113.997 163.398 1.00 30.14  ? 294  PRO B C   1 
ATOM   4715  O  O   . PRO B  1 294 ? 20.774  112.863 163.015 1.00 31.00  ? 294  PRO B O   1 
ATOM   4716  C  CB  . PRO B  1 294 ? 23.302  114.256 164.367 1.00 30.27  ? 294  PRO B CB  1 
ATOM   4717  C  CG  . PRO B  1 294 ? 23.763  112.926 164.697 1.00 38.12  ? 294  PRO B CG  1 
ATOM   4718  C  CD  . PRO B  1 294 ? 22.865  112.361 165.782 1.00 32.97  ? 294  PRO B CD  1 
ATOM   4719  N  N   . TYR B  1 295 ? 20.553  115.072 162.743 1.00 28.80  ? 295  TYR B N   1 
ATOM   4720  C  CA  . TYR B  1 295 ? 19.855  114.990 161.465 1.00 30.02  ? 295  TYR B CA  1 
ATOM   4721  C  C   . TYR B  1 295 ? 20.529  115.955 160.501 1.00 29.89  ? 295  TYR B C   1 
ATOM   4722  O  O   . TYR B  1 295 ? 20.632  117.145 160.799 1.00 30.53  ? 295  TYR B O   1 
ATOM   4723  C  CB  . TYR B  1 295 ? 18.374  115.347 161.642 1.00 28.27  ? 295  TYR B CB  1 
ATOM   4724  C  CG  . TYR B  1 295 ? 17.560  115.180 160.395 1.00 25.08  ? 295  TYR B CG  1 
ATOM   4725  C  CD1 . TYR B  1 295 ? 17.152  113.912 159.985 1.00 30.90  ? 295  TYR B CD1 1 
ATOM   4726  C  CD2 . TYR B  1 295 ? 17.197  116.285 159.615 1.00 30.07  ? 295  TYR B CD2 1 
ATOM   4727  C  CE1 . TYR B  1 295 ? 16.394  113.729 158.843 1.00 29.81  ? 295  TYR B CE1 1 
ATOM   4728  C  CE2 . TYR B  1 295 ? 16.437  116.110 158.451 1.00 38.04  ? 295  TYR B CE2 1 
ATOM   4729  C  CZ  . TYR B  1 295 ? 16.041  114.816 158.078 1.00 38.94  ? 295  TYR B CZ  1 
ATOM   4730  O  OH  . TYR B  1 295 ? 15.284  114.594 156.952 1.00 43.47  ? 295  TYR B OH  1 
ATOM   4731  N  N   . TYR B  1 296 ? 20.985  115.455 159.354 1.00 31.50  ? 296  TYR B N   1 
ATOM   4732  C  CA  . TYR B  1 296 ? 21.794  116.234 158.418 1.00 33.38  ? 296  TYR B CA  1 
ATOM   4733  C  C   . TYR B  1 296 ? 21.023  116.527 157.132 1.00 34.79  ? 296  TYR B C   1 
ATOM   4734  O  O   . TYR B  1 296 ? 20.687  115.607 156.372 1.00 30.43  ? 296  TYR B O   1 
ATOM   4735  C  CB  . TYR B  1 296 ? 23.112  115.503 158.121 1.00 32.62  ? 296  TYR B CB  1 
ATOM   4736  C  CG  . TYR B  1 296 ? 24.153  115.731 159.203 1.00 33.61  ? 296  TYR B CG  1 
ATOM   4737  C  CD1 . TYR B  1 296 ? 24.916  116.886 159.206 1.00 42.21  ? 296  TYR B CD1 1 
ATOM   4738  C  CD2 . TYR B  1 296 ? 24.366  114.810 160.220 1.00 37.82  ? 296  TYR B CD2 1 
ATOM   4739  C  CE1 . TYR B  1 296 ? 25.874  117.139 160.178 1.00 44.13  ? 296  TYR B CE1 1 
ATOM   4740  C  CE2 . TYR B  1 296 ? 25.337  115.056 161.218 1.00 38.83  ? 296  TYR B CE2 1 
ATOM   4741  C  CZ  . TYR B  1 296 ? 26.078  116.234 161.188 1.00 44.39  ? 296  TYR B CZ  1 
ATOM   4742  O  OH  . TYR B  1 296 ? 27.037  116.535 162.152 1.00 41.29  ? 296  TYR B OH  1 
ATOM   4743  N  N   . MET B  1 297 ? 20.788  117.811 156.868 1.00 29.43  ? 297  MET B N   1 
ATOM   4744  C  CA  . MET B  1 297 ? 20.192  118.262 155.619 1.00 27.42  ? 297  MET B CA  1 
ATOM   4745  C  C   . MET B  1 297 ? 21.286  118.721 154.661 1.00 27.83  ? 297  MET B C   1 
ATOM   4746  O  O   . MET B  1 297 ? 22.242  119.374 155.074 1.00 29.31  ? 297  MET B O   1 
ATOM   4747  C  CB  . MET B  1 297 ? 19.188  119.403 155.870 1.00 32.08  ? 297  MET B CB  1 
ATOM   4748  C  CG  . MET B  1 297 ? 17.988  118.996 156.763 1.00 33.31  ? 297  MET B CG  1 
ATOM   4749  S  SD  . MET B  1 297 ? 16.935  120.370 157.328 1.00 36.80  ? 297  MET B SD  1 
ATOM   4750  C  CE  . MET B  1 297 ? 16.254  120.913 155.746 1.00 30.86  ? 297  MET B CE  1 
ATOM   4751  N  N   . PHE B  1 298 ? 21.143  118.368 153.385 1.00 29.82  ? 298  PHE B N   1 
ATOM   4752  C  CA  . PHE B  1 298 ? 22.072  118.777 152.338 1.00 30.83  ? 298  PHE B CA  1 
ATOM   4753  C  C   . PHE B  1 298 ? 21.536  120.002 151.616 1.00 28.33  ? 298  PHE B C   1 
ATOM   4754  O  O   . PHE B  1 298 ? 20.357  120.054 151.264 1.00 29.95  ? 298  PHE B O   1 
ATOM   4755  C  CB  . PHE B  1 298 ? 22.287  117.660 151.307 1.00 27.84  ? 298  PHE B CB  1 
ATOM   4756  C  CG  . PHE B  1 298 ? 23.271  116.582 151.735 1.00 35.65  ? 298  PHE B CG  1 
ATOM   4757  C  CD1 . PHE B  1 298 ? 23.258  116.068 153.021 1.00 37.00  ? 298  PHE B CD1 1 
ATOM   4758  C  CD2 . PHE B  1 298 ? 24.201  116.081 150.828 1.00 35.73  ? 298  PHE B CD2 1 
ATOM   4759  C  CE1 . PHE B  1 298 ? 24.158  115.067 153.396 1.00 35.92  ? 298  PHE B CE1 1 
ATOM   4760  C  CE2 . PHE B  1 298 ? 25.106  115.087 151.195 1.00 29.26  ? 298  PHE B CE2 1 
ATOM   4761  C  CZ  . PHE B  1 298 ? 25.079  114.572 152.479 1.00 26.75  ? 298  PHE B CZ  1 
ATOM   4762  N  N   . PHE B  1 299 ? 22.413  120.966 151.351 1.00 30.70  ? 299  PHE B N   1 
ATOM   4763  C  CA  . PHE B  1 299 ? 22.010  122.183 150.668 1.00 28.38  ? 299  PHE B CA  1 
ATOM   4764  C  C   . PHE B  1 299 ? 22.983  122.546 149.558 1.00 31.89  ? 299  PHE B C   1 
ATOM   4765  O  O   . PHE B  1 299 ? 24.171  122.197 149.578 1.00 30.66  ? 299  PHE B O   1 
ATOM   4766  C  CB  . PHE B  1 299 ? 21.935  123.383 151.614 1.00 27.40  ? 299  PHE B CB  1 
ATOM   4767  C  CG  . PHE B  1 299 ? 20.894  123.279 152.696 1.00 25.21  ? 299  PHE B CG  1 
ATOM   4768  C  CD1 . PHE B  1 299 ? 21.185  122.636 153.880 1.00 27.56  ? 299  PHE B CD1 1 
ATOM   4769  C  CD2 . PHE B  1 299 ? 19.662  123.910 152.557 1.00 30.54  ? 299  PHE B CD2 1 
ATOM   4770  C  CE1 . PHE B  1 299 ? 20.246  122.592 154.909 1.00 32.31  ? 299  PHE B CE1 1 
ATOM   4771  C  CE2 . PHE B  1 299 ? 18.710  123.877 153.572 1.00 25.82  ? 299  PHE B CE2 1 
ATOM   4772  C  CZ  . PHE B  1 299 ? 19.008  123.224 154.760 1.00 27.82  ? 299  PHE B CZ  1 
ATOM   4773  N  N   . SER B  1 300 ? 22.475  123.301 148.617 1.00 31.90  ? 300  SER B N   1 
ATOM   4774  C  CA  . SER B  1 300 ? 23.321  123.963 147.662 1.00 33.66  ? 300  SER B CA  1 
ATOM   4775  C  C   . SER B  1 300 ? 23.283  125.469 147.899 1.00 34.36  ? 300  SER B C   1 
ATOM   4776  O  O   . SER B  1 300 ? 22.194  126.039 148.040 1.00 35.65  ? 300  SER B O   1 
ATOM   4777  C  CB  . SER B  1 300 ? 22.863  123.636 146.246 1.00 36.09  ? 300  SER B CB  1 
ATOM   4778  O  OG  . SER B  1 300 ? 23.614  124.361 145.308 1.00 48.55  ? 300  SER B OG  1 
ATOM   4779  N  N   . PRO B  1 301 ? 24.427  126.141 147.993 1.00 35.79  ? 301  PRO B N   1 
ATOM   4780  C  CA  . PRO B  1 301 ? 24.423  127.606 148.107 1.00 35.94  ? 301  PRO B CA  1 
ATOM   4781  C  C   . PRO B  1 301 ? 24.129  128.214 146.747 1.00 33.21  ? 301  PRO B C   1 
ATOM   4782  O  O   . PRO B  1 301 ? 24.918  128.075 145.810 1.00 39.48  ? 301  PRO B O   1 
ATOM   4783  C  CB  . PRO B  1 301 ? 25.850  127.922 148.584 1.00 34.17  ? 301  PRO B CB  1 
ATOM   4784  C  CG  . PRO B  1 301 ? 26.677  126.794 148.058 1.00 39.75  ? 301  PRO B CG  1 
ATOM   4785  C  CD  . PRO B  1 301 ? 25.787  125.575 148.070 1.00 31.11  ? 301  PRO B CD  1 
ATOM   4786  N  N   . MET B  1 302 ? 22.963  128.855 146.621 1.00 34.02  ? 302  MET B N   1 
ATOM   4787  C  CA  . MET B  1 302 ? 22.575  129.453 145.342 1.00 38.18  ? 302  MET B CA  1 
ATOM   4788  C  C   . MET B  1 302 ? 23.210  130.823 145.149 1.00 38.87  ? 302  MET B C   1 
ATOM   4789  O  O   . MET B  1 302 ? 23.676  131.152 144.053 1.00 51.18  ? 302  MET B O   1 
ATOM   4790  C  CB  . MET B  1 302 ? 21.057  129.604 145.243 1.00 40.56  ? 302  MET B CB  1 
ATOM   4791  C  CG  . MET B  1 302 ? 20.244  128.361 145.440 1.00 50.12  ? 302  MET B CG  1 
ATOM   4792  S  SD  A MET B  1 302 ? 20.780  127.054 144.317 0.48 52.35  ? 302  MET B SD  1 
ATOM   4793  S  SD  B MET B  1 302 ? 18.493  128.857 145.498 0.52 51.43  ? 302  MET B SD  1 
ATOM   4794  C  CE  A MET B  1 302 ? 19.691  127.377 142.925 0.48 47.55  ? 302  MET B CE  1 
ATOM   4795  C  CE  B MET B  1 302 ? 18.318  129.722 143.939 0.52 46.76  ? 302  MET B CE  1 
ATOM   4796  N  N   . MET B  1 303 ? 23.162  131.661 146.180 1.00 41.81  ? 303  MET B N   1 
ATOM   4797  C  CA  . MET B  1 303 ? 23.743  132.998 146.169 1.00 37.65  ? 303  MET B CA  1 
ATOM   4798  C  C   . MET B  1 303 ? 24.500  133.179 147.468 1.00 37.24  ? 303  MET B C   1 
ATOM   4799  O  O   . MET B  1 303 ? 24.071  132.687 148.518 1.00 37.02  ? 303  MET B O   1 
ATOM   4800  C  CB  . MET B  1 303 ? 22.709  134.134 146.075 1.00 48.54  ? 303  MET B CB  1 
ATOM   4801  C  CG  . MET B  1 303 ? 21.756  134.150 144.902 1.00 79.67  ? 303  MET B CG  1 
ATOM   4802  S  SD  . MET B  1 303 ? 20.884  135.753 144.854 1.00 104.72 ? 303  MET B SD  1 
ATOM   4803  C  CE  . MET B  1 303 ? 19.614  135.566 146.121 1.00 101.72 ? 303  MET B CE  1 
ATOM   4804  N  N   . GLU B  1 304 ? 25.615  133.888 147.401 1.00 36.46  ? 304  GLU B N   1 
ATOM   4805  C  CA  . GLU B  1 304 ? 26.416  134.128 148.585 1.00 36.23  ? 304  GLU B CA  1 
ATOM   4806  C  C   . GLU B  1 304 ? 26.989  135.523 148.512 1.00 40.49  ? 304  GLU B C   1 
ATOM   4807  O  O   . GLU B  1 304 ? 27.469  135.958 147.459 1.00 38.16  ? 304  GLU B O   1 
ATOM   4808  C  CB  . GLU B  1 304 ? 27.580  133.145 148.717 1.00 36.50  ? 304  GLU B CB  1 
ATOM   4809  C  CG  . GLU B  1 304 ? 27.217  131.687 148.572 1.00 39.79  ? 304  GLU B CG  1 
ATOM   4810  C  CD  . GLU B  1 304 ? 28.424  130.815 148.784 1.00 40.73  ? 304  GLU B CD  1 
ATOM   4811  O  OE1 . GLU B  1 304 ? 29.021  130.363 147.783 1.00 44.19  ? 304  GLU B OE1 1 
ATOM   4812  O  OE2 . GLU B  1 304 ? 28.781  130.609 149.963 1.00 38.04  ? 304  GLU B OE2 1 
ATOM   4813  N  N   . GLN B  1 305 ? 26.962  136.211 149.631 1.00 37.16  ? 305  GLN B N   1 
ATOM   4814  C  CA  . GLN B  1 305 ? 27.787  137.396 149.799 1.00 38.03  ? 305  GLN B CA  1 
ATOM   4815  C  C   . GLN B  1 305 ? 28.671  137.054 150.988 1.00 43.60  ? 305  GLN B C   1 
ATOM   4816  O  O   . GLN B  1 305 ? 28.251  137.212 152.138 1.00 36.93  ? 305  GLN B O   1 
ATOM   4817  C  CB  . GLN B  1 305 ? 26.932  138.644 150.007 1.00 41.10  ? 305  GLN B CB  1 
ATOM   4818  C  CG  . GLN B  1 305 ? 27.707  139.937 149.830 1.00 42.37  ? 305  GLN B CG  1 
ATOM   4819  C  CD  . GLN B  1 305 ? 28.445  140.314 151.078 1.00 42.09  ? 305  GLN B CD  1 
ATOM   4820  O  OE1 . GLN B  1 305 ? 29.528  139.789 151.364 1.00 40.24  ? 305  GLN B OE1 1 
ATOM   4821  N  NE2 . GLN B  1 305 ? 27.852  141.229 151.856 1.00 47.43  ? 305  GLN B NE2 1 
ATOM   4822  N  N   . GLY B  1 306 ? 29.893  136.583 150.713 1.00 39.72  ? 306  GLY B N   1 
ATOM   4823  C  CA  . GLY B  1 306 ? 30.664  135.906 151.740 1.00 36.90  ? 306  GLY B CA  1 
ATOM   4824  C  C   . GLY B  1 306 ? 31.671  136.757 152.495 1.00 48.21  ? 306  GLY B C   1 
ATOM   4825  O  O   . GLY B  1 306 ? 32.510  136.211 153.222 1.00 42.73  ? 306  GLY B O   1 
ATOM   4826  N  N   . LEU B  1 307 ? 31.569  138.087 152.407 1.00 38.20  ? 307  LEU B N   1 
ATOM   4827  C  CA  . LEU B  1 307 ? 32.582  138.903 153.071 1.00 48.15  ? 307  LEU B CA  1 
ATOM   4828  C  C   . LEU B  1 307 ? 32.570  138.753 154.582 1.00 39.98  ? 307  LEU B C   1 
ATOM   4829  O  O   . LEU B  1 307 ? 33.625  138.896 155.209 1.00 37.99  ? 307  LEU B O   1 
ATOM   4830  C  CB  . LEU B  1 307 ? 32.441  140.370 152.676 1.00 42.44  ? 307  LEU B CB  1 
ATOM   4831  C  CG  . LEU B  1 307 ? 33.241  140.508 151.373 1.00 54.77  ? 307  LEU B CG  1 
ATOM   4832  C  CD1 . LEU B  1 307 ? 32.371  140.521 150.120 1.00 51.77  ? 307  LEU B CD1 1 
ATOM   4833  C  CD2 . LEU B  1 307 ? 34.202  141.681 151.426 1.00 64.59  ? 307  LEU B CD2 1 
ATOM   4834  N  N   . TRP B  1 308 ? 31.433  138.377 155.164 1.00 37.09  ? 308  TRP B N   1 
ATOM   4835  C  CA  . TRP B  1 308 ? 31.376  138.116 156.598 1.00 38.46  ? 308  TRP B CA  1 
ATOM   4836  C  C   . TRP B  1 308 ? 32.366  137.047 157.015 1.00 44.21  ? 308  TRP B C   1 
ATOM   4837  O  O   . TRP B  1 308 ? 32.852  137.063 158.149 1.00 48.45  ? 308  TRP B O   1 
ATOM   4838  C  CB  . TRP B  1 308 ? 29.973  137.664 156.996 1.00 37.15  ? 308  TRP B CB  1 
ATOM   4839  C  CG  . TRP B  1 308 ? 29.562  136.336 156.417 1.00 34.73  ? 308  TRP B CG  1 
ATOM   4840  C  CD1 . TRP B  1 308 ? 29.011  136.113 155.186 1.00 43.61  ? 308  TRP B CD1 1 
ATOM   4841  C  CD2 . TRP B  1 308 ? 29.640  135.055 157.053 1.00 35.18  ? 308  TRP B CD2 1 
ATOM   4842  N  NE1 . TRP B  1 308 ? 28.739  134.775 155.014 1.00 34.18  ? 308  TRP B NE1 1 
ATOM   4843  C  CE2 . TRP B  1 308 ? 29.118  134.101 156.144 1.00 36.55  ? 308  TRP B CE2 1 
ATOM   4844  C  CE3 . TRP B  1 308 ? 30.078  134.622 158.309 1.00 39.75  ? 308  TRP B CE3 1 
ATOM   4845  C  CZ2 . TRP B  1 308 ? 29.033  132.739 156.447 1.00 33.42  ? 308  TRP B CZ2 1 
ATOM   4846  C  CZ3 . TRP B  1 308 ? 29.995  133.259 158.612 1.00 41.94  ? 308  TRP B CZ3 1 
ATOM   4847  C  CH2 . TRP B  1 308 ? 29.470  132.338 157.687 1.00 34.26  ? 308  TRP B CH2 1 
ATOM   4848  N  N   . ARG B  1 309 ? 32.660  136.096 156.129 1.00 42.66  ? 309  ARG B N   1 
ATOM   4849  C  CA  . ARG B  1 309 ? 33.609  135.057 156.489 1.00 40.28  ? 309  ARG B CA  1 
ATOM   4850  C  C   . ARG B  1 309 ? 34.982  135.639 156.731 1.00 46.18  ? 309  ARG B C   1 
ATOM   4851  O  O   . ARG B  1 309 ? 35.736  135.106 157.550 1.00 50.75  ? 309  ARG B O   1 
ATOM   4852  C  CB  . ARG B  1 309 ? 33.692  134.005 155.401 1.00 41.67  ? 309  ARG B CB  1 
ATOM   4853  C  CG  . ARG B  1 309 ? 32.416  133.323 155.070 1.00 41.81  ? 309  ARG B CG  1 
ATOM   4854  C  CD  . ARG B  1 309 ? 32.651  132.490 153.811 1.00 48.21  ? 309  ARG B CD  1 
ATOM   4855  N  NE  . ARG B  1 309 ? 31.610  131.507 153.724 1.00 57.39  ? 309  ARG B NE  1 
ATOM   4856  C  CZ  . ARG B  1 309 ? 31.798  130.200 153.675 1.00 47.54  ? 309  ARG B CZ  1 
ATOM   4857  N  NH1 . ARG B  1 309 ? 33.013  129.667 153.638 1.00 42.80  ? 309  ARG B NH1 1 
ATOM   4858  N  NH2 . ARG B  1 309 ? 30.731  129.433 153.630 1.00 52.82  ? 309  ARG B NH2 1 
ATOM   4859  N  N   . LYS B  1 310 ? 35.303  136.750 156.053 1.00 56.10  ? 310  LYS B N   1 
ATOM   4860  C  CA  . LYS B  1 310 ? 36.633  137.346 156.125 1.00 62.14  ? 310  LYS B CA  1 
ATOM   4861  C  C   . LYS B  1 310 ? 36.981  137.803 157.532 1.00 60.53  ? 310  LYS B C   1 
ATOM   4862  O  O   . LYS B  1 310 ? 38.166  137.885 157.860 1.00 77.08  ? 310  LYS B O   1 
ATOM   4863  C  CB  . LYS B  1 310 ? 36.784  138.554 155.175 1.00 62.75  ? 310  LYS B CB  1 
ATOM   4864  C  CG  . LYS B  1 310 ? 36.842  138.212 153.700 1.00 63.91  ? 310  LYS B CG  1 
ATOM   4865  C  CD  . LYS B  1 310 ? 37.742  139.190 152.881 1.00 68.26  ? 310  LYS B CD  1 
ATOM   4866  C  CE  . LYS B  1 310 ? 37.763  138.814 151.379 1.00 63.84  ? 310  LYS B CE  1 
ATOM   4867  N  NZ  . LYS B  1 310 ? 38.979  139.314 150.661 1.00 48.50  ? 310  LYS B NZ  1 
ATOM   4868  N  N   . HIS B  1 311 ? 35.993  138.095 158.369 1.00 57.71  ? 311  HIS B N   1 
ATOM   4869  C  CA  . HIS B  1 311 ? 36.234  138.495 159.752 1.00 66.44  ? 311  HIS B CA  1 
ATOM   4870  C  C   . HIS B  1 311 ? 35.477  137.575 160.711 1.00 75.35  ? 311  HIS B C   1 
ATOM   4871  O  O   . HIS B  1 311 ? 34.444  137.947 161.273 1.00 83.20  ? 311  HIS B O   1 
ATOM   4872  C  CB  . HIS B  1 311 ? 35.876  140.006 159.956 1.00 78.73  ? 311  HIS B CB  1 
ATOM   4873  C  CG  . HIS B  1 311 ? 34.714  140.496 159.137 1.00 90.53  ? 311  HIS B CG  1 
ATOM   4874  N  ND1 . HIS B  1 311 ? 33.400  140.345 159.535 1.00 88.44  ? 311  HIS B ND1 1 
ATOM   4875  C  CD2 . HIS B  1 311 ? 34.674  141.177 157.965 1.00 90.46  ? 311  HIS B CD2 1 
ATOM   4876  C  CE1 . HIS B  1 311 ? 32.603  140.895 158.636 1.00 86.78  ? 311  HIS B CE1 1 
ATOM   4877  N  NE2 . HIS B  1 311 ? 33.350  141.405 157.672 1.00 89.21  ? 311  HIS B NE2 1 
ATOM   4878  N  N   . LEU B  1 312 ? 36.011  136.367 160.895 1.00 76.24  ? 312  LEU B N   1 
ATOM   4879  C  CA  . LEU B  1 312 ? 35.585  135.446 161.945 1.00 70.00  ? 312  LEU B CA  1 
ATOM   4880  C  C   . LEU B  1 312 ? 36.728  135.203 162.928 1.00 74.18  ? 312  LEU B C   1 
ATOM   4881  O  O   . LEU B  1 312 ? 37.553  136.091 163.148 1.00 81.42  ? 312  LEU B O   1 
ATOM   4882  C  CB  . LEU B  1 312 ? 35.120  134.118 161.342 1.00 57.35  ? 312  LEU B CB  1 
ATOM   4883  C  CG  . LEU B  1 312 ? 33.745  134.039 160.702 1.00 55.01  ? 312  LEU B CG  1 
ATOM   4884  C  CD1 . LEU B  1 312 ? 33.589  132.714 159.967 1.00 46.41  ? 312  LEU B CD1 1 
ATOM   4885  C  CD2 . LEU B  1 312 ? 32.698  134.154 161.786 1.00 54.93  ? 312  LEU B CD2 1 
ATOM   4886  N  N   . LYS B  1 313 ? 36.787  134.001 163.506 1.00 84.25  ? 313  LYS B N   1 
ATOM   4887  C  CA  . LYS B  1 313 ? 37.830  133.591 164.461 1.00 73.08  ? 313  LYS B CA  1 
ATOM   4888  C  C   . LYS B  1 313 ? 38.013  134.622 165.564 1.00 75.20  ? 313  LYS B C   1 
ATOM   4889  O  O   . LYS B  1 313 ? 37.091  135.374 165.870 1.00 73.18  ? 313  LYS B O   1 
ATOM   4890  C  CB  . LYS B  1 313 ? 39.167  133.338 163.753 1.00 59.50  ? 313  LYS B CB  1 
ATOM   4891  C  CG  . LYS B  1 313 ? 39.388  131.892 163.349 1.00 66.94  ? 313  LYS B CG  1 
ATOM   4892  C  CD  . LYS B  1 313 ? 40.704  131.355 163.920 1.00 71.85  ? 313  LYS B CD  1 
ATOM   4893  C  CE  . LYS B  1 313 ? 41.903  132.144 163.422 1.00 71.48  ? 313  LYS B CE  1 
ATOM   4894  N  NZ  . LYS B  1 313 ? 43.191  131.517 163.867 1.00 75.83  ? 313  LYS B NZ  1 
ATOM   4895  N  N   . GLU C  1 4   ? 1.425   177.959 118.298 1.00 78.24  ? 4    GLU C N   1 
ATOM   4896  C  CA  . GLU C  1 4   ? 1.910   177.095 119.377 1.00 84.43  ? 4    GLU C CA  1 
ATOM   4897  C  C   . GLU C  1 4   ? 3.110   176.251 118.935 1.00 86.66  ? 4    GLU C C   1 
ATOM   4898  O  O   . GLU C  1 4   ? 2.982   175.415 118.027 1.00 83.97  ? 4    GLU C O   1 
ATOM   4899  C  CB  . GLU C  1 4   ? 0.783   176.182 119.874 1.00 84.11  ? 4    GLU C CB  1 
ATOM   4900  C  CG  . GLU C  1 4   ? 1.222   175.016 120.776 1.00 76.97  ? 4    GLU C CG  1 
ATOM   4901  C  CD  . GLU C  1 4   ? 1.235   175.368 122.260 1.00 70.79  ? 4    GLU C CD  1 
ATOM   4902  O  OE1 . GLU C  1 4   ? 2.343   175.436 122.847 1.00 58.30  ? 4    GLU C OE1 1 
ATOM   4903  O  OE2 . GLU C  1 4   ? 0.134   175.564 122.836 1.00 72.17  ? 4    GLU C OE2 1 
ATOM   4904  N  N   . ASN C  1 5   ? 4.276   176.480 119.561 1.00 78.79  ? 5    ASN C N   1 
ATOM   4905  C  CA  . ASN C  1 5   ? 5.427   175.608 119.347 1.00 71.77  ? 5    ASN C CA  1 
ATOM   4906  C  C   . ASN C  1 5   ? 5.656   174.757 120.590 1.00 59.92  ? 5    ASN C C   1 
ATOM   4907  O  O   . ASN C  1 5   ? 6.297   175.212 121.553 1.00 53.79  ? 5    ASN C O   1 
ATOM   4908  C  CB  . ASN C  1 5   ? 6.684   176.403 118.996 1.00 79.10  ? 5    ASN C CB  1 
ATOM   4909  C  CG  . ASN C  1 5   ? 7.555   175.663 117.987 1.00 92.75  ? 5    ASN C CG  1 
ATOM   4910  O  OD1 . ASN C  1 5   ? 7.072   174.770 117.270 1.00 91.00  ? 5    ASN C OD1 1 
ATOM   4911  N  ND2 . ASN C  1 5   ? 8.839   176.021 117.925 1.00 95.55  ? 5    ASN C ND2 1 
ATOM   4912  N  N   . PRO C  1 6   ? 5.147   173.533 120.627 1.00 53.37  ? 6    PRO C N   1 
ATOM   4913  C  CA  . PRO C  1 6   ? 5.223   172.730 121.846 1.00 46.16  ? 6    PRO C CA  1 
ATOM   4914  C  C   . PRO C  1 6   ? 6.545   171.976 121.949 1.00 41.57  ? 6    PRO C C   1 
ATOM   4915  O  O   . PRO C  1 6   ? 7.314   171.876 120.999 1.00 46.61  ? 6    PRO C O   1 
ATOM   4916  C  CB  . PRO C  1 6   ? 4.043   171.765 121.687 1.00 41.79  ? 6    PRO C CB  1 
ATOM   4917  C  CG  . PRO C  1 6   ? 3.924   171.595 120.219 1.00 44.78  ? 6    PRO C CG  1 
ATOM   4918  C  CD  . PRO C  1 6   ? 4.262   172.924 119.616 1.00 42.41  ? 6    PRO C CD  1 
ATOM   4919  N  N   . ILE C  1 7   ? 6.774   171.423 123.123 1.00 39.76  ? 7    ILE C N   1 
ATOM   4920  C  CA  . ILE C  1 7   ? 7.933   170.589 123.401 1.00 37.28  ? 7    ILE C CA  1 
ATOM   4921  C  C   . ILE C  1 7   ? 7.498   169.132 123.330 1.00 36.95  ? 7    ILE C C   1 
ATOM   4922  O  O   . ILE C  1 7   ? 6.403   168.782 123.775 1.00 39.83  ? 7    ILE C O   1 
ATOM   4923  C  CB  . ILE C  1 7   ? 8.502   170.926 124.792 1.00 44.51  ? 7    ILE C CB  1 
ATOM   4924  C  CG1 . ILE C  1 7   ? 8.910   172.394 124.844 1.00 51.95  ? 7    ILE C CG1 1 
ATOM   4925  C  CG2 . ILE C  1 7   ? 9.682   170.048 125.110 1.00 46.05  ? 7    ILE C CG2 1 
ATOM   4926  C  CD1 . ILE C  1 7   ? 9.774   172.785 123.694 1.00 45.42  ? 7    ILE C CD1 1 
ATOM   4927  N  N   . ILE C  1 8   ? 8.358   168.272 122.802 1.00 35.04  ? 8    ILE C N   1 
ATOM   4928  C  CA  . ILE C  1 8   ? 8.047   166.852 122.684 1.00 38.51  ? 8    ILE C CA  1 
ATOM   4929  C  C   . ILE C  1 8   ? 9.062   166.076 123.502 1.00 41.12  ? 8    ILE C C   1 
ATOM   4930  O  O   . ILE C  1 8   ? 10.271  166.161 123.246 1.00 38.24  ? 8    ILE C O   1 
ATOM   4931  C  CB  . ILE C  1 8   ? 8.021   166.386 121.219 1.00 40.34  ? 8    ILE C CB  1 
ATOM   4932  C  CG1 . ILE C  1 8   ? 6.934   167.151 120.442 1.00 37.96  ? 8    ILE C CG1 1 
ATOM   4933  C  CG2 . ILE C  1 8   ? 7.915   164.841 121.124 1.00 36.70  ? 8    ILE C CG2 1 
ATOM   4934  C  CD1 . ILE C  1 8   ? 6.794   166.705 119.009 1.00 39.94  ? 8    ILE C CD1 1 
ATOM   4935  N  N   . ALA C  1 9   ? 8.571   165.341 124.500 1.00 37.38  ? 9    ALA C N   1 
ATOM   4936  C  CA  . ALA C  1 9   ? 9.381   164.376 125.230 1.00 39.45  ? 9    ALA C CA  1 
ATOM   4937  C  C   . ALA C  1 9   ? 9.220   163.000 124.590 1.00 32.87  ? 9    ALA C C   1 
ATOM   4938  O  O   . ALA C  1 9   ? 8.101   162.508 124.426 1.00 36.53  ? 9    ALA C O   1 
ATOM   4939  C  CB  . ALA C  1 9   ? 8.972   164.335 126.705 1.00 32.24  ? 9    ALA C CB  1 
ATOM   4940  N  N   . ILE C  1 10  ? 10.327  162.377 124.228 1.00 32.44  ? 10   ILE C N   1 
ATOM   4941  C  CA  . ILE C  1 10  ? 10.272  161.063 123.602 1.00 35.60  ? 10   ILE C CA  1 
ATOM   4942  C  C   . ILE C  1 10  ? 10.884  160.080 124.587 1.00 37.81  ? 10   ILE C C   1 
ATOM   4943  O  O   . ILE C  1 10  ? 12.107  160.025 124.760 1.00 37.09  ? 10   ILE C O   1 
ATOM   4944  C  CB  . ILE C  1 10  ? 10.980  161.032 122.240 1.00 36.79  ? 10   ILE C CB  1 
ATOM   4945  C  CG1 . ILE C  1 10  ? 10.341  162.052 121.290 1.00 36.09  ? 10   ILE C CG1 1 
ATOM   4946  C  CG2 . ILE C  1 10  ? 10.925  159.630 121.628 1.00 36.01  ? 10   ILE C CG2 1 
ATOM   4947  C  CD1 . ILE C  1 10  ? 10.988  162.114 119.916 1.00 39.13  ? 10   ILE C CD1 1 
ATOM   4948  N  N   . ASN C  1 11  ? 10.025  159.304 125.240 1.00 36.97  ? 11   ASN C N   1 
ATOM   4949  C  CA  . ASN C  1 11  ? 10.483  158.233 126.113 1.00 35.34  ? 11   ASN C CA  1 
ATOM   4950  C  C   . ASN C  1 11  ? 10.901  157.073 125.224 1.00 38.14  ? 11   ASN C C   1 
ATOM   4951  O  O   . ASN C  1 11  ? 10.069  156.503 124.513 1.00 39.02  ? 11   ASN C O   1 
ATOM   4952  C  CB  . ASN C  1 11  ? 9.381   157.822 127.080 1.00 36.15  ? 11   ASN C CB  1 
ATOM   4953  C  CG  . ASN C  1 11  ? 9.875   156.908 128.160 1.00 44.96  ? 11   ASN C CG  1 
ATOM   4954  O  OD1 . ASN C  1 11  ? 10.141  155.728 127.918 1.00 48.03  ? 11   ASN C OD1 1 
ATOM   4955  N  ND2 . ASN C  1 11  ? 9.983   157.436 129.373 1.00 56.96  ? 11   ASN C ND2 1 
ATOM   4956  N  N   . MET C  1 12  ? 12.194  156.761 125.215 1.00 36.50  ? 12   MET C N   1 
ATOM   4957  C  CA  . MET C  1 12  ? 12.751  155.745 124.330 1.00 34.31  ? 12   MET C CA  1 
ATOM   4958  C  C   . MET C  1 12  ? 13.121  154.521 125.149 1.00 38.54  ? 12   MET C C   1 
ATOM   4959  O  O   . MET C  1 12  ? 13.893  154.618 126.111 1.00 38.41  ? 12   MET C O   1 
ATOM   4960  C  CB  . MET C  1 12  ? 13.973  156.263 123.580 1.00 36.04  ? 12   MET C CB  1 
ATOM   4961  C  CG  . MET C  1 12  ? 13.714  157.532 122.782 1.00 33.84  ? 12   MET C CG  1 
ATOM   4962  S  SD  . MET C  1 12  ? 15.305  158.144 122.255 1.00 43.28  ? 12   MET C SD  1 
ATOM   4963  C  CE  . MET C  1 12  ? 14.843  159.488 121.172 1.00 46.24  ? 12   MET C CE  1 
ATOM   4964  N  N   . ALA C  1 13  ? 12.580  153.376 124.757 1.00 34.62  ? 13   ALA C N   1 
ATOM   4965  C  CA  . ALA C  1 13  ? 12.899  152.118 125.405 1.00 37.40  ? 13   ALA C CA  1 
ATOM   4966  C  C   . ALA C  1 13  ? 13.021  151.039 124.344 1.00 42.06  ? 13   ALA C C   1 
ATOM   4967  O  O   . ALA C  1 13  ? 12.515  151.175 123.228 1.00 40.78  ? 13   ALA C O   1 
ATOM   4968  C  CB  . ALA C  1 13  ? 11.827  151.728 126.433 1.00 33.63  ? 13   ALA C CB  1 
ATOM   4969  N  N   . LYS C  1 14  ? 13.711  149.966 124.706 1.00 39.18  ? 14   LYS C N   1 
ATOM   4970  C  CA  . LYS C  1 14  ? 13.765  148.750 123.906 1.00 41.16  ? 14   LYS C CA  1 
ATOM   4971  C  C   . LYS C  1 14  ? 13.183  147.622 124.746 1.00 33.58  ? 14   LYS C C   1 
ATOM   4972  O  O   . LYS C  1 14  ? 13.628  147.392 125.873 1.00 42.26  ? 14   LYS C O   1 
ATOM   4973  C  CB  . LYS C  1 14  ? 15.194  148.452 123.443 1.00 40.98  ? 14   LYS C CB  1 
ATOM   4974  C  CG  . LYS C  1 14  ? 15.724  149.431 122.401 1.00 42.46  ? 14   LYS C CG  1 
ATOM   4975  C  CD  . LYS C  1 14  ? 17.130  149.056 121.950 1.00 56.06  ? 14   LYS C CD  1 
ATOM   4976  C  CE  . LYS C  1 14  ? 17.580  149.862 120.737 1.00 66.11  ? 14   LYS C CE  1 
ATOM   4977  N  NZ  . LYS C  1 14  ? 16.700  149.572 119.539 1.00 72.06  ? 14   LYS C NZ  1 
ATOM   4978  N  N   . ILE C  1 15  ? 12.163  146.949 124.215 1.00 39.86  ? 15   ILE C N   1 
ATOM   4979  C  CA  . ILE C  1 15  ? 11.381  145.996 124.992 1.00 35.55  ? 15   ILE C CA  1 
ATOM   4980  C  C   . ILE C  1 15  ? 11.448  144.614 124.361 1.00 37.94  ? 15   ILE C C   1 
ATOM   4981  O  O   . ILE C  1 15  ? 11.698  144.448 123.164 1.00 37.88  ? 15   ILE C O   1 
ATOM   4982  C  CB  . ILE C  1 15  ? 9.915   146.431 125.139 1.00 36.63  ? 15   ILE C CB  1 
ATOM   4983  C  CG1 . ILE C  1 15  ? 9.238   146.410 123.778 1.00 38.02  ? 15   ILE C CG1 1 
ATOM   4984  C  CG2 . ILE C  1 15  ? 9.834   147.815 125.797 1.00 37.18  ? 15   ILE C CG2 1 
ATOM   4985  C  CD1 . ILE C  1 15  ? 7.762   146.784 123.816 1.00 42.25  ? 15   ILE C CD1 1 
ATOM   4986  N  N   . ALA C  1 16  ? 11.182  143.613 125.192 1.00 36.81  ? 16   ALA C N   1 
ATOM   4987  C  CA  . ALA C  1 16  ? 11.196  142.233 124.730 1.00 36.47  ? 16   ALA C CA  1 
ATOM   4988  C  C   . ALA C  1 16  ? 10.077  142.006 123.720 1.00 39.88  ? 16   ALA C C   1 
ATOM   4989  O  O   . ALA C  1 16  ? 8.944   142.438 123.923 1.00 41.32  ? 16   ALA C O   1 
ATOM   4990  C  CB  . ALA C  1 16  ? 11.046  141.278 125.917 1.00 34.90  ? 16   ALA C CB  1 
ATOM   4991  N  N   . ASN C  1 17  ? 10.396  141.334 122.624 1.00 40.38  ? 17   ASN C N   1 
ATOM   4992  C  CA  . ASN C  1 17  ? 9.416   141.071 121.578 1.00 43.23  ? 17   ASN C CA  1 
ATOM   4993  C  C   . ASN C  1 17  ? 8.823   139.703 121.854 1.00 43.36  ? 17   ASN C C   1 
ATOM   4994  O  O   . ASN C  1 17  ? 9.305   138.689 121.365 1.00 52.30  ? 17   ASN C O   1 
ATOM   4995  C  CB  . ASN C  1 17  ? 10.064  141.137 120.206 1.00 47.43  ? 17   ASN C CB  1 
ATOM   4996  C  CG  . ASN C  1 17  ? 9.062   140.995 119.087 1.00 42.43  ? 17   ASN C CG  1 
ATOM   4997  O  OD1 . ASN C  1 17  ? 7.861   140.868 119.320 1.00 45.01  ? 17   ASN C OD1 1 
ATOM   4998  N  ND2 . ASN C  1 17  ? 9.549   141.046 117.860 1.00 40.62  ? 17   ASN C ND2 1 
ATOM   4999  N  N   . LYS C  1 18  ? 7.793   139.670 122.683 1.00 45.93  ? 18   LYS C N   1 
ATOM   5000  C  CA  . LYS C  1 18  ? 7.151   138.420 123.050 1.00 56.62  ? 18   LYS C CA  1 
ATOM   5001  C  C   . LYS C  1 18  ? 5.722   138.735 123.454 1.00 54.05  ? 18   LYS C C   1 
ATOM   5002  O  O   . LYS C  1 18  ? 5.417   139.880 123.811 1.00 53.50  ? 18   LYS C O   1 
ATOM   5003  C  CB  . LYS C  1 18  ? 7.921   137.722 124.182 1.00 65.73  ? 18   LYS C CB  1 
ATOM   5004  C  CG  . LYS C  1 18  ? 8.052   138.575 125.434 1.00 78.90  ? 18   LYS C CG  1 
ATOM   5005  C  CD  . LYS C  1 18  ? 8.896   137.906 126.511 1.00 87.82  ? 18   LYS C CD  1 
ATOM   5006  C  CE  . LYS C  1 18  ? 8.191   136.687 127.071 1.00 92.95  ? 18   LYS C CE  1 
ATOM   5007  N  NZ  . LYS C  1 18  ? 8.917   136.106 128.224 1.00 97.63  ? 18   LYS C NZ  1 
ATOM   5008  N  N   . PRO C  1 19  ? 4.820   137.751 123.404 1.00 53.77  ? 19   PRO C N   1 
ATOM   5009  C  CA  . PRO C  1 19  ? 3.398   138.042 123.690 1.00 59.72  ? 19   PRO C CA  1 
ATOM   5010  C  C   . PRO C  1 19  ? 3.150   138.756 125.016 1.00 63.36  ? 19   PRO C C   1 
ATOM   5011  O  O   . PRO C  1 19  ? 2.241   139.592 125.103 1.00 53.70  ? 19   PRO C O   1 
ATOM   5012  C  CB  . PRO C  1 19  ? 2.753   136.648 123.664 1.00 60.19  ? 19   PRO C CB  1 
ATOM   5013  C  CG  . PRO C  1 19  ? 3.624   135.856 122.704 1.00 55.21  ? 19   PRO C CG  1 
ATOM   5014  C  CD  . PRO C  1 19  ? 5.026   136.361 122.946 1.00 58.31  ? 19   PRO C CD  1 
ATOM   5015  N  N   . ASP C  1 20  ? 3.935   138.454 126.053 1.00 74.65  ? 20   ASP C N   1 
ATOM   5016  C  CA  . ASP C  1 20  ? 3.742   139.103 127.348 1.00 78.70  ? 20   ASP C CA  1 
ATOM   5017  C  C   . ASP C  1 20  ? 3.885   140.624 127.253 1.00 71.10  ? 20   ASP C C   1 
ATOM   5018  O  O   . ASP C  1 20  ? 3.188   141.362 127.961 1.00 68.21  ? 20   ASP C O   1 
ATOM   5019  C  CB  . ASP C  1 20  ? 4.727   138.528 128.367 1.00 90.99  ? 20   ASP C CB  1 
ATOM   5020  C  CG  . ASP C  1 20  ? 4.585   137.022 128.525 1.00 104.05 ? 20   ASP C CG  1 
ATOM   5021  O  OD1 . ASP C  1 20  ? 5.162   136.274 127.702 1.00 106.50 ? 20   ASP C OD1 1 
ATOM   5022  O  OD2 . ASP C  1 20  ? 3.889   136.585 129.467 1.00 106.31 ? 20   ASP C OD2 1 
ATOM   5023  N  N   . SER C  1 21  ? 4.787   141.117 126.397 1.00 63.71  ? 21   SER C N   1 
ATOM   5024  C  CA  . SER C  1 21  ? 4.996   142.565 126.304 1.00 61.30  ? 21   SER C CA  1 
ATOM   5025  C  C   . SER C  1 21  ? 3.795   143.280 125.696 1.00 57.37  ? 21   SER C C   1 
ATOM   5026  O  O   . SER C  1 21  ? 3.421   144.370 126.152 1.00 56.88  ? 21   SER C O   1 
ATOM   5027  C  CB  . SER C  1 21  ? 6.259   142.873 125.500 1.00 59.48  ? 21   SER C CB  1 
ATOM   5028  O  OG  . SER C  1 21  ? 7.406   142.357 126.143 1.00 60.95  ? 21   SER C OG  1 
ATOM   5029  N  N   . TYR C  1 22  ? 3.187   142.698 124.656 1.00 51.89  ? 22   TYR C N   1 
ATOM   5030  C  CA  . TYR C  1 22  ? 1.983   143.295 124.095 1.00 53.37  ? 22   TYR C CA  1 
ATOM   5031  C  C   . TYR C  1 22  ? 0.866   143.317 125.117 1.00 59.19  ? 22   TYR C C   1 
ATOM   5032  O  O   . TYR C  1 22  ? 0.070   144.261 125.144 1.00 58.75  ? 22   TYR C O   1 
ATOM   5033  C  CB  . TYR C  1 22  ? 1.561   142.537 122.831 1.00 58.17  ? 22   TYR C CB  1 
ATOM   5034  C  CG  . TYR C  1 22  ? 2.612   142.587 121.739 1.00 67.09  ? 22   TYR C CG  1 
ATOM   5035  C  CD1 . TYR C  1 22  ? 2.709   143.678 120.882 1.00 66.09  ? 22   TYR C CD1 1 
ATOM   5036  C  CD2 . TYR C  1 22  ? 3.524   141.538 121.575 1.00 68.06  ? 22   TYR C CD2 1 
ATOM   5037  C  CE1 . TYR C  1 22  ? 3.682   143.724 119.885 1.00 64.09  ? 22   TYR C CE1 1 
ATOM   5038  C  CE2 . TYR C  1 22  ? 4.499   141.578 120.580 1.00 64.65  ? 22   TYR C CE2 1 
ATOM   5039  C  CZ  . TYR C  1 22  ? 4.576   142.673 119.740 1.00 64.65  ? 22   TYR C CZ  1 
ATOM   5040  O  OH  . TYR C  1 22  ? 5.544   142.706 118.754 1.00 64.50  ? 22   TYR C OH  1 
ATOM   5041  N  N   . GLU C  1 23  ? 0.831   142.306 125.985 1.00 66.25  ? 23   GLU C N   1 
ATOM   5042  C  CA  . GLU C  1 23  ? -0.167  142.238 127.043 1.00 74.90  ? 23   GLU C CA  1 
ATOM   5043  C  C   . GLU C  1 23  ? -0.039  143.410 128.006 1.00 72.07  ? 23   GLU C C   1 
ATOM   5044  O  O   . GLU C  1 23  ? -1.008  144.144 128.244 1.00 72.35  ? 23   GLU C O   1 
ATOM   5045  C  CB  . GLU C  1 23  ? -0.007  140.914 127.800 1.00 87.74  ? 23   GLU C CB  1 
ATOM   5046  C  CG  . GLU C  1 23  ? -1.044  140.669 128.873 1.00 107.20 ? 23   GLU C CG  1 
ATOM   5047  C  CD  . GLU C  1 23  ? -2.438  140.535 128.322 1.00 122.54 ? 23   GLU C CD  1 
ATOM   5048  O  OE1 . GLU C  1 23  ? -2.563  140.084 127.168 1.00 128.06 ? 23   GLU C OE1 1 
ATOM   5049  O  OE2 . GLU C  1 23  ? -3.398  140.902 129.033 1.00 126.78 ? 23   GLU C OE2 1 
ATOM   5050  N  N   . THR C  1 24  ? 1.163   143.632 128.539 1.00 67.85  ? 24   THR C N   1 
ATOM   5051  C  CA  . THR C  1 24  ? 1.333   144.736 129.470 1.00 66.09  ? 24   THR C CA  1 
ATOM   5052  C  C   . THR C  1 24  ? 1.238   146.096 128.776 1.00 60.36  ? 24   THR C C   1 
ATOM   5053  O  O   . THR C  1 24  ? 0.884   147.083 129.429 1.00 54.27  ? 24   THR C O   1 
ATOM   5054  C  CB  . THR C  1 24  ? 2.666   144.603 130.235 1.00 70.86  ? 24   THR C CB  1 
ATOM   5055  O  OG1 . THR C  1 24  ? 3.749   145.067 129.432 1.00 80.11  ? 24   THR C OG1 1 
ATOM   5056  C  CG2 . THR C  1 24  ? 2.918   143.139 130.630 1.00 68.23  ? 24   THR C CG2 1 
ATOM   5057  N  N   . MET C  1 25  ? 1.503   146.181 127.466 1.00 60.82  ? 25   MET C N   1 
ATOM   5058  C  CA  . MET C  1 25  ? 1.339   147.471 126.803 1.00 68.15  ? 25   MET C CA  1 
ATOM   5059  C  C   . MET C  1 25  ? -0.124  147.891 126.713 1.00 80.85  ? 25   MET C C   1 
ATOM   5060  O  O   . MET C  1 25  ? -0.419  149.086 126.818 1.00 82.12  ? 25   MET C O   1 
ATOM   5061  C  CB  . MET C  1 25  ? 1.959   147.460 125.404 1.00 63.77  ? 25   MET C CB  1 
ATOM   5062  C  CG  . MET C  1 25  ? 3.432   147.844 125.359 1.00 65.94  ? 25   MET C CG  1 
ATOM   5063  S  SD  . MET C  1 25  ? 3.989   148.174 123.668 1.00 69.16  ? 25   MET C SD  1 
ATOM   5064  C  CE  . MET C  1 25  ? 3.568   146.608 122.893 1.00 70.20  ? 25   MET C CE  1 
ATOM   5065  N  N   . MET C  1 26  ? -1.058  146.946 126.544 1.00 88.20  ? 26   MET C N   1 
ATOM   5066  C  CA  . MET C  1 26  ? -2.459  147.358 126.514 1.00 95.68  ? 26   MET C CA  1 
ATOM   5067  C  C   . MET C  1 26  ? -3.053  147.498 127.912 1.00 94.50  ? 26   MET C C   1 
ATOM   5068  O  O   . MET C  1 26  ? -4.065  148.191 128.074 1.00 95.24  ? 26   MET C O   1 
ATOM   5069  C  CB  . MET C  1 26  ? -3.345  146.389 125.719 1.00 105.15 ? 26   MET C CB  1 
ATOM   5070  C  CG  . MET C  1 26  ? -3.435  144.980 126.287 1.00 117.02 ? 26   MET C CG  1 
ATOM   5071  S  SD  . MET C  1 26  ? -4.115  143.762 125.134 1.00 125.08 ? 26   MET C SD  1 
ATOM   5072  C  CE  . MET C  1 26  ? -5.872  144.090 125.297 1.00 120.49 ? 26   MET C CE  1 
ATOM   5073  N  N   . LYS C  1 27  ? -2.446  146.873 128.920 1.00 91.29  ? 27   LYS C N   1 
ATOM   5074  C  CA  . LYS C  1 27  ? -2.971  146.935 130.278 1.00 88.72  ? 27   LYS C CA  1 
ATOM   5075  C  C   . LYS C  1 27  ? -2.406  148.107 131.069 1.00 83.08  ? 27   LYS C C   1 
ATOM   5076  O  O   . LYS C  1 27  ? -3.145  148.754 131.822 1.00 79.52  ? 27   LYS C O   1 
ATOM   5077  C  CB  . LYS C  1 27  ? -2.673  145.627 131.023 1.00 93.26  ? 27   LYS C CB  1 
ATOM   5078  C  CG  . LYS C  1 27  ? -3.031  145.667 132.509 1.00 99.68  ? 27   LYS C CG  1 
ATOM   5079  C  CD  . LYS C  1 27  ? -3.644  144.345 132.969 1.00 103.09 ? 27   LYS C CD  1 
ATOM   5080  C  CE  . LYS C  1 27  ? -3.672  144.209 134.494 1.00 103.94 ? 27   LYS C CE  1 
ATOM   5081  N  NZ  . LYS C  1 27  ? -2.615  144.988 135.204 1.00 103.61 ? 27   LYS C NZ  1 
ATOM   5082  N  N   . VAL C  1 28  ? -1.122  148.408 130.893 1.00 76.97  ? 28   VAL C N   1 
ATOM   5083  C  CA  . VAL C  1 28  ? -0.443  149.434 131.673 1.00 69.09  ? 28   VAL C CA  1 
ATOM   5084  C  C   . VAL C  1 28  ? -0.346  150.748 130.907 1.00 67.17  ? 28   VAL C C   1 
ATOM   5085  O  O   . VAL C  1 28  ? -0.493  151.820 131.495 1.00 63.88  ? 28   VAL C O   1 
ATOM   5086  C  CB  . VAL C  1 28  ? 0.955   148.927 132.099 1.00 61.88  ? 28   VAL C CB  1 
ATOM   5087  C  CG1 . VAL C  1 28  ? 1.708   149.986 132.879 1.00 57.78  ? 28   VAL C CG1 1 
ATOM   5088  C  CG2 . VAL C  1 28  ? 0.839   147.638 132.915 1.00 63.37  ? 28   VAL C CG2 1 
ATOM   5089  N  N   . GLY C  1 29  ? -0.135  150.672 129.593 1.00 64.49  ? 29   GLY C N   1 
ATOM   5090  C  CA  . GLY C  1 29  ? -0.023  151.832 128.736 1.00 71.28  ? 29   GLY C CA  1 
ATOM   5091  C  C   . GLY C  1 29  ? -1.114  152.876 128.913 1.00 78.01  ? 29   GLY C C   1 
ATOM   5092  O  O   . GLY C  1 29  ? -0.835  154.058 129.153 1.00 73.67  ? 29   GLY C O   1 
ATOM   5093  N  N   . PRO C  1 30  ? -2.384  152.465 128.781 1.00 80.77  ? 30   PRO C N   1 
ATOM   5094  C  CA  . PRO C  1 30  ? -3.481  153.427 128.997 1.00 74.43  ? 30   PRO C CA  1 
ATOM   5095  C  C   . PRO C  1 30  ? -3.420  154.123 130.347 1.00 61.28  ? 30   PRO C C   1 
ATOM   5096  O  O   . PRO C  1 30  ? -3.729  155.319 130.442 1.00 59.65  ? 30   PRO C O   1 
ATOM   5097  C  CB  . PRO C  1 30  ? -4.738  152.550 128.872 1.00 75.57  ? 30   PRO C CB  1 
ATOM   5098  C  CG  . PRO C  1 30  ? -4.317  151.401 128.035 1.00 75.76  ? 30   PRO C CG  1 
ATOM   5099  C  CD  . PRO C  1 30  ? -2.885  151.143 128.359 1.00 77.99  ? 30   PRO C CD  1 
ATOM   5100  N  N   . LYS C  1 31  ? -3.011  153.405 131.394 1.00 51.26  ? 31   LYS C N   1 
ATOM   5101  C  CA  . LYS C  1 31  ? -2.990  153.982 132.732 1.00 47.81  ? 31   LYS C CA  1 
ATOM   5102  C  C   . LYS C  1 31  ? -1.948  155.090 132.846 1.00 50.12  ? 31   LYS C C   1 
ATOM   5103  O  O   . LYS C  1 31  ? -2.170  156.086 133.544 1.00 48.05  ? 31   LYS C O   1 
ATOM   5104  C  CB  . LYS C  1 31  ? -2.733  152.883 133.762 1.00 46.04  ? 31   LYS C CB  1 
ATOM   5105  C  CG  . LYS C  1 31  ? -3.818  151.821 133.816 1.00 41.82  ? 31   LYS C CG  1 
ATOM   5106  C  CD  . LYS C  1 31  ? -3.602  150.893 134.987 1.00 46.82  ? 31   LYS C CD  1 
ATOM   5107  C  CE  . LYS C  1 31  ? -4.897  150.257 135.387 1.00 56.00  ? 31   LYS C CE  1 
ATOM   5108  N  NZ  . LYS C  1 31  ? -5.346  149.459 134.236 1.00 62.16  ? 31   LYS C NZ  1 
ATOM   5109  N  N   . VAL C  1 32  ? -0.807  154.934 132.174 1.00 45.59  ? 32   VAL C N   1 
ATOM   5110  C  CA  . VAL C  1 32  ? 0.228   155.964 132.174 1.00 46.66  ? 32   VAL C CA  1 
ATOM   5111  C  C   . VAL C  1 32  ? -0.272  157.222 131.466 1.00 51.36  ? 32   VAL C C   1 
ATOM   5112  O  O   . VAL C  1 32  ? -0.042  158.344 131.935 1.00 46.48  ? 32   VAL C O   1 
ATOM   5113  C  CB  . VAL C  1 32  ? 1.533   155.465 131.519 1.00 45.65  ? 32   VAL C CB  1 
ATOM   5114  C  CG1 . VAL C  1 32  ? 2.520   156.602 131.413 1.00 48.11  ? 32   VAL C CG1 1 
ATOM   5115  C  CG2 . VAL C  1 32  ? 2.146   154.341 132.335 1.00 48.55  ? 32   VAL C CG2 1 
HETATM 5116  N  N   . CSS C  1 33  ? -0.962  157.037 130.342 1.00 49.63  ? 33   CSS C N   1 
HETATM 5117  C  CA  . CSS C  1 33  ? -1.473  158.161 129.599 1.00 54.18  ? 33   CSS C CA  1 
HETATM 5118  C  CB  . CSS C  1 33  ? -1.973  157.723 128.246 1.00 62.95  ? 33   CSS C CB  1 
HETATM 5119  S  SG  . CSS C  1 33  ? -0.639  157.171 127.195 1.00 70.57  ? 33   CSS C SG  1 
HETATM 5120  S  SD  . CSS C  1 33  ? 0.835   158.555 127.287 0.50 66.15  ? 33   CSS C SD  1 
HETATM 5121  C  C   . CSS C  1 33  ? -2.544  158.851 130.404 1.00 53.48  ? 33   CSS C C   1 
HETATM 5122  O  O   . CSS C  1 33  ? -2.628  160.110 130.367 1.00 53.94  ? 33   CSS C O   1 
ATOM   5123  N  N   . ILE C  1 34  ? -3.365  158.101 131.142 1.00 48.46  ? 34   ILE C N   1 
ATOM   5124  C  CA  . ILE C  1 34  ? -4.406  158.730 131.952 1.00 49.19  ? 34   ILE C CA  1 
ATOM   5125  C  C   . ILE C  1 34  ? -3.790  159.616 133.028 1.00 43.52  ? 34   ILE C C   1 
ATOM   5126  O  O   . ILE C  1 34  ? -4.252  160.726 133.280 1.00 40.43  ? 34   ILE C O   1 
ATOM   5127  C  CB  . ILE C  1 34  ? -5.340  157.681 132.583 1.00 47.61  ? 34   ILE C CB  1 
ATOM   5128  C  CG1 . ILE C  1 34  ? -6.175  157.001 131.500 1.00 45.58  ? 34   ILE C CG1 1 
ATOM   5129  C  CG2 . ILE C  1 34  ? -6.229  158.314 133.665 1.00 39.43  ? 34   ILE C CG2 1 
ATOM   5130  C  CD1 . ILE C  1 34  ? -7.002  155.827 132.025 1.00 46.28  ? 34   ILE C CD1 1 
ATOM   5131  N  N   . THR C  1 35  ? -2.732  159.098 133.651 1.00 41.72  ? 35   THR C N   1 
ATOM   5132  C  CA  . THR C  1 35  ? -1.996  159.863 134.651 1.00 53.16  ? 35   THR C CA  1 
ATOM   5133  C  C   . THR C  1 35  ? -1.416  161.140 134.047 1.00 48.75  ? 35   THR C C   1 
ATOM   5134  O  O   . THR C  1 35  ? -1.527  162.227 134.630 1.00 48.23  ? 35   THR C O   1 
ATOM   5135  C  CB  . THR C  1 35  ? -0.884  158.990 135.236 1.00 51.85  ? 35   THR C CB  1 
ATOM   5136  O  OG1 . THR C  1 35  ? -1.445  157.781 135.778 1.00 43.30  ? 35   THR C OG1 1 
ATOM   5137  C  CG2 . THR C  1 35  ? -0.178  159.733 136.323 1.00 49.31  ? 35   THR C CG2 1 
ATOM   5138  N  N   . THR C  1 36  ? -0.820  161.022 132.860 1.00 51.45  ? 36   THR C N   1 
ATOM   5139  C  CA  . THR C  1 36  ? -0.201  162.161 132.194 1.00 51.90  ? 36   THR C CA  1 
ATOM   5140  C  C   . THR C  1 36  ? -1.217  163.261 131.918 1.00 49.45  ? 36   THR C C   1 
ATOM   5141  O  O   . THR C  1 36  ? -0.952  164.441 132.175 1.00 45.15  ? 36   THR C O   1 
ATOM   5142  C  CB  . THR C  1 36  ? 0.436   161.677 130.892 1.00 54.78  ? 36   THR C CB  1 
ATOM   5143  O  OG1 . THR C  1 36  ? 1.324   160.589 131.181 1.00 60.53  ? 36   THR C OG1 1 
ATOM   5144  C  CG2 . THR C  1 36  ? 1.209   162.771 130.236 1.00 49.24  ? 36   THR C CG2 1 
ATOM   5145  N  N   . ALA C  1 37  ? -2.414  162.883 131.442 1.00 45.72  ? 37   ALA C N   1 
ATOM   5146  C  CA  . ALA C  1 37  ? -3.448  163.845 131.058 1.00 46.95  ? 37   ALA C CA  1 
ATOM   5147  C  C   . ALA C  1 37  ? -4.114  164.485 132.238 1.00 47.36  ? 37   ALA C C   1 
ATOM   5148  O  O   . ALA C  1 37  ? -5.076  165.224 132.033 1.00 45.63  ? 37   ALA C O   1 
ATOM   5149  C  CB  . ALA C  1 37  ? -4.501  163.181 130.165 1.00 46.69  ? 37   ALA C CB  1 
ATOM   5150  N  N   . SER C  1 38  ? -3.683  164.242 133.477 1.00 46.20  ? 38   SER C N   1 
ATOM   5151  C  CA  . SER C  1 38  ? -4.194  165.049 134.577 1.00 50.38  ? 38   SER C CA  1 
ATOM   5152  C  C   . SER C  1 38  ? -3.615  166.460 134.564 1.00 48.05  ? 38   SER C C   1 
ATOM   5153  O  O   . SER C  1 38  ? -4.115  167.330 135.289 1.00 46.11  ? 38   SER C O   1 
ATOM   5154  C  CB  . SER C  1 38  ? -3.875  164.380 135.912 1.00 41.03  ? 38   SER C CB  1 
ATOM   5155  O  OG  . SER C  1 38  ? -2.472  164.322 136.107 1.00 48.17  ? 38   SER C OG  1 
ATOM   5156  N  N   . HIS C  1 39  ? -2.563  166.711 133.739 1.00 43.06  ? 39   HIS C N   1 
ATOM   5157  C  CA  . HIS C  1 39  ? -1.864  167.987 133.802 1.00 41.51  ? 39   HIS C CA  1 
ATOM   5158  C  C   . HIS C  1 39  ? -2.338  168.914 132.690 1.00 40.81  ? 39   HIS C C   1 
ATOM   5159  O  O   . HIS C  1 39  ? -2.418  168.495 131.524 1.00 40.49  ? 39   HIS C O   1 
ATOM   5160  C  CB  . HIS C  1 39  ? -0.360  167.786 133.689 1.00 42.52  ? 39   HIS C CB  1 
ATOM   5161  C  CG  . HIS C  1 39  ? 0.416   168.989 134.102 1.00 45.99  ? 39   HIS C CG  1 
ATOM   5162  N  ND1 . HIS C  1 39  ? 0.486   170.132 133.329 1.00 42.79  ? 39   HIS C ND1 1 
ATOM   5163  C  CD2 . HIS C  1 39  ? 1.131   169.246 135.221 1.00 43.81  ? 39   HIS C CD2 1 
ATOM   5164  C  CE1 . HIS C  1 39  ? 1.214   171.039 133.954 1.00 43.38  ? 39   HIS C CE1 1 
ATOM   5165  N  NE2 . HIS C  1 39  ? 1.623   170.526 135.101 1.00 47.06  ? 39   HIS C NE2 1 
ATOM   5166  N  N   . PRO C  1 40  ? -2.640  170.178 133.001 1.00 40.59  ? 40   PRO C N   1 
ATOM   5167  C  CA  . PRO C  1 40  ? -3.172  171.084 131.966 1.00 39.88  ? 40   PRO C CA  1 
ATOM   5168  C  C   . PRO C  1 40  ? -2.174  171.422 130.866 1.00 40.23  ? 40   PRO C C   1 
ATOM   5169  O  O   . PRO C  1 40  ? -2.591  171.885 129.798 1.00 46.13  ? 40   PRO C O   1 
ATOM   5170  C  CB  . PRO C  1 40  ? -3.552  172.341 132.758 1.00 50.35  ? 40   PRO C CB  1 
ATOM   5171  C  CG  . PRO C  1 40  ? -2.673  172.287 133.990 1.00 54.10  ? 40   PRO C CG  1 
ATOM   5172  C  CD  . PRO C  1 40  ? -2.546  170.816 134.322 1.00 40.95  ? 40   PRO C CD  1 
ATOM   5173  N  N   . GLY C  1 41  ? -0.880  171.199 131.070 1.00 41.18  ? 41   GLY C N   1 
ATOM   5174  C  CA  . GLY C  1 41  ? 0.044   171.445 129.984 1.00 41.50  ? 41   GLY C CA  1 
ATOM   5175  C  C   . GLY C  1 41  ? 0.166   170.321 128.983 1.00 41.42  ? 41   GLY C C   1 
ATOM   5176  O  O   . GLY C  1 41  ? 0.890   170.449 127.994 1.00 46.72  ? 41   GLY C O   1 
ATOM   5177  N  N   . PHE C  1 42  ? -0.551  169.227 129.202 1.00 41.09  ? 42   PHE C N   1 
ATOM   5178  C  CA  . PHE C  1 42  ? -0.426  168.054 128.350 1.00 41.28  ? 42   PHE C CA  1 
ATOM   5179  C  C   . PHE C  1 42  ? -1.262  168.216 127.088 1.00 40.15  ? 42   PHE C C   1 
ATOM   5180  O  O   . PHE C  1 42  ? -2.469  168.432 127.158 1.00 39.33  ? 42   PHE C O   1 
ATOM   5181  C  CB  . PHE C  1 42  ? -0.853  166.812 129.123 1.00 41.08  ? 42   PHE C CB  1 
ATOM   5182  C  CG  . PHE C  1 42  ? -0.902  165.590 128.299 1.00 40.95  ? 42   PHE C CG  1 
ATOM   5183  C  CD1 . PHE C  1 42  ? 0.265   165.030 127.801 1.00 45.16  ? 42   PHE C CD1 1 
ATOM   5184  C  CD2 . PHE C  1 42  ? -2.111  164.998 128.002 1.00 40.10  ? 42   PHE C CD2 1 
ATOM   5185  C  CE1 . PHE C  1 42  ? 0.229   163.885 127.028 1.00 44.86  ? 42   PHE C CE1 1 
ATOM   5186  C  CE2 . PHE C  1 42  ? -2.163  163.851 127.221 1.00 43.74  ? 42   PHE C CE2 1 
ATOM   5187  C  CZ  . PHE C  1 42  ? -0.990  163.292 126.738 1.00 45.91  ? 42   PHE C CZ  1 
ATOM   5188  N  N   . LEU C  1 43  ? -0.623  168.066 125.933 1.00 40.31  ? 43   LEU C N   1 
ATOM   5189  C  CA  . LEU C  1 43  ? -1.263  168.367 124.662 1.00 39.52  ? 43   LEU C CA  1 
ATOM   5190  C  C   . LEU C  1 43  ? -1.578  167.150 123.805 1.00 39.21  ? 43   LEU C C   1 
ATOM   5191  O  O   . LEU C  1 43  ? -2.434  167.257 122.924 1.00 45.34  ? 43   LEU C O   1 
ATOM   5192  C  CB  . LEU C  1 43  ? -0.381  169.322 123.844 1.00 39.83  ? 43   LEU C CB  1 
ATOM   5193  C  CG  . LEU C  1 43  ? -0.017  170.590 124.610 1.00 40.16  ? 43   LEU C CG  1 
ATOM   5194  C  CD1 . LEU C  1 43  ? 0.896   171.480 123.797 1.00 40.50  ? 43   LEU C CD1 1 
ATOM   5195  C  CD2 . LEU C  1 43  ? -1.284  171.326 125.024 1.00 39.34  ? 43   LEU C CD2 1 
ATOM   5196  N  N   . GLY C  1 44  ? -0.945  166.007 124.044 1.00 39.81  ? 44   GLY C N   1 
ATOM   5197  C  CA  . GLY C  1 44  ? -1.216  164.816 123.263 1.00 39.55  ? 44   GLY C CA  1 
ATOM   5198  C  C   . GLY C  1 44  ? -0.063  163.836 123.345 1.00 48.44  ? 44   GLY C C   1 
ATOM   5199  O  O   . GLY C  1 44  ? 0.942   164.076 124.018 1.00 41.29  ? 44   GLY C O   1 
ATOM   5200  N  N   . PHE C  1 45  ? -0.241  162.700 122.662 1.00 41.48  ? 45   PHE C N   1 
ATOM   5201  C  CA  . PHE C  1 45  ? 0.776   161.656 122.697 1.00 41.41  ? 45   PHE C CA  1 
ATOM   5202  C  C   . PHE C  1 45  ? 0.745   160.822 121.416 1.00 40.86  ? 45   PHE C C   1 
ATOM   5203  O  O   . PHE C  1 45  ? -0.215  160.863 120.645 1.00 40.01  ? 45   PHE C O   1 
ATOM   5204  C  CB  . PHE C  1 45  ? 0.635   160.765 123.954 1.00 41.41  ? 45   PHE C CB  1 
ATOM   5205  C  CG  . PHE C  1 45  ? -0.505  159.789 123.914 1.00 46.60  ? 45   PHE C CG  1 
ATOM   5206  C  CD1 . PHE C  1 45  ? -0.339  158.524 123.341 1.00 51.20  ? 45   PHE C CD1 1 
ATOM   5207  C  CD2 . PHE C  1 45  ? -1.737  160.108 124.480 1.00 50.92  ? 45   PHE C CD2 1 
ATOM   5208  C  CE1 . PHE C  1 45  ? -1.389  157.603 123.316 1.00 55.17  ? 45   PHE C CE1 1 
ATOM   5209  C  CE2 . PHE C  1 45  ? -2.788  159.198 124.459 1.00 53.17  ? 45   PHE C CE2 1 
ATOM   5210  C  CZ  . PHE C  1 45  ? -2.618  157.943 123.870 1.00 55.20  ? 45   PHE C CZ  1 
ATOM   5211  N  N   . GLU C  1 46  ? 1.853   160.105 121.186 1.00 41.66  ? 46   GLU C N   1 
ATOM   5212  C  CA  . GLU C  1 46  ? 2.026   159.133 120.104 1.00 42.85  ? 46   GLU C CA  1 
ATOM   5213  C  C   . GLU C  1 46  ? 2.751   157.918 120.671 1.00 44.82  ? 46   GLU C C   1 
ATOM   5214  O  O   . GLU C  1 46  ? 3.878   158.055 121.160 1.00 43.29  ? 46   GLU C O   1 
ATOM   5215  C  CB  . GLU C  1 46  ? 2.851   159.702 118.934 1.00 45.50  ? 46   GLU C CB  1 
ATOM   5216  C  CG  . GLU C  1 46  ? 2.362   160.996 118.308 1.00 53.01  ? 46   GLU C CG  1 
ATOM   5217  C  CD  . GLU C  1 46  ? 1.276   160.767 117.280 1.00 53.99  ? 46   GLU C CD  1 
ATOM   5218  O  OE1 . GLU C  1 46  ? 1.021   159.585 116.964 1.00 49.17  ? 46   GLU C OE1 1 
ATOM   5219  O  OE2 . GLU C  1 46  ? 0.671   161.760 116.808 1.00 54.23  ? 46   GLU C OE2 1 
ATOM   5220  N  N   . GLN C  1 47  ? 2.126   156.734 120.599 1.00 42.09  ? 47   GLN C N   1 
ATOM   5221  C  CA  . GLN C  1 47  ? 2.761   155.483 121.003 1.00 42.78  ? 47   GLN C CA  1 
ATOM   5222  C  C   . GLN C  1 47  ? 3.243   154.757 119.756 1.00 46.37  ? 47   GLN C C   1 
ATOM   5223  O  O   . GLN C  1 47  ? 2.433   154.225 118.993 1.00 42.24  ? 47   GLN C O   1 
ATOM   5224  C  CB  . GLN C  1 47  ? 1.798   154.617 121.807 1.00 46.15  ? 47   GLN C CB  1 
ATOM   5225  C  CG  . GLN C  1 47  ? 2.426   153.371 122.428 1.00 63.76  ? 47   GLN C CG  1 
ATOM   5226  C  CD  . GLN C  1 47  ? 1.397   152.479 123.127 1.00 80.86  ? 47   GLN C CD  1 
ATOM   5227  O  OE1 . GLN C  1 47  ? 0.352   152.147 122.561 1.00 80.56  ? 47   GLN C OE1 1 
ATOM   5228  N  NE2 . GLN C  1 47  ? 1.699   152.083 124.360 1.00 90.54  ? 47   GLN C NE2 1 
ATOM   5229  N  N   . LEU C  1 48  ? 4.562   154.705 119.569 1.00 31.63  ? 48   LEU C N   1 
ATOM   5230  C  CA  . LEU C  1 48  ? 5.169   154.170 118.354 1.00 33.31  ? 48   LEU C CA  1 
ATOM   5231  C  C   . LEU C  1 48  ? 5.889   152.883 118.680 1.00 36.70  ? 48   LEU C C   1 
ATOM   5232  O  O   . LEU C  1 48  ? 6.807   152.887 119.505 1.00 36.95  ? 48   LEU C O   1 
ATOM   5233  C  CB  . LEU C  1 48  ? 6.169   155.154 117.749 1.00 33.39  ? 48   LEU C CB  1 
ATOM   5234  C  CG  . LEU C  1 48  ? 5.620   156.545 117.462 1.00 43.42  ? 48   LEU C CG  1 
ATOM   5235  C  CD1 . LEU C  1 48  ? 6.703   157.414 116.867 1.00 40.84  ? 48   LEU C CD1 1 
ATOM   5236  C  CD2 . LEU C  1 48  ? 4.431   156.420 116.521 1.00 46.11  ? 48   LEU C CD2 1 
ATOM   5237  N  N   . LEU C  1 49  ? 5.528   151.808 117.983 1.00 35.39  ? 49   LEU C N   1 
ATOM   5238  C  CA  . LEU C  1 49  ? 6.177   150.514 118.145 1.00 34.30  ? 49   LEU C CA  1 
ATOM   5239  C  C   . LEU C  1 49  ? 7.005   150.234 116.899 1.00 32.82  ? 49   LEU C C   1 
ATOM   5240  O  O   . LEU C  1 49  ? 6.492   150.289 115.779 1.00 37.47  ? 49   LEU C O   1 
ATOM   5241  C  CB  . LEU C  1 49  ? 5.145   149.405 118.378 1.00 32.98  ? 49   LEU C CB  1 
ATOM   5242  C  CG  . LEU C  1 49  ? 5.704   148.021 118.702 1.00 47.68  ? 49   LEU C CG  1 
ATOM   5243  C  CD1 . LEU C  1 49  ? 6.472   148.044 120.026 1.00 50.75  ? 49   LEU C CD1 1 
ATOM   5244  C  CD2 . LEU C  1 49  ? 4.598   146.984 118.744 1.00 52.55  ? 49   LEU C CD2 1 
ATOM   5245  N  N   . GLN C  1 50  ? 8.284   149.955 117.092 1.00 31.70  ? 50   GLN C N   1 
ATOM   5246  C  CA  . GLN C  1 50  ? 9.171   149.739 115.956 1.00 34.22  ? 50   GLN C CA  1 
ATOM   5247  C  C   . GLN C  1 50  ? 8.775   148.470 115.199 1.00 44.20  ? 50   GLN C C   1 
ATOM   5248  O  O   . GLN C  1 50  ? 8.556   147.412 115.799 1.00 33.56  ? 50   GLN C O   1 
ATOM   5249  C  CB  . GLN C  1 50  ? 10.620  149.629 116.421 1.00 34.38  ? 50   GLN C CB  1 
ATOM   5250  C  CG  . GLN C  1 50  ? 11.598  149.391 115.252 1.00 41.51  ? 50   GLN C CG  1 
ATOM   5251  C  CD  . GLN C  1 50  ? 13.046  149.303 115.679 1.00 37.09  ? 50   GLN C CD  1 
ATOM   5252  O  OE1 . GLN C  1 50  ? 13.352  149.140 116.858 1.00 42.55  ? 50   GLN C OE1 1 
ATOM   5253  N  NE2 . GLN C  1 50  ? 13.948  149.383 114.710 1.00 39.25  ? 50   GLN C NE2 1 
ATOM   5254  N  N   . THR C  1 51  ? 8.709   148.578 113.875 1.00 42.24  ? 51   THR C N   1 
ATOM   5255  C  CA  . THR C  1 51  ? 8.411   147.454 113.005 1.00 35.84  ? 51   THR C CA  1 
ATOM   5256  C  C   . THR C  1 51  ? 9.595   147.065 112.124 1.00 41.79  ? 51   THR C C   1 
ATOM   5257  O  O   . THR C  1 51  ? 9.581   145.978 111.544 1.00 42.04  ? 51   THR C O   1 
ATOM   5258  C  CB  . THR C  1 51  ? 7.207   147.780 112.106 1.00 41.66  ? 51   THR C CB  1 
ATOM   5259  O  OG1 . THR C  1 51  ? 7.470   148.984 111.381 1.00 45.58  ? 51   THR C OG1 1 
ATOM   5260  C  CG2 . THR C  1 51  ? 5.940   147.987 112.924 1.00 34.11  ? 51   THR C CG2 1 
ATOM   5261  N  N   . GLY C  1 52  ? 10.611  147.917 112.010 1.00 35.94  ? 52   GLY C N   1 
ATOM   5262  C  CA  . GLY C  1 52  ? 11.762  147.593 111.191 1.00 38.16  ? 52   GLY C CA  1 
ATOM   5263  C  C   . GLY C  1 52  ? 12.671  148.794 111.053 1.00 41.45  ? 52   GLY C C   1 
ATOM   5264  O  O   . GLY C  1 52  ? 12.641  149.718 111.878 1.00 36.42  ? 52   GLY C O   1 
ATOM   5265  N  N   . ILE C  1 53  ? 13.500  148.744 110.008 1.00 40.27  ? 53   ILE C N   1 
ATOM   5266  C  CA  . ILE C  1 53  ? 14.434  149.811 109.656 1.00 41.33  ? 53   ILE C CA  1 
ATOM   5267  C  C   . ILE C  1 53  ? 14.462  149.937 108.138 1.00 40.99  ? 53   ILE C C   1 
ATOM   5268  O  O   . ILE C  1 53  ? 14.013  149.055 107.406 1.00 42.79  ? 53   ILE C O   1 
ATOM   5269  C  CB  . ILE C  1 53  ? 15.871  149.556 110.164 1.00 39.99  ? 53   ILE C CB  1 
ATOM   5270  C  CG1 . ILE C  1 53  ? 16.508  148.394 109.389 1.00 42.62  ? 53   ILE C CG1 1 
ATOM   5271  C  CG2 . ILE C  1 53  ? 15.912  149.306 111.665 1.00 36.32  ? 53   ILE C CG2 1 
ATOM   5272  C  CD1 . ILE C  1 53  ? 18.024  148.315 109.555 1.00 39.68  ? 53   ILE C CD1 1 
ATOM   5273  N  N   . HIS C  1 54  ? 15.065  151.021 107.665 1.00 39.25  ? 54   HIS C N   1 
ATOM   5274  C  CA  . HIS C  1 54  ? 15.363  151.151 106.248 1.00 42.72  ? 54   HIS C CA  1 
ATOM   5275  C  C   . HIS C  1 54  ? 16.741  150.575 105.971 1.00 39.33  ? 54   HIS C C   1 
ATOM   5276  O  O   . HIS C  1 54  ? 17.718  151.051 106.554 1.00 37.69  ? 54   HIS C O   1 
ATOM   5277  C  CB  . HIS C  1 54  ? 15.331  152.597 105.808 1.00 44.36  ? 54   HIS C CB  1 
ATOM   5278  C  CG  . HIS C  1 54  ? 15.200  152.754 104.329 1.00 47.48  ? 54   HIS C CG  1 
ATOM   5279  N  ND1 . HIS C  1 54  ? 16.151  152.290 103.450 1.00 52.28  ? 54   HIS C ND1 1 
ATOM   5280  C  CD2 . HIS C  1 54  ? 14.218  153.297 103.571 1.00 52.41  ? 54   HIS C CD2 1 
ATOM   5281  C  CE1 . HIS C  1 54  ? 15.769  152.553 102.213 1.00 55.66  ? 54   HIS C CE1 1 
ATOM   5282  N  NE2 . HIS C  1 54  ? 14.598  153.163 102.258 1.00 50.55  ? 54   HIS C NE2 1 
ATOM   5283  N  N   . PRO C  1 55  ? 16.867  149.534 105.144 1.00 39.23  ? 55   PRO C N   1 
ATOM   5284  C  CA  . PRO C  1 55  ? 18.203  148.964 104.891 1.00 41.22  ? 55   PRO C CA  1 
ATOM   5285  C  C   . PRO C  1 55  ? 19.122  149.865 104.068 1.00 44.44  ? 55   PRO C C   1 
ATOM   5286  O  O   . PRO C  1 55  ? 20.336  149.629 104.066 1.00 47.10  ? 55   PRO C O   1 
ATOM   5287  C  CB  . PRO C  1 55  ? 17.896  147.643 104.156 1.00 37.79  ? 55   PRO C CB  1 
ATOM   5288  C  CG  . PRO C  1 55  ? 16.463  147.380 104.367 1.00 37.70  ? 55   PRO C CG  1 
ATOM   5289  C  CD  . PRO C  1 55  ? 15.797  148.721 104.536 1.00 38.79  ? 55   PRO C CD  1 
ATOM   5290  N  N   . MET C  1 56  ? 18.597  150.892 103.404 1.00 50.82  ? 56   MET C N   1 
ATOM   5291  C  CA  . MET C  1 56  ? 19.396  151.877 102.666 1.00 51.54  ? 56   MET C CA  1 
ATOM   5292  C  C   . MET C  1 56  ? 20.376  151.196 101.712 1.00 45.49  ? 56   MET C C   1 
ATOM   5293  O  O   . MET C  1 56  ? 21.590  151.430 101.730 1.00 44.22  ? 56   MET C O   1 
ATOM   5294  C  CB  . MET C  1 56  ? 20.110  152.827 103.628 1.00 56.79  ? 56   MET C CB  1 
ATOM   5295  C  CG  . MET C  1 56  ? 19.224  153.987 104.067 1.00 68.49  ? 56   MET C CG  1 
ATOM   5296  S  SD  . MET C  1 56  ? 19.995  154.968 105.367 1.00 82.10  ? 56   MET C SD  1 
ATOM   5297  C  CE  . MET C  1 56  ? 21.533  155.466 104.581 1.00 81.46  ? 56   MET C CE  1 
ATOM   5298  N  N   . ALA C  1 57  ? 19.796  150.348 100.862 1.00 46.10  ? 57   ALA C N   1 
ATOM   5299  C  CA  . ALA C  1 57  ? 20.496  149.681 99.763  1.00 51.16  ? 57   ALA C CA  1 
ATOM   5300  C  C   . ALA C  1 57  ? 21.656  148.821 100.260 1.00 53.46  ? 57   ALA C C   1 
ATOM   5301  O  O   . ALA C  1 57  ? 22.697  148.715 99.609  1.00 58.90  ? 57   ALA C O   1 
ATOM   5302  C  CB  . ALA C  1 57  ? 20.975  150.698 98.721  1.00 52.00  ? 57   ALA C CB  1 
ATOM   5303  N  N   . GLY C  1 58  ? 21.484  148.194 101.419 1.00 47.79  ? 58   GLY C N   1 
ATOM   5304  C  CA  . GLY C  1 58  ? 22.476  147.262 101.914 1.00 44.97  ? 58   GLY C CA  1 
ATOM   5305  C  C   . GLY C  1 58  ? 23.426  147.840 102.935 1.00 45.14  ? 58   GLY C C   1 
ATOM   5306  O  O   . GLY C  1 58  ? 24.239  147.099 103.486 1.00 48.54  ? 58   GLY C O   1 
ATOM   5307  N  N   . ARG C  1 59  ? 23.374  149.148 103.169 1.00 49.08  ? 59   ARG C N   1 
ATOM   5308  C  CA  . ARG C  1 59  ? 24.151  149.744 104.246 1.00 44.61  ? 59   ARG C CA  1 
ATOM   5309  C  C   . ARG C  1 59  ? 23.795  149.115 105.589 1.00 47.47  ? 59   ARG C C   1 
ATOM   5310  O  O   . ARG C  1 59  ? 24.639  149.047 106.491 1.00 50.26  ? 59   ARG C O   1 
ATOM   5311  C  CB  . ARG C  1 59  ? 23.913  151.252 104.242 1.00 45.99  ? 59   ARG C CB  1 
ATOM   5312  C  CG  . ARG C  1 59  ? 24.443  152.020 105.430 1.00 49.21  ? 59   ARG C CG  1 
ATOM   5313  C  CD  . ARG C  1 59  ? 25.957  152.044 105.475 1.00 50.01  ? 59   ARG C CD  1 
ATOM   5314  N  NE  . ARG C  1 59  ? 26.431  152.810 106.629 1.00 56.64  ? 59   ARG C NE  1 
ATOM   5315  C  CZ  . ARG C  1 59  ? 26.609  152.290 107.840 1.00 58.20  ? 59   ARG C CZ  1 
ATOM   5316  N  NH1 . ARG C  1 59  ? 26.360  150.995 108.046 1.00 53.88  ? 59   ARG C NH1 1 
ATOM   5317  N  NH2 . ARG C  1 59  ? 27.039  153.057 108.840 1.00 56.66  ? 59   ARG C NH2 1 
ATOM   5318  N  N   . TYR C  1 60  ? 22.542  148.683 105.751 1.00 47.19  ? 60   TYR C N   1 
ATOM   5319  C  CA  . TYR C  1 60  ? 22.117  147.885 106.898 1.00 38.68  ? 60   TYR C CA  1 
ATOM   5320  C  C   . TYR C  1 60  ? 21.477  146.594 106.406 1.00 45.90  ? 60   TYR C C   1 
ATOM   5321  O  O   . TYR C  1 60  ? 20.294  146.334 106.651 1.00 43.41  ? 60   TYR C O   1 
ATOM   5322  C  CB  . TYR C  1 60  ? 21.174  148.700 107.778 1.00 46.44  ? 60   TYR C CB  1 
ATOM   5323  C  CG  . TYR C  1 60  ? 21.804  150.008 108.174 1.00 47.19  ? 60   TYR C CG  1 
ATOM   5324  C  CD1 . TYR C  1 60  ? 22.789  150.050 109.151 1.00 51.14  ? 60   TYR C CD1 1 
ATOM   5325  C  CD2 . TYR C  1 60  ? 21.460  151.193 107.535 1.00 49.16  ? 60   TYR C CD2 1 
ATOM   5326  C  CE1 . TYR C  1 60  ? 23.395  151.247 109.509 1.00 48.96  ? 60   TYR C CE1 1 
ATOM   5327  C  CE2 . TYR C  1 60  ? 22.060  152.391 107.886 1.00 51.43  ? 60   TYR C CE2 1 
ATOM   5328  C  CZ  . TYR C  1 60  ? 23.035  152.413 108.874 1.00 52.90  ? 60   TYR C CZ  1 
ATOM   5329  O  OH  . TYR C  1 60  ? 23.650  153.601 109.233 1.00 51.92  ? 60   TYR C OH  1 
ATOM   5330  N  N   . GLY C  1 61  ? 22.271  145.779 105.710 1.00 46.39  ? 61   GLY C N   1 
ATOM   5331  C  CA  . GLY C  1 61  ? 21.769  144.602 105.030 1.00 39.51  ? 61   GLY C CA  1 
ATOM   5332  C  C   . GLY C  1 61  ? 21.286  143.495 105.945 1.00 47.98  ? 61   GLY C C   1 
ATOM   5333  O  O   . GLY C  1 61  ? 20.612  142.577 105.473 1.00 45.97  ? 61   GLY C O   1 
ATOM   5334  N  N   . GLY C  1 62  ? 21.635  143.537 107.231 1.00 48.55  ? 62   GLY C N   1 
ATOM   5335  C  CA  . GLY C  1 62  ? 21.074  142.575 108.159 1.00 36.28  ? 62   GLY C CA  1 
ATOM   5336  C  C   . GLY C  1 62  ? 19.654  142.874 108.598 1.00 37.63  ? 62   GLY C C   1 
ATOM   5337  O  O   . GLY C  1 62  ? 18.997  142.014 109.186 1.00 39.54  ? 62   GLY C O   1 
ATOM   5338  N  N   . GLY C  1 63  ? 19.170  144.090 108.355 1.00 36.04  ? 63   GLY C N   1 
ATOM   5339  C  CA  . GLY C  1 63  ? 17.819  144.459 108.703 1.00 36.11  ? 63   GLY C CA  1 
ATOM   5340  C  C   . GLY C  1 63  ? 16.881  144.371 107.506 1.00 37.92  ? 63   GLY C C   1 
ATOM   5341  O  O   . GLY C  1 63  ? 17.246  143.948 106.410 1.00 37.73  ? 63   GLY C O   1 
ATOM   5342  N  N   . ALA C  1 64  ? 15.648  144.804 107.742 1.00 36.42  ? 64   ALA C N   1 
ATOM   5343  C  CA  . ALA C  1 64  ? 14.604  144.749 106.731 1.00 48.89  ? 64   ALA C CA  1 
ATOM   5344  C  C   . ALA C  1 64  ? 13.520  145.747 107.103 1.00 46.79  ? 64   ALA C C   1 
ATOM   5345  O  O   . ALA C  1 64  ? 13.387  146.148 108.263 1.00 42.93  ? 64   ALA C O   1 
ATOM   5346  C  CB  . ALA C  1 64  ? 14.007  143.341 106.607 1.00 37.31  ? 64   ALA C CB  1 
ATOM   5347  N  N   . VAL C  1 65  ? 12.737  146.138 106.100 1.00 43.69  ? 65   VAL C N   1 
ATOM   5348  C  CA  . VAL C  1 65  ? 11.595  147.008 106.364 1.00 46.70  ? 65   VAL C CA  1 
ATOM   5349  C  C   . VAL C  1 65  ? 10.677  146.371 107.400 1.00 42.46  ? 65   VAL C C   1 
ATOM   5350  O  O   . VAL C  1 65  ? 10.237  147.029 108.349 1.00 44.80  ? 65   VAL C O   1 
ATOM   5351  C  CB  . VAL C  1 65  ? 10.861  147.328 105.049 1.00 42.05  ? 65   VAL C CB  1 
ATOM   5352  C  CG1 . VAL C  1 65  ? 9.533   147.975 105.325 1.00 38.35  ? 65   VAL C CG1 1 
ATOM   5353  C  CG2 . VAL C  1 65  ? 11.744  148.226 104.170 1.00 38.57  ? 65   VAL C CG2 1 
ATOM   5354  N  N   . ASP C  1 66  ? 10.409  145.072 107.263 1.00 41.95  ? 66   ASP C N   1 
ATOM   5355  C  CA  . ASP C  1 66  ? 9.506   144.356 108.162 1.00 36.67  ? 66   ASP C CA  1 
ATOM   5356  C  C   . ASP C  1 66  ? 10.329  143.389 109.005 1.00 40.92  ? 66   ASP C C   1 
ATOM   5357  O  O   . ASP C  1 66  ? 10.713  142.313 108.538 1.00 40.29  ? 66   ASP C O   1 
ATOM   5358  C  CB  . ASP C  1 66  ? 8.437   143.616 107.371 1.00 37.25  ? 66   ASP C CB  1 
ATOM   5359  C  CG  . ASP C  1 66  ? 7.424   142.936 108.260 1.00 42.47  ? 66   ASP C CG  1 
ATOM   5360  O  OD1 . ASP C  1 66  ? 7.494   143.080 109.498 1.00 45.88  ? 66   ASP C OD1 1 
ATOM   5361  O  OD2 . ASP C  1 66  ? 6.558   142.239 107.714 1.00 45.42  ? 66   ASP C OD2 1 
ATOM   5362  N  N   . MET C  1 67  ? 10.594  143.769 110.252 1.00 37.92  ? 67   MET C N   1 
ATOM   5363  C  CA  . MET C  1 67  ? 11.296  142.897 111.183 1.00 37.95  ? 67   MET C CA  1 
ATOM   5364  C  C   . MET C  1 67  ? 10.416  142.487 112.346 1.00 37.59  ? 67   MET C C   1 
ATOM   5365  O  O   . MET C  1 67  ? 10.932  142.087 113.395 1.00 45.72  ? 67   MET C O   1 
ATOM   5366  C  CB  . MET C  1 67  ? 12.567  143.568 111.706 1.00 36.84  ? 67   MET C CB  1 
ATOM   5367  C  CG  . MET C  1 67  ? 13.552  143.942 110.618 1.00 39.32  ? 67   MET C CG  1 
ATOM   5368  S  SD  . MET C  1 67  ? 14.914  144.964 111.245 1.00 42.91  ? 67   MET C SD  1 
ATOM   5369  C  CE  . MET C  1 67  ? 15.856  143.774 112.209 1.00 42.78  ? 67   MET C CE  1 
ATOM   5370  N  N   . ARG C  1 68  ? 9.095   142.563 112.174 1.00 38.31  ? 68   ARG C N   1 
ATOM   5371  C  CA  . ARG C  1 68  ? 8.194   142.386 113.308 1.00 39.76  ? 68   ARG C CA  1 
ATOM   5372  C  C   . ARG C  1 68  ? 8.353   141.015 113.959 1.00 42.67  ? 68   ARG C C   1 
ATOM   5373  O  O   . ARG C  1 68  ? 8.137   140.876 115.167 1.00 42.66  ? 68   ARG C O   1 
ATOM   5374  C  CB  . ARG C  1 68  ? 6.753   142.611 112.857 1.00 42.39  ? 68   ARG C CB  1 
ATOM   5375  C  CG  . ARG C  1 68  ? 6.460   144.057 112.566 1.00 44.25  ? 68   ARG C CG  1 
ATOM   5376  C  CD  . ARG C  1 68  ? 5.089   144.223 111.946 1.00 51.67  ? 68   ARG C CD  1 
ATOM   5377  N  NE  . ARG C  1 68  ? 4.996   143.555 110.654 1.00 53.15  ? 68   ARG C NE  1 
ATOM   5378  C  CZ  . ARG C  1 68  ? 3.874   143.467 109.943 1.00 60.93  ? 68   ARG C CZ  1 
ATOM   5379  N  NH1 . ARG C  1 68  ? 2.752   144.010 110.398 1.00 64.64  ? 68   ARG C NH1 1 
ATOM   5380  N  NH2 . ARG C  1 68  ? 3.872   142.839 108.776 1.00 55.64  ? 68   ARG C NH2 1 
ATOM   5381  N  N   . GLU C  1 69  ? 8.758   140.007 113.186 1.00 43.40  ? 69   GLU C N   1 
ATOM   5382  C  CA  . GLU C  1 69  ? 8.887   138.638 113.675 1.00 56.54  ? 69   GLU C CA  1 
ATOM   5383  C  C   . GLU C  1 69  ? 10.234  138.355 114.327 1.00 58.53  ? 69   GLU C C   1 
ATOM   5384  O  O   . GLU C  1 69  ? 10.361  137.363 115.051 1.00 55.28  ? 69   GLU C O   1 
ATOM   5385  C  CB  . GLU C  1 69  ? 8.708   137.644 112.520 1.00 62.17  ? 69   GLU C CB  1 
ATOM   5386  C  CG  . GLU C  1 69  ? 7.397   137.760 111.767 1.00 75.52  ? 69   GLU C CG  1 
ATOM   5387  C  CD  . GLU C  1 69  ? 6.201   137.452 112.629 1.00 87.69  ? 69   GLU C CD  1 
ATOM   5388  O  OE1 . GLU C  1 69  ? 6.204   136.385 113.279 1.00 96.34  ? 69   GLU C OE1 1 
ATOM   5389  O  OE2 . GLU C  1 69  ? 5.260   138.274 112.657 1.00 91.10  ? 69   GLU C OE2 1 
ATOM   5390  N  N   . THR C  1 70  ? 11.256  139.163 114.041 1.00 54.28  ? 70   THR C N   1 
ATOM   5391  C  CA  . THR C  1 70  ? 12.617  138.833 114.430 1.00 47.04  ? 70   THR C CA  1 
ATOM   5392  C  C   . THR C  1 70  ? 13.273  139.833 115.370 1.00 44.55  ? 70   THR C C   1 
ATOM   5393  O  O   . THR C  1 70  ? 14.229  139.467 116.056 1.00 45.02  ? 70   THR C O   1 
ATOM   5394  C  CB  . THR C  1 70  ? 13.485  138.693 113.178 1.00 42.13  ? 70   THR C CB  1 
ATOM   5395  O  OG1 . THR C  1 70  ? 13.438  139.923 112.453 1.00 50.71  ? 70   THR C OG1 1 
ATOM   5396  C  CG2 . THR C  1 70  ? 12.924  137.600 112.296 1.00 44.49  ? 70   THR C CG2 1 
ATOM   5397  N  N   . LEU C  1 71  ? 12.789  141.066 115.428 1.00 37.92  ? 71   LEU C N   1 
ATOM   5398  C  CA  . LEU C  1 71  ? 13.422  142.111 116.213 1.00 35.76  ? 71   LEU C CA  1 
ATOM   5399  C  C   . LEU C  1 71  ? 13.259  141.837 117.707 1.00 37.58  ? 71   LEU C C   1 
ATOM   5400  O  O   . LEU C  1 71  ? 12.137  141.721 118.201 1.00 41.60  ? 71   LEU C O   1 
ATOM   5401  C  CB  . LEU C  1 71  ? 12.791  143.440 115.823 1.00 34.73  ? 71   LEU C CB  1 
ATOM   5402  C  CG  . LEU C  1 71  ? 13.389  144.784 116.130 1.00 37.82  ? 71   LEU C CG  1 
ATOM   5403  C  CD1 . LEU C  1 71  ? 14.825  144.852 115.673 1.00 38.53  ? 71   LEU C CD1 1 
ATOM   5404  C  CD2 . LEU C  1 71  ? 12.540  145.825 115.421 1.00 44.97  ? 71   LEU C CD2 1 
ATOM   5405  N  N   . ASN C  1 72  ? 14.364  141.733 118.429 1.00 37.93  ? 72   ASN C N   1 
ATOM   5406  C  CA  . ASN C  1 72  ? 14.287  141.589 119.880 1.00 36.78  ? 72   ASN C CA  1 
ATOM   5407  C  C   . ASN C  1 72  ? 15.585  142.028 120.555 1.00 41.47  ? 72   ASN C C   1 
ATOM   5408  O  O   . ASN C  1 72  ? 16.601  141.320 120.467 1.00 42.74  ? 72   ASN C O   1 
ATOM   5409  C  CB  . ASN C  1 72  ? 13.972  140.143 120.269 1.00 38.63  ? 72   ASN C CB  1 
ATOM   5410  C  CG  . ASN C  1 72  ? 13.893  139.976 121.765 1.00 48.78  ? 72   ASN C CG  1 
ATOM   5411  O  OD1 . ASN C  1 72  ? 13.045  140.587 122.421 1.00 46.80  ? 72   ASN C OD1 1 
ATOM   5412  N  ND2 . ASN C  1 72  ? 14.810  139.191 122.326 1.00 45.23  ? 72   ASN C ND2 1 
ATOM   5413  N  N   . PRO C  1 73  ? 15.585  143.144 121.297 1.00 38.20  ? 73   PRO C N   1 
ATOM   5414  C  CA  . PRO C  1 73  ? 14.415  143.974 121.621 1.00 40.10  ? 73   PRO C CA  1 
ATOM   5415  C  C   . PRO C  1 73  ? 13.880  144.804 120.453 1.00 41.92  ? 73   PRO C C   1 
ATOM   5416  O  O   . PRO C  1 73  ? 14.541  144.996 119.434 1.00 37.09  ? 73   PRO C O   1 
ATOM   5417  C  CB  . PRO C  1 73  ? 14.949  144.902 122.708 1.00 37.87  ? 73   PRO C CB  1 
ATOM   5418  C  CG  . PRO C  1 73  ? 16.399  145.103 122.315 1.00 38.62  ? 73   PRO C CG  1 
ATOM   5419  C  CD  . PRO C  1 73  ? 16.836  143.746 121.794 1.00 41.11  ? 73   PRO C CD  1 
ATOM   5420  N  N   . MET C  1 74  ? 12.666  145.306 120.605 1.00 36.92  ? 74   MET C N   1 
ATOM   5421  C  CA  . MET C  1 74  ? 12.099  146.198 119.616 1.00 39.98  ? 74   MET C CA  1 
ATOM   5422  C  C   . MET C  1 74  ? 11.964  147.582 120.233 1.00 41.88  ? 74   MET C C   1 
ATOM   5423  O  O   . MET C  1 74  ? 11.688  147.718 121.433 1.00 38.19  ? 74   MET C O   1 
ATOM   5424  C  CB  . MET C  1 74  ? 10.750  145.678 119.106 1.00 38.57  ? 74   MET C CB  1 
ATOM   5425  C  CG  . MET C  1 74  ? 9.681   145.586 120.171 1.00 44.64  ? 74   MET C CG  1 
ATOM   5426  S  SD  . MET C  1 74  ? 8.305   144.529 119.708 1.00 49.89  ? 74   MET C SD  1 
ATOM   5427  C  CE  . MET C  1 74  ? 8.072   144.985 118.005 1.00 58.11  ? 74   MET C CE  1 
ATOM   5428  N  N   . GLY C  1 75  ? 12.193  148.606 119.418 1.00 40.60  ? 75   GLY C N   1 
ATOM   5429  C  CA  . GLY C  1 75  ? 12.080  149.966 119.910 1.00 37.90  ? 75   GLY C CA  1 
ATOM   5430  C  C   . GLY C  1 75  ? 10.645  150.325 120.261 1.00 39.74  ? 75   GLY C C   1 
ATOM   5431  O  O   . GLY C  1 75  ? 9.688   149.935 119.588 1.00 33.98  ? 75   GLY C O   1 
ATOM   5432  N  N   . MET C  1 76  ? 10.499  151.102 121.322 1.00 37.03  ? 76   MET C N   1 
ATOM   5433  C  CA  . MET C  1 76  ? 9.197   151.631 121.694 1.00 38.37  ? 76   MET C CA  1 
ATOM   5434  C  C   . MET C  1 76  ? 9.391   153.096 122.069 1.00 41.55  ? 76   MET C C   1 
ATOM   5435  O  O   . MET C  1 76  ? 10.059  153.406 123.060 1.00 45.56  ? 76   MET C O   1 
ATOM   5436  C  CB  . MET C  1 76  ? 8.601   150.821 122.833 1.00 44.24  ? 76   MET C CB  1 
ATOM   5437  C  CG  . MET C  1 76  ? 7.110   150.661 122.721 1.00 58.96  ? 76   MET C CG  1 
ATOM   5438  S  SD  . MET C  1 76  ? 6.321   151.789 123.832 1.00 75.28  ? 76   MET C SD  1 
ATOM   5439  C  CE  . MET C  1 76  ? 6.635   150.947 125.398 1.00 75.21  ? 76   MET C CE  1 
ATOM   5440  N  N   . PHE C  1 77  ? 8.847   153.997 121.258 1.00 38.67  ? 77   PHE C N   1 
ATOM   5441  C  CA  . PHE C  1 77  ? 8.981   155.436 121.474 1.00 42.75  ? 77   PHE C CA  1 
ATOM   5442  C  C   . PHE C  1 77  ? 7.627   156.006 121.854 1.00 38.14  ? 77   PHE C C   1 
ATOM   5443  O  O   . PHE C  1 77  ? 6.639   155.777 121.153 1.00 44.33  ? 77   PHE C O   1 
ATOM   5444  C  CB  . PHE C  1 77  ? 9.479   156.173 120.231 1.00 34.00  ? 77   PHE C CB  1 
ATOM   5445  C  CG  . PHE C  1 77  ? 10.932  155.998 119.955 1.00 41.84  ? 77   PHE C CG  1 
ATOM   5446  C  CD1 . PHE C  1 77  ? 11.656  154.953 120.514 1.00 40.31  ? 77   PHE C CD1 1 
ATOM   5447  C  CD2 . PHE C  1 77  ? 11.580  156.884 119.113 1.00 35.84  ? 77   PHE C CD2 1 
ATOM   5448  C  CE1 . PHE C  1 77  ? 12.982  154.796 120.246 1.00 41.69  ? 77   PHE C CE1 1 
ATOM   5449  C  CE2 . PHE C  1 77  ? 12.918  156.718 118.823 1.00 41.35  ? 77   PHE C CE2 1 
ATOM   5450  C  CZ  . PHE C  1 77  ? 13.625  155.679 119.402 1.00 41.26  ? 77   PHE C CZ  1 
ATOM   5451  N  N   . GLN C  1 78  ? 7.577   156.725 122.961 1.00 42.52  ? 78   GLN C N   1 
ATOM   5452  C  CA  . GLN C  1 78  ? 6.362   157.400 123.409 1.00 44.93  ? 78   GLN C CA  1 
ATOM   5453  C  C   . GLN C  1 78  ? 6.581   158.904 123.368 1.00 43.43  ? 78   GLN C C   1 
ATOM   5454  O  O   . GLN C  1 78  ? 7.330   159.449 124.190 1.00 40.20  ? 78   GLN C O   1 
ATOM   5455  C  CB  . GLN C  1 78  ? 5.969   156.950 124.811 1.00 52.32  ? 78   GLN C CB  1 
ATOM   5456  C  CG  . GLN C  1 78  ? 4.592   157.424 125.237 1.00 76.76  ? 78   GLN C CG  1 
ATOM   5457  C  CD  . GLN C  1 78  ? 3.463   156.583 124.652 1.00 95.12  ? 78   GLN C CD  1 
ATOM   5458  O  OE1 . GLN C  1 78  ? 3.616   155.379 124.418 1.00 102.47 ? 78   GLN C OE1 1 
ATOM   5459  N  NE2 . GLN C  1 78  ? 2.302   157.209 124.455 1.00 95.79  ? 78   GLN C NE2 1 
ATOM   5460  N  N   . TYR C  1 79  ? 5.946   159.565 122.404 1.00 40.95  ? 79   TYR C N   1 
ATOM   5461  C  CA  . TYR C  1 79  ? 5.906   161.015 122.394 1.00 38.29  ? 79   TYR C CA  1 
ATOM   5462  C  C   . TYR C  1 79  ? 4.865   161.464 123.390 1.00 38.52  ? 79   TYR C C   1 
ATOM   5463  O  O   . TYR C  1 79  ? 3.713   161.035 123.312 1.00 39.67  ? 79   TYR C O   1 
ATOM   5464  C  CB  . TYR C  1 79  ? 5.495   161.572 121.033 1.00 36.76  ? 79   TYR C CB  1 
ATOM   5465  C  CG  . TYR C  1 79  ? 6.384   161.325 119.858 1.00 33.97  ? 79   TYR C CG  1 
ATOM   5466  C  CD1 . TYR C  1 79  ? 7.366   160.348 119.865 1.00 38.96  ? 79   TYR C CD1 1 
ATOM   5467  C  CD2 . TYR C  1 79  ? 6.209   162.064 118.705 1.00 38.63  ? 79   TYR C CD2 1 
ATOM   5468  C  CE1 . TYR C  1 79  ? 8.161   160.136 118.745 1.00 41.38  ? 79   TYR C CE1 1 
ATOM   5469  C  CE2 . TYR C  1 79  ? 7.002   161.871 117.599 1.00 42.10  ? 79   TYR C CE2 1 
ATOM   5470  C  CZ  . TYR C  1 79  ? 7.959   160.909 117.612 1.00 36.03  ? 79   TYR C CZ  1 
ATOM   5471  O  OH  . TYR C  1 79  ? 8.721   160.754 116.478 1.00 37.64  ? 79   TYR C OH  1 
ATOM   5472  N  N   . THR C  1 80  ? 5.240   162.360 124.292 1.00 36.83  ? 80   THR C N   1 
ATOM   5473  C  CA  . THR C  1 80  ? 4.262   163.163 125.005 1.00 36.00  ? 80   THR C CA  1 
ATOM   5474  C  C   . THR C  1 80  ? 4.577   164.617 124.690 1.00 41.35  ? 80   THR C C   1 
ATOM   5475  O  O   . THR C  1 80  ? 5.748   165.013 124.682 1.00 38.46  ? 80   THR C O   1 
ATOM   5476  C  CB  . THR C  1 80  ? 4.260   162.868 126.506 1.00 31.75  ? 80   THR C CB  1 
ATOM   5477  O  OG1 . THR C  1 80  ? 5.567   163.068 127.055 1.00 34.95  ? 80   THR C OG1 1 
ATOM   5478  C  CG2 . THR C  1 80  ? 3.812   161.385 126.734 1.00 31.31  ? 80   THR C CG2 1 
ATOM   5479  N  N   . VAL C  1 81  ? 3.537   165.387 124.374 1.00 37.30  ? 81   VAL C N   1 
ATOM   5480  C  CA  . VAL C  1 81  ? 3.659   166.740 123.837 1.00 40.56  ? 81   VAL C CA  1 
ATOM   5481  C  C   . VAL C  1 81  ? 3.161   167.717 124.895 1.00 38.42  ? 81   VAL C C   1 
ATOM   5482  O  O   . VAL C  1 81  ? 2.099   167.504 125.497 1.00 41.08  ? 81   VAL C O   1 
ATOM   5483  C  CB  . VAL C  1 81  ? 2.862   166.884 122.527 1.00 36.46  ? 81   VAL C CB  1 
ATOM   5484  C  CG1 . VAL C  1 81  ? 3.128   168.247 121.854 1.00 33.08  ? 81   VAL C CG1 1 
ATOM   5485  C  CG2 . VAL C  1 81  ? 3.163   165.716 121.600 1.00 35.82  ? 81   VAL C CG2 1 
ATOM   5486  N  N   . TRP C  1 82  ? 3.916   168.793 125.109 1.00 35.43  ? 82   TRP C N   1 
ATOM   5487  C  CA  . TRP C  1 82  ? 3.734   169.655 126.267 1.00 34.35  ? 82   TRP C CA  1 
ATOM   5488  C  C   . TRP C  1 82  ? 3.818   171.119 125.868 1.00 48.35  ? 82   TRP C C   1 
ATOM   5489  O  O   . TRP C  1 82  ? 4.501   171.484 124.903 1.00 44.16  ? 82   TRP C O   1 
ATOM   5490  C  CB  . TRP C  1 82  ? 4.784   169.353 127.339 1.00 34.29  ? 82   TRP C CB  1 
ATOM   5491  C  CG  . TRP C  1 82  ? 4.699   167.938 127.820 1.00 39.59  ? 82   TRP C CG  1 
ATOM   5492  C  CD1 . TRP C  1 82  ? 5.355   166.851 127.310 1.00 33.24  ? 82   TRP C CD1 1 
ATOM   5493  C  CD2 . TRP C  1 82  ? 3.897   167.454 128.904 1.00 39.82  ? 82   TRP C CD2 1 
ATOM   5494  N  NE1 . TRP C  1 82  ? 5.005   165.719 128.013 1.00 33.63  ? 82   TRP C NE1 1 
ATOM   5495  C  CE2 . TRP C  1 82  ? 4.106   166.062 128.990 1.00 33.91  ? 82   TRP C CE2 1 
ATOM   5496  C  CE3 . TRP C  1 82  ? 3.015   168.064 129.806 1.00 36.87  ? 82   TRP C CE3 1 
ATOM   5497  C  CZ2 . TRP C  1 82  ? 3.490   165.272 129.961 1.00 38.54  ? 82   TRP C CZ2 1 
ATOM   5498  C  CZ3 . TRP C  1 82  ? 2.397   167.281 130.757 1.00 37.95  ? 82   TRP C CZ3 1 
ATOM   5499  C  CH2 . TRP C  1 82  ? 2.635   165.893 130.829 1.00 33.94  ? 82   TRP C CH2 1 
ATOM   5500  N  N   . LYS C  1 83  ? 3.113   171.964 126.626 1.00 43.05  ? 83   LYS C N   1 
ATOM   5501  C  CA  . LYS C  1 83  ? 3.283   173.402 126.448 1.00 40.14  ? 83   LYS C CA  1 
ATOM   5502  C  C   . LYS C  1 83  ? 4.721   173.824 126.737 1.00 38.29  ? 83   LYS C C   1 
ATOM   5503  O  O   . LYS C  1 83  ? 5.265   174.705 126.062 1.00 42.77  ? 83   LYS C O   1 
ATOM   5504  C  CB  . LYS C  1 83  ? 2.306   174.165 127.345 1.00 44.15  ? 83   LYS C CB  1 
ATOM   5505  C  CG  . LYS C  1 83  ? 0.846   173.997 126.949 1.00 50.49  ? 83   LYS C CG  1 
ATOM   5506  C  CD  . LYS C  1 83  ? -0.074  174.811 127.857 1.00 55.09  ? 83   LYS C CD  1 
ATOM   5507  C  CE  . LYS C  1 83  ? -1.545  174.631 127.500 1.00 51.99  ? 83   LYS C CE  1 
ATOM   5508  N  NZ  . LYS C  1 83  ? -2.407  175.333 128.501 1.00 57.36  ? 83   LYS C NZ  1 
ATOM   5509  N  N   . ASP C  1 84  ? 5.362   173.187 127.713 1.00 39.25  ? 84   ASP C N   1 
ATOM   5510  C  CA  . ASP C  1 84  ? 6.723   173.532 128.105 1.00 44.57  ? 84   ASP C CA  1 
ATOM   5511  C  C   . ASP C  1 84  ? 7.310   172.396 128.935 1.00 43.95  ? 84   ASP C C   1 
ATOM   5512  O  O   . ASP C  1 84  ? 6.606   171.481 129.369 1.00 40.79  ? 84   ASP C O   1 
ATOM   5513  C  CB  . ASP C  1 84  ? 6.776   174.859 128.887 1.00 40.79  ? 84   ASP C CB  1 
ATOM   5514  C  CG  . ASP C  1 84  ? 5.706   174.944 129.960 1.00 44.79  ? 84   ASP C CG  1 
ATOM   5515  O  OD1 . ASP C  1 84  ? 5.497   173.950 130.695 1.00 43.55  ? 84   ASP C OD1 1 
ATOM   5516  O  OD2 . ASP C  1 84  ? 5.096   176.024 130.096 1.00 48.86  ? 84   ASP C OD2 1 
ATOM   5517  N  N   . VAL C  1 85  ? 8.620   172.492 129.172 1.00 38.81  ? 85   VAL C N   1 
ATOM   5518  C  CA  . VAL C  1 85  ? 9.324   171.487 129.961 1.00 35.01  ? 85   VAL C CA  1 
ATOM   5519  C  C   . VAL C  1 85  ? 8.732   171.410 131.360 1.00 35.63  ? 85   VAL C C   1 
ATOM   5520  O  O   . VAL C  1 85  ? 8.522   170.317 131.902 1.00 38.66  ? 85   VAL C O   1 
ATOM   5521  C  CB  . VAL C  1 85  ? 10.833  171.810 129.995 1.00 46.01  ? 85   VAL C CB  1 
ATOM   5522  C  CG1 . VAL C  1 85  ? 11.564  170.976 131.048 1.00 34.73  ? 85   VAL C CG1 1 
ATOM   5523  C  CG2 . VAL C  1 85  ? 11.452  171.615 128.618 1.00 34.52  ? 85   VAL C CG2 1 
ATOM   5524  N  N   . HIS C  1 86  ? 8.411   172.570 131.946 1.00 35.98  ? 86   HIS C N   1 
ATOM   5525  C  CA  . HIS C  1 86  ? 7.926   172.606 133.322 1.00 36.34  ? 86   HIS C CA  1 
ATOM   5526  C  C   . HIS C  1 86  ? 6.666   171.762 133.485 1.00 38.95  ? 86   HIS C C   1 
ATOM   5527  O  O   . HIS C  1 86  ? 6.503   171.066 134.494 1.00 43.64  ? 86   HIS C O   1 
ATOM   5528  C  CB  . HIS C  1 86  ? 7.662   174.055 133.768 1.00 37.07  ? 86   HIS C CB  1 
ATOM   5529  C  CG  . HIS C  1 86  ? 7.206   174.153 135.192 1.00 46.31  ? 86   HIS C CG  1 
ATOM   5530  N  ND1 . HIS C  1 86  ? 5.875   174.155 135.551 1.00 47.61  ? 86   HIS C ND1 1 
ATOM   5531  C  CD2 . HIS C  1 86  ? 7.908   174.198 136.353 1.00 45.78  ? 86   HIS C CD2 1 
ATOM   5532  C  CE1 . HIS C  1 86  ? 5.775   174.200 136.869 1.00 48.80  ? 86   HIS C CE1 1 
ATOM   5533  N  NE2 . HIS C  1 86  ? 6.994   174.228 137.380 1.00 47.75  ? 86   HIS C NE2 1 
ATOM   5534  N  N   . SER C  1 87  ? 5.777   171.785 132.490 1.00 44.51  ? 87   SER C N   1 
ATOM   5535  C  CA  . SER C  1 87  ? 4.555   170.986 132.574 1.00 43.17  ? 87   SER C CA  1 
ATOM   5536  C  C   . SER C  1 87  ? 4.873   169.497 132.686 1.00 40.13  ? 87   SER C C   1 
ATOM   5537  O  O   . SER C  1 87  ? 4.292   168.783 133.514 1.00 35.36  ? 87   SER C O   1 
ATOM   5538  C  CB  . SER C  1 87  ? 3.667   171.252 131.359 1.00 38.81  ? 87   SER C CB  1 
ATOM   5539  O  OG  . SER C  1 87  ? 3.227   172.589 131.340 1.00 41.92  ? 87   SER C OG  1 
ATOM   5540  N  N   . HIS C  1 88  ? 5.802   169.014 131.865 1.00 34.90  ? 88   HIS C N   1 
ATOM   5541  C  CA  . HIS C  1 88  ? 6.152   167.603 131.921 1.00 34.31  ? 88   HIS C CA  1 
ATOM   5542  C  C   . HIS C  1 88  ? 6.806   167.256 133.252 1.00 45.34  ? 88   HIS C C   1 
ATOM   5543  O  O   . HIS C  1 88  ? 6.397   166.298 133.922 1.00 34.59  ? 88   HIS C O   1 
ATOM   5544  C  CB  . HIS C  1 88  ? 7.073   167.256 130.753 1.00 33.81  ? 88   HIS C CB  1 
ATOM   5545  C  CG  . HIS C  1 88  ? 7.471   165.816 130.698 1.00 44.05  ? 88   HIS C CG  1 
ATOM   5546  N  ND1 . HIS C  1 88  ? 8.776   165.401 130.844 1.00 46.91  ? 88   HIS C ND1 1 
ATOM   5547  C  CD2 . HIS C  1 88  ? 6.740   164.692 130.511 1.00 44.16  ? 88   HIS C CD2 1 
ATOM   5548  C  CE1 . HIS C  1 88  ? 8.836   164.085 130.734 1.00 43.31  ? 88   HIS C CE1 1 
ATOM   5549  N  NE2 . HIS C  1 88  ? 7.614   163.631 130.531 1.00 45.77  ? 88   HIS C NE2 1 
ATOM   5550  N  N   . GLU C  1 89  ? 7.787   168.060 133.676 1.00 34.61  ? 89   GLU C N   1 
ATOM   5551  C  CA  . GLU C  1 89  ? 8.482   167.787 134.931 1.00 34.89  ? 89   GLU C CA  1 
ATOM   5552  C  C   . GLU C  1 89  ? 7.533   167.861 136.123 1.00 35.22  ? 89   GLU C C   1 
ATOM   5553  O  O   . GLU C  1 89  ? 7.648   167.071 137.072 1.00 35.51  ? 89   GLU C O   1 
ATOM   5554  C  CB  . GLU C  1 89  ? 9.645   168.761 135.106 1.00 34.92  ? 89   GLU C CB  1 
ATOM   5555  C  CG  . GLU C  1 89  ? 10.762  168.574 134.079 1.00 43.29  ? 89   GLU C CG  1 
ATOM   5556  C  CD  . GLU C  1 89  ? 11.516  167.259 134.242 1.00 43.36  ? 89   GLU C CD  1 
ATOM   5557  O  OE1 . GLU C  1 89  ? 11.728  166.832 135.393 1.00 44.87  ? 89   GLU C OE1 1 
ATOM   5558  O  OE2 . GLU C  1 89  ? 11.888  166.645 133.217 1.00 37.01  ? 89   GLU C OE2 1 
ATOM   5559  N  N   . GLU C  1 90  ? 6.594   168.806 136.098 1.00 35.57  ? 90   GLU C N   1 
ATOM   5560  C  CA  . GLU C  1 90  ? 5.648   168.929 137.205 1.00 42.07  ? 90   GLU C CA  1 
ATOM   5561  C  C   . GLU C  1 90  ? 4.704   167.731 137.245 1.00 41.54  ? 90   GLU C C   1 
ATOM   5562  O  O   . GLU C  1 90  ? 4.397   167.202 138.320 1.00 37.12  ? 90   GLU C O   1 
ATOM   5563  C  CB  . GLU C  1 90  ? 4.865   170.244 137.077 1.00 40.88  ? 90   GLU C CB  1 
ATOM   5564  C  CG  . GLU C  1 90  ? 3.895   170.537 138.222 1.00 49.25  ? 90   GLU C CG  1 
ATOM   5565  C  CD  . GLU C  1 90  ? 3.284   171.937 138.127 1.00 57.12  ? 90   GLU C CD  1 
ATOM   5566  O  OE1 . GLU C  1 90  ? 2.575   172.217 137.139 1.00 58.08  ? 90   GLU C OE1 1 
ATOM   5567  O  OE2 . GLU C  1 90  ? 3.542   172.770 139.023 1.00 59.87  ? 90   GLU C OE2 1 
ATOM   5568  N  N   . MET C  1 91  ? 4.224   167.300 136.082 1.00 35.32  ? 91   MET C N   1 
ATOM   5569  C  CA  . MET C  1 91  ? 3.390   166.108 136.027 1.00 39.19  ? 91   MET C CA  1 
ATOM   5570  C  C   . MET C  1 91  ? 4.134   164.912 136.598 1.00 39.59  ? 91   MET C C   1 
ATOM   5571  O  O   . MET C  1 91  ? 3.587   164.152 137.405 1.00 43.82  ? 91   MET C O   1 
ATOM   5572  C  CB  . MET C  1 91  ? 2.931   165.862 134.588 1.00 44.60  ? 91   MET C CB  1 
ATOM   5573  C  CG  . MET C  1 91  ? 1.927   164.725 134.415 1.00 46.60  ? 91   MET C CG  1 
ATOM   5574  S  SD  . MET C  1 91  ? 2.716   163.083 134.417 1.00 56.11  ? 91   MET C SD  1 
ATOM   5575  C  CE  . MET C  1 91  ? 3.953   163.244 133.120 1.00 53.33  ? 91   MET C CE  1 
ATOM   5576  N  N   . HIS C  1 92  ? 5.390   164.724 136.188 1.00 38.83  ? 92   HIS C N   1 
ATOM   5577  C  CA  . HIS C  1 92  ? 6.165   163.607 136.718 1.00 37.66  ? 92   HIS C CA  1 
ATOM   5578  C  C   . HIS C  1 92  ? 6.304   163.708 138.228 1.00 36.03  ? 92   HIS C C   1 
ATOM   5579  O  O   . HIS C  1 92  ? 6.243   162.698 138.936 1.00 37.41  ? 92   HIS C O   1 
ATOM   5580  C  CB  . HIS C  1 92  ? 7.543   163.553 136.061 1.00 47.67  ? 92   HIS C CB  1 
ATOM   5581  C  CG  . HIS C  1 92  ? 7.582   162.712 134.828 1.00 56.00  ? 92   HIS C CG  1 
ATOM   5582  N  ND1 . HIS C  1 92  ? 7.351   161.353 134.848 1.00 55.35  ? 92   HIS C ND1 1 
ATOM   5583  C  CD2 . HIS C  1 92  ? 7.828   163.035 133.537 1.00 58.80  ? 92   HIS C CD2 1 
ATOM   5584  C  CE1 . HIS C  1 92  ? 7.447   160.875 133.620 1.00 58.12  ? 92   HIS C CE1 1 
ATOM   5585  N  NE2 . HIS C  1 92  ? 7.736   161.875 132.805 1.00 62.33  ? 92   HIS C NE2 1 
ATOM   5586  N  N   . HIS C  1 93  ? 6.494   164.927 138.737 1.00 36.49  ? 93   HIS C N   1 
ATOM   5587  C  CA  . HIS C  1 93  ? 6.609   165.121 140.174 1.00 36.60  ? 93   HIS C CA  1 
ATOM   5588  C  C   . HIS C  1 93  ? 5.283   164.843 140.877 1.00 41.97  ? 93   HIS C C   1 
ATOM   5589  O  O   . HIS C  1 93  ? 5.230   164.083 141.851 1.00 43.53  ? 93   HIS C O   1 
ATOM   5590  C  CB  . HIS C  1 93  ? 7.070   166.548 140.479 1.00 35.54  ? 93   HIS C CB  1 
ATOM   5591  C  CG  . HIS C  1 93  ? 7.085   166.852 141.941 1.00 39.17  ? 93   HIS C CG  1 
ATOM   5592  N  ND1 . HIS C  1 93  ? 5.977   167.315 142.619 1.00 40.21  ? 93   HIS C ND1 1 
ATOM   5593  C  CD2 . HIS C  1 93  ? 8.060   166.690 142.870 1.00 38.21  ? 93   HIS C CD2 1 
ATOM   5594  C  CE1 . HIS C  1 93  ? 6.278   167.450 143.899 1.00 42.76  ? 93   HIS C CE1 1 
ATOM   5595  N  NE2 . HIS C  1 93  ? 7.534   167.073 144.079 1.00 41.89  ? 93   HIS C NE2 1 
ATOM   5596  N  N   . ASP C  1 94  ? 4.199   165.456 140.397 1.00 35.52  ? 94   ASP C N   1 
ATOM   5597  C  CA  . ASP C  1 94  ? 2.902   165.341 141.059 1.00 40.75  ? 94   ASP C CA  1 
ATOM   5598  C  C   . ASP C  1 94  ? 2.363   163.915 141.043 1.00 42.63  ? 94   ASP C C   1 
ATOM   5599  O  O   . ASP C  1 94  ? 1.533   163.570 141.885 1.00 46.15  ? 94   ASP C O   1 
ATOM   5600  C  CB  . ASP C  1 94  ? 1.892   166.269 140.382 1.00 36.98  ? 94   ASP C CB  1 
ATOM   5601  C  CG  . ASP C  1 94  ? 2.240   167.748 140.556 1.00 49.11  ? 94   ASP C CG  1 
ATOM   5602  O  OD1 . ASP C  1 94  ? 3.145   168.063 141.366 1.00 46.85  ? 94   ASP C OD1 1 
ATOM   5603  O  OD2 . ASP C  1 94  ? 1.625   168.589 139.855 1.00 51.70  ? 94   ASP C OD2 1 
ATOM   5604  N  N   . ASN C  1 95  ? 2.800   163.090 140.093 1.00 40.67  ? 95   ASN C N   1 
ATOM   5605  C  CA  . ASN C  1 95  ? 2.314   161.730 139.932 1.00 36.29  ? 95   ASN C CA  1 
ATOM   5606  C  C   . ASN C  1 95  ? 3.421   160.700 140.093 1.00 38.16  ? 95   ASN C C   1 
ATOM   5607  O  O   . ASN C  1 95  ? 3.329   159.592 139.559 1.00 36.09  ? 95   ASN C O   1 
ATOM   5608  C  CB  . ASN C  1 95  ? 1.636   161.595 138.576 1.00 42.95  ? 95   ASN C CB  1 
ATOM   5609  C  CG  . ASN C  1 95  ? 0.468   162.546 138.435 1.00 47.07  ? 95   ASN C CG  1 
ATOM   5610  O  OD1 . ASN C  1 95  ? 0.527   163.529 137.687 1.00 48.76  ? 95   ASN C OD1 1 
ATOM   5611  N  ND2 . ASN C  1 95  ? -0.587  162.288 139.203 1.00 43.17  ? 95   ASN C ND2 1 
ATOM   5612  N  N   . PHE C  1 96  ? 4.460   161.046 140.856 1.00 41.92  ? 96   PHE C N   1 
ATOM   5613  C  CA  . PHE C  1 96  ? 5.651   160.206 140.914 1.00 35.69  ? 96   PHE C CA  1 
ATOM   5614  C  C   . PHE C  1 96  ? 5.324   158.818 141.461 1.00 33.02  ? 96   PHE C C   1 
ATOM   5615  O  O   . PHE C  1 96  ? 5.753   157.810 140.897 1.00 35.91  ? 96   PHE C O   1 
ATOM   5616  C  CB  . PHE C  1 96  ? 6.732   160.902 141.744 1.00 33.95  ? 96   PHE C CB  1 
ATOM   5617  C  CG  . PHE C  1 96  ? 8.025   160.163 141.778 1.00 36.26  ? 96   PHE C CG  1 
ATOM   5618  C  CD1 . PHE C  1 96  ? 8.816   160.069 140.644 1.00 39.12  ? 96   PHE C CD1 1 
ATOM   5619  C  CD2 . PHE C  1 96  ? 8.455   159.555 142.942 1.00 41.56  ? 96   PHE C CD2 1 
ATOM   5620  C  CE1 . PHE C  1 96  ? 10.024  159.376 140.678 1.00 41.09  ? 96   PHE C CE1 1 
ATOM   5621  C  CE2 . PHE C  1 96  ? 9.652   158.861 142.981 1.00 42.20  ? 96   PHE C CE2 1 
ATOM   5622  C  CZ  . PHE C  1 96  ? 10.436  158.771 141.844 1.00 37.63  ? 96   PHE C CZ  1 
ATOM   5623  N  N   . LYS C  1 97  ? 4.552   158.746 142.555 1.00 33.35  ? 97   LYS C N   1 
ATOM   5624  C  CA  . LYS C  1 97  ? 4.200   157.447 143.128 1.00 40.79  ? 97   LYS C CA  1 
ATOM   5625  C  C   . LYS C  1 97  ? 3.441   156.589 142.126 1.00 40.91  ? 97   LYS C C   1 
ATOM   5626  O  O   . LYS C  1 97  ? 3.709   155.391 141.997 1.00 37.36  ? 97   LYS C O   1 
ATOM   5627  C  CB  . LYS C  1 97  ? 3.346   157.604 144.384 1.00 45.26  ? 97   LYS C CB  1 
ATOM   5628  C  CG  . LYS C  1 97  ? 4.004   158.173 145.615 1.00 56.63  ? 97   LYS C CG  1 
ATOM   5629  C  CD  . LYS C  1 97  ? 2.934   158.867 146.472 1.00 67.36  ? 97   LYS C CD  1 
ATOM   5630  C  CE  . LYS C  1 97  ? 1.524   158.278 146.228 1.00 76.97  ? 97   LYS C CE  1 
ATOM   5631  N  NZ  . LYS C  1 97  ? 0.367   159.247 146.328 1.00 78.52  ? 97   LYS C NZ  1 
ATOM   5632  N  N   . GLU C  1 98  ? 2.474   157.184 141.421 1.00 39.57  ? 98   GLU C N   1 
ATOM   5633  C  CA  . GLU C  1 98  ? 1.621   156.393 140.541 1.00 41.65  ? 98   GLU C CA  1 
ATOM   5634  C  C   . GLU C  1 98  ? 2.371   155.989 139.278 1.00 43.41  ? 98   GLU C C   1 
ATOM   5635  O  O   . GLU C  1 98  ? 2.306   154.827 138.857 1.00 40.84  ? 98   GLU C O   1 
ATOM   5636  C  CB  . GLU C  1 98  ? 0.304   157.143 140.226 1.00 34.33  ? 98   GLU C CB  1 
ATOM   5637  C  CG  . GLU C  1 98  ? 0.298   158.653 140.423 1.00 54.98  ? 98   GLU C CG  1 
ATOM   5638  C  CD  . GLU C  1 98  ? 0.286   159.114 141.882 1.00 50.29  ? 98   GLU C CD  1 
ATOM   5639  O  OE1 . GLU C  1 98  ? -0.748  158.988 142.565 1.00 50.37  ? 98   GLU C OE1 1 
ATOM   5640  O  OE2 . GLU C  1 98  ? 1.328   159.628 142.340 1.00 54.53  ? 98   GLU C OE2 1 
ATOM   5641  N  N   . ILE C  1 99  ? 3.145   156.907 138.699 1.00 37.37  ? 99   ILE C N   1 
ATOM   5642  C  CA  . ILE C  1 99  ? 3.965   156.549 137.546 1.00 39.92  ? 99   ILE C CA  1 
ATOM   5643  C  C   . ILE C  1 99  ? 4.980   155.474 137.932 1.00 36.09  ? 99   ILE C C   1 
ATOM   5644  O  O   . ILE C  1 99  ? 5.205   154.513 137.187 1.00 37.58  ? 99   ILE C O   1 
ATOM   5645  C  CB  . ILE C  1 99  ? 4.628   157.811 136.962 1.00 40.65  ? 99   ILE C CB  1 
ATOM   5646  C  CG1 . ILE C  1 99  ? 3.562   158.681 136.309 1.00 38.22  ? 99   ILE C CG1 1 
ATOM   5647  C  CG2 . ILE C  1 99  ? 5.681   157.451 135.931 1.00 36.17  ? 99   ILE C CG2 1 
ATOM   5648  C  CD1 . ILE C  1 99  ? 4.063   160.066 135.932 1.00 47.35  ? 99   ILE C CD1 1 
ATOM   5649  N  N   . PHE C  1 100 ? 5.562   155.578 139.126 1.00 36.08  ? 100  PHE C N   1 
ATOM   5650  C  CA  . PHE C  1 100 ? 6.495   154.540 139.550 1.00 38.16  ? 100  PHE C CA  1 
ATOM   5651  C  C   . PHE C  1 100 ? 5.807   153.182 139.663 1.00 38.10  ? 100  PHE C C   1 
ATOM   5652  O  O   . PHE C  1 100 ? 6.337   152.167 139.199 1.00 41.20  ? 100  PHE C O   1 
ATOM   5653  C  CB  . PHE C  1 100 ? 7.152   154.919 140.871 1.00 38.98  ? 100  PHE C CB  1 
ATOM   5654  C  CG  . PHE C  1 100 ? 8.144   153.899 141.348 1.00 40.31  ? 100  PHE C CG  1 
ATOM   5655  C  CD1 . PHE C  1 100 ? 9.435   153.895 140.845 1.00 39.69  ? 100  PHE C CD1 1 
ATOM   5656  C  CD2 . PHE C  1 100 ? 7.779   152.939 142.293 1.00 37.32  ? 100  PHE C CD2 1 
ATOM   5657  C  CE1 . PHE C  1 100 ? 10.354  152.953 141.280 1.00 42.47  ? 100  PHE C CE1 1 
ATOM   5658  C  CE2 . PHE C  1 100 ? 8.682   151.996 142.732 1.00 41.41  ? 100  PHE C CE2 1 
ATOM   5659  C  CZ  . PHE C  1 100 ? 9.979   152.000 142.228 1.00 42.63  ? 100  PHE C CZ  1 
ATOM   5660  N  N   . GLU C  1 101 ? 4.618   153.147 140.260 1.00 35.95  ? 101  GLU C N   1 
ATOM   5661  C  CA  . GLU C  1 101 ? 3.903   151.886 140.372 1.00 39.50  ? 101  GLU C CA  1 
ATOM   5662  C  C   . GLU C  1 101 ? 3.645   151.285 138.992 1.00 42.43  ? 101  GLU C C   1 
ATOM   5663  O  O   . GLU C  1 101 ? 3.832   150.080 138.781 1.00 46.70  ? 101  GLU C O   1 
ATOM   5664  C  CB  . GLU C  1 101 ? 2.582   152.090 141.129 1.00 41.81  ? 101  GLU C CB  1 
ATOM   5665  C  CG  . GLU C  1 101 ? 1.787   150.790 141.285 1.00 43.33  ? 101  GLU C CG  1 
ATOM   5666  C  CD  . GLU C  1 101 ? 0.301   150.976 141.628 1.00 48.10  ? 101  GLU C CD  1 
ATOM   5667  O  OE1 . GLU C  1 101 ? -0.218  152.120 141.590 1.00 36.31  ? 101  GLU C OE1 1 
ATOM   5668  O  OE2 . GLU C  1 101 ? -0.359  149.944 141.898 1.00 42.54  ? 101  GLU C OE2 1 
ATOM   5669  N  N   . LEU C  1 102 ? 3.217   152.103 138.041 1.00 37.57  ? 102  LEU C N   1 
ATOM   5670  C  CA  . LEU C  1 102 ? 2.878   151.587 136.724 1.00 36.32  ? 102  LEU C CA  1 
ATOM   5671  C  C   . LEU C  1 102 ? 4.120   151.129 135.951 1.00 45.18  ? 102  LEU C C   1 
ATOM   5672  O  O   . LEU C  1 102 ? 4.121   150.062 135.351 1.00 41.63  ? 102  LEU C O   1 
ATOM   5673  C  CB  . LEU C  1 102 ? 2.101   152.634 135.924 1.00 33.20  ? 102  LEU C CB  1 
ATOM   5674  C  CG  . LEU C  1 102 ? 0.735   152.991 136.540 1.00 40.73  ? 102  LEU C CG  1 
ATOM   5675  C  CD1 . LEU C  1 102 ? 0.091   154.204 135.845 1.00 48.11  ? 102  LEU C CD1 1 
ATOM   5676  C  CD2 . LEU C  1 102 ? -0.213  151.823 136.530 1.00 33.37  ? 102  LEU C CD2 1 
HETATM 5677  N  N   . CSS C  1 103 ? 5.176   151.930 135.978 1.00 49.93  ? 103  CSS C N   1 
HETATM 5678  C  CA  . CSS C  1 103 ? 6.327   151.628 135.191 1.00 57.13  ? 103  CSS C CA  1 
HETATM 5679  C  CB  . CSS C  1 103 ? 7.199   152.839 135.019 1.00 63.85  ? 103  CSS C CB  1 
HETATM 5680  S  SG  . CSS C  1 103 ? 6.446   153.909 133.811 1.00 76.65  ? 103  CSS C SG  1 
HETATM 5681  S  SD  . CSS C  1 103 ? 5.925   152.887 132.152 0.50 69.16  ? 103  CSS C SD  1 
HETATM 5682  C  C   . CSS C  1 103 ? 7.058   150.487 135.814 1.00 59.79  ? 103  CSS C C   1 
HETATM 5683  O  O   . CSS C  1 103 ? 7.799   149.779 135.095 1.00 63.52  ? 103  CSS C O   1 
ATOM   5684  N  N   . SER C  1 104 ? 6.884   150.269 137.117 1.00 65.54  ? 104  SER C N   1 
ATOM   5685  C  CA  . SER C  1 104 ? 7.457   149.093 137.779 1.00 59.00  ? 104  SER C CA  1 
ATOM   5686  C  C   . SER C  1 104 ? 6.956   147.803 137.140 1.00 60.71  ? 104  SER C C   1 
ATOM   5687  O  O   . SER C  1 104 ? 7.684   146.819 137.068 1.00 66.24  ? 104  SER C O   1 
ATOM   5688  C  CB  . SER C  1 104 ? 7.150   149.087 139.273 1.00 55.47  ? 104  SER C CB  1 
ATOM   5689  O  OG  . SER C  1 104 ? 8.107   149.855 139.971 1.00 57.73  ? 104  SER C OG  1 
ATOM   5690  N  N   . GLY C  1 105 ? 5.696   147.800 136.705 1.00 61.31  ? 105  GLY C N   1 
ATOM   5691  C  CA  . GLY C  1 105 ? 5.204   146.674 135.928 1.00 64.95  ? 105  GLY C CA  1 
ATOM   5692  C  C   . GLY C  1 105 ? 5.880   146.553 134.574 1.00 69.56  ? 105  GLY C C   1 
ATOM   5693  O  O   . GLY C  1 105 ? 6.221   145.450 134.138 1.00 81.39  ? 105  GLY C O   1 
ATOM   5694  N  N   . CYS C  1 106 ? 6.129   147.685 133.911 1.00 61.01  ? 106  CYS C N   1 
ATOM   5695  C  CA  . CYS C  1 106 ? 6.726   147.661 132.578 1.00 63.32  ? 106  CYS C CA  1 
ATOM   5696  C  C   . CYS C  1 106 ? 8.190   147.229 132.592 1.00 58.21  ? 106  CYS C C   1 
ATOM   5697  O  O   . CYS C  1 106 ? 8.703   146.818 131.548 1.00 59.27  ? 106  CYS C O   1 
ATOM   5698  C  CB  . CYS C  1 106 ? 6.584   149.028 131.905 1.00 70.76  ? 106  CYS C CB  1 
ATOM   5699  S  SG  . CYS C  1 106 ? 4.865   149.447 131.453 1.00 80.99  ? 106  CYS C SG  1 
ATOM   5700  N  N   . LEU C  1 107 ? 8.884   147.355 133.727 1.00 49.09  ? 107  LEU C N   1 
ATOM   5701  C  CA  . LEU C  1 107 ? 10.299  147.003 133.773 1.00 53.49  ? 107  LEU C CA  1 
ATOM   5702  C  C   . LEU C  1 107 ? 10.538  145.522 133.500 1.00 49.36  ? 107  LEU C C   1 
ATOM   5703  O  O   . LEU C  1 107 ? 11.644  145.153 133.093 1.00 49.60  ? 107  LEU C O   1 
ATOM   5704  C  CB  . LEU C  1 107 ? 10.897  147.381 135.128 1.00 49.30  ? 107  LEU C CB  1 
ATOM   5705  C  CG  . LEU C  1 107 ? 11.141  148.882 135.302 1.00 55.12  ? 107  LEU C CG  1 
ATOM   5706  C  CD1 . LEU C  1 107 ? 11.772  149.192 136.648 1.00 55.48  ? 107  LEU C CD1 1 
ATOM   5707  C  CD2 . LEU C  1 107 ? 11.994  149.429 134.169 1.00 53.20  ? 107  LEU C CD2 1 
ATOM   5708  N  N   . GLY C  1 108 ? 9.532   144.672 133.704 1.00 40.79  ? 108  GLY C N   1 
ATOM   5709  C  CA  . GLY C  1 108 ? 9.666   143.258 133.377 1.00 42.21  ? 108  GLY C CA  1 
ATOM   5710  C  C   . GLY C  1 108 ? 9.809   142.963 131.900 1.00 42.57  ? 108  GLY C C   1 
ATOM   5711  O  O   . GLY C  1 108 ? 10.100  141.819 131.539 1.00 45.51  ? 108  GLY C O   1 
ATOM   5712  N  N   . MET C  1 109 ? 9.573   143.949 131.040 1.00 43.55  ? 109  MET C N   1 
ATOM   5713  C  CA  . MET C  1 109 ? 9.754   143.782 129.608 1.00 39.92  ? 109  MET C CA  1 
ATOM   5714  C  C   . MET C  1 109 ? 10.857  144.674 129.058 1.00 35.40  ? 109  MET C C   1 
ATOM   5715  O  O   . MET C  1 109 ? 11.138  144.636 127.856 1.00 34.50  ? 109  MET C O   1 
ATOM   5716  C  CB  . MET C  1 109 ? 8.436   144.049 128.866 1.00 39.83  ? 109  MET C CB  1 
ATOM   5717  C  CG  . MET C  1 109 ? 8.013   145.504 128.816 1.00 49.36  ? 109  MET C CG  1 
ATOM   5718  S  SD  . MET C  1 109 ? 6.474   145.781 127.881 1.00 62.89  ? 109  MET C SD  1 
ATOM   5719  C  CE  . MET C  1 109 ? 6.223   147.540 128.150 1.00 63.80  ? 109  MET C CE  1 
ATOM   5720  N  N   . VAL C  1 110 ? 11.504  145.448 129.894 1.00 35.38  ? 110  VAL C N   1 
ATOM   5721  C  CA  . VAL C  1 110 ? 12.483  146.407 129.424 1.00 38.75  ? 110  VAL C CA  1 
ATOM   5722  C  C   . VAL C  1 110 ? 13.828  145.718 129.299 1.00 31.86  ? 110  VAL C C   1 
ATOM   5723  O  O   . VAL C  1 110 ? 14.287  145.041 130.227 1.00 34.68  ? 110  VAL C O   1 
ATOM   5724  C  CB  . VAL C  1 110 ? 12.563  147.621 130.365 1.00 35.91  ? 110  VAL C CB  1 
ATOM   5725  C  CG1 . VAL C  1 110 ? 13.752  148.474 129.997 1.00 36.83  ? 110  VAL C CG1 1 
ATOM   5726  C  CG2 . VAL C  1 110 ? 11.276  148.409 130.279 1.00 37.59  ? 110  VAL C CG2 1 
ATOM   5727  N  N   . ILE C  1 111 ? 14.441  145.878 128.134 1.00 26.70  ? 111  ILE C N   1 
ATOM   5728  C  CA  . ILE C  1 111 ? 15.795  145.427 127.898 1.00 31.32  ? 111  ILE C CA  1 
ATOM   5729  C  C   . ILE C  1 111 ? 16.770  146.593 127.877 1.00 39.26  ? 111  ILE C C   1 
ATOM   5730  O  O   . ILE C  1 111 ? 17.920  146.437 128.305 1.00 45.16  ? 111  ILE C O   1 
ATOM   5731  C  CB  . ILE C  1 111 ? 15.852  144.627 126.580 1.00 32.51  ? 111  ILE C CB  1 
ATOM   5732  C  CG1 . ILE C  1 111 ? 15.156  143.280 126.779 1.00 36.62  ? 111  ILE C CG1 1 
ATOM   5733  C  CG2 . ILE C  1 111 ? 17.303  144.479 126.030 1.00 28.25  ? 111  ILE C CG2 1 
ATOM   5734  C  CD1 . ILE C  1 111 ? 14.854  142.580 125.509 1.00 38.62  ? 111  ILE C CD1 1 
ATOM   5735  N  N   . GLU C  1 112 ? 16.327  147.770 127.450 1.00 38.09  ? 112  GLU C N   1 
ATOM   5736  C  CA  . GLU C  1 112 ? 17.166  148.962 127.447 1.00 41.36  ? 112  GLU C CA  1 
ATOM   5737  C  C   . GLU C  1 112 ? 16.259  150.174 127.632 1.00 42.21  ? 112  GLU C C   1 
ATOM   5738  O  O   . GLU C  1 112 ? 15.108  150.169 127.188 1.00 38.78  ? 112  GLU C O   1 
ATOM   5739  C  CB  . GLU C  1 112 ? 17.966  149.033 126.140 1.00 45.75  ? 112  GLU C CB  1 
ATOM   5740  C  CG  . GLU C  1 112 ? 19.150  149.949 126.139 1.00 63.84  ? 112  GLU C CG  1 
ATOM   5741  C  CD  . GLU C  1 112 ? 19.961  149.810 124.865 1.00 72.86  ? 112  GLU C CD  1 
ATOM   5742  O  OE1 . GLU C  1 112 ? 19.595  148.966 124.012 1.00 69.80  ? 112  GLU C OE1 1 
ATOM   5743  O  OE2 . GLU C  1 112 ? 20.952  150.555 124.714 1.00 82.12  ? 112  GLU C OE2 1 
ATOM   5744  N  N   . GLY C  1 113 ? 16.767  151.204 128.319 1.00 43.02  ? 113  GLY C N   1 
ATOM   5745  C  CA  . GLY C  1 113 ? 15.984  152.390 128.603 1.00 41.74  ? 113  GLY C CA  1 
ATOM   5746  C  C   . GLY C  1 113 ? 15.276  152.309 129.944 1.00 43.42  ? 113  GLY C C   1 
ATOM   5747  O  O   . GLY C  1 113 ? 15.469  151.360 130.710 1.00 40.29  ? 113  GLY C O   1 
ATOM   5748  N  N   . PRO C  1 114 ? 14.371  153.261 130.226 1.00 41.16  ? 114  PRO C N   1 
ATOM   5749  C  CA  . PRO C  1 114 ? 13.949  154.351 129.349 1.00 38.54  ? 114  PRO C CA  1 
ATOM   5750  C  C   . PRO C  1 114 ? 14.954  155.489 129.330 1.00 42.76  ? 114  PRO C C   1 
ATOM   5751  O  O   . PRO C  1 114 ? 15.697  155.687 130.288 1.00 38.52  ? 114  PRO C O   1 
ATOM   5752  C  CB  . PRO C  1 114 ? 12.635  154.800 129.984 1.00 35.47  ? 114  PRO C CB  1 
ATOM   5753  C  CG  . PRO C  1 114 ? 12.896  154.632 131.446 1.00 40.37  ? 114  PRO C CG  1 
ATOM   5754  C  CD  . PRO C  1 114 ? 13.745  153.378 131.558 1.00 36.83  ? 114  PRO C CD  1 
ATOM   5755  N  N   . TRP C  1 115 ? 15.005  156.203 128.215 1.00 40.31  ? 115  TRP C N   1 
ATOM   5756  C  CA  . TRP C  1 115 ? 15.774  157.433 128.110 1.00 41.08  ? 115  TRP C CA  1 
ATOM   5757  C  C   . TRP C  1 115 ? 14.847  158.456 127.474 1.00 38.35  ? 115  TRP C C   1 
ATOM   5758  O  O   . TRP C  1 115 ? 14.256  158.178 126.424 1.00 39.66  ? 115  TRP C O   1 
ATOM   5759  C  CB  . TRP C  1 115 ? 17.050  157.220 127.282 1.00 37.31  ? 115  TRP C CB  1 
ATOM   5760  C  CG  . TRP C  1 115 ? 17.987  158.387 127.280 1.00 33.47  ? 115  TRP C CG  1 
ATOM   5761  C  CD1 . TRP C  1 115 ? 18.314  159.164 126.205 1.00 30.59  ? 115  TRP C CD1 1 
ATOM   5762  C  CD2 . TRP C  1 115 ? 18.729  158.916 128.399 1.00 33.05  ? 115  TRP C CD2 1 
ATOM   5763  N  NE1 . TRP C  1 115 ? 19.216  160.129 126.574 1.00 33.58  ? 115  TRP C NE1 1 
ATOM   5764  C  CE2 . TRP C  1 115 ? 19.490  160.007 127.913 1.00 39.91  ? 115  TRP C CE2 1 
ATOM   5765  C  CE3 . TRP C  1 115 ? 18.830  158.571 129.756 1.00 35.94  ? 115  TRP C CE3 1 
ATOM   5766  C  CZ2 . TRP C  1 115 ? 20.348  160.765 128.738 1.00 38.67  ? 115  TRP C CZ2 1 
ATOM   5767  C  CZ3 . TRP C  1 115 ? 19.685  159.327 130.578 1.00 39.72  ? 115  TRP C CZ3 1 
ATOM   5768  C  CH2 . TRP C  1 115 ? 20.428  160.414 130.060 1.00 40.44  ? 115  TRP C CH2 1 
ATOM   5769  N  N   . GLU C  1 116 ? 14.658  159.608 128.125 1.00 32.86  ? 116  GLU C N   1 
ATOM   5770  C  CA  . GLU C  1 116 ? 13.620  160.548 127.698 1.00 38.29  ? 116  GLU C CA  1 
ATOM   5771  C  C   . GLU C  1 116 ? 14.181  161.939 127.409 1.00 38.68  ? 116  GLU C C   1 
ATOM   5772  O  O   . GLU C  1 116 ? 14.097  162.847 128.253 1.00 34.13  ? 116  GLU C O   1 
ATOM   5773  C  CB  . GLU C  1 116 ? 12.492  160.632 128.725 1.00 35.63  ? 116  GLU C CB  1 
ATOM   5774  C  CG  . GLU C  1 116 ? 11.252  161.278 128.118 1.00 40.60  ? 116  GLU C CG  1 
ATOM   5775  C  CD  . GLU C  1 116 ? 10.083  161.418 129.095 1.00 46.25  ? 116  GLU C CD  1 
ATOM   5776  O  OE1 . GLU C  1 116 ? 10.325  161.717 130.289 1.00 36.43  ? 116  GLU C OE1 1 
ATOM   5777  O  OE2 . GLU C  1 116 ? 8.920   161.260 128.648 1.00 53.92  ? 116  GLU C OE2 1 
ATOM   5778  N  N   . PRO C  1 117 ? 14.700  162.161 126.205 1.00 34.72  ? 117  PRO C N   1 
ATOM   5779  C  CA  . PRO C  1 117 ? 15.143  163.503 125.828 1.00 34.11  ? 117  PRO C CA  1 
ATOM   5780  C  C   . PRO C  1 117 ? 13.956  164.382 125.469 1.00 37.45  ? 117  PRO C C   1 
ATOM   5781  O  O   . PRO C  1 117 ? 12.873  163.910 125.101 1.00 34.50  ? 117  PRO C O   1 
ATOM   5782  C  CB  . PRO C  1 117 ? 16.031  163.268 124.594 1.00 34.58  ? 117  PRO C CB  1 
ATOM   5783  C  CG  . PRO C  1 117 ? 16.170  161.726 124.482 1.00 34.24  ? 117  PRO C CG  1 
ATOM   5784  C  CD  . PRO C  1 117 ? 14.962  161.177 125.142 1.00 31.82  ? 117  PRO C CD  1 
ATOM   5785  N  N   . TYR C  1 118 ? 14.196  165.681 125.596 1.00 32.79  ? 118  TYR C N   1 
ATOM   5786  C  CA  . TYR C  1 118 ? 13.289  166.750 125.196 1.00 36.83  ? 118  TYR C CA  1 
ATOM   5787  C  C   . TYR C  1 118 ? 13.667  167.249 123.805 1.00 42.74  ? 118  TYR C C   1 
ATOM   5788  O  O   . TYR C  1 118 ? 14.853  167.369 123.475 1.00 38.95  ? 118  TYR C O   1 
ATOM   5789  C  CB  . TYR C  1 118 ? 13.366  167.918 126.173 1.00 30.55  ? 118  TYR C CB  1 
ATOM   5790  C  CG  . TYR C  1 118 ? 12.703  167.705 127.505 1.00 36.38  ? 118  TYR C CG  1 
ATOM   5791  C  CD1 . TYR C  1 118 ? 11.318  167.747 127.619 1.00 29.42  ? 118  TYR C CD1 1 
ATOM   5792  C  CD2 . TYR C  1 118 ? 13.457  167.501 128.661 1.00 32.96  ? 118  TYR C CD2 1 
ATOM   5793  C  CE1 . TYR C  1 118 ? 10.693  167.595 128.843 1.00 31.24  ? 118  TYR C CE1 1 
ATOM   5794  C  CE2 . TYR C  1 118 ? 12.834  167.336 129.897 1.00 37.86  ? 118  TYR C CE2 1 
ATOM   5795  C  CZ  . TYR C  1 118 ? 11.450  167.390 129.974 1.00 36.68  ? 118  TYR C CZ  1 
ATOM   5796  O  OH  . TYR C  1 118 ? 10.808  167.234 131.174 1.00 37.44  ? 118  TYR C OH  1 
ATOM   5797  N  N   . PHE C  1 119 ? 12.659  167.515 122.984 1.00 33.82  ? 119  PHE C N   1 
ATOM   5798  C  CA  . PHE C  1 119 ? 12.882  167.914 121.604 1.00 30.94  ? 119  PHE C CA  1 
ATOM   5799  C  C   . PHE C  1 119 ? 12.140  169.191 121.283 1.00 36.24  ? 119  PHE C C   1 
ATOM   5800  O  O   . PHE C  1 119 ? 10.995  169.386 121.705 1.00 36.96  ? 119  PHE C O   1 
ATOM   5801  C  CB  . PHE C  1 119 ? 12.465  166.837 120.617 1.00 31.43  ? 119  PHE C CB  1 
ATOM   5802  C  CG  . PHE C  1 119 ? 13.370  165.648 120.620 1.00 39.54  ? 119  PHE C CG  1 
ATOM   5803  C  CD1 . PHE C  1 119 ? 13.181  164.623 121.520 1.00 37.29  ? 119  PHE C CD1 1 
ATOM   5804  C  CD2 . PHE C  1 119 ? 14.448  165.591 119.746 1.00 38.73  ? 119  PHE C CD2 1 
ATOM   5805  C  CE1 . PHE C  1 119 ? 14.040  163.532 121.526 1.00 36.02  ? 119  PHE C CE1 1 
ATOM   5806  C  CE2 . PHE C  1 119 ? 15.306  164.528 119.757 1.00 36.42  ? 119  PHE C CE2 1 
ATOM   5807  C  CZ  . PHE C  1 119 ? 15.103  163.486 120.647 1.00 37.56  ? 119  PHE C CZ  1 
ATOM   5808  N  N   . GLU C  1 120 ? 12.811  170.059 120.546 1.00 37.44  ? 120  GLU C N   1 
ATOM   5809  C  CA  . GLU C  1 120 ? 12.182  171.235 119.980 1.00 43.14  ? 120  GLU C CA  1 
ATOM   5810  C  C   . GLU C  1 120 ? 11.710  170.911 118.567 1.00 36.79  ? 120  GLU C C   1 
ATOM   5811  O  O   . GLU C  1 120 ? 12.426  170.265 117.797 1.00 37.54  ? 120  GLU C O   1 
ATOM   5812  C  CB  . GLU C  1 120 ? 13.166  172.407 119.967 1.00 46.61  ? 120  GLU C CB  1 
ATOM   5813  C  CG  . GLU C  1 120 ? 12.666  173.584 119.187 1.00 55.02  ? 120  GLU C CG  1 
ATOM   5814  C  CD  . GLU C  1 120 ? 13.737  174.624 118.929 1.00 61.95  ? 120  GLU C CD  1 
ATOM   5815  O  OE1 . GLU C  1 120 ? 14.873  174.470 119.433 1.00 52.71  ? 120  GLU C OE1 1 
ATOM   5816  O  OE2 . GLU C  1 120 ? 13.406  175.628 118.264 1.00 63.48  ? 120  GLU C OE2 1 
ATOM   5817  N  N   . VAL C  1 121 ? 10.497  171.342 118.229 1.00 36.31  ? 121  VAL C N   1 
ATOM   5818  C  CA  . VAL C  1 121 ? 9.984   171.150 116.873 1.00 44.04  ? 121  VAL C CA  1 
ATOM   5819  C  C   . VAL C  1 121 ? 10.536  172.297 116.033 1.00 50.51  ? 121  VAL C C   1 
ATOM   5820  O  O   . VAL C  1 121 ? 10.059  173.426 116.128 1.00 50.58  ? 121  VAL C O   1 
ATOM   5821  C  CB  . VAL C  1 121 ? 8.455   171.098 116.832 1.00 44.45  ? 121  VAL C CB  1 
ATOM   5822  C  CG1 . VAL C  1 121 ? 7.975   170.918 115.403 1.00 37.74  ? 121  VAL C CG1 1 
ATOM   5823  C  CG2 . VAL C  1 121 ? 7.938   169.954 117.704 1.00 39.93  ? 121  VAL C CG2 1 
ATOM   5824  N  N   . VAL C  1 122 ? 11.579  172.025 115.246 1.00 46.59  ? 122  VAL C N   1 
ATOM   5825  C  CA  . VAL C  1 122 ? 12.204  173.081 114.458 1.00 46.83  ? 122  VAL C CA  1 
ATOM   5826  C  C   . VAL C  1 122 ? 11.266  173.541 113.354 1.00 44.49  ? 122  VAL C C   1 
ATOM   5827  O  O   . VAL C  1 122 ? 11.069  174.737 113.143 1.00 45.72  ? 122  VAL C O   1 
ATOM   5828  C  CB  . VAL C  1 122 ? 13.543  172.602 113.878 1.00 49.03  ? 122  VAL C CB  1 
ATOM   5829  C  CG1 . VAL C  1 122 ? 14.095  173.656 112.961 1.00 52.47  ? 122  VAL C CG1 1 
ATOM   5830  C  CG2 . VAL C  1 122 ? 14.521  172.289 114.990 1.00 47.60  ? 122  VAL C CG2 1 
ATOM   5831  N  N   . LYS C  1 123 ? 10.691  172.595 112.627 1.00 48.51  ? 123  LYS C N   1 
ATOM   5832  C  CA  . LYS C  1 123 ? 9.738   172.877 111.566 1.00 45.36  ? 123  LYS C CA  1 
ATOM   5833  C  C   . LYS C  1 123 ? 8.960   171.601 111.314 1.00 48.42  ? 123  LYS C C   1 
ATOM   5834  O  O   . LYS C  1 123 ? 9.454   170.494 111.569 1.00 38.53  ? 123  LYS C O   1 
ATOM   5835  C  CB  . LYS C  1 123 ? 10.422  173.356 110.282 1.00 58.56  ? 123  LYS C CB  1 
ATOM   5836  C  CG  . LYS C  1 123 ? 9.537   174.220 109.391 1.00 68.69  ? 123  LYS C CG  1 
ATOM   5837  C  CD  . LYS C  1 123 ? 10.333  175.399 108.840 1.00 78.78  ? 123  LYS C CD  1 
ATOM   5838  C  CE  . LYS C  1 123 ? 9.475   176.330 107.998 1.00 82.59  ? 123  LYS C CE  1 
ATOM   5839  N  NZ  . LYS C  1 123 ? 8.801   175.590 106.893 1.00 83.03  ? 123  LYS C NZ  1 
ATOM   5840  N  N   . SER C  1 124 ? 7.752   171.767 110.791 1.00 46.93  ? 124  SER C N   1 
ATOM   5841  C  CA  . SER C  1 124 ? 6.879   170.632 110.583 1.00 51.33  ? 124  SER C CA  1 
ATOM   5842  C  C   . SER C  1 124 ? 5.900   170.940 109.467 1.00 54.13  ? 124  SER C C   1 
ATOM   5843  O  O   . SER C  1 124 ? 5.599   172.102 109.168 1.00 46.23  ? 124  SER C O   1 
ATOM   5844  C  CB  . SER C  1 124 ? 6.114   170.287 111.861 1.00 52.50  ? 124  SER C CB  1 
ATOM   5845  O  OG  . SER C  1 124 ? 5.124   171.280 112.104 1.00 52.97  ? 124  SER C OG  1 
ATOM   5846  N  N   . ASP C  1 125 ? 5.407   169.866 108.855 1.00 53.05  ? 125  ASP C N   1 
ATOM   5847  C  CA  . ASP C  1 125 ? 4.253   169.898 107.968 1.00 47.60  ? 125  ASP C CA  1 
ATOM   5848  C  C   . ASP C  1 125 ? 3.516   168.584 108.251 1.00 44.07  ? 125  ASP C C   1 
ATOM   5849  O  O   . ASP C  1 125 ? 3.608   167.603 107.504 1.00 39.54  ? 125  ASP C O   1 
ATOM   5850  C  CB  . ASP C  1 125 ? 4.658   170.060 106.507 1.00 46.70  ? 125  ASP C CB  1 
ATOM   5851  C  CG  . ASP C  1 125 ? 3.467   170.210 105.579 1.00 50.96  ? 125  ASP C CG  1 
ATOM   5852  O  OD1 . ASP C  1 125 ? 2.309   170.193 106.046 1.00 51.53  ? 125  ASP C OD1 1 
ATOM   5853  O  OD2 . ASP C  1 125 ? 3.699   170.339 104.365 1.00 56.67  ? 125  ASP C OD2 1 
ATOM   5854  N  N   . LEU C  1 126 ? 2.790   168.573 109.367 1.00 43.18  ? 126  LEU C N   1 
ATOM   5855  C  CA  . LEU C  1 126 ? 2.108   167.397 109.873 1.00 43.54  ? 126  LEU C CA  1 
ATOM   5856  C  C   . LEU C  1 126 ? 0.614   167.653 109.812 1.00 39.65  ? 126  LEU C C   1 
ATOM   5857  O  O   . LEU C  1 126 ? 0.134   168.597 110.451 1.00 46.19  ? 126  LEU C O   1 
ATOM   5858  C  CB  . LEU C  1 126 ? 2.530   167.114 111.311 1.00 46.09  ? 126  LEU C CB  1 
ATOM   5859  C  CG  . LEU C  1 126 ? 3.680   166.159 111.630 1.00 49.17  ? 126  LEU C CG  1 
ATOM   5860  C  CD1 . LEU C  1 126 ? 3.724   165.906 113.121 1.00 50.42  ? 126  LEU C CD1 1 
ATOM   5861  C  CD2 . LEU C  1 126 ? 3.585   164.846 110.870 1.00 33.36  ? 126  LEU C CD2 1 
ATOM   5862  N  N   . PRO C  1 127 ? -0.153  166.878 109.063 1.00 34.44  ? 127  PRO C N   1 
ATOM   5863  C  CA  . PRO C  1 127 ? -1.606  167.062 109.057 1.00 42.70  ? 127  PRO C CA  1 
ATOM   5864  C  C   . PRO C  1 127 ? -2.270  166.477 110.301 1.00 44.72  ? 127  PRO C C   1 
ATOM   5865  O  O   . PRO C  1 127 ? -1.723  165.614 110.997 1.00 46.07  ? 127  PRO C O   1 
ATOM   5866  C  CB  . PRO C  1 127 ? -2.061  166.313 107.801 1.00 36.62  ? 127  PRO C CB  1 
ATOM   5867  C  CG  . PRO C  1 127 ? -0.938  165.368 107.465 1.00 37.71  ? 127  PRO C CG  1 
ATOM   5868  C  CD  . PRO C  1 127 ? 0.299   165.785 108.187 1.00 39.74  ? 127  PRO C CD  1 
ATOM   5869  N  N   . GLN C  1 128 ? -3.497  166.953 110.548 1.00 34.68  ? 128  GLN C N   1 
ATOM   5870  C  CA  . GLN C  1 128 ? -4.355  166.365 111.571 1.00 41.20  ? 128  GLN C CA  1 
ATOM   5871  C  C   . GLN C  1 128 ? -4.625  164.908 111.216 1.00 40.55  ? 128  GLN C C   1 
ATOM   5872  O  O   . GLN C  1 128 ? -4.730  164.551 110.042 1.00 46.64  ? 128  GLN C O   1 
ATOM   5873  C  CB  . GLN C  1 128 ? -5.695  167.115 111.651 1.00 45.18  ? 128  GLN C CB  1 
ATOM   5874  C  CG  . GLN C  1 128 ? -6.510  166.961 110.325 1.00 70.55  ? 128  GLN C CG  1 
ATOM   5875  C  CD  . GLN C  1 128 ? -7.901  167.608 110.331 1.00 92.18  ? 128  GLN C CD  1 
ATOM   5876  O  OE1 . GLN C  1 128 ? -8.390  168.074 111.371 1.00 100.32 ? 128  GLN C OE1 1 
ATOM   5877  N  NE2 . GLN C  1 128 ? -8.550  167.618 109.161 1.00 93.30  ? 128  GLN C NE2 1 
ATOM   5878  N  N   . ILE C  1 129 ? -4.722  164.049 112.222 1.00 35.49  ? 129  ILE C N   1 
ATOM   5879  C  CA  . ILE C  1 129 ? -5.053  162.655 111.931 1.00 44.55  ? 129  ILE C CA  1 
ATOM   5880  C  C   . ILE C  1 129 ? -6.566  162.530 111.790 1.00 49.04  ? 129  ILE C C   1 
ATOM   5881  O  O   . ILE C  1 129 ? -7.336  163.333 112.335 1.00 40.34  ? 129  ILE C O   1 
ATOM   5882  C  CB  . ILE C  1 129 ? -4.485  161.674 112.982 1.00 43.81  ? 129  ILE C CB  1 
ATOM   5883  C  CG1 . ILE C  1 129 ? -5.027  161.996 114.387 1.00 44.00  ? 129  ILE C CG1 1 
ATOM   5884  C  CG2 . ILE C  1 129 ? -2.959  161.681 112.956 1.00 39.03  ? 129  ILE C CG2 1 
ATOM   5885  C  CD1 . ILE C  1 129 ? -4.570  161.019 115.439 1.00 42.01  ? 129  ILE C CD1 1 
ATOM   5886  N  N   . MET C  1 130 ? -6.989  161.533 111.018 1.00 48.36  ? 130  MET C N   1 
ATOM   5887  C  CA  . MET C  1 130 ? -8.392  161.307 110.706 1.00 45.96  ? 130  MET C CA  1 
ATOM   5888  C  C   . MET C  1 130 ? -8.581  159.844 110.340 1.00 39.60  ? 130  MET C C   1 
ATOM   5889  O  O   . MET C  1 130 ? -7.635  159.051 110.344 1.00 44.02  ? 130  MET C O   1 
ATOM   5890  C  CB  . MET C  1 130 ? -8.857  162.217 109.568 1.00 42.75  ? 130  MET C CB  1 
ATOM   5891  C  CG  . MET C  1 130 ? -8.080  161.996 108.273 1.00 43.37  ? 130  MET C CG  1 
ATOM   5892  S  SD  . MET C  1 130 ? -8.567  163.147 106.974 1.00 46.88  ? 130  MET C SD  1 
ATOM   5893  C  CE  . MET C  1 130 ? -7.671  164.621 107.453 1.00 59.59  ? 130  MET C CE  1 
ATOM   5894  N  N   . SER C  1 131 ? -9.823  159.486 110.033 1.00 40.17  ? 131  SER C N   1 
ATOM   5895  C  CA  . SER C  1 131 ? -10.135 158.154 109.530 1.00 38.92  ? 131  SER C CA  1 
ATOM   5896  C  C   . SER C  1 131 ? -10.775 158.275 108.152 1.00 36.14  ? 131  SER C C   1 
ATOM   5897  O  O   . SER C  1 131 ? -11.140 159.367 107.709 1.00 34.76  ? 131  SER C O   1 
ATOM   5898  C  CB  . SER C  1 131 ? -11.065 157.399 110.475 1.00 31.94  ? 131  SER C CB  1 
ATOM   5899  O  OG  . SER C  1 131 ? -12.396 157.860 110.308 1.00 43.99  ? 131  SER C OG  1 
ATOM   5900  N  N   . MET C  1 132 ? -10.908 157.125 107.477 1.00 39.62  ? 132  MET C N   1 
ATOM   5901  C  CA  . MET C  1 132 ? -11.512 157.089 106.144 1.00 47.29  ? 132  MET C CA  1 
ATOM   5902  C  C   . MET C  1 132 ? -12.885 157.753 106.131 1.00 42.32  ? 132  MET C C   1 
ATOM   5903  O  O   . MET C  1 132 ? -13.213 158.515 105.215 1.00 34.44  ? 132  MET C O   1 
ATOM   5904  C  CB  . MET C  1 132 ? -11.631 155.647 105.642 1.00 53.72  ? 132  MET C CB  1 
ATOM   5905  C  CG  . MET C  1 132 ? -10.326 154.992 105.247 1.00 75.25  ? 132  MET C CG  1 
ATOM   5906  S  SD  . MET C  1 132 ? -9.656  155.656 103.703 1.00 94.38  ? 132  MET C SD  1 
ATOM   5907  C  CE  . MET C  1 132 ? -8.511  154.357 103.216 1.00 92.38  ? 132  MET C CE  1 
ATOM   5908  N  N   . THR C  1 133 ? -13.719 157.448 107.127 1.00 37.65  ? 133  THR C N   1 
ATOM   5909  C  CA  . THR C  1 133 ? -15.068 157.990 107.107 1.00 38.16  ? 133  THR C CA  1 
ATOM   5910  C  C   . THR C  1 133 ? -15.104 159.489 107.354 1.00 41.60  ? 133  THR C C   1 
ATOM   5911  O  O   . THR C  1 133 ? -16.162 160.088 107.155 1.00 35.78  ? 133  THR C O   1 
ATOM   5912  C  CB  . THR C  1 133 ? -15.955 157.294 108.148 1.00 36.64  ? 133  THR C CB  1 
ATOM   5913  O  OG1 . THR C  1 133 ? -15.309 157.322 109.428 1.00 42.11  ? 133  THR C OG1 1 
ATOM   5914  C  CG2 . THR C  1 133 ? -16.286 155.868 107.747 1.00 35.43  ? 133  THR C CG2 1 
ATOM   5915  N  N   . ASP C  1 134 ? -13.986 160.101 107.762 1.00 42.07  ? 134  ASP C N   1 
ATOM   5916  C  CA  . ASP C  1 134 ? -13.907 161.551 107.922 1.00 38.83  ? 134  ASP C CA  1 
ATOM   5917  C  C   . ASP C  1 134 ? -13.528 162.273 106.635 1.00 37.88  ? 134  ASP C C   1 
ATOM   5918  O  O   . ASP C  1 134 ? -13.662 163.499 106.561 1.00 39.55  ? 134  ASP C O   1 
ATOM   5919  C  CB  . ASP C  1 134 ? -12.875 161.927 108.991 1.00 33.74  ? 134  ASP C CB  1 
ATOM   5920  C  CG  . ASP C  1 134 ? -13.156 161.307 110.337 1.00 39.76  ? 134  ASP C CG  1 
ATOM   5921  O  OD1 . ASP C  1 134 ? -14.338 161.112 110.677 1.00 44.31  ? 134  ASP C OD1 1 
ATOM   5922  O  OD2 . ASP C  1 134 ? -12.178 161.029 111.065 1.00 39.45  ? 134  ASP C OD2 1 
ATOM   5923  N  N   . VAL C  1 135 ? -13.008 161.551 105.646 1.00 43.24  ? 135  VAL C N   1 
ATOM   5924  C  CA  . VAL C  1 135 ? -12.370 162.207 104.504 1.00 41.02  ? 135  VAL C CA  1 
ATOM   5925  C  C   . VAL C  1 135 ? -13.351 163.028 103.677 1.00 40.47  ? 135  VAL C C   1 
ATOM   5926  O  O   . VAL C  1 135 ? -13.023 164.178 103.338 1.00 42.61  ? 135  VAL C O   1 
ATOM   5927  C  CB  . VAL C  1 135 ? -11.622 161.165 103.654 1.00 41.79  ? 135  VAL C CB  1 
ATOM   5928  C  CG1 . VAL C  1 135 ? -11.142 161.798 102.354 1.00 41.32  ? 135  VAL C CG1 1 
ATOM   5929  C  CG2 . VAL C  1 135 ? -10.472 160.551 104.458 1.00 40.99  ? 135  VAL C CG2 1 
ATOM   5930  N  N   . PRO C  1 136 ? -14.538 162.524 103.310 1.00 37.57  ? 136  PRO C N   1 
ATOM   5931  C  CA  . PRO C  1 136 ? -15.455 163.376 102.538 1.00 45.75  ? 136  PRO C CA  1 
ATOM   5932  C  C   . PRO C  1 136 ? -15.769 164.686 103.234 1.00 48.50  ? 136  PRO C C   1 
ATOM   5933  O  O   . PRO C  1 136 ? -15.807 165.734 102.581 1.00 43.11  ? 136  PRO C O   1 
ATOM   5934  C  CB  . PRO C  1 136 ? -16.690 162.483 102.367 1.00 40.71  ? 136  PRO C CB  1 
ATOM   5935  C  CG  . PRO C  1 136 ? -16.129 161.114 102.364 1.00 37.21  ? 136  PRO C CG  1 
ATOM   5936  C  CD  . PRO C  1 136 ? -15.041 161.139 103.392 1.00 41.22  ? 136  PRO C CD  1 
ATOM   5937  N  N   . GLN C  1 137 ? -15.963 164.670 104.554 1.00 49.46  ? 137  GLN C N   1 
ATOM   5938  C  CA  . GLN C  1 137 ? -16.255 165.923 105.237 1.00 43.95  ? 137  GLN C CA  1 
ATOM   5939  C  C   . GLN C  1 137 ? -15.033 166.832 105.284 1.00 45.54  ? 137  GLN C C   1 
ATOM   5940  O  O   . GLN C  1 137 ? -15.157 168.050 105.122 1.00 51.14  ? 137  GLN C O   1 
ATOM   5941  C  CB  . GLN C  1 137 ? -16.778 165.644 106.639 1.00 43.42  ? 137  GLN C CB  1 
ATOM   5942  C  CG  . GLN C  1 137 ? -16.856 166.877 107.521 1.00 43.98  ? 137  GLN C CG  1 
ATOM   5943  C  CD  . GLN C  1 137 ? -17.642 166.611 108.781 1.00 51.97  ? 137  GLN C CD  1 
ATOM   5944  O  OE1 . GLN C  1 137 ? -17.075 166.527 109.870 1.00 48.41  ? 137  GLN C OE1 1 
ATOM   5945  N  NE2 . GLN C  1 137 ? -18.962 166.511 108.648 1.00 48.33  ? 137  GLN C NE2 1 
ATOM   5946  N  N   . VAL C  1 138 ? -13.841 166.267 105.507 1.00 46.61  ? 138  VAL C N   1 
ATOM   5947  C  CA  . VAL C  1 138 ? -12.631 167.085 105.472 1.00 45.83  ? 138  VAL C CA  1 
ATOM   5948  C  C   . VAL C  1 138 ? -12.471 167.733 104.105 1.00 45.05  ? 138  VAL C C   1 
ATOM   5949  O  O   . VAL C  1 138 ? -12.074 168.897 103.992 1.00 47.35  ? 138  VAL C O   1 
ATOM   5950  C  CB  . VAL C  1 138 ? -11.391 166.252 105.847 1.00 48.10  ? 138  VAL C CB  1 
ATOM   5951  C  CG1 . VAL C  1 138 ? -10.103 167.034 105.528 1.00 50.43  ? 138  VAL C CG1 1 
ATOM   5952  C  CG2 . VAL C  1 138 ? -11.431 165.889 107.307 1.00 41.92  ? 138  VAL C CG2 1 
ATOM   5953  N  N   . LEU C  1 139 ? -12.773 166.987 103.045 1.00 51.23  ? 139  LEU C N   1 
ATOM   5954  C  CA  . LEU C  1 139 ? -12.728 167.549 101.704 1.00 49.34  ? 139  LEU C CA  1 
ATOM   5955  C  C   . LEU C  1 139 ? -13.707 168.702 101.567 1.00 53.69  ? 139  LEU C C   1 
ATOM   5956  O  O   . LEU C  1 139 ? -13.344 169.786 101.104 1.00 52.62  ? 139  LEU C O   1 
ATOM   5957  C  CB  . LEU C  1 139 ? -13.046 166.466 100.678 1.00 56.50  ? 139  LEU C CB  1 
ATOM   5958  C  CG  . LEU C  1 139 ? -12.802 166.824 99.219  1.00 63.25  ? 139  LEU C CG  1 
ATOM   5959  C  CD1 . LEU C  1 139 ? -11.350 167.127 98.997  1.00 61.71  ? 139  LEU C CD1 1 
ATOM   5960  C  CD2 . LEU C  1 139 ? -13.227 165.674 98.352  1.00 72.52  ? 139  LEU C CD2 1 
ATOM   5961  N  N   . GLY C  1 140 ? -14.963 168.485 101.958 1.00 53.11  ? 140  GLY C N   1 
ATOM   5962  C  CA  . GLY C  1 140 ? -15.950 169.547 101.838 1.00 47.76  ? 140  GLY C CA  1 
ATOM   5963  C  C   . GLY C  1 140 ? -15.617 170.764 102.676 1.00 51.21  ? 140  GLY C C   1 
ATOM   5964  O  O   . GLY C  1 140 ? -15.702 171.902 102.200 1.00 52.97  ? 140  GLY C O   1 
ATOM   5965  N  N   . ASP C  1 141 ? -15.191 170.544 103.921 1.00 56.73  ? 141  ASP C N   1 
ATOM   5966  C  CA  . ASP C  1 141 ? -14.867 171.669 104.786 1.00 53.30  ? 141  ASP C CA  1 
ATOM   5967  C  C   . ASP C  1 141 ? -13.690 172.451 104.225 1.00 58.86  ? 141  ASP C C   1 
ATOM   5968  O  O   . ASP C  1 141 ? -13.651 173.683 104.324 1.00 65.42  ? 141  ASP C O   1 
ATOM   5969  C  CB  . ASP C  1 141 ? -14.565 171.185 106.207 1.00 51.86  ? 141  ASP C CB  1 
ATOM   5970  C  CG  . ASP C  1 141 ? -15.798 170.635 106.928 1.00 53.15  ? 141  ASP C CG  1 
ATOM   5971  O  OD1 . ASP C  1 141 ? -16.920 170.691 106.374 1.00 54.79  ? 141  ASP C OD1 1 
ATOM   5972  O  OD2 . ASP C  1 141 ? -15.641 170.142 108.066 1.00 45.21  ? 141  ASP C OD2 1 
ATOM   5973  N  N   . SER C  1 142 ? -12.725 171.753 103.620 1.00 53.85  ? 142  SER C N   1 
ATOM   5974  C  CA  . SER C  1 142 ? -11.604 172.449 102.995 1.00 58.95  ? 142  SER C CA  1 
ATOM   5975  C  C   . SER C  1 142 ? -12.076 173.341 101.851 1.00 57.67  ? 142  SER C C   1 
ATOM   5976  O  O   . SER C  1 142 ? -11.610 174.478 101.712 1.00 54.11  ? 142  SER C O   1 
ATOM   5977  C  CB  . SER C  1 142 ? -10.550 171.450 102.514 1.00 55.91  ? 142  SER C CB  1 
ATOM   5978  O  OG  . SER C  1 142 ? -9.875  170.854 103.618 1.00 52.76  ? 142  SER C OG  1 
ATOM   5979  N  N   . PHE C  1 143 ? -12.987 172.841 101.012 1.00 59.45  ? 143  PHE C N   1 
ATOM   5980  C  CA  . PHE C  1 143 ? -13.515 173.669 99.930  1.00 60.68  ? 143  PHE C CA  1 
ATOM   5981  C  C   . PHE C  1 143 ? -14.291 174.860 100.473 1.00 58.89  ? 143  PHE C C   1 
ATOM   5982  O  O   . PHE C  1 143 ? -14.166 175.979 99.959  1.00 60.24  ? 143  PHE C O   1 
ATOM   5983  C  CB  . PHE C  1 143 ? -14.391 172.832 99.002  1.00 66.31  ? 143  PHE C CB  1 
ATOM   5984  C  CG  . PHE C  1 143 ? -13.612 171.903 98.136  1.00 86.30  ? 143  PHE C CG  1 
ATOM   5985  C  CD1 . PHE C  1 143 ? -12.247 172.074 97.982  1.00 97.93  ? 143  PHE C CD1 1 
ATOM   5986  C  CD2 . PHE C  1 143 ? -14.228 170.852 97.487  1.00 94.43  ? 143  PHE C CD2 1 
ATOM   5987  C  CE1 . PHE C  1 143 ? -11.514 171.219 97.190  1.00 102.30 ? 143  PHE C CE1 1 
ATOM   5988  C  CE2 . PHE C  1 143 ? -13.499 169.986 96.693  1.00 97.51  ? 143  PHE C CE2 1 
ATOM   5989  C  CZ  . PHE C  1 143 ? -12.139 170.172 96.545  1.00 99.50  ? 143  PHE C CZ  1 
ATOM   5990  N  N   . ALA C  1 144 ? -15.106 174.633 101.502 1.00 54.48  ? 144  ALA C N   1 
ATOM   5991  C  CA  . ALA C  1 144 ? -15.874 175.721 102.092 1.00 58.79  ? 144  ALA C CA  1 
ATOM   5992  C  C   . ALA C  1 144 ? -14.955 176.816 102.619 1.00 62.48  ? 144  ALA C C   1 
ATOM   5993  O  O   . ALA C  1 144 ? -15.121 177.993 102.288 1.00 62.88  ? 144  ALA C O   1 
ATOM   5994  C  CB  . ALA C  1 144 ? -16.770 175.175 103.206 1.00 50.20  ? 144  ALA C CB  1 
ATOM   5995  N  N   . LYS C  1 145 ? -13.943 176.434 103.392 1.00 66.20  ? 145  LYS C N   1 
ATOM   5996  C  CA  . LYS C  1 145 ? -12.997 177.336 104.036 1.00 65.83  ? 145  LYS C CA  1 
ATOM   5997  C  C   . LYS C  1 145 ? -11.903 177.839 103.086 1.00 68.34  ? 145  LYS C C   1 
ATOM   5998  O  O   . LYS C  1 145 ? -10.954 178.487 103.543 1.00 67.45  ? 145  LYS C O   1 
ATOM   5999  C  CB  . LYS C  1 145 ? -12.384 176.622 105.250 1.00 66.43  ? 145  LYS C CB  1 
ATOM   6000  C  CG  . LYS C  1 145 ? -13.320 176.536 106.460 1.00 73.04  ? 145  LYS C CG  1 
ATOM   6001  C  CD  . LYS C  1 145 ? -13.297 175.144 107.110 1.00 81.61  ? 145  LYS C CD  1 
ATOM   6002  C  CE  . LYS C  1 145 ? -11.962 174.796 107.746 1.00 90.35  ? 145  LYS C CE  1 
ATOM   6003  N  NZ  . LYS C  1 145 ? -11.926 173.366 108.203 1.00 89.85  ? 145  LYS C NZ  1 
ATOM   6004  N  N   . GLN C  1 146 ? -12.019 177.557 101.785 1.00 70.39  ? 146  GLN C N   1 
ATOM   6005  C  CA  . GLN C  1 146 ? -11.039 177.969 100.778 1.00 77.62  ? 146  GLN C CA  1 
ATOM   6006  C  C   . GLN C  1 146 ? -9.632  177.471 101.109 1.00 68.85  ? 146  GLN C C   1 
ATOM   6007  O  O   . GLN C  1 146 ? -8.640  178.043 100.658 1.00 66.53  ? 146  GLN C O   1 
ATOM   6008  C  CB  . GLN C  1 146 ? -11.014 179.499 100.643 1.00 95.54  ? 146  GLN C CB  1 
ATOM   6009  C  CG  . GLN C  1 146 ? -12.344 180.166 100.294 1.00 108.76 ? 146  GLN C CG  1 
ATOM   6010  C  CD  . GLN C  1 146 ? -12.746 179.975 98.853  1.00 118.79 ? 146  GLN C CD  1 
ATOM   6011  O  OE1 . GLN C  1 146 ? -13.582 179.128 98.534  1.00 123.91 ? 146  GLN C OE1 1 
ATOM   6012  N  NE2 . GLN C  1 146 ? -12.170 180.785 97.970  1.00 120.04 ? 146  GLN C NE2 1 
ATOM   6013  N  N   . GLU C  1 147 ? -9.519  176.384 101.862 1.00 68.52  ? 147  GLU C N   1 
ATOM   6014  C  CA  . GLU C  1 147 ? -8.228  175.900 102.325 1.00 68.03  ? 147  GLU C CA  1 
ATOM   6015  C  C   . GLU C  1 147 ? -7.795  174.665 101.550 1.00 65.58  ? 147  GLU C C   1 
ATOM   6016  O  O   . GLU C  1 147 ? -8.576  174.040 100.825 1.00 71.34  ? 147  GLU C O   1 
ATOM   6017  C  CB  . GLU C  1 147 ? -8.258  175.599 103.827 1.00 74.48  ? 147  GLU C CB  1 
ATOM   6018  C  CG  . GLU C  1 147 ? -8.467  176.835 104.689 1.00 80.21  ? 147  GLU C CG  1 
ATOM   6019  C  CD  . GLU C  1 147 ? -8.645  176.509 106.160 1.00 88.11  ? 147  GLU C CD  1 
ATOM   6020  O  OE1 . GLU C  1 147 ? -8.622  175.310 106.509 1.00 92.61  ? 147  GLU C OE1 1 
ATOM   6021  O  OE2 . GLU C  1 147 ? -8.808  177.451 106.968 1.00 91.86  ? 147  GLU C OE2 1 
ATOM   6022  N  N   . ARG C  1 148 ? -6.509  174.357 101.669 1.00 59.31  ? 148  ARG C N   1 
ATOM   6023  C  CA  . ARG C  1 148 ? -5.956  173.201 100.991 1.00 56.70  ? 148  ARG C CA  1 
ATOM   6024  C  C   . ARG C  1 148 ? -6.347  171.911 101.706 1.00 55.31  ? 148  ARG C C   1 
ATOM   6025  O  O   . ARG C  1 148 ? -6.328  171.827 102.941 1.00 55.68  ? 148  ARG C O   1 
ATOM   6026  C  CB  . ARG C  1 148 ? -4.439  173.315 100.889 1.00 49.63  ? 148  ARG C CB  1 
ATOM   6027  C  CG  . ARG C  1 148 ? -3.882  172.332 99.895  1.00 51.17  ? 148  ARG C CG  1 
ATOM   6028  C  CD  . ARG C  1 148 ? -2.421  172.512 99.716  1.00 58.02  ? 148  ARG C CD  1 
ATOM   6029  N  NE  . ARG C  1 148 ? -1.914  171.645 98.661  1.00 61.94  ? 148  ARG C NE  1 
ATOM   6030  C  CZ  . ARG C  1 148 ? -0.626  171.366 98.506  1.00 62.31  ? 148  ARG C CZ  1 
ATOM   6031  N  NH1 . ARG C  1 148 ? 0.258   171.893 99.344  1.00 61.55  ? 148  ARG C NH1 1 
ATOM   6032  N  NH2 . ARG C  1 148 ? -0.223  170.562 97.530  1.00 60.24  ? 148  ARG C NH2 1 
ATOM   6033  N  N   . VAL C  1 149 ? -6.714  170.913 100.917 1.00 47.28  ? 149  VAL C N   1 
ATOM   6034  C  CA  . VAL C  1 149 ? -7.006  169.578 101.452 1.00 42.39  ? 149  VAL C CA  1 
ATOM   6035  C  C   . VAL C  1 149 ? -5.698  168.927 101.876 1.00 39.50  ? 149  VAL C C   1 
ATOM   6036  O  O   . VAL C  1 149 ? -4.728  168.942 101.096 1.00 45.66  ? 149  VAL C O   1 
ATOM   6037  C  CB  . VAL C  1 149 ? -7.710  168.736 100.401 1.00 44.25  ? 149  VAL C CB  1 
ATOM   6038  C  CG1 . VAL C  1 149 ? -8.074  167.370 100.966 1.00 41.26  ? 149  VAL C CG1 1 
ATOM   6039  C  CG2 . VAL C  1 149 ? -8.921  169.478 99.901  1.00 48.99  ? 149  VAL C CG2 1 
ATOM   6040  N  N   . PRO C  1 150 ? -5.602  168.381 103.079 1.00 46.60  ? 150  PRO C N   1 
ATOM   6041  C  CA  . PRO C  1 150 ? -4.338  167.785 103.524 1.00 45.95  ? 150  PRO C CA  1 
ATOM   6042  C  C   . PRO C  1 150 ? -4.132  166.391 102.940 1.00 44.20  ? 150  PRO C C   1 
ATOM   6043  O  O   . PRO C  1 150 ? -5.046  165.762 102.410 1.00 47.03  ? 150  PRO C O   1 
ATOM   6044  C  CB  . PRO C  1 150 ? -4.504  167.733 105.048 1.00 44.65  ? 150  PRO C CB  1 
ATOM   6045  C  CG  . PRO C  1 150 ? -6.003  167.555 105.233 1.00 42.88  ? 150  PRO C CG  1 
ATOM   6046  C  CD  . PRO C  1 150 ? -6.626  168.387 104.147 1.00 42.60  ? 150  PRO C CD  1 
ATOM   6047  N  N   . LYS C  1 151 ? -2.896  165.913 103.056 1.00 45.34  ? 151  LYS C N   1 
ATOM   6048  C  CA  . LYS C  1 151 ? -2.654  164.483 102.944 1.00 47.83  ? 151  LYS C CA  1 
ATOM   6049  C  C   . LYS C  1 151 ? -3.437  163.750 104.025 1.00 42.40  ? 151  LYS C C   1 
ATOM   6050  O  O   . LYS C  1 151 ? -3.632  164.258 105.132 1.00 43.89  ? 151  LYS C O   1 
ATOM   6051  C  CB  . LYS C  1 151 ? -1.162  164.167 103.087 1.00 50.24  ? 151  LYS C CB  1 
ATOM   6052  C  CG  . LYS C  1 151 ? -0.277  164.798 102.026 1.00 50.66  ? 151  LYS C CG  1 
ATOM   6053  C  CD  . LYS C  1 151 ? -0.762  164.412 100.641 1.00 44.81  ? 151  LYS C CD  1 
ATOM   6054  C  CE  . LYS C  1 151 ? 0.283   164.712 99.578  1.00 50.72  ? 151  LYS C CE  1 
ATOM   6055  N  NZ  . LYS C  1 151 ? 1.329   163.655 99.609  1.00 61.77  ? 151  LYS C NZ  1 
ATOM   6056  N  N   . VAL C  1 152 ? -3.882  162.542 103.709 1.00 36.82  ? 152  VAL C N   1 
ATOM   6057  C  CA  . VAL C  1 152 ? -4.686  161.766 104.642 1.00 36.94  ? 152  VAL C CA  1 
ATOM   6058  C  C   . VAL C  1 152 ? -3.752  161.003 105.574 1.00 38.83  ? 152  VAL C C   1 
ATOM   6059  O  O   . VAL C  1 152 ? -3.039  160.091 105.151 1.00 37.72  ? 152  VAL C O   1 
ATOM   6060  C  CB  . VAL C  1 152 ? -5.640  160.813 103.920 1.00 42.01  ? 152  VAL C CB  1 
ATOM   6061  C  CG1 . VAL C  1 152 ? -6.407  159.989 104.941 1.00 38.62  ? 152  VAL C CG1 1 
ATOM   6062  C  CG2 . VAL C  1 152 ? -6.592  161.591 103.042 1.00 36.66  ? 152  VAL C CG2 1 
ATOM   6063  N  N   . ALA C  1 153 ? -3.766  161.379 106.849 1.00 40.77  ? 153  ALA C N   1 
ATOM   6064  C  CA  . ALA C  1 153 ? -3.009  160.710 107.906 1.00 39.50  ? 153  ALA C CA  1 
ATOM   6065  C  C   . ALA C  1 153 ? -3.986  159.850 108.702 1.00 36.60  ? 153  ALA C C   1 
ATOM   6066  O  O   . ALA C  1 153 ? -4.695  160.353 109.574 1.00 39.18  ? 153  ALA C O   1 
ATOM   6067  C  CB  . ALA C  1 153 ? -2.313  161.734 108.802 1.00 36.43  ? 153  ALA C CB  1 
ATOM   6068  N  N   . LEU C  1 154 ? -4.032  158.550 108.405 1.00 38.28  ? 154  LEU C N   1 
ATOM   6069  C  CA  . LEU C  1 154 ? -5.018  157.682 109.037 1.00 37.16  ? 154  LEU C CA  1 
ATOM   6070  C  C   . LEU C  1 154 ? -4.605  157.355 110.471 1.00 40.33  ? 154  LEU C C   1 
ATOM   6071  O  O   . LEU C  1 154 ? -3.501  156.856 110.714 1.00 37.26  ? 154  LEU C O   1 
ATOM   6072  C  CB  . LEU C  1 154 ? -5.205  156.415 108.215 1.00 35.29  ? 154  LEU C CB  1 
ATOM   6073  C  CG  . LEU C  1 154 ? -5.845  156.675 106.855 1.00 38.07  ? 154  LEU C CG  1 
ATOM   6074  C  CD1 . LEU C  1 154 ? -5.863  155.393 106.029 1.00 36.12  ? 154  LEU C CD1 1 
ATOM   6075  C  CD2 . LEU C  1 154 ? -7.252  157.206 107.039 1.00 37.99  ? 154  LEU C CD2 1 
ATOM   6076  N  N   . SER C  1 155 ? -5.499  157.640 111.409 1.00 41.18  ? 155  SER C N   1 
ATOM   6077  C  CA  . SER C  1 155 ? -5.269  157.371 112.824 1.00 44.02  ? 155  SER C CA  1 
ATOM   6078  C  C   . SER C  1 155 ? -4.910  155.907 113.070 1.00 42.75  ? 155  SER C C   1 
ATOM   6079  O  O   . SER C  1 155 ? -5.664  155.004 112.701 1.00 39.57  ? 155  SER C O   1 
ATOM   6080  C  CB  . SER C  1 155 ? -6.521  157.745 113.614 1.00 41.44  ? 155  SER C CB  1 
ATOM   6081  O  OG  . SER C  1 155 ? -6.301  157.514 114.990 1.00 59.80  ? 155  SER C OG  1 
ATOM   6082  N  N   . SER C  1 156 ? -3.748  155.680 113.689 1.00 37.77  ? 156  SER C N   1 
ATOM   6083  C  CA  . SER C  1 156 ? -3.271  154.338 114.014 1.00 48.04  ? 156  SER C CA  1 
ATOM   6084  C  C   . SER C  1 156 ? -3.271  153.420 112.796 1.00 42.08  ? 156  SER C C   1 
ATOM   6085  O  O   . SER C  1 156 ? -3.458  152.216 112.930 1.00 48.92  ? 156  SER C O   1 
ATOM   6086  C  CB  . SER C  1 156 ? -4.106  153.717 115.142 1.00 50.72  ? 156  SER C CB  1 
ATOM   6087  O  OG  . SER C  1 156 ? -3.945  154.427 116.365 1.00 47.12  ? 156  SER C OG  1 
ATOM   6088  N  N   . GLN C  1 157 ? -3.089  153.968 111.596 1.00 37.93  ? 157  GLN C N   1 
ATOM   6089  C  CA  . GLN C  1 157 ? -3.153  153.154 110.375 1.00 40.26  ? 157  GLN C CA  1 
ATOM   6090  C  C   . GLN C  1 157 ? -2.196  153.697 109.310 1.00 40.41  ? 157  GLN C C   1 
ATOM   6091  O  O   . GLN C  1 157 ? -2.590  153.956 108.172 1.00 43.64  ? 157  GLN C O   1 
ATOM   6092  C  CB  . GLN C  1 157 ? -4.580  153.126 109.823 1.00 42.67  ? 157  GLN C CB  1 
ATOM   6093  C  CG  . GLN C  1 157 ? -5.586  152.262 110.573 1.00 61.42  ? 157  GLN C CG  1 
ATOM   6094  C  CD  . GLN C  1 157 ? -7.032  152.453 110.080 1.00 69.36  ? 157  GLN C CD  1 
ATOM   6095  O  OE1 . GLN C  1 157 ? -7.274  152.946 108.973 1.00 65.48  ? 157  GLN C OE1 1 
ATOM   6096  N  NE2 . GLN C  1 157 ? -7.995  152.074 110.919 1.00 74.81  ? 157  GLN C NE2 1 
ATOM   6097  N  N   . ARG C  1 158 ? -0.927  153.902 109.663 1.00 38.19  ? 158  ARG C N   1 
ATOM   6098  C  CA  . ARG C  1 158 ? 0.055   154.392 108.693 1.00 35.10  ? 158  ARG C CA  1 
ATOM   6099  C  C   . ARG C  1 158 ? 1.454   154.139 109.244 1.00 35.72  ? 158  ARG C C   1 
ATOM   6100  O  O   . ARG C  1 158 ? 1.619   153.541 110.309 1.00 36.82  ? 158  ARG C O   1 
ATOM   6101  C  CB  . ARG C  1 158 ? -0.179  155.870 108.367 1.00 33.43  ? 158  ARG C CB  1 
ATOM   6102  C  CG  . ARG C  1 158 ? 0.161   156.827 109.502 1.00 37.45  ? 158  ARG C CG  1 
ATOM   6103  C  CD  . ARG C  1 158 ? -0.548  158.184 109.341 1.00 41.25  ? 158  ARG C CD  1 
ATOM   6104  N  NE  . ARG C  1 158 ? -0.082  159.074 110.393 1.00 41.73  ? 158  ARG C NE  1 
ATOM   6105  C  CZ  . ARG C  1 158 ? -0.470  158.976 111.659 1.00 41.21  ? 158  ARG C CZ  1 
ATOM   6106  N  NH1 . ARG C  1 158 ? -1.349  158.048 112.017 1.00 39.67  ? 158  ARG C NH1 1 
ATOM   6107  N  NH2 . ARG C  1 158 ? 0.035   159.789 112.571 1.00 38.14  ? 158  ARG C NH2 1 
ATOM   6108  N  N   . THR C  1 159 ? 2.475   154.596 108.512 1.00 35.05  ? 159  THR C N   1 
ATOM   6109  C  CA  . THR C  1 159 ? 3.859   154.342 108.899 1.00 35.11  ? 159  THR C CA  1 
ATOM   6110  C  C   . THR C  1 159 ? 4.536   155.638 109.338 1.00 40.40  ? 159  THR C C   1 
ATOM   6111  O  O   . THR C  1 159 ? 4.437   156.671 108.662 1.00 39.07  ? 159  THR C O   1 
ATOM   6112  C  CB  . THR C  1 159 ? 4.642   153.674 107.762 1.00 34.49  ? 159  THR C CB  1 
ATOM   6113  O  OG1 . THR C  1 159 ? 4.117   152.360 107.541 1.00 40.12  ? 159  THR C OG1 1 
ATOM   6114  C  CG2 . THR C  1 159 ? 6.119   153.530 108.119 1.00 35.41  ? 159  THR C CG2 1 
ATOM   6115  N  N   . VAL C  1 160 ? 5.204   155.579 110.488 1.00 40.61  ? 160  VAL C N   1 
ATOM   6116  C  CA  . VAL C  1 160 ? 6.029   156.669 110.986 1.00 39.78  ? 160  VAL C CA  1 
ATOM   6117  C  C   . VAL C  1 160 ? 7.467   156.197 110.922 1.00 40.96  ? 160  VAL C C   1 
ATOM   6118  O  O   . VAL C  1 160 ? 7.807   155.138 111.465 1.00 39.71  ? 160  VAL C O   1 
ATOM   6119  C  CB  . VAL C  1 160 ? 5.665   157.075 112.422 1.00 39.59  ? 160  VAL C CB  1 
ATOM   6120  C  CG1 . VAL C  1 160 ? 6.636   158.171 112.911 1.00 35.58  ? 160  VAL C CG1 1 
ATOM   6121  C  CG2 . VAL C  1 160 ? 4.199   157.536 112.516 1.00 35.51  ? 160  VAL C CG2 1 
ATOM   6122  N  N   . VAL C  1 161 ? 8.308   156.998 110.294 1.00 39.89  ? 161  VAL C N   1 
ATOM   6123  C  CA  . VAL C  1 161 ? 9.720   156.710 110.137 1.00 38.02  ? 161  VAL C CA  1 
ATOM   6124  C  C   . VAL C  1 161 ? 10.494  157.783 110.895 1.00 40.53  ? 161  VAL C C   1 
ATOM   6125  O  O   . VAL C  1 161 ? 10.151  158.968 110.825 1.00 42.77  ? 161  VAL C O   1 
ATOM   6126  C  CB  . VAL C  1 161 ? 10.068  156.685 108.633 1.00 40.84  ? 161  VAL C CB  1 
ATOM   6127  C  CG1 . VAL C  1 161 ? 11.469  156.982 108.412 1.00 53.01  ? 161  VAL C CG1 1 
ATOM   6128  C  CG2 . VAL C  1 161 ? 9.718   155.335 108.028 1.00 35.92  ? 161  VAL C CG2 1 
ATOM   6129  N  N   . ILE C  1 162 ? 11.522  157.379 111.636 1.00 38.60  ? 162  ILE C N   1 
ATOM   6130  C  CA  . ILE C  1 162 ? 12.336  158.330 112.383 1.00 38.53  ? 162  ILE C CA  1 
ATOM   6131  C  C   . ILE C  1 162 ? 13.792  158.183 111.960 1.00 38.68  ? 162  ILE C C   1 
ATOM   6132  O  O   . ILE C  1 162 ? 14.396  157.110 112.132 1.00 41.74  ? 162  ILE C O   1 
ATOM   6133  C  CB  . ILE C  1 162 ? 12.187  158.149 113.897 1.00 38.19  ? 162  ILE C CB  1 
ATOM   6134  C  CG1 . ILE C  1 162 ? 10.718  158.299 114.307 1.00 40.69  ? 162  ILE C CG1 1 
ATOM   6135  C  CG2 . ILE C  1 162 ? 13.023  159.204 114.599 1.00 41.02  ? 162  ILE C CG2 1 
ATOM   6136  C  CD1 . ILE C  1 162 ? 10.463  158.082 115.792 1.00 35.48  ? 162  ILE C CD1 1 
ATOM   6137  N  N   . GLY C  1 163 ? 14.351  159.269 111.425 1.00 35.60  ? 163  GLY C N   1 
ATOM   6138  C  CA  . GLY C  1 163 ? 15.734  159.314 111.002 1.00 33.25  ? 163  GLY C CA  1 
ATOM   6139  C  C   . GLY C  1 163 ? 16.637  159.995 112.007 1.00 40.91  ? 163  GLY C C   1 
ATOM   6140  O  O   . GLY C  1 163 ? 16.502  161.192 112.278 1.00 40.78  ? 163  GLY C O   1 
ATOM   6141  N  N   . ASP C  1 164 ? 17.589  159.228 112.530 1.00 39.98  ? 164  ASP C N   1 
ATOM   6142  C  CA  . ASP C  1 164 ? 18.512  159.689 113.557 1.00 35.09  ? 164  ASP C CA  1 
ATOM   6143  C  C   . ASP C  1 164 ? 19.717  160.310 112.871 1.00 39.72  ? 164  ASP C C   1 
ATOM   6144  O  O   . ASP C  1 164 ? 20.324  159.686 111.991 1.00 46.40  ? 164  ASP C O   1 
ATOM   6145  C  CB  . ASP C  1 164 ? 18.911  158.517 114.457 1.00 38.28  ? 164  ASP C CB  1 
ATOM   6146  C  CG  . ASP C  1 164 ? 19.543  158.955 115.766 1.00 40.21  ? 164  ASP C CG  1 
ATOM   6147  O  OD1 . ASP C  1 164 ? 20.003  160.106 115.875 1.00 40.73  ? 164  ASP C OD1 1 
ATOM   6148  O  OD2 . ASP C  1 164 ? 19.571  158.138 116.705 1.00 41.84  ? 164  ASP C OD2 1 
ATOM   6149  N  N   . HIS C  1 165 ? 20.008  161.565 113.216 1.00 37.77  ? 165  HIS C N   1 
ATOM   6150  C  CA  . HIS C  1 165 ? 21.130  162.330 112.681 1.00 36.34  ? 165  HIS C CA  1 
ATOM   6151  C  C   . HIS C  1 165 ? 21.904  162.959 113.830 1.00 40.82  ? 165  HIS C C   1 
ATOM   6152  O  O   . HIS C  1 165 ? 21.302  163.562 114.722 1.00 42.91  ? 165  HIS C O   1 
ATOM   6153  C  CB  . HIS C  1 165 ? 20.676  163.462 111.758 1.00 37.73  ? 165  HIS C CB  1 
ATOM   6154  C  CG  . HIS C  1 165 ? 19.802  163.031 110.623 1.00 39.66  ? 165  HIS C CG  1 
ATOM   6155  N  ND1 . HIS C  1 165 ? 18.501  162.610 110.800 1.00 37.71  ? 165  HIS C ND1 1 
ATOM   6156  C  CD2 . HIS C  1 165 ? 20.022  163.023 109.285 1.00 34.98  ? 165  HIS C CD2 1 
ATOM   6157  C  CE1 . HIS C  1 165 ? 17.968  162.327 109.625 1.00 37.84  ? 165  HIS C CE1 1 
ATOM   6158  N  NE2 . HIS C  1 165 ? 18.869  162.572 108.689 1.00 38.72  ? 165  HIS C NE2 1 
ATOM   6159  N  N   . TRP C  1 166 ? 23.223  162.829 113.818 1.00 36.42  ? 166  TRP C N   1 
ATOM   6160  C  CA  . TRP C  1 166 ? 24.082  163.646 114.669 1.00 35.83  ? 166  TRP C CA  1 
ATOM   6161  C  C   . TRP C  1 166 ? 24.758  164.674 113.779 1.00 36.85  ? 166  TRP C C   1 
ATOM   6162  O  O   . TRP C  1 166 ? 25.430  164.312 112.811 1.00 41.14  ? 166  TRP C O   1 
ATOM   6163  C  CB  . TRP C  1 166 ? 25.120  162.807 115.407 1.00 38.33  ? 166  TRP C CB  1 
ATOM   6164  C  CG  . TRP C  1 166 ? 24.526  161.797 116.352 1.00 39.65  ? 166  TRP C CG  1 
ATOM   6165  C  CD1 . TRP C  1 166 ? 23.219  161.409 116.430 1.00 40.94  ? 166  TRP C CD1 1 
ATOM   6166  C  CD2 . TRP C  1 166 ? 25.228  161.050 117.350 1.00 40.16  ? 166  TRP C CD2 1 
ATOM   6167  N  NE1 . TRP C  1 166 ? 23.064  160.470 117.418 1.00 43.92  ? 166  TRP C NE1 1 
ATOM   6168  C  CE2 . TRP C  1 166 ? 24.284  160.224 117.992 1.00 39.50  ? 166  TRP C CE2 1 
ATOM   6169  C  CE3 . TRP C  1 166 ? 26.568  160.996 117.758 1.00 36.07  ? 166  TRP C CE3 1 
ATOM   6170  C  CZ2 . TRP C  1 166 ? 24.631  159.353 119.022 1.00 37.02  ? 166  TRP C CZ2 1 
ATOM   6171  C  CZ3 . TRP C  1 166 ? 26.914  160.135 118.773 1.00 39.70  ? 166  TRP C CZ3 1 
ATOM   6172  C  CH2 . TRP C  1 166 ? 25.948  159.326 119.403 1.00 44.27  ? 166  TRP C CH2 1 
ATOM   6173  N  N   . VAL C  1 167 ? 24.580  165.946 114.098 1.00 41.78  ? 167  VAL C N   1 
ATOM   6174  C  CA  . VAL C  1 167 ? 25.024  167.020 113.221 1.00 40.72  ? 167  VAL C CA  1 
ATOM   6175  C  C   . VAL C  1 167 ? 26.329  167.596 113.751 1.00 41.95  ? 167  VAL C C   1 
ATOM   6176  O  O   . VAL C  1 167 ? 26.497  167.783 114.963 1.00 44.63  ? 167  VAL C O   1 
ATOM   6177  C  CB  . VAL C  1 167 ? 23.934  168.096 113.092 1.00 39.42  ? 167  VAL C CB  1 
ATOM   6178  C  CG1 . VAL C  1 167 ? 24.444  169.301 112.318 1.00 40.62  ? 167  VAL C CG1 1 
ATOM   6179  C  CG2 . VAL C  1 167 ? 22.729  167.492 112.418 1.00 31.93  ? 167  VAL C CG2 1 
ATOM   6180  N  N   . MET C  1 168 ? 27.262  167.854 112.834 1.00 40.03  ? 168  MET C N   1 
ATOM   6181  C  CA  . MET C  1 168 ? 28.556  168.433 113.176 1.00 46.84  ? 168  MET C CA  1 
ATOM   6182  C  C   . MET C  1 168 ? 28.404  169.761 113.911 1.00 47.83  ? 168  MET C C   1 
ATOM   6183  O  O   . MET C  1 168 ? 27.485  170.547 113.650 1.00 43.42  ? 168  MET C O   1 
ATOM   6184  C  CB  . MET C  1 168 ? 29.387  168.643 111.913 1.00 40.01  ? 168  MET C CB  1 
ATOM   6185  C  CG  . MET C  1 168 ? 29.692  167.368 111.173 1.00 47.76  ? 168  MET C CG  1 
ATOM   6186  S  SD  . MET C  1 168 ? 30.218  167.701 109.495 1.00 47.25  ? 168  MET C SD  1 
ATOM   6187  C  CE  . MET C  1 168 ? 31.766  168.583 109.787 1.00 43.12  ? 168  MET C CE  1 
ATOM   6188  N  N   . ASP C  1 169 ? 29.275  169.960 114.895 1.00 41.13  ? 169  ASP C N   1 
ATOM   6189  C  CA  . ASP C  1 169 ? 29.321  171.205 115.637 1.00 39.40  ? 169  ASP C CA  1 
ATOM   6190  C  C   . ASP C  1 169 ? 29.415  172.381 114.665 1.00 47.96  ? 169  ASP C C   1 
ATOM   6191  O  O   . ASP C  1 169 ? 30.260  172.389 113.763 1.00 44.25  ? 169  ASP C O   1 
ATOM   6192  C  CB  . ASP C  1 169 ? 30.508  171.178 116.607 1.00 42.35  ? 169  ASP C CB  1 
ATOM   6193  C  CG  . ASP C  1 169 ? 30.517  172.371 117.567 1.00 51.76  ? 169  ASP C CG  1 
ATOM   6194  O  OD1 . ASP C  1 169 ? 29.477  173.047 117.718 1.00 58.24  ? 169  ASP C OD1 1 
ATOM   6195  O  OD2 . ASP C  1 169 ? 31.575  172.641 118.162 1.00 53.17  ? 169  ASP C OD2 1 
ATOM   6196  N  N   . GLY C  1 170 ? 28.496  173.344 114.807 1.00 42.54  ? 170  GLY C N   1 
ATOM   6197  C  CA  . GLY C  1 170 ? 28.482  174.509 113.950 1.00 43.08  ? 170  GLY C CA  1 
ATOM   6198  C  C   . GLY C  1 170 ? 27.694  174.367 112.665 1.00 47.41  ? 170  GLY C C   1 
ATOM   6199  O  O   . GLY C  1 170 ? 27.542  175.361 111.943 1.00 49.18  ? 170  GLY C O   1 
ATOM   6200  N  N   . HIS C  1 171 ? 27.189  173.173 112.351 1.00 45.47  ? 171  HIS C N   1 
ATOM   6201  C  CA  . HIS C  1 171 ? 26.412  172.947 111.139 1.00 41.56  ? 171  HIS C CA  1 
ATOM   6202  C  C   . HIS C  1 171 ? 24.912  172.881 111.409 1.00 42.05  ? 171  HIS C C   1 
ATOM   6203  O  O   . HIS C  1 171 ? 24.144  172.529 110.508 1.00 48.95  ? 171  HIS C O   1 
ATOM   6204  C  CB  . HIS C  1 171 ? 26.884  171.663 110.455 1.00 47.43  ? 171  HIS C CB  1 
ATOM   6205  C  CG  . HIS C  1 171 ? 28.295  171.736 109.964 1.00 48.27  ? 171  HIS C CG  1 
ATOM   6206  N  ND1 . HIS C  1 171 ? 28.650  171.453 108.660 1.00 49.36  ? 171  HIS C ND1 1 
ATOM   6207  C  CD2 . HIS C  1 171 ? 29.441  172.076 110.601 1.00 43.56  ? 171  HIS C CD2 1 
ATOM   6208  C  CE1 . HIS C  1 171 ? 29.953  171.613 108.517 1.00 42.24  ? 171  HIS C CE1 1 
ATOM   6209  N  NE2 . HIS C  1 171 ? 30.456  171.995 109.678 1.00 49.80  ? 171  HIS C NE2 1 
ATOM   6210  N  N   . GLU C  1 172 ? 24.482  173.218 112.625 1.00 40.83  ? 172  GLU C N   1 
ATOM   6211  C  CA  . GLU C  1 172 ? 23.092  172.994 113.015 1.00 44.40  ? 172  GLU C CA  1 
ATOM   6212  C  C   . GLU C  1 172 ? 22.126  173.717 112.086 1.00 46.94  ? 172  GLU C C   1 
ATOM   6213  O  O   . GLU C  1 172 ? 21.142  173.128 111.617 1.00 42.57  ? 172  GLU C O   1 
ATOM   6214  C  CB  . GLU C  1 172 ? 22.876  173.424 114.464 1.00 43.76  ? 172  GLU C CB  1 
ATOM   6215  C  CG  . GLU C  1 172 ? 23.334  172.390 115.483 1.00 43.46  ? 172  GLU C CG  1 
ATOM   6216  C  CD  . GLU C  1 172 ? 24.803  172.509 115.841 1.00 48.89  ? 172  GLU C CD  1 
ATOM   6217  O  OE1 . GLU C  1 172 ? 25.525  173.330 115.227 1.00 50.60  ? 172  GLU C OE1 1 
ATOM   6218  O  OE2 . GLU C  1 172 ? 25.242  171.764 116.739 1.00 50.59  ? 172  GLU C OE2 1 
ATOM   6219  N  N   . LYS C  1 173 ? 22.394  174.998 111.808 1.00 43.89  ? 173  LYS C N   1 
ATOM   6220  C  CA  . LYS C  1 173 ? 21.480  175.787 110.988 1.00 51.13  ? 173  LYS C CA  1 
ATOM   6221  C  C   . LYS C  1 173 ? 21.459  175.290 109.552 1.00 47.56  ? 173  LYS C C   1 
ATOM   6222  O  O   . LYS C  1 173 ? 20.387  175.167 108.947 1.00 48.41  ? 173  LYS C O   1 
ATOM   6223  C  CB  . LYS C  1 173 ? 21.877  177.267 111.020 1.00 58.56  ? 173  LYS C CB  1 
ATOM   6224  C  CG  . LYS C  1 173 ? 20.943  178.155 110.188 1.00 72.35  ? 173  LYS C CG  1 
ATOM   6225  C  CD  . LYS C  1 173 ? 21.375  179.621 110.155 1.00 84.64  ? 173  LYS C CD  1 
ATOM   6226  C  CE  . LYS C  1 173 ? 20.409  180.467 109.317 1.00 87.00  ? 173  LYS C CE  1 
ATOM   6227  N  NZ  . LYS C  1 173 ? 20.780  181.914 109.262 1.00 90.56  ? 173  LYS C NZ  1 
ATOM   6228  N  N   . ALA C  1 174 ? 22.635  175.005 108.994 1.00 39.39  ? 174  ALA C N   1 
ATOM   6229  C  CA  . ALA C  1 174 ? 22.709  174.470 107.644 1.00 42.94  ? 174  ALA C CA  1 
ATOM   6230  C  C   . ALA C  1 174 ? 21.983  173.130 107.546 1.00 43.63  ? 174  ALA C C   1 
ATOM   6231  O  O   . ALA C  1 174 ? 21.295  172.865 106.554 1.00 46.27  ? 174  ALA C O   1 
ATOM   6232  C  CB  . ALA C  1 174 ? 24.173  174.343 107.211 1.00 37.65  ? 174  ALA C CB  1 
ATOM   6233  N  N   . PHE C  1 175 ? 22.133  172.264 108.553 1.00 41.93  ? 175  PHE C N   1 
ATOM   6234  C  CA  . PHE C  1 175 ? 21.374  171.014 108.542 1.00 44.64  ? 175  PHE C CA  1 
ATOM   6235  C  C   . PHE C  1 175 ? 19.874  171.285 108.519 1.00 46.05  ? 175  PHE C C   1 
ATOM   6236  O  O   . PHE C  1 175 ? 19.131  170.662 107.754 1.00 43.29  ? 175  PHE C O   1 
ATOM   6237  C  CB  . PHE C  1 175 ? 21.707  170.131 109.748 1.00 42.39  ? 175  PHE C CB  1 
ATOM   6238  C  CG  . PHE C  1 175 ? 20.762  168.953 109.899 1.00 41.75  ? 175  PHE C CG  1 
ATOM   6239  C  CD1 . PHE C  1 175 ? 21.006  167.762 109.228 1.00 39.06  ? 175  PHE C CD1 1 
ATOM   6240  C  CD2 . PHE C  1 175 ? 19.617  169.049 110.676 1.00 43.33  ? 175  PHE C CD2 1 
ATOM   6241  C  CE1 . PHE C  1 175 ? 20.145  166.698 109.338 1.00 42.89  ? 175  PHE C CE1 1 
ATOM   6242  C  CE2 . PHE C  1 175 ? 18.740  167.978 110.787 1.00 44.79  ? 175  PHE C CE2 1 
ATOM   6243  C  CZ  . PHE C  1 175 ? 19.003  166.801 110.122 1.00 42.82  ? 175  PHE C CZ  1 
ATOM   6244  N  N   . GLU C  1 176 ? 19.406  172.199 109.372 1.00 43.45  ? 176  GLU C N   1 
ATOM   6245  C  CA  . GLU C  1 176 ? 17.971  172.450 109.447 1.00 46.53  ? 176  GLU C CA  1 
ATOM   6246  C  C   . GLU C  1 176 ? 17.416  172.911 108.104 1.00 49.60  ? 176  GLU C C   1 
ATOM   6247  O  O   . GLU C  1 176 ? 16.328  172.489 107.694 1.00 46.90  ? 176  GLU C O   1 
ATOM   6248  C  CB  . GLU C  1 176 ? 17.674  173.483 110.536 1.00 47.30  ? 176  GLU C CB  1 
ATOM   6249  C  CG  . GLU C  1 176 ? 17.964  172.982 111.932 1.00 47.48  ? 176  GLU C CG  1 
ATOM   6250  C  CD  . GLU C  1 176 ? 17.717  174.023 112.981 1.00 48.71  ? 176  GLU C CD  1 
ATOM   6251  O  OE1 . GLU C  1 176 ? 17.157  175.076 112.636 1.00 56.49  ? 176  GLU C OE1 1 
ATOM   6252  O  OE2 . GLU C  1 176 ? 18.063  173.786 114.151 1.00 51.20  ? 176  GLU C OE2 1 
ATOM   6253  N  N   . GLN C  1 177 ? 18.144  173.790 107.414 1.00 41.68  ? 177  GLN C N   1 
ATOM   6254  C  CA  . GLN C  1 177 ? 17.678  174.294 106.126 1.00 48.26  ? 177  GLN C CA  1 
ATOM   6255  C  C   . GLN C  1 177 ? 17.712  173.209 105.055 1.00 45.87  ? 177  GLN C C   1 
ATOM   6256  O  O   . GLN C  1 177 ? 16.792  173.109 104.235 1.00 46.62  ? 177  GLN C O   1 
ATOM   6257  C  CB  . GLN C  1 177 ? 18.521  175.503 105.722 1.00 47.67  ? 177  GLN C CB  1 
ATOM   6258  C  CG  . GLN C  1 177 ? 18.319  176.668 106.654 1.00 62.35  ? 177  GLN C CG  1 
ATOM   6259  C  CD  . GLN C  1 177 ? 19.264  177.825 106.363 1.00 79.03  ? 177  GLN C CD  1 
ATOM   6260  O  OE1 . GLN C  1 177 ? 19.094  178.921 106.895 1.00 80.63  ? 177  GLN C OE1 1 
ATOM   6261  N  NE2 . GLN C  1 177 ? 20.270  177.582 105.520 1.00 84.61  ? 177  GLN C NE2 1 
ATOM   6262  N  N   . GLY C  1 178 ? 18.776  172.406 105.028 1.00 46.87  ? 178  GLY C N   1 
ATOM   6263  C  CA  . GLY C  1 178 ? 18.853  171.335 104.050 1.00 39.53  ? 178  GLY C CA  1 
ATOM   6264  C  C   . GLY C  1 178 ? 17.815  170.254 104.291 1.00 44.29  ? 178  GLY C C   1 
ATOM   6265  O  O   . GLY C  1 178 ? 17.193  169.758 103.347 1.00 46.15  ? 178  GLY C O   1 
ATOM   6266  N  N   . ALA C  1 179 ? 17.610  169.873 105.556 1.00 42.86  ? 179  ALA C N   1 
ATOM   6267  C  CA  . ALA C  1 179 ? 16.564  168.900 105.863 1.00 40.31  ? 179  ALA C CA  1 
ATOM   6268  C  C   . ALA C  1 179 ? 15.193  169.447 105.502 1.00 40.96  ? 179  ALA C C   1 
ATOM   6269  O  O   . ALA C  1 179 ? 14.366  168.738 104.914 1.00 45.08  ? 179  ALA C O   1 
ATOM   6270  C  CB  . ALA C  1 179 ? 16.602  168.515 107.342 1.00 39.46  ? 179  ALA C CB  1 
ATOM   6271  N  N   . THR C  1 180 ? 14.946  170.721 105.809 1.00 37.14  ? 180  THR C N   1 
ATOM   6272  C  CA  . THR C  1 180 ? 13.672  171.327 105.442 1.00 43.37  ? 180  THR C CA  1 
ATOM   6273  C  C   . THR C  1 180 ? 13.450  171.266 103.935 1.00 45.05  ? 180  THR C C   1 
ATOM   6274  O  O   . THR C  1 180 ? 12.413  170.779 103.467 1.00 48.88  ? 180  THR C O   1 
ATOM   6275  C  CB  . THR C  1 180 ? 13.621  172.768 105.942 1.00 43.74  ? 180  THR C CB  1 
ATOM   6276  O  OG1 . THR C  1 180 ? 13.685  172.769 107.374 1.00 47.29  ? 180  THR C OG1 1 
ATOM   6277  C  CG2 . THR C  1 180 ? 12.344  173.463 105.463 1.00 36.86  ? 180  THR C CG2 1 
ATOM   6278  N  N   . GLU C  1 181 ? 14.451  171.687 103.159 1.00 39.75  ? 181  GLU C N   1 
ATOM   6279  C  CA  . GLU C  1 181 ? 14.307  171.682 101.709 1.00 42.39  ? 181  GLU C CA  1 
ATOM   6280  C  C   . GLU C  1 181 ? 14.096  170.264 101.187 1.00 50.29  ? 181  GLU C C   1 
ATOM   6281  O  O   . GLU C  1 181 ? 13.277  170.044 100.289 1.00 52.97  ? 181  GLU C O   1 
ATOM   6282  C  CB  . GLU C  1 181 ? 15.536  172.323 101.070 1.00 41.55  ? 181  GLU C CB  1 
ATOM   6283  C  CG  . GLU C  1 181 ? 15.397  172.544 99.589  1.00 54.20  ? 181  GLU C CG  1 
ATOM   6284  C  CD  . GLU C  1 181 ? 16.650  173.134 98.977  1.00 67.57  ? 181  GLU C CD  1 
ATOM   6285  O  OE1 . GLU C  1 181 ? 17.620  173.379 99.734  1.00 71.92  ? 181  GLU C OE1 1 
ATOM   6286  O  OE2 . GLU C  1 181 ? 16.674  173.315 97.739  1.00 65.69  ? 181  GLU C OE2 1 
ATOM   6287  N  N   . THR C  1 182 ? 14.822  169.288 101.746 1.00 47.33  ? 182  THR C N   1 
ATOM   6288  C  CA  . THR C  1 182 ? 14.628  167.891 101.371 1.00 39.62  ? 182  THR C CA  1 
ATOM   6289  C  C   . THR C  1 182 ? 13.204  167.441 101.660 1.00 44.69  ? 182  THR C C   1 
ATOM   6290  O  O   . THR C  1 182 ? 12.546  166.829 100.808 1.00 39.91  ? 182  THR C O   1 
ATOM   6291  C  CB  . THR C  1 182 ? 15.610  166.994 102.125 1.00 43.19  ? 182  THR C CB  1 
ATOM   6292  O  OG1 . THR C  1 182 ? 16.953  167.360 101.805 1.00 47.28  ? 182  THR C OG1 1 
ATOM   6293  C  CG2 . THR C  1 182 ? 15.386  165.511 101.758 1.00 44.19  ? 182  THR C CG2 1 
ATOM   6294  N  N   . LEU C  1 183 ? 12.711  167.722 102.869 1.00 42.22  ? 183  LEU C N   1 
ATOM   6295  C  CA  . LEU C  1 183 ? 11.398  167.209 103.250 1.00 43.15  ? 183  LEU C CA  1 
ATOM   6296  C  C   . LEU C  1 183 ? 10.291  167.890 102.457 1.00 41.77  ? 183  LEU C C   1 
ATOM   6297  O  O   . LEU C  1 183 ? 9.316   167.242 102.052 1.00 42.85  ? 183  LEU C O   1 
ATOM   6298  C  CB  . LEU C  1 183 ? 11.180  167.388 104.755 1.00 40.88  ? 183  LEU C CB  1 
ATOM   6299  C  CG  . LEU C  1 183 ? 12.082  166.494 105.599 1.00 37.88  ? 183  LEU C CG  1 
ATOM   6300  C  CD1 . LEU C  1 183 ? 12.147  166.965 107.030 1.00 37.25  ? 183  LEU C CD1 1 
ATOM   6301  C  CD2 . LEU C  1 183 ? 11.555  165.067 105.527 1.00 35.89  ? 183  LEU C CD2 1 
ATOM   6302  N  N   . GLU C  1 184 ? 10.444  169.186 102.200 1.00 38.95  ? 184  GLU C N   1 
ATOM   6303  C  CA  . GLU C  1 184 ? 9.465   169.910 101.398 1.00 46.67  ? 184  GLU C CA  1 
ATOM   6304  C  C   . GLU C  1 184 ? 9.428   169.391 99.964  1.00 49.96  ? 184  GLU C C   1 
ATOM   6305  O  O   . GLU C  1 184 ? 8.349   169.279 99.366  1.00 50.52  ? 184  GLU C O   1 
ATOM   6306  C  CB  . GLU C  1 184 ? 9.781   171.408 101.445 1.00 41.04  ? 184  GLU C CB  1 
ATOM   6307  C  CG  . GLU C  1 184 ? 9.494   171.987 102.830 1.00 48.49  ? 184  GLU C CG  1 
ATOM   6308  C  CD  . GLU C  1 184 ? 9.781   173.481 102.950 1.00 52.07  ? 184  GLU C CD  1 
ATOM   6309  O  OE1 . GLU C  1 184 ? 10.534  174.021 102.116 1.00 49.78  ? 184  GLU C OE1 1 
ATOM   6310  O  OE2 . GLU C  1 184 ? 9.250   174.102 103.895 1.00 57.41  ? 184  GLU C OE2 1 
ATOM   6311  N  N   . TRP C  1 185 ? 10.594  169.085 99.393  1.00 44.58  ? 185  TRP C N   1 
ATOM   6312  C  CA  . TRP C  1 185 ? 10.643  168.477 98.068  1.00 45.28  ? 185  TRP C CA  1 
ATOM   6313  C  C   . TRP C  1 185 ? 9.925   167.131 98.059  1.00 46.83  ? 185  TRP C C   1 
ATOM   6314  O  O   . TRP C  1 185 ? 9.166   166.824 97.130  1.00 48.74  ? 185  TRP C O   1 
ATOM   6315  C  CB  . TRP C  1 185 ? 12.102  168.324 97.628  1.00 43.36  ? 185  TRP C CB  1 
ATOM   6316  C  CG  . TRP C  1 185 ? 12.316  167.968 96.179  1.00 50.19  ? 185  TRP C CG  1 
ATOM   6317  C  CD1 . TRP C  1 185 ? 12.692  168.823 95.171  1.00 48.58  ? 185  TRP C CD1 1 
ATOM   6318  C  CD2 . TRP C  1 185 ? 12.201  166.667 95.576  1.00 51.27  ? 185  TRP C CD2 1 
ATOM   6319  N  NE1 . TRP C  1 185 ? 12.806  168.136 93.987  1.00 46.69  ? 185  TRP C NE1 1 
ATOM   6320  C  CE2 . TRP C  1 185 ? 12.511  166.814 94.204  1.00 52.02  ? 185  TRP C CE2 1 
ATOM   6321  C  CE3 . TRP C  1 185 ? 11.861  165.397 96.059  1.00 54.03  ? 185  TRP C CE3 1 
ATOM   6322  C  CZ2 . TRP C  1 185 ? 12.491  165.735 93.311  1.00 48.33  ? 185  TRP C CZ2 1 
ATOM   6323  C  CZ3 . TRP C  1 185 ? 11.844  164.320 95.167  1.00 49.05  ? 185  TRP C CZ3 1 
ATOM   6324  C  CH2 . TRP C  1 185 ? 12.157  164.502 93.807  1.00 50.05  ? 185  TRP C CH2 1 
ATOM   6325  N  N   . MET C  1 186 ? 10.169  166.308 99.079  1.00 49.52  ? 186  MET C N   1 
ATOM   6326  C  CA  . MET C  1 186 ? 9.551   164.986 99.125  1.00 47.52  ? 186  MET C CA  1 
ATOM   6327  C  C   . MET C  1 186 ? 8.037   165.090 99.237  1.00 51.91  ? 186  MET C C   1 
ATOM   6328  O  O   . MET C  1 186 ? 7.305   164.364 98.553  1.00 52.90  ? 186  MET C O   1 
ATOM   6329  C  CB  . MET C  1 186 ? 10.115  164.179 100.290 1.00 41.36  ? 186  MET C CB  1 
ATOM   6330  C  CG  . MET C  1 186 ? 11.576  163.833 100.133 1.00 46.38  ? 186  MET C CG  1 
ATOM   6331  S  SD  . MET C  1 186 ? 12.242  163.004 101.586 1.00 59.07  ? 186  MET C SD  1 
ATOM   6332  C  CE  . MET C  1 186 ? 11.269  161.534 101.592 1.00 53.22  ? 186  MET C CE  1 
ATOM   6333  N  N   . LYS C  1 187 ? 7.545   166.002 100.074 1.00 48.01  ? 187  LYS C N   1 
ATOM   6334  C  CA  . LYS C  1 187 ? 6.101   166.107 100.224 1.00 51.33  ? 187  LYS C CA  1 
ATOM   6335  C  C   . LYS C  1 187 ? 5.454   166.591 98.938  1.00 43.33  ? 187  LYS C C   1 
ATOM   6336  O  O   . LYS C  1 187 ? 4.294   166.273 98.676  1.00 51.01  ? 187  LYS C O   1 
ATOM   6337  C  CB  . LYS C  1 187 ? 5.735   167.014 101.400 1.00 58.10  ? 187  LYS C CB  1 
ATOM   6338  C  CG  . LYS C  1 187 ? 4.242   166.948 101.800 1.00 56.78  ? 187  LYS C CG  1 
ATOM   6339  C  CD  . LYS C  1 187 ? 4.062   167.159 103.295 1.00 49.71  ? 187  LYS C CD  1 
ATOM   6340  C  CE  . LYS C  1 187 ? 2.594   167.127 103.736 1.00 53.59  ? 187  LYS C CE  1 
ATOM   6341  N  NZ  . LYS C  1 187 ? 1.781   168.147 103.046 1.00 59.09  ? 187  LYS C NZ  1 
ATOM   6342  N  N   . ALA C  1 188 ? 6.184   167.356 98.131  1.00 45.30  ? 188  ALA C N   1 
ATOM   6343  C  CA  . ALA C  1 188 ? 5.630   167.833 96.873  1.00 51.01  ? 188  ALA C CA  1 
ATOM   6344  C  C   . ALA C  1 188 ? 5.632   166.758 95.796  1.00 56.00  ? 188  ALA C C   1 
ATOM   6345  O  O   . ALA C  1 188 ? 4.762   166.768 94.917  1.00 57.06  ? 188  ALA C O   1 
ATOM   6346  C  CB  . ALA C  1 188 ? 6.421   169.054 96.384  1.00 49.85  ? 188  ALA C CB  1 
ATOM   6347  N  N   . ASN C  1 189 ? 6.567   165.806 95.857  1.00 53.12  ? 189  ASN C N   1 
ATOM   6348  C  CA  . ASN C  1 189 ? 6.879   165.009 94.679  1.00 50.65  ? 189  ASN C CA  1 
ATOM   6349  C  C   . ASN C  1 189 ? 6.833   163.497 94.851  1.00 47.48  ? 189  ASN C C   1 
ATOM   6350  O  O   . ASN C  1 189 ? 6.850   162.794 93.834  1.00 46.18  ? 189  ASN C O   1 
ATOM   6351  C  CB  . ASN C  1 189 ? 8.266   165.407 94.146  1.00 44.64  ? 189  ASN C CB  1 
ATOM   6352  C  CG  . ASN C  1 189 ? 8.290   166.834 93.634  1.00 54.36  ? 189  ASN C CG  1 
ATOM   6353  O  OD1 . ASN C  1 189 ? 7.480   167.204 92.774  1.00 53.30  ? 189  ASN C OD1 1 
ATOM   6354  N  ND2 . ASN C  1 189 ? 9.203   167.656 94.175  1.00 45.50  ? 189  ASN C ND2 1 
ATOM   6355  N  N   . VAL C  1 190 ? 6.767   162.973 96.067  1.00 48.63  ? 190  VAL C N   1 
ATOM   6356  C  CA  . VAL C  1 190 ? 6.929   161.542 96.325  1.00 41.38  ? 190  VAL C CA  1 
ATOM   6357  C  C   . VAL C  1 190 ? 5.590   160.963 96.767  1.00 44.94  ? 190  VAL C C   1 
ATOM   6358  O  O   . VAL C  1 190 ? 4.962   161.512 97.681  1.00 48.02  ? 190  VAL C O   1 
ATOM   6359  C  CB  . VAL C  1 190 ? 8.016   161.267 97.382  1.00 41.19  ? 190  VAL C CB  1 
ATOM   6360  C  CG1 . VAL C  1 190 ? 8.173   159.769 97.589  1.00 48.29  ? 190  VAL C CG1 1 
ATOM   6361  C  CG2 . VAL C  1 190 ? 9.349   161.886 96.964  1.00 42.25  ? 190  VAL C CG2 1 
ATOM   6362  N  N   . PRO C  1 191 ? 5.116   159.880 96.147  1.00 43.81  ? 191  PRO C N   1 
ATOM   6363  C  CA  . PRO C  1 191 ? 3.805   159.322 96.518  1.00 41.84  ? 191  PRO C CA  1 
ATOM   6364  C  C   . PRO C  1 191 ? 3.776   158.809 97.952  1.00 44.65  ? 191  PRO C C   1 
ATOM   6365  O  O   . PRO C  1 191 ? 4.773   158.299 98.471  1.00 43.93  ? 191  PRO C O   1 
ATOM   6366  C  CB  . PRO C  1 191 ? 3.594   158.182 95.511  1.00 40.33  ? 191  PRO C CB  1 
ATOM   6367  C  CG  . PRO C  1 191 ? 4.865   158.030 94.772  1.00 44.11  ? 191  PRO C CG  1 
ATOM   6368  C  CD  . PRO C  1 191 ? 5.662   159.278 94.920  1.00 42.81  ? 191  PRO C CD  1 
ATOM   6369  N  N   . GLY C  1 192 ? 2.624   158.985 98.602  1.00 39.90  ? 192  GLY C N   1 
ATOM   6370  C  CA  . GLY C  1 192 ? 2.384   158.426 99.919  1.00 40.55  ? 192  GLY C CA  1 
ATOM   6371  C  C   . GLY C  1 192 ? 3.026   159.166 101.070 1.00 42.12  ? 192  GLY C C   1 
ATOM   6372  O  O   . GLY C  1 192 ? 2.939   158.696 102.209 1.00 45.84  ? 192  GLY C O   1 
ATOM   6373  N  N   . MET C  1 193 ? 3.649   160.313 100.808 1.00 42.58  ? 193  MET C N   1 
ATOM   6374  C  CA  . MET C  1 193 ? 4.283   161.144 101.827 1.00 40.06  ? 193  MET C CA  1 
ATOM   6375  C  C   . MET C  1 193 ? 3.217   161.931 102.571 1.00 40.91  ? 193  MET C C   1 
ATOM   6376  O  O   . MET C  1 193 ? 2.598   162.845 102.014 1.00 49.02  ? 193  MET C O   1 
ATOM   6377  C  CB  . MET C  1 193 ? 5.312   162.047 101.148 1.00 46.63  ? 193  MET C CB  1 
ATOM   6378  C  CG  . MET C  1 193 ? 5.702   163.329 101.859 1.00 60.66  ? 193  MET C CG  1 
ATOM   6379  S  SD  . MET C  1 193 ? 6.603   163.350 103.387 1.00 59.82  ? 193  MET C SD  1 
ATOM   6380  C  CE  . MET C  1 193 ? 7.954   164.451 103.036 1.00 51.43  ? 193  MET C CE  1 
ATOM   6381  N  N   . VAL C  1 194 ? 3.014   161.597 103.839 1.00 32.83  ? 194  VAL C N   1 
ATOM   6382  C  CA  . VAL C  1 194 ? 1.900   162.178 104.573 1.00 36.20  ? 194  VAL C CA  1 
ATOM   6383  C  C   . VAL C  1 194 ? 2.306   163.464 105.288 1.00 44.17  ? 194  VAL C C   1 
ATOM   6384  O  O   . VAL C  1 194 ? 1.557   164.442 105.293 1.00 45.12  ? 194  VAL C O   1 
ATOM   6385  C  CB  . VAL C  1 194 ? 1.326   161.133 105.541 1.00 40.04  ? 194  VAL C CB  1 
ATOM   6386  C  CG1 . VAL C  1 194 ? 0.314   161.778 106.496 1.00 35.86  ? 194  VAL C CG1 1 
ATOM   6387  C  CG2 . VAL C  1 194 ? 0.677   159.994 104.749 1.00 40.11  ? 194  VAL C CG2 1 
ATOM   6388  N  N   . GLY C  1 195 ? 3.491   163.498 105.879 1.00 39.50  ? 195  GLY C N   1 
ATOM   6389  C  CA  . GLY C  1 195 ? 3.910   164.680 106.602 1.00 42.42  ? 195  GLY C CA  1 
ATOM   6390  C  C   . GLY C  1 195 ? 5.266   164.449 107.222 1.00 45.90  ? 195  GLY C C   1 
ATOM   6391  O  O   . GLY C  1 195 ? 5.836   163.357 107.139 1.00 44.41  ? 195  GLY C O   1 
ATOM   6392  N  N   . TRP C  1 196 ? 5.778   165.500 107.855 1.00 46.27  ? 196  TRP C N   1 
ATOM   6393  C  CA  . TRP C  1 196 ? 7.114   165.433 108.421 1.00 41.14  ? 196  TRP C CA  1 
ATOM   6394  C  C   . TRP C  1 196 ? 7.243   166.437 109.553 1.00 45.73  ? 196  TRP C C   1 
ATOM   6395  O  O   . TRP C  1 196 ? 6.434   167.357 109.704 1.00 40.30  ? 196  TRP C O   1 
ATOM   6396  C  CB  . TRP C  1 196 ? 8.188   165.681 107.359 1.00 38.66  ? 196  TRP C CB  1 
ATOM   6397  C  CG  . TRP C  1 196 ? 8.073   167.007 106.636 1.00 46.32  ? 196  TRP C CG  1 
ATOM   6398  C  CD1 . TRP C  1 196 ? 7.465   167.230 105.430 1.00 46.97  ? 196  TRP C CD1 1 
ATOM   6399  C  CD2 . TRP C  1 196 ? 8.584   168.285 107.066 1.00 41.41  ? 196  TRP C CD2 1 
ATOM   6400  N  NE1 . TRP C  1 196 ? 7.566   168.558 105.089 1.00 40.46  ? 196  TRP C NE1 1 
ATOM   6401  C  CE2 . TRP C  1 196 ? 8.247   169.225 106.072 1.00 40.23  ? 196  TRP C CE2 1 
ATOM   6402  C  CE3 . TRP C  1 196 ? 9.298   168.719 108.189 1.00 41.15  ? 196  TRP C CE3 1 
ATOM   6403  C  CZ2 . TRP C  1 196 ? 8.593   170.574 106.167 1.00 39.73  ? 196  TRP C CZ2 1 
ATOM   6404  C  CZ3 . TRP C  1 196 ? 9.645   170.055 108.282 1.00 47.25  ? 196  TRP C CZ3 1 
ATOM   6405  C  CH2 . TRP C  1 196 ? 9.293   170.967 107.278 1.00 45.32  ? 196  TRP C CH2 1 
ATOM   6406  N  N   . MET C  1 197 ? 8.299   166.249 110.335 1.00 43.70  ? 197  MET C N   1 
ATOM   6407  C  CA  . MET C  1 197 ? 8.589   167.106 111.471 1.00 43.99  ? 197  MET C CA  1 
ATOM   6408  C  C   . MET C  1 197 ? 10.076  166.972 111.757 1.00 47.78  ? 197  MET C C   1 
ATOM   6409  O  O   . MET C  1 197 ? 10.605  165.854 111.724 1.00 45.34  ? 197  MET C O   1 
ATOM   6410  C  CB  . MET C  1 197 ? 7.731   166.694 112.666 1.00 48.37  ? 197  MET C CB  1 
ATOM   6411  C  CG  . MET C  1 197 ? 8.044   167.374 113.969 1.00 53.01  ? 197  MET C CG  1 
ATOM   6412  S  SD  . MET C  1 197 ? 6.709   167.062 115.158 1.00 50.13  ? 197  MET C SD  1 
ATOM   6413  C  CE  . MET C  1 197 ? 6.773   165.288 115.383 1.00 42.38  ? 197  MET C CE  1 
ATOM   6414  N  N   . ILE C  1 198 ? 10.755  168.105 111.976 1.00 41.36  ? 198  ILE C N   1 
ATOM   6415  C  CA  . ILE C  1 198 ? 12.172  168.124 112.338 1.00 38.45  ? 198  ILE C CA  1 
ATOM   6416  C  C   . ILE C  1 198 ? 12.265  168.424 113.820 1.00 38.69  ? 198  ILE C C   1 
ATOM   6417  O  O   . ILE C  1 198 ? 11.792  169.474 114.270 1.00 40.09  ? 198  ILE C O   1 
ATOM   6418  C  CB  . ILE C  1 198 ? 12.964  169.175 111.538 1.00 41.92  ? 198  ILE C CB  1 
ATOM   6419  C  CG1 . ILE C  1 198 ? 12.962  168.862 110.041 1.00 38.12  ? 198  ILE C CG1 1 
ATOM   6420  C  CG2 . ILE C  1 198 ? 14.396  169.252 112.057 1.00 31.13  ? 198  ILE C CG2 1 
ATOM   6421  C  CD1 . ILE C  1 198 ? 13.518  169.988 109.175 1.00 33.14  ? 198  ILE C CD1 1 
ATOM   6422  N  N   . MET C  1 199 ? 12.885  167.521 114.577 1.00 39.12  ? 199  MET C N   1 
ATOM   6423  C  CA  . MET C  1 199 ? 12.974  167.629 116.031 1.00 33.58  ? 199  MET C CA  1 
ATOM   6424  C  C   . MET C  1 199 ? 14.437  167.727 116.447 1.00 38.10  ? 199  MET C C   1 
ATOM   6425  O  O   . MET C  1 199 ? 15.277  166.963 115.965 1.00 40.49  ? 199  MET C O   1 
ATOM   6426  C  CB  . MET C  1 199 ? 12.307  166.434 116.719 1.00 33.14  ? 199  MET C CB  1 
ATOM   6427  C  CG  . MET C  1 199 ? 10.832  166.300 116.377 1.00 40.29  ? 199  MET C CG  1 
ATOM   6428  S  SD  . MET C  1 199 ? 9.971   164.974 117.238 1.00 43.10  ? 199  MET C SD  1 
ATOM   6429  C  CE  . MET C  1 199 ? 10.746  163.526 116.523 1.00 40.01  ? 199  MET C CE  1 
ATOM   6430  N  N   . LYS C  1 200 ? 14.737  168.668 117.339 1.00 38.73  ? 200  LYS C N   1 
ATOM   6431  C  CA  . LYS C  1 200 ? 16.098  168.936 117.797 1.00 30.91  ? 200  LYS C CA  1 
ATOM   6432  C  C   . LYS C  1 200 ? 16.166  168.645 119.288 1.00 42.15  ? 200  LYS C C   1 
ATOM   6433  O  O   . LYS C  1 200 ? 15.417  169.242 120.071 1.00 35.66  ? 200  LYS C O   1 
ATOM   6434  C  CB  . LYS C  1 200 ? 16.475  170.391 117.506 1.00 32.05  ? 200  LYS C CB  1 
ATOM   6435  C  CG  . LYS C  1 200 ? 17.867  170.798 117.932 1.00 32.66  ? 200  LYS C CG  1 
ATOM   6436  C  CD  . LYS C  1 200 ? 18.049  172.330 117.744 1.00 38.90  ? 200  LYS C CD  1 
ATOM   6437  C  CE  . LYS C  1 200 ? 19.458  172.762 118.120 1.00 38.84  ? 200  LYS C CE  1 
ATOM   6438  N  NZ  . LYS C  1 200 ? 19.612  174.229 118.105 1.00 50.18  ? 200  LYS C NZ  1 
ATOM   6439  N  N   . GLN C  1 201 ? 17.051  167.733 119.683 1.00 42.43  ? 201  GLN C N   1 
ATOM   6440  C  CA  . GLN C  1 201 ? 17.188  167.419 121.099 1.00 39.16  ? 201  GLN C CA  1 
ATOM   6441  C  C   . GLN C  1 201 ? 17.884  168.564 121.820 1.00 37.49  ? 201  GLN C C   1 
ATOM   6442  O  O   . GLN C  1 201 ? 18.923  169.046 121.367 1.00 38.16  ? 201  GLN C O   1 
ATOM   6443  C  CB  . GLN C  1 201 ? 17.968  166.120 121.300 1.00 41.89  ? 201  GLN C CB  1 
ATOM   6444  C  CG  . GLN C  1 201 ? 18.201  165.863 122.772 1.00 35.10  ? 201  GLN C CG  1 
ATOM   6445  C  CD  . GLN C  1 201 ? 19.164  164.747 123.076 1.00 37.66  ? 201  GLN C CD  1 
ATOM   6446  O  OE1 . GLN C  1 201 ? 19.932  164.853 124.035 1.00 33.46  ? 201  GLN C OE1 1 
ATOM   6447  N  NE2 . GLN C  1 201 ? 19.098  163.643 122.311 1.00 31.35  ? 201  GLN C NE2 1 
ATOM   6448  N  N   . PHE C  1 202 ? 17.300  169.040 122.922 1.00 33.84  ? 202  PHE C N   1 
ATOM   6449  C  CA  . PHE C  1 202 ? 17.952  170.100 123.679 1.00 35.72  ? 202  PHE C CA  1 
ATOM   6450  C  C   . PHE C  1 202 ? 18.116  169.789 125.157 1.00 39.84  ? 202  PHE C C   1 
ATOM   6451  O  O   . PHE C  1 202 ? 18.615  170.647 125.890 1.00 39.69  ? 202  PHE C O   1 
ATOM   6452  C  CB  . PHE C  1 202 ? 17.211  171.448 123.515 1.00 35.35  ? 202  PHE C CB  1 
ATOM   6453  C  CG  . PHE C  1 202 ? 15.825  171.459 124.086 1.00 36.10  ? 202  PHE C CG  1 
ATOM   6454  C  CD1 . PHE C  1 202 ? 14.753  171.011 123.330 1.00 36.41  ? 202  PHE C CD1 1 
ATOM   6455  C  CD2 . PHE C  1 202 ? 15.588  171.923 125.367 1.00 35.62  ? 202  PHE C CD2 1 
ATOM   6456  C  CE1 . PHE C  1 202 ? 13.476  171.012 123.844 1.00 34.87  ? 202  PHE C CE1 1 
ATOM   6457  C  CE2 . PHE C  1 202 ? 14.320  171.936 125.875 1.00 41.12  ? 202  PHE C CE2 1 
ATOM   6458  C  CZ  . PHE C  1 202 ? 13.256  171.475 125.108 1.00 40.73  ? 202  PHE C CZ  1 
ATOM   6459  N  N   . GLY C  1 203 ? 17.746  168.595 125.607 1.00 31.80  ? 203  GLY C N   1 
ATOM   6460  C  CA  . GLY C  1 203 ? 17.911  168.235 127.001 1.00 37.84  ? 203  GLY C CA  1 
ATOM   6461  C  C   . GLY C  1 203 ? 17.276  166.886 127.255 1.00 32.37  ? 203  GLY C C   1 
ATOM   6462  O  O   . GLY C  1 203 ? 16.697  166.275 126.359 1.00 40.28  ? 203  GLY C O   1 
ATOM   6463  N  N   . VAL C  1 204 ? 17.406  166.420 128.498 1.00 36.37  ? 204  VAL C N   1 
ATOM   6464  C  CA  . VAL C  1 204 ? 16.849  165.131 128.902 1.00 30.77  ? 204  VAL C CA  1 
ATOM   6465  C  C   . VAL C  1 204 ? 16.200  165.273 130.273 1.00 32.55  ? 204  VAL C C   1 
ATOM   6466  O  O   . VAL C  1 204 ? 16.693  166.015 131.129 1.00 33.91  ? 204  VAL C O   1 
ATOM   6467  C  CB  . VAL C  1 204 ? 17.920  164.017 128.939 1.00 35.08  ? 204  VAL C CB  1 
ATOM   6468  C  CG1 . VAL C  1 204 ? 17.261  162.665 129.271 1.00 30.24  ? 204  VAL C CG1 1 
ATOM   6469  C  CG2 . VAL C  1 204 ? 18.686  163.957 127.630 1.00 33.57  ? 204  VAL C CG2 1 
ATOM   6470  N  N   . SER C  1 205 ? 15.088  164.558 130.479 1.00 31.38  ? 205  SER C N   1 
ATOM   6471  C  CA  . SER C  1 205 ? 14.445  164.487 131.789 1.00 37.12  ? 205  SER C CA  1 
ATOM   6472  C  C   . SER C  1 205 ? 15.116  163.405 132.635 1.00 37.47  ? 205  SER C C   1 
ATOM   6473  O  O   . SER C  1 205 ? 15.213  162.255 132.201 1.00 35.14  ? 205  SER C O   1 
ATOM   6474  C  CB  . SER C  1 205 ? 12.952  164.194 131.624 1.00 32.49  ? 205  SER C CB  1 
ATOM   6475  O  OG  . SER C  1 205 ? 12.327  163.927 132.882 1.00 32.71  ? 205  SER C OG  1 
ATOM   6476  N  N   . ALA C  1 206 ? 15.594  163.760 133.831 1.00 33.89  ? 206  ALA C N   1 
ATOM   6477  C  CA  . ALA C  1 206 ? 16.186  162.740 134.700 1.00 34.96  ? 206  ALA C CA  1 
ATOM   6478  C  C   . ALA C  1 206 ? 15.116  161.803 135.243 1.00 37.89  ? 206  ALA C C   1 
ATOM   6479  O  O   . ALA C  1 206 ? 15.253  160.572 135.190 1.00 37.49  ? 206  ALA C O   1 
ATOM   6480  C  CB  . ALA C  1 206 ? 16.962  163.382 135.855 1.00 31.86  ? 206  ALA C CB  1 
ATOM   6481  N  N   . ILE C  1 207 ? 14.040  162.372 135.775 1.00 35.61  ? 207  ILE C N   1 
ATOM   6482  C  CA  . ILE C  1 207 ? 12.975  161.551 136.332 1.00 37.94  ? 207  ILE C CA  1 
ATOM   6483  C  C   . ILE C  1 207 ? 12.386  160.652 135.253 1.00 35.53  ? 207  ILE C C   1 
ATOM   6484  O  O   . ILE C  1 207 ? 12.205  159.451 135.465 1.00 34.40  ? 207  ILE C O   1 
ATOM   6485  C  CB  . ILE C  1 207 ? 11.907  162.442 136.994 1.00 41.01  ? 207  ILE C CB  1 
ATOM   6486  C  CG1 . ILE C  1 207 ? 12.482  163.094 138.256 1.00 38.60  ? 207  ILE C CG1 1 
ATOM   6487  C  CG2 . ILE C  1 207 ? 10.626  161.646 137.261 1.00 34.43  ? 207  ILE C CG2 1 
ATOM   6488  C  CD1 . ILE C  1 207 ? 12.685  162.113 139.426 1.00 39.63  ? 207  ILE C CD1 1 
ATOM   6489  N  N   . GLY C  1 208 ? 12.115  161.212 134.068 1.00 38.29  ? 208  GLY C N   1 
ATOM   6490  C  CA  . GLY C  1 208 ? 11.545  160.440 132.971 1.00 34.68  ? 208  GLY C CA  1 
ATOM   6491  C  C   . GLY C  1 208 ? 12.458  159.355 132.430 1.00 43.09  ? 208  GLY C C   1 
ATOM   6492  O  O   . GLY C  1 208 ? 11.984  158.425 131.763 1.00 35.98  ? 208  GLY C O   1 
ATOM   6493  N  N   . SER C  1 209 ? 13.761  159.487 132.647 1.00 38.84  ? 209  SER C N   1 
ATOM   6494  C  CA  . SER C  1 209 ? 14.732  158.472 132.270 1.00 34.44  ? 209  SER C CA  1 
ATOM   6495  C  C   . SER C  1 209 ? 15.036  157.522 133.418 1.00 33.51  ? 209  SER C C   1 
ATOM   6496  O  O   . SER C  1 209 ? 15.994  156.750 133.330 1.00 39.83  ? 209  SER C O   1 
ATOM   6497  C  CB  . SER C  1 209 ? 16.031  159.138 131.800 1.00 32.43  ? 209  SER C CB  1 
ATOM   6498  O  OG  . SER C  1 209 ? 15.790  160.031 130.723 1.00 29.82  ? 209  SER C OG  1 
ATOM   6499  N  N   . PHE C  1 210 ? 14.284  157.609 134.514 1.00 30.18  ? 210  PHE C N   1 
ATOM   6500  C  CA  . PHE C  1 210 ? 14.520  156.770 135.683 1.00 42.00  ? 210  PHE C CA  1 
ATOM   6501  C  C   . PHE C  1 210 ? 15.954  156.922 136.202 1.00 40.98  ? 210  PHE C C   1 
ATOM   6502  O  O   . PHE C  1 210 ? 16.581  155.964 136.666 1.00 36.65  ? 210  PHE C O   1 
ATOM   6503  C  CB  . PHE C  1 210 ? 14.174  155.306 135.377 1.00 48.62  ? 210  PHE C CB  1 
ATOM   6504  C  CG  . PHE C  1 210 ? 13.696  154.543 136.574 1.00 65.61  ? 210  PHE C CG  1 
ATOM   6505  C  CD1 . PHE C  1 210 ? 12.526  154.900 137.219 1.00 76.07  ? 210  PHE C CD1 1 
ATOM   6506  C  CD2 . PHE C  1 210 ? 14.405  153.445 137.041 1.00 74.81  ? 210  PHE C CD2 1 
ATOM   6507  C  CE1 . PHE C  1 210 ? 12.090  154.193 138.329 1.00 78.85  ? 210  PHE C CE1 1 
ATOM   6508  C  CE2 . PHE C  1 210 ? 13.967  152.729 138.140 1.00 73.61  ? 210  PHE C CE2 1 
ATOM   6509  C  CZ  . PHE C  1 210 ? 12.813  153.103 138.785 1.00 72.61  ? 210  PHE C CZ  1 
ATOM   6510  N  N   . GLN C  1 211 ? 16.498  158.130 136.102 1.00 36.93  ? 211  GLN C N   1 
ATOM   6511  C  CA  . GLN C  1 211 ? 17.849  158.414 136.564 1.00 36.58  ? 211  GLN C CA  1 
ATOM   6512  C  C   . GLN C  1 211 ? 17.692  159.166 137.881 1.00 35.26  ? 211  GLN C C   1 
ATOM   6513  O  O   . GLN C  1 211 ? 17.599  160.391 137.915 1.00 39.50  ? 211  GLN C O   1 
ATOM   6514  C  CB  . GLN C  1 211 ? 18.627  159.200 135.512 1.00 31.95  ? 211  GLN C CB  1 
ATOM   6515  C  CG  A GLN C  1 211 ? 18.886  158.404 134.216 0.71 37.08  ? 211  GLN C CG  1 
ATOM   6516  C  CG  B GLN C  1 211 ? 20.094  158.854 135.394 0.29 38.96  ? 211  GLN C CG  1 
ATOM   6517  C  CD  A GLN C  1 211 ? 19.996  157.358 134.337 0.71 39.66  ? 211  GLN C CD  1 
ATOM   6518  C  CD  B GLN C  1 211 ? 20.345  157.378 135.141 0.29 40.14  ? 211  GLN C CD  1 
ATOM   6519  O  OE1 A GLN C  1 211 ? 20.157  156.520 133.455 0.71 40.62  ? 211  GLN C OE1 1 
ATOM   6520  O  OE1 B GLN C  1 211 ? 19.883  156.809 134.147 0.29 38.01  ? 211  GLN C OE1 1 
ATOM   6521  N  NE2 A GLN C  1 211 ? 20.776  157.419 135.420 0.71 40.80  ? 211  GLN C NE2 1 
ATOM   6522  N  NE2 B GLN C  1 211 ? 21.076  156.748 136.050 0.29 39.49  ? 211  GLN C NE2 1 
ATOM   6523  N  N   . LEU C  1 212 ? 17.655  158.414 138.972 1.00 33.10  ? 212  LEU C N   1 
ATOM   6524  C  CA  . LEU C  1 212 ? 17.476  158.969 140.303 1.00 36.27  ? 212  LEU C CA  1 
ATOM   6525  C  C   . LEU C  1 212 ? 18.823  159.183 140.995 1.00 42.22  ? 212  LEU C C   1 
ATOM   6526  O  O   . LEU C  1 212 ? 19.884  158.797 140.498 1.00 37.30  ? 212  LEU C O   1 
ATOM   6527  C  CB  . LEU C  1 212 ? 16.610  158.036 141.134 1.00 36.32  ? 212  LEU C CB  1 
ATOM   6528  C  CG  . LEU C  1 212 ? 15.314  157.616 140.456 1.00 42.19  ? 212  LEU C CG  1 
ATOM   6529  C  CD1 . LEU C  1 212 ? 14.560  156.675 141.383 1.00 44.96  ? 212  LEU C CD1 1 
ATOM   6530  C  CD2 . LEU C  1 212 ? 14.503  158.853 140.139 1.00 39.97  ? 212  LEU C CD2 1 
ATOM   6531  N  N   . ASP C  1 213 ? 18.769  159.796 142.175 1.00 40.84  ? 213  ASP C N   1 
ATOM   6532  C  CA  . ASP C  1 213 ? 19.910  159.830 143.068 1.00 36.87  ? 213  ASP C CA  1 
ATOM   6533  C  C   . ASP C  1 213 ? 20.256  158.401 143.510 1.00 40.49  ? 213  ASP C C   1 
ATOM   6534  O  O   . ASP C  1 213 ? 19.439  157.484 143.384 1.00 40.48  ? 213  ASP C O   1 
ATOM   6535  C  CB  . ASP C  1 213 ? 19.580  160.687 144.286 1.00 35.09  ? 213  ASP C CB  1 
ATOM   6536  C  CG  . ASP C  1 213 ? 18.532  160.050 145.151 1.00 41.98  ? 213  ASP C CG  1 
ATOM   6537  O  OD1 . ASP C  1 213 ? 17.401  159.860 144.664 1.00 41.09  ? 213  ASP C OD1 1 
ATOM   6538  O  OD2 . ASP C  1 213 ? 18.854  159.688 146.297 1.00 51.34  ? 213  ASP C OD2 1 
ATOM   6539  N  N   . PRO C  1 214 ? 21.460  158.191 144.050 1.00 38.24  ? 214  PRO C N   1 
ATOM   6540  C  CA  . PRO C  1 214 ? 21.877  156.813 144.368 1.00 38.27  ? 214  PRO C CA  1 
ATOM   6541  C  C   . PRO C  1 214 ? 20.960  156.098 145.347 1.00 37.59  ? 214  PRO C C   1 
ATOM   6542  O  O   . PRO C  1 214 ? 20.717  154.897 145.175 1.00 41.45  ? 214  PRO C O   1 
ATOM   6543  C  CB  . PRO C  1 214 ? 23.299  156.998 144.931 1.00 36.81  ? 214  PRO C CB  1 
ATOM   6544  C  CG  . PRO C  1 214 ? 23.796  158.246 144.279 1.00 36.68  ? 214  PRO C CG  1 
ATOM   6545  C  CD  . PRO C  1 214 ? 22.568  159.153 144.226 1.00 36.55  ? 214  PRO C CD  1 
ATOM   6546  N  N   . GLU C  1 215 ? 20.473  156.778 146.387 1.00 36.90  ? 215  GLU C N   1 
ATOM   6547  C  CA  . GLU C  1 215 ? 19.577  156.118 147.332 1.00 54.17  ? 215  GLU C CA  1 
ATOM   6548  C  C   . GLU C  1 215 ? 18.242  155.781 146.693 1.00 45.10  ? 215  GLU C C   1 
ATOM   6549  O  O   . GLU C  1 215 ? 17.685  154.702 146.941 1.00 42.27  ? 215  GLU C O   1 
ATOM   6550  C  CB  . GLU C  1 215 ? 19.368  156.979 148.579 1.00 65.48  ? 215  GLU C CB  1 
ATOM   6551  C  CG  . GLU C  1 215 ? 20.532  156.919 149.536 1.00 81.25  ? 215  GLU C CG  1 
ATOM   6552  C  CD  . GLU C  1 215 ? 20.744  155.505 150.075 1.00 94.89  ? 215  GLU C CD  1 
ATOM   6553  O  OE1 . GLU C  1 215 ? 19.752  154.745 150.197 1.00 98.60  ? 215  GLU C OE1 1 
ATOM   6554  O  OE2 . GLU C  1 215 ? 21.903  155.144 150.368 1.00 100.49 ? 215  GLU C OE2 1 
ATOM   6555  N  N   . GLY C  1 216 ? 17.719  156.678 145.863 1.00 40.70  ? 216  GLY C N   1 
ATOM   6556  C  CA  . GLY C  1 216 ? 16.512  156.346 145.130 1.00 42.41  ? 216  GLY C CA  1 
ATOM   6557  C  C   . GLY C  1 216 ? 16.716  155.145 144.226 1.00 43.04  ? 216  GLY C C   1 
ATOM   6558  O  O   . GLY C  1 216 ? 15.840  154.282 144.112 1.00 42.20  ? 216  GLY C O   1 
ATOM   6559  N  N   . ALA C  1 217 ? 17.888  155.057 143.591 1.00 36.69  ? 217  ALA C N   1 
ATOM   6560  C  CA  . ALA C  1 217 ? 18.162  153.899 142.745 1.00 35.93  ? 217  ALA C CA  1 
ATOM   6561  C  C   . ALA C  1 217 ? 18.123  152.603 143.548 1.00 36.14  ? 217  ALA C C   1 
ATOM   6562  O  O   . ALA C  1 217 ? 17.599  151.591 143.076 1.00 41.86  ? 217  ALA C O   1 
ATOM   6563  C  CB  . ALA C  1 217 ? 19.513  154.057 142.053 1.00 36.14  ? 217  ALA C CB  1 
ATOM   6564  N  N   . MET C  1 218 ? 18.690  152.609 144.757 1.00 43.05  ? 218  MET C N   1 
ATOM   6565  C  CA  . MET C  1 218 ? 18.633  151.426 145.611 1.00 43.91  ? 218  MET C CA  1 
ATOM   6566  C  C   . MET C  1 218 ? 17.193  151.093 145.969 1.00 42.91  ? 218  MET C C   1 
ATOM   6567  O  O   . MET C  1 218 ? 16.748  149.949 145.816 1.00 38.20  ? 218  MET C O   1 
ATOM   6568  C  CB  . MET C  1 218 ? 19.450  151.637 146.883 1.00 49.57  ? 218  MET C CB  1 
ATOM   6569  C  CG  . MET C  1 218 ? 20.957  151.847 146.701 1.00 47.65  ? 218  MET C CG  1 
ATOM   6570  S  SD  . MET C  1 218 ? 21.844  150.551 145.807 1.00 58.08  ? 218  MET C SD  1 
ATOM   6571  C  CE  . MET C  1 218 ? 21.867  151.181 144.120 1.00 46.38  ? 218  MET C CE  1 
ATOM   6572  N  N   . LYS C  1 219 ? 16.437  152.085 146.455 1.00 41.39  ? 219  LYS C N   1 
ATOM   6573  C  CA  . LYS C  1 219 ? 15.059  151.803 146.852 1.00 47.21  ? 219  LYS C CA  1 
ATOM   6574  C  C   . LYS C  1 219 ? 14.212  151.381 145.656 1.00 41.41  ? 219  LYS C C   1 
ATOM   6575  O  O   . LYS C  1 219 ? 13.307  150.568 145.805 1.00 48.68  ? 219  LYS C O   1 
ATOM   6576  C  CB  . LYS C  1 219 ? 14.472  152.996 147.613 1.00 46.01  ? 219  LYS C CB  1 
ATOM   6577  C  CG  . LYS C  1 219 ? 15.134  153.141 148.987 1.00 58.10  ? 219  LYS C CG  1 
ATOM   6578  C  CD  . LYS C  1 219 ? 14.916  151.848 149.855 1.00 81.82  ? 219  LYS C CD  1 
ATOM   6579  C  CE  . LYS C  1 219 ? 15.693  151.889 151.194 1.00 86.78  ? 219  LYS C CE  1 
ATOM   6580  N  NZ  . LYS C  1 219 ? 15.701  150.584 151.946 1.00 84.38  ? 219  LYS C NZ  1 
ATOM   6581  N  N   . ALA C  1 220 ? 14.530  151.886 144.459 1.00 40.17  ? 220  ALA C N   1 
ATOM   6582  C  CA  . ALA C  1 220 ? 13.753  151.584 143.253 1.00 45.36  ? 220  ALA C CA  1 
ATOM   6583  C  C   . ALA C  1 220 ? 13.699  150.088 142.947 1.00 48.96  ? 220  ALA C C   1 
ATOM   6584  O  O   . ALA C  1 220 ? 12.722  149.616 142.355 1.00 40.42  ? 220  ALA C O   1 
ATOM   6585  C  CB  . ALA C  1 220 ? 14.291  152.357 142.058 1.00 40.81  ? 220  ALA C CB  1 
ATOM   6586  N  N   . VAL C  1 221 ? 14.749  149.336 143.277 1.00 43.22  ? 221  VAL C N   1 
ATOM   6587  C  CA  . VAL C  1 221 ? 14.719  147.895 143.087 1.00 43.55  ? 221  VAL C CA  1 
ATOM   6588  C  C   . VAL C  1 221 ? 14.435  147.151 144.392 1.00 48.46  ? 221  VAL C C   1 
ATOM   6589  O  O   . VAL C  1 221 ? 14.467  145.921 144.415 1.00 56.95  ? 221  VAL C O   1 
ATOM   6590  C  CB  . VAL C  1 221 ? 16.014  147.387 142.425 1.00 47.40  ? 221  VAL C CB  1 
ATOM   6591  C  CG1 . VAL C  1 221 ? 16.032  147.750 140.929 1.00 41.35  ? 221  VAL C CG1 1 
ATOM   6592  C  CG2 . VAL C  1 221 ? 17.249  147.956 143.137 1.00 37.42  ? 221  VAL C CG2 1 
ATOM   6593  N  N   . SER C  1 222 ? 14.147  147.868 145.476 1.00 48.71  ? 222  SER C N   1 
ATOM   6594  C  CA  . SER C  1 222 ? 13.757  147.268 146.746 1.00 50.45  ? 222  SER C CA  1 
ATOM   6595  C  C   . SER C  1 222 ? 12.245  147.149 146.905 1.00 52.71  ? 222  SER C C   1 
ATOM   6596  O  O   . SER C  1 222 ? 11.759  146.938 148.024 1.00 53.65  ? 222  SER C O   1 
ATOM   6597  C  CB  . SER C  1 222 ? 14.334  148.081 147.906 1.00 48.58  ? 222  SER C CB  1 
ATOM   6598  O  OG  . SER C  1 222 ? 15.745  148.179 147.804 1.00 61.78  ? 222  SER C OG  1 
ATOM   6599  N  N   . THR C  1 223 ? 11.498  147.271 145.813 1.00 45.74  ? 223  THR C N   1 
ATOM   6600  C  CA  . THR C  1 223 ? 10.045  147.291 145.841 1.00 41.16  ? 223  THR C CA  1 
ATOM   6601  C  C   . THR C  1 223 ? 9.558   146.665 144.545 1.00 36.96  ? 223  THR C C   1 
ATOM   6602  O  O   . THR C  1 223 ? 10.293  146.584 143.561 1.00 41.35  ? 223  THR C O   1 
ATOM   6603  C  CB  . THR C  1 223 ? 9.521   148.733 145.992 1.00 38.01  ? 223  THR C CB  1 
ATOM   6604  O  OG1 . THR C  1 223 ? 8.089   148.757 145.930 1.00 37.97  ? 223  THR C OG1 1 
ATOM   6605  C  CG2 . THR C  1 223 ? 10.079  149.618 144.885 1.00 36.02  ? 223  THR C CG2 1 
ATOM   6606  N  N   . LEU C  1 224 ? 8.319   146.206 144.543 1.00 40.22  ? 224  LEU C N   1 
ATOM   6607  C  CA  . LEU C  1 224 ? 7.712   145.762 143.298 1.00 35.71  ? 224  LEU C CA  1 
ATOM   6608  C  C   . LEU C  1 224 ? 6.818   146.834 142.701 1.00 46.02  ? 224  LEU C C   1 
ATOM   6609  O  O   . LEU C  1 224 ? 6.138   146.571 141.704 1.00 46.80  ? 224  LEU C O   1 
ATOM   6610  C  CB  . LEU C  1 224 ? 6.932   144.457 143.511 1.00 35.78  ? 224  LEU C CB  1 
ATOM   6611  C  CG  . LEU C  1 224 ? 7.809   143.321 144.049 1.00 40.26  ? 224  LEU C CG  1 
ATOM   6612  C  CD1 . LEU C  1 224 ? 6.971   142.111 144.491 1.00 49.72  ? 224  LEU C CD1 1 
ATOM   6613  C  CD2 . LEU C  1 224 ? 8.864   142.909 143.040 1.00 42.14  ? 224  LEU C CD2 1 
ATOM   6614  N  N   . GLY C  1 225 ? 6.780   148.021 143.314 1.00 39.80  ? 225  GLY C N   1 
ATOM   6615  C  CA  . GLY C  1 225 ? 6.010   149.136 142.798 1.00 35.42  ? 225  GLY C CA  1 
ATOM   6616  C  C   . GLY C  1 225 ? 5.208   149.877 143.848 1.00 35.60  ? 225  GLY C C   1 
ATOM   6617  O  O   . GLY C  1 225 ? 4.833   151.026 143.627 1.00 48.58  ? 225  GLY C O   1 
ATOM   6618  N  N   . ALA C  1 226 ? 4.947   149.249 145.000 1.00 41.89  ? 226  ALA C N   1 
ATOM   6619  C  CA  . ALA C  1 226 ? 4.101   149.858 146.026 1.00 36.04  ? 226  ALA C CA  1 
ATOM   6620  C  C   . ALA C  1 226 ? 4.850   150.787 146.972 1.00 41.95  ? 226  ALA C C   1 
ATOM   6621  O  O   . ALA C  1 226 ? 4.205   151.556 147.696 1.00 41.80  ? 226  ALA C O   1 
ATOM   6622  C  CB  . ALA C  1 226 ? 3.398   148.781 146.855 1.00 36.24  ? 226  ALA C CB  1 
ATOM   6623  N  N   . ASN C  1 227 ? 6.179   150.730 147.014 1.00 36.31  ? 227  ASN C N   1 
ATOM   6624  C  CA  . ASN C  1 227 ? 6.966   151.540 147.946 1.00 38.21  ? 227  ASN C CA  1 
ATOM   6625  C  C   . ASN C  1 227 ? 7.979   152.342 147.151 1.00 36.37  ? 227  ASN C C   1 
ATOM   6626  O  O   . ASN C  1 227 ? 9.155   151.968 147.053 1.00 38.12  ? 227  ASN C O   1 
ATOM   6627  C  CB  . ASN C  1 227 ? 7.630   150.673 149.016 1.00 36.82  ? 227  ASN C CB  1 
ATOM   6628  C  CG  . ASN C  1 227 ? 6.614   150.082 149.968 1.00 38.80  ? 227  ASN C CG  1 
ATOM   6629  O  OD1 . ASN C  1 227 ? 6.052   150.798 150.792 1.00 38.98  ? 227  ASN C OD1 1 
ATOM   6630  N  ND2 . ASN C  1 227 ? 6.327   148.787 149.823 1.00 37.00  ? 227  ASN C ND2 1 
ATOM   6631  N  N   . PRO C  1 228 ? 7.553   153.449 146.558 1.00 39.19  ? 228  PRO C N   1 
ATOM   6632  C  CA  . PRO C  1 228 ? 8.427   154.189 145.659 1.00 36.02  ? 228  PRO C CA  1 
ATOM   6633  C  C   . PRO C  1 228 ? 9.534   154.890 146.423 1.00 39.07  ? 228  PRO C C   1 
ATOM   6634  O  O   . PRO C  1 228 ? 9.400   155.180 147.621 1.00 36.50  ? 228  PRO C O   1 
ATOM   6635  C  CB  . PRO C  1 228 ? 7.478   155.202 145.008 1.00 35.83  ? 228  PRO C CB  1 
ATOM   6636  C  CG  . PRO C  1 228 ? 6.430   155.434 146.051 1.00 37.57  ? 228  PRO C CG  1 
ATOM   6637  C  CD  . PRO C  1 228 ? 6.238   154.088 146.717 1.00 37.11  ? 228  PRO C CD  1 
ATOM   6638  N  N   . PRO C  1 229 ? 10.644  155.189 145.761 1.00 44.74  ? 229  PRO C N   1 
ATOM   6639  C  CA  . PRO C  1 229 ? 11.651  156.058 146.372 1.00 49.05  ? 229  PRO C CA  1 
ATOM   6640  C  C   . PRO C  1 229 ? 11.127  157.483 146.481 1.00 45.40  ? 229  PRO C C   1 
ATOM   6641  O  O   . PRO C  1 229 ? 10.082  157.847 145.932 1.00 37.33  ? 229  PRO C O   1 
ATOM   6642  C  CB  . PRO C  1 229 ? 12.832  155.957 145.405 1.00 48.75  ? 229  PRO C CB  1 
ATOM   6643  C  CG  . PRO C  1 229 ? 12.186  155.676 144.080 1.00 45.49  ? 229  PRO C CG  1 
ATOM   6644  C  CD  . PRO C  1 229 ? 10.997  154.805 144.381 1.00 42.00  ? 229  PRO C CD  1 
ATOM   6645  N  N   . GLU C  1 230 ? 11.860  158.291 147.240 1.00 44.70  ? 230  GLU C N   1 
ATOM   6646  C  CA  . GLU C  1 230 ? 11.604  159.721 147.249 1.00 44.00  ? 230  GLU C CA  1 
ATOM   6647  C  C   . GLU C  1 230 ? 11.931  160.301 145.881 1.00 37.66  ? 230  GLU C C   1 
ATOM   6648  O  O   . GLU C  1 230 ? 12.858  159.852 145.205 1.00 39.26  ? 230  GLU C O   1 
ATOM   6649  C  CB  . GLU C  1 230 ? 12.456  160.425 148.309 1.00 48.54  ? 230  GLU C CB  1 
ATOM   6650  C  CG  . GLU C  1 230 ? 12.145  160.033 149.730 1.00 64.68  ? 230  GLU C CG  1 
ATOM   6651  C  CD  . GLU C  1 230 ? 10.681  160.195 150.063 1.00 80.17  ? 230  GLU C CD  1 
ATOM   6652  O  OE1 . GLU C  1 230 ? 10.003  159.169 150.281 1.00 85.34  ? 230  GLU C OE1 1 
ATOM   6653  O  OE2 . GLU C  1 230 ? 10.201  161.349 150.075 1.00 87.85  ? 230  GLU C OE2 1 
ATOM   6654  N  N   . TYR C  1 231 ? 11.157  161.313 145.473 1.00 41.61  ? 231  TYR C N   1 
ATOM   6655  C  CA  . TYR C  1 231 ? 11.479  162.074 144.268 1.00 37.91  ? 231  TYR C CA  1 
ATOM   6656  C  C   . TYR C  1 231 ? 12.821  162.795 144.427 1.00 38.17  ? 231  TYR C C   1 
ATOM   6657  O  O   . TYR C  1 231 ? 12.944  163.714 145.243 1.00 36.11  ? 231  TYR C O   1 
ATOM   6658  C  CB  . TYR C  1 231 ? 10.351  163.054 143.966 1.00 35.69  ? 231  TYR C CB  1 
ATOM   6659  C  CG  . TYR C  1 231 ? 10.554  163.931 142.746 1.00 40.78  ? 231  TYR C CG  1 
ATOM   6660  C  CD1 . TYR C  1 231 ? 11.243  165.143 142.835 1.00 42.39  ? 231  TYR C CD1 1 
ATOM   6661  C  CD2 . TYR C  1 231 ? 10.025  163.568 141.511 1.00 35.13  ? 231  TYR C CD2 1 
ATOM   6662  C  CE1 . TYR C  1 231 ? 11.420  165.963 141.707 1.00 38.26  ? 231  TYR C CE1 1 
ATOM   6663  C  CE2 . TYR C  1 231 ? 10.185  164.375 140.391 1.00 37.80  ? 231  TYR C CE2 1 
ATOM   6664  C  CZ  . TYR C  1 231 ? 10.888  165.576 140.493 1.00 40.55  ? 231  TYR C CZ  1 
ATOM   6665  O  OH  . TYR C  1 231 ? 11.042  166.383 139.378 1.00 39.06  ? 231  TYR C OH  1 
ATOM   6666  N  N   . ASN C  1 232 ? 13.842  162.375 143.679 1.00 40.32  ? 232  ASN C N   1 
ATOM   6667  C  CA  . ASN C  1 232 ? 15.165  162.981 143.814 1.00 36.57  ? 232  ASN C CA  1 
ATOM   6668  C  C   . ASN C  1 232 ? 16.045  162.482 142.683 1.00 39.81  ? 232  ASN C C   1 
ATOM   6669  O  O   . ASN C  1 232 ? 15.828  161.390 142.148 1.00 37.90  ? 232  ASN C O   1 
ATOM   6670  C  CB  . ASN C  1 232 ? 15.803  162.668 145.183 1.00 39.30  ? 232  ASN C CB  1 
ATOM   6671  C  CG  . ASN C  1 232 ? 16.953  163.628 145.543 1.00 46.40  ? 232  ASN C CG  1 
ATOM   6672  O  OD1 . ASN C  1 232 ? 17.188  164.637 144.866 1.00 36.28  ? 232  ASN C OD1 1 
ATOM   6673  N  ND2 . ASN C  1 232 ? 17.652  163.320 146.632 1.00 46.81  ? 232  ASN C ND2 1 
ATOM   6674  N  N   . THR C  1 233 ? 17.006  163.318 142.293 1.00 37.48  ? 233  THR C N   1 
ATOM   6675  C  CA  . THR C  1 233 ? 17.929  163.029 141.207 1.00 37.66  ? 233  THR C CA  1 
ATOM   6676  C  C   . THR C  1 233 ? 19.304  163.558 141.597 1.00 41.20  ? 233  THR C C   1 
ATOM   6677  O  O   . THR C  1 233 ? 19.473  164.210 142.637 1.00 38.54  ? 233  THR C O   1 
ATOM   6678  C  CB  . THR C  1 233 ? 17.469  163.661 139.882 1.00 37.00  ? 233  THR C CB  1 
ATOM   6679  O  OG1 . THR C  1 233 ? 17.527  165.090 139.989 1.00 34.35  ? 233  THR C OG1 1 
ATOM   6680  C  CG2 . THR C  1 233 ? 16.041  163.266 139.524 1.00 32.55  ? 233  THR C CG2 1 
ATOM   6681  N  N   . ASN C  1 234 ? 20.288  163.301 140.728 1.00 30.67  ? 234  ASN C N   1 
ATOM   6682  C  CA  . ASN C  1 234 ? 21.607  163.893 140.873 1.00 31.62  ? 234  ASN C CA  1 
ATOM   6683  C  C   . ASN C  1 234 ? 21.577  165.387 140.633 1.00 39.40  ? 234  ASN C C   1 
ATOM   6684  O  O   . ASN C  1 234 ? 22.578  166.063 140.899 1.00 43.19  ? 234  ASN C O   1 
ATOM   6685  C  CB  . ASN C  1 234 ? 22.601  163.241 139.916 1.00 31.18  ? 234  ASN C CB  1 
ATOM   6686  C  CG  . ASN C  1 234 ? 22.970  161.839 140.340 1.00 37.14  ? 234  ASN C CG  1 
ATOM   6687  O  OD1 . ASN C  1 234 ? 22.794  161.473 141.508 1.00 38.43  ? 234  ASN C OD1 1 
ATOM   6688  N  ND2 . ASN C  1 234 ? 23.545  161.066 139.417 1.00 30.65  ? 234  ASN C ND2 1 
ATOM   6689  N  N   . TYR C  1 235 ? 20.432  165.914 140.199 1.00 35.93  ? 235  TYR C N   1 
ATOM   6690  C  CA  . TYR C  1 235 ? 20.214  167.350 140.097 1.00 38.64  ? 235  TYR C CA  1 
ATOM   6691  C  C   . TYR C  1 235 ? 19.290  167.847 141.193 1.00 44.36  ? 235  TYR C C   1 
ATOM   6692  O  O   . TYR C  1 235 ? 18.702  168.922 141.063 1.00 40.67  ? 235  TYR C O   1 
ATOM   6693  C  CB  . TYR C  1 235 ? 19.656  167.690 138.720 1.00 39.24  ? 235  TYR C CB  1 
ATOM   6694  C  CG  . TYR C  1 235 ? 20.659  167.450 137.628 1.00 40.10  ? 235  TYR C CG  1 
ATOM   6695  C  CD1 . TYR C  1 235 ? 21.661  168.384 137.336 1.00 40.46  ? 235  TYR C CD1 1 
ATOM   6696  C  CD2 . TYR C  1 235 ? 20.683  166.240 136.973 1.00 35.39  ? 235  TYR C CD2 1 
ATOM   6697  C  CE1 . TYR C  1 235 ? 22.599  168.129 136.332 1.00 42.95  ? 235  TYR C CE1 1 
ATOM   6698  C  CE2 . TYR C  1 235 ? 21.611  165.967 135.989 1.00 37.44  ? 235  TYR C CE2 1 
ATOM   6699  C  CZ  . TYR C  1 235 ? 22.572  166.899 135.672 1.00 37.55  ? 235  TYR C CZ  1 
ATOM   6700  O  OH  . TYR C  1 235 ? 23.476  166.579 134.672 1.00 37.73  ? 235  TYR C OH  1 
ATOM   6701  N  N   . GLY C  1 236 ? 19.157  167.088 142.280 1.00 38.90  ? 236  GLY C N   1 
ATOM   6702  C  CA  . GLY C  1 236 ? 18.337  167.534 143.382 1.00 38.66  ? 236  GLY C CA  1 
ATOM   6703  C  C   . GLY C  1 236 ? 16.887  167.143 143.212 1.00 44.11  ? 236  GLY C C   1 
ATOM   6704  O  O   . GLY C  1 236 ? 16.503  166.410 142.295 1.00 47.73  ? 236  GLY C O   1 
ATOM   6705  N  N   . ASN C  1 237 ? 16.054  167.664 144.113 1.00 39.35  ? 237  ASN C N   1 
ATOM   6706  C  CA  . ASN C  1 237 ? 14.687  167.168 144.206 1.00 40.67  ? 237  ASN C CA  1 
ATOM   6707  C  C   . ASN C  1 237 ? 13.638  168.201 143.854 1.00 39.03  ? 237  ASN C C   1 
ATOM   6708  O  O   . ASN C  1 237 ? 12.459  167.983 144.150 1.00 42.00  ? 237  ASN C O   1 
ATOM   6709  C  CB  . ASN C  1 237 ? 14.417  166.626 145.612 1.00 39.69  ? 237  ASN C CB  1 
ATOM   6710  C  CG  . ASN C  1 237 ? 14.374  167.714 146.671 1.00 43.45  ? 237  ASN C CG  1 
ATOM   6711  O  OD1 . ASN C  1 237 ? 14.666  168.889 146.421 1.00 42.89  ? 237  ASN C OD1 1 
ATOM   6712  N  ND2 . ASN C  1 237 ? 14.044  167.308 147.882 1.00 40.17  ? 237  ASN C ND2 1 
ATOM   6713  N  N   . LYS C  1 238 ? 14.022  169.303 143.228 1.00 34.42  ? 238  LYS C N   1 
ATOM   6714  C  CA  . LYS C  1 238 ? 13.055  170.322 142.850 1.00 38.97  ? 238  LYS C CA  1 
ATOM   6715  C  C   . LYS C  1 238 ? 12.565  170.100 141.412 1.00 45.46  ? 238  LYS C C   1 
ATOM   6716  O  O   . LYS C  1 238 ? 13.179  169.372 140.625 1.00 45.13  ? 238  LYS C O   1 
ATOM   6717  C  CB  . LYS C  1 238 ? 13.660  171.720 143.021 1.00 38.34  ? 238  LYS C CB  1 
ATOM   6718  C  CG  . LYS C  1 238 ? 14.164  172.009 144.472 1.00 49.46  ? 238  LYS C CG  1 
ATOM   6719  C  CD  . LYS C  1 238 ? 13.098  171.708 145.570 1.00 51.89  ? 238  LYS C CD  1 
ATOM   6720  C  CE  . LYS C  1 238 ? 13.553  172.062 147.015 1.00 39.23  ? 238  LYS C CE  1 
ATOM   6721  N  NZ  . LYS C  1 238 ? 14.695  171.251 147.559 1.00 48.23  ? 238  LYS C NZ  1 
ATOM   6722  N  N   . VAL C  1 239 ? 11.427  170.718 141.093 1.00 45.49  ? 239  VAL C N   1 
ATOM   6723  C  CA  . VAL C  1 239 ? 10.848  170.682 139.750 1.00 41.97  ? 239  VAL C CA  1 
ATOM   6724  C  C   . VAL C  1 239 ? 11.508  171.730 138.863 1.00 47.02  ? 239  VAL C C   1 
ATOM   6725  O  O   . VAL C  1 239 ? 11.420  172.929 139.140 1.00 43.24  ? 239  VAL C O   1 
ATOM   6726  C  CB  . VAL C  1 239 ? 9.331   170.894 139.797 1.00 41.61  ? 239  VAL C CB  1 
ATOM   6727  C  CG1 . VAL C  1 239 ? 8.776   171.021 138.382 1.00 40.53  ? 239  VAL C CG1 1 
ATOM   6728  C  CG2 . VAL C  1 239 ? 8.653   169.718 140.542 1.00 36.47  ? 239  VAL C CG2 1 
ATOM   6729  N  N   . HIS C  1 240 ? 12.160  171.274 137.789 1.00 43.36  ? 240  HIS C N   1 
ATOM   6730  C  CA  . HIS C  1 240 ? 12.962  172.116 136.906 1.00 47.82  ? 240  HIS C CA  1 
ATOM   6731  C  C   . HIS C  1 240 ? 12.121  172.802 135.823 1.00 41.59  ? 240  HIS C C   1 
ATOM   6732  O  O   . HIS C  1 240 ? 11.159  172.233 135.297 1.00 40.30  ? 240  HIS C O   1 
ATOM   6733  C  CB  . HIS C  1 240 ? 14.061  171.288 136.236 1.00 47.63  ? 240  HIS C CB  1 
ATOM   6734  C  CG  . HIS C  1 240 ? 15.140  170.845 137.171 1.00 52.08  ? 240  HIS C CG  1 
ATOM   6735  N  ND1 . HIS C  1 240 ? 15.005  169.752 138.001 1.00 52.54  ? 240  HIS C ND1 1 
ATOM   6736  C  CD2 . HIS C  1 240 ? 16.368  171.355 137.417 1.00 55.12  ? 240  HIS C CD2 1 
ATOM   6737  C  CE1 . HIS C  1 240 ? 16.110  169.602 138.710 1.00 56.74  ? 240  HIS C CE1 1 
ATOM   6738  N  NE2 . HIS C  1 240 ? 16.951  170.565 138.378 1.00 57.45  ? 240  HIS C NE2 1 
ATOM   6739  N  N   . ASP C  1 241 ? 12.525  174.035 135.477 1.00 44.05  ? 241  ASP C N   1 
ATOM   6740  C  CA  . ASP C  1 241 ? 11.956  174.803 134.361 1.00 47.15  ? 241  ASP C CA  1 
ATOM   6741  C  C   . ASP C  1 241 ? 12.564  174.448 133.011 1.00 42.95  ? 241  ASP C C   1 
ATOM   6742  O  O   . ASP C  1 241 ? 11.923  174.648 131.971 1.00 37.35  ? 241  ASP C O   1 
ATOM   6743  C  CB  . ASP C  1 241 ? 12.169  176.301 134.592 1.00 55.21  ? 241  ASP C CB  1 
ATOM   6744  C  CG  . ASP C  1 241 ? 11.151  176.893 135.515 1.00 69.96  ? 241  ASP C CG  1 
ATOM   6745  O  OD1 . ASP C  1 241 ? 10.141  176.214 135.801 1.00 71.85  ? 241  ASP C OD1 1 
ATOM   6746  O  OD2 . ASP C  1 241 ? 11.367  178.035 135.971 1.00 84.68  ? 241  ASP C OD2 1 
ATOM   6747  N  N   . LYS C  1 242 ? 13.811  174.004 133.013 1.00 45.07  ? 242  LYS C N   1 
ATOM   6748  C  CA  . LYS C  1 242 ? 14.667  173.596 131.925 1.00 44.37  ? 242  LYS C CA  1 
ATOM   6749  C  C   . LYS C  1 242 ? 15.080  172.145 132.144 1.00 39.34  ? 242  LYS C C   1 
ATOM   6750  O  O   . LYS C  1 242 ? 15.109  171.684 133.288 1.00 39.80  ? 242  LYS C O   1 
ATOM   6751  C  CB  . LYS C  1 242 ? 15.904  174.504 131.906 1.00 38.60  ? 242  LYS C CB  1 
ATOM   6752  C  CG  . LYS C  1 242 ? 15.554  175.958 131.728 1.00 46.27  ? 242  LYS C CG  1 
ATOM   6753  C  CD  . LYS C  1 242 ? 16.772  176.873 131.890 1.00 57.30  ? 242  LYS C CD  1 
ATOM   6754  C  CE  . LYS C  1 242 ? 16.346  178.334 131.749 1.00 67.36  ? 242  LYS C CE  1 
ATOM   6755  N  NZ  . LYS C  1 242 ? 17.452  179.327 131.954 1.00 72.85  ? 242  LYS C NZ  1 
ATOM   6756  N  N   . PRO C  1 243 ? 15.389  171.399 131.091 1.00 36.90  ? 243  PRO C N   1 
ATOM   6757  C  CA  . PRO C  1 243 ? 15.812  169.991 131.280 1.00 36.87  ? 243  PRO C CA  1 
ATOM   6758  C  C   . PRO C  1 243 ? 16.983  169.899 132.245 1.00 38.90  ? 243  PRO C C   1 
ATOM   6759  O  O   . PRO C  1 243 ? 17.949  170.665 132.139 1.00 40.86  ? 243  PRO C O   1 
ATOM   6760  C  CB  . PRO C  1 243 ? 16.212  169.552 129.864 1.00 40.23  ? 243  PRO C CB  1 
ATOM   6761  C  CG  . PRO C  1 243 ? 15.391  170.435 128.964 1.00 41.16  ? 243  PRO C CG  1 
ATOM   6762  C  CD  . PRO C  1 243 ? 15.320  171.775 129.667 1.00 35.12  ? 243  PRO C CD  1 
ATOM   6763  N  N   . PRO C  1 244 ? 16.914  169.009 133.238 1.00 43.12  ? 244  PRO C N   1 
ATOM   6764  C  CA  . PRO C  1 244 ? 18.057  168.877 134.168 1.00 41.79  ? 244  PRO C CA  1 
ATOM   6765  C  C   . PRO C  1 244 ? 19.312  168.347 133.495 1.00 40.08  ? 244  PRO C C   1 
ATOM   6766  O  O   . PRO C  1 244 ? 20.418  168.806 133.798 1.00 37.48  ? 244  PRO C O   1 
ATOM   6767  C  CB  . PRO C  1 244 ? 17.540  167.903 135.241 1.00 44.83  ? 244  PRO C CB  1 
ATOM   6768  C  CG  . PRO C  1 244 ? 16.089  167.656 134.926 1.00 44.02  ? 244  PRO C CG  1 
ATOM   6769  C  CD  . PRO C  1 244 ? 15.839  168.048 133.518 1.00 42.70  ? 244  PRO C CD  1 
ATOM   6770  N  N   . ILE C  1 245 ? 19.170  167.387 132.591 1.00 37.84  ? 245  ILE C N   1 
ATOM   6771  C  CA  . ILE C  1 245 ? 20.303  166.793 131.886 1.00 40.14  ? 245  ILE C CA  1 
ATOM   6772  C  C   . ILE C  1 245 ? 20.489  167.562 130.586 1.00 37.16  ? 245  ILE C C   1 
ATOM   6773  O  O   . ILE C  1 245 ? 19.515  167.746 129.837 1.00 38.70  ? 245  ILE C O   1 
ATOM   6774  C  CB  . ILE C  1 245 ? 20.070  165.294 131.622 1.00 35.99  ? 245  ILE C CB  1 
ATOM   6775  C  CG1 . ILE C  1 245 ? 19.969  164.522 132.937 1.00 36.67  ? 245  ILE C CG1 1 
ATOM   6776  C  CG2 . ILE C  1 245 ? 21.134  164.696 130.689 1.00 31.45  ? 245  ILE C CG2 1 
ATOM   6777  C  CD1 . ILE C  1 245 ? 19.520  163.080 132.732 1.00 35.07  ? 245  ILE C CD1 1 
ATOM   6778  N  N   . PRO C  1 246 ? 21.701  168.048 130.291 1.00 43.15  ? 246  PRO C N   1 
ATOM   6779  C  CA  . PRO C  1 246 ? 21.922  168.780 129.035 1.00 32.13  ? 246  PRO C CA  1 
ATOM   6780  C  C   . PRO C  1 246 ? 21.687  167.886 127.830 1.00 38.12  ? 246  PRO C C   1 
ATOM   6781  O  O   . PRO C  1 246 ? 21.814  166.656 127.906 1.00 37.76  ? 246  PRO C O   1 
ATOM   6782  C  CB  . PRO C  1 246 ? 23.395  169.218 129.119 1.00 41.24  ? 246  PRO C CB  1 
ATOM   6783  C  CG  . PRO C  1 246 ? 23.770  169.103 130.549 1.00 38.49  ? 246  PRO C CG  1 
ATOM   6784  C  CD  . PRO C  1 246 ? 22.922  167.981 131.114 1.00 39.07  ? 246  PRO C CD  1 
ATOM   6785  N  N   . GLY C  1 247 ? 21.328  168.516 126.714 1.00 33.61  ? 247  GLY C N   1 
ATOM   6786  C  CA  . GLY C  1 247 ? 21.277  167.792 125.457 1.00 42.00  ? 247  GLY C CA  1 
ATOM   6787  C  C   . GLY C  1 247 ? 22.638  167.248 125.062 1.00 39.30  ? 247  GLY C C   1 
ATOM   6788  O  O   . GLY C  1 247 ? 23.682  167.824 125.381 1.00 38.62  ? 247  GLY C O   1 
ATOM   6789  N  N   . GLN C  1 248 ? 22.631  166.114 124.370 1.00 37.56  ? 248  GLN C N   1 
ATOM   6790  C  CA  . GLN C  1 248 ? 23.892  165.515 123.956 1.00 42.37  ? 248  GLN C CA  1 
ATOM   6791  C  C   . GLN C  1 248 ? 24.545  166.331 122.845 1.00 47.56  ? 248  GLN C C   1 
ATOM   6792  O  O   . GLN C  1 248 ? 23.871  166.959 122.023 1.00 43.25  ? 248  GLN C O   1 
ATOM   6793  C  CB  . GLN C  1 248 ? 23.665  164.087 123.465 1.00 33.36  ? 248  GLN C CB  1 
ATOM   6794  C  CG  . GLN C  1 248 ? 23.005  164.016 122.113 1.00 40.20  ? 248  GLN C CG  1 
ATOM   6795  C  CD  . GLN C  1 248 ? 23.081  162.623 121.511 1.00 52.17  ? 248  GLN C CD  1 
ATOM   6796  O  OE1 . GLN C  1 248 ? 23.771  162.404 120.511 1.00 60.02  ? 248  GLN C OE1 1 
ATOM   6797  N  NE2 . GLN C  1 248 ? 22.366  161.675 122.120 1.00 49.94  ? 248  GLN C NE2 1 
ATOM   6798  N  N   . THR C  1 249 ? 25.874  166.272 122.797 1.00 42.92  ? 249  THR C N   1 
ATOM   6799  C  CA  . THR C  1 249 ? 26.589  166.735 121.628 1.00 39.93  ? 249  THR C CA  1 
ATOM   6800  C  C   . THR C  1 249 ? 27.395  165.569 121.072 1.00 40.49  ? 249  THR C C   1 
ATOM   6801  O  O   . THR C  1 249 ? 27.871  164.730 121.839 1.00 41.48  ? 249  THR C O   1 
ATOM   6802  C  CB  . THR C  1 249 ? 27.531  167.916 121.918 1.00 39.20  ? 249  THR C CB  1 
ATOM   6803  O  OG1 . THR C  1 249 ? 28.652  167.472 122.694 1.00 35.35  ? 249  THR C OG1 1 
ATOM   6804  C  CG2 . THR C  1 249 ? 26.800  169.033 122.663 1.00 35.93  ? 249  THR C CG2 1 
ATOM   6805  N  N   . PRO C  1 250 ? 27.558  165.475 119.744 1.00 44.20  ? 250  PRO C N   1 
ATOM   6806  C  CA  . PRO C  1 250 ? 26.999  166.343 118.699 1.00 43.88  ? 250  PRO C CA  1 
ATOM   6807  C  C   . PRO C  1 250 ? 25.477  166.398 118.760 1.00 42.44  ? 250  PRO C C   1 
ATOM   6808  O  O   . PRO C  1 250 ? 24.869  165.436 119.225 1.00 37.34  ? 250  PRO C O   1 
ATOM   6809  C  CB  . PRO C  1 250 ? 27.464  165.677 117.398 1.00 40.78  ? 250  PRO C CB  1 
ATOM   6810  C  CG  . PRO C  1 250 ? 28.644  164.885 117.781 1.00 43.87  ? 250  PRO C CG  1 
ATOM   6811  C  CD  . PRO C  1 250 ? 28.384  164.399 119.173 1.00 42.51  ? 250  PRO C CD  1 
ATOM   6812  N  N   . THR C  1 251 ? 24.896  167.526 118.361 1.00 40.71  ? 251  THR C N   1 
ATOM   6813  C  CA  . THR C  1 251 ? 23.452  167.714 118.445 1.00 43.40  ? 251  THR C CA  1 
ATOM   6814  C  C   . THR C  1 251 ? 22.700  166.617 117.707 1.00 36.40  ? 251  THR C C   1 
ATOM   6815  O  O   . THR C  1 251 ? 22.953  166.364 116.523 1.00 39.44  ? 251  THR C O   1 
ATOM   6816  C  CB  . THR C  1 251 ? 23.071  169.072 117.853 1.00 41.35  ? 251  THR C CB  1 
ATOM   6817  O  OG1 . THR C  1 251 ? 23.816  170.103 118.506 1.00 44.77  ? 251  THR C OG1 1 
ATOM   6818  C  CG2 . THR C  1 251 ? 21.599  169.320 118.018 1.00 32.45  ? 251  THR C CG2 1 
ATOM   6819  N  N   . GLN C  1 252 ? 21.731  166.002 118.388 1.00 38.35  ? 252  GLN C N   1 
ATOM   6820  C  CA  . GLN C  1 252 ? 20.876  165.016 117.741 1.00 32.05  ? 252  GLN C CA  1 
ATOM   6821  C  C   . GLN C  1 252 ? 19.636  165.675 117.157 1.00 37.15  ? 252  GLN C C   1 
ATOM   6822  O  O   . GLN C  1 252 ? 18.952  166.454 117.832 1.00 35.77  ? 252  GLN C O   1 
ATOM   6823  C  CB  . GLN C  1 252 ? 20.449  163.907 118.698 1.00 30.82  ? 252  GLN C CB  1 
ATOM   6824  C  CG  . GLN C  1 252 ? 19.466  162.986 118.053 1.00 33.45  ? 252  GLN C CG  1 
ATOM   6825  C  CD  . GLN C  1 252 ? 18.972  161.929 118.999 1.00 41.19  ? 252  GLN C CD  1 
ATOM   6826  O  OE1 . GLN C  1 252 ? 18.423  162.237 120.044 1.00 44.76  ? 252  GLN C OE1 1 
ATOM   6827  N  NE2 . GLN C  1 252 ? 19.195  160.665 118.647 1.00 39.25  ? 252  GLN C NE2 1 
ATOM   6828  N  N   . TYR C  1 253 ? 19.365  165.364 115.895 1.00 41.66  ? 253  TYR C N   1 
ATOM   6829  C  CA  . TYR C  1 253 ? 18.105  165.684 115.246 1.00 40.09  ? 253  TYR C CA  1 
ATOM   6830  C  C   . TYR C  1 253 ? 17.418  164.383 114.871 1.00 40.11  ? 253  TYR C C   1 
ATOM   6831  O  O   . TYR C  1 253 ? 18.046  163.497 114.276 1.00 34.83  ? 253  TYR C O   1 
ATOM   6832  C  CB  . TYR C  1 253 ? 18.313  166.519 113.982 1.00 41.58  ? 253  TYR C CB  1 
ATOM   6833  C  CG  . TYR C  1 253 ? 18.728  167.952 114.215 1.00 42.79  ? 253  TYR C CG  1 
ATOM   6834  C  CD1 . TYR C  1 253 ? 20.055  168.276 114.456 1.00 38.17  ? 253  TYR C CD1 1 
ATOM   6835  C  CD2 . TYR C  1 253 ? 17.791  168.984 114.173 1.00 45.09  ? 253  TYR C CD2 1 
ATOM   6836  C  CE1 . TYR C  1 253 ? 20.450  169.602 114.645 1.00 39.23  ? 253  TYR C CE1 1 
ATOM   6837  C  CE2 . TYR C  1 253 ? 18.165  170.305 114.367 1.00 43.73  ? 253  TYR C CE2 1 
ATOM   6838  C  CZ  . TYR C  1 253 ? 19.501  170.610 114.598 1.00 44.16  ? 253  TYR C CZ  1 
ATOM   6839  O  OH  . TYR C  1 253 ? 19.885  171.922 114.797 1.00 47.22  ? 253  TYR C OH  1 
ATOM   6840  N  N   . LEU C  1 254 ? 16.133  164.283 115.194 1.00 38.00  ? 254  LEU C N   1 
ATOM   6841  C  CA  . LEU C  1 254 ? 15.279  163.200 114.722 1.00 44.38  ? 254  LEU C CA  1 
ATOM   6842  C  C   . LEU C  1 254 ? 14.368  163.767 113.642 1.00 42.53  ? 254  LEU C C   1 
ATOM   6843  O  O   . LEU C  1 254 ? 13.685  164.777 113.864 1.00 37.81  ? 254  LEU C O   1 
ATOM   6844  C  CB  . LEU C  1 254 ? 14.459  162.580 115.856 1.00 36.42  ? 254  LEU C CB  1 
ATOM   6845  C  CG  . LEU C  1 254 ? 15.236  161.879 116.970 1.00 36.12  ? 254  LEU C CG  1 
ATOM   6846  C  CD1 . LEU C  1 254 ? 14.284  161.203 117.953 1.00 32.50  ? 254  LEU C CD1 1 
ATOM   6847  C  CD2 . LEU C  1 254 ? 16.229  160.864 116.398 1.00 35.21  ? 254  LEU C CD2 1 
ATOM   6848  N  N   . VAL C  1 255 ? 14.396  163.152 112.467 1.00 42.30  ? 255  VAL C N   1 
ATOM   6849  C  CA  . VAL C  1 255 ? 13.542  163.557 111.363 1.00 35.86  ? 255  VAL C CA  1 
ATOM   6850  C  C   . VAL C  1 255 ? 12.362  162.600 111.332 1.00 35.95  ? 255  VAL C C   1 
ATOM   6851  O  O   . VAL C  1 255 ? 12.515  161.424 110.990 1.00 38.30  ? 255  VAL C O   1 
ATOM   6852  C  CB  . VAL C  1 255 ? 14.304  163.570 110.036 1.00 38.75  ? 255  VAL C CB  1 
ATOM   6853  C  CG1 . VAL C  1 255 ? 13.341  163.840 108.904 1.00 36.91  ? 255  VAL C CG1 1 
ATOM   6854  C  CG2 . VAL C  1 255 ? 15.379  164.653 110.097 1.00 39.42  ? 255  VAL C CG2 1 
ATOM   6855  N  N   . HIS C  1 256 ? 11.186  163.117 111.679 1.00 39.99  ? 256  HIS C N   1 
ATOM   6856  C  CA  . HIS C  1 256 ? 9.954   162.346 111.801 1.00 41.50  ? 256  HIS C CA  1 
ATOM   6857  C  C   . HIS C  1 256 ? 9.195   162.482 110.487 1.00 39.78  ? 256  HIS C C   1 
ATOM   6858  O  O   . HIS C  1 256 ? 8.815   163.592 110.111 1.00 35.89  ? 256  HIS C O   1 
ATOM   6859  C  CB  . HIS C  1 256 ? 9.160   162.886 113.000 1.00 35.41  ? 256  HIS C CB  1 
ATOM   6860  C  CG  . HIS C  1 256 ? 7.759   162.371 113.127 1.00 41.16  ? 256  HIS C CG  1 
ATOM   6861  N  ND1 . HIS C  1 256 ? 7.314   161.704 114.251 1.00 40.08  ? 256  HIS C ND1 1 
ATOM   6862  C  CD2 . HIS C  1 256 ? 6.684   162.492 112.311 1.00 37.91  ? 256  HIS C CD2 1 
ATOM   6863  C  CE1 . HIS C  1 256 ? 6.036   161.406 114.106 1.00 39.14  ? 256  HIS C CE1 1 
ATOM   6864  N  NE2 . HIS C  1 256 ? 5.629   161.874 112.937 1.00 35.47  ? 256  HIS C NE2 1 
ATOM   6865  N  N   . ILE C  1 257 ? 9.009   161.373 109.769 1.00 38.03  ? 257  ILE C N   1 
ATOM   6866  C  CA  . ILE C  1 257 ? 8.327   161.393 108.473 1.00 45.28  ? 257  ILE C CA  1 
ATOM   6867  C  C   . ILE C  1 257 ? 7.208   160.363 108.478 1.00 42.22  ? 257  ILE C C   1 
ATOM   6868  O  O   . ILE C  1 257 ? 7.442   159.193 108.799 1.00 39.96  ? 257  ILE C O   1 
ATOM   6869  C  CB  . ILE C  1 257 ? 9.277   161.098 107.296 1.00 45.73  ? 257  ILE C CB  1 
ATOM   6870  C  CG1 . ILE C  1 257 ? 10.608  161.836 107.443 1.00 40.45  ? 257  ILE C CG1 1 
ATOM   6871  C  CG2 . ILE C  1 257 ? 8.592   161.479 105.984 1.00 39.04  ? 257  ILE C CG2 1 
ATOM   6872  C  CD1 . ILE C  1 257 ? 11.614  161.480 106.340 1.00 41.47  ? 257  ILE C CD1 1 
ATOM   6873  N  N   . GLU C  1 258 ? 6.008   160.782 108.067 1.00 39.49  ? 258  GLU C N   1 
ATOM   6874  C  CA  . GLU C  1 258 ? 4.850   159.894 108.013 1.00 38.69  ? 258  GLU C CA  1 
ATOM   6875  C  C   . GLU C  1 258 ? 4.537   159.486 106.581 1.00 37.34  ? 258  GLU C C   1 
ATOM   6876  O  O   . GLU C  1 258 ? 4.653   160.284 105.645 1.00 43.37  ? 258  GLU C O   1 
ATOM   6877  C  CB  . GLU C  1 258 ? 3.636   160.546 108.672 1.00 38.31  ? 258  GLU C CB  1 
ATOM   6878  C  CG  . GLU C  1 258 ? 3.967   160.962 110.080 1.00 42.16  ? 258  GLU C CG  1 
ATOM   6879  C  CD  . GLU C  1 258 ? 2.762   161.332 110.916 1.00 47.76  ? 258  GLU C CD  1 
ATOM   6880  O  OE1 . GLU C  1 258 ? 2.939   161.432 112.142 1.00 43.23  ? 258  GLU C OE1 1 
ATOM   6881  O  OE2 . GLU C  1 258 ? 1.647   161.515 110.372 1.00 45.27  ? 258  GLU C OE2 1 
ATOM   6882  N  N   . TRP C  1 259 ? 4.170   158.218 106.419 1.00 41.44  ? 259  TRP C N   1 
ATOM   6883  C  CA  . TRP C  1 259 ? 3.969   157.621 105.110 1.00 42.32  ? 259  TRP C CA  1 
ATOM   6884  C  C   . TRP C  1 259 ? 2.713   156.770 105.128 1.00 39.38  ? 259  TRP C C   1 
ATOM   6885  O  O   . TRP C  1 259 ? 2.281   156.288 106.172 1.00 41.75  ? 259  TRP C O   1 
ATOM   6886  C  CB  . TRP C  1 259 ? 5.164   156.744 104.685 1.00 38.56  ? 259  TRP C CB  1 
ATOM   6887  C  CG  . TRP C  1 259 ? 6.456   157.471 104.539 1.00 35.63  ? 259  TRP C CG  1 
ATOM   6888  C  CD1 . TRP C  1 259 ? 7.407   157.661 105.500 1.00 36.65  ? 259  TRP C CD1 1 
ATOM   6889  C  CD2 . TRP C  1 259 ? 6.956   158.092 103.345 1.00 36.92  ? 259  TRP C CD2 1 
ATOM   6890  N  NE1 . TRP C  1 259 ? 8.467   158.363 104.978 1.00 38.38  ? 259  TRP C NE1 1 
ATOM   6891  C  CE2 . TRP C  1 259 ? 8.208   158.654 103.662 1.00 38.10  ? 259  TRP C CE2 1 
ATOM   6892  C  CE3 . TRP C  1 259 ? 6.457   158.238 102.037 1.00 33.79  ? 259  TRP C CE3 1 
ATOM   6893  C  CZ2 . TRP C  1 259 ? 8.977   159.347 102.718 1.00 42.25  ? 259  TRP C CZ2 1 
ATOM   6894  C  CZ3 . TRP C  1 259 ? 7.216   158.915 101.104 1.00 35.12  ? 259  TRP C CZ3 1 
ATOM   6895  C  CH2 . TRP C  1 259 ? 8.464   159.469 101.449 1.00 46.15  ? 259  TRP C CH2 1 
ATOM   6896  N  N   . GLU C  1 260 ? 2.150   156.559 103.940 1.00 41.89  ? 260  GLU C N   1 
ATOM   6897  C  CA  . GLU C  1 260 ? 0.944   155.750 103.838 1.00 40.85  ? 260  GLU C CA  1 
ATOM   6898  C  C   . GLU C  1 260 ? 1.163   154.335 104.360 1.00 40.83  ? 260  GLU C C   1 
ATOM   6899  O  O   . GLU C  1 260 ? 0.273   153.770 105.002 1.00 36.54  ? 260  GLU C O   1 
ATOM   6900  C  CB  . GLU C  1 260 ? 0.464   155.692 102.392 1.00 37.41  ? 260  GLU C CB  1 
ATOM   6901  C  CG  . GLU C  1 260 ? -0.734  154.762 102.221 1.00 40.72  ? 260  GLU C CG  1 
ATOM   6902  C  CD  . GLU C  1 260 ? -1.344  154.819 100.840 1.00 44.40  ? 260  GLU C CD  1 
ATOM   6903  O  OE1 . GLU C  1 260 ? -1.546  153.740 100.259 1.00 45.37  ? 260  GLU C OE1 1 
ATOM   6904  O  OE2 . GLU C  1 260 ? -1.616  155.933 100.334 1.00 45.69  ? 260  GLU C OE2 1 
ATOM   6905  N  N   . SER C  1 261 ? 2.328   153.747 104.089 1.00 36.38  ? 261  SER C N   1 
ATOM   6906  C  CA  . SER C  1 261 ? 2.571   152.332 104.348 1.00 38.02  ? 261  SER C CA  1 
ATOM   6907  C  C   . SER C  1 261 ? 4.078   152.103 104.397 1.00 40.46  ? 261  SER C C   1 
ATOM   6908  O  O   . SER C  1 261 ? 4.857   152.954 103.946 1.00 38.61  ? 261  SER C O   1 
ATOM   6909  C  CB  . SER C  1 261 ? 1.933   151.456 103.257 1.00 39.55  ? 261  SER C CB  1 
ATOM   6910  O  OG  . SER C  1 261 ? 2.697   151.564 102.060 1.00 42.27  ? 261  SER C OG  1 
ATOM   6911  N  N   . PRO C  1 262 ? 4.523   150.942 104.897 1.00 38.70  ? 262  PRO C N   1 
ATOM   6912  C  CA  . PRO C  1 262 ? 5.971   150.661 104.885 1.00 34.40  ? 262  PRO C CA  1 
ATOM   6913  C  C   . PRO C  1 262 ? 6.564   150.661 103.493 1.00 35.48  ? 262  PRO C C   1 
ATOM   6914  O  O   . PRO C  1 262 ? 7.705   151.115 103.304 1.00 40.42  ? 262  PRO C O   1 
ATOM   6915  C  CB  . PRO C  1 262 ? 6.067   149.281 105.553 1.00 36.40  ? 262  PRO C CB  1 
ATOM   6916  C  CG  . PRO C  1 262 ? 4.870   149.229 106.444 1.00 37.43  ? 262  PRO C CG  1 
ATOM   6917  C  CD  . PRO C  1 262 ? 3.779   149.921 105.658 1.00 35.64  ? 262  PRO C CD  1 
ATOM   6918  N  N   . GLU C  1 263 ? 5.812   150.194 102.503 1.00 36.90  ? 263  GLU C N   1 
ATOM   6919  C  CA  . GLU C  1 263 ? 6.323   150.184 101.137 1.00 43.47  ? 263  GLU C CA  1 
ATOM   6920  C  C   . GLU C  1 263 ? 6.515   151.603 100.620 1.00 39.89  ? 263  GLU C C   1 
ATOM   6921  O  O   . GLU C  1 263 ? 7.528   151.904 99.981  1.00 45.23  ? 263  GLU C O   1 
ATOM   6922  C  CB  . GLU C  1 263 ? 5.374   149.404 100.224 1.00 47.65  ? 263  GLU C CB  1 
ATOM   6923  C  CG  . GLU C  1 263 ? 5.192   147.936 100.577 1.00 68.14  ? 263  GLU C CG  1 
ATOM   6924  C  CD  . GLU C  1 263 ? 4.405   147.709 101.875 1.00 72.49  ? 263  GLU C CD  1 
ATOM   6925  O  OE1 . GLU C  1 263 ? 3.645   148.603 102.309 1.00 67.53  ? 263  GLU C OE1 1 
ATOM   6926  O  OE2 . GLU C  1 263 ? 4.536   146.607 102.448 1.00 76.71  ? 263  GLU C OE2 1 
ATOM   6927  N  N   . HIS C  1 264 ? 5.557   152.488 100.882 1.00 43.62  ? 264  HIS C N   1 
ATOM   6928  C  CA  . HIS C  1 264 ? 5.724   153.874 100.459 1.00 46.86  ? 264  HIS C CA  1 
ATOM   6929  C  C   . HIS C  1 264 ? 6.887   154.542 101.180 1.00 44.58  ? 264  HIS C C   1 
ATOM   6930  O  O   . HIS C  1 264 ? 7.589   155.373 100.594 1.00 44.61  ? 264  HIS C O   1 
ATOM   6931  C  CB  . HIS C  1 264 ? 4.438   154.661 100.680 1.00 42.46  ? 264  HIS C CB  1 
ATOM   6932  C  CG  . HIS C  1 264 ? 3.323   154.236 99.784  1.00 44.85  ? 264  HIS C CG  1 
ATOM   6933  N  ND1 . HIS C  1 264 ? 2.334   153.368 100.188 1.00 46.59  ? 264  HIS C ND1 1 
ATOM   6934  C  CD2 . HIS C  1 264 ? 3.065   154.525 98.487  1.00 48.19  ? 264  HIS C CD2 1 
ATOM   6935  C  CE1 . HIS C  1 264 ? 1.496   153.163 99.189  1.00 41.87  ? 264  HIS C CE1 1 
ATOM   6936  N  NE2 . HIS C  1 264 ? 1.923   153.843 98.142  1.00 47.65  ? 264  HIS C NE2 1 
ATOM   6937  N  N   . ALA C  1 265 ? 7.086   154.222 102.464 1.00 40.93  ? 265  ALA C N   1 
ATOM   6938  C  CA  . ALA C  1 265 ? 8.207   154.801 103.201 1.00 39.06  ? 265  ALA C CA  1 
ATOM   6939  C  C   . ALA C  1 265 ? 9.535   154.315 102.640 1.00 41.74  ? 265  ALA C C   1 
ATOM   6940  O  O   . ALA C  1 265 ? 10.463  155.106 102.425 1.00 44.77  ? 265  ALA C O   1 
ATOM   6941  C  CB  . ALA C  1 265 ? 8.102   154.460 104.688 1.00 36.49  ? 265  ALA C CB  1 
ATOM   6942  N  N   . HIS C  1 266 ? 9.640   153.009 102.387 1.00 38.64  ? 266  HIS C N   1 
ATOM   6943  C  CA  . HIS C  1 266 ? 10.894  152.455 101.899 1.00 40.60  ? 266  HIS C CA  1 
ATOM   6944  C  C   . HIS C  1 266 ? 11.254  153.052 100.548 1.00 44.39  ? 266  HIS C C   1 
ATOM   6945  O  O   . HIS C  1 266 ? 12.355  153.582 100.355 1.00 42.85  ? 266  HIS C O   1 
ATOM   6946  C  CB  . HIS C  1 266 ? 10.787  150.938 101.802 1.00 42.78  ? 266  HIS C CB  1 
ATOM   6947  C  CG  . HIS C  1 266 ? 12.042  150.282 101.322 1.00 52.13  ? 266  HIS C CG  1 
ATOM   6948  N  ND1 . HIS C  1 266 ? 12.107  149.568 100.145 1.00 51.27  ? 266  HIS C ND1 1 
ATOM   6949  C  CD2 . HIS C  1 266 ? 13.283  150.236 101.861 1.00 52.45  ? 266  HIS C CD2 1 
ATOM   6950  C  CE1 . HIS C  1 266 ? 13.335  149.109 99.981  1.00 52.06  ? 266  HIS C CE1 1 
ATOM   6951  N  NE2 . HIS C  1 266 ? 14.067  149.497 101.010 1.00 50.28  ? 266  HIS C NE2 1 
ATOM   6952  N  N   . GLN C  1 267 ? 10.313  152.991 99.607  1.00 46.95  ? 267  GLN C N   1 
ATOM   6953  C  CA  . GLN C  1 267 ? 10.529  153.541 98.278  1.00 44.14  ? 267  GLN C CA  1 
ATOM   6954  C  C   . GLN C  1 267 ? 10.678  155.059 98.327  1.00 43.78  ? 267  GLN C C   1 
ATOM   6955  O  O   . GLN C  1 267 ? 11.489  155.632 97.595  1.00 46.20  ? 267  GLN C O   1 
ATOM   6956  C  CB  . GLN C  1 267 ? 9.361   153.123 97.384  1.00 47.16  ? 267  GLN C CB  1 
ATOM   6957  C  CG  . GLN C  1 267 ? 9.480   153.453 95.917  1.00 66.48  ? 267  GLN C CG  1 
ATOM   6958  C  CD  . GLN C  1 267 ? 8.683   152.491 95.051  1.00 74.62  ? 267  GLN C CD  1 
ATOM   6959  O  OE1 . GLN C  1 267 ? 8.904   152.396 93.847  1.00 75.19  ? 267  GLN C OE1 1 
ATOM   6960  N  NE2 . GLN C  1 267 ? 7.751   151.767 95.669  1.00 79.62  ? 267  GLN C NE2 1 
ATOM   6961  N  N   . GLY C  1 268 ? 9.921   155.724 99.198  1.00 34.65  ? 268  GLY C N   1 
ATOM   6962  C  CA  . GLY C  1 268 ? 9.975   157.176 99.246  1.00 39.27  ? 268  GLY C CA  1 
ATOM   6963  C  C   . GLY C  1 268 ? 11.306  157.703 99.750  1.00 43.24  ? 268  GLY C C   1 
ATOM   6964  O  O   . GLY C  1 268 ? 11.883  158.626 99.169  1.00 49.20  ? 268  GLY C O   1 
ATOM   6965  N  N   . LEU C  1 269 ? 11.796  157.150 100.863 1.00 41.77  ? 269  LEU C N   1 
ATOM   6966  C  CA  . LEU C  1 269 ? 13.104  157.553 101.363 1.00 43.35  ? 269  LEU C CA  1 
ATOM   6967  C  C   . LEU C  1 269 ? 14.191  157.267 100.335 1.00 44.06  ? 269  LEU C C   1 
ATOM   6968  O  O   . LEU C  1 269 ? 15.172  158.012 100.245 1.00 43.82  ? 269  LEU C O   1 
ATOM   6969  C  CB  . LEU C  1 269 ? 13.400  156.827 102.674 1.00 45.21  ? 269  LEU C CB  1 
ATOM   6970  C  CG  . LEU C  1 269 ? 12.554  157.297 103.860 1.00 48.82  ? 269  LEU C CG  1 
ATOM   6971  C  CD1 . LEU C  1 269 ? 12.699  156.348 105.039 1.00 51.43  ? 269  LEU C CD1 1 
ATOM   6972  C  CD2 . LEU C  1 269 ? 12.957  158.679 104.260 1.00 42.14  ? 269  LEU C CD2 1 
ATOM   6973  N  N   . GLY C  1 270 ? 14.016  156.222 99.522  1.00 40.43  ? 270  GLY C N   1 
ATOM   6974  C  CA  . GLY C  1 270 ? 15.020  155.883 98.531  1.00 37.46  ? 270  GLY C CA  1 
ATOM   6975  C  C   . GLY C  1 270 ? 15.229  156.958 97.484  1.00 45.58  ? 270  GLY C C   1 
ATOM   6976  O  O   . GLY C  1 270 ? 16.274  156.971 96.828  1.00 46.92  ? 270  GLY C O   1 
ATOM   6977  N  N   . HIS C  1 271 ? 14.280  157.892 97.345  1.00 42.99  ? 271  HIS C N   1 
ATOM   6978  C  CA  . HIS C  1 271 ? 14.409  158.950 96.343  1.00 47.23  ? 271  HIS C CA  1 
ATOM   6979  C  C   . HIS C  1 271 ? 15.599  159.868 96.582  1.00 49.75  ? 271  HIS C C   1 
ATOM   6980  O  O   . HIS C  1 271 ? 16.061  160.504 95.629  1.00 48.18  ? 271  HIS C O   1 
ATOM   6981  C  CB  . HIS C  1 271 ? 13.148  159.813 96.281  1.00 48.91  ? 271  HIS C CB  1 
ATOM   6982  C  CG  . HIS C  1 271 ? 12.061  159.235 95.435  1.00 50.98  ? 271  HIS C CG  1 
ATOM   6983  N  ND1 . HIS C  1 271 ? 11.456  158.032 95.721  1.00 53.46  ? 271  HIS C ND1 1 
ATOM   6984  C  CD2 . HIS C  1 271 ? 11.469  159.697 94.310  1.00 52.49  ? 271  HIS C CD2 1 
ATOM   6985  C  CE1 . HIS C  1 271 ? 10.533  157.778 94.811  1.00 53.58  ? 271  HIS C CE1 1 
ATOM   6986  N  NE2 . HIS C  1 271 ? 10.519  158.774 93.945  1.00 54.55  ? 271  HIS C NE2 1 
ATOM   6987  N  N   . VAL C  1 272 ? 16.094  159.984 97.822  1.00 50.18  ? 272  VAL C N   1 
ATOM   6988  C  CA  . VAL C  1 272 ? 17.297  160.786 98.039  1.00 53.06  ? 272  VAL C CA  1 
ATOM   6989  C  C   . VAL C  1 272 ? 18.515  160.181 97.362  1.00 55.85  ? 272  VAL C C   1 
ATOM   6990  O  O   . VAL C  1 272 ? 19.564  160.839 97.291  1.00 47.85  ? 272  VAL C O   1 
ATOM   6991  C  CB  . VAL C  1 272 ? 17.653  160.988 99.530  1.00 45.87  ? 272  VAL C CB  1 
ATOM   6992  C  CG1 . VAL C  1 272 ? 16.520  161.661 100.300 1.00 41.75  ? 272  VAL C CG1 1 
ATOM   6993  C  CG2 . VAL C  1 272 ? 18.029  159.670 100.168 1.00 38.89  ? 272  VAL C CG2 1 
ATOM   6994  N  N   . MET C  1 273 ? 18.398  158.952 96.846  1.00 51.90  ? 273  MET C N   1 
ATOM   6995  C  CA  . MET C  1 273 ? 19.477  158.305 96.111  1.00 52.57  ? 273  MET C CA  1 
ATOM   6996  C  C   . MET C  1 273 ? 19.181  158.131 94.629  1.00 51.16  ? 273  MET C C   1 
ATOM   6997  O  O   . MET C  1 273 ? 20.111  158.158 93.821  1.00 48.43  ? 273  MET C O   1 
ATOM   6998  C  CB  . MET C  1 273 ? 19.783  156.925 96.715  1.00 56.60  ? 273  MET C CB  1 
ATOM   6999  C  CG  . MET C  1 273 ? 20.350  156.967 98.138  1.00 63.52  ? 273  MET C CG  1 
ATOM   7000  S  SD  . MET C  1 273 ? 20.829  155.361 98.833  1.00 72.08  ? 273  MET C SD  1 
ATOM   7001  C  CE  . MET C  1 273 ? 19.262  154.492 98.981  1.00 64.76  ? 273  MET C CE  1 
ATOM   7002  N  N   . VAL C  1 274 ? 17.915  157.978 94.245  1.00 47.29  ? 274  VAL C N   1 
ATOM   7003  C  CA  . VAL C  1 274 ? 17.574  157.630 92.872  1.00 49.63  ? 274  VAL C CA  1 
ATOM   7004  C  C   . VAL C  1 274 ? 16.881  158.758 92.124  1.00 51.77  ? 274  VAL C C   1 
ATOM   7005  O  O   . VAL C  1 274 ? 16.464  158.555 90.971  1.00 50.88  ? 274  VAL C O   1 
ATOM   7006  C  CB  . VAL C  1 274 ? 16.738  156.338 92.822  1.00 48.11  ? 274  VAL C CB  1 
ATOM   7007  C  CG1 . VAL C  1 274 ? 17.557  155.185 93.410  1.00 46.73  ? 274  VAL C CG1 1 
ATOM   7008  C  CG2 . VAL C  1 274 ? 15.424  156.509 93.580  1.00 42.25  ? 274  VAL C CG2 1 
ATOM   7009  N  N   . ASP C  1 275 ? 16.743  159.937 92.727  1.00 51.47  ? 275  ASP C N   1 
ATOM   7010  C  CA  . ASP C  1 275 ? 16.334  161.133 92.001  1.00 43.48  ? 275  ASP C CA  1 
ATOM   7011  C  C   . ASP C  1 275 ? 17.484  162.126 92.018  1.00 43.39  ? 275  ASP C C   1 
ATOM   7012  O  O   . ASP C  1 275 ? 17.920  162.557 93.092  1.00 49.09  ? 275  ASP C O   1 
ATOM   7013  C  CB  . ASP C  1 275 ? 15.079  161.765 92.595  1.00 41.86  ? 275  ASP C CB  1 
ATOM   7014  C  CG  . ASP C  1 275 ? 14.654  163.002 91.827  1.00 51.05  ? 275  ASP C CG  1 
ATOM   7015  O  OD1 . ASP C  1 275 ? 15.299  164.063 91.978  1.00 54.81  ? 275  ASP C OD1 1 
ATOM   7016  O  OD2 . ASP C  1 275 ? 13.702  162.907 91.031  1.00 56.27  ? 275  ASP C OD2 1 
ATOM   7017  N  N   . TYR C  1 276 ? 17.959  162.502 90.834  1.00 39.97  ? 276  TYR C N   1 
ATOM   7018  C  CA  . TYR C  1 276 ? 19.166  163.326 90.759  1.00 47.33  ? 276  TYR C CA  1 
ATOM   7019  C  C   . TYR C  1 276 ? 18.999  164.639 91.518  1.00 51.22  ? 276  TYR C C   1 
ATOM   7020  O  O   . TYR C  1 276 ? 19.878  165.041 92.292  1.00 45.28  ? 276  TYR C O   1 
ATOM   7021  C  CB  . TYR C  1 276 ? 19.534  163.618 89.304  1.00 42.64  ? 276  TYR C CB  1 
ATOM   7022  C  CG  . TYR C  1 276 ? 20.753  164.511 89.210  1.00 47.55  ? 276  TYR C CG  1 
ATOM   7023  C  CD1 . TYR C  1 276 ? 22.032  163.961 89.232  1.00 45.97  ? 276  TYR C CD1 1 
ATOM   7024  C  CD2 . TYR C  1 276 ? 20.632  165.897 89.147  1.00 48.45  ? 276  TYR C CD2 1 
ATOM   7025  C  CE1 . TYR C  1 276 ? 23.143  164.749 89.170  1.00 50.77  ? 276  TYR C CE1 1 
ATOM   7026  C  CE2 . TYR C  1 276 ? 21.752  166.702 89.085  1.00 51.94  ? 276  TYR C CE2 1 
ATOM   7027  C  CZ  . TYR C  1 276 ? 23.004  166.118 89.097  1.00 57.32  ? 276  TYR C CZ  1 
ATOM   7028  O  OH  . TYR C  1 276 ? 24.133  166.892 89.032  1.00 65.15  ? 276  TYR C OH  1 
ATOM   7029  N  N   . GLU C  1 277 ? 17.871  165.320 91.308  1.00 52.52  ? 277  GLU C N   1 
ATOM   7030  C  CA  . GLU C  1 277 ? 17.670  166.640 91.900  1.00 53.96  ? 277  GLU C CA  1 
ATOM   7031  C  C   . GLU C  1 277 ? 17.598  166.557 93.426  1.00 52.26  ? 277  GLU C C   1 
ATOM   7032  O  O   . GLU C  1 277 ? 18.270  167.323 94.131  1.00 51.77  ? 277  GLU C O   1 
ATOM   7033  C  CB  . GLU C  1 277 ? 16.413  167.281 91.296  1.00 54.78  ? 277  GLU C CB  1 
ATOM   7034  C  CG  . GLU C  1 277 ? 16.033  168.650 91.820  1.00 64.14  ? 277  GLU C CG  1 
ATOM   7035  C  CD  . GLU C  1 277 ? 14.811  169.231 91.110  1.00 68.83  ? 277  GLU C CD  1 
ATOM   7036  O  OE1 . GLU C  1 277 ? 13.678  169.068 91.611  1.00 67.21  ? 277  GLU C OE1 1 
ATOM   7037  O  OE2 . GLU C  1 277 ? 14.990  169.854 90.038  1.00 75.47  ? 277  GLU C OE2 1 
ATOM   7038  N  N   . LEU C  1 278 ? 16.796  165.625 93.957  1.00 51.63  ? 278  LEU C N   1 
ATOM   7039  C  CA  . LEU C  1 278 ? 16.707  165.463 95.411  1.00 48.63  ? 278  LEU C CA  1 
ATOM   7040  C  C   . LEU C  1 278 ? 18.043  165.023 96.008  1.00 50.71  ? 278  LEU C C   1 
ATOM   7041  O  O   . LEU C  1 278 ? 18.418  165.454 97.106  1.00 46.74  ? 278  LEU C O   1 
ATOM   7042  C  CB  . LEU C  1 278 ? 15.620  164.444 95.769  1.00 42.56  ? 278  LEU C CB  1 
ATOM   7043  C  CG  . LEU C  1 278 ? 15.377  164.259 97.276  1.00 38.77  ? 278  LEU C CG  1 
ATOM   7044  C  CD1 . LEU C  1 278 ? 14.891  165.552 97.913  1.00 39.89  ? 278  LEU C CD1 1 
ATOM   7045  C  CD2 . LEU C  1 278 ? 14.423  163.142 97.564  1.00 34.99  ? 278  LEU C CD2 1 
ATOM   7046  N  N   . ARG C  1 279 ? 18.772  164.163 95.291  1.00 48.07  ? 279  ARG C N   1 
ATOM   7047  C  CA  . ARG C  1 279 ? 20.073  163.688 95.751  1.00 49.50  ? 279  ARG C CA  1 
ATOM   7048  C  C   . ARG C  1 279 ? 21.047  164.847 95.994  1.00 50.61  ? 279  ARG C C   1 
ATOM   7049  O  O   . ARG C  1 279 ? 21.778  164.853 96.997  1.00 39.22  ? 279  ARG C O   1 
ATOM   7050  C  CB  . ARG C  1 279 ? 20.612  162.698 94.720  1.00 49.03  ? 279  ARG C CB  1 
ATOM   7051  C  CG  . ARG C  1 279 ? 21.967  162.102 94.988  1.00 44.20  ? 279  ARG C CG  1 
ATOM   7052  C  CD  . ARG C  1 279 ? 22.142  160.914 94.069  1.00 51.94  ? 279  ARG C CD  1 
ATOM   7053  N  NE  . ARG C  1 279 ? 23.534  160.531 93.877  1.00 49.88  ? 279  ARG C NE  1 
ATOM   7054  C  CZ  . ARG C  1 279 ? 23.905  159.367 93.357  1.00 51.55  ? 279  ARG C CZ  1 
ATOM   7055  N  NH1 . ARG C  1 279 ? 22.981  158.483 92.995  1.00 50.34  ? 279  ARG C NH1 1 
ATOM   7056  N  NH2 . ARG C  1 279 ? 25.193  159.082 93.212  1.00 48.92  ? 279  ARG C NH2 1 
ATOM   7057  N  N   . GLN C  1 280 ? 21.062  165.845 95.097  1.00 47.93  ? 280  GLN C N   1 
ATOM   7058  C  CA  . GLN C  1 280 ? 21.920  167.016 95.307  1.00 54.09  ? 280  GLN C CA  1 
ATOM   7059  C  C   . GLN C  1 280 ? 21.483  167.807 96.535  1.00 52.10  ? 280  GLN C C   1 
ATOM   7060  O  O   . GLN C  1 280 ? 22.322  168.231 97.342  1.00 48.45  ? 280  GLN C O   1 
ATOM   7061  C  CB  . GLN C  1 280 ? 21.911  167.927 94.072  1.00 48.02  ? 280  GLN C CB  1 
ATOM   7062  C  CG  . GLN C  1 280 ? 22.281  167.236 92.771  1.00 53.61  ? 280  GLN C CG  1 
ATOM   7063  C  CD  . GLN C  1 280 ? 23.469  166.300 92.924  1.00 59.23  ? 280  GLN C CD  1 
ATOM   7064  O  OE1 . GLN C  1 280 ? 23.375  165.100 92.631  1.00 59.81  ? 280  GLN C OE1 1 
ATOM   7065  N  NE2 . GLN C  1 280 ? 24.599  166.845 93.371  1.00 55.38  ? 280  GLN C NE2 1 
ATOM   7066  N  N   . ILE C  1 281 ? 20.175  168.018 96.688  1.00 47.69  ? 281  ILE C N   1 
ATOM   7067  C  CA  . ILE C  1 281 ? 19.662  168.736 97.850  1.00 41.47  ? 281  ILE C CA  1 
ATOM   7068  C  C   . ILE C  1 281 ? 20.059  168.014 99.130  1.00 46.66  ? 281  ILE C C   1 
ATOM   7069  O  O   . ILE C  1 281 ? 20.593  168.613 100.076 1.00 48.87  ? 281  ILE C O   1 
ATOM   7070  C  CB  . ILE C  1 281 ? 18.136  168.877 97.750  1.00 43.73  ? 281  ILE C CB  1 
ATOM   7071  C  CG1 . ILE C  1 281 ? 17.750  169.780 96.574  1.00 48.69  ? 281  ILE C CG1 1 
ATOM   7072  C  CG2 . ILE C  1 281 ? 17.581  169.415 99.047  1.00 50.63  ? 281  ILE C CG2 1 
ATOM   7073  C  CD1 . ILE C  1 281 ? 16.275  169.708 96.214  1.00 44.65  ? 281  ILE C CD1 1 
ATOM   7074  N  N   . HIS C  1 282 ? 19.850  166.700 99.151  1.00 43.00  ? 282  HIS C N   1 
ATOM   7075  C  CA  . HIS C  1 282 ? 20.069  165.923 100.359 1.00 40.09  ? 282  HIS C CA  1 
ATOM   7076  C  C   . HIS C  1 282 ? 21.554  165.767 100.664 1.00 39.40  ? 282  HIS C C   1 
ATOM   7077  O  O   . HIS C  1 282 ? 21.971  165.885 101.824 1.00 43.22  ? 282  HIS C O   1 
ATOM   7078  C  CB  . HIS C  1 282 ? 19.398  164.559 100.203 1.00 42.95  ? 282  HIS C CB  1 
ATOM   7079  C  CG  . HIS C  1 282 ? 19.441  163.730 101.444 1.00 44.31  ? 282  HIS C CG  1 
ATOM   7080  N  ND1 . HIS C  1 282 ? 20.190  162.576 101.542 1.00 41.07  ? 282  HIS C ND1 1 
ATOM   7081  C  CD2 . HIS C  1 282 ? 18.832  163.890 102.642 1.00 43.34  ? 282  HIS C CD2 1 
ATOM   7082  C  CE1 . HIS C  1 282 ? 20.044  162.061 102.750 1.00 40.57  ? 282  HIS C CE1 1 
ATOM   7083  N  NE2 . HIS C  1 282 ? 19.226  162.839 103.438 1.00 45.86  ? 282  HIS C NE2 1 
ATOM   7084  N  N   . ASN C  1 283 ? 22.364  165.503 99.641  1.00 40.44  ? 283  ASN C N   1 
ATOM   7085  C  CA  . ASN C  1 283 ? 23.807  165.376 99.845  1.00 46.83  ? 283  ASN C CA  1 
ATOM   7086  C  C   . ASN C  1 283 ? 24.393  166.657 100.419 1.00 47.75  ? 283  ASN C C   1 
ATOM   7087  O  O   . ASN C  1 283 ? 25.127  166.635 101.415 1.00 44.31  ? 283  ASN C O   1 
ATOM   7088  C  CB  . ASN C  1 283 ? 24.498  165.033 98.529  1.00 48.00  ? 283  ASN C CB  1 
ATOM   7089  C  CG  . ASN C  1 283 ? 24.319  163.583 98.143  1.00 52.77  ? 283  ASN C CG  1 
ATOM   7090  O  OD1 . ASN C  1 283 ? 23.602  162.833 98.806  1.00 49.59  ? 283  ASN C OD1 1 
ATOM   7091  N  ND2 . ASN C  1 283 ? 24.971  163.178 97.062  1.00 60.59  ? 283  ASN C ND2 1 
ATOM   7092  N  N   . ASN C  1 284 ? 24.076  167.788 99.795  1.00 44.36  ? 284  ASN C N   1 
ATOM   7093  C  CA  . ASN C  1 284 ? 24.670  169.049 100.202 1.00 48.54  ? 284  ASN C CA  1 
ATOM   7094  C  C   . ASN C  1 284 ? 23.992  169.632 101.429 1.00 45.72  ? 284  ASN C C   1 
ATOM   7095  O  O   . ASN C  1 284 ? 24.659  170.287 102.236 1.00 44.45  ? 284  ASN C O   1 
ATOM   7096  C  CB  . ASN C  1 284 ? 24.605  170.054 99.047  1.00 48.05  ? 284  ASN C CB  1 
ATOM   7097  C  CG  . ASN C  1 284 ? 25.407  169.608 97.838  1.00 55.43  ? 284  ASN C CG  1 
ATOM   7098  O  OD1 . ASN C  1 284 ? 26.537  169.140 97.970  1.00 58.77  ? 284  ASN C OD1 1 
ATOM   7099  N  ND2 . ASN C  1 284 ? 24.812  169.722 96.655  1.00 56.94  ? 284  ASN C ND2 1 
ATOM   7100  N  N   . GLY C  1 285 ? 22.693  169.393 101.598 1.00 43.06  ? 285  GLY C N   1 
ATOM   7101  C  CA  . GLY C  1 285 ? 21.959  170.033 102.671 1.00 45.43  ? 285  GLY C CA  1 
ATOM   7102  C  C   . GLY C  1 285 ? 21.888  169.224 103.950 1.00 50.40  ? 285  GLY C C   1 
ATOM   7103  O  O   . GLY C  1 285 ? 21.669  169.782 105.031 1.00 46.24  ? 285  GLY C O   1 
ATOM   7104  N  N   . VAL C  1 286 ? 22.097  167.913 103.850 1.00 45.82  ? 286  VAL C N   1 
ATOM   7105  C  CA  . VAL C  1 286 ? 21.977  167.045 105.017 1.00 44.80  ? 286  VAL C CA  1 
ATOM   7106  C  C   . VAL C  1 286 ? 23.259  166.251 105.223 1.00 43.57  ? 286  VAL C C   1 
ATOM   7107  O  O   . VAL C  1 286 ? 23.934  166.403 106.247 1.00 46.08  ? 286  VAL C O   1 
ATOM   7108  C  CB  . VAL C  1 286 ? 20.757  166.116 104.890 1.00 42.48  ? 286  VAL C CB  1 
ATOM   7109  C  CG1 . VAL C  1 286 ? 20.726  165.098 106.035 1.00 40.70  ? 286  VAL C CG1 1 
ATOM   7110  C  CG2 . VAL C  1 286 ? 19.478  166.944 104.853 1.00 38.30  ? 286  VAL C CG2 1 
ATOM   7111  N  N   . LEU C  1 287 ? 23.610  165.407 104.251 1.00 44.23  ? 287  LEU C N   1 
ATOM   7112  C  CA  . LEU C  1 287 ? 24.720  164.488 104.452 1.00 43.64  ? 287  LEU C CA  1 
ATOM   7113  C  C   . LEU C  1 287 ? 26.028  165.217 104.717 1.00 46.89  ? 287  LEU C C   1 
ATOM   7114  O  O   . LEU C  1 287 ? 26.860  164.727 105.498 1.00 35.37  ? 287  LEU C O   1 
ATOM   7115  C  CB  . LEU C  1 287 ? 24.868  163.551 103.249 1.00 44.65  ? 287  LEU C CB  1 
ATOM   7116  C  CG  . LEU C  1 287 ? 23.743  162.544 102.968 1.00 40.90  ? 287  LEU C CG  1 
ATOM   7117  C  CD1 . LEU C  1 287 ? 24.134  161.562 101.848 1.00 38.37  ? 287  LEU C CD1 1 
ATOM   7118  C  CD2 . LEU C  1 287 ? 23.313  161.787 104.238 1.00 35.29  ? 287  LEU C CD2 1 
ATOM   7119  N  N   . ALA C  1 288 ? 26.235  166.383 104.090 1.00 42.47  ? 288  ALA C N   1 
ATOM   7120  C  CA  . ALA C  1 288 ? 27.491  167.097 104.291 1.00 41.29  ? 288  ALA C CA  1 
ATOM   7121  C  C   . ALA C  1 288 ? 27.664  167.595 105.721 1.00 41.74  ? 288  ALA C C   1 
ATOM   7122  O  O   . ALA C  1 288 ? 28.775  167.989 106.090 1.00 41.91  ? 288  ALA C O   1 
ATOM   7123  C  CB  . ALA C  1 288 ? 27.607  168.282 103.313 1.00 38.71  ? 288  ALA C CB  1 
ATOM   7124  N  N   . HIS C  1 289 ? 26.616  167.563 106.541 1.00 36.76  ? 289  HIS C N   1 
ATOM   7125  C  CA  . HIS C  1 289 ? 26.659  168.170 107.864 1.00 43.57  ? 289  HIS C CA  1 
ATOM   7126  C  C   . HIS C  1 289 ? 26.592  167.161 109.004 1.00 45.57  ? 289  HIS C C   1 
ATOM   7127  O  O   . HIS C  1 289 ? 26.442  167.572 110.158 1.00 42.58  ? 289  HIS C O   1 
ATOM   7128  C  CB  . HIS C  1 289 ? 25.520  169.182 107.998 1.00 37.04  ? 289  HIS C CB  1 
ATOM   7129  C  CG  . HIS C  1 289 ? 25.512  170.209 106.913 1.00 43.57  ? 289  HIS C CG  1 
ATOM   7130  N  ND1 . HIS C  1 289 ? 26.583  171.043 106.675 1.00 47.92  ? 289  HIS C ND1 1 
ATOM   7131  C  CD2 . HIS C  1 289 ? 24.569  170.536 105.997 1.00 43.56  ? 289  HIS C CD2 1 
ATOM   7132  C  CE1 . HIS C  1 289 ? 26.302  171.838 105.658 1.00 49.26  ? 289  HIS C CE1 1 
ATOM   7133  N  NE2 . HIS C  1 289 ? 25.087  171.549 105.228 1.00 45.49  ? 289  HIS C NE2 1 
ATOM   7134  N  N   . LEU C  1 290 ? 26.731  165.866 108.722 1.00 39.82  ? 290  LEU C N   1 
ATOM   7135  C  CA  . LEU C  1 290 ? 26.498  164.814 109.705 1.00 41.42  ? 290  LEU C CA  1 
ATOM   7136  C  C   . LEU C  1 290 ? 27.801  164.289 110.290 1.00 37.71  ? 290  LEU C C   1 
ATOM   7137  O  O   . LEU C  1 290 ? 28.754  164.014 109.557 1.00 39.32  ? 290  LEU C O   1 
ATOM   7138  C  CB  . LEU C  1 290 ? 25.753  163.625 109.088 1.00 34.15  ? 290  LEU C CB  1 
ATOM   7139  C  CG  . LEU C  1 290 ? 24.390  163.888 108.471 1.00 40.58  ? 290  LEU C CG  1 
ATOM   7140  C  CD1 . LEU C  1 290 ? 23.733  162.573 108.021 1.00 36.47  ? 290  LEU C CD1 1 
ATOM   7141  C  CD2 . LEU C  1 290 ? 23.516  164.651 109.476 1.00 43.28  ? 290  LEU C CD2 1 
ATOM   7142  N  N   . ASP C  1 291 ? 27.814  164.120 111.615 1.00 34.76  ? 291  ASP C N   1 
ATOM   7143  C  CA  . ASP C  1 291 ? 28.777  163.236 112.265 1.00 38.26  ? 291  ASP C CA  1 
ATOM   7144  C  C   . ASP C  1 291 ? 28.306  161.787 112.260 1.00 47.25  ? 291  ASP C C   1 
ATOM   7145  O  O   . ASP C  1 291 ? 29.134  160.870 112.180 1.00 38.55  ? 291  ASP C O   1 
ATOM   7146  C  CB  . ASP C  1 291 ? 29.006  163.657 113.713 1.00 42.99  ? 291  ASP C CB  1 
ATOM   7147  C  CG  . ASP C  1 291 ? 29.956  164.811 113.835 1.00 45.46  ? 291  ASP C CG  1 
ATOM   7148  O  OD1 . ASP C  1 291 ? 30.882  164.913 113.002 1.00 47.22  ? 291  ASP C OD1 1 
ATOM   7149  O  OD2 . ASP C  1 291 ? 29.763  165.624 114.760 1.00 48.89  ? 291  ASP C OD2 1 
ATOM   7150  N  N   . LYS C  1 292 ? 26.993  161.566 112.346 1.00 44.75  ? 292  LYS C N   1 
ATOM   7151  C  CA  . LYS C  1 292 ? 26.442  160.220 112.421 1.00 41.94  ? 292  LYS C CA  1 
ATOM   7152  C  C   . LYS C  1 292 ? 25.114  160.180 111.681 1.00 37.96  ? 292  LYS C C   1 
ATOM   7153  O  O   . LYS C  1 292 ? 24.348  161.149 111.699 1.00 37.99  ? 292  LYS C O   1 
ATOM   7154  C  CB  . LYS C  1 292 ? 26.247  159.759 113.875 1.00 30.78  ? 292  LYS C CB  1 
ATOM   7155  C  CG  . LYS C  1 292 ? 25.855  158.286 114.022 1.00 30.25  ? 292  LYS C CG  1 
ATOM   7156  C  CD  . LYS C  1 292 ? 25.848  157.892 115.484 1.00 48.92  ? 292  LYS C CD  1 
ATOM   7157  C  CE  . LYS C  1 292 ? 25.677  156.389 115.651 1.00 53.83  ? 292  LYS C CE  1 
ATOM   7158  N  NZ  . LYS C  1 292 ? 25.791  155.976 117.080 1.00 61.13  ? 292  LYS C NZ  1 
ATOM   7159  N  N   . GLY C  1 293 ? 24.851  159.050 111.028 1.00 31.78  ? 293  GLY C N   1 
ATOM   7160  C  CA  . GLY C  1 293 ? 23.600  158.845 110.349 1.00 30.38  ? 293  GLY C CA  1 
ATOM   7161  C  C   . GLY C  1 293 ? 23.704  159.086 108.860 1.00 39.59  ? 293  GLY C C   1 
ATOM   7162  O  O   . GLY C  1 293 ? 24.795  159.218 108.297 1.00 44.62  ? 293  GLY C O   1 
ATOM   7163  N  N   . PRO C  1 294 ? 22.556  159.119 108.182 1.00 42.53  ? 294  PRO C N   1 
ATOM   7164  C  CA  . PRO C  1 294 ? 21.236  158.917 108.781 1.00 41.27  ? 294  PRO C CA  1 
ATOM   7165  C  C   . PRO C  1 294 ? 20.894  157.443 109.035 1.00 43.11  ? 294  PRO C C   1 
ATOM   7166  O  O   . PRO C  1 294 ? 21.367  156.553 108.327 1.00 41.29  ? 294  PRO C O   1 
ATOM   7167  C  CB  . PRO C  1 294 ? 20.294  159.529 107.745 1.00 45.35  ? 294  PRO C CB  1 
ATOM   7168  C  CG  . PRO C  1 294 ? 21.017  159.430 106.466 1.00 45.04  ? 294  PRO C CG  1 
ATOM   7169  C  CD  . PRO C  1 294 ? 22.479  159.477 106.757 1.00 42.98  ? 294  PRO C CD  1 
ATOM   7170  N  N   . TYR C  1 295 ? 20.083  157.198 110.062 1.00 40.10  ? 295  TYR C N   1 
ATOM   7171  C  CA  . TYR C  1 295 ? 19.582  155.869 110.367 1.00 40.13  ? 295  TYR C CA  1 
ATOM   7172  C  C   . TYR C  1 295 ? 18.079  155.985 110.557 1.00 36.10  ? 295  TYR C C   1 
ATOM   7173  O  O   . TYR C  1 295 ? 17.621  156.779 111.378 1.00 39.25  ? 295  TYR C O   1 
ATOM   7174  C  CB  . TYR C  1 295 ? 20.257  155.294 111.619 1.00 34.47  ? 295  TYR C CB  1 
ATOM   7175  C  CG  . TYR C  1 295 ? 19.902  153.838 111.938 1.00 28.37  ? 295  TYR C CG  1 
ATOM   7176  C  CD1 . TYR C  1 295 ? 20.460  152.796 111.222 1.00 30.78  ? 295  TYR C CD1 1 
ATOM   7177  C  CD2 . TYR C  1 295 ? 19.030  153.515 112.975 1.00 34.27  ? 295  TYR C CD2 1 
ATOM   7178  C  CE1 . TYR C  1 295 ? 20.161  151.465 111.520 1.00 29.37  ? 295  TYR C CE1 1 
ATOM   7179  C  CE2 . TYR C  1 295 ? 18.718  152.190 113.275 1.00 32.47  ? 295  TYR C CE2 1 
ATOM   7180  C  CZ  . TYR C  1 295 ? 19.286  151.168 112.545 1.00 37.92  ? 295  TYR C CZ  1 
ATOM   7181  O  OH  . TYR C  1 295 ? 18.990  149.843 112.851 1.00 37.89  ? 295  TYR C OH  1 
ATOM   7182  N  N   . TYR C  1 296 ? 17.316  155.221 109.780 1.00 40.31  ? 296  TYR C N   1 
ATOM   7183  C  CA  . TYR C  1 296 ? 15.859  155.313 109.758 1.00 35.21  ? 296  TYR C CA  1 
ATOM   7184  C  C   . TYR C  1 296 ? 15.242  154.058 110.368 1.00 40.01  ? 296  TYR C C   1 
ATOM   7185  O  O   . TYR C  1 296 ? 15.447  152.953 109.862 1.00 36.84  ? 296  TYR C O   1 
ATOM   7186  C  CB  . TYR C  1 296 ? 15.359  155.524 108.331 1.00 36.54  ? 296  TYR C CB  1 
ATOM   7187  C  CG  . TYR C  1 296 ? 15.469  156.968 107.901 1.00 49.55  ? 296  TYR C CG  1 
ATOM   7188  C  CD1 . TYR C  1 296 ? 14.502  157.884 108.271 1.00 51.12  ? 296  TYR C CD1 1 
ATOM   7189  C  CD2 . TYR C  1 296 ? 16.538  157.420 107.146 1.00 50.66  ? 296  TYR C CD2 1 
ATOM   7190  C  CE1 . TYR C  1 296 ? 14.576  159.199 107.898 1.00 56.20  ? 296  TYR C CE1 1 
ATOM   7191  C  CE2 . TYR C  1 296 ? 16.624  158.753 106.767 1.00 52.17  ? 296  TYR C CE2 1 
ATOM   7192  C  CZ  . TYR C  1 296 ? 15.631  159.634 107.151 1.00 54.81  ? 296  TYR C CZ  1 
ATOM   7193  O  OH  . TYR C  1 296 ? 15.673  160.964 106.801 1.00 64.00  ? 296  TYR C OH  1 
ATOM   7194  N  N   . MET C  1 297 ? 14.515  154.233 111.467 1.00 39.03  ? 297  MET C N   1 
ATOM   7195  C  CA  . MET C  1 297 ? 13.714  153.183 112.077 1.00 38.06  ? 297  MET C CA  1 
ATOM   7196  C  C   . MET C  1 297 ? 12.260  153.343 111.645 1.00 37.04  ? 297  MET C C   1 
ATOM   7197  O  O   . MET C  1 297 ? 11.741  154.461 111.581 1.00 42.35  ? 297  MET C O   1 
ATOM   7198  C  CB  . MET C  1 297 ? 13.812  153.239 113.602 1.00 37.64  ? 297  MET C CB  1 
ATOM   7199  C  CG  . MET C  1 297 ? 15.212  153.039 114.159 1.00 42.16  ? 297  MET C CG  1 
ATOM   7200  S  SD  . MET C  1 297 ? 15.336  153.548 115.887 1.00 44.85  ? 297  MET C SD  1 
ATOM   7201  C  CE  . MET C  1 297 ? 14.235  152.399 116.726 1.00 40.92  ? 297  MET C CE  1 
ATOM   7202  N  N   . PHE C  1 298 ? 11.611  152.222 111.349 1.00 30.97  ? 298  PHE C N   1 
ATOM   7203  C  CA  . PHE C  1 298 ? 10.208  152.201 110.952 1.00 30.86  ? 298  PHE C CA  1 
ATOM   7204  C  C   . PHE C  1 298 ? 9.354   151.877 112.166 1.00 36.79  ? 298  PHE C C   1 
ATOM   7205  O  O   . PHE C  1 298 ? 9.674   150.956 112.928 1.00 31.34  ? 298  PHE C O   1 
ATOM   7206  C  CB  . PHE C  1 298 ? 9.963   151.149 109.863 1.00 31.95  ? 298  PHE C CB  1 
ATOM   7207  C  CG  . PHE C  1 298 ? 10.371  151.578 108.478 1.00 37.69  ? 298  PHE C CG  1 
ATOM   7208  C  CD1 . PHE C  1 298 ? 11.504  152.342 108.270 1.00 46.84  ? 298  PHE C CD1 1 
ATOM   7209  C  CD2 . PHE C  1 298 ? 9.615   151.199 107.377 1.00 34.51  ? 298  PHE C CD2 1 
ATOM   7210  C  CE1 . PHE C  1 298 ? 11.868  152.727 106.995 1.00 49.15  ? 298  PHE C CE1 1 
ATOM   7211  C  CE2 . PHE C  1 298 ? 9.972   151.582 106.102 1.00 39.00  ? 298  PHE C CE2 1 
ATOM   7212  C  CZ  . PHE C  1 298 ? 11.105  152.345 105.912 1.00 41.55  ? 298  PHE C CZ  1 
ATOM   7213  N  N   . PHE C  1 299 ? 8.249   152.603 112.329 1.00 36.41  ? 299  PHE C N   1 
ATOM   7214  C  CA  . PHE C  1 299 ? 7.360   152.397 113.467 1.00 38.30  ? 299  PHE C CA  1 
ATOM   7215  C  C   . PHE C  1 299 ? 5.915   152.294 113.008 1.00 37.74  ? 299  PHE C C   1 
ATOM   7216  O  O   . PHE C  1 299 ? 5.536   152.803 111.951 1.00 39.26  ? 299  PHE C O   1 
ATOM   7217  C  CB  . PHE C  1 299 ? 7.414   153.534 114.488 1.00 37.52  ? 299  PHE C CB  1 
ATOM   7218  C  CG  . PHE C  1 299 ? 8.732   153.699 115.161 1.00 34.75  ? 299  PHE C CG  1 
ATOM   7219  C  CD1 . PHE C  1 299 ? 9.731   154.442 114.560 1.00 32.33  ? 299  PHE C CD1 1 
ATOM   7220  C  CD2 . PHE C  1 299 ? 8.950   153.167 116.423 1.00 28.82  ? 299  PHE C CD2 1 
ATOM   7221  C  CE1 . PHE C  1 299 ? 10.951  154.625 115.181 1.00 34.86  ? 299  PHE C CE1 1 
ATOM   7222  C  CE2 . PHE C  1 299 ? 10.150  153.348 117.054 1.00 36.90  ? 299  PHE C CE2 1 
ATOM   7223  C  CZ  . PHE C  1 299 ? 11.159  154.080 116.440 1.00 34.77  ? 299  PHE C CZ  1 
ATOM   7224  N  N   . SER C  1 300 ? 5.112   151.636 113.837 1.00 34.45  ? 300  SER C N   1 
ATOM   7225  C  CA  . SER C  1 300 ? 3.660   151.676 113.756 1.00 39.97  ? 300  SER C CA  1 
ATOM   7226  C  C   . SER C  1 300 ? 3.103   152.471 114.929 1.00 40.30  ? 300  SER C C   1 
ATOM   7227  O  O   . SER C  1 300 ? 3.455   152.190 116.083 1.00 37.91  ? 300  SER C O   1 
ATOM   7228  C  CB  . SER C  1 300 ? 3.075   150.262 113.775 1.00 36.54  ? 300  SER C CB  1 
ATOM   7229  O  OG  . SER C  1 300 ? 1.665   150.313 113.857 1.00 61.08  ? 300  SER C OG  1 
ATOM   7230  N  N   . PRO C  1 301 ? 2.254   153.467 114.685 1.00 48.60  ? 301  PRO C N   1 
ATOM   7231  C  CA  . PRO C  1 301 ? 1.594   154.188 115.787 1.00 48.56  ? 301  PRO C CA  1 
ATOM   7232  C  C   . PRO C  1 301 ? 0.445   153.364 116.351 1.00 44.70  ? 301  PRO C C   1 
ATOM   7233  O  O   . PRO C  1 301 ? -0.605  153.221 115.718 1.00 51.67  ? 301  PRO C O   1 
ATOM   7234  C  CB  . PRO C  1 301 ? 1.101   155.477 115.112 1.00 46.25  ? 301  PRO C CB  1 
ATOM   7235  C  CG  . PRO C  1 301 ? 0.861   155.069 113.694 1.00 50.60  ? 301  PRO C CG  1 
ATOM   7236  C  CD  . PRO C  1 301 ? 1.897   154.004 113.365 1.00 37.17  ? 301  PRO C CD  1 
ATOM   7237  N  N   . MET C  1 302 ? 0.640   152.820 117.551 1.00 39.35  ? 302  MET C N   1 
ATOM   7238  C  CA  . MET C  1 302 ? -0.373  151.963 118.158 1.00 42.99  ? 302  MET C CA  1 
ATOM   7239  C  C   . MET C  1 302 ? -1.540  152.774 118.708 1.00 48.16  ? 302  MET C C   1 
ATOM   7240  O  O   . MET C  1 302 ? -2.704  152.429 118.490 1.00 64.18  ? 302  MET C O   1 
ATOM   7241  C  CB  . MET C  1 302 ? 0.236   151.139 119.286 1.00 45.10  ? 302  MET C CB  1 
ATOM   7242  C  CG  . MET C  1 302 ? 1.348   150.212 118.910 1.00 55.96  ? 302  MET C CG  1 
ATOM   7243  S  SD  A MET C  1 302 ? 0.862   149.193 117.488 0.50 61.13  ? 302  MET C SD  1 
ATOM   7244  S  SD  B MET C  1 302 ? 2.198   149.775 120.458 0.50 57.04  ? 302  MET C SD  1 
ATOM   7245  C  CE  A MET C  1 302 ? -0.548  148.318 118.183 0.50 59.17  ? 302  MET C CE  1 
ATOM   7246  C  CE  B MET C  1 302 ? 0.843   149.133 121.442 0.50 55.63  ? 302  MET C CE  1 
ATOM   7247  N  N   . MET C  1 303 ? -1.245  153.807 119.484 1.00 45.59  ? 303  MET C N   1 
ATOM   7248  C  CA  . MET C  1 303 ? -2.251  154.684 120.062 1.00 49.58  ? 303  MET C CA  1 
ATOM   7249  C  C   . MET C  1 303 ? -1.822  156.114 119.790 1.00 53.13  ? 303  MET C C   1 
ATOM   7250  O  O   . MET C  1 303 ? -0.626  156.420 119.842 1.00 43.92  ? 303  MET C O   1 
ATOM   7251  C  CB  . MET C  1 303 ? -2.396  154.502 121.581 1.00 57.50  ? 303  MET C CB  1 
ATOM   7252  C  CG  . MET C  1 303 ? -2.680  153.093 122.075 1.00 78.09  ? 303  MET C CG  1 
ATOM   7253  S  SD  . MET C  1 303 ? -3.185  153.117 123.821 1.00 99.89  ? 303  MET C SD  1 
ATOM   7254  C  CE  . MET C  1 303 ? -1.629  153.318 124.699 1.00 99.72  ? 303  MET C CE  1 
ATOM   7255  N  N   . GLU C  1 304 ? -2.795  156.986 119.519 1.00 40.64  ? 304  GLU C N   1 
ATOM   7256  C  CA  . GLU C  1 304 ? -2.521  158.392 119.279 1.00 42.49  ? 304  GLU C CA  1 
ATOM   7257  C  C   . GLU C  1 304 ? -3.603  159.228 119.928 1.00 45.75  ? 304  GLU C C   1 
ATOM   7258  O  O   . GLU C  1 304 ? -4.795  158.953 119.765 1.00 44.08  ? 304  GLU C O   1 
ATOM   7259  C  CB  . GLU C  1 304 ? -2.501  158.753 117.788 1.00 40.95  ? 304  GLU C CB  1 
ATOM   7260  C  CG  . GLU C  1 304 ? -1.673  157.859 116.910 1.00 48.95  ? 304  GLU C CG  1 
ATOM   7261  C  CD  . GLU C  1 304 ? -1.633  158.352 115.480 1.00 47.83  ? 304  GLU C CD  1 
ATOM   7262  O  OE1 . GLU C  1 304 ? -0.862  159.298 115.206 1.00 44.14  ? 304  GLU C OE1 1 
ATOM   7263  O  OE2 . GLU C  1 304 ? -2.366  157.808 114.635 1.00 45.50  ? 304  GLU C OE2 1 
ATOM   7264  N  N   . GLN C  1 305 ? -3.186  160.280 120.613 1.00 41.60  ? 305  GLN C N   1 
ATOM   7265  C  CA  . GLN C  1 305 ? -4.084  161.373 120.955 1.00 42.44  ? 305  GLN C CA  1 
ATOM   7266  C  C   . GLN C  1 305 ? -3.463  162.563 120.243 1.00 42.34  ? 305  GLN C C   1 
ATOM   7267  O  O   . GLN C  1 305 ? -2.532  163.185 120.765 1.00 43.02  ? 305  GLN C O   1 
ATOM   7268  C  CB  . GLN C  1 305 ? -4.200  161.565 122.459 1.00 42.48  ? 305  GLN C CB  1 
ATOM   7269  C  CG  . GLN C  1 305 ? -5.326  162.469 122.868 1.00 43.43  ? 305  GLN C CG  1 
ATOM   7270  C  CD  . GLN C  1 305 ? -4.950  163.935 122.763 1.00 53.15  ? 305  GLN C CD  1 
ATOM   7271  O  OE1 . GLN C  1 305 ? -4.948  164.516 121.672 1.00 48.98  ? 305  GLN C OE1 1 
ATOM   7272  N  NE2 . GLN C  1 305 ? -4.616  164.541 123.904 1.00 50.41  ? 305  GLN C NE2 1 
ATOM   7273  N  N   . GLY C  1 306 ? -3.976  162.862 119.049 1.00 42.83  ? 306  GLY C N   1 
ATOM   7274  C  CA  . GLY C  1 306 ? -3.284  163.718 118.106 1.00 42.61  ? 306  GLY C CA  1 
ATOM   7275  C  C   . GLY C  1 306 ? -3.727  165.171 118.059 1.00 60.91  ? 306  GLY C C   1 
ATOM   7276  O  O   . GLY C  1 306 ? -3.462  165.862 117.066 1.00 57.32  ? 306  GLY C O   1 
ATOM   7277  N  N   . LEU C  1 307 ? -4.436  165.654 119.081 1.00 43.80  ? 307  LEU C N   1 
ATOM   7278  C  CA  . LEU C  1 307 ? -4.881  167.042 119.008 1.00 57.99  ? 307  LEU C CA  1 
ATOM   7279  C  C   . LEU C  1 307 ? -3.727  168.040 119.054 1.00 52.03  ? 307  LEU C C   1 
ATOM   7280  O  O   . LEU C  1 307 ? -3.874  169.151 118.539 1.00 44.30  ? 307  LEU C O   1 
ATOM   7281  C  CB  . LEU C  1 307 ? -5.903  167.333 120.101 1.00 63.32  ? 307  LEU C CB  1 
ATOM   7282  C  CG  . LEU C  1 307 ? -7.270  166.879 119.564 1.00 69.34  ? 307  LEU C CG  1 
ATOM   7283  C  CD1 . LEU C  1 307 ? -7.679  165.498 120.092 1.00 71.09  ? 307  LEU C CD1 1 
ATOM   7284  C  CD2 . LEU C  1 307 ? -8.348  167.917 119.800 1.00 67.63  ? 307  LEU C CD2 1 
ATOM   7285  N  N   . TRP C  1 308 ? -2.567  167.657 119.597 1.00 44.41  ? 308  TRP C N   1 
ATOM   7286  C  CA  . TRP C  1 308 ? -1.418  168.559 119.593 1.00 44.69  ? 308  TRP C CA  1 
ATOM   7287  C  C   . TRP C  1 308 ? -1.045  168.999 118.181 1.00 50.17  ? 308  TRP C C   1 
ATOM   7288  O  O   . TRP C  1 308 ? -0.543  170.113 117.988 1.00 49.36  ? 308  TRP C O   1 
ATOM   7289  C  CB  . TRP C  1 308 ? -0.226  167.881 120.264 1.00 48.35  ? 308  TRP C CB  1 
ATOM   7290  C  CG  . TRP C  1 308 ? 0.269   166.675 119.522 1.00 41.57  ? 308  TRP C CG  1 
ATOM   7291  C  CD1 . TRP C  1 308 ? -0.220  165.410 119.612 1.00 40.86  ? 308  TRP C CD1 1 
ATOM   7292  C  CD2 . TRP C  1 308 ? 1.360   166.622 118.594 1.00 42.93  ? 308  TRP C CD2 1 
ATOM   7293  N  NE1 . TRP C  1 308 ? 0.476   164.573 118.784 1.00 40.23  ? 308  TRP C NE1 1 
ATOM   7294  C  CE2 . TRP C  1 308 ? 1.461   165.287 118.152 1.00 44.31  ? 308  TRP C CE2 1 
ATOM   7295  C  CE3 . TRP C  1 308 ? 2.251   167.574 118.083 1.00 43.24  ? 308  TRP C CE3 1 
ATOM   7296  C  CZ2 . TRP C  1 308 ? 2.432   164.869 117.228 1.00 41.99  ? 308  TRP C CZ2 1 
ATOM   7297  C  CZ3 . TRP C  1 308 ? 3.217   167.159 117.170 1.00 40.54  ? 308  TRP C CZ3 1 
ATOM   7298  C  CH2 . TRP C  1 308 ? 3.294   165.814 116.749 1.00 38.75  ? 308  TRP C CH2 1 
ATOM   7299  N  N   . ARG C  1 309 ? -1.294  168.154 117.182 1.00 49.52  ? 309  ARG C N   1 
ATOM   7300  C  CA  . ARG C  1 309 ? -0.973  168.533 115.814 1.00 51.75  ? 309  ARG C CA  1 
ATOM   7301  C  C   . ARG C  1 309 ? -1.775  169.742 115.367 1.00 57.40  ? 309  ARG C C   1 
ATOM   7302  O  O   . ARG C  1 309 ? -1.318  170.487 114.496 1.00 61.03  ? 309  ARG C O   1 
ATOM   7303  C  CB  . ARG C  1 309 ? -1.236  167.374 114.862 1.00 42.29  ? 309  ARG C CB  1 
ATOM   7304  C  CG  . ARG C  1 309 ? -0.484  166.112 115.173 1.00 41.46  ? 309  ARG C CG  1 
ATOM   7305  C  CD  . ARG C  1 309 ? -1.036  164.987 114.313 1.00 41.62  ? 309  ARG C CD  1 
ATOM   7306  N  NE  . ARG C  1 309 ? -0.101  163.898 114.295 1.00 52.38  ? 309  ARG C NE  1 
ATOM   7307  C  CZ  . ARG C  1 309 ? 0.452   163.378 113.212 1.00 51.64  ? 309  ARG C CZ  1 
ATOM   7308  N  NH1 . ARG C  1 309 ? 0.133   163.806 111.996 1.00 40.69  ? 309  ARG C NH1 1 
ATOM   7309  N  NH2 . ARG C  1 309 ? 1.304   162.381 113.368 1.00 53.21  ? 309  ARG C NH2 1 
ATOM   7310  N  N   . LYS C  1 310 ? -2.979  169.937 115.935 1.00 63.03  ? 310  LYS C N   1 
ATOM   7311  C  CA  . LYS C  1 310 ? -3.875  170.999 115.475 1.00 67.36  ? 310  LYS C CA  1 
ATOM   7312  C  C   . LYS C  1 310 ? -3.313  172.389 115.727 1.00 73.05  ? 310  LYS C C   1 
ATOM   7313  O  O   . LYS C  1 310 ? -3.677  173.329 115.016 1.00 75.47  ? 310  LYS C O   1 
ATOM   7314  C  CB  . LYS C  1 310 ? -5.260  170.872 116.116 1.00 70.23  ? 310  LYS C CB  1 
ATOM   7315  C  CG  . LYS C  1 310 ? -6.111  169.733 115.552 1.00 74.32  ? 310  LYS C CG  1 
ATOM   7316  C  CD  . LYS C  1 310 ? -7.611  170.010 115.711 1.00 78.59  ? 310  LYS C CD  1 
ATOM   7317  C  CE  . LYS C  1 310 ? -8.461  168.850 115.173 1.00 82.16  ? 310  LYS C CE  1 
ATOM   7318  N  NZ  . LYS C  1 310 ? -9.897  169.226 114.971 1.00 77.94  ? 310  LYS C NZ  1 
ATOM   7319  N  N   . HIS C  1 311 ? -2.430  172.556 116.701 1.00 77.26  ? 311  HIS C N   1 
ATOM   7320  C  CA  . HIS C  1 311 ? -1.801  173.852 116.928 1.00 89.36  ? 311  HIS C CA  1 
ATOM   7321  C  C   . HIS C  1 311 ? -0.285  173.706 116.785 1.00 91.91  ? 311  HIS C C   1 
ATOM   7322  O  O   . HIS C  1 311 ? 0.467   173.736 117.769 1.00 95.14  ? 311  HIS C O   1 
ATOM   7323  C  CB  . HIS C  1 311 ? -2.230  174.450 118.300 1.00 102.40 ? 311  HIS C CB  1 
ATOM   7324  C  CG  . HIS C  1 311 ? -2.468  173.434 119.379 1.00 110.45 ? 311  HIS C CG  1 
ATOM   7325  N  ND1 . HIS C  1 311 ? -1.452  172.902 120.147 1.00 110.42 ? 311  HIS C ND1 1 
ATOM   7326  C  CD2 . HIS C  1 311 ? -3.614  172.875 119.837 1.00 110.77 ? 311  HIS C CD2 1 
ATOM   7327  C  CE1 . HIS C  1 311 ? -1.961  172.054 121.024 1.00 107.06 ? 311  HIS C CE1 1 
ATOM   7328  N  NE2 . HIS C  1 311 ? -3.270  172.017 120.855 1.00 108.50 ? 311  HIS C NE2 1 
ATOM   7329  N  N   . LEU C  1 312 ? 0.156   173.555 115.534 1.00 86.25  ? 312  LEU C N   1 
ATOM   7330  C  CA  . LEU C  1 312 ? 1.555   173.653 115.136 1.00 74.23  ? 312  LEU C CA  1 
ATOM   7331  C  C   . LEU C  1 312 ? 1.710   174.808 114.154 1.00 73.06  ? 312  LEU C C   1 
ATOM   7332  O  O   . LEU C  1 312 ? 0.816   175.645 114.042 1.00 68.52  ? 312  LEU C O   1 
ATOM   7333  C  CB  . LEU C  1 312 ? 2.038   172.344 114.496 1.00 60.75  ? 312  LEU C CB  1 
ATOM   7334  C  CG  . LEU C  1 312 ? 2.354   171.145 115.379 1.00 61.80  ? 312  LEU C CG  1 
ATOM   7335  C  CD1 . LEU C  1 312 ? 2.574   169.933 114.514 1.00 57.53  ? 312  LEU C CD1 1 
ATOM   7336  C  CD2 . LEU C  1 312 ? 3.590   171.420 116.209 1.00 61.28  ? 312  LEU C CD2 1 
ATOM   7337  N  N   . LYS C  1 313 ? 2.825   174.832 113.419 1.00 84.78  ? 313  LYS C N   1 
ATOM   7338  C  CA  . LYS C  1 313 ? 3.059   175.783 112.331 1.00 83.19  ? 313  LYS C CA  1 
ATOM   7339  C  C   . LYS C  1 313 ? 2.956   177.193 112.854 1.00 82.90  ? 313  LYS C C   1 
ATOM   7340  O  O   . LYS C  1 313 ? 3.227   177.429 114.026 1.00 81.97  ? 313  LYS C O   1 
ATOM   7341  C  CB  . LYS C  1 313 ? 2.074   175.566 111.179 1.00 88.25  ? 313  LYS C CB  1 
ATOM   7342  C  CG  . LYS C  1 313 ? 2.737   175.178 109.867 1.00 91.45  ? 313  LYS C CG  1 
ATOM   7343  C  CD  . LYS C  1 313 ? 3.050   176.404 109.015 1.00 91.54  ? 313  LYS C CD  1 
ATOM   7344  C  CE  . LYS C  1 313 ? 1.775   177.074 108.524 1.00 89.39  ? 313  LYS C CE  1 
ATOM   7345  N  NZ  . LYS C  1 313 ? 2.032   177.961 107.350 1.00 90.84  ? 313  LYS C NZ  1 
ATOM   7346  N  N   . GLU D  1 4   ? -40.890 90.410  52.554  1.00 96.21  ? 4    GLU D N   1 
ATOM   7347  C  CA  . GLU D  1 4   ? -39.846 91.427  52.659  1.00 100.02 ? 4    GLU D CA  1 
ATOM   7348  C  C   . GLU D  1 4   ? -38.584 90.873  53.337  1.00 100.53 ? 4    GLU D C   1 
ATOM   7349  O  O   . GLU D  1 4   ? -38.646 90.354  54.461  1.00 108.78 ? 4    GLU D O   1 
ATOM   7350  C  CB  . GLU D  1 4   ? -40.377 92.652  53.421  1.00 95.31  ? 4    GLU D CB  1 
ATOM   7351  C  CG  . GLU D  1 4   ? -39.332 93.425  54.238  1.00 92.37  ? 4    GLU D CG  1 
ATOM   7352  C  CD  . GLU D  1 4   ? -38.773 94.646  53.522  1.00 88.36  ? 4    GLU D CD  1 
ATOM   7353  O  OE1 . GLU D  1 4   ? -37.811 94.495  52.733  1.00 80.95  ? 4    GLU D OE1 1 
ATOM   7354  O  OE2 . GLU D  1 4   ? -39.298 95.760  53.759  1.00 88.10  ? 4    GLU D OE2 1 
ATOM   7355  N  N   . ASN D  1 5   ? -37.443 90.964  52.654  1.00 80.41  ? 5    ASN D N   1 
ATOM   7356  C  CA  A ASN D  1 5   ? -36.155 90.540  53.201  0.49 70.08  ? 5    ASN D CA  1 
ATOM   7357  C  CA  B ASN D  1 5   ? -36.166 90.557  53.236  0.51 70.11  ? 5    ASN D CA  1 
ATOM   7358  C  C   . ASN D  1 5   ? -35.150 91.676  53.054  1.00 60.49  ? 5    ASN D C   1 
ATOM   7359  O  O   . ASN D  1 5   ? -34.595 91.865  51.957  1.00 51.07  ? 5    ASN D O   1 
ATOM   7360  C  CB  A ASN D  1 5   ? -35.662 89.281  52.495  0.49 67.96  ? 5    ASN D CB  1 
ATOM   7361  C  CB  B ASN D  1 5   ? -35.655 89.246  52.660  0.51 68.11  ? 5    ASN D CB  1 
ATOM   7362  C  CG  A ASN D  1 5   ? -36.015 89.264  51.014  0.49 66.53  ? 5    ASN D CG  1 
ATOM   7363  C  CG  B ASN D  1 5   ? -35.246 88.270  53.748  0.51 62.24  ? 5    ASN D CG  1 
ATOM   7364  O  OD1 A ASN D  1 5   ? -36.923 89.974  50.568  0.49 59.23  ? 5    ASN D OD1 1 
ATOM   7365  O  OD1 B ASN D  1 5   ? -35.768 88.311  54.867  0.51 47.51  ? 5    ASN D OD1 1 
ATOM   7366  N  ND2 A ASN D  1 5   ? -35.307 88.439  50.246  0.49 65.72  ? 5    ASN D ND2 1 
ATOM   7367  N  ND2 B ASN D  1 5   ? -34.307 87.394  53.431  0.51 65.22  ? 5    ASN D ND2 1 
ATOM   7368  N  N   . PRO D  1 6   ? -34.888 92.438  54.106  1.00 51.70  ? 6    PRO D N   1 
ATOM   7369  C  CA  . PRO D  1 6   ? -33.977 93.583  54.004  1.00 54.33  ? 6    PRO D CA  1 
ATOM   7370  C  C   . PRO D  1 6   ? -32.510 93.167  53.994  1.00 47.39  ? 6    PRO D C   1 
ATOM   7371  O  O   . PRO D  1 6   ? -32.144 92.026  54.276  1.00 52.03  ? 6    PRO D O   1 
ATOM   7372  C  CB  . PRO D  1 6   ? -34.316 94.404  55.254  1.00 56.10  ? 6    PRO D CB  1 
ATOM   7373  C  CG  . PRO D  1 6   ? -34.793 93.384  56.238  1.00 58.48  ? 6    PRO D CG  1 
ATOM   7374  C  CD  . PRO D  1 6   ? -35.532 92.349  55.429  1.00 53.63  ? 6    PRO D CD  1 
ATOM   7375  N  N   . ILE D  1 7   ? -31.666 94.141  53.670  1.00 40.61  ? 7    ILE D N   1 
ATOM   7376  C  CA  . ILE D  1 7   ? -30.217 93.980  53.638  1.00 44.20  ? 7    ILE D CA  1 
ATOM   7377  C  C   . ILE D  1 7   ? -29.638 94.550  54.922  1.00 41.46  ? 7    ILE D C   1 
ATOM   7378  O  O   . ILE D  1 7   ? -30.101 95.592  55.409  1.00 45.80  ? 7    ILE D O   1 
ATOM   7379  C  CB  . ILE D  1 7   ? -29.646 94.697  52.399  1.00 46.68  ? 7    ILE D CB  1 
ATOM   7380  C  CG1 . ILE D  1 7   ? -30.166 94.009  51.131  1.00 53.85  ? 7    ILE D CG1 1 
ATOM   7381  C  CG2 . ILE D  1 7   ? -28.125 94.772  52.433  1.00 41.56  ? 7    ILE D CG2 1 
ATOM   7382  C  CD1 . ILE D  1 7   ? -29.989 92.499  51.147  1.00 52.55  ? 7    ILE D CD1 1 
ATOM   7383  N  N   . ILE D  1 8   ? -28.613 93.892  55.461  1.00 37.47  ? 8    ILE D N   1 
ATOM   7384  C  CA  . ILE D  1 8   ? -27.975 94.330  56.697  1.00 50.70  ? 8    ILE D CA  1 
ATOM   7385  C  C   . ILE D  1 8   ? -26.525 94.683  56.403  1.00 46.66  ? 8    ILE D C   1 
ATOM   7386  O  O   . ILE D  1 8   ? -25.737 93.826  55.984  1.00 43.51  ? 8    ILE D O   1 
ATOM   7387  C  CB  . ILE D  1 8   ? -28.050 93.274  57.809  1.00 48.48  ? 8    ILE D CB  1 
ATOM   7388  C  CG1 . ILE D  1 8   ? -29.493 92.907  58.117  1.00 45.01  ? 8    ILE D CG1 1 
ATOM   7389  C  CG2 . ILE D  1 8   ? -27.393 93.801  59.083  1.00 37.63  ? 8    ILE D CG2 1 
ATOM   7390  C  CD1 . ILE D  1 8   ? -29.599 91.941  59.280  1.00 41.36  ? 8    ILE D CD1 1 
ATOM   7391  N  N   . ALA D  1 9   ? -26.174 95.937  56.641  1.00 46.63  ? 9    ALA D N   1 
ATOM   7392  C  CA  . ALA D  1 9   ? -24.786 96.359  56.647  1.00 47.49  ? 9    ALA D CA  1 
ATOM   7393  C  C   . ALA D  1 9   ? -24.275 96.278  58.078  1.00 42.31  ? 9    ALA D C   1 
ATOM   7394  O  O   . ALA D  1 9   ? -24.892 96.829  58.993  1.00 46.83  ? 9    ALA D O   1 
ATOM   7395  C  CB  . ALA D  1 9   ? -24.654 97.782  56.101  1.00 44.33  ? 9    ALA D CB  1 
ATOM   7396  N  N   . ILE D  1 10  ? -23.171 95.578  58.281  1.00 42.55  ? 10   ILE D N   1 
ATOM   7397  C  CA  . ILE D  1 10  ? -22.594 95.443  59.613  1.00 41.50  ? 10   ILE D CA  1 
ATOM   7398  C  C   . ILE D  1 10  ? -21.260 96.169  59.622  1.00 44.31  ? 10   ILE D C   1 
ATOM   7399  O  O   . ILE D  1 10  ? -20.269 95.677  59.074  1.00 42.41  ? 10   ILE D O   1 
ATOM   7400  C  CB  . ILE D  1 10  ? -22.413 93.980  60.026  1.00 49.24  ? 10   ILE D CB  1 
ATOM   7401  C  CG1 . ILE D  1 10  ? -23.752 93.230  59.955  1.00 48.99  ? 10   ILE D CG1 1 
ATOM   7402  C  CG2 . ILE D  1 10  ? -21.789 93.914  61.430  1.00 47.25  ? 10   ILE D CG2 1 
ATOM   7403  C  CD1 . ILE D  1 10  ? -23.665 91.764  60.340  1.00 39.03  ? 10   ILE D CD1 1 
ATOM   7404  N  N   . ASN D  1 11  ? -21.226 97.329  60.258  1.00 43.21  ? 11   ASN D N   1 
ATOM   7405  C  CA  . ASN D  1 11  ? -19.976 98.041  60.474  1.00 40.83  ? 11   ASN D CA  1 
ATOM   7406  C  C   . ASN D  1 11  ? -19.244 97.342  61.614  1.00 43.05  ? 11   ASN D C   1 
ATOM   7407  O  O   . ASN D  1 11  ? -19.743 97.297  62.744  1.00 38.36  ? 11   ASN D O   1 
ATOM   7408  C  CB  . ASN D  1 11  ? -20.248 99.504  60.810  1.00 44.65  ? 11   ASN D CB  1 
ATOM   7409  C  CG  . ASN D  1 11  ? -18.994 100.346 60.804  1.00 61.48  ? 11   ASN D CG  1 
ATOM   7410  O  OD1 . ASN D  1 11  ? -18.172 100.265 61.720  1.00 60.44  ? 11   ASN D OD1 1 
ATOM   7411  N  ND2 . ASN D  1 11  ? -18.839 101.161 59.772  1.00 70.41  ? 11   ASN D ND2 1 
ATOM   7412  N  N   . MET D  1 12  ? -18.092 96.751  61.309  1.00 39.25  ? 12   MET D N   1 
ATOM   7413  C  CA  . MET D  1 12  ? -17.304 95.990  62.274  1.00 46.24  ? 12   MET D CA  1 
ATOM   7414  C  C   . MET D  1 12  ? -16.074 96.797  62.664  1.00 49.86  ? 12   MET D C   1 
ATOM   7415  O  O   . MET D  1 12  ? -15.297 97.216  61.800  1.00 48.83  ? 12   MET D O   1 
ATOM   7416  C  CB  . MET D  1 12  ? -16.886 94.642  61.697  1.00 47.80  ? 12   MET D CB  1 
ATOM   7417  C  CG  . MET D  1 12  ? -18.047 93.809  61.236  1.00 45.70  ? 12   MET D CG  1 
ATOM   7418  S  SD  . MET D  1 12  ? -17.394 92.455  60.282  1.00 51.46  ? 12   MET D SD  1 
ATOM   7419  C  CE  . MET D  1 12  ? -18.873 91.477  59.995  1.00 53.97  ? 12   MET D CE  1 
ATOM   7420  N  N   . ALA D  1 13  ? -15.900 97.028  63.959  1.00 42.68  ? 13   ALA D N   1 
ATOM   7421  C  CA  . ALA D  1 13  ? -14.727 97.744  64.413  1.00 38.89  ? 13   ALA D CA  1 
ATOM   7422  C  C   . ALA D  1 13  ? -14.244 97.133  65.714  1.00 44.28  ? 13   ALA D C   1 
ATOM   7423  O  O   . ALA D  1 13  ? -14.988 96.451  66.422  1.00 47.20  ? 13   ALA D O   1 
ATOM   7424  C  CB  . ALA D  1 13  ? -15.015 99.241  64.594  1.00 43.52  ? 13   ALA D CB  1 
ATOM   7425  N  N   . LYS D  1 14  ? -12.979 97.392  66.021  1.00 44.40  ? 14   LYS D N   1 
ATOM   7426  C  CA  . LYS D  1 14  ? -12.406 97.038  67.305  1.00 47.14  ? 14   LYS D CA  1 
ATOM   7427  C  C   . LYS D  1 14  ? -11.920 98.325  67.950  1.00 46.50  ? 14   LYS D C   1 
ATOM   7428  O  O   . LYS D  1 14  ? -11.090 99.038  67.378  1.00 47.97  ? 14   LYS D O   1 
ATOM   7429  C  CB  . LYS D  1 14  ? -11.293 95.998  67.124  1.00 50.41  ? 14   LYS D CB  1 
ATOM   7430  C  CG  . LYS D  1 14  ? -11.838 94.662  66.595  1.00 45.27  ? 14   LYS D CG  1 
ATOM   7431  C  CD  . LYS D  1 14  ? -10.766 93.599  66.443  1.00 63.07  ? 14   LYS D CD  1 
ATOM   7432  C  CE  . LYS D  1 14  ? -11.346 92.226  66.050  1.00 68.40  ? 14   LYS D CE  1 
ATOM   7433  N  NZ  . LYS D  1 14  ? -12.283 91.663  67.084  1.00 71.77  ? 14   LYS D NZ  1 
ATOM   7434  N  N   . ILE D  1 15  ? -12.444 98.621  69.136  1.00 47.44  ? 15   ILE D N   1 
ATOM   7435  C  CA  . ILE D  1 15  ? -12.223 99.899  69.789  1.00 44.21  ? 15   ILE D CA  1 
ATOM   7436  C  C   . ILE D  1 15  ? -11.549 99.658  71.131  1.00 45.19  ? 15   ILE D C   1 
ATOM   7437  O  O   . ILE D  1 15  ? -11.570 98.551  71.677  1.00 43.95  ? 15   ILE D O   1 
ATOM   7438  C  CB  . ILE D  1 15  ? -13.526 100.695 69.974  1.00 46.62  ? 15   ILE D CB  1 
ATOM   7439  C  CG1 . ILE D  1 15  ? -14.442 99.984  70.965  1.00 45.54  ? 15   ILE D CG1 1 
ATOM   7440  C  CG2 . ILE D  1 15  ? -14.228 100.933 68.606  1.00 38.09  ? 15   ILE D CG2 1 
ATOM   7441  C  CD1 . ILE D  1 15  ? -15.742 100.719 71.219  1.00 42.02  ? 15   ILE D CD1 1 
ATOM   7442  N  N   . ALA D  1 16  ? -10.914 100.712 71.641  1.00 44.28  ? 16   ALA D N   1 
ATOM   7443  C  CA  . ALA D  1 16  ? -10.209 100.628 72.913  1.00 45.57  ? 16   ALA D CA  1 
ATOM   7444  C  C   . ALA D  1 16  ? -11.183 100.423 74.066  1.00 46.00  ? 16   ALA D C   1 
ATOM   7445  O  O   . ALA D  1 16  ? -12.227 101.073 74.141  1.00 42.85  ? 16   ALA D O   1 
ATOM   7446  C  CB  . ALA D  1 16  ? -9.374  101.886 73.140  1.00 40.47  ? 16   ALA D CB  1 
ATOM   7447  N  N   . ASN D  1 17  ? -10.836 99.511  74.971  1.00 45.88  ? 17   ASN D N   1 
ATOM   7448  C  CA  . ASN D  1 17  ? -11.688 99.211  76.116  1.00 45.94  ? 17   ASN D CA  1 
ATOM   7449  C  C   . ASN D  1 17  ? -11.215 100.065 77.277  1.00 52.64  ? 17   ASN D C   1 
ATOM   7450  O  O   . ASN D  1 17  ? -10.411 99.643  78.111  1.00 55.01  ? 17   ASN D O   1 
ATOM   7451  C  CB  . ASN D  1 17  ? -11.659 97.727  76.447  1.00 50.38  ? 17   ASN D CB  1 
ATOM   7452  C  CG  . ASN D  1 17  ? -12.618 97.355  77.571  1.00 53.46  ? 17   ASN D CG  1 
ATOM   7453  O  OD1 . ASN D  1 17  ? -13.311 98.210  78.127  1.00 51.14  ? 17   ASN D OD1 1 
ATOM   7454  N  ND2 . ASN D  1 17  ? -12.692 96.065  77.880  1.00 55.53  ? 17   ASN D ND2 1 
ATOM   7455  N  N   . LYS D  1 18  ? -11.723 101.288 77.317  1.00 49.47  ? 18   LYS D N   1 
ATOM   7456  C  CA  . LYS D  1 18  ? -11.386 102.239 78.360  1.00 56.94  ? 18   LYS D CA  1 
ATOM   7457  C  C   . LYS D  1 18  ? -12.540 103.217 78.489  1.00 58.22  ? 18   LYS D C   1 
ATOM   7458  O  O   . LYS D  1 18  ? -13.339 103.364 77.556  1.00 53.76  ? 18   LYS D O   1 
ATOM   7459  C  CB  . LYS D  1 18  ? -10.059 102.950 78.051  1.00 65.64  ? 18   LYS D CB  1 
ATOM   7460  C  CG  . LYS D  1 18  ? -10.013 103.740 76.751  1.00 69.60  ? 18   LYS D CG  1 
ATOM   7461  C  CD  . LYS D  1 18  ? -8.598  104.270 76.527  1.00 71.53  ? 18   LYS D CD  1 
ATOM   7462  C  CE  . LYS D  1 18  ? -8.232  105.301 77.587  1.00 77.55  ? 18   LYS D CE  1 
ATOM   7463  N  NZ  . LYS D  1 18  ? -6.901  105.932 77.363  1.00 81.16  ? 18   LYS D NZ  1 
ATOM   7464  N  N   . PRO D  1 19  ? -12.676 103.875 79.646  1.00 66.08  ? 19   PRO D N   1 
ATOM   7465  C  CA  . PRO D  1 19  ? -13.843 104.748 79.879  1.00 69.16  ? 19   PRO D CA  1 
ATOM   7466  C  C   . PRO D  1 19  ? -14.074 105.822 78.828  1.00 69.37  ? 19   PRO D C   1 
ATOM   7467  O  O   . PRO D  1 19  ? -15.233 106.141 78.538  1.00 68.89  ? 19   PRO D O   1 
ATOM   7468  C  CB  . PRO D  1 19  ? -13.530 105.363 81.246  1.00 64.91  ? 19   PRO D CB  1 
ATOM   7469  C  CG  . PRO D  1 19  ? -12.719 104.322 81.928  1.00 64.50  ? 19   PRO D CG  1 
ATOM   7470  C  CD  . PRO D  1 19  ? -11.869 103.696 80.865  1.00 64.23  ? 19   PRO D CD  1 
ATOM   7471  N  N   . ASP D  1 20  ? -13.009 106.399 78.262  1.00 67.23  ? 20   ASP D N   1 
ATOM   7472  C  CA  . ASP D  1 20  ? -13.178 107.447 77.259  1.00 72.16  ? 20   ASP D CA  1 
ATOM   7473  C  C   . ASP D  1 20  ? -13.989 106.953 76.066  1.00 71.37  ? 20   ASP D C   1 
ATOM   7474  O  O   . ASP D  1 20  ? -14.779 107.713 75.488  1.00 63.13  ? 20   ASP D O   1 
ATOM   7475  C  CB  . ASP D  1 20  ? -11.810 107.962 76.811  1.00 83.79  ? 20   ASP D CB  1 
ATOM   7476  C  CG  . ASP D  1 20  ? -10.993 108.515 77.966  1.00 100.78 ? 20   ASP D CG  1 
ATOM   7477  O  OD1 . ASP D  1 20  ? -11.299 109.634 78.439  1.00 100.37 ? 20   ASP D OD1 1 
ATOM   7478  O  OD2 . ASP D  1 20  ? -10.062 107.814 78.422  1.00 108.53 ? 20   ASP D OD2 1 
ATOM   7479  N  N   . SER D  1 21  ? -13.815 105.677 75.692  1.00 65.33  ? 21   SER D N   1 
ATOM   7480  C  CA  . SER D  1 21  ? -14.521 105.116 74.539  1.00 60.24  ? 21   SER D CA  1 
ATOM   7481  C  C   . SER D  1 21  ? -16.024 104.979 74.789  1.00 66.62  ? 21   SER D C   1 
ATOM   7482  O  O   . SER D  1 21  ? -16.829 105.238 73.886  1.00 68.54  ? 21   SER D O   1 
ATOM   7483  C  CB  . SER D  1 21  ? -13.917 103.764 74.165  1.00 55.74  ? 21   SER D CB  1 
ATOM   7484  O  OG  . SER D  1 21  ? -12.556 103.905 73.792  1.00 56.38  ? 21   SER D OG  1 
ATOM   7485  N  N   . TYR D  1 22  ? -16.427 104.550 75.993  1.00 72.42  ? 22   TYR D N   1 
ATOM   7486  C  CA  . TYR D  1 22  ? -17.855 104.483 76.310  1.00 74.19  ? 22   TYR D CA  1 
ATOM   7487  C  C   . TYR D  1 22  ? -18.498 105.863 76.285  1.00 74.15  ? 22   TYR D C   1 
ATOM   7488  O  O   . TYR D  1 22  ? -19.675 105.994 75.932  1.00 70.78  ? 22   TYR D O   1 
ATOM   7489  C  CB  . TYR D  1 22  ? -18.086 103.824 77.677  1.00 75.62  ? 22   TYR D CB  1 
ATOM   7490  C  CG  . TYR D  1 22  ? -17.634 102.381 77.764  1.00 75.89  ? 22   TYR D CG  1 
ATOM   7491  C  CD1 . TYR D  1 22  ? -16.315 102.069 78.089  1.00 76.87  ? 22   TYR D CD1 1 
ATOM   7492  C  CD2 . TYR D  1 22  ? -18.521 101.331 77.517  1.00 71.85  ? 22   TYR D CD2 1 
ATOM   7493  C  CE1 . TYR D  1 22  ? -15.884 100.754 78.167  1.00 77.10  ? 22   TYR D CE1 1 
ATOM   7494  C  CE2 . TYR D  1 22  ? -18.101 100.008 77.595  1.00 73.24  ? 22   TYR D CE2 1 
ATOM   7495  C  CZ  . TYR D  1 22  ? -16.774 99.726  77.922  1.00 75.95  ? 22   TYR D CZ  1 
ATOM   7496  O  OH  . TYR D  1 22  ? -16.323 98.422  78.011  1.00 78.07  ? 22   TYR D OH  1 
ATOM   7497  N  N   . GLU D  1 23  ? -17.746 106.896 76.675  1.00 77.90  ? 23   GLU D N   1 
ATOM   7498  C  CA  . GLU D  1 23  ? -18.269 108.256 76.652  1.00 87.51  ? 23   GLU D CA  1 
ATOM   7499  C  C   . GLU D  1 23  ? -18.600 108.690 75.229  1.00 82.85  ? 23   GLU D C   1 
ATOM   7500  O  O   . GLU D  1 23  ? -19.708 109.171 74.956  1.00 78.99  ? 23   GLU D O   1 
ATOM   7501  C  CB  . GLU D  1 23  ? -17.261 109.216 77.292  1.00 95.61  ? 23   GLU D CB  1 
ATOM   7502  C  CG  . GLU D  1 23  ? -17.857 110.164 78.331  1.00 106.29 ? 23   GLU D CG  1 
ATOM   7503  C  CD  . GLU D  1 23  ? -17.610 111.632 78.003  1.00 117.80 ? 23   GLU D CD  1 
ATOM   7504  O  OE1 . GLU D  1 23  ? -18.439 112.234 77.280  1.00 121.99 ? 23   GLU D OE1 1 
ATOM   7505  O  OE2 . GLU D  1 23  ? -16.584 112.180 78.463  1.00 121.06 ? 23   GLU D OE2 1 
ATOM   7506  N  N   . THR D  1 24  ? -17.649 108.526 74.302  1.00 76.85  ? 24   THR D N   1 
ATOM   7507  C  CA  . THR D  1 24  ? -17.883 108.953 72.925  1.00 76.46  ? 24   THR D CA  1 
ATOM   7508  C  C   . THR D  1 24  ? -18.919 108.099 72.206  1.00 77.91  ? 24   THR D C   1 
ATOM   7509  O  O   . THR D  1 24  ? -19.549 108.592 71.264  1.00 83.57  ? 24   THR D O   1 
ATOM   7510  C  CB  . THR D  1 24  ? -16.582 108.941 72.126  1.00 74.86  ? 24   THR D CB  1 
ATOM   7511  O  OG1 . THR D  1 24  ? -16.314 107.604 71.697  1.00 85.20  ? 24   THR D OG1 1 
ATOM   7512  C  CG2 . THR D  1 24  ? -15.422 109.432 72.976  1.00 67.63  ? 24   THR D CG2 1 
ATOM   7513  N  N   . MET D  1 25  ? -19.116 106.841 72.617  1.00 79.20  ? 25   MET D N   1 
ATOM   7514  C  CA  . MET D  1 25  ? -20.167 106.028 72.007  1.00 76.11  ? 25   MET D CA  1 
ATOM   7515  C  C   . MET D  1 25  ? -21.539 106.579 72.350  1.00 82.40  ? 25   MET D C   1 
ATOM   7516  O  O   . MET D  1 25  ? -22.482 106.450 71.560  1.00 83.54  ? 25   MET D O   1 
ATOM   7517  C  CB  . MET D  1 25  ? -20.054 104.580 72.480  1.00 72.17  ? 25   MET D CB  1 
ATOM   7518  C  CG  . MET D  1 25  ? -19.112 103.725 71.653  1.00 76.22  ? 25   MET D CG  1 
ATOM   7519  S  SD  . MET D  1 25  ? -19.257 101.968 72.032  1.00 83.84  ? 25   MET D SD  1 
ATOM   7520  C  CE  . MET D  1 25  ? -18.897 101.938 73.791  1.00 77.07  ? 25   MET D CE  1 
ATOM   7521  N  N   . MET D  1 26  ? -21.660 107.171 73.536  1.00 87.21  ? 26   MET D N   1 
ATOM   7522  C  CA  . MET D  1 26  ? -22.876 107.816 73.992  1.00 92.65  ? 26   MET D CA  1 
ATOM   7523  C  C   . MET D  1 26  ? -22.976 109.258 73.516  1.00 86.12  ? 26   MET D C   1 
ATOM   7524  O  O   . MET D  1 26  ? -24.082 109.803 73.458  1.00 85.22  ? 26   MET D O   1 
ATOM   7525  C  CB  . MET D  1 26  ? -22.904 107.773 75.524  1.00 102.05 ? 26   MET D CB  1 
ATOM   7526  C  CG  . MET D  1 26  ? -23.114 106.380 76.069  1.00 113.28 ? 26   MET D CG  1 
ATOM   7527  S  SD  . MET D  1 26  ? -23.584 106.455 77.794  1.00 122.44 ? 26   MET D SD  1 
ATOM   7528  C  CE  . MET D  1 26  ? -21.953 106.698 78.503  1.00 123.64 ? 26   MET D CE  1 
ATOM   7529  N  N   . LYS D  1 27  ? -21.853 109.873 73.157  1.00 80.84  ? 27   LYS D N   1 
ATOM   7530  C  CA  . LYS D  1 27  ? -21.813 111.257 72.719  1.00 82.19  ? 27   LYS D CA  1 
ATOM   7531  C  C   . LYS D  1 27  ? -21.921 111.401 71.205  1.00 79.68  ? 27   LYS D C   1 
ATOM   7532  O  O   . LYS D  1 27  ? -22.610 112.307 70.718  1.00 87.40  ? 27   LYS D O   1 
ATOM   7533  C  CB  . LYS D  1 27  ? -20.507 111.906 73.219  1.00 96.98  ? 27   LYS D CB  1 
ATOM   7534  C  CG  . LYS D  1 27  ? -20.262 113.326 72.716  1.00 107.11 ? 27   LYS D CG  1 
ATOM   7535  C  CD  . LYS D  1 27  ? -19.054 113.963 73.404  1.00 112.82 ? 27   LYS D CD  1 
ATOM   7536  C  CE  . LYS D  1 27  ? -18.597 115.230 72.671  1.00 112.78 ? 27   LYS D CE  1 
ATOM   7537  N  NZ  . LYS D  1 27  ? -17.852 115.002 71.397  1.00 107.69 ? 27   LYS D NZ  1 
ATOM   7538  N  N   . VAL D  1 28  ? -21.257 110.531 70.446  1.00 77.07  ? 28   VAL D N   1 
ATOM   7539  C  CA  . VAL D  1 28  ? -21.229 110.637 68.987  1.00 75.00  ? 28   VAL D CA  1 
ATOM   7540  C  C   . VAL D  1 28  ? -22.156 109.605 68.352  1.00 76.47  ? 28   VAL D C   1 
ATOM   7541  O  O   . VAL D  1 28  ? -22.777 109.869 67.318  1.00 81.31  ? 28   VAL D O   1 
ATOM   7542  C  CB  . VAL D  1 28  ? -19.782 110.491 68.465  1.00 75.35  ? 28   VAL D CB  1 
ATOM   7543  C  CG1 . VAL D  1 28  ? -19.742 110.547 66.957  1.00 78.99  ? 28   VAL D CG1 1 
ATOM   7544  C  CG2 . VAL D  1 28  ? -18.912 111.591 69.065  1.00 69.99  ? 28   VAL D CG2 1 
ATOM   7545  N  N   . GLY D  1 29  ? -22.257 108.430 68.973  1.00 76.02  ? 29   GLY D N   1 
ATOM   7546  C  CA  . GLY D  1 29  ? -23.075 107.338 68.486  1.00 73.87  ? 29   GLY D CA  1 
ATOM   7547  C  C   . GLY D  1 29  ? -24.490 107.703 68.074  1.00 79.23  ? 29   GLY D C   1 
ATOM   7548  O  O   . GLY D  1 29  ? -24.931 107.384 66.963  1.00 79.52  ? 29   GLY D O   1 
ATOM   7549  N  N   . PRO D  1 30  ? -25.254 108.332 68.982  1.00 78.22  ? 30   PRO D N   1 
ATOM   7550  C  CA  . PRO D  1 30  ? -26.610 108.768 68.602  1.00 74.52  ? 30   PRO D CA  1 
ATOM   7551  C  C   . PRO D  1 30  ? -26.624 109.676 67.386  1.00 76.01  ? 30   PRO D C   1 
ATOM   7552  O  O   . PRO D  1 30  ? -27.513 109.557 66.534  1.00 77.28  ? 30   PRO D O   1 
ATOM   7553  C  CB  . PRO D  1 30  ? -27.105 109.507 69.854  1.00 69.75  ? 30   PRO D CB  1 
ATOM   7554  C  CG  . PRO D  1 30  ? -26.313 108.952 70.962  1.00 72.08  ? 30   PRO D CG  1 
ATOM   7555  C  CD  . PRO D  1 30  ? -24.963 108.621 70.399  1.00 74.49  ? 30   PRO D CD  1 
ATOM   7556  N  N   . LYS D  1 31  ? -25.627 110.557 67.267  1.00 68.28  ? 31   LYS D N   1 
ATOM   7557  C  CA  . LYS D  1 31  ? -25.597 111.521 66.176  1.00 62.90  ? 31   LYS D CA  1 
ATOM   7558  C  C   . LYS D  1 31  ? -25.439 110.817 64.832  1.00 65.35  ? 31   LYS D C   1 
ATOM   7559  O  O   . LYS D  1 31  ? -25.995 111.272 63.826  1.00 61.07  ? 31   LYS D O   1 
ATOM   7560  C  CB  . LYS D  1 31  ? -24.456 112.507 66.410  1.00 60.52  ? 31   LYS D CB  1 
ATOM   7561  C  CG  . LYS D  1 31  ? -24.560 113.241 67.737  1.00 63.71  ? 31   LYS D CG  1 
ATOM   7562  C  CD  . LYS D  1 31  ? -23.517 114.343 67.875  1.00 67.28  ? 31   LYS D CD  1 
ATOM   7563  C  CE  . LYS D  1 31  ? -23.904 115.361 68.938  1.00 66.86  ? 31   LYS D CE  1 
ATOM   7564  N  NZ  . LYS D  1 31  ? -25.304 115.834 68.807  1.00 77.50  ? 31   LYS D NZ  1 
ATOM   7565  N  N   . VAL D  1 32  ? -24.691 109.710 64.795  1.00 61.12  ? 32   VAL D N   1 
ATOM   7566  C  CA  . VAL D  1 32  ? -24.529 108.919 63.577  1.00 59.48  ? 32   VAL D CA  1 
ATOM   7567  C  C   . VAL D  1 32  ? -25.879 108.313 63.173  1.00 60.37  ? 32   VAL D C   1 
ATOM   7568  O  O   . VAL D  1 32  ? -26.293 108.396 62.012  1.00 60.51  ? 32   VAL D O   1 
ATOM   7569  C  CB  . VAL D  1 32  ? -23.466 107.801 63.751  1.00 66.26  ? 32   VAL D CB  1 
ATOM   7570  C  CG1 . VAL D  1 32  ? -23.411 106.910 62.506  1.00 59.11  ? 32   VAL D CG1 1 
ATOM   7571  C  CG2 . VAL D  1 32  ? -22.088 108.396 64.070  1.00 70.47  ? 32   VAL D CG2 1 
HETATM 7572  N  N   . CSS D  1 33  ? -26.563 107.714 64.142  1.00 55.19  ? 33   CSS D N   1 
HETATM 7573  C  CA  . CSS D  1 33  ? -27.843 107.111 63.916  1.00 56.71  ? 33   CSS D CA  1 
HETATM 7574  C  CB  . CSS D  1 33  ? -28.311 106.469 65.180  1.00 66.34  ? 33   CSS D CB  1 
HETATM 7575  S  SG  . CSS D  1 33  ? -27.222 105.127 65.556  1.00 81.84  ? 33   CSS D SG  1 
HETATM 7576  S  SD  . CSS D  1 33  ? -26.970 104.037 63.871  0.50 84.73  ? 33   CSS D SD  1 
HETATM 7577  C  C   . CSS D  1 33  ? -28.849 108.116 63.419  1.00 61.46  ? 33   CSS D C   1 
HETATM 7578  O  O   . CSS D  1 33  ? -29.720 107.763 62.583  1.00 60.17  ? 33   CSS D O   1 
ATOM   7579  N  N   . ILE D  1 34  ? -28.752 109.365 63.874  1.00 51.08  ? 34   ILE D N   1 
ATOM   7580  C  CA  . ILE D  1 34  ? -29.688 110.415 63.454  1.00 51.13  ? 34   ILE D CA  1 
ATOM   7581  C  C   . ILE D  1 34  ? -29.467 110.780 61.992  1.00 56.02  ? 34   ILE D C   1 
ATOM   7582  O  O   . ILE D  1 34  ? -30.413 110.971 61.219  1.00 58.97  ? 34   ILE D O   1 
ATOM   7583  C  CB  . ILE D  1 34  ? -29.553 111.650 64.344  1.00 51.08  ? 34   ILE D CB  1 
ATOM   7584  C  CG1 . ILE D  1 34  ? -30.014 111.322 65.764  1.00 55.66  ? 34   ILE D CG1 1 
ATOM   7585  C  CG2 . ILE D  1 34  ? -30.352 112.822 63.765  1.00 51.20  ? 34   ILE D CG2 1 
ATOM   7586  C  CD1 . ILE D  1 34  ? -29.719 112.421 66.753  1.00 63.06  ? 34   ILE D CD1 1 
ATOM   7587  N  N   . THR D  1 35  ? -28.193 110.886 61.623  1.00 56.69  ? 35   THR D N   1 
ATOM   7588  C  CA  . THR D  1 35  ? -27.846 111.099 60.225  1.00 57.34  ? 35   THR D CA  1 
ATOM   7589  C  C   . THR D  1 35  ? -28.366 109.951 59.370  1.00 62.26  ? 35   THR D C   1 
ATOM   7590  O  O   . THR D  1 35  ? -28.978 110.168 58.317  1.00 65.13  ? 35   THR D O   1 
ATOM   7591  C  CB  . THR D  1 35  ? -26.328 111.231 60.101  1.00 59.82  ? 35   THR D CB  1 
ATOM   7592  O  OG1 . THR D  1 35  ? -25.875 112.316 60.917  1.00 63.74  ? 35   THR D OG1 1 
ATOM   7593  C  CG2 . THR D  1 35  ? -25.923 111.475 58.684  1.00 57.49  ? 35   THR D CG2 1 
ATOM   7594  N  N   . THR D  1 36  ? -28.158 108.713 59.840  1.00 57.16  ? 36   THR D N   1 
ATOM   7595  C  CA  . THR D  1 36  ? -28.597 107.528 59.106  1.00 58.28  ? 36   THR D CA  1 
ATOM   7596  C  C   . THR D  1 36  ? -30.113 107.519 58.912  1.00 66.43  ? 36   THR D C   1 
ATOM   7597  O  O   . THR D  1 36  ? -30.607 107.200 57.824  1.00 59.85  ? 36   THR D O   1 
ATOM   7598  C  CB  . THR D  1 36  ? -28.135 106.270 59.846  1.00 58.45  ? 36   THR D CB  1 
ATOM   7599  O  OG1 . THR D  1 36  ? -26.717 106.323 60.040  1.00 67.43  ? 36   THR D OG1 1 
ATOM   7600  C  CG2 . THR D  1 36  ? -28.424 105.070 59.041  1.00 62.98  ? 36   THR D CG2 1 
ATOM   7601  N  N   . ALA D  1 37  ? -30.869 107.892 59.949  1.00 51.47  ? 37   ALA D N   1 
ATOM   7602  C  CA  . ALA D  1 37  ? -32.324 107.846 59.903  1.00 54.16  ? 37   ALA D CA  1 
ATOM   7603  C  C   . ALA D  1 37  ? -32.928 108.957 59.067  1.00 53.26  ? 37   ALA D C   1 
ATOM   7604  O  O   . ALA D  1 37  ? -34.157 109.077 59.018  1.00 52.32  ? 37   ALA D O   1 
ATOM   7605  C  CB  . ALA D  1 37  ? -32.892 107.911 61.319  1.00 61.98  ? 37   ALA D CB  1 
ATOM   7606  N  N   . SER D  1 38  ? -32.109 109.777 58.414  1.00 53.52  ? 38   SER D N   1 
ATOM   7607  C  CA  . SER D  1 38  ? -32.664 110.714 57.450  1.00 54.98  ? 38   SER D CA  1 
ATOM   7608  C  C   . SER D  1 38  ? -33.102 110.032 56.162  1.00 55.45  ? 38   SER D C   1 
ATOM   7609  O  O   . SER D  1 38  ? -33.854 110.634 55.389  1.00 60.11  ? 38   SER D O   1 
ATOM   7610  C  CB  . SER D  1 38  ? -31.639 111.802 57.114  1.00 57.09  ? 38   SER D CB  1 
ATOM   7611  O  OG  . SER D  1 38  ? -30.499 111.254 56.460  1.00 57.15  ? 38   SER D OG  1 
ATOM   7612  N  N   . HIS D  1 39  ? -32.693 108.784 55.930  1.00 55.24  ? 39   HIS D N   1 
ATOM   7613  C  CA  . HIS D  1 39  ? -32.953 108.199 54.619  1.00 54.60  ? 39   HIS D CA  1 
ATOM   7614  C  C   . HIS D  1 39  ? -34.167 107.287 54.665  1.00 52.13  ? 39   HIS D C   1 
ATOM   7615  O  O   . HIS D  1 39  ? -34.257 106.432 55.553  1.00 53.93  ? 39   HIS D O   1 
ATOM   7616  C  CB  . HIS D  1 39  ? -31.733 107.421 54.131  1.00 58.87  ? 39   HIS D CB  1 
ATOM   7617  C  CG  . HIS D  1 39  ? -31.801 107.064 52.684  1.00 52.84  ? 39   HIS D CG  1 
ATOM   7618  N  ND1 . HIS D  1 39  ? -32.575 106.025 52.213  1.00 52.77  ? 39   HIS D ND1 1 
ATOM   7619  C  CD2 . HIS D  1 39  ? -31.255 107.653 51.594  1.00 53.21  ? 39   HIS D CD2 1 
ATOM   7620  C  CE1 . HIS D  1 39  ? -32.473 105.965 50.897  1.00 53.08  ? 39   HIS D CE1 1 
ATOM   7621  N  NE2 . HIS D  1 39  ? -31.683 106.945 50.496  1.00 53.65  ? 39   HIS D NE2 1 
ATOM   7622  N  N   . PRO D  1 40  ? -35.093 107.409 53.707  1.00 57.32  ? 40   PRO D N   1 
ATOM   7623  C  CA  . PRO D  1 40  ? -36.339 106.617 53.772  1.00 52.02  ? 40   PRO D CA  1 
ATOM   7624  C  C   . PRO D  1 40  ? -36.137 105.126 53.606  1.00 53.75  ? 40   PRO D C   1 
ATOM   7625  O  O   . PRO D  1 40  ? -37.052 104.359 53.925  1.00 51.74  ? 40   PRO D O   1 
ATOM   7626  C  CB  . PRO D  1 40  ? -37.180 107.187 52.620  1.00 55.40  ? 40   PRO D CB  1 
ATOM   7627  C  CG  . PRO D  1 40  ? -36.172 107.770 51.667  1.00 52.60  ? 40   PRO D CG  1 
ATOM   7628  C  CD  . PRO D  1 40  ? -35.056 108.303 52.533  1.00 53.92  ? 40   PRO D CD  1 
ATOM   7629  N  N   . GLY D  1 41  ? -34.990 104.687 53.103  1.00 52.18  ? 41   GLY D N   1 
ATOM   7630  C  CA  . GLY D  1 41  ? -34.714 103.272 53.057  1.00 55.45  ? 41   GLY D CA  1 
ATOM   7631  C  C   . GLY D  1 41  ? -34.175 102.685 54.344  1.00 51.85  ? 41   GLY D C   1 
ATOM   7632  O  O   . GLY D  1 41  ? -33.908 101.484 54.385  1.00 51.79  ? 41   GLY D O   1 
ATOM   7633  N  N   . PHE D  1 42  ? -33.999 103.501 55.389  1.00 51.71  ? 42   PHE D N   1 
ATOM   7634  C  CA  . PHE D  1 42  ? -33.410 103.048 56.648  1.00 51.47  ? 42   PHE D CA  1 
ATOM   7635  C  C   . PHE D  1 42  ? -34.475 102.379 57.511  1.00 51.12  ? 42   PHE D C   1 
ATOM   7636  O  O   . PHE D  1 42  ? -35.489 102.999 57.846  1.00 50.98  ? 42   PHE D O   1 
ATOM   7637  C  CB  . PHE D  1 42  ? -32.777 104.223 57.396  1.00 51.47  ? 42   PHE D CB  1 
ATOM   7638  C  CG  . PHE D  1 42  ? -32.231 103.856 58.756  1.00 61.91  ? 42   PHE D CG  1 
ATOM   7639  C  CD1 . PHE D  1 42  ? -31.111 103.042 58.873  1.00 51.28  ? 42   PHE D CD1 1 
ATOM   7640  C  CD2 . PHE D  1 42  ? -32.845 104.310 59.917  1.00 50.95  ? 42   PHE D CD2 1 
ATOM   7641  C  CE1 . PHE D  1 42  ? -30.608 102.705 60.117  1.00 51.06  ? 42   PHE D CE1 1 
ATOM   7642  C  CE2 . PHE D  1 42  ? -32.348 103.964 61.174  1.00 50.73  ? 42   PHE D CE2 1 
ATOM   7643  C  CZ  . PHE D  1 42  ? -31.228 103.170 61.270  1.00 51.43  ? 42   PHE D CZ  1 
ATOM   7644  N  N   . LEU D  1 43  ? -34.217 101.131 57.921  1.00 46.52  ? 43   LEU D N   1 
ATOM   7645  C  CA  . LEU D  1 43  ? -35.214 100.330 58.619  1.00 39.72  ? 43   LEU D CA  1 
ATOM   7646  C  C   . LEU D  1 43  ? -34.922 100.104 60.095  1.00 47.88  ? 43   LEU D C   1 
ATOM   7647  O  O   . LEU D  1 43  ? -35.848 99.773  60.841  1.00 53.72  ? 43   LEU D O   1 
ATOM   7648  C  CB  . LEU D  1 43  ? -35.363 98.966  57.930  1.00 43.82  ? 43   LEU D CB  1 
ATOM   7649  C  CG  . LEU D  1 43  ? -35.703 99.035  56.438  1.00 43.63  ? 43   LEU D CG  1 
ATOM   7650  C  CD1 . LEU D  1 43  ? -35.719 97.648  55.795  1.00 43.92  ? 43   LEU D CD1 1 
ATOM   7651  C  CD2 . LEU D  1 43  ? -37.052 99.732  56.244  1.00 42.59  ? 43   LEU D CD2 1 
ATOM   7652  N  N   . GLY D  1 44  ? -33.687 100.277 60.535  1.00 49.87  ? 44   GLY D N   1 
ATOM   7653  C  CA  . GLY D  1 44  ? -33.361 100.107 61.936  1.00 43.11  ? 44   GLY D CA  1 
ATOM   7654  C  C   . GLY D  1 44  ? -31.897 99.764  62.116  1.00 45.20  ? 44   GLY D C   1 
ATOM   7655  O  O   . GLY D  1 44  ? -31.143 99.591  61.150  1.00 39.30  ? 44   GLY D O   1 
ATOM   7656  N  N   . PHE D  1 45  ? -31.514 99.622  63.386  1.00 38.68  ? 45   PHE D N   1 
ATOM   7657  C  CA  . PHE D  1 45  ? -30.116 99.379  63.693  1.00 44.03  ? 45   PHE D CA  1 
ATOM   7658  C  C   . PHE D  1 45  ? -29.982 98.553  64.965  1.00 48.26  ? 45   PHE D C   1 
ATOM   7659  O  O   . PHE D  1 45  ? -30.903 98.477  65.782  1.00 53.34  ? 45   PHE D O   1 
ATOM   7660  C  CB  . PHE D  1 45  ? -29.328 100.699 63.814  1.00 35.86  ? 45   PHE D CB  1 
ATOM   7661  C  CG  . PHE D  1 45  ? -29.663 101.512 65.029  1.00 46.59  ? 45   PHE D CG  1 
ATOM   7662  C  CD1 . PHE D  1 45  ? -29.058 101.252 66.258  1.00 48.13  ? 45   PHE D CD1 1 
ATOM   7663  C  CD2 . PHE D  1 45  ? -30.545 102.586 64.938  1.00 55.96  ? 45   PHE D CD2 1 
ATOM   7664  C  CE1 . PHE D  1 45  ? -29.366 102.018 67.387  1.00 54.15  ? 45   PHE D CE1 1 
ATOM   7665  C  CE2 . PHE D  1 45  ? -30.846 103.367 66.061  1.00 58.54  ? 45   PHE D CE2 1 
ATOM   7666  C  CZ  . PHE D  1 45  ? -30.257 103.080 67.283  1.00 57.46  ? 45   PHE D CZ  1 
ATOM   7667  N  N   . GLU D  1 46  ? -28.800 97.947  65.122  1.00 44.68  ? 46   GLU D N   1 
ATOM   7668  C  CA  . GLU D  1 46  ? -28.420 97.213  66.330  1.00 41.36  ? 46   GLU D CA  1 
ATOM   7669  C  C   . GLU D  1 46  ? -27.001 97.616  66.690  1.00 41.99  ? 46   GLU D C   1 
ATOM   7670  O  O   . GLU D  1 46  ? -26.077 97.367  65.908  1.00 47.48  ? 46   GLU D O   1 
ATOM   7671  C  CB  . GLU D  1 46  ? -28.467 95.692  66.129  1.00 41.20  ? 46   GLU D CB  1 
ATOM   7672  C  CG  . GLU D  1 46  ? -29.767 95.120  65.601  1.00 46.66  ? 46   GLU D CG  1 
ATOM   7673  C  CD  . GLU D  1 46  ? -30.829 94.921  66.673  1.00 49.20  ? 46   GLU D CD  1 
ATOM   7674  O  OE1 . GLU D  1 46  ? -30.526 95.103  67.872  1.00 46.72  ? 46   GLU D OE1 1 
ATOM   7675  O  OE2 . GLU D  1 46  ? -31.979 94.585  66.303  1.00 57.47  ? 46   GLU D OE2 1 
ATOM   7676  N  N   . GLN D  1 47  ? -26.805 98.190  67.875  1.00 41.46  ? 47   GLN D N   1 
ATOM   7677  C  CA  . GLN D  1 47  ? -25.459 98.512  68.345  1.00 44.09  ? 47   GLN D CA  1 
ATOM   7678  C  C   . GLN D  1 47  ? -25.010 97.402  69.294  1.00 43.11  ? 47   GLN D C   1 
ATOM   7679  O  O   . GLN D  1 47  ? -25.530 97.283  70.406  1.00 42.49  ? 47   GLN D O   1 
ATOM   7680  C  CB  . GLN D  1 47  ? -25.408 99.884  69.020  1.00 41.73  ? 47   GLN D CB  1 
ATOM   7681  C  CG  . GLN D  1 47  ? -23.979 100.370 69.279  1.00 62.39  ? 47   GLN D CG  1 
ATOM   7682  C  CD  . GLN D  1 47  ? -23.892 101.682 70.058  1.00 81.05  ? 47   GLN D CD  1 
ATOM   7683  O  OE1 . GLN D  1 47  ? -24.520 101.845 71.110  1.00 83.54  ? 47   GLN D OE1 1 
ATOM   7684  N  NE2 . GLN D  1 47  ? -23.093 102.620 69.547  1.00 84.10  ? 47   GLN D NE2 1 
ATOM   7685  N  N   . LEU D  1 48  ? -24.042 96.596  68.855  1.00 34.51  ? 48   LEU D N   1 
ATOM   7686  C  CA  . LEU D  1 48  ? -23.576 95.432  69.601  1.00 39.65  ? 48   LEU D CA  1 
ATOM   7687  C  C   . LEU D  1 48  ? -22.156 95.658  70.103  1.00 37.34  ? 48   LEU D C   1 
ATOM   7688  O  O   . LEU D  1 48  ? -21.250 95.938  69.310  1.00 38.27  ? 48   LEU D O   1 
ATOM   7689  C  CB  . LEU D  1 48  ? -23.604 94.173  68.737  1.00 38.62  ? 48   LEU D CB  1 
ATOM   7690  C  CG  . LEU D  1 48  ? -24.930 93.832  68.076  1.00 41.34  ? 48   LEU D CG  1 
ATOM   7691  C  CD1 . LEU D  1 48  ? -24.739 92.582  67.236  1.00 36.03  ? 48   LEU D CD1 1 
ATOM   7692  C  CD2 . LEU D  1 48  ? -26.008 93.635  69.133  1.00 37.21  ? 48   LEU D CD2 1 
ATOM   7693  N  N   . LEU D  1 49  ? -21.961 95.499  71.408  1.00 35.87  ? 49   LEU D N   1 
ATOM   7694  C  CA  . LEU D  1 49  ? -20.658 95.627  72.043  1.00 40.51  ? 49   LEU D CA  1 
ATOM   7695  C  C   . LEU D  1 49  ? -20.204 94.249  72.515  1.00 43.08  ? 49   LEU D C   1 
ATOM   7696  O  O   . LEU D  1 49  ? -20.950 93.549  73.215  1.00 40.78  ? 49   LEU D O   1 
ATOM   7697  C  CB  . LEU D  1 49  ? -20.718 96.611  73.218  1.00 43.02  ? 49   LEU D CB  1 
ATOM   7698  C  CG  . LEU D  1 49  ? -19.373 96.959  73.867  1.00 51.86  ? 49   LEU D CG  1 
ATOM   7699  C  CD1 . LEU D  1 49  ? -18.495 97.685  72.849  1.00 49.77  ? 49   LEU D CD1 1 
ATOM   7700  C  CD2 . LEU D  1 49  ? -19.518 97.779  75.161  1.00 49.82  ? 49   LEU D CD2 1 
ATOM   7701  N  N   . GLN D  1 50  ? -18.996 93.850  72.123  1.00 33.43  ? 50   GLN D N   1 
ATOM   7702  C  CA  . GLN D  1 50  ? -18.521 92.520  72.479  1.00 37.93  ? 50   GLN D CA  1 
ATOM   7703  C  C   . GLN D  1 50  ? -18.292 92.416  73.977  1.00 39.12  ? 50   GLN D C   1 
ATOM   7704  O  O   . GLN D  1 50  ? -17.703 93.310  74.585  1.00 39.44  ? 50   GLN D O   1 
ATOM   7705  C  CB  . GLN D  1 50  ? -17.235 92.176  71.730  1.00 35.36  ? 50   GLN D CB  1 
ATOM   7706  C  CG  . GLN D  1 50  ? -16.688 90.810  72.133  1.00 36.21  ? 50   GLN D CG  1 
ATOM   7707  C  CD  . GLN D  1 50  ? -15.475 90.380  71.337  1.00 40.74  ? 50   GLN D CD  1 
ATOM   7708  O  OE1 . GLN D  1 50  ? -14.831 91.188  70.665  1.00 43.30  ? 50   GLN D OE1 1 
ATOM   7709  N  NE2 . GLN D  1 50  ? -15.170 89.076  71.389  1.00 32.82  ? 50   GLN D NE2 1 
ATOM   7710  N  N   . THR D  1 51  ? -18.764 91.312  74.566  1.00 35.72  ? 51   THR D N   1 
ATOM   7711  C  CA  . THR D  1 51  ? -18.552 91.008  75.971  1.00 34.71  ? 51   THR D CA  1 
ATOM   7712  C  C   . THR D  1 51  ? -17.681 89.780  76.199  1.00 38.53  ? 51   THR D C   1 
ATOM   7713  O  O   . THR D  1 51  ? -17.198 89.593  77.322  1.00 36.76  ? 51   THR D O   1 
ATOM   7714  C  CB  . THR D  1 51  ? -19.891 90.777  76.682  1.00 39.24  ? 51   THR D CB  1 
ATOM   7715  O  OG1 . THR D  1 51  ? -20.612 89.752  75.994  1.00 39.04  ? 51   THR D OG1 1 
ATOM   7716  C  CG2 . THR D  1 51  ? -20.720 92.047  76.695  1.00 37.95  ? 51   THR D CG2 1 
ATOM   7717  N  N   . GLY D  1 52  ? -17.469 88.948  75.181  1.00 35.95  ? 52   GLY D N   1 
ATOM   7718  C  CA  . GLY D  1 52  ? -16.636 87.767  75.353  1.00 31.68  ? 52   GLY D CA  1 
ATOM   7719  C  C   . GLY D  1 52  ? -16.734 86.859  74.146  1.00 35.23  ? 52   GLY D C   1 
ATOM   7720  O  O   . GLY D  1 52  ? -17.092 87.296  73.053  1.00 33.03  ? 52   GLY D O   1 
ATOM   7721  N  N   . ILE D  1 53  ? -16.405 85.590  74.360  1.00 39.73  ? 53   ILE D N   1 
ATOM   7722  C  CA  . ILE D  1 53  ? -16.473 84.574  73.315  1.00 41.85  ? 53   ILE D CA  1 
ATOM   7723  C  C   . ILE D  1 53  ? -17.005 83.282  73.914  1.00 37.12  ? 53   ILE D C   1 
ATOM   7724  O  O   . ILE D  1 53  ? -17.073 83.117  75.131  1.00 33.76  ? 53   ILE D O   1 
ATOM   7725  C  CB  . ILE D  1 53  ? -15.101 84.304  72.667  1.00 38.27  ? 53   ILE D CB  1 
ATOM   7726  C  CG1 . ILE D  1 53  ? -14.172 83.662  73.704  1.00 40.90  ? 53   ILE D CG1 1 
ATOM   7727  C  CG2 . ILE D  1 53  ? -14.518 85.564  72.017  1.00 35.69  ? 53   ILE D CG2 1 
ATOM   7728  C  CD1 . ILE D  1 53  ? -12.915 83.069  73.102  1.00 41.71  ? 53   ILE D CD1 1 
ATOM   7729  N  N   . HIS D  1 54  ? -17.339 82.331  73.038  1.00 37.47  ? 54   HIS D N   1 
ATOM   7730  C  CA  . HIS D  1 54  ? -17.595 80.982  73.504  1.00 36.01  ? 54   HIS D CA  1 
ATOM   7731  C  C   . HIS D  1 54  ? -16.287 80.209  73.495  1.00 38.66  ? 54   HIS D C   1 
ATOM   7732  O  O   . HIS D  1 54  ? -15.705 80.015  72.422  1.00 41.61  ? 54   HIS D O   1 
ATOM   7733  C  CB  . HIS D  1 54  ? -18.622 80.262  72.648  1.00 38.12  ? 54   HIS D CB  1 
ATOM   7734  C  CG  . HIS D  1 54  ? -19.199 79.061  73.332  1.00 50.93  ? 54   HIS D CG  1 
ATOM   7735  N  ND1 . HIS D  1 54  ? -18.435 77.969  73.675  1.00 53.03  ? 54   HIS D ND1 1 
ATOM   7736  C  CD2 . HIS D  1 54  ? -20.440 78.813  73.814  1.00 54.79  ? 54   HIS D CD2 1 
ATOM   7737  C  CE1 . HIS D  1 54  ? -19.184 77.083  74.304  1.00 51.67  ? 54   HIS D CE1 1 
ATOM   7738  N  NE2 . HIS D  1 54  ? -20.405 77.571  74.403  1.00 54.88  ? 54   HIS D NE2 1 
ATOM   7739  N  N   . PRO D  1 55  ? -15.783 79.762  74.648  1.00 42.72  ? 55   PRO D N   1 
ATOM   7740  C  CA  . PRO D  1 55  ? -14.501 79.031  74.656  1.00 42.71  ? 55   PRO D CA  1 
ATOM   7741  C  C   . PRO D  1 55  ? -14.591 77.650  74.027  1.00 44.62  ? 55   PRO D C   1 
ATOM   7742  O  O   . PRO D  1 55  ? -13.545 77.040  73.757  1.00 42.88  ? 55   PRO D O   1 
ATOM   7743  C  CB  . PRO D  1 55  ? -14.148 78.933  76.150  1.00 34.96  ? 55   PRO D CB  1 
ATOM   7744  C  CG  . PRO D  1 55  ? -15.085 79.867  76.848  1.00 34.04  ? 55   PRO D CG  1 
ATOM   7745  C  CD  . PRO D  1 55  ? -16.329 79.942  75.997  1.00 30.93  ? 55   PRO D CD  1 
ATOM   7746  N  N   . MET D  1 56  ? -15.800 77.143  73.793  1.00 39.05  ? 56   MET D N   1 
ATOM   7747  C  CA  . MET D  1 56  ? -16.021 75.878  73.101  1.00 41.49  ? 56   MET D CA  1 
ATOM   7748  C  C   . MET D  1 56  ? -15.183 74.755  73.711  1.00 43.11  ? 56   MET D C   1 
ATOM   7749  O  O   . MET D  1 56  ? -14.388 74.086  73.044  1.00 43.53  ? 56   MET D O   1 
ATOM   7750  C  CB  . MET D  1 56  ? -15.755 76.026  71.608  1.00 48.61  ? 56   MET D CB  1 
ATOM   7751  C  CG  . MET D  1 56  ? -16.949 76.592  70.865  1.00 63.64  ? 56   MET D CG  1 
ATOM   7752  S  SD  . MET D  1 56  ? -16.561 76.890  69.137  1.00 79.84  ? 56   MET D SD  1 
ATOM   7753  C  CE  . MET D  1 56  ? -16.098 75.232  68.608  1.00 79.55  ? 56   MET D CE  1 
ATOM   7754  N  N   . ALA D  1 57  ? -15.369 74.578  75.016  1.00 40.74  ? 57   ALA D N   1 
ATOM   7755  C  CA  . ALA D  1 57  ? -14.791 73.453  75.737  1.00 46.70  ? 57   ALA D CA  1 
ATOM   7756  C  C   . ALA D  1 57  ? -13.268 73.428  75.614  1.00 45.17  ? 57   ALA D C   1 
ATOM   7757  O  O   . ALA D  1 57  ? -12.656 72.367  75.498  1.00 46.01  ? 57   ALA D O   1 
ATOM   7758  C  CB  . ALA D  1 57  ? -15.404 72.130  75.262  1.00 47.16  ? 57   ALA D CB  1 
ATOM   7759  N  N   . GLY D  1 58  ? -12.654 74.608  75.604  1.00 42.15  ? 58   GLY D N   1 
ATOM   7760  C  CA  . GLY D  1 58  ? -11.212 74.731  75.640  1.00 36.78  ? 58   GLY D CA  1 
ATOM   7761  C  C   . GLY D  1 58  ? -10.551 74.950  74.301  1.00 40.63  ? 58   GLY D C   1 
ATOM   7762  O  O   . GLY D  1 58  ? -9.353  75.245  74.262  1.00 48.27  ? 58   GLY D O   1 
ATOM   7763  N  N   . ARG D  1 59  ? -11.296 74.829  73.210  1.00 43.82  ? 59   ARG D N   1 
ATOM   7764  C  CA  . ARG D  1 59  ? -10.750 75.136  71.897  1.00 37.13  ? 59   ARG D CA  1 
ATOM   7765  C  C   . ARG D  1 59  ? -10.236 76.566  71.840  1.00 47.84  ? 59   ARG D C   1 
ATOM   7766  O  O   . ARG D  1 59  ? -9.225  76.845  71.186  1.00 51.59  ? 59   ARG D O   1 
ATOM   7767  C  CB  . ARG D  1 59  ? -11.835 74.907  70.852  1.00 39.11  ? 59   ARG D CB  1 
ATOM   7768  C  CG  . ARG D  1 59  ? -11.546 75.440  69.468  1.00 49.64  ? 59   ARG D CG  1 
ATOM   7769  C  CD  . ARG D  1 59  ? -10.437 74.692  68.765  1.00 50.72  ? 59   ARG D CD  1 
ATOM   7770  N  NE  . ARG D  1 59  ? -10.254 75.217  67.414  1.00 54.87  ? 59   ARG D NE  1 
ATOM   7771  C  CZ  . ARG D  1 59  ? -9.460  76.236  67.106  1.00 61.92  ? 59   ARG D CZ  1 
ATOM   7772  N  NH1 . ARG D  1 59  ? -8.745  76.841  68.052  1.00 58.76  ? 59   ARG D NH1 1 
ATOM   7773  N  NH2 . ARG D  1 59  ? -9.372  76.638  65.845  1.00 64.51  ? 59   ARG D NH2 1 
ATOM   7774  N  N   . TYR D  1 60  ? -10.912 77.483  72.538  1.00 49.00  ? 60   TYR D N   1 
ATOM   7775  C  CA  . TYR D  1 60  ? -10.400 78.832  72.726  1.00 47.06  ? 60   TYR D CA  1 
ATOM   7776  C  C   . TYR D  1 60  ? -10.297 79.091  74.217  1.00 44.59  ? 60   TYR D C   1 
ATOM   7777  O  O   . TYR D  1 60  ? -10.939 80.005  74.742  1.00 42.41  ? 60   TYR D O   1 
ATOM   7778  C  CB  . TYR D  1 60  ? -11.295 79.869  72.049  1.00 43.27  ? 60   TYR D CB  1 
ATOM   7779  C  CG  . TYR D  1 60  ? -11.547 79.544  70.610  1.00 44.38  ? 60   TYR D CG  1 
ATOM   7780  C  CD1 . TYR D  1 60  ? -10.554 79.724  69.655  1.00 49.01  ? 60   TYR D CD1 1 
ATOM   7781  C  CD2 . TYR D  1 60  ? -12.778 79.056  70.191  1.00 37.97  ? 60   TYR D CD2 1 
ATOM   7782  C  CE1 . TYR D  1 60  ? -10.778 79.417  68.319  1.00 46.74  ? 60   TYR D CE1 1 
ATOM   7783  C  CE2 . TYR D  1 60  ? -13.005 78.737  68.855  1.00 42.96  ? 60   TYR D CE2 1 
ATOM   7784  C  CZ  . TYR D  1 60  ? -11.998 78.926  67.924  1.00 43.93  ? 60   TYR D CZ  1 
ATOM   7785  O  OH  . TYR D  1 60  ? -12.223 78.630  66.593  1.00 53.89  ? 60   TYR D OH  1 
ATOM   7786  N  N   . GLY D  1 61  ? -9.471  78.289  74.894  1.00 42.46  ? 61   GLY D N   1 
ATOM   7787  C  CA  . GLY D  1 61  ? -9.376  78.298  76.342  1.00 39.96  ? 61   GLY D CA  1 
ATOM   7788  C  C   . GLY D  1 61  ? -8.775  79.556  76.925  1.00 41.19  ? 61   GLY D C   1 
ATOM   7789  O  O   . GLY D  1 61  ? -8.896  79.777  78.136  1.00 43.58  ? 61   GLY D O   1 
ATOM   7790  N  N   . GLY D  1 62  ? -8.122  80.378  76.104  1.00 43.10  ? 62   GLY D N   1 
ATOM   7791  C  CA  . GLY D  1 62  ? -7.673  81.666  76.597  1.00 42.43  ? 62   GLY D CA  1 
ATOM   7792  C  C   . GLY D  1 62  ? -8.784  82.680  76.735  1.00 47.52  ? 62   GLY D C   1 
ATOM   7793  O  O   . GLY D  1 62  ? -8.613  83.695  77.418  1.00 42.30  ? 62   GLY D O   1 
ATOM   7794  N  N   . GLY D  1 63  ? -9.946  82.404  76.136  1.00 45.28  ? 63   GLY D N   1 
ATOM   7795  C  CA  . GLY D  1 63  ? -11.076 83.299  76.218  1.00 41.57  ? 63   GLY D CA  1 
ATOM   7796  C  C   . GLY D  1 63  ? -12.045 82.887  77.314  1.00 40.67  ? 63   GLY D C   1 
ATOM   7797  O  O   . GLY D  1 63  ? -11.828 81.933  78.059  1.00 45.95  ? 63   GLY D O   1 
ATOM   7798  N  N   . ALA D  1 64  ? -13.144 83.635  77.392  1.00 36.71  ? 64   ALA D N   1 
ATOM   7799  C  CA  . ALA D  1 64  ? -14.162 83.416  78.408  1.00 39.27  ? 64   ALA D CA  1 
ATOM   7800  C  C   . ALA D  1 64  ? -15.462 84.040  77.934  1.00 43.28  ? 64   ALA D C   1 
ATOM   7801  O  O   . ALA D  1 64  ? -15.471 84.929  77.081  1.00 36.88  ? 64   ALA D O   1 
ATOM   7802  C  CB  . ALA D  1 64  ? -13.753 84.015  79.749  1.00 29.86  ? 64   ALA D CB  1 
ATOM   7803  N  N   . VAL D  1 65  ? -16.565 83.549  78.497  1.00 44.11  ? 65   VAL D N   1 
ATOM   7804  C  CA  . VAL D  1 65  ? -17.867 84.137  78.211  1.00 40.46  ? 65   VAL D CA  1 
ATOM   7805  C  C   . VAL D  1 65  ? -17.864 85.620  78.558  1.00 41.65  ? 65   VAL D C   1 
ATOM   7806  O  O   . VAL D  1 65  ? -18.312 86.464  77.768  1.00 37.12  ? 65   VAL D O   1 
ATOM   7807  C  CB  . VAL D  1 65  ? -18.964 83.375  78.966  1.00 39.21  ? 65   VAL D CB  1 
ATOM   7808  C  CG1 . VAL D  1 65  ? -20.272 84.142  78.921  1.00 40.17  ? 65   VAL D CG1 1 
ATOM   7809  C  CG2 . VAL D  1 65  ? -19.112 81.957  78.369  1.00 35.17  ? 65   VAL D CG2 1 
ATOM   7810  N  N   . ASP D  1 66  ? -17.326 85.966  79.729  1.00 36.95  ? 66   ASP D N   1 
ATOM   7811  C  CA  . ASP D  1 66  ? -17.281 87.356  80.186  1.00 42.30  ? 66   ASP D CA  1 
ATOM   7812  C  C   . ASP D  1 66  ? -15.831 87.842  80.200  1.00 38.28  ? 66   ASP D C   1 
ATOM   7813  O  O   . ASP D  1 66  ? -15.086 87.594  81.153  1.00 43.14  ? 66   ASP D O   1 
ATOM   7814  C  CB  . ASP D  1 66  ? -17.926 87.501  81.564  1.00 42.80  ? 66   ASP D CB  1 
ATOM   7815  C  CG  . ASP D  1 66  ? -17.961 88.951  82.047  1.00 47.50  ? 66   ASP D CG  1 
ATOM   7816  O  OD1 . ASP D  1 66  ? -17.525 89.859  81.309  1.00 50.86  ? 66   ASP D OD1 1 
ATOM   7817  O  OD2 . ASP D  1 66  ? -18.444 89.186  83.168  1.00 50.44  ? 66   ASP D OD2 1 
ATOM   7818  N  N   . MET D  1 67  ? -15.468 88.611  79.179  1.00 40.20  ? 67   MET D N   1 
ATOM   7819  C  CA  . MET D  1 67  ? -14.162 89.243  79.086  1.00 43.51  ? 67   MET D CA  1 
ATOM   7820  C  C   . MET D  1 67  ? -14.251 90.762  79.206  1.00 44.98  ? 67   MET D C   1 
ATOM   7821  O  O   . MET D  1 67  ? -13.335 91.463  78.766  1.00 44.28  ? 67   MET D O   1 
ATOM   7822  C  CB  . MET D  1 67  ? -13.486 88.856  77.763  1.00 29.80  ? 67   MET D CB  1 
ATOM   7823  C  CG  . MET D  1 67  ? -13.303 87.335  77.569  1.00 34.30  ? 67   MET D CG  1 
ATOM   7824  S  SD  . MET D  1 67  ? -12.744 86.932  75.914  1.00 39.32  ? 67   MET D SD  1 
ATOM   7825  C  CE  . MET D  1 67  ? -11.049 87.522  75.946  1.00 35.47  ? 67   MET D CE  1 
ATOM   7826  N  N   . ARG D  1 68  ? -15.333 91.283  79.806  1.00 44.39  ? 68   ARG D N   1 
ATOM   7827  C  CA  . ARG D  1 68  ? -15.599 92.724  79.766  1.00 43.06  ? 68   ARG D CA  1 
ATOM   7828  C  C   . ARG D  1 68  ? -14.489 93.547  80.415  1.00 48.87  ? 68   ARG D C   1 
ATOM   7829  O  O   . ARG D  1 68  ? -14.227 94.680  79.994  1.00 55.03  ? 68   ARG D O   1 
ATOM   7830  C  CB  . ARG D  1 68  ? -16.943 93.028  80.431  1.00 40.47  ? 68   ARG D CB  1 
ATOM   7831  C  CG  . ARG D  1 68  ? -18.124 92.614  79.595  1.00 42.97  ? 68   ARG D CG  1 
ATOM   7832  C  CD  . ARG D  1 68  ? -19.436 92.756  80.331  1.00 46.43  ? 68   ARG D CD  1 
ATOM   7833  N  NE  . ARG D  1 68  ? -19.522 91.868  81.484  1.00 52.47  ? 68   ARG D NE  1 
ATOM   7834  C  CZ  . ARG D  1 68  ? -20.546 91.862  82.330  1.00 60.40  ? 68   ARG D CZ  1 
ATOM   7835  N  NH1 . ARG D  1 68  ? -21.565 92.687  82.138  1.00 68.45  ? 68   ARG D NH1 1 
ATOM   7836  N  NH2 . ARG D  1 68  ? -20.563 91.029  83.357  1.00 60.36  ? 68   ARG D NH2 1 
ATOM   7837  N  N   . GLU D  1 69  ? -13.807 92.994  81.404  1.00 46.73  ? 69   GLU D N   1 
ATOM   7838  C  CA  . GLU D  1 69  ? -12.754 93.733  82.082  1.00 51.07  ? 69   GLU D CA  1 
ATOM   7839  C  C   . GLU D  1 69  ? -11.425 93.655  81.356  1.00 54.27  ? 69   GLU D C   1 
ATOM   7840  O  O   . GLU D  1 69  ? -10.577 94.529  81.548  1.00 55.94  ? 69   GLU D O   1 
ATOM   7841  C  CB  . GLU D  1 69  ? -12.550 93.184  83.500  1.00 56.51  ? 69   GLU D CB  1 
ATOM   7842  C  CG  . GLU D  1 69  ? -13.747 93.290  84.427  1.00 75.67  ? 69   GLU D CG  1 
ATOM   7843  C  CD  . GLU D  1 69  ? -14.096 94.729  84.738  1.00 91.52  ? 69   GLU D CD  1 
ATOM   7844  O  OE1 . GLU D  1 69  ? -13.184 95.480  85.153  1.00 96.61  ? 69   GLU D OE1 1 
ATOM   7845  O  OE2 . GLU D  1 69  ? -15.271 95.113  84.558  1.00 98.75  ? 69   GLU D OE2 1 
ATOM   7846  N  N   . THR D  1 70  ? -11.227 92.649  80.513  1.00 48.36  ? 70   THR D N   1 
ATOM   7847  C  CA  . THR D  1 70  ? -9.904  92.349  79.996  1.00 45.92  ? 70   THR D CA  1 
ATOM   7848  C  C   . THR D  1 70  ? -9.768  92.506  78.495  1.00 45.19  ? 70   THR D C   1 
ATOM   7849  O  O   . THR D  1 70  ? -8.652  92.707  78.012  1.00 48.57  ? 70   THR D O   1 
ATOM   7850  C  CB  . THR D  1 70  ? -9.520  90.914  80.371  1.00 46.42  ? 70   THR D CB  1 
ATOM   7851  O  OG1 . THR D  1 70  ? -10.514 90.024  79.857  1.00 45.15  ? 70   THR D OG1 1 
ATOM   7852  C  CG2 . THR D  1 70  ? -9.460  90.755  81.883  1.00 49.14  ? 70   THR D CG2 1 
ATOM   7853  N  N   . LEU D  1 71  ? -10.858 92.462  77.759  1.00 38.57  ? 71   LEU D N   1 
ATOM   7854  C  CA  . LEU D  1 71  ? -10.801 92.496  76.309  1.00 42.20  ? 71   LEU D CA  1 
ATOM   7855  C  C   . LEU D  1 71  ? -10.344 93.869  75.852  1.00 44.30  ? 71   LEU D C   1 
ATOM   7856  O  O   . LEU D  1 71  ? -10.970 94.872  76.199  1.00 42.62  ? 71   LEU D O   1 
ATOM   7857  C  CB  . LEU D  1 71  ? -12.183 92.176  75.762  1.00 40.27  ? 71   LEU D CB  1 
ATOM   7858  C  CG  . LEU D  1 71  ? -12.440 91.766  74.335  1.00 43.58  ? 71   LEU D CG  1 
ATOM   7859  C  CD1 . LEU D  1 71  ? -11.528 90.633  73.955  1.00 36.99  ? 71   LEU D CD1 1 
ATOM   7860  C  CD2 . LEU D  1 71  ? -13.883 91.330  74.324  1.00 47.65  ? 71   LEU D CD2 1 
ATOM   7861  N  N   . ASN D  1 72  ? -9.239  93.922  75.100  1.00 37.95  ? 72   ASN D N   1 
ATOM   7862  C  CA  . ASN D  1 72  ? -8.789  95.183  74.516  1.00 40.27  ? 72   ASN D CA  1 
ATOM   7863  C  C   . ASN D  1 72  ? -7.891  94.922  73.314  1.00 45.17  ? 72   ASN D C   1 
ATOM   7864  O  O   . ASN D  1 72  ? -6.771  94.421  73.473  1.00 52.74  ? 72   ASN D O   1 
ATOM   7865  C  CB  . ASN D  1 72  ? -8.065  96.041  75.560  1.00 45.25  ? 72   ASN D CB  1 
ATOM   7866  C  CG  . ASN D  1 72  ? -7.585  97.363  74.994  1.00 52.63  ? 72   ASN D CG  1 
ATOM   7867  O  OD1 . ASN D  1 72  ? -8.383  98.182  74.543  1.00 48.43  ? 72   ASN D OD1 1 
ATOM   7868  N  ND2 . ASN D  1 72  ? -6.272  97.584  75.026  1.00 58.81  ? 72   ASN D ND2 1 
ATOM   7869  N  N   . PRO D  1 73  ? -8.336  95.249  72.093  1.00 36.89  ? 73   PRO D N   1 
ATOM   7870  C  CA  . PRO D  1 73  ? -9.608  95.917  71.804  1.00 42.00  ? 73   PRO D CA  1 
ATOM   7871  C  C   . PRO D  1 73  ? -10.827 95.011  71.944  1.00 44.29  ? 73   PRO D C   1 
ATOM   7872  O  O   . PRO D  1 73  ? -10.705 93.793  71.992  1.00 42.23  ? 73   PRO D O   1 
ATOM   7873  C  CB  . PRO D  1 73  ? -9.438  96.350  70.354  1.00 38.85  ? 73   PRO D CB  1 
ATOM   7874  C  CG  . PRO D  1 73  ? -8.596  95.291  69.767  1.00 39.23  ? 73   PRO D CG  1 
ATOM   7875  C  CD  . PRO D  1 73  ? -7.604  94.923  70.857  1.00 32.81  ? 73   PRO D CD  1 
ATOM   7876  N  N   . MET D  1 74  ? -12.003 95.617  72.000  1.00 46.83  ? 74   MET D N   1 
ATOM   7877  C  CA  . MET D  1 74  ? -13.254 94.881  72.031  1.00 46.35  ? 74   MET D CA  1 
ATOM   7878  C  C   . MET D  1 74  ? -14.017 95.128  70.739  1.00 43.14  ? 74   MET D C   1 
ATOM   7879  O  O   . MET D  1 74  ? -13.966 96.221  70.173  1.00 42.84  ? 74   MET D O   1 
ATOM   7880  C  CB  . MET D  1 74  ? -14.096 95.286  73.242  1.00 48.43  ? 74   MET D CB  1 
ATOM   7881  C  CG  . MET D  1 74  ? -14.497 96.731  73.239  1.00 49.88  ? 74   MET D CG  1 
ATOM   7882  S  SD  . MET D  1 74  ? -15.002 97.305  74.864  1.00 53.86  ? 74   MET D SD  1 
ATOM   7883  C  CE  . MET D  1 74  ? -15.927 95.890  75.431  1.00 54.92  ? 74   MET D CE  1 
ATOM   7884  N  N   . GLY D  1 75  ? -14.693 94.097  70.255  1.00 41.29  ? 75   GLY D N   1 
ATOM   7885  C  CA  . GLY D  1 75  ? -15.465 94.251  69.043  1.00 39.61  ? 75   GLY D CA  1 
ATOM   7886  C  C   . GLY D  1 75  ? -16.659 95.163  69.269  1.00 37.83  ? 75   GLY D C   1 
ATOM   7887  O  O   . GLY D  1 75  ? -17.304 95.142  70.318  1.00 40.25  ? 75   GLY D O   1 
ATOM   7888  N  N   . MET D  1 76  ? -16.964 95.957  68.251  1.00 34.04  ? 76   MET D N   1 
ATOM   7889  C  CA  . MET D  1 76  ? -18.147 96.807  68.238  1.00 37.92  ? 76   MET D CA  1 
ATOM   7890  C  C   . MET D  1 76  ? -18.754 96.688  66.849  1.00 39.02  ? 76   MET D C   1 
ATOM   7891  O  O   . MET D  1 76  ? -18.129 97.091  65.861  1.00 44.97  ? 76   MET D O   1 
ATOM   7892  C  CB  . MET D  1 76  ? -17.781 98.245  68.576  1.00 45.91  ? 76   MET D CB  1 
ATOM   7893  C  CG  . MET D  1 76  ? -18.833 98.945  69.366  1.00 64.38  ? 76   MET D CG  1 
ATOM   7894  S  SD  . MET D  1 76  ? -19.724 99.950  68.200  1.00 77.34  ? 76   MET D SD  1 
ATOM   7895  C  CE  . MET D  1 76  ? -18.513 101.261 67.934  1.00 74.84  ? 76   MET D CE  1 
ATOM   7896  N  N   . PHE D  1 77  ? -19.936 96.082  66.768  1.00 36.58  ? 77   PHE D N   1 
ATOM   7897  C  CA  . PHE D  1 77  ? -20.634 95.843  65.507  1.00 34.98  ? 77   PHE D CA  1 
ATOM   7898  C  C   . PHE D  1 77  ? -21.871 96.728  65.469  1.00 45.83  ? 77   PHE D C   1 
ATOM   7899  O  O   . PHE D  1 77  ? -22.643 96.765  66.432  1.00 52.44  ? 77   PHE D O   1 
ATOM   7900  C  CB  . PHE D  1 77  ? -21.055 94.371  65.344  1.00 35.13  ? 77   PHE D CB  1 
ATOM   7901  C  CG  . PHE D  1 77  ? -19.918 93.407  64.989  1.00 44.11  ? 77   PHE D CG  1 
ATOM   7902  C  CD1 . PHE D  1 77  ? -18.581 93.734  65.203  1.00 44.07  ? 77   PHE D CD1 1 
ATOM   7903  C  CD2 . PHE D  1 77  ? -20.207 92.157  64.447  1.00 40.91  ? 77   PHE D CD2 1 
ATOM   7904  C  CE1 . PHE D  1 77  ? -17.557 92.828  64.880  1.00 39.38  ? 77   PHE D CE1 1 
ATOM   7905  C  CE2 . PHE D  1 77  ? -19.196 91.259  64.121  1.00 41.86  ? 77   PHE D CE2 1 
ATOM   7906  C  CZ  . PHE D  1 77  ? -17.869 91.595  64.348  1.00 37.10  ? 77   PHE D CZ  1 
ATOM   7907  N  N   . GLN D  1 78  ? -22.038 97.475  64.390  1.00 46.41  ? 78   GLN D N   1 
ATOM   7908  C  CA  . GLN D  1 78  ? -23.240 98.277  64.193  1.00 41.05  ? 78   GLN D CA  1 
ATOM   7909  C  C   . GLN D  1 78  ? -24.001 97.716  62.995  1.00 46.05  ? 78   GLN D C   1 
ATOM   7910  O  O   . GLN D  1 78  ? -23.532 97.822  61.856  1.00 48.23  ? 78   GLN D O   1 
ATOM   7911  C  CB  . GLN D  1 78  ? -22.902 99.752  63.988  1.00 48.62  ? 78   GLN D CB  1 
ATOM   7912  C  CG  . GLN D  1 78  ? -22.368 100.438 65.235  1.00 68.19  ? 78   GLN D CG  1 
ATOM   7913  C  CD  . GLN D  1 78  ? -21.924 101.867 64.977  1.00 89.09  ? 78   GLN D CD  1 
ATOM   7914  O  OE1 . GLN D  1 78  ? -22.406 102.528 64.050  1.00 97.89  ? 78   GLN D OE1 1 
ATOM   7915  N  NE2 . GLN D  1 78  ? -21.006 102.357 65.805  1.00 95.04  ? 78   GLN D NE2 1 
ATOM   7916  N  N   . TYR D  1 79  ? -25.153 97.090  63.246  1.00 42.30  ? 79   TYR D N   1 
ATOM   7917  C  CA  . TYR D  1 79  ? -26.051 96.725  62.152  1.00 44.41  ? 79   TYR D CA  1 
ATOM   7918  C  C   . TYR D  1 79  ? -26.821 97.961  61.731  1.00 44.16  ? 79   TYR D C   1 
ATOM   7919  O  O   . TYR D  1 79  ? -27.436 98.621  62.570  1.00 44.64  ? 79   TYR D O   1 
ATOM   7920  C  CB  . TYR D  1 79  ? -27.081 95.674  62.563  1.00 35.58  ? 79   TYR D CB  1 
ATOM   7921  C  CG  . TYR D  1 79  ? -26.620 94.291  62.949  1.00 38.70  ? 79   TYR D CG  1 
ATOM   7922  C  CD1 . TYR D  1 79  ? -25.295 94.002  63.222  1.00 43.17  ? 79   TYR D CD1 1 
ATOM   7923  C  CD2 . TYR D  1 79  ? -27.555 93.273  63.081  1.00 39.78  ? 79   TYR D CD2 1 
ATOM   7924  C  CE1 . TYR D  1 79  ? -24.908 92.708  63.585  1.00 50.62  ? 79   TYR D CE1 1 
ATOM   7925  C  CE2 . TYR D  1 79  ? -27.188 91.994  63.443  1.00 43.53  ? 79   TYR D CE2 1 
ATOM   7926  C  CZ  . TYR D  1 79  ? -25.873 91.716  63.690  1.00 45.64  ? 79   TYR D CZ  1 
ATOM   7927  O  OH  . TYR D  1 79  ? -25.544 90.443  64.050  1.00 38.44  ? 79   TYR D OH  1 
ATOM   7928  N  N   . THR D  1 80  ? -26.823 98.268  60.444  1.00 40.51  ? 80   THR D N   1 
ATOM   7929  C  CA  . THR D  1 80  ? -27.850 99.141  59.903  1.00 42.43  ? 80   THR D CA  1 
ATOM   7930  C  C   . THR D  1 80  ? -28.598 98.351  58.838  1.00 48.11  ? 80   THR D C   1 
ATOM   7931  O  O   . THR D  1 80  ? -27.983 97.642  58.027  1.00 44.50  ? 80   THR D O   1 
ATOM   7932  C  CB  . THR D  1 80  ? -27.288 100.469 59.364  1.00 43.37  ? 80   THR D CB  1 
ATOM   7933  O  OG1 . THR D  1 80  ? -26.251 100.230 58.407  1.00 43.40  ? 80   THR D OG1 1 
ATOM   7934  C  CG2 . THR D  1 80  ? -26.754 101.340 60.516  1.00 42.03  ? 80   THR D CG2 1 
ATOM   7935  N  N   . VAL D  1 81  ? -29.925 98.426  58.886  1.00 42.86  ? 81   VAL D N   1 
ATOM   7936  C  CA  . VAL D  1 81  ? -30.796 97.582  58.082  1.00 39.73  ? 81   VAL D CA  1 
ATOM   7937  C  C   . VAL D  1 81  ? -31.495 98.476  57.078  1.00 39.49  ? 81   VAL D C   1 
ATOM   7938  O  O   . VAL D  1 81  ? -31.946 99.571  57.429  1.00 47.74  ? 81   VAL D O   1 
ATOM   7939  C  CB  . VAL D  1 81  ? -31.810 96.814  58.953  1.00 43.18  ? 81   VAL D CB  1 
ATOM   7940  C  CG1 . VAL D  1 81  ? -32.552 95.781  58.116  1.00 38.79  ? 81   VAL D CG1 1 
ATOM   7941  C  CG2 . VAL D  1 81  ? -31.110 96.164  60.138  1.00 45.26  ? 81   VAL D CG2 1 
ATOM   7942  N  N   . TRP D  1 82  ? -31.544 98.026  55.823  1.00 40.18  ? 82   TRP D N   1 
ATOM   7943  C  CA  . TRP D  1 82  ? -31.914 98.859  54.687  1.00 41.52  ? 82   TRP D CA  1 
ATOM   7944  C  C   . TRP D  1 82  ? -32.817 98.081  53.741  1.00 48.94  ? 82   TRP D C   1 
ATOM   7945  O  O   . TRP D  1 82  ? -32.683 96.865  53.595  1.00 44.48  ? 82   TRP D O   1 
ATOM   7946  C  CB  . TRP D  1 82  ? -30.670 99.313  53.925  1.00 45.47  ? 82   TRP D CB  1 
ATOM   7947  C  CG  . TRP D  1 82  ? -29.704 100.054 54.776  1.00 53.20  ? 82   TRP D CG  1 
ATOM   7948  C  CD1 . TRP D  1 82  ? -28.677 99.520  55.503  1.00 50.55  ? 82   TRP D CD1 1 
ATOM   7949  C  CD2 . TRP D  1 82  ? -29.659 101.464 54.990  1.00 57.51  ? 82   TRP D CD2 1 
ATOM   7950  N  NE1 . TRP D  1 82  ? -27.991 100.513 56.155  1.00 54.24  ? 82   TRP D NE1 1 
ATOM   7951  C  CE2 . TRP D  1 82  ? -28.576 101.718 55.862  1.00 58.78  ? 82   TRP D CE2 1 
ATOM   7952  C  CE3 . TRP D  1 82  ? -30.426 102.541 54.528  1.00 57.98  ? 82   TRP D CE3 1 
ATOM   7953  C  CZ2 . TRP D  1 82  ? -28.240 103.007 56.280  1.00 54.28  ? 82   TRP D CZ2 1 
ATOM   7954  C  CZ3 . TRP D  1 82  ? -30.098 103.818 54.947  1.00 55.41  ? 82   TRP D CZ3 1 
ATOM   7955  C  CH2 . TRP D  1 82  ? -29.012 104.041 55.810  1.00 61.31  ? 82   TRP D CH2 1 
ATOM   7956  N  N   . LYS D  1 83  ? -33.688 98.809  53.035  1.00 51.88  ? 83   LYS D N   1 
ATOM   7957  C  CA  . LYS D  1 83  ? -34.500 98.178  51.997  1.00 56.12  ? 83   LYS D CA  1 
ATOM   7958  C  C   . LYS D  1 83  ? -33.635 97.551  50.917  1.00 52.00  ? 83   LYS D C   1 
ATOM   7959  O  O   . LYS D  1 83  ? -34.009 96.523  50.340  1.00 49.76  ? 83   LYS D O   1 
ATOM   7960  C  CB  . LYS D  1 83  ? -35.457 99.199  51.378  1.00 60.89  ? 83   LYS D CB  1 
ATOM   7961  C  CG  . LYS D  1 83  ? -36.527 99.709  52.338  1.00 61.80  ? 83   LYS D CG  1 
ATOM   7962  C  CD  . LYS D  1 83  ? -37.450 100.712 51.663  1.00 63.28  ? 83   LYS D CD  1 
ATOM   7963  C  CE  . LYS D  1 83  ? -38.487 101.258 52.629  1.00 64.28  ? 83   LYS D CE  1 
ATOM   7964  N  NZ  . LYS D  1 83  ? -39.293 102.341 51.981  1.00 71.33  ? 83   LYS D NZ  1 
ATOM   7965  N  N   . ASP D  1 84  ? -32.485 98.157  50.628  1.00 52.29  ? 84   ASP D N   1 
ATOM   7966  C  CA  . ASP D  1 84  ? -31.591 97.674  49.585  1.00 54.71  ? 84   ASP D CA  1 
ATOM   7967  C  C   . ASP D  1 84  ? -30.220 98.309  49.759  1.00 53.06  ? 84   ASP D C   1 
ATOM   7968  O  O   . ASP D  1 84  ? -30.025 99.220  50.570  1.00 52.68  ? 84   ASP D O   1 
ATOM   7969  C  CB  . ASP D  1 84  ? -32.147 97.962  48.190  1.00 57.46  ? 84   ASP D CB  1 
ATOM   7970  C  CG  . ASP D  1 84  ? -32.708 99.362  48.074  1.00 61.25  ? 84   ASP D CG  1 
ATOM   7971  O  OD1 . ASP D  1 84  ? -32.058 100.341 48.523  1.00 51.50  ? 84   ASP D OD1 1 
ATOM   7972  O  OD2 . ASP D  1 84  ? -33.818 99.471  47.529  1.00 68.42  ? 84   ASP D OD2 1 
ATOM   7973  N  N   . VAL D  1 85  ? -29.266 97.797  48.982  1.00 55.81  ? 85   VAL D N   1 
ATOM   7974  C  CA  . VAL D  1 85  ? -27.901 98.307  49.030  1.00 51.63  ? 85   VAL D CA  1 
ATOM   7975  C  C   . VAL D  1 85  ? -27.860 99.772  48.623  1.00 48.69  ? 85   VAL D C   1 
ATOM   7976  O  O   . VAL D  1 85  ? -27.148 100.579 49.238  1.00 52.42  ? 85   VAL D O   1 
ATOM   7977  C  CB  . VAL D  1 85  ? -26.986 97.450  48.140  1.00 50.98  ? 85   VAL D CB  1 
ATOM   7978  C  CG1 . VAL D  1 85  ? -25.648 98.147  47.928  1.00 49.04  ? 85   VAL D CG1 1 
ATOM   7979  C  CG2 . VAL D  1 85  ? -26.804 96.073  48.756  1.00 47.40  ? 85   VAL D CG2 1 
ATOM   7980  N  N   . HIS D  1 86  ? -28.620 100.140 47.584  1.00 48.76  ? 86   HIS D N   1 
ATOM   7981  C  CA  . HIS D  1 86  ? -28.568 101.510 47.078  1.00 50.49  ? 86   HIS D CA  1 
ATOM   7982  C  C   . HIS D  1 86  ? -28.930 102.517 48.164  1.00 52.79  ? 86   HIS D C   1 
ATOM   7983  O  O   . HIS D  1 86  ? -28.348 103.608 48.223  1.00 55.23  ? 86   HIS D O   1 
ATOM   7984  C  CB  . HIS D  1 86  ? -29.492 101.682 45.873  1.00 50.49  ? 86   HIS D CB  1 
ATOM   7985  C  CG  . HIS D  1 86  ? -29.458 103.059 45.294  1.00 62.69  ? 86   HIS D CG  1 
ATOM   7986  N  ND1 . HIS D  1 86  ? -30.347 104.047 45.665  1.00 67.41  ? 86   HIS D ND1 1 
ATOM   7987  C  CD2 . HIS D  1 86  ? -28.622 103.624 44.391  1.00 67.38  ? 86   HIS D CD2 1 
ATOM   7988  C  CE1 . HIS D  1 86  ? -30.063 105.159 45.012  1.00 67.14  ? 86   HIS D CE1 1 
ATOM   7989  N  NE2 . HIS D  1 86  ? -29.023 104.929 44.230  1.00 68.33  ? 86   HIS D NE2 1 
ATOM   7990  N  N   . SER D  1 87  ? -29.890 102.173 49.030  1.00 48.45  ? 87   SER D N   1 
ATOM   7991  C  CA  . SER D  1 87  ? -30.278 103.090 50.103  1.00 51.01  ? 87   SER D CA  1 
ATOM   7992  C  C   . SER D  1 87  ? -29.104 103.396 51.026  1.00 55.75  ? 87   SER D C   1 
ATOM   7993  O  O   . SER D  1 87  ? -28.901 104.549 51.430  1.00 54.30  ? 87   SER D O   1 
ATOM   7994  C  CB  . SER D  1 87  ? -31.446 102.513 50.894  1.00 48.39  ? 87   SER D CB  1 
ATOM   7995  O  OG  . SER D  1 87  ? -32.593 102.396 50.065  1.00 52.81  ? 87   SER D OG  1 
ATOM   7996  N  N   . HIS D  1 88  ? -28.332 102.374 51.386  1.00 46.69  ? 88   HIS D N   1 
ATOM   7997  C  CA  . HIS D  1 88  ? -27.193 102.595 52.262  1.00 49.18  ? 88   HIS D CA  1 
ATOM   7998  C  C   . HIS D  1 88  ? -26.128 103.444 51.572  1.00 49.70  ? 88   HIS D C   1 
ATOM   7999  O  O   . HIS D  1 88  ? -25.652 104.435 52.136  1.00 49.09  ? 88   HIS D O   1 
ATOM   8000  C  CB  . HIS D  1 88  ? -26.633 101.246 52.709  1.00 48.22  ? 88   HIS D CB  1 
ATOM   8001  C  CG  . HIS D  1 88  ? -25.480 101.356 53.651  1.00 57.75  ? 88   HIS D CG  1 
ATOM   8002  N  ND1 . HIS D  1 88  ? -24.212 100.925 53.328  1.00 60.20  ? 88   HIS D ND1 1 
ATOM   8003  C  CD2 . HIS D  1 88  ? -25.403 101.844 54.910  1.00 57.54  ? 88   HIS D CD2 1 
ATOM   8004  C  CE1 . HIS D  1 88  ? -23.403 101.141 54.350  1.00 58.19  ? 88   HIS D CE1 1 
ATOM   8005  N  NE2 . HIS D  1 88  ? -24.101 101.697 55.323  1.00 61.72  ? 88   HIS D NE2 1 
ATOM   8006  N  N   . GLU D  1 89  ? -25.776 103.100 50.328  1.00 50.34  ? 89   GLU D N   1 
ATOM   8007  C  CA  . GLU D  1 89  ? -24.755 103.863 49.612  1.00 52.14  ? 89   GLU D CA  1 
ATOM   8008  C  C   . GLU D  1 89  ? -25.193 105.302 49.387  1.00 50.42  ? 89   GLU D C   1 
ATOM   8009  O  O   . GLU D  1 89  ? -24.375 106.228 49.460  1.00 50.46  ? 89   GLU D O   1 
ATOM   8010  C  CB  . GLU D  1 89  ? -24.424 103.200 48.274  1.00 45.17  ? 89   GLU D CB  1 
ATOM   8011  C  CG  . GLU D  1 89  ? -23.776 101.846 48.421  1.00 44.24  ? 89   GLU D CG  1 
ATOM   8012  C  CD  . GLU D  1 89  ? -22.405 101.935 49.070  1.00 53.38  ? 89   GLU D CD  1 
ATOM   8013  O  OE1 . GLU D  1 89  ? -21.688 102.924 48.814  1.00 52.40  ? 89   GLU D OE1 1 
ATOM   8014  O  OE2 . GLU D  1 89  ? -22.053 101.028 49.855  1.00 51.03  ? 89   GLU D OE2 1 
ATOM   8015  N  N   . GLU D  1 90  ? -26.477 105.510 49.100  1.00 51.21  ? 90   GLU D N   1 
ATOM   8016  C  CA  . GLU D  1 90  ? -26.966 106.865 48.877  1.00 50.21  ? 90   GLU D CA  1 
ATOM   8017  C  C   . GLU D  1 90  ? -26.956 107.677 50.168  1.00 50.32  ? 90   GLU D C   1 
ATOM   8018  O  O   . GLU D  1 90  ? -26.570 108.853 50.168  1.00 51.14  ? 90   GLU D O   1 
ATOM   8019  C  CB  . GLU D  1 90  ? -28.370 106.822 48.266  1.00 52.36  ? 90   GLU D CB  1 
ATOM   8020  C  CG  . GLU D  1 90  ? -28.923 108.200 47.920  1.00 53.60  ? 90   GLU D CG  1 
ATOM   8021  C  CD  . GLU D  1 90  ? -30.222 108.145 47.121  1.00 60.97  ? 90   GLU D CD  1 
ATOM   8022  O  OE1 . GLU D  1 90  ? -31.229 107.615 47.636  1.00 61.67  ? 90   GLU D OE1 1 
ATOM   8023  O  OE2 . GLU D  1 90  ? -30.224 108.622 45.962  1.00 66.41  ? 90   GLU D OE2 1 
ATOM   8024  N  N   . MET D  1 91  ? -27.374 107.064 51.278  1.00 54.53  ? 91   MET D N   1 
ATOM   8025  C  CA  . MET D  1 91  ? -27.318 107.739 52.570  1.00 52.97  ? 91   MET D CA  1 
ATOM   8026  C  C   . MET D  1 91  ? -25.893 108.181 52.883  1.00 53.91  ? 91   MET D C   1 
ATOM   8027  O  O   . MET D  1 91  ? -25.659 109.345 53.229  1.00 56.42  ? 91   MET D O   1 
ATOM   8028  C  CB  . MET D  1 91  ? -27.874 106.817 53.658  1.00 47.93  ? 91   MET D CB  1 
ATOM   8029  C  CG  . MET D  1 91  ? -28.065 107.439 55.041  1.00 50.80  ? 91   MET D CG  1 
ATOM   8030  S  SD  . MET D  1 91  ? -26.576 107.576 56.043  1.00 69.92  ? 91   MET D SD  1 
ATOM   8031  C  CE  . MET D  1 91  ? -25.982 105.876 56.060  1.00 69.70  ? 91   MET D CE  1 
ATOM   8032  N  N   . HIS D  1 92  ? -24.922 107.272 52.725  1.00 48.22  ? 92   HIS D N   1 
ATOM   8033  C  CA  . HIS D  1 92  ? -23.524 107.625 52.970  1.00 53.17  ? 92   HIS D CA  1 
ATOM   8034  C  C   . HIS D  1 92  ? -23.065 108.765 52.070  1.00 56.74  ? 92   HIS D C   1 
ATOM   8035  O  O   . HIS D  1 92  ? -22.318 109.647 52.506  1.00 53.91  ? 92   HIS D O   1 
ATOM   8036  C  CB  . HIS D  1 92  ? -22.621 106.408 52.776  1.00 58.20  ? 92   HIS D CB  1 
ATOM   8037  C  CG  . HIS D  1 92  ? -22.314 105.670 54.042  1.00 69.95  ? 92   HIS D CG  1 
ATOM   8038  N  ND1 . HIS D  1 92  ? -21.562 106.221 55.058  1.00 70.66  ? 92   HIS D ND1 1 
ATOM   8039  C  CD2 . HIS D  1 92  ? -22.650 104.425 54.456  1.00 72.88  ? 92   HIS D CD2 1 
ATOM   8040  C  CE1 . HIS D  1 92  ? -21.448 105.348 56.043  1.00 67.95  ? 92   HIS D CE1 1 
ATOM   8041  N  NE2 . HIS D  1 92  ? -22.099 104.251 55.704  1.00 70.12  ? 92   HIS D NE2 1 
ATOM   8042  N  N   . HIS D  1 93  ? -23.503 108.764 50.811  1.00 61.56  ? 93   HIS D N   1 
ATOM   8043  C  CA  . HIS D  1 93  ? -23.108 109.821 49.886  1.00 54.97  ? 93   HIS D CA  1 
ATOM   8044  C  C   . HIS D  1 93  ? -23.722 111.164 50.273  1.00 57.43  ? 93   HIS D C   1 
ATOM   8045  O  O   . HIS D  1 93  ? -23.019 112.178 50.360  1.00 58.24  ? 93   HIS D O   1 
ATOM   8046  C  CB  . HIS D  1 93  ? -23.504 109.435 48.465  1.00 48.21  ? 93   HIS D CB  1 
ATOM   8047  C  CG  . HIS D  1 93  ? -23.307 110.533 47.472  1.00 52.17  ? 93   HIS D CG  1 
ATOM   8048  N  ND1 . HIS D  1 93  ? -24.267 111.491 47.224  1.00 52.86  ? 93   HIS D ND1 1 
ATOM   8049  C  CD2 . HIS D  1 93  ? -22.258 110.835 46.671  1.00 53.40  ? 93   HIS D CD2 1 
ATOM   8050  C  CE1 . HIS D  1 93  ? -23.824 112.327 46.303  1.00 54.92  ? 93   HIS D CE1 1 
ATOM   8051  N  NE2 . HIS D  1 93  ? -22.607 111.951 45.950  1.00 50.92  ? 93   HIS D NE2 1 
ATOM   8052  N  N   . ASP D  1 94  ? -25.038 111.189 50.502  1.00 55.94  ? 94   ASP D N   1 
ATOM   8053  C  CA  . ASP D  1 94  ? -25.732 112.438 50.794  1.00 56.02  ? 94   ASP D CA  1 
ATOM   8054  C  C   . ASP D  1 94  ? -25.299 113.052 52.117  1.00 60.47  ? 94   ASP D C   1 
ATOM   8055  O  O   . ASP D  1 94  ? -25.411 114.269 52.293  1.00 53.94  ? 94   ASP D O   1 
ATOM   8056  C  CB  . ASP D  1 94  ? -27.242 112.206 50.820  1.00 49.55  ? 94   ASP D CB  1 
ATOM   8057  C  CG  . ASP D  1 94  ? -27.797 111.837 49.457  1.00 57.11  ? 94   ASP D CG  1 
ATOM   8058  O  OD1 . ASP D  1 94  ? -27.051 111.938 48.465  1.00 53.86  ? 94   ASP D OD1 1 
ATOM   8059  O  OD2 . ASP D  1 94  ? -28.982 111.450 49.380  1.00 56.44  ? 94   ASP D OD2 1 
ATOM   8060  N  N   . ASN D  1 95  ? -24.795 112.248 53.044  1.00 62.80  ? 95   ASN D N   1 
ATOM   8061  C  CA  . ASN D  1 95  ? -24.423 112.737 54.361  1.00 56.59  ? 95   ASN D CA  1 
ATOM   8062  C  C   . ASN D  1 95  ? -22.932 112.572 54.600  1.00 52.58  ? 95   ASN D C   1 
ATOM   8063  O  O   . ASN D  1 95  ? -22.482 112.472 55.745  1.00 51.47  ? 95   ASN D O   1 
ATOM   8064  C  CB  . ASN D  1 95  ? -25.224 112.004 55.431  1.00 57.09  ? 95   ASN D CB  1 
ATOM   8065  C  CG  . ASN D  1 95  ? -26.716 112.149 55.232  1.00 60.10  ? 95   ASN D CG  1 
ATOM   8066  O  OD1 . ASN D  1 95  ? -27.398 111.199 54.853  1.00 65.15  ? 95   ASN D OD1 1 
ATOM   8067  N  ND2 . ASN D  1 95  ? -27.228 113.349 55.467  1.00 55.88  ? 95   ASN D ND2 1 
ATOM   8068  N  N   . PHE D  1 96  ? -22.162 112.559 53.510  1.00 53.81  ? 96   PHE D N   1 
ATOM   8069  C  CA  . PHE D  1 96  ? -20.747 112.215 53.585  1.00 52.77  ? 96   PHE D CA  1 
ATOM   8070  C  C   . PHE D  1 96  ? -19.972 113.216 54.438  1.00 54.69  ? 96   PHE D C   1 
ATOM   8071  O  O   . PHE D  1 96  ? -19.110 112.828 55.235  1.00 57.54  ? 96   PHE D O   1 
ATOM   8072  C  CB  . PHE D  1 96  ? -20.163 112.106 52.173  1.00 50.12  ? 96   PHE D CB  1 
ATOM   8073  C  CG  . PHE D  1 96  ? -18.750 111.613 52.150  1.00 48.39  ? 96   PHE D CG  1 
ATOM   8074  C  CD1 . PHE D  1 96  ? -18.463 110.290 52.476  1.00 44.93  ? 96   PHE D CD1 1 
ATOM   8075  C  CD2 . PHE D  1 96  ? -17.710 112.463 51.815  1.00 46.58  ? 96   PHE D CD2 1 
ATOM   8076  C  CE1 . PHE D  1 96  ? -17.152 109.821 52.469  1.00 43.42  ? 96   PHE D CE1 1 
ATOM   8077  C  CE2 . PHE D  1 96  ? -16.404 112.007 51.801  1.00 47.78  ? 96   PHE D CE2 1 
ATOM   8078  C  CZ  . PHE D  1 96  ? -16.125 110.679 52.131  1.00 49.09  ? 96   PHE D CZ  1 
ATOM   8079  N  N   . LYS D  1 97  ? -20.233 114.510 54.258  1.00 53.61  ? 97   LYS D N   1 
ATOM   8080  C  CA  . LYS D  1 97  ? -19.529 115.520 55.043  1.00 58.76  ? 97   LYS D CA  1 
ATOM   8081  C  C   . LYS D  1 97  ? -19.765 115.325 56.540  1.00 53.99  ? 97   LYS D C   1 
ATOM   8082  O  O   . LYS D  1 97  ? -18.816 115.332 57.336  1.00 51.15  ? 97   LYS D O   1 
ATOM   8083  C  CB  . LYS D  1 97  ? -19.980 116.913 54.607  1.00 66.69  ? 97   LYS D CB  1 
ATOM   8084  C  CG  . LYS D  1 97  ? -19.546 117.308 53.208  1.00 75.23  ? 97   LYS D CG  1 
ATOM   8085  C  CD  . LYS D  1 97  ? -20.539 118.289 52.590  1.00 81.48  ? 97   LYS D CD  1 
ATOM   8086  C  CE  . LYS D  1 97  ? -21.286 119.081 53.659  1.00 89.21  ? 97   LYS D CE  1 
ATOM   8087  N  NZ  . LYS D  1 97  ? -22.696 119.410 53.274  1.00 95.45  ? 97   LYS D NZ  1 
ATOM   8088  N  N   . GLU D  1 98  ? -21.030 115.124 56.936  1.00 57.08  ? 98   GLU D N   1 
ATOM   8089  C  CA  . GLU D  1 98  ? -21.396 115.040 58.352  1.00 54.89  ? 98   GLU D CA  1 
ATOM   8090  C  C   . GLU D  1 98  ? -21.001 113.700 58.972  1.00 56.20  ? 98   GLU D C   1 
ATOM   8091  O  O   . GLU D  1 98  ? -20.543 113.655 60.122  1.00 47.73  ? 98   GLU D O   1 
ATOM   8092  C  CB  . GLU D  1 98  ? -22.895 115.317 58.538  1.00 62.95  ? 98   GLU D CB  1 
ATOM   8093  C  CG  . GLU D  1 98  ? -23.783 115.057 57.322  1.00 75.51  ? 98   GLU D CG  1 
ATOM   8094  C  CD  . GLU D  1 98  ? -23.814 116.207 56.323  1.00 77.74  ? 98   GLU D CD  1 
ATOM   8095  O  OE1 . GLU D  1 98  ? -24.077 117.357 56.729  1.00 82.15  ? 98   GLU D OE1 1 
ATOM   8096  O  OE2 . GLU D  1 98  ? -23.575 115.953 55.124  1.00 80.71  ? 98   GLU D OE2 1 
ATOM   8097  N  N   . ILE D  1 99  ? -21.172 112.595 58.244  1.00 56.94  ? 99   ILE D N   1 
ATOM   8098  C  CA  . ILE D  1 99  ? -20.694 111.320 58.767  1.00 57.05  ? 99   ILE D CA  1 
ATOM   8099  C  C   . ILE D  1 99  ? -19.183 111.360 58.952  1.00 54.60  ? 99   ILE D C   1 
ATOM   8100  O  O   . ILE D  1 99  ? -18.654 110.859 59.948  1.00 54.09  ? 99   ILE D O   1 
ATOM   8101  C  CB  . ILE D  1 99  ? -21.116 110.161 57.848  1.00 56.70  ? 99   ILE D CB  1 
ATOM   8102  C  CG1 . ILE D  1 99  ? -22.625 109.938 57.945  1.00 54.09  ? 99   ILE D CG1 1 
ATOM   8103  C  CG2 . ILE D  1 99  ? -20.348 108.877 58.227  1.00 50.57  ? 99   ILE D CG2 1 
ATOM   8104  C  CD1 . ILE D  1 99  ? -23.156 108.974 56.909  1.00 59.28  ? 99   ILE D CD1 1 
ATOM   8105  N  N   . PHE D  1 100 ? -18.465 111.973 58.008  1.00 55.20  ? 100  PHE D N   1 
ATOM   8106  C  CA  . PHE D  1 100 ? -17.021 112.094 58.170  1.00 54.09  ? 100  PHE D CA  1 
ATOM   8107  C  C   . PHE D  1 100 ? -16.671 112.893 59.423  1.00 54.40  ? 100  PHE D C   1 
ATOM   8108  O  O   . PHE D  1 100 ? -15.785 112.496 60.190  1.00 48.43  ? 100  PHE D O   1 
ATOM   8109  C  CB  . PHE D  1 100 ? -16.388 112.734 56.932  1.00 51.92  ? 100  PHE D CB  1 
ATOM   8110  C  CG  . PHE D  1 100 ? -14.890 112.861 57.022  1.00 56.04  ? 100  PHE D CG  1 
ATOM   8111  C  CD1 . PHE D  1 100 ? -14.065 111.798 56.676  1.00 51.04  ? 100  PHE D CD1 1 
ATOM   8112  C  CD2 . PHE D  1 100 ? -14.304 114.028 57.488  1.00 56.77  ? 100  PHE D CD2 1 
ATOM   8113  C  CE1 . PHE D  1 100 ? -12.693 111.910 56.775  1.00 50.79  ? 100  PHE D CE1 1 
ATOM   8114  C  CE2 . PHE D  1 100 ? -12.929 114.142 57.593  1.00 55.06  ? 100  PHE D CE2 1 
ATOM   8115  C  CZ  . PHE D  1 100 ? -12.123 113.090 57.237  1.00 53.60  ? 100  PHE D CZ  1 
ATOM   8116  N  N   . GLU D  1 101 ? -17.364 114.018 59.656  1.00 51.16  ? 101  GLU D N   1 
ATOM   8117  C  CA  . GLU D  1 101 ? -17.085 114.811 60.854  1.00 47.42  ? 101  GLU D CA  1 
ATOM   8118  C  C   . GLU D  1 101 ? -17.304 113.991 62.121  1.00 49.44  ? 101  GLU D C   1 
ATOM   8119  O  O   . GLU D  1 101 ? -16.498 114.058 63.059  1.00 49.66  ? 101  GLU D O   1 
ATOM   8120  C  CB  . GLU D  1 101 ? -17.939 116.083 60.887  1.00 47.56  ? 101  GLU D CB  1 
ATOM   8121  C  CG  . GLU D  1 101 ? -17.696 116.914 62.154  1.00 56.92  ? 101  GLU D CG  1 
ATOM   8122  C  CD  . GLU D  1 101 ? -18.771 117.953 62.421  1.00 60.55  ? 101  GLU D CD  1 
ATOM   8123  O  OE1 . GLU D  1 101 ? -19.797 117.933 61.708  1.00 59.19  ? 101  GLU D OE1 1 
ATOM   8124  O  OE2 . GLU D  1 101 ? -18.597 118.771 63.357  1.00 63.61  ? 101  GLU D OE2 1 
ATOM   8125  N  N   . LEU D  1 102 ? -18.388 113.218 62.169  1.00 45.62  ? 102  LEU D N   1 
ATOM   8126  C  CA  . LEU D  1 102 ? -18.716 112.435 63.353  1.00 51.55  ? 102  LEU D CA  1 
ATOM   8127  C  C   . LEU D  1 102 ? -17.719 111.294 63.555  1.00 57.68  ? 102  LEU D C   1 
ATOM   8128  O  O   . LEU D  1 102 ? -17.277 111.055 64.677  1.00 55.93  ? 102  LEU D O   1 
ATOM   8129  C  CB  . LEU D  1 102 ? -20.138 111.884 63.254  1.00 54.49  ? 102  LEU D CB  1 
ATOM   8130  C  CG  . LEU D  1 102 ? -21.221 112.961 63.219  1.00 59.06  ? 102  LEU D CG  1 
ATOM   8131  C  CD1 . LEU D  1 102 ? -22.580 112.347 62.903  1.00 56.12  ? 102  LEU D CD1 1 
ATOM   8132  C  CD2 . LEU D  1 102 ? -21.243 113.726 64.540  1.00 46.93  ? 102  LEU D CD2 1 
HETATM 8133  N  N   . CSS D  1 103 ? -17.360 110.592 62.479  1.00 57.53  ? 103  CSS D N   1 
HETATM 8134  C  CA  . CSS D  1 103 ? -16.487 109.448 62.605  1.00 69.59  ? 103  CSS D CA  1 
HETATM 8135  C  CB  . CSS D  1 103 ? -16.600 108.535 61.422  1.00 74.22  ? 103  CSS D CB  1 
HETATM 8136  S  SG  . CSS D  1 103 ? -18.094 107.577 61.536  1.00 81.94  ? 103  CSS D SG  1 
HETATM 8137  S  SD  . CSS D  1 103 ? -18.277 106.676 63.326  0.50 79.60  ? 103  CSS D SD  1 
HETATM 8138  C  C   . CSS D  1 103 ? -15.071 109.901 62.805  1.00 72.69  ? 103  CSS D C   1 
HETATM 8139  O  O   . CSS D  1 103 ? -14.256 109.120 63.364  1.00 75.19  ? 103  CSS D O   1 
ATOM   8140  N  N   . SER D  1 104 ? -14.739 111.127 62.402  1.00 71.89  ? 104  SER D N   1 
ATOM   8141  C  CA  . SER D  1 104 ? -13.419 111.679 62.716  1.00 69.30  ? 104  SER D CA  1 
ATOM   8142  C  C   . SER D  1 104 ? -13.230 111.716 64.219  1.00 63.46  ? 104  SER D C   1 
ATOM   8143  O  O   . SER D  1 104 ? -12.136 111.462 64.721  1.00 70.41  ? 104  SER D O   1 
ATOM   8144  C  CB  . SER D  1 104 ? -13.230 113.079 62.131  1.00 70.29  ? 104  SER D CB  1 
ATOM   8145  O  OG  . SER D  1 104 ? -12.765 113.002 60.799  1.00 74.15  ? 104  SER D OG  1 
ATOM   8146  N  N   . GLY D  1 105 ? -14.305 112.030 64.941  1.00 59.46  ? 105  GLY D N   1 
ATOM   8147  C  CA  . GLY D  1 105 ? -14.257 111.906 66.387  1.00 68.00  ? 105  GLY D CA  1 
ATOM   8148  C  C   . GLY D  1 105 ? -14.105 110.466 66.847  1.00 71.67  ? 105  GLY D C   1 
ATOM   8149  O  O   . GLY D  1 105 ? -13.351 110.185 67.779  1.00 82.22  ? 105  GLY D O   1 
ATOM   8150  N  N   . CYS D  1 106 ? -14.779 109.528 66.170  1.00 66.51  ? 106  CYS D N   1 
ATOM   8151  C  CA  . CYS D  1 106 ? -14.752 108.133 66.612  1.00 72.44  ? 106  CYS D CA  1 
ATOM   8152  C  C   . CYS D  1 106 ? -13.395 107.479 66.388  1.00 76.64  ? 106  CYS D C   1 
ATOM   8153  O  O   . CYS D  1 106 ? -13.039 106.549 67.118  1.00 78.25  ? 106  CYS D O   1 
ATOM   8154  C  CB  . CYS D  1 106 ? -15.828 107.308 65.891  1.00 76.12  ? 106  CYS D CB  1 
ATOM   8155  S  SG  . CYS D  1 106 ? -17.568 107.654 66.320  1.00 82.98  ? 106  CYS D SG  1 
ATOM   8156  N  N   . LEU D  1 107 ? -12.615 107.956 65.414  1.00 74.67  ? 107  LEU D N   1 
ATOM   8157  C  CA  . LEU D  1 107 ? -11.360 107.291 65.077  1.00 68.44  ? 107  LEU D CA  1 
ATOM   8158  C  C   . LEU D  1 107 ? -10.359 107.305 66.229  1.00 59.74  ? 107  LEU D C   1 
ATOM   8159  O  O   . LEU D  1 107 ? -9.490  106.428 66.294  1.00 53.95  ? 107  LEU D O   1 
ATOM   8160  C  CB  . LEU D  1 107 ? -10.743 107.948 63.838  1.00 64.84  ? 107  LEU D CB  1 
ATOM   8161  C  CG  . LEU D  1 107 ? -11.398 107.647 62.484  1.00 63.13  ? 107  LEU D CG  1 
ATOM   8162  C  CD1 . LEU D  1 107 ? -10.675 108.350 61.343  1.00 59.93  ? 107  LEU D CD1 1 
ATOM   8163  C  CD2 . LEU D  1 107 ? -11.462 106.147 62.220  1.00 60.32  ? 107  LEU D CD2 1 
ATOM   8164  N  N   . GLY D  1 108 ? -10.488 108.244 67.162  1.00 51.41  ? 108  GLY D N   1 
ATOM   8165  C  CA  . GLY D  1 108 ? -9.603  108.274 68.311  1.00 44.57  ? 108  GLY D CA  1 
ATOM   8166  C  C   . GLY D  1 108 ? -9.729  107.089 69.248  1.00 54.81  ? 108  GLY D C   1 
ATOM   8167  O  O   . GLY D  1 108 ? -8.865  106.919 70.112  1.00 56.39  ? 108  GLY D O   1 
ATOM   8168  N  N   . MET D  1 109 ? -10.765 106.264 69.098  1.00 54.10  ? 109  MET D N   1 
ATOM   8169  C  CA  . MET D  1 109 ? -10.908 105.058 69.904  1.00 45.28  ? 109  MET D CA  1 
ATOM   8170  C  C   . MET D  1 109 ? -10.802 103.783 69.074  1.00 46.74  ? 109  MET D C   1 
ATOM   8171  O  O   . MET D  1 109 ? -10.940 102.686 69.630  1.00 41.34  ? 109  MET D O   1 
ATOM   8172  C  CB  . MET D  1 109 ? -12.238 105.064 70.673  1.00 44.44  ? 109  MET D CB  1 
ATOM   8173  C  CG  . MET D  1 109 ? -13.459 104.806 69.796  1.00 55.46  ? 109  MET D CG  1 
ATOM   8174  S  SD  . MET D  1 109 ? -15.033 104.760 70.686  1.00 69.96  ? 109  MET D SD  1 
ATOM   8175  C  CE  . MET D  1 109 ? -16.198 104.572 69.333  1.00 64.84  ? 109  MET D CE  1 
ATOM   8176  N  N   . VAL D  1 110 ? -10.553 103.893 67.769  1.00 40.44  ? 110  VAL D N   1 
ATOM   8177  C  CA  . VAL D  1 110 ? -10.546 102.744 66.872  1.00 46.36  ? 110  VAL D CA  1 
ATOM   8178  C  C   . VAL D  1 110 ? -9.154  102.107 66.829  1.00 47.60  ? 110  VAL D C   1 
ATOM   8179  O  O   . VAL D  1 110 ? -8.144  102.794 66.624  1.00 46.78  ? 110  VAL D O   1 
ATOM   8180  C  CB  . VAL D  1 110 ? -11.008 103.159 65.467  1.00 47.14  ? 110  VAL D CB  1 
ATOM   8181  C  CG1 . VAL D  1 110 ? -10.823 102.014 64.485  1.00 41.08  ? 110  VAL D CG1 1 
ATOM   8182  C  CG2 . VAL D  1 110 ? -12.446 103.623 65.509  1.00 53.59  ? 110  VAL D CG2 1 
ATOM   8183  N  N   . ILE D  1 111 ? -9.104  100.788 67.020  1.00 42.94  ? 111  ILE D N   1 
ATOM   8184  C  CA  . ILE D  1 111 ? -7.869  100.026 66.885  1.00 41.34  ? 111  ILE D CA  1 
ATOM   8185  C  C   . ILE D  1 111 ? -7.837  99.209  65.594  1.00 46.97  ? 111  ILE D C   1 
ATOM   8186  O  O   . ILE D  1 111 ? -6.757  98.980  65.037  1.00 47.41  ? 111  ILE D O   1 
ATOM   8187  C  CB  . ILE D  1 111 ? -7.670  99.118  68.122  1.00 37.78  ? 111  ILE D CB  1 
ATOM   8188  C  CG1 . ILE D  1 111 ? -7.311  99.976  69.336  1.00 34.33  ? 111  ILE D CG1 1 
ATOM   8189  C  CG2 . ILE D  1 111 ? -6.559  98.084  67.904  1.00 40.70  ? 111  ILE D CG2 1 
ATOM   8190  C  CD1 . ILE D  1 111 ? -7.413  99.271  70.661  1.00 33.25  ? 111  ILE D CD1 1 
ATOM   8191  N  N   . GLU D  1 112 ? -8.989  98.782  65.098  1.00 47.07  ? 112  GLU D N   1 
ATOM   8192  C  CA  . GLU D  1 112 ? -9.098  98.045  63.858  1.00 46.71  ? 112  GLU D CA  1 
ATOM   8193  C  C   . GLU D  1 112 ? -10.462 98.379  63.267  1.00 45.87  ? 112  GLU D C   1 
ATOM   8194  O  O   . GLU D  1 112 ? -11.412 98.670  64.000  1.00 45.67  ? 112  GLU D O   1 
ATOM   8195  C  CB  . GLU D  1 112 ? -8.925  96.544  64.107  1.00 55.60  ? 112  GLU D CB  1 
ATOM   8196  C  CG  . GLU D  1 112 ? -8.644  95.724  62.864  1.00 70.80  ? 112  GLU D CG  1 
ATOM   8197  C  CD  . GLU D  1 112 ? -8.312  94.279  63.186  1.00 78.47  ? 112  GLU D CD  1 
ATOM   8198  O  OE1 . GLU D  1 112 ? -8.257  93.930  64.388  1.00 78.21  ? 112  GLU D OE1 1 
ATOM   8199  O  OE2 . GLU D  1 112 ? -8.137  93.490  62.232  1.00 79.91  ? 112  GLU D OE2 1 
ATOM   8200  N  N   . GLY D  1 113 ? -10.539 98.391  61.937  1.00 43.83  ? 113  GLY D N   1 
ATOM   8201  C  CA  . GLY D  1 113 ? -11.755 98.749  61.252  1.00 43.19  ? 113  GLY D CA  1 
ATOM   8202  C  C   . GLY D  1 113 ? -11.790 100.234 60.938  1.00 53.28  ? 113  GLY D C   1 
ATOM   8203  O  O   . GLY D  1 113 ? -10.792 100.944 61.093  1.00 57.03  ? 113  GLY D O   1 
ATOM   8204  N  N   . PRO D  1 114 ? -12.945 100.740 60.484  1.00 49.41  ? 114  PRO D N   1 
ATOM   8205  C  CA  . PRO D  1 114 ? -14.161 99.960  60.254  1.00 50.95  ? 114  PRO D CA  1 
ATOM   8206  C  C   . PRO D  1 114 ? -14.106 99.179  58.950  1.00 52.24  ? 114  PRO D C   1 
ATOM   8207  O  O   . PRO D  1 114 ? -13.404 99.547  58.007  1.00 45.67  ? 114  PRO D O   1 
ATOM   8208  C  CB  . PRO D  1 114 ? -15.249 101.032 60.209  1.00 55.21  ? 114  PRO D CB  1 
ATOM   8209  C  CG  . PRO D  1 114 ? -14.559 102.205 59.611  1.00 47.62  ? 114  PRO D CG  1 
ATOM   8210  C  CD  . PRO D  1 114 ? -13.147 102.167 60.172  1.00 50.15  ? 114  PRO D CD  1 
ATOM   8211  N  N   . TRP D  1 115 ? -14.812 98.056  58.948  1.00 51.74  ? 115  TRP D N   1 
ATOM   8212  C  CA  . TRP D  1 115 ? -15.028 97.226  57.770  1.00 42.87  ? 115  TRP D CA  1 
ATOM   8213  C  C   . TRP D  1 115 ? -16.512 96.909  57.762  1.00 39.59  ? 115  TRP D C   1 
ATOM   8214  O  O   . TRP D  1 115 ? -17.034 96.403  58.760  1.00 50.95  ? 115  TRP D O   1 
ATOM   8215  C  CB  . TRP D  1 115 ? -14.169 95.955  57.836  1.00 37.36  ? 115  TRP D CB  1 
ATOM   8216  C  CG  . TRP D  1 115 ? -14.196 95.101  56.611  1.00 48.62  ? 115  TRP D CG  1 
ATOM   8217  C  CD1 . TRP D  1 115 ? -14.693 93.833  56.510  1.00 48.59  ? 115  TRP D CD1 1 
ATOM   8218  C  CD2 . TRP D  1 115 ? -13.692 95.439  55.307  1.00 50.06  ? 115  TRP D CD2 1 
ATOM   8219  N  NE1 . TRP D  1 115 ? -14.528 93.359  55.230  1.00 50.40  ? 115  TRP D NE1 1 
ATOM   8220  C  CE2 . TRP D  1 115 ? -13.921 94.324  54.470  1.00 50.26  ? 115  TRP D CE2 1 
ATOM   8221  C  CE3 . TRP D  1 115 ? -13.066 96.573  54.769  1.00 51.00  ? 115  TRP D CE3 1 
ATOM   8222  C  CZ2 . TRP D  1 115 ? -13.553 94.311  53.123  1.00 44.31  ? 115  TRP D CZ2 1 
ATOM   8223  C  CZ3 . TRP D  1 115 ? -12.698 96.561  53.429  1.00 48.43  ? 115  TRP D CZ3 1 
ATOM   8224  C  CH2 . TRP D  1 115 ? -12.941 95.434  52.623  1.00 45.62  ? 115  TRP D CH2 1 
ATOM   8225  N  N   . GLU D  1 116 ? -17.202 97.237  56.670  1.00 43.26  ? 116  GLU D N   1 
ATOM   8226  C  CA  . GLU D  1 116 ? -18.660 97.176  56.633  1.00 46.32  ? 116  GLU D CA  1 
ATOM   8227  C  C   . GLU D  1 116 ? -19.121 96.263  55.503  1.00 47.22  ? 116  GLU D C   1 
ATOM   8228  O  O   . GLU D  1 116 ? -19.449 96.734  54.402  1.00 46.38  ? 116  GLU D O   1 
ATOM   8229  C  CB  . GLU D  1 116 ? -19.263 98.576  56.503  1.00 44.72  ? 116  GLU D CB  1 
ATOM   8230  C  CG  . GLU D  1 116 ? -20.756 98.607  56.787  1.00 47.85  ? 116  GLU D CG  1 
ATOM   8231  C  CD  . GLU D  1 116 ? -21.359 100.002 56.709  1.00 55.69  ? 116  GLU D CD  1 
ATOM   8232  O  OE1 . GLU D  1 116 ? -20.951 100.796 55.841  1.00 58.06  ? 116  GLU D OE1 1 
ATOM   8233  O  OE2 . GLU D  1 116 ? -22.261 100.299 57.518  1.00 59.07  ? 116  GLU D OE2 1 
ATOM   8234  N  N   . PRO D  1 117 ? -19.188 94.956  55.744  1.00 43.85  ? 117  PRO D N   1 
ATOM   8235  C  CA  . PRO D  1 117 ? -19.731 94.053  54.728  1.00 45.50  ? 117  PRO D CA  1 
ATOM   8236  C  C   . PRO D  1 117 ? -21.248 94.124  54.690  1.00 45.11  ? 117  PRO D C   1 
ATOM   8237  O  O   . PRO D  1 117 ? -21.905 94.417  55.691  1.00 49.77  ? 117  PRO D O   1 
ATOM   8238  C  CB  . PRO D  1 117 ? -19.260 92.663  55.189  1.00 46.64  ? 117  PRO D CB  1 
ATOM   8239  C  CG  . PRO D  1 117 ? -18.278 92.911  56.330  1.00 43.50  ? 117  PRO D CG  1 
ATOM   8240  C  CD  . PRO D  1 117 ? -18.674 94.225  56.917  1.00 41.43  ? 117  PRO D CD  1 
ATOM   8241  N  N   . TYR D  1 118 ? -21.798 93.790  53.525  1.00 36.40  ? 118  TYR D N   1 
ATOM   8242  C  CA  . TYR D  1 118 ? -23.238 93.683  53.318  1.00 40.85  ? 118  TYR D CA  1 
ATOM   8243  C  C   . TYR D  1 118 ? -23.683 92.233  53.464  1.00 47.82  ? 118  TYR D C   1 
ATOM   8244  O  O   . TYR D  1 118 ? -23.045 91.319  52.928  1.00 46.64  ? 118  TYR D O   1 
ATOM   8245  C  CB  . TYR D  1 118 ? -23.641 94.178  51.928  1.00 39.77  ? 118  TYR D CB  1 
ATOM   8246  C  CG  . TYR D  1 118 ? -23.640 95.673  51.709  1.00 43.36  ? 118  TYR D CG  1 
ATOM   8247  C  CD1 . TYR D  1 118 ? -24.648 96.474  52.243  1.00 43.82  ? 118  TYR D CD1 1 
ATOM   8248  C  CD2 . TYR D  1 118 ? -22.682 96.274  50.895  1.00 48.60  ? 118  TYR D CD2 1 
ATOM   8249  C  CE1 . TYR D  1 118 ? -24.675 97.848  52.016  1.00 47.04  ? 118  TYR D CE1 1 
ATOM   8250  C  CE2 . TYR D  1 118 ? -22.700 97.644  50.655  1.00 53.62  ? 118  TYR D CE2 1 
ATOM   8251  C  CZ  . TYR D  1 118 ? -23.701 98.426  51.217  1.00 56.50  ? 118  TYR D CZ  1 
ATOM   8252  O  OH  . TYR D  1 118 ? -23.726 99.783  50.989  1.00 55.30  ? 118  TYR D OH  1 
ATOM   8253  N  N   . PHE D  1 119 ? -24.807 92.028  54.148  1.00 43.75  ? 119  PHE D N   1 
ATOM   8254  C  CA  . PHE D  1 119 ? -25.289 90.684  54.422  1.00 43.94  ? 119  PHE D CA  1 
ATOM   8255  C  C   . PHE D  1 119 ? -26.719 90.514  53.946  1.00 48.86  ? 119  PHE D C   1 
ATOM   8256  O  O   . PHE D  1 119 ? -27.566 91.390  54.143  1.00 47.38  ? 119  PHE D O   1 
ATOM   8257  C  CB  . PHE D  1 119 ? -25.201 90.362  55.909  1.00 40.18  ? 119  PHE D CB  1 
ATOM   8258  C  CG  . PHE D  1 119 ? -23.799 90.256  56.400  1.00 47.46  ? 119  PHE D CG  1 
ATOM   8259  C  CD1 . PHE D  1 119 ? -23.099 91.397  56.762  1.00 45.72  ? 119  PHE D CD1 1 
ATOM   8260  C  CD2 . PHE D  1 119 ? -23.158 89.027  56.455  1.00 41.24  ? 119  PHE D CD2 1 
ATOM   8261  C  CE1 . PHE D  1 119 ? -21.788 91.314  57.195  1.00 45.95  ? 119  PHE D CE1 1 
ATOM   8262  C  CE2 . PHE D  1 119 ? -21.847 88.932  56.894  1.00 42.42  ? 119  PHE D CE2 1 
ATOM   8263  C  CZ  . PHE D  1 119 ? -21.159 90.079  57.268  1.00 45.81  ? 119  PHE D CZ  1 
ATOM   8264  N  N   . GLU D  1 120 ? -26.968 89.370  53.319  1.00 37.18  ? 120  GLU D N   1 
ATOM   8265  C  CA  . GLU D  1 120 ? -28.305 88.923  52.992  1.00 46.27  ? 120  GLU D CA  1 
ATOM   8266  C  C   . GLU D  1 120 ? -28.836 88.048  54.120  1.00 44.87  ? 120  GLU D C   1 
ATOM   8267  O  O   . GLU D  1 120 ? -28.111 87.218  54.672  1.00 48.66  ? 120  GLU D O   1 
ATOM   8268  C  CB  . GLU D  1 120 ? -28.272 88.154  51.673  1.00 48.66  ? 120  GLU D CB  1 
ATOM   8269  C  CG  . GLU D  1 120 ? -29.502 87.373  51.358  1.00 61.63  ? 120  GLU D CG  1 
ATOM   8270  C  CD  . GLU D  1 120 ? -29.279 86.429  50.194  1.00 68.41  ? 120  GLU D CD  1 
ATOM   8271  O  OE1 . GLU D  1 120 ? -30.193 85.622  49.920  1.00 68.56  ? 120  GLU D OE1 1 
ATOM   8272  O  OE2 . GLU D  1 120 ? -28.191 86.497  49.564  1.00 62.53  ? 120  GLU D OE2 1 
ATOM   8273  N  N   . VAL D  1 121 ? -30.099 88.259  54.483  1.00 47.14  ? 121  VAL D N   1 
ATOM   8274  C  CA  . VAL D  1 121 ? -30.756 87.438  55.500  1.00 53.53  ? 121  VAL D CA  1 
ATOM   8275  C  C   . VAL D  1 121 ? -31.263 86.181  54.801  1.00 47.42  ? 121  VAL D C   1 
ATOM   8276  O  O   . VAL D  1 121 ? -32.309 86.193  54.161  1.00 47.72  ? 121  VAL D O   1 
ATOM   8277  C  CB  . VAL D  1 121 ? -31.887 88.195  56.205  1.00 52.77  ? 121  VAL D CB  1 
ATOM   8278  C  CG1 . VAL D  1 121 ? -32.583 87.295  57.224  1.00 52.14  ? 121  VAL D CG1 1 
ATOM   8279  C  CG2 . VAL D  1 121 ? -31.330 89.426  56.895  1.00 50.22  ? 121  VAL D CG2 1 
ATOM   8280  N  N   . VAL D  1 122 ? -30.514 85.090  54.913  1.00 49.61  ? 122  VAL D N   1 
ATOM   8281  C  CA  . VAL D  1 122 ? -30.895 83.879  54.202  1.00 52.72  ? 122  VAL D CA  1 
ATOM   8282  C  C   . VAL D  1 122 ? -32.162 83.298  54.802  1.00 46.33  ? 122  VAL D C   1 
ATOM   8283  O  O   . VAL D  1 122 ? -33.065 82.863  54.082  1.00 50.69  ? 122  VAL D O   1 
ATOM   8284  C  CB  . VAL D  1 122 ? -29.738 82.863  54.210  1.00 56.69  ? 122  VAL D CB  1 
ATOM   8285  C  CG1 . VAL D  1 122 ? -30.187 81.558  53.578  1.00 52.89  ? 122  VAL D CG1 1 
ATOM   8286  C  CG2 . VAL D  1 122 ? -28.530 83.432  53.482  1.00 61.85  ? 122  VAL D CG2 1 
ATOM   8287  N  N   . LYS D  1 123 ? -32.235 83.253  56.126  1.00 43.68  ? 123  LYS D N   1 
ATOM   8288  C  CA  . LYS D  1 123 ? -33.398 82.753  56.840  1.00 42.75  ? 123  LYS D CA  1 
ATOM   8289  C  C   . LYS D  1 123 ? -33.331 83.313  58.249  1.00 45.70  ? 123  LYS D C   1 
ATOM   8290  O  O   . LYS D  1 123 ? -32.248 83.623  58.748  1.00 42.28  ? 123  LYS D O   1 
ATOM   8291  C  CB  . LYS D  1 123 ? -33.443 81.219  56.864  1.00 49.02  ? 123  LYS D CB  1 
ATOM   8292  C  CG  . LYS D  1 123 ? -34.839 80.665  57.042  1.00 67.19  ? 123  LYS D CG  1 
ATOM   8293  C  CD  . LYS D  1 123 ? -35.132 79.434  56.196  1.00 72.61  ? 123  LYS D CD  1 
ATOM   8294  C  CE  . LYS D  1 123 ? -36.585 79.019  56.407  1.00 78.78  ? 123  LYS D CE  1 
ATOM   8295  N  NZ  . LYS D  1 123 ? -36.891 78.851  57.870  1.00 81.74  ? 123  LYS D NZ  1 
ATOM   8296  N  N   . SER D  1 124 ? -34.492 83.433  58.891  1.00 48.83  ? 124  SER D N   1 
ATOM   8297  C  CA  . SER D  1 124 ? -34.532 84.029  60.214  1.00 47.96  ? 124  SER D CA  1 
ATOM   8298  C  C   . SER D  1 124 ? -35.730 83.509  60.987  1.00 44.86  ? 124  SER D C   1 
ATOM   8299  O  O   . SER D  1 124 ? -36.738 83.099  60.412  1.00 47.17  ? 124  SER D O   1 
ATOM   8300  C  CB  . SER D  1 124 ? -34.602 85.557  60.141  1.00 44.11  ? 124  SER D CB  1 
ATOM   8301  O  OG  . SER D  1 124 ? -35.895 85.989  59.755  1.00 49.57  ? 124  SER D OG  1 
ATOM   8302  N  N   . ASP D  1 125 ? -35.595 83.531  62.303  1.00 41.88  ? 125  ASP D N   1 
ATOM   8303  C  CA  . ASP D  1 125 ? -36.704 83.354  63.232  1.00 45.38  ? 125  ASP D CA  1 
ATOM   8304  C  C   . ASP D  1 125 ? -36.372 84.294  64.399  1.00 44.15  ? 125  ASP D C   1 
ATOM   8305  O  O   . ASP D  1 125 ? -35.873 83.871  65.443  1.00 43.53  ? 125  ASP D O   1 
ATOM   8306  C  CB  . ASP D  1 125 ? -36.862 81.892  63.657  1.00 44.78  ? 125  ASP D CB  1 
ATOM   8307  C  CG  . ASP D  1 125 ? -38.075 81.660  64.550  1.00 50.75  ? 125  ASP D CG  1 
ATOM   8308  O  OD1 . ASP D  1 125 ? -38.794 82.627  64.860  1.00 50.56  ? 125  ASP D OD1 1 
ATOM   8309  O  OD2 . ASP D  1 125 ? -38.314 80.498  64.934  1.00 55.40  ? 125  ASP D OD2 1 
ATOM   8310  N  N   . LEU D  1 126 ? -36.600 85.591  64.186  1.00 43.18  ? 126  LEU D N   1 
ATOM   8311  C  CA  . LEU D  1 126 ? -36.231 86.639  65.134  1.00 52.42  ? 126  LEU D CA  1 
ATOM   8312  C  C   . LEU D  1 126 ? -37.487 87.358  65.608  1.00 50.88  ? 126  LEU D C   1 
ATOM   8313  O  O   . LEU D  1 126 ? -38.189 87.957  64.777  1.00 50.14  ? 126  LEU D O   1 
ATOM   8314  C  CB  . LEU D  1 126 ? -35.278 87.640  64.481  1.00 63.50  ? 126  LEU D CB  1 
ATOM   8315  C  CG  . LEU D  1 126 ? -33.753 87.575  64.549  1.00 58.63  ? 126  LEU D CG  1 
ATOM   8316  C  CD1 . LEU D  1 126 ? -33.246 88.894  63.984  1.00 58.85  ? 126  LEU D CD1 1 
ATOM   8317  C  CD2 . LEU D  1 126 ? -33.211 87.353  65.953  1.00 45.53  ? 126  LEU D CD2 1 
ATOM   8318  N  N   . PRO D  1 127 ? -37.805 87.363  66.899  1.00 43.39  ? 127  PRO D N   1 
ATOM   8319  C  CA  . PRO D  1 127 ? -38.982 88.101  67.374  1.00 42.86  ? 127  PRO D CA  1 
ATOM   8320  C  C   . PRO D  1 127 ? -38.748 89.602  67.488  1.00 41.98  ? 127  PRO D C   1 
ATOM   8321  O  O   . PRO D  1 127 ? -37.619 90.095  67.560  1.00 42.22  ? 127  PRO D O   1 
ATOM   8322  C  CB  . PRO D  1 127 ? -39.257 87.490  68.754  1.00 41.23  ? 127  PRO D CB  1 
ATOM   8323  C  CG  . PRO D  1 127 ? -37.984 86.846  69.167  1.00 38.47  ? 127  PRO D CG  1 
ATOM   8324  C  CD  . PRO D  1 127 ? -37.087 86.685  67.989  1.00 39.00  ? 127  PRO D CD  1 
ATOM   8325  N  N   . GLN D  1 128 ? -39.865 90.326  67.529  1.00 39.31  ? 128  GLN D N   1 
ATOM   8326  C  CA  . GLN D  1 128 ? -39.834 91.743  67.868  1.00 46.82  ? 128  GLN D CA  1 
ATOM   8327  C  C   . GLN D  1 128 ? -39.321 91.937  69.289  1.00 43.75  ? 128  GLN D C   1 
ATOM   8328  O  O   . GLN D  1 128 ? -39.611 91.139  70.178  1.00 47.47  ? 128  GLN D O   1 
ATOM   8329  C  CB  . GLN D  1 128 ? -41.236 92.323  67.739  1.00 49.24  ? 128  GLN D CB  1 
ATOM   8330  C  CG  . GLN D  1 128 ? -41.758 92.220  66.321  1.00 72.16  ? 128  GLN D CG  1 
ATOM   8331  C  CD  . GLN D  1 128 ? -43.160 92.766  66.186  1.00 95.54  ? 128  GLN D CD  1 
ATOM   8332  O  OE1 . GLN D  1 128 ? -43.726 93.275  67.157  1.00 105.42 ? 128  GLN D OE1 1 
ATOM   8333  N  NE2 . GLN D  1 128 ? -43.734 92.657  64.986  1.00 101.94 ? 128  GLN D NE2 1 
ATOM   8334  N  N   . ILE D  1 129 ? -38.572 93.007  69.513  1.00 42.54  ? 129  ILE D N   1 
ATOM   8335  C  CA  . ILE D  1 129 ? -38.109 93.289  70.868  1.00 46.61  ? 129  ILE D CA  1 
ATOM   8336  C  C   . ILE D  1 129 ? -39.201 94.013  71.651  1.00 46.07  ? 129  ILE D C   1 
ATOM   8337  O  O   . ILE D  1 129 ? -40.049 94.734  71.098  1.00 46.19  ? 129  ILE D O   1 
ATOM   8338  C  CB  . ILE D  1 129 ? -36.796 94.096  70.879  1.00 45.28  ? 129  ILE D CB  1 
ATOM   8339  C  CG1 . ILE D  1 129 ? -36.981 95.456  70.208  1.00 45.86  ? 129  ILE D CG1 1 
ATOM   8340  C  CG2 . ILE D  1 129 ? -35.675 93.294  70.207  1.00 39.83  ? 129  ILE D CG2 1 
ATOM   8341  C  CD1 . ILE D  1 129 ? -35.750 96.334  70.321  1.00 44.21  ? 129  ILE D CD1 1 
ATOM   8342  N  N   . MET D  1 130 ? -39.167 93.819  72.962  1.00 41.00  ? 130  MET D N   1 
ATOM   8343  C  CA  . MET D  1 130 ? -40.165 94.348  73.878  1.00 43.55  ? 130  MET D CA  1 
ATOM   8344  C  C   . MET D  1 130 ? -39.531 94.449  75.256  1.00 44.44  ? 130  MET D C   1 
ATOM   8345  O  O   . MET D  1 130 ? -38.354 94.122  75.449  1.00 39.27  ? 130  MET D O   1 
ATOM   8346  C  CB  . MET D  1 130 ? -41.405 93.460  73.920  1.00 41.43  ? 130  MET D CB  1 
ATOM   8347  C  CG  . MET D  1 130 ? -41.081 92.039  74.381  1.00 47.46  ? 130  MET D CG  1 
ATOM   8348  S  SD  . MET D  1 130 ? -42.520 90.960  74.351  1.00 52.98  ? 130  MET D SD  1 
ATOM   8349  C  CE  . MET D  1 130 ? -42.655 90.601  72.611  1.00 60.00  ? 130  MET D CE  1 
ATOM   8350  N  N   . SER D  1 131 ? -40.324 94.909  76.216  1.00 34.93  ? 131  SER D N   1 
ATOM   8351  C  CA  . SER D  1 131 ? -39.921 94.988  77.609  1.00 36.54  ? 131  SER D CA  1 
ATOM   8352  C  C   . SER D  1 131 ? -40.870 94.161  78.471  1.00 35.91  ? 131  SER D C   1 
ATOM   8353  O  O   . SER D  1 131 ? -41.926 93.711  78.013  1.00 39.31  ? 131  SER D O   1 
ATOM   8354  C  CB  . SER D  1 131 ? -39.897 96.444  78.091  1.00 38.43  ? 131  SER D CB  1 
ATOM   8355  O  OG  . SER D  1 131 ? -41.208 96.892  78.374  1.00 43.81  ? 131  SER D OG  1 
ATOM   8356  N  N   . MET D  1 132 ? -40.483 93.987  79.744  1.00 36.40  ? 132  MET D N   1 
ATOM   8357  C  CA  . MET D  1 132 ? -41.284 93.207  80.687  1.00 31.59  ? 132  MET D CA  1 
ATOM   8358  C  C   . MET D  1 132 ? -42.728 93.686  80.753  1.00 38.46  ? 132  MET D C   1 
ATOM   8359  O  O   . MET D  1 132 ? -43.659 92.873  80.771  1.00 34.37  ? 132  MET D O   1 
ATOM   8360  C  CB  . MET D  1 132 ? -40.670 93.271  82.085  1.00 38.15  ? 132  MET D CB  1 
ATOM   8361  C  CG  . MET D  1 132 ? -39.383 92.489  82.257  1.00 68.30  ? 132  MET D CG  1 
ATOM   8362  S  SD  . MET D  1 132 ? -39.619 90.686  82.260  1.00 87.62  ? 132  MET D SD  1 
ATOM   8363  C  CE  . MET D  1 132 ? -38.100 90.154  83.068  1.00 88.67  ? 132  MET D CE  1 
ATOM   8364  N  N   . THR D  1 133 ? -42.931 95.004  80.860  1.00 37.42  ? 133  THR D N   1 
ATOM   8365  C  CA  . THR D  1 133 ? -44.281 95.547  81.017  1.00 38.12  ? 133  THR D CA  1 
ATOM   8366  C  C   . THR D  1 133 ? -45.119 95.437  79.742  1.00 36.98  ? 133  THR D C   1 
ATOM   8367  O  O   . THR D  1 133 ? -46.331 95.675  79.792  1.00 38.92  ? 133  THR D O   1 
ATOM   8368  C  CB  . THR D  1 133 ? -44.208 97.011  81.503  1.00 42.00  ? 133  THR D CB  1 
ATOM   8369  O  OG1 . THR D  1 133 ? -43.344 97.788  80.662  1.00 37.16  ? 133  THR D OG1 1 
ATOM   8370  C  CG2 . THR D  1 133 ? -43.715 97.101  82.935  1.00 33.14  ? 133  THR D CG2 1 
ATOM   8371  N  N   . ASP D  1 134 ? -44.509 95.067  78.613  1.00 33.78  ? 134  ASP D N   1 
ATOM   8372  C  CA  . ASP D  1 134 ? -45.223 94.800  77.372  1.00 39.85  ? 134  ASP D CA  1 
ATOM   8373  C  C   . ASP D  1 134 ? -45.742 93.367  77.281  1.00 39.92  ? 134  ASP D C   1 
ATOM   8374  O  O   . ASP D  1 134 ? -46.610 93.081  76.447  1.00 43.69  ? 134  ASP D O   1 
ATOM   8375  C  CB  . ASP D  1 134 ? -44.315 95.048  76.155  1.00 39.80  ? 134  ASP D CB  1 
ATOM   8376  C  CG  . ASP D  1 134 ? -43.785 96.478  76.067  1.00 45.47  ? 134  ASP D CG  1 
ATOM   8377  O  OD1 . ASP D  1 134 ? -44.476 97.417  76.509  1.00 47.45  ? 134  ASP D OD1 1 
ATOM   8378  O  OD2 . ASP D  1 134 ? -42.696 96.673  75.482  1.00 41.36  ? 134  ASP D OD2 1 
ATOM   8379  N  N   . VAL D  1 135 ? -45.221 92.464  78.100  1.00 39.93  ? 135  VAL D N   1 
ATOM   8380  C  CA  . VAL D  1 135 ? -45.429 91.030  77.904  1.00 45.00  ? 135  VAL D CA  1 
ATOM   8381  C  C   . VAL D  1 135 ? -46.879 90.619  78.132  1.00 41.47  ? 135  VAL D C   1 
ATOM   8382  O  O   . VAL D  1 135 ? -47.420 89.874  77.307  1.00 39.01  ? 135  VAL D O   1 
ATOM   8383  C  CB  . VAL D  1 135 ? -44.448 90.231  78.772  1.00 41.95  ? 135  VAL D CB  1 
ATOM   8384  C  CG1 . VAL D  1 135 ? -44.807 88.755  78.768  1.00 43.42  ? 135  VAL D CG1 1 
ATOM   8385  C  CG2 . VAL D  1 135 ? -43.047 90.439  78.220  1.00 34.74  ? 135  VAL D CG2 1 
ATOM   8386  N  N   . PRO D  1 136 ? -47.557 91.067  79.200  1.00 40.48  ? 136  PRO D N   1 
ATOM   8387  C  CA  . PRO D  1 136 ? -48.980 90.698  79.339  1.00 42.81  ? 136  PRO D CA  1 
ATOM   8388  C  C   . PRO D  1 136 ? -49.813 91.076  78.131  1.00 46.73  ? 136  PRO D C   1 
ATOM   8389  O  O   . PRO D  1 136 ? -50.644 90.280  77.684  1.00 47.31  ? 136  PRO D O   1 
ATOM   8390  C  CB  . PRO D  1 136 ? -49.413 91.462  80.596  1.00 39.16  ? 136  PRO D CB  1 
ATOM   8391  C  CG  . PRO D  1 136 ? -48.143 91.536  81.416  1.00 39.29  ? 136  PRO D CG  1 
ATOM   8392  C  CD  . PRO D  1 136 ? -47.060 91.770  80.405  1.00 37.27  ? 136  PRO D CD  1 
ATOM   8393  N  N   . GLN D  1 137 ? -49.592 92.259  77.564  1.00 45.79  ? 137  GLN D N   1 
ATOM   8394  C  CA  . GLN D  1 137 ? -50.358 92.649  76.393  1.00 42.33  ? 137  GLN D CA  1 
ATOM   8395  C  C   . GLN D  1 137 ? -49.958 91.835  75.172  1.00 48.00  ? 137  GLN D C   1 
ATOM   8396  O  O   . GLN D  1 137 ? -50.822 91.404  74.398  1.00 48.90  ? 137  GLN D O   1 
ATOM   8397  C  CB  . GLN D  1 137 ? -50.181 94.141  76.125  1.00 48.21  ? 137  GLN D CB  1 
ATOM   8398  C  CG  . GLN D  1 137 ? -50.707 94.587  74.767  1.00 48.49  ? 137  GLN D CG  1 
ATOM   8399  C  CD  . GLN D  1 137 ? -50.765 96.096  74.662  1.00 53.26  ? 137  GLN D CD  1 
ATOM   8400  O  OE1 . GLN D  1 137 ? -49.972 96.704  73.942  1.00 55.39  ? 137  GLN D OE1 1 
ATOM   8401  N  NE2 . GLN D  1 137 ? -51.713 96.711  75.374  1.00 43.43  ? 137  GLN D NE2 1 
ATOM   8402  N  N   . VAL D  1 138 ? -48.661 91.578  74.993  1.00 40.93  ? 138  VAL D N   1 
ATOM   8403  C  CA  . VAL D  1 138 ? -48.256 90.737  73.874  1.00 42.91  ? 138  VAL D CA  1 
ATOM   8404  C  C   . VAL D  1 138 ? -48.916 89.370  73.989  1.00 43.58  ? 138  VAL D C   1 
ATOM   8405  O  O   . VAL D  1 138 ? -49.450 88.833  73.012  1.00 51.16  ? 138  VAL D O   1 
ATOM   8406  C  CB  . VAL D  1 138 ? -46.719 90.640  73.816  1.00 49.72  ? 138  VAL D CB  1 
ATOM   8407  C  CG1 . VAL D  1 138 ? -46.282 89.555  72.848  1.00 49.35  ? 138  VAL D CG1 1 
ATOM   8408  C  CG2 . VAL D  1 138 ? -46.153 91.976  73.401  1.00 41.05  ? 138  VAL D CG2 1 
ATOM   8409  N  N   . LEU D  1 139 ? -48.951 88.823  75.205  1.00 46.15  ? 139  LEU D N   1 
ATOM   8410  C  CA  . LEU D  1 139 ? -49.629 87.557  75.464  1.00 50.36  ? 139  LEU D CA  1 
ATOM   8411  C  C   . LEU D  1 139 ? -51.115 87.641  75.132  1.00 51.09  ? 139  LEU D C   1 
ATOM   8412  O  O   . LEU D  1 139 ? -51.660 86.779  74.430  1.00 52.42  ? 139  LEU D O   1 
ATOM   8413  C  CB  . LEU D  1 139 ? -49.430 87.184  76.933  1.00 55.51  ? 139  LEU D CB  1 
ATOM   8414  C  CG  . LEU D  1 139 ? -49.844 85.816  77.449  1.00 67.22  ? 139  LEU D CG  1 
ATOM   8415  C  CD1 . LEU D  1 139 ? -49.078 84.717  76.753  1.00 68.65  ? 139  LEU D CD1 1 
ATOM   8416  C  CD2 . LEU D  1 139 ? -49.592 85.771  78.933  1.00 71.47  ? 139  LEU D CD2 1 
ATOM   8417  N  N   . GLY D  1 140 ? -51.791 88.671  75.642  1.00 45.25  ? 140  GLY D N   1 
ATOM   8418  C  CA  . GLY D  1 140 ? -53.211 88.822  75.370  1.00 47.27  ? 140  GLY D CA  1 
ATOM   8419  C  C   . GLY D  1 140 ? -53.511 88.992  73.893  1.00 57.02  ? 140  GLY D C   1 
ATOM   8420  O  O   . GLY D  1 140 ? -54.475 88.417  73.374  1.00 58.34  ? 140  GLY D O   1 
ATOM   8421  N  N   . ASP D  1 141 ? -52.694 89.788  73.197  1.00 50.87  ? 141  ASP D N   1 
ATOM   8422  C  CA  . ASP D  1 141 ? -52.906 90.000  71.771  1.00 58.69  ? 141  ASP D CA  1 
ATOM   8423  C  C   . ASP D  1 141 ? -52.693 88.719  70.978  1.00 66.14  ? 141  ASP D C   1 
ATOM   8424  O  O   . ASP D  1 141 ? -53.428 88.449  70.018  1.00 67.03  ? 141  ASP D O   1 
ATOM   8425  C  CB  . ASP D  1 141 ? -51.970 91.086  71.261  1.00 57.67  ? 141  ASP D CB  1 
ATOM   8426  C  CG  . ASP D  1 141 ? -52.329 92.444  71.791  1.00 59.21  ? 141  ASP D CG  1 
ATOM   8427  O  OD1 . ASP D  1 141 ? -53.366 92.563  72.485  1.00 54.53  ? 141  ASP D OD1 1 
ATOM   8428  O  OD2 . ASP D  1 141 ? -51.565 93.391  71.523  1.00 62.44  ? 141  ASP D OD2 1 
ATOM   8429  N  N   . SER D  1 142 ? -51.707 87.909  71.379  1.00 61.44  ? 142  SER D N   1 
ATOM   8430  C  CA  . SER D  1 142 ? -51.464 86.654  70.680  1.00 57.06  ? 142  SER D CA  1 
ATOM   8431  C  C   . SER D  1 142 ? -52.686 85.748  70.757  1.00 61.15  ? 142  SER D C   1 
ATOM   8432  O  O   . SER D  1 142 ? -53.107 85.180  69.743  1.00 58.20  ? 142  SER D O   1 
ATOM   8433  C  CB  . SER D  1 142 ? -50.233 85.958  71.262  1.00 55.29  ? 142  SER D CB  1 
ATOM   8434  O  OG  . SER D  1 142 ? -49.044 86.664  70.937  1.00 58.25  ? 142  SER D OG  1 
ATOM   8435  N  N   . PHE D  1 143 ? -53.293 85.633  71.944  1.00 59.18  ? 143  PHE D N   1 
ATOM   8436  C  CA  . PHE D  1 143 ? -54.500 84.826  72.069  1.00 67.52  ? 143  PHE D CA  1 
ATOM   8437  C  C   . PHE D  1 143 ? -55.610 85.401  71.208  1.00 75.32  ? 143  PHE D C   1 
ATOM   8438  O  O   . PHE D  1 143 ? -56.341 84.658  70.546  1.00 80.56  ? 143  PHE D O   1 
ATOM   8439  C  CB  . PHE D  1 143 ? -54.955 84.747  73.523  1.00 73.15  ? 143  PHE D CB  1 
ATOM   8440  C  CG  . PHE D  1 143 ? -54.054 83.938  74.389  1.00 91.00  ? 143  PHE D CG  1 
ATOM   8441  C  CD1 . PHE D  1 143 ? -53.096 83.113  73.835  1.00 102.09 ? 143  PHE D CD1 1 
ATOM   8442  C  CD2 . PHE D  1 143 ? -54.163 83.994  75.761  1.00 96.64  ? 143  PHE D CD2 1 
ATOM   8443  C  CE1 . PHE D  1 143 ? -52.254 82.369  74.640  1.00 100.38 ? 143  PHE D CE1 1 
ATOM   8444  C  CE2 . PHE D  1 143 ? -53.324 83.255  76.572  1.00 97.60  ? 143  PHE D CE2 1 
ATOM   8445  C  CZ  . PHE D  1 143 ? -52.368 82.443  76.007  1.00 95.77  ? 143  PHE D CZ  1 
ATOM   8446  N  N   . ALA D  1 144 ? -55.746 86.729  71.208  1.00 76.76  ? 144  ALA D N   1 
ATOM   8447  C  CA  . ALA D  1 144 ? -56.762 87.378  70.389  1.00 75.26  ? 144  ALA D CA  1 
ATOM   8448  C  C   . ALA D  1 144 ? -56.575 87.049  68.910  1.00 79.81  ? 144  ALA D C   1 
ATOM   8449  O  O   . ALA D  1 144 ? -57.523 86.641  68.230  1.00 86.83  ? 144  ALA D O   1 
ATOM   8450  C  CB  . ALA D  1 144 ? -56.718 88.889  70.619  1.00 61.74  ? 144  ALA D CB  1 
ATOM   8451  N  N   . LYS D  1 145 ? -55.353 87.201  68.400  1.00 82.16  ? 145  LYS D N   1 
ATOM   8452  C  CA  . LYS D  1 145 ? -55.044 86.948  66.997  1.00 76.60  ? 145  LYS D CA  1 
ATOM   8453  C  C   . LYS D  1 145 ? -54.826 85.468  66.691  1.00 78.59  ? 145  LYS D C   1 
ATOM   8454  O  O   . LYS D  1 145 ? -54.449 85.137  65.560  1.00 73.45  ? 145  LYS D O   1 
ATOM   8455  C  CB  . LYS D  1 145 ? -53.813 87.768  66.580  1.00 77.22  ? 145  LYS D CB  1 
ATOM   8456  C  CG  . LYS D  1 145 ? -54.098 89.262  66.376  1.00 78.22  ? 145  LYS D CG  1 
ATOM   8457  C  CD  . LYS D  1 145 ? -52.984 90.166  66.921  1.00 83.45  ? 145  LYS D CD  1 
ATOM   8458  C  CE  . LYS D  1 145 ? -51.680 90.046  66.141  1.00 86.65  ? 145  LYS D CE  1 
ATOM   8459  N  NZ  . LYS D  1 145 ? -50.554 90.807  66.783  1.00 89.79  ? 145  LYS D NZ  1 
ATOM   8460  N  N   . GLN D  1 146 ? -55.071 84.578  67.658  1.00 85.92  ? 146  GLN D N   1 
ATOM   8461  C  CA  . GLN D  1 146 ? -54.874 83.134  67.494  1.00 95.64  ? 146  GLN D CA  1 
ATOM   8462  C  C   . GLN D  1 146 ? -53.446 82.804  67.058  1.00 89.74  ? 146  GLN D C   1 
ATOM   8463  O  O   . GLN D  1 146 ? -53.206 81.798  66.383  1.00 90.05  ? 146  GLN D O   1 
ATOM   8464  C  CB  . GLN D  1 146 ? -55.882 82.542  66.501  1.00 111.74 ? 146  GLN D CB  1 
ATOM   8465  C  CG  . GLN D  1 146 ? -57.347 82.774  66.867  1.00 126.55 ? 146  GLN D CG  1 
ATOM   8466  C  CD  . GLN D  1 146 ? -57.802 81.945  68.052  1.00 134.62 ? 146  GLN D CD  1 
ATOM   8467  O  OE1 . GLN D  1 146 ? -57.412 80.786  68.201  1.00 138.66 ? 146  GLN D OE1 1 
ATOM   8468  N  NE2 . GLN D  1 146 ? -58.640 82.534  68.900  1.00 134.33 ? 146  GLN D NE2 1 
ATOM   8469  N  N   . GLU D  1 147 ? -52.486 83.636  67.447  1.00 79.75  ? 147  GLU D N   1 
ATOM   8470  C  CA  . GLU D  1 147 ? -51.101 83.484  67.036  1.00 73.04  ? 147  GLU D CA  1 
ATOM   8471  C  C   . GLU D  1 147 ? -50.275 82.881  68.158  1.00 69.87  ? 147  GLU D C   1 
ATOM   8472  O  O   . GLU D  1 147 ? -50.671 82.863  69.325  1.00 63.59  ? 147  GLU D O   1 
ATOM   8473  C  CB  . GLU D  1 147 ? -50.479 84.828  66.651  1.00 82.30  ? 147  GLU D CB  1 
ATOM   8474  C  CG  . GLU D  1 147 ? -51.039 85.531  65.433  1.00 91.20  ? 147  GLU D CG  1 
ATOM   8475  C  CD  . GLU D  1 147 ? -50.422 86.918  65.258  1.00 100.23 ? 147  GLU D CD  1 
ATOM   8476  O  OE1 . GLU D  1 147 ? -49.587 87.314  66.105  1.00 101.30 ? 147  GLU D OE1 1 
ATOM   8477  O  OE2 . GLU D  1 147 ? -50.759 87.610  64.275  1.00 102.43 ? 147  GLU D OE2 1 
ATOM   8478  N  N   . ARG D  1 148 ? -49.111 82.373  67.780  1.00 61.73  ? 148  ARG D N   1 
ATOM   8479  C  CA  . ARG D  1 148 ? -48.200 81.819  68.763  1.00 56.14  ? 148  ARG D CA  1 
ATOM   8480  C  C   . ARG D  1 148 ? -47.536 82.946  69.540  1.00 56.33  ? 148  ARG D C   1 
ATOM   8481  O  O   . ARG D  1 148 ? -47.145 83.967  68.970  1.00 56.54  ? 148  ARG D O   1 
ATOM   8482  C  CB  . ARG D  1 148 ? -47.138 80.964  68.083  1.00 51.58  ? 148  ARG D CB  1 
ATOM   8483  C  CG  . ARG D  1 148 ? -46.398 80.095  69.053  1.00 55.07  ? 148  ARG D CG  1 
ATOM   8484  C  CD  . ARG D  1 148 ? -45.418 79.213  68.353  1.00 53.89  ? 148  ARG D CD  1 
ATOM   8485  N  NE  . ARG D  1 148 ? -44.836 78.272  69.292  1.00 57.13  ? 148  ARG D NE  1 
ATOM   8486  C  CZ  . ARG D  1 148 ? -43.733 77.580  69.053  1.00 61.21  ? 148  ARG D CZ  1 
ATOM   8487  N  NH1 . ARG D  1 148 ? -43.090 77.732  67.898  1.00 59.93  ? 148  ARG D NH1 1 
ATOM   8488  N  NH2 . ARG D  1 148 ? -43.273 76.739  69.969  1.00 64.15  ? 148  ARG D NH2 1 
ATOM   8489  N  N   . VAL D  1 149 ? -47.412 82.759  70.844  1.00 52.73  ? 149  VAL D N   1 
ATOM   8490  C  CA  . VAL D  1 149 ? -46.666 83.733  71.648  1.00 51.21  ? 149  VAL D CA  1 
ATOM   8491  C  C   . VAL D  1 149 ? -45.180 83.612  71.329  1.00 46.66  ? 149  VAL D C   1 
ATOM   8492  O  O   . VAL D  1 149 ? -44.650 82.490  71.294  1.00 47.06  ? 149  VAL D O   1 
ATOM   8493  C  CB  . VAL D  1 149 ? -46.933 83.505  73.130  1.00 49.47  ? 149  VAL D CB  1 
ATOM   8494  C  CG1 . VAL D  1 149 ? -46.169 84.524  73.965  1.00 39.39  ? 149  VAL D CG1 1 
ATOM   8495  C  CG2 . VAL D  1 149 ? -48.435 83.581  73.391  1.00 46.16  ? 149  VAL D CG2 1 
ATOM   8496  N  N   . PRO D  1 150 ? -44.474 84.705  71.073  1.00 50.02  ? 150  PRO D N   1 
ATOM   8497  C  CA  . PRO D  1 150 ? -43.047 84.606  70.749  1.00 46.53  ? 150  PRO D CA  1 
ATOM   8498  C  C   . PRO D  1 150 ? -42.209 84.354  71.996  1.00 43.01  ? 150  PRO D C   1 
ATOM   8499  O  O   . PRO D  1 150 ? -42.670 84.478  73.133  1.00 43.30  ? 150  PRO D O   1 
ATOM   8500  C  CB  . PRO D  1 150 ? -42.732 85.982  70.155  1.00 41.70  ? 150  PRO D CB  1 
ATOM   8501  C  CG  . PRO D  1 150 ? -43.688 86.903  70.869  1.00 43.26  ? 150  PRO D CG  1 
ATOM   8502  C  CD  . PRO D  1 150 ? -44.956 86.099  71.014  1.00 46.29  ? 150  PRO D CD  1 
ATOM   8503  N  N   . LYS D  1 151 ? -40.956 83.968  71.763  1.00 40.77  ? 151  LYS D N   1 
ATOM   8504  C  CA  . LYS D  1 151 ? -39.949 84.119  72.805  1.00 41.74  ? 151  LYS D CA  1 
ATOM   8505  C  C   . LYS D  1 151 ? -39.800 85.596  73.138  1.00 43.95  ? 151  LYS D C   1 
ATOM   8506  O  O   . LYS D  1 151 ? -39.981 86.463  72.279  1.00 40.23  ? 151  LYS D O   1 
ATOM   8507  C  CB  . LYS D  1 151 ? -38.612 83.545  72.354  1.00 44.36  ? 151  LYS D CB  1 
ATOM   8508  C  CG  . LYS D  1 151 ? -38.640 82.047  72.045  1.00 45.98  ? 151  LYS D CG  1 
ATOM   8509  C  CD  . LYS D  1 151 ? -39.147 81.224  73.225  1.00 42.05  ? 151  LYS D CD  1 
ATOM   8510  C  CE  . LYS D  1 151 ? -38.793 79.751  73.035  1.00 40.08  ? 151  LYS D CE  1 
ATOM   8511  N  NZ  . LYS D  1 151 ? -37.355 79.531  73.324  1.00 43.72  ? 151  LYS D NZ  1 
ATOM   8512  N  N   . VAL D  1 152 ? -39.490 85.889  74.399  1.00 35.86  ? 152  VAL D N   1 
ATOM   8513  C  CA  . VAL D  1 152 ? -39.391 87.267  74.869  1.00 44.27  ? 152  VAL D CA  1 
ATOM   8514  C  C   . VAL D  1 152 ? -37.979 87.791  74.612  1.00 45.87  ? 152  VAL D C   1 
ATOM   8515  O  O   . VAL D  1 152 ? -37.010 87.310  75.204  1.00 43.02  ? 152  VAL D O   1 
ATOM   8516  C  CB  . VAL D  1 152 ? -39.758 87.383  76.351  1.00 39.58  ? 152  VAL D CB  1 
ATOM   8517  C  CG1 . VAL D  1 152 ? -39.590 88.823  76.807  1.00 34.19  ? 152  VAL D CG1 1 
ATOM   8518  C  CG2 . VAL D  1 152 ? -41.172 86.923  76.573  1.00 40.16  ? 152  VAL D CG2 1 
ATOM   8519  N  N   . ALA D  1 153 ? -37.867 88.778  73.722  1.00 44.11  ? 153  ALA D N   1 
ATOM   8520  C  CA  . ALA D  1 153 ? -36.602 89.453  73.418  1.00 40.58  ? 153  ALA D CA  1 
ATOM   8521  C  C   . ALA D  1 153 ? -36.612 90.825  74.098  1.00 40.56  ? 153  ALA D C   1 
ATOM   8522  O  O   . ALA D  1 153 ? -37.197 91.777  73.583  1.00 43.64  ? 153  ALA D O   1 
ATOM   8523  C  CB  . ALA D  1 153 ? -36.411 89.573  71.908  1.00 34.78  ? 153  ALA D CB  1 
ATOM   8524  N  N   . LEU D  1 154 ? -35.974 90.920  75.263  1.00 40.35  ? 154  LEU D N   1 
ATOM   8525  C  CA  . LEU D  1 154 ? -36.001 92.154  76.035  1.00 41.05  ? 154  LEU D CA  1 
ATOM   8526  C  C   . LEU D  1 154 ? -35.093 93.194  75.393  1.00 41.63  ? 154  LEU D C   1 
ATOM   8527  O  O   . LEU D  1 154 ? -33.903 92.948  75.167  1.00 43.56  ? 154  LEU D O   1 
ATOM   8528  C  CB  . LEU D  1 154 ? -35.576 91.888  77.478  1.00 36.83  ? 154  LEU D CB  1 
ATOM   8529  C  CG  . LEU D  1 154 ? -36.546 91.044  78.300  1.00 33.59  ? 154  LEU D CG  1 
ATOM   8530  C  CD1 . LEU D  1 154 ? -35.979 90.733  79.688  1.00 33.20  ? 154  LEU D CD1 1 
ATOM   8531  C  CD2 . LEU D  1 154 ? -37.889 91.761  78.396  1.00 34.16  ? 154  LEU D CD2 1 
ATOM   8532  N  N   . SER D  1 155 ? -35.664 94.354  75.099  1.00 40.39  ? 155  SER D N   1 
ATOM   8533  C  CA  . SER D  1 155 ? -34.932 95.455  74.484  1.00 40.18  ? 155  SER D CA  1 
ATOM   8534  C  C   . SER D  1 155 ? -33.695 95.790  75.309  1.00 39.74  ? 155  SER D C   1 
ATOM   8535  O  O   . SER D  1 155 ? -33.790 96.035  76.515  1.00 39.28  ? 155  SER D O   1 
ATOM   8536  C  CB  . SER D  1 155 ? -35.856 96.678  74.374  1.00 36.36  ? 155  SER D CB  1 
ATOM   8537  O  OG  . SER D  1 155 ? -35.235 97.760  73.696  1.00 49.38  ? 155  SER D OG  1 
ATOM   8538  N  N   . SER D  1 156 ? -32.526 95.730  74.661  1.00 37.90  ? 156  SER D N   1 
ATOM   8539  C  CA  . SER D  1 156 ? -31.236 96.050  75.289  1.00 42.48  ? 156  SER D CA  1 
ATOM   8540  C  C   . SER D  1 156 ? -31.000 95.303  76.603  1.00 44.90  ? 156  SER D C   1 
ATOM   8541  O  O   . SER D  1 156 ? -30.290 95.798  77.477  1.00 47.02  ? 156  SER D O   1 
ATOM   8542  C  CB  . SER D  1 156 ? -31.102 97.560  75.500  1.00 44.84  ? 156  SER D CB  1 
ATOM   8543  O  OG  . SER D  1 156 ? -31.027 98.219  74.242  1.00 58.25  ? 156  SER D OG  1 
ATOM   8544  N  N   . GLN D  1 157 ? -31.560 94.101  76.749  1.00 39.32  ? 157  GLN D N   1 
ATOM   8545  C  CA  . GLN D  1 157 ? -31.460 93.340  77.996  1.00 43.59  ? 157  GLN D CA  1 
ATOM   8546  C  C   . GLN D  1 157 ? -31.410 91.843  77.685  1.00 41.02  ? 157  GLN D C   1 
ATOM   8547  O  O   . GLN D  1 157 ? -32.207 91.053  78.193  1.00 47.27  ? 157  GLN D O   1 
ATOM   8548  C  CB  . GLN D  1 157 ? -32.637 93.656  78.923  1.00 50.66  ? 157  GLN D CB  1 
ATOM   8549  C  CG  . GLN D  1 157 ? -32.592 95.011  79.604  1.00 71.82  ? 157  GLN D CG  1 
ATOM   8550  C  CD  . GLN D  1 157 ? -33.883 95.358  80.355  1.00 78.67  ? 157  GLN D CD  1 
ATOM   8551  O  OE1 . GLN D  1 157 ? -34.683 94.484  80.700  1.00 76.36  ? 157  GLN D OE1 1 
ATOM   8552  N  NE2 . GLN D  1 157 ? -34.105 96.653  80.566  1.00 79.67  ? 157  GLN D NE2 1 
ATOM   8553  N  N   . ARG D  1 158 ? -30.494 91.441  76.811  1.00 39.32  ? 158  ARG D N   1 
ATOM   8554  C  CA  . ARG D  1 158 ? -30.302 90.042  76.451  1.00 34.71  ? 158  ARG D CA  1 
ATOM   8555  C  C   . ARG D  1 158 ? -28.935 89.926  75.792  1.00 37.88  ? 158  ARG D C   1 
ATOM   8556  O  O   . ARG D  1 158 ? -28.194 90.907  75.694  1.00 39.19  ? 158  ARG D O   1 
ATOM   8557  C  CB  . ARG D  1 158 ? -31.419 89.539  75.543  1.00 32.13  ? 158  ARG D CB  1 
ATOM   8558  C  CG  . ARG D  1 158 ? -31.382 90.108  74.118  1.00 36.94  ? 158  ARG D CG  1 
ATOM   8559  C  CD  . ARG D  1 158 ? -32.741 90.007  73.403  1.00 37.22  ? 158  ARG D CD  1 
ATOM   8560  N  NE  . ARG D  1 158 ? -32.643 90.421  72.000  1.00 37.07  ? 158  ARG D NE  1 
ATOM   8561  C  CZ  . ARG D  1 158 ? -32.557 91.684  71.583  1.00 34.19  ? 158  ARG D CZ  1 
ATOM   8562  N  NH1 . ARG D  1 158 ? -32.581 92.690  72.443  1.00 30.79  ? 158  ARG D NH1 1 
ATOM   8563  N  NH2 . ARG D  1 158 ? -32.445 91.945  70.286  1.00 34.57  ? 158  ARG D NH2 1 
ATOM   8564  N  N   . THR D  1 159 ? -28.597 88.719  75.353  1.00 36.35  ? 159  THR D N   1 
ATOM   8565  C  CA  . THR D  1 159 ? -27.289 88.416  74.779  1.00 36.18  ? 159  THR D CA  1 
ATOM   8566  C  C   . THR D  1 159 ? -27.424 88.066  73.304  1.00 40.97  ? 159  THR D C   1 
ATOM   8567  O  O   . THR D  1 159 ? -28.301 87.285  72.919  1.00 40.51  ? 159  THR D O   1 
ATOM   8568  C  CB  . THR D  1 159 ? -26.610 87.281  75.555  1.00 32.48  ? 159  THR D CB  1 
ATOM   8569  O  OG1 . THR D  1 159 ? -26.237 87.764  76.849  1.00 41.10  ? 159  THR D OG1 1 
ATOM   8570  C  CG2 . THR D  1 159 ? -25.370 86.749  74.823  1.00 33.49  ? 159  THR D CG2 1 
ATOM   8571  N  N   . VAL D  1 160 ? -26.563 88.653  72.481  1.00 39.35  ? 160  VAL D N   1 
ATOM   8572  C  CA  . VAL D  1 160 ? -26.485 88.328  71.064  1.00 38.10  ? 160  VAL D CA  1 
ATOM   8573  C  C   . VAL D  1 160 ? -25.161 87.627  70.820  1.00 43.90  ? 160  VAL D C   1 
ATOM   8574  O  O   . VAL D  1 160 ? -24.096 88.114  71.219  1.00 40.55  ? 160  VAL D O   1 
ATOM   8575  C  CB  . VAL D  1 160 ? -26.623 89.575  70.175  1.00 39.95  ? 160  VAL D CB  1 
ATOM   8576  C  CG1 . VAL D  1 160 ? -26.435 89.210  68.718  1.00 36.32  ? 160  VAL D CG1 1 
ATOM   8577  C  CG2 . VAL D  1 160 ? -27.983 90.218  70.385  1.00 38.44  ? 160  VAL D CG2 1 
ATOM   8578  N  N   . VAL D  1 161 ? -25.232 86.493  70.157  1.00 38.24  ? 161  VAL D N   1 
ATOM   8579  C  CA  . VAL D  1 161 ? -24.074 85.688  69.827  1.00 36.41  ? 161  VAL D CA  1 
ATOM   8580  C  C   . VAL D  1 161 ? -23.970 85.680  68.310  1.00 40.85  ? 161  VAL D C   1 
ATOM   8581  O  O   . VAL D  1 161 ? -24.996 85.620  67.628  1.00 38.61  ? 161  VAL D O   1 
ATOM   8582  C  CB  . VAL D  1 161 ? -24.271 84.273  70.420  1.00 46.48  ? 161  VAL D CB  1 
ATOM   8583  C  CG1 . VAL D  1 161 ? -23.549 83.263  69.652  1.00 51.86  ? 161  VAL D CG1 1 
ATOM   8584  C  CG2 . VAL D  1 161 ? -23.831 84.251  71.869  1.00 42.50  ? 161  VAL D CG2 1 
ATOM   8585  N  N   . ILE D  1 162 ? -22.754 85.818  67.776  1.00 38.87  ? 162  ILE D N   1 
ATOM   8586  C  CA  . ILE D  1 162 ? -22.524 85.791  66.328  1.00 36.58  ? 162  ILE D CA  1 
ATOM   8587  C  C   . ILE D  1 162 ? -21.511 84.698  66.027  1.00 37.83  ? 162  ILE D C   1 
ATOM   8588  O  O   . ILE D  1 162 ? -20.379 84.746  66.529  1.00 40.87  ? 162  ILE D O   1 
ATOM   8589  C  CB  . ILE D  1 162 ? -22.032 87.143  65.788  1.00 41.40  ? 162  ILE D CB  1 
ATOM   8590  C  CG1 . ILE D  1 162 ? -23.033 88.255  66.115  1.00 44.82  ? 162  ILE D CG1 1 
ATOM   8591  C  CG2 . ILE D  1 162 ? -21.840 87.056  64.287  1.00 35.21  ? 162  ILE D CG2 1 
ATOM   8592  C  CD1 . ILE D  1 162 ? -22.590 89.621  65.656  1.00 43.67  ? 162  ILE D CD1 1 
ATOM   8593  N  N   . GLY D  1 163 ? -21.910 83.723  65.219  1.00 35.70  ? 163  GLY D N   1 
ATOM   8594  C  CA  . GLY D  1 163 ? -21.040 82.634  64.830  1.00 35.05  ? 163  GLY D CA  1 
ATOM   8595  C  C   . GLY D  1 163 ? -20.429 82.862  63.464  1.00 38.04  ? 163  GLY D C   1 
ATOM   8596  O  O   . GLY D  1 163 ? -21.141 83.038  62.475  1.00 42.38  ? 163  GLY D O   1 
ATOM   8597  N  N   . ASP D  1 164 ? -19.106 82.923  63.425  1.00 38.28  ? 164  ASP D N   1 
ATOM   8598  C  CA  . ASP D  1 164 ? -18.408 83.183  62.176  1.00 38.48  ? 164  ASP D CA  1 
ATOM   8599  C  C   . ASP D  1 164 ? -18.110 81.855  61.488  1.00 39.56  ? 164  ASP D C   1 
ATOM   8600  O  O   . ASP D  1 164 ? -17.438 80.992  62.068  1.00 34.71  ? 164  ASP D O   1 
ATOM   8601  C  CB  . ASP D  1 164 ? -17.126 83.976  62.439  1.00 39.31  ? 164  ASP D CB  1 
ATOM   8602  C  CG  . ASP D  1 164 ? -16.595 84.653  61.190  1.00 40.58  ? 164  ASP D CG  1 
ATOM   8603  O  OD1 . ASP D  1 164 ? -16.993 84.254  60.073  1.00 37.21  ? 164  ASP D OD1 1 
ATOM   8604  O  OD2 . ASP D  1 164 ? -15.805 85.609  61.326  1.00 46.03  ? 164  ASP D OD2 1 
ATOM   8605  N  N   . HIS D  1 165 ? -18.603 81.695  60.254  1.00 38.20  ? 165  HIS D N   1 
ATOM   8606  C  CA  . HIS D  1 165 ? -18.387 80.494  59.455  1.00 40.46  ? 165  HIS D CA  1 
ATOM   8607  C  C   . HIS D  1 165 ? -17.876 80.896  58.080  1.00 48.23  ? 165  HIS D C   1 
ATOM   8608  O  O   . HIS D  1 165 ? -18.494 81.732  57.415  1.00 54.33  ? 165  HIS D O   1 
ATOM   8609  C  CB  . HIS D  1 165 ? -19.683 79.682  59.268  1.00 44.77  ? 165  HIS D CB  1 
ATOM   8610  C  CG  . HIS D  1 165 ? -20.377 79.319  60.544  1.00 43.49  ? 165  HIS D CG  1 
ATOM   8611  N  ND1 . HIS D  1 165 ? -21.039 80.245  61.319  1.00 40.17  ? 165  HIS D ND1 1 
ATOM   8612  C  CD2 . HIS D  1 165 ? -20.542 78.125  61.163  1.00 38.96  ? 165  HIS D CD2 1 
ATOM   8613  C  CE1 . HIS D  1 165 ? -21.566 79.644  62.370  1.00 37.70  ? 165  HIS D CE1 1 
ATOM   8614  N  NE2 . HIS D  1 165 ? -21.278 78.356  62.299  1.00 41.37  ? 165  HIS D NE2 1 
ATOM   8615  N  N   . TRP D  1 166 ? -16.779 80.276  57.636  1.00 46.45  ? 166  TRP D N   1 
ATOM   8616  C  CA  . TRP D  1 166 ? -16.354 80.333  56.238  1.00 44.68  ? 166  TRP D CA  1 
ATOM   8617  C  C   . TRP D  1 166 ? -16.704 79.004  55.583  1.00 44.25  ? 166  TRP D C   1 
ATOM   8618  O  O   . TRP D  1 166 ? -16.280 77.945  56.059  1.00 50.64  ? 166  TRP D O   1 
ATOM   8619  C  CB  . TRP D  1 166 ? -14.856 80.608  56.096  1.00 44.32  ? 166  TRP D CB  1 
ATOM   8620  C  CG  . TRP D  1 166 ? -14.386 81.933  56.600  1.00 45.37  ? 166  TRP D CG  1 
ATOM   8621  C  CD1 . TRP D  1 166 ? -15.083 82.817  57.371  1.00 43.59  ? 166  TRP D CD1 1 
ATOM   8622  C  CD2 . TRP D  1 166 ? -13.102 82.532  56.360  1.00 45.52  ? 166  TRP D CD2 1 
ATOM   8623  N  NE1 . TRP D  1 166 ? -14.307 83.924  57.639  1.00 46.44  ? 166  TRP D NE1 1 
ATOM   8624  C  CE2 . TRP D  1 166 ? -13.090 83.776  57.027  1.00 46.35  ? 166  TRP D CE2 1 
ATOM   8625  C  CE3 . TRP D  1 166 ? -11.959 82.131  55.656  1.00 47.12  ? 166  TRP D CE3 1 
ATOM   8626  C  CZ2 . TRP D  1 166 ? -11.983 84.632  56.999  1.00 42.09  ? 166  TRP D CZ2 1 
ATOM   8627  C  CZ3 . TRP D  1 166 ? -10.856 82.977  55.637  1.00 41.52  ? 166  TRP D CZ3 1 
ATOM   8628  C  CH2 . TRP D  1 166 ? -10.878 84.212  56.305  1.00 41.68  ? 166  TRP D CH2 1 
ATOM   8629  N  N   . VAL D  1 167 ? -17.469 79.054  54.496  1.00 41.67  ? 167  VAL D N   1 
ATOM   8630  C  CA  . VAL D  1 167 ? -18.059 77.863  53.897  1.00 41.73  ? 167  VAL D CA  1 
ATOM   8631  C  C   . VAL D  1 167 ? -17.248 77.425  52.677  1.00 44.61  ? 167  VAL D C   1 
ATOM   8632  O  O   . VAL D  1 167 ? -16.805 78.254  51.871  1.00 45.69  ? 167  VAL D O   1 
ATOM   8633  C  CB  . VAL D  1 167 ? -19.542 78.130  53.555  1.00 44.96  ? 167  VAL D CB  1 
ATOM   8634  C  CG1 . VAL D  1 167 ? -20.143 77.006  52.712  1.00 37.70  ? 167  VAL D CG1 1 
ATOM   8635  C  CG2 . VAL D  1 167 ? -20.320 78.265  54.851  1.00 45.07  ? 167  VAL D CG2 1 
ATOM   8636  N  N   . MET D  1 168 ? -17.007 76.118  52.570  1.00 43.04  ? 168  MET D N   1 
ATOM   8637  C  CA  . MET D  1 168 ? -16.275 75.585  51.429  1.00 41.50  ? 168  MET D CA  1 
ATOM   8638  C  C   . MET D  1 168 ? -16.992 75.916  50.133  1.00 46.03  ? 168  MET D C   1 
ATOM   8639  O  O   . MET D  1 168 ? -18.221 75.836  50.044  1.00 47.92  ? 168  MET D O   1 
ATOM   8640  C  CB  . MET D  1 168 ? -16.111 74.075  51.549  1.00 40.33  ? 168  MET D CB  1 
ATOM   8641  C  CG  . MET D  1 168 ? -15.303 73.605  52.736  1.00 45.31  ? 168  MET D CG  1 
ATOM   8642  S  SD  . MET D  1 168 ? -15.655 71.854  53.019  1.00 45.74  ? 168  MET D SD  1 
ATOM   8643  C  CE  . MET D  1 168 ? -15.016 71.117  51.512  1.00 44.84  ? 168  MET D CE  1 
ATOM   8644  N  N   . ASP D  1 169 ? -16.208 76.292  49.127  1.00 51.43  ? 169  ASP D N   1 
ATOM   8645  C  CA  . ASP D  1 169 ? -16.742 76.586  47.805  1.00 52.38  ? 169  ASP D CA  1 
ATOM   8646  C  C   . ASP D  1 169 ? -17.644 75.453  47.327  1.00 53.32  ? 169  ASP D C   1 
ATOM   8647  O  O   . ASP D  1 169 ? -17.252 74.285  47.341  1.00 51.31  ? 169  ASP D O   1 
ATOM   8648  C  CB  . ASP D  1 169 ? -15.592 76.799  46.823  1.00 53.42  ? 169  ASP D CB  1 
ATOM   8649  C  CG  . ASP D  1 169 ? -16.066 77.283  45.470  1.00 63.43  ? 169  ASP D CG  1 
ATOM   8650  O  OD1 . ASP D  1 169 ? -17.216 77.763  45.367  1.00 67.05  ? 169  ASP D OD1 1 
ATOM   8651  O  OD2 . ASP D  1 169 ? -15.290 77.176  44.506  1.00 63.99  ? 169  ASP D OD2 1 
ATOM   8652  N  N   . GLY D  1 170 ? -18.875 75.802  46.945  1.00 47.70  ? 170  GLY D N   1 
ATOM   8653  C  CA  . GLY D  1 170 ? -19.832 74.832  46.464  1.00 43.94  ? 170  GLY D CA  1 
ATOM   8654  C  C   . GLY D  1 170 ? -20.688 74.189  47.532  1.00 52.71  ? 170  GLY D C   1 
ATOM   8655  O  O   . GLY D  1 170 ? -21.605 73.424  47.191  1.00 48.64  ? 170  GLY D O   1 
ATOM   8656  N  N   . HIS D  1 171 ? -20.418 74.461  48.812  1.00 45.61  ? 171  HIS D N   1 
ATOM   8657  C  CA  . HIS D  1 171 ? -21.193 73.899  49.909  1.00 45.14  ? 171  HIS D CA  1 
ATOM   8658  C  C   . HIS D  1 171 ? -22.196 74.888  50.499  1.00 50.94  ? 171  HIS D C   1 
ATOM   8659  O  O   . HIS D  1 171 ? -22.788 74.598  51.544  1.00 51.43  ? 171  HIS D O   1 
ATOM   8660  C  CB  . HIS D  1 171 ? -20.257 73.398  51.009  1.00 50.19  ? 171  HIS D CB  1 
ATOM   8661  C  CG  . HIS D  1 171 ? -19.396 72.241  50.601  1.00 49.93  ? 171  HIS D CG  1 
ATOM   8662  N  ND1 . HIS D  1 171 ? -19.355 71.061  51.311  1.00 48.30  ? 171  HIS D ND1 1 
ATOM   8663  C  CD2 . HIS D  1 171 ? -18.532 72.088  49.569  1.00 47.46  ? 171  HIS D CD2 1 
ATOM   8664  C  CE1 . HIS D  1 171 ? -18.514 70.224  50.729  1.00 44.82  ? 171  HIS D CE1 1 
ATOM   8665  N  NE2 . HIS D  1 171 ? -17.995 70.826  49.674  1.00 49.03  ? 171  HIS D NE2 1 
ATOM   8666  N  N   . GLU D  1 172 ? -22.395 76.045  49.855  1.00 43.66  ? 172  GLU D N   1 
ATOM   8667  C  CA  . GLU D  1 172 ? -23.194 77.118  50.447  1.00 45.12  ? 172  GLU D CA  1 
ATOM   8668  C  C   . GLU D  1 172 ? -24.617 76.660  50.753  1.00 50.13  ? 172  GLU D C   1 
ATOM   8669  O  O   . GLU D  1 172 ? -25.148 76.930  51.841  1.00 46.33  ? 172  GLU D O   1 
ATOM   8670  C  CB  . GLU D  1 172 ? -23.217 78.341  49.519  1.00 46.47  ? 172  GLU D CB  1 
ATOM   8671  C  CG  . GLU D  1 172 ? -21.978 79.238  49.583  1.00 46.19  ? 172  GLU D CG  1 
ATOM   8672  C  CD  . GLU D  1 172 ? -20.862 78.771  48.664  1.00 51.68  ? 172  GLU D CD  1 
ATOM   8673  O  OE1 . GLU D  1 172 ? -20.994 77.687  48.065  1.00 49.48  ? 172  GLU D OE1 1 
ATOM   8674  O  OE2 . GLU D  1 172 ? -19.846 79.483  48.544  1.00 53.39  ? 172  GLU D OE2 1 
ATOM   8675  N  N   . LYS D  1 173 ? -25.268 76.003  49.788  1.00 45.29  ? 173  LYS D N   1 
ATOM   8676  C  CA  . LYS D  1 173 ? -26.664 75.621  49.970  1.00 45.58  ? 173  LYS D CA  1 
ATOM   8677  C  C   . LYS D  1 173 ? -26.815 74.565  51.053  1.00 44.14  ? 173  LYS D C   1 
ATOM   8678  O  O   . LYS D  1 173 ? -27.727 74.646  51.884  1.00 51.30  ? 173  LYS D O   1 
ATOM   8679  C  CB  . LYS D  1 173 ? -27.248 75.120  48.647  1.00 52.26  ? 173  LYS D CB  1 
ATOM   8680  C  CG  . LYS D  1 173 ? -28.712 74.720  48.723  1.00 59.24  ? 173  LYS D CG  1 
ATOM   8681  C  CD  . LYS D  1 173 ? -29.215 74.169  47.379  1.00 75.29  ? 173  LYS D CD  1 
ATOM   8682  C  CE  . LYS D  1 173 ? -30.699 73.781  47.415  1.00 74.98  ? 173  LYS D CE  1 
ATOM   8683  N  NZ  . LYS D  1 173 ? -31.170 73.278  46.089  1.00 77.25  ? 173  LYS D NZ  1 
ATOM   8684  N  N   . ALA D  1 174 ? -25.933 73.567  51.059  1.00 46.13  ? 174  ALA D N   1 
ATOM   8685  C  CA  . ALA D  1 174 ? -25.952 72.559  52.116  1.00 44.91  ? 174  ALA D CA  1 
ATOM   8686  C  C   . ALA D  1 174 ? -25.729 73.185  53.485  1.00 46.09  ? 174  ALA D C   1 
ATOM   8687  O  O   . ALA D  1 174 ? -26.355 72.775  54.471  1.00 44.02  ? 174  ALA D O   1 
ATOM   8688  C  CB  . ALA D  1 174 ? -24.897 71.490  51.848  1.00 47.32  ? 174  ALA D CB  1 
ATOM   8689  N  N   . PHE D  1 175 ? -24.812 74.152  53.577  1.00 48.08  ? 175  PHE D N   1 
ATOM   8690  C  CA  . PHE D  1 175 ? -24.610 74.842  54.849  1.00 46.96  ? 175  PHE D CA  1 
ATOM   8691  C  C   . PHE D  1 175 ? -25.895 75.525  55.307  1.00 48.15  ? 175  PHE D C   1 
ATOM   8692  O  O   . PHE D  1 175 ? -26.257 75.471  56.487  1.00 44.59  ? 175  PHE D O   1 
ATOM   8693  C  CB  . PHE D  1 175 ? -23.476 75.865  54.741  1.00 40.72  ? 175  PHE D CB  1 
ATOM   8694  C  CG  . PHE D  1 175 ? -23.410 76.799  55.923  1.00 45.02  ? 175  PHE D CG  1 
ATOM   8695  C  CD1 . PHE D  1 175 ? -22.699 76.450  57.064  1.00 43.42  ? 175  PHE D CD1 1 
ATOM   8696  C  CD2 . PHE D  1 175 ? -24.103 78.008  55.911  1.00 41.63  ? 175  PHE D CD2 1 
ATOM   8697  C  CE1 . PHE D  1 175 ? -22.667 77.298  58.165  1.00 43.80  ? 175  PHE D CE1 1 
ATOM   8698  C  CE2 . PHE D  1 175 ? -24.076 78.862  57.002  1.00 42.76  ? 175  PHE D CE2 1 
ATOM   8699  C  CZ  . PHE D  1 175 ? -23.354 78.514  58.129  1.00 41.25  ? 175  PHE D CZ  1 
ATOM   8700  N  N   . GLU D  1 176 ? -26.572 76.218  54.390  1.00 50.98  ? 176  GLU D N   1 
ATOM   8701  C  CA  . GLU D  1 176 ? -27.792 76.937  54.746  1.00 49.37  ? 176  GLU D CA  1 
ATOM   8702  C  C   . GLU D  1 176 ? -28.866 75.988  55.284  1.00 49.40  ? 176  GLU D C   1 
ATOM   8703  O  O   . GLU D  1 176 ? -29.533 76.297  56.278  1.00 48.34  ? 176  GLU D O   1 
ATOM   8704  C  CB  . GLU D  1 176 ? -28.278 77.730  53.534  1.00 46.71  ? 176  GLU D CB  1 
ATOM   8705  C  CG  . GLU D  1 176 ? -27.337 78.882  53.166  1.00 51.02  ? 176  GLU D CG  1 
ATOM   8706  C  CD  . GLU D  1 176 ? -27.755 79.589  51.895  1.00 53.63  ? 176  GLU D CD  1 
ATOM   8707  O  OE1 . GLU D  1 176 ? -28.851 79.286  51.403  1.00 55.23  ? 176  GLU D OE1 1 
ATOM   8708  O  OE2 . GLU D  1 176 ? -26.999 80.444  51.387  1.00 53.82  ? 176  GLU D OE2 1 
ATOM   8709  N  N   . GLN D  1 177 ? -29.031 74.817  54.657  1.00 43.18  ? 177  GLN D N   1 
ATOM   8710  C  CA  . GLN D  1 177 ? -30.006 73.840  55.144  1.00 42.74  ? 177  GLN D CA  1 
ATOM   8711  C  C   . GLN D  1 177 ? -29.593 73.252  56.492  1.00 41.25  ? 177  GLN D C   1 
ATOM   8712  O  O   . GLN D  1 177 ? -30.431 73.084  57.388  1.00 42.55  ? 177  GLN D O   1 
ATOM   8713  C  CB  . GLN D  1 177 ? -30.168 72.721  54.113  1.00 47.10  ? 177  GLN D CB  1 
ATOM   8714  C  CG  . GLN D  1 177 ? -30.806 73.193  52.834  1.00 65.84  ? 177  GLN D CG  1 
ATOM   8715  C  CD  . GLN D  1 177 ? -30.809 72.135  51.738  1.00 81.77  ? 177  GLN D CD  1 
ATOM   8716  O  OE1 . GLN D  1 177 ? -30.104 71.121  51.826  1.00 88.05  ? 177  GLN D OE1 1 
ATOM   8717  N  NE2 . GLN D  1 177 ? -31.594 72.377  50.687  1.00 80.32  ? 177  GLN D NE2 1 
ATOM   8718  N  N   . GLY D  1 178 ? -28.312 72.913  56.650  1.00 38.47  ? 178  GLY D N   1 
ATOM   8719  C  CA  . GLY D  1 178 ? -27.857 72.350  57.912  1.00 36.18  ? 178  GLY D CA  1 
ATOM   8720  C  C   . GLY D  1 178 ? -27.919 73.347  59.056  1.00 40.46  ? 178  GLY D C   1 
ATOM   8721  O  O   . GLY D  1 178 ? -28.278 72.992  60.180  1.00 42.99  ? 178  GLY D O   1 
ATOM   8722  N  N   . ALA D  1 179 ? -27.532 74.598  58.797  1.00 37.17  ? 179  ALA D N   1 
ATOM   8723  C  CA  . ALA D  1 179 ? -27.627 75.624  59.833  1.00 42.92  ? 179  ALA D CA  1 
ATOM   8724  C  C   . ALA D  1 179 ? -29.080 75.887  60.211  1.00 45.77  ? 179  ALA D C   1 
ATOM   8725  O  O   . ALA D  1 179 ? -29.401 76.040  61.396  1.00 42.64  ? 179  ALA D O   1 
ATOM   8726  C  CB  . ALA D  1 179 ? -26.940 76.910  59.376  1.00 34.59  ? 179  ALA D CB  1 
ATOM   8727  N  N   . THR D  1 180 ? -29.975 75.937  59.218  1.00 42.83  ? 180  THR D N   1 
ATOM   8728  C  CA  . THR D  1 180 ? -31.396 76.102  59.512  1.00 40.71  ? 180  THR D CA  1 
ATOM   8729  C  C   . THR D  1 180 ? -31.906 74.969  60.386  1.00 47.71  ? 180  THR D C   1 
ATOM   8730  O  O   . THR D  1 180 ? -32.632 75.199  61.361  1.00 47.03  ? 180  THR D O   1 
ATOM   8731  C  CB  . THR D  1 180 ? -32.218 76.165  58.224  1.00 45.62  ? 180  THR D CB  1 
ATOM   8732  O  OG1 . THR D  1 180 ? -31.858 77.327  57.476  1.00 42.86  ? 180  THR D OG1 1 
ATOM   8733  C  CG2 . THR D  1 180 ? -33.701 76.217  58.554  1.00 45.22  ? 180  THR D CG2 1 
ATOM   8734  N  N   . GLU D  1 181 ? -31.574 73.727  60.023  1.00 43.08  ? 181  GLU D N   1 
ATOM   8735  C  CA  . GLU D  1 181 ? -32.056 72.605  60.814  1.00 47.07  ? 181  GLU D CA  1 
ATOM   8736  C  C   . GLU D  1 181 ? -31.484 72.655  62.217  1.00 42.18  ? 181  GLU D C   1 
ATOM   8737  O  O   . GLU D  1 181 ? -32.183 72.351  63.191  1.00 42.21  ? 181  GLU D O   1 
ATOM   8738  C  CB  . GLU D  1 181 ? -31.707 71.276  60.155  1.00 48.75  ? 181  GLU D CB  1 
ATOM   8739  C  CG  . GLU D  1 181 ? -32.425 70.113  60.830  1.00 53.31  ? 181  GLU D CG  1 
ATOM   8740  C  CD  . GLU D  1 181 ? -32.095 68.746  60.242  1.00 60.08  ? 181  GLU D CD  1 
ATOM   8741  O  OE1 . GLU D  1 181 ? -31.275 68.657  59.295  1.00 65.30  ? 181  GLU D OE1 1 
ATOM   8742  O  OE2 . GLU D  1 181 ? -32.670 67.754  60.741  1.00 60.16  ? 181  GLU D OE2 1 
ATOM   8743  N  N   . THR D  1 182 ? -30.207 73.030  62.337  1.00 43.81  ? 182  THR D N   1 
ATOM   8744  C  CA  . THR D  1 182 ? -29.588 73.176  63.652  1.00 40.16  ? 182  THR D CA  1 
ATOM   8745  C  C   . THR D  1 182 ? -30.325 74.218  64.486  1.00 39.43  ? 182  THR D C   1 
ATOM   8746  O  O   . THR D  1 182 ? -30.711 73.953  65.629  1.00 40.90  ? 182  THR D O   1 
ATOM   8747  C  CB  . THR D  1 182 ? -28.112 73.557  63.504  1.00 39.72  ? 182  THR D CB  1 
ATOM   8748  O  OG1 . THR D  1 182 ? -27.408 72.529  62.797  1.00 42.03  ? 182  THR D OG1 1 
ATOM   8749  C  CG2 . THR D  1 182 ? -27.473 73.790  64.872  1.00 35.35  ? 182  THR D CG2 1 
ATOM   8750  N  N   . LEU D  1 183 ? -30.570 75.398  63.905  1.00 36.65  ? 183  LEU D N   1 
ATOM   8751  C  CA  . LEU D  1 183 ? -31.157 76.506  64.660  1.00 46.34  ? 183  LEU D CA  1 
ATOM   8752  C  C   . LEU D  1 183 ? -32.616 76.244  65.013  1.00 48.52  ? 183  LEU D C   1 
ATOM   8753  O  O   . LEU D  1 183 ? -33.077 76.604  66.105  1.00 40.41  ? 183  LEU D O   1 
ATOM   8754  C  CB  . LEU D  1 183 ? -31.032 77.795  63.857  1.00 36.87  ? 183  LEU D CB  1 
ATOM   8755  C  CG  . LEU D  1 183 ? -29.560 78.180  63.740  1.00 37.62  ? 183  LEU D CG  1 
ATOM   8756  C  CD1 . LEU D  1 183 ? -29.349 79.227  62.656  1.00 38.45  ? 183  LEU D CD1 1 
ATOM   8757  C  CD2 . LEU D  1 183 ? -29.023 78.656  65.100  1.00 34.79  ? 183  LEU D CD2 1 
ATOM   8758  N  N   . GLU D  1 184 ? -33.362 75.625  64.101  1.00 52.96  ? 184  GLU D N   1 
ATOM   8759  C  CA  . GLU D  1 184 ? -34.746 75.293  64.405  1.00 48.30  ? 184  GLU D CA  1 
ATOM   8760  C  C   . GLU D  1 184 ? -34.825 74.260  65.523  1.00 46.33  ? 184  GLU D C   1 
ATOM   8761  O  O   . GLU D  1 184 ? -35.655 74.374  66.427  1.00 45.52  ? 184  GLU D O   1 
ATOM   8762  C  CB  . GLU D  1 184 ? -35.442 74.838  63.119  1.00 42.01  ? 184  GLU D CB  1 
ATOM   8763  C  CG  . GLU D  1 184 ? -35.661 76.028  62.168  1.00 42.82  ? 184  GLU D CG  1 
ATOM   8764  C  CD  . GLU D  1 184 ? -36.322 75.673  60.851  1.00 51.99  ? 184  GLU D CD  1 
ATOM   8765  O  OE1 . GLU D  1 184 ? -36.282 74.496  60.446  1.00 56.26  ? 184  GLU D OE1 1 
ATOM   8766  O  OE2 . GLU D  1 184 ? -36.907 76.582  60.232  1.00 61.18  ? 184  GLU D OE2 1 
ATOM   8767  N  N   . TRP D  1 185 ? -33.936 73.271  65.512  1.00 39.57  ? 185  TRP D N   1 
ATOM   8768  C  CA  . TRP D  1 185 ? -33.897 72.318  66.612  1.00 41.47  ? 185  TRP D CA  1 
ATOM   8769  C  C   . TRP D  1 185 ? -33.600 73.026  67.931  1.00 46.98  ? 185  TRP D C   1 
ATOM   8770  O  O   . TRP D  1 185 ? -34.274 72.804  68.947  1.00 47.27  ? 185  TRP D O   1 
ATOM   8771  C  CB  . TRP D  1 185 ? -32.846 71.252  66.307  1.00 46.58  ? 185  TRP D CB  1 
ATOM   8772  C  CG  . TRP D  1 185 ? -32.886 70.057  67.186  1.00 43.73  ? 185  TRP D CG  1 
ATOM   8773  C  CD1 . TRP D  1 185 ? -33.408 68.837  66.874  1.00 45.53  ? 185  TRP D CD1 1 
ATOM   8774  C  CD2 . TRP D  1 185 ? -32.363 69.943  68.523  1.00 42.75  ? 185  TRP D CD2 1 
ATOM   8775  N  NE1 . TRP D  1 185 ? -33.252 67.971  67.931  1.00 48.97  ? 185  TRP D NE1 1 
ATOM   8776  C  CE2 . TRP D  1 185 ? -32.613 68.623  68.955  1.00 43.17  ? 185  TRP D CE2 1 
ATOM   8777  C  CE3 . TRP D  1 185 ? -31.713 70.825  69.393  1.00 40.56  ? 185  TRP D CE3 1 
ATOM   8778  C  CZ2 . TRP D  1 185 ? -32.244 68.167  70.216  1.00 43.07  ? 185  TRP D CZ2 1 
ATOM   8779  C  CZ3 . TRP D  1 185 ? -31.343 70.366  70.653  1.00 49.01  ? 185  TRP D CZ3 1 
ATOM   8780  C  CH2 . TRP D  1 185 ? -31.614 69.053  71.052  1.00 44.27  ? 185  TRP D CH2 1 
ATOM   8781  N  N   . MET D  1 186 ? -32.602 73.902  67.926  1.00 40.91  ? 186  MET D N   1 
ATOM   8782  C  CA  . MET D  1 186 ? -32.240 74.603  69.150  1.00 43.66  ? 186  MET D CA  1 
ATOM   8783  C  C   . MET D  1 186 ? -33.379 75.481  69.649  1.00 44.51  ? 186  MET D C   1 
ATOM   8784  O  O   . MET D  1 186 ? -33.642 75.536  70.859  1.00 38.80  ? 186  MET D O   1 
ATOM   8785  C  CB  . MET D  1 186 ? -30.978 75.428  68.930  1.00 37.63  ? 186  MET D CB  1 
ATOM   8786  C  CG  . MET D  1 186 ? -29.748 74.558  68.718  1.00 39.79  ? 186  MET D CG  1 
ATOM   8787  S  SD  . MET D  1 186 ? -28.345 75.611  68.364  1.00 50.26  ? 186  MET D SD  1 
ATOM   8788  C  CE  . MET D  1 186 ? -28.264 76.531  69.873  1.00 47.81  ? 186  MET D CE  1 
ATOM   8789  N  N   . LYS D  1 187 ? -34.066 76.178  68.737  1.00 43.86  ? 187  LYS D N   1 
ATOM   8790  C  CA  . LYS D  1 187 ? -35.150 77.046  69.178  1.00 51.62  ? 187  LYS D CA  1 
ATOM   8791  C  C   . LYS D  1 187 ? -36.305 76.233  69.739  1.00 50.93  ? 187  LYS D C   1 
ATOM   8792  O  O   . LYS D  1 187 ? -36.998 76.691  70.656  1.00 46.38  ? 187  LYS D O   1 
ATOM   8793  C  CB  . LYS D  1 187 ? -35.628 77.950  68.040  1.00 54.84  ? 187  LYS D CB  1 
ATOM   8794  C  CG  . LYS D  1 187 ? -36.562 79.052  68.535  1.00 52.61  ? 187  LYS D CG  1 
ATOM   8795  C  CD  . LYS D  1 187 ? -36.439 80.334  67.728  1.00 59.48  ? 187  LYS D CD  1 
ATOM   8796  C  CE  . LYS D  1 187 ? -37.398 81.404  68.257  1.00 62.11  ? 187  LYS D CE  1 
ATOM   8797  N  NZ  . LYS D  1 187 ? -38.805 80.924  68.258  1.00 55.43  ? 187  LYS D NZ  1 
ATOM   8798  N  N   . ALA D  1 188 ? -36.504 75.014  69.240  1.00 49.63  ? 188  ALA D N   1 
ATOM   8799  C  CA  . ALA D  1 188 ? -37.564 74.191  69.796  1.00 45.54  ? 188  ALA D CA  1 
ATOM   8800  C  C   . ALA D  1 188 ? -37.187 73.582  71.144  1.00 44.39  ? 188  ALA D C   1 
ATOM   8801  O  O   . ALA D  1 188 ? -38.067 73.383  71.986  1.00 44.70  ? 188  ALA D O   1 
ATOM   8802  C  CB  . ALA D  1 188 ? -37.925 73.073  68.822  1.00 45.54  ? 188  ALA D CB  1 
ATOM   8803  N  N   . ASN D  1 189 ? -35.898 73.339  71.405  1.00 40.51  ? 189  ASN D N   1 
ATOM   8804  C  CA  . ASN D  1 189 ? -35.526 72.406  72.462  1.00 42.75  ? 189  ASN D CA  1 
ATOM   8805  C  C   . ASN D  1 189 ? -34.600 72.940  73.546  1.00 42.11  ? 189  ASN D C   1 
ATOM   8806  O  O   . ASN D  1 189 ? -34.454 72.267  74.571  1.00 43.96  ? 189  ASN D O   1 
ATOM   8807  C  CB  . ASN D  1 189 ? -34.863 71.164  71.846  1.00 41.55  ? 189  ASN D CB  1 
ATOM   8808  C  CG  . ASN D  1 189 ? -35.827 70.358  70.998  1.00 49.36  ? 189  ASN D CG  1 
ATOM   8809  O  OD1 . ASN D  1 189 ? -36.876 69.921  71.470  1.00 53.55  ? 189  ASN D OD1 1 
ATOM   8810  N  ND2 . ASN D  1 189 ? -35.505 70.217  69.721  1.00 45.05  ? 189  ASN D ND2 1 
ATOM   8811  N  N   . VAL D  1 190 ? -33.981 74.098  73.377  1.00 39.35  ? 190  VAL D N   1 
ATOM   8812  C  CA  . VAL D  1 190 ? -32.941 74.582  74.287  1.00 38.28  ? 190  VAL D CA  1 
ATOM   8813  C  C   . VAL D  1 190 ? -33.485 75.777  75.059  1.00 42.26  ? 190  VAL D C   1 
ATOM   8814  O  O   . VAL D  1 190 ? -33.963 76.732  74.439  1.00 45.24  ? 190  VAL D O   1 
ATOM   8815  C  CB  . VAL D  1 190 ? -31.658 74.970  73.534  1.00 37.88  ? 190  VAL D CB  1 
ATOM   8816  C  CG1 . VAL D  1 190 ? -30.598 75.459  74.521  1.00 33.75  ? 190  VAL D CG1 1 
ATOM   8817  C  CG2 . VAL D  1 190 ? -31.156 73.790  72.728  1.00 38.55  ? 190  VAL D CG2 1 
ATOM   8818  N  N   . PRO D  1 191 ? -33.414 75.777  76.388  1.00 38.62  ? 191  PRO D N   1 
ATOM   8819  C  CA  . PRO D  1 191 ? -33.987 76.890  77.155  1.00 44.55  ? 191  PRO D CA  1 
ATOM   8820  C  C   . PRO D  1 191 ? -33.296 78.213  76.857  1.00 39.69  ? 191  PRO D C   1 
ATOM   8821  O  O   . PRO D  1 191 ? -32.082 78.282  76.667  1.00 36.91  ? 191  PRO D O   1 
ATOM   8822  C  CB  . PRO D  1 191 ? -33.780 76.469  78.622  1.00 42.23  ? 191  PRO D CB  1 
ATOM   8823  C  CG  . PRO D  1 191 ? -32.938 75.270  78.604  1.00 36.42  ? 191  PRO D CG  1 
ATOM   8824  C  CD  . PRO D  1 191 ? -32.981 74.663  77.247  1.00 35.01  ? 191  PRO D CD  1 
ATOM   8825  N  N   . GLY D  1 192 ? -34.093 79.271  76.816  1.00 36.05  ? 192  GLY D N   1 
ATOM   8826  C  CA  . GLY D  1 192 ? -33.540 80.601  76.710  1.00 43.90  ? 192  GLY D CA  1 
ATOM   8827  C  C   . GLY D  1 192 ? -33.113 81.028  75.329  1.00 40.33  ? 192  GLY D C   1 
ATOM   8828  O  O   . GLY D  1 192 ? -32.501 82.092  75.198  1.00 37.85  ? 192  GLY D O   1 
ATOM   8829  N  N   . MET D  1 193 ? -33.387 80.231  74.299  1.00 38.56  ? 193  MET D N   1 
ATOM   8830  C  CA  . MET D  1 193 ? -33.081 80.652  72.941  1.00 42.12  ? 193  MET D CA  1 
ATOM   8831  C  C   . MET D  1 193 ? -34.174 81.588  72.443  1.00 42.66  ? 193  MET D C   1 
ATOM   8832  O  O   . MET D  1 193 ? -35.333 81.185  72.305  1.00 38.06  ? 193  MET D O   1 
ATOM   8833  C  CB  . MET D  1 193 ? -32.924 79.476  71.985  1.00 43.10  ? 193  MET D CB  1 
ATOM   8834  C  CG  . MET D  1 193 ? -32.920 80.008  70.559  1.00 44.61  ? 193  MET D CG  1 
ATOM   8835  S  SD  . MET D  1 193 ? -32.167 78.856  69.489  1.00 66.31  ? 193  MET D SD  1 
ATOM   8836  C  CE  . MET D  1 193 ? -31.814 79.905  68.103  1.00 68.43  ? 193  MET D CE  1 
ATOM   8837  N  N   . VAL D  1 194 ? -33.796 82.829  72.165  1.00 44.52  ? 194  VAL D N   1 
ATOM   8838  C  CA  . VAL D  1 194 ? -34.768 83.864  71.851  1.00 41.06  ? 194  VAL D CA  1 
ATOM   8839  C  C   . VAL D  1 194 ? -35.061 83.907  70.359  1.00 42.76  ? 194  VAL D C   1 
ATOM   8840  O  O   . VAL D  1 194 ? -36.218 84.013  69.955  1.00 43.50  ? 194  VAL D O   1 
ATOM   8841  C  CB  . VAL D  1 194 ? -34.246 85.210  72.382  1.00 40.21  ? 194  VAL D CB  1 
ATOM   8842  C  CG1 . VAL D  1 194 ? -35.097 86.356  71.894  1.00 37.90  ? 194  VAL D CG1 1 
ATOM   8843  C  CG2 . VAL D  1 194 ? -34.191 85.177  73.910  1.00 38.54  ? 194  VAL D CG2 1 
ATOM   8844  N  N   . GLY D  1 195 ? -34.046 83.773  69.517  1.00 38.84  ? 195  GLY D N   1 
ATOM   8845  C  CA  . GLY D  1 195 ? -34.285 83.797  68.087  1.00 37.92  ? 195  GLY D CA  1 
ATOM   8846  C  C   . GLY D  1 195 ? -32.979 83.668  67.345  1.00 40.67  ? 195  GLY D C   1 
ATOM   8847  O  O   . GLY D  1 195 ? -31.905 83.601  67.945  1.00 39.46  ? 195  GLY D O   1 
ATOM   8848  N  N   . TRP D  1 196 ? -33.076 83.646  66.020  1.00 42.99  ? 196  TRP D N   1 
ATOM   8849  C  CA  . TRP D  1 196 ? -31.867 83.446  65.235  1.00 42.87  ? 196  TRP D CA  1 
ATOM   8850  C  C   . TRP D  1 196 ? -32.050 84.023  63.838  1.00 45.06  ? 196  TRP D C   1 
ATOM   8851  O  O   . TRP D  1 196 ? -33.165 84.319  63.398  1.00 43.83  ? 196  TRP D O   1 
ATOM   8852  C  CB  . TRP D  1 196 ? -31.487 81.962  65.159  1.00 36.67  ? 196  TRP D CB  1 
ATOM   8853  C  CG  . TRP D  1 196 ? -32.557 81.067  64.555  1.00 37.43  ? 196  TRP D CG  1 
ATOM   8854  C  CD1 . TRP D  1 196 ? -33.494 80.344  65.240  1.00 37.40  ? 196  TRP D CD1 1 
ATOM   8855  C  CD2 . TRP D  1 196 ? -32.799 80.804  63.156  1.00 34.50  ? 196  TRP D CD2 1 
ATOM   8856  N  NE1 . TRP D  1 196 ? -34.290 79.648  64.363  1.00 41.23  ? 196  TRP D NE1 1 
ATOM   8857  C  CE2 . TRP D  1 196 ? -33.889 79.917  63.080  1.00 37.31  ? 196  TRP D CE2 1 
ATOM   8858  C  CE3 . TRP D  1 196 ? -32.206 81.241  61.969  1.00 38.08  ? 196  TRP D CE3 1 
ATOM   8859  C  CZ2 . TRP D  1 196 ? -34.397 79.450  61.859  1.00 43.43  ? 196  TRP D CZ2 1 
ATOM   8860  C  CZ3 . TRP D  1 196 ? -32.707 80.780  60.762  1.00 40.04  ? 196  TRP D CZ3 1 
ATOM   8861  C  CH2 . TRP D  1 196 ? -33.792 79.890  60.715  1.00 43.06  ? 196  TRP D CH2 1 
ATOM   8862  N  N   . MET D  1 197 ? -30.922 84.153  63.141  1.00 41.79  ? 197  MET D N   1 
ATOM   8863  C  CA  . MET D  1 197 ? -30.877 84.703  61.795  1.00 39.79  ? 197  MET D CA  1 
ATOM   8864  C  C   . MET D  1 197 ? -29.583 84.233  61.138  1.00 47.66  ? 197  MET D C   1 
ATOM   8865  O  O   . MET D  1 197 ? -28.524 84.263  61.773  1.00 46.66  ? 197  MET D O   1 
ATOM   8866  C  CB  . MET D  1 197 ? -30.953 86.221  61.886  1.00 45.48  ? 197  MET D CB  1 
ATOM   8867  C  CG  . MET D  1 197 ? -30.769 86.973  60.630  1.00 48.41  ? 197  MET D CG  1 
ATOM   8868  S  SD  . MET D  1 197 ? -31.212 88.692  60.978  1.00 50.44  ? 197  MET D SD  1 
ATOM   8869  C  CE  . MET D  1 197 ? -29.967 89.158  62.178  1.00 43.48  ? 197  MET D CE  1 
ATOM   8870  N  N   . ILE D  1 198 ? -29.671 83.771  59.891  1.00 45.61  ? 198  ILE D N   1 
ATOM   8871  C  CA  . ILE D  1 198 ? -28.511 83.368  59.097  1.00 46.37  ? 198  ILE D CA  1 
ATOM   8872  C  C   . ILE D  1 198 ? -28.236 84.468  58.074  1.00 44.67  ? 198  ILE D C   1 
ATOM   8873  O  O   . ILE D  1 198 ? -29.091 84.770  57.234  1.00 42.99  ? 198  ILE D O   1 
ATOM   8874  C  CB  . ILE D  1 198 ? -28.752 82.017  58.394  1.00 43.94  ? 198  ILE D CB  1 
ATOM   8875  C  CG1 . ILE D  1 198 ? -28.953 80.889  59.399  1.00 37.25  ? 198  ILE D CG1 1 
ATOM   8876  C  CG2 . ILE D  1 198 ? -27.585 81.647  57.509  1.00 41.99  ? 198  ILE D CG2 1 
ATOM   8877  C  CD1 . ILE D  1 198 ? -29.508 79.612  58.760  1.00 35.71  ? 198  ILE D CD1 1 
ATOM   8878  N  N   . MET D  1 199 ? -27.040 85.047  58.116  1.00 42.09  ? 199  MET D N   1 
ATOM   8879  C  CA  . MET D  1 199 ? -26.665 86.164  57.259  1.00 45.44  ? 199  MET D CA  1 
ATOM   8880  C  C   . MET D  1 199 ? -25.526 85.723  56.353  1.00 47.93  ? 199  MET D C   1 
ATOM   8881  O  O   . MET D  1 199 ? -24.584 85.081  56.818  1.00 47.34  ? 199  MET D O   1 
ATOM   8882  C  CB  . MET D  1 199 ? -26.229 87.375  58.093  1.00 45.47  ? 199  MET D CB  1 
ATOM   8883  C  CG  . MET D  1 199 ? -27.295 87.885  59.028  1.00 48.39  ? 199  MET D CG  1 
ATOM   8884  S  SD  . MET D  1 199 ? -26.825 89.319  60.019  1.00 46.83  ? 199  MET D SD  1 
ATOM   8885  C  CE  . MET D  1 199 ? -25.618 88.619  61.117  1.00 47.57  ? 199  MET D CE  1 
ATOM   8886  N  N   . LYS D  1 200 ? -25.613 86.053  55.066  1.00 48.06  ? 200  LYS D N   1 
ATOM   8887  C  CA  . LYS D  1 200 ? -24.602 85.673  54.081  1.00 41.92  ? 200  LYS D CA  1 
ATOM   8888  C  C   . LYS D  1 200 ? -23.946 86.936  53.539  1.00 40.38  ? 200  LYS D C   1 
ATOM   8889  O  O   . LYS D  1 200 ? -24.635 87.810  53.002  1.00 40.15  ? 200  LYS D O   1 
ATOM   8890  C  CB  . LYS D  1 200 ? -25.225 84.853  52.946  1.00 35.56  ? 200  LYS D CB  1 
ATOM   8891  C  CG  . LYS D  1 200 ? -24.261 84.355  51.869  1.00 38.57  ? 200  LYS D CG  1 
ATOM   8892  C  CD  . LYS D  1 200 ? -25.091 83.747  50.723  1.00 46.50  ? 200  LYS D CD  1 
ATOM   8893  C  CE  . LYS D  1 200 ? -24.245 83.200  49.594  1.00 52.58  ? 200  LYS D CE  1 
ATOM   8894  N  NZ  . LYS D  1 200 ? -25.091 82.770  48.451  1.00 52.59  ? 200  LYS D NZ  1 
ATOM   8895  N  N   . GLN D  1 201 ? -22.623 87.039  53.679  1.00 33.78  ? 201  GLN D N   1 
ATOM   8896  C  CA  . GLN D  1 201 ? -21.917 88.187  53.126  1.00 43.26  ? 201  GLN D CA  1 
ATOM   8897  C  C   . GLN D  1 201 ? -21.865 88.079  51.609  1.00 45.46  ? 201  GLN D C   1 
ATOM   8898  O  O   . GLN D  1 201 ? -21.505 87.031  51.065  1.00 43.48  ? 201  GLN D O   1 
ATOM   8899  C  CB  . GLN D  1 201 ? -20.497 88.295  53.675  1.00 41.52  ? 201  GLN D CB  1 
ATOM   8900  C  CG  . GLN D  1 201 ? -19.743 89.457  53.035  1.00 40.30  ? 201  GLN D CG  1 
ATOM   8901  C  CD  . GLN D  1 201 ? -18.262 89.493  53.337  1.00 41.91  ? 201  GLN D CD  1 
ATOM   8902  O  OE1 . GLN D  1 201 ? -17.468 89.928  52.499  1.00 43.56  ? 201  GLN D OE1 1 
ATOM   8903  N  NE2 . GLN D  1 201 ? -17.874 89.013  54.513  1.00 39.20  ? 201  GLN D NE2 1 
ATOM   8904  N  N   . PHE D  1 202 ? -22.270 89.149  50.921  1.00 47.19  ? 202  PHE D N   1 
ATOM   8905  C  CA  . PHE D  1 202 ? -22.217 89.181  49.461  1.00 45.29  ? 202  PHE D CA  1 
ATOM   8906  C  C   . PHE D  1 202 ? -21.523 90.416  48.907  1.00 45.62  ? 202  PHE D C   1 
ATOM   8907  O  O   . PHE D  1 202 ? -21.507 90.598  47.687  1.00 50.03  ? 202  PHE D O   1 
ATOM   8908  C  CB  . PHE D  1 202 ? -23.631 89.080  48.852  1.00 46.16  ? 202  PHE D CB  1 
ATOM   8909  C  CG  . PHE D  1 202 ? -24.505 90.276  49.137  1.00 48.22  ? 202  PHE D CG  1 
ATOM   8910  C  CD1 . PHE D  1 202 ? -25.221 90.355  50.325  1.00 53.23  ? 202  PHE D CD1 1 
ATOM   8911  C  CD2 . PHE D  1 202 ? -24.623 91.314  48.211  1.00 44.00  ? 202  PHE D CD2 1 
ATOM   8912  C  CE1 . PHE D  1 202 ? -26.028 91.456  50.599  1.00 51.33  ? 202  PHE D CE1 1 
ATOM   8913  C  CE2 . PHE D  1 202 ? -25.428 92.413  48.473  1.00 45.21  ? 202  PHE D CE2 1 
ATOM   8914  C  CZ  . PHE D  1 202 ? -26.130 92.485  49.669  1.00 46.88  ? 202  PHE D CZ  1 
ATOM   8915  N  N   . GLY D  1 203 ? -20.969 91.269  49.752  1.00 44.64  ? 203  GLY D N   1 
ATOM   8916  C  CA  . GLY D  1 203 ? -20.277 92.445  49.271  1.00 41.87  ? 203  GLY D CA  1 
ATOM   8917  C  C   . GLY D  1 203 ? -19.893 93.317  50.442  1.00 40.96  ? 203  GLY D C   1 
ATOM   8918  O  O   . GLY D  1 203 ? -20.217 93.022  51.594  1.00 40.92  ? 203  GLY D O   1 
ATOM   8919  N  N   . VAL D  1 204 ? -19.172 94.394  50.125  1.00 39.68  ? 204  VAL D N   1 
ATOM   8920  C  CA  . VAL D  1 204 ? -18.666 95.328  51.125  1.00 39.75  ? 204  VAL D CA  1 
ATOM   8921  C  C   . VAL D  1 204 ? -18.871 96.740  50.608  1.00 42.25  ? 204  VAL D C   1 
ATOM   8922  O  O   . VAL D  1 204 ? -18.728 96.997  49.409  1.00 47.65  ? 204  VAL D O   1 
ATOM   8923  C  CB  . VAL D  1 204 ? -17.170 95.101  51.435  1.00 41.78  ? 204  VAL D CB  1 
ATOM   8924  C  CG1 . VAL D  1 204 ? -16.716 96.027  52.552  1.00 36.57  ? 204  VAL D CG1 1 
ATOM   8925  C  CG2 . VAL D  1 204 ? -16.876 93.632  51.767  1.00 40.74  ? 204  VAL D CG2 1 
ATOM   8926  N  N   . SER D  1 205 ? -19.204 97.653  51.510  1.00 44.52  ? 205  SER D N   1 
ATOM   8927  C  CA  . SER D  1 205 ? -19.296 99.068  51.170  1.00 53.87  ? 205  SER D CA  1 
ATOM   8928  C  C   . SER D  1 205 ? -17.913 99.699  51.247  1.00 51.38  ? 205  SER D C   1 
ATOM   8929  O  O   . SER D  1 205 ? -17.260 99.647  52.298  1.00 46.12  ? 205  SER D O   1 
ATOM   8930  C  CB  . SER D  1 205 ? -20.261 99.785  52.113  1.00 50.14  ? 205  SER D CB  1 
ATOM   8931  O  OG  . SER D  1 205 ? -20.198 101.188 51.929  1.00 48.14  ? 205  SER D OG  1 
ATOM   8932  N  N   . ALA D  1 206 ? -17.468 100.306 50.146  1.00 45.43  ? 206  ALA D N   1 
ATOM   8933  C  CA  . ALA D  1 206 ? -16.177 100.983 50.178  1.00 49.71  ? 206  ALA D CA  1 
ATOM   8934  C  C   . ALA D  1 206 ? -16.234 102.224 51.064  1.00 46.28  ? 206  ALA D C   1 
ATOM   8935  O  O   . ALA D  1 206 ? -15.401 102.393 51.961  1.00 50.59  ? 206  ALA D O   1 
ATOM   8936  C  CB  . ALA D  1 206 ? -15.733 101.342 48.761  1.00 57.46  ? 206  ALA D CB  1 
ATOM   8937  N  N   . ILE D  1 207 ? -17.233 103.085 50.854  1.00 47.25  ? 207  ILE D N   1 
ATOM   8938  C  CA  . ILE D  1 207 ? -17.357 104.306 51.651  1.00 47.58  ? 207  ILE D CA  1 
ATOM   8939  C  C   . ILE D  1 207 ? -17.513 103.969 53.133  1.00 45.66  ? 207  ILE D C   1 
ATOM   8940  O  O   . ILE D  1 207 ? -16.850 104.560 53.994  1.00 54.45  ? 207  ILE D O   1 
ATOM   8941  C  CB  . ILE D  1 207 ? -18.536 105.161 51.141  1.00 44.57  ? 207  ILE D CB  1 
ATOM   8942  C  CG1 . ILE D  1 207 ? -18.243 105.742 49.757  1.00 46.05  ? 207  ILE D CG1 1 
ATOM   8943  C  CG2 . ILE D  1 207 ? -18.835 106.304 52.093  1.00 39.63  ? 207  ILE D CG2 1 
ATOM   8944  C  CD1 . ILE D  1 207 ? -17.217 106.858 49.784  1.00 44.13  ? 207  ILE D CD1 1 
ATOM   8945  N  N   . GLY D  1 208 ? -18.382 103.007 53.455  1.00 49.57  ? 208  GLY D N   1 
ATOM   8946  C  CA  . GLY D  1 208 ? -18.604 102.629 54.849  1.00 48.34  ? 208  GLY D CA  1 
ATOM   8947  C  C   . GLY D  1 208 ? -17.406 101.994 55.534  1.00 48.84  ? 208  GLY D C   1 
ATOM   8948  O  O   . GLY D  1 208 ? -17.313 102.021 56.769  1.00 40.08  ? 208  GLY D O   1 
ATOM   8949  N  N   . SER D  1 209 ? -16.491 101.420 54.767  1.00 44.42  ? 209  SER D N   1 
ATOM   8950  C  CA  . SER D  1 209 ? -15.270 100.857 55.316  1.00 46.36  ? 209  SER D CA  1 
ATOM   8951  C  C   . SER D  1 209 ? -14.140 101.864 55.319  1.00 46.05  ? 209  SER D C   1 
ATOM   8952  O  O   . SER D  1 209 ? -12.984 101.489 55.556  1.00 41.00  ? 209  SER D O   1 
ATOM   8953  C  CB  . SER D  1 209 ? -14.866 99.606  54.536  1.00 44.67  ? 209  SER D CB  1 
ATOM   8954  O  OG  . SER D  1 209 ? -15.904 98.646  54.579  1.00 48.37  ? 209  SER D OG  1 
ATOM   8955  N  N   . PHE D  1 210 ? -14.450 103.128 55.033  1.00 44.97  ? 210  PHE D N   1 
ATOM   8956  C  CA  . PHE D  1 210 ? -13.460 104.199 54.994  1.00 54.43  ? 210  PHE D CA  1 
ATOM   8957  C  C   . PHE D  1 210 ? -12.346 103.906 53.994  1.00 48.35  ? 210  PHE D C   1 
ATOM   8958  O  O   . PHE D  1 210 ? -11.189 104.267 54.206  1.00 49.79  ? 210  PHE D O   1 
ATOM   8959  C  CB  . PHE D  1 210 ? -12.880 104.460 56.384  1.00 61.93  ? 210  PHE D CB  1 
ATOM   8960  C  CG  . PHE D  1 210 ? -12.513 105.884 56.619  1.00 77.85  ? 210  PHE D CG  1 
ATOM   8961  C  CD1 . PHE D  1 210 ? -13.491 106.863 56.655  1.00 86.19  ? 210  PHE D CD1 1 
ATOM   8962  C  CD2 . PHE D  1 210 ? -11.191 106.250 56.816  1.00 85.34  ? 210  PHE D CD2 1 
ATOM   8963  C  CE1 . PHE D  1 210 ? -13.151 108.185 56.875  1.00 92.65  ? 210  PHE D CE1 1 
ATOM   8964  C  CE2 . PHE D  1 210 ? -10.844 107.569 57.037  1.00 89.20  ? 210  PHE D CE2 1 
ATOM   8965  C  CZ  . PHE D  1 210 ? -11.823 108.538 57.069  1.00 90.91  ? 210  PHE D CZ  1 
ATOM   8966  N  N   . GLN D  1 211 ? -12.683 103.251 52.894  1.00 49.21  ? 211  GLN D N   1 
ATOM   8967  C  CA  . GLN D  1 211 ? -11.692 102.856 51.901  1.00 49.79  ? 211  GLN D CA  1 
ATOM   8968  C  C   . GLN D  1 211 ? -11.857 103.820 50.733  1.00 46.76  ? 211  GLN D C   1 
ATOM   8969  O  O   . GLN D  1 211 ? -12.683 103.625 49.839  1.00 48.18  ? 211  GLN D O   1 
ATOM   8970  C  CB  . GLN D  1 211 ? -11.867 101.392 51.507  1.00 46.49  ? 211  GLN D CB  1 
ATOM   8971  C  CG  A GLN D  1 211 ? -11.591 100.398 52.655  0.70 46.56  ? 211  GLN D CG  1 
ATOM   8972  C  CG  B GLN D  1 211 ? -10.612 100.555 51.597  0.30 47.06  ? 211  GLN D CG  1 
ATOM   8973  C  CD  A GLN D  1 211 ? -10.098 100.183 52.983  0.70 46.81  ? 211  GLN D CD  1 
ATOM   8974  C  CD  B GLN D  1 211 ? -10.144 100.356 53.021  0.30 45.79  ? 211  GLN D CD  1 
ATOM   8975  O  OE1 A GLN D  1 211 ? -9.769  99.582  54.006  0.70 42.10  ? 211  GLN D OE1 1 
ATOM   8976  O  OE1 B GLN D  1 211 ? -10.948 100.118 53.922  0.30 46.22  ? 211  GLN D OE1 1 
ATOM   8977  N  NE2 A GLN D  1 211 ? -9.202  100.656 52.111  0.70 44.65  ? 211  GLN D NE2 1 
ATOM   8978  N  NE2 B GLN D  1 211 ? -8.836  100.457 53.233  0.30 41.92  ? 211  GLN D NE2 1 
ATOM   8979  N  N   . LEU D  1 212 ? -11.070 104.884 50.755  1.00 48.68  ? 212  LEU D N   1 
ATOM   8980  C  CA  . LEU D  1 212 ? -11.174 105.941 49.762  1.00 46.85  ? 212  LEU D CA  1 
ATOM   8981  C  C   . LEU D  1 212 ? -10.129 105.763 48.669  1.00 49.33  ? 212  LEU D C   1 
ATOM   8982  O  O   . LEU D  1 212 ? -9.271  104.874 48.714  1.00 52.07  ? 212  LEU D O   1 
ATOM   8983  C  CB  . LEU D  1 212 ? -11.009 107.305 50.431  1.00 47.41  ? 212  LEU D CB  1 
ATOM   8984  C  CG  . LEU D  1 212 ? -11.923 107.454 51.648  1.00 53.66  ? 212  LEU D CG  1 
ATOM   8985  C  CD1 . LEU D  1 212 ? -11.743 108.800 52.305  1.00 48.81  ? 212  LEU D CD1 1 
ATOM   8986  C  CD2 . LEU D  1 212 ? -13.371 107.246 51.222  1.00 56.60  ? 212  LEU D CD2 1 
ATOM   8987  N  N   . ASP D  1 213 ? -10.229 106.626 47.661  1.00 47.50  ? 213  ASP D N   1 
ATOM   8988  C  CA  . ASP D  1 213 ? -9.168  106.778 46.694  1.00 49.84  ? 213  ASP D CA  1 
ATOM   8989  C  C   . ASP D  1 213 ? -7.926  107.333 47.397  1.00 50.93  ? 213  ASP D C   1 
ATOM   8990  O  O   . ASP D  1 213 ? -8.010  107.833 48.520  1.00 45.12  ? 213  ASP D O   1 
ATOM   8991  C  CB  . ASP D  1 213 ? -9.631  107.701 45.572  1.00 54.63  ? 213  ASP D CB  1 
ATOM   8992  C  CG  . ASP D  1 213 ? -9.832  109.115 46.042  1.00 62.14  ? 213  ASP D CG  1 
ATOM   8993  O  OD1 . ASP D  1 213 ? -10.678 109.312 46.930  1.00 69.61  ? 213  ASP D OD1 1 
ATOM   8994  O  OD2 . ASP D  1 213 ? -9.156  110.030 45.525  1.00 68.60  ? 213  ASP D OD2 1 
ATOM   8995  N  N   . PRO D  1 214 ? -6.753  107.245 46.766  1.00 53.99  ? 214  PRO D N   1 
ATOM   8996  C  CA  . PRO D  1 214 ? -5.531  107.671 47.481  1.00 58.09  ? 214  PRO D CA  1 
ATOM   8997  C  C   . PRO D  1 214 ? -5.542  109.129 47.940  1.00 58.14  ? 214  PRO D C   1 
ATOM   8998  O  O   . PRO D  1 214 ? -5.123  109.406 49.073  1.00 56.20  ? 214  PRO D O   1 
ATOM   8999  C  CB  . PRO D  1 214 ? -4.418  107.376 46.460  1.00 57.55  ? 214  PRO D CB  1 
ATOM   9000  C  CG  . PRO D  1 214 ? -4.971  106.236 45.635  1.00 47.48  ? 214  PRO D CG  1 
ATOM   9001  C  CD  . PRO D  1 214 ? -6.442  106.556 45.496  1.00 47.11  ? 214  PRO D CD  1 
ATOM   9002  N  N   . GLU D  1 215 ? -6.017  110.071 47.113  1.00 52.06  ? 215  GLU D N   1 
ATOM   9003  C  CA  . GLU D  1 215 ? -6.039  111.475 47.541  1.00 62.50  ? 215  GLU D CA  1 
ATOM   9004  C  C   . GLU D  1 215 ? -7.042  111.708 48.666  1.00 61.29  ? 215  GLU D C   1 
ATOM   9005  O  O   . GLU D  1 215 ? -6.782  112.498 49.582  1.00 64.76  ? 215  GLU D O   1 
ATOM   9006  C  CB  . GLU D  1 215 ? -6.331  112.403 46.358  1.00 68.66  ? 215  GLU D CB  1 
ATOM   9007  C  CG  . GLU D  1 215 ? -5.155  112.580 45.397  1.00 78.58  ? 215  GLU D CG  1 
ATOM   9008  C  CD  . GLU D  1 215 ? -3.930  113.200 46.076  1.00 90.10  ? 215  GLU D CD  1 
ATOM   9009  O  OE1 . GLU D  1 215 ? -4.105  113.973 47.045  1.00 93.28  ? 215  GLU D OE1 1 
ATOM   9010  O  OE2 . GLU D  1 215 ? -2.790  112.922 45.637  1.00 93.64  ? 215  GLU D OE2 1 
ATOM   9011  N  N   . GLY D  1 216 ? -8.199  111.054 48.600  1.00 55.41  ? 216  GLY D N   1 
ATOM   9012  C  CA  . GLY D  1 216 ? -9.139  111.123 49.706  1.00 55.32  ? 216  GLY D CA  1 
ATOM   9013  C  C   . GLY D  1 216 ? -8.571  110.548 50.989  1.00 55.64  ? 216  GLY D C   1 
ATOM   9014  O  O   . GLY D  1 216 ? -8.831  111.060 52.080  1.00 57.89  ? 216  GLY D O   1 
ATOM   9015  N  N   . ALA D  1 217 ? -7.814  109.455 50.880  1.00 50.91  ? 217  ALA D N   1 
ATOM   9016  C  CA  . ALA D  1 217 ? -7.172  108.890 52.059  1.00 48.89  ? 217  ALA D CA  1 
ATOM   9017  C  C   . ALA D  1 217 ? -6.185  109.874 52.670  1.00 51.98  ? 217  ALA D C   1 
ATOM   9018  O  O   . ALA D  1 217 ? -6.119  110.017 53.897  1.00 52.90  ? 217  ALA D O   1 
ATOM   9019  C  CB  . ALA D  1 217 ? -6.478  107.572 51.706  1.00 48.38  ? 217  ALA D CB  1 
ATOM   9020  N  N   . MET D  1 218 ? -5.415  110.572 51.830  1.00 49.32  ? 218  MET D N   1 
ATOM   9021  C  CA  . MET D  1 218 ? -4.488  111.575 52.345  1.00 51.70  ? 218  MET D CA  1 
ATOM   9022  C  C   . MET D  1 218 ? -5.235  112.703 53.054  1.00 57.75  ? 218  MET D C   1 
ATOM   9023  O  O   . MET D  1 218 ? -4.888  113.086 54.179  1.00 61.79  ? 218  MET D O   1 
ATOM   9024  C  CB  . MET D  1 218 ? -3.615  112.124 51.217  1.00 62.90  ? 218  MET D CB  1 
ATOM   9025  C  CG  . MET D  1 218 ? -2.760  111.078 50.515  1.00 69.24  ? 218  MET D CG  1 
ATOM   9026  S  SD  . MET D  1 218 ? -1.740  110.073 51.617  1.00 76.61  ? 218  MET D SD  1 
ATOM   9027  C  CE  . MET D  1 218 ? -0.867  111.335 52.524  1.00 80.89  ? 218  MET D CE  1 
ATOM   9028  N  N   . LYS D  1 219 ? -6.267  113.251 52.409  1.00 50.38  ? 219  LYS D N   1 
ATOM   9029  C  CA  . LYS D  1 219 ? -6.997  114.356 53.019  1.00 53.32  ? 219  LYS D CA  1 
ATOM   9030  C  C   . LYS D  1 219 ? -7.703  113.924 54.291  1.00 54.61  ? 219  LYS D C   1 
ATOM   9031  O  O   . LYS D  1 219 ? -7.816  114.719 55.232  1.00 54.78  ? 219  LYS D O   1 
ATOM   9032  C  CB  . LYS D  1 219 ? -8.022  114.921 52.042  1.00 57.53  ? 219  LYS D CB  1 
ATOM   9033  C  CG  . LYS D  1 219 ? -7.399  115.615 50.874  1.00 64.98  ? 219  LYS D CG  1 
ATOM   9034  C  CD  . LYS D  1 219 ? -8.447  116.301 50.050  1.00 72.02  ? 219  LYS D CD  1 
ATOM   9035  C  CE  . LYS D  1 219 ? -7.795  117.126 48.975  1.00 81.67  ? 219  LYS D CE  1 
ATOM   9036  N  NZ  . LYS D  1 219 ? -7.073  116.210 48.046  1.00 87.91  ? 219  LYS D NZ  1 
ATOM   9037  N  N   . ALA D  1 220 ? -8.135  112.655 54.355  1.00 52.69  ? 220  ALA D N   1 
ATOM   9038  C  CA  . ALA D  1 220 ? -8.893  112.172 55.505  1.00 50.07  ? 220  ALA D CA  1 
ATOM   9039  C  C   . ALA D  1 220 ? -8.126  112.346 56.805  1.00 48.85  ? 220  ALA D C   1 
ATOM   9040  O  O   . ALA D  1 220 ? -8.733  112.596 57.852  1.00 54.32  ? 220  ALA D O   1 
ATOM   9041  C  CB  . ALA D  1 220 ? -9.275  110.710 55.304  1.00 54.45  ? 220  ALA D CB  1 
ATOM   9042  N  N   . VAL D  1 221 ? -6.796  112.233 56.761  1.00 56.07  ? 221  VAL D N   1 
ATOM   9043  C  CA  . VAL D  1 221 ? -5.974  112.440 57.946  1.00 63.68  ? 221  VAL D CA  1 
ATOM   9044  C  C   . VAL D  1 221 ? -5.325  113.816 57.972  1.00 65.30  ? 221  VAL D C   1 
ATOM   9045  O  O   . VAL D  1 221 ? -4.544  114.100 58.883  1.00 69.31  ? 221  VAL D O   1 
ATOM   9046  C  CB  . VAL D  1 221 ? -4.892  111.349 58.073  1.00 65.60  ? 221  VAL D CB  1 
ATOM   9047  C  CG1 . VAL D  1 221 ? -5.522  110.011 58.477  1.00 66.30  ? 221  VAL D CG1 1 
ATOM   9048  C  CG2 . VAL D  1 221 ? -4.114  111.227 56.776  1.00 55.01  ? 221  VAL D CG2 1 
ATOM   9049  N  N   . SER D  1 222 ? -5.630  114.680 57.009  1.00 63.59  ? 222  SER D N   1 
ATOM   9050  C  CA  . SER D  1 222 ? -5.160  116.056 57.018  1.00 61.96  ? 222  SER D CA  1 
ATOM   9051  C  C   . SER D  1 222 ? -6.163  116.988 57.674  1.00 62.84  ? 222  SER D C   1 
ATOM   9052  O  O   . SER D  1 222 ? -6.074  118.210 57.504  1.00 69.58  ? 222  SER D O   1 
ATOM   9053  C  CB  . SER D  1 222 ? -4.872  116.524 55.587  1.00 64.45  ? 222  SER D CB  1 
ATOM   9054  O  OG  . SER D  1 222 ? -3.954  115.667 54.933  1.00 65.33  ? 222  SER D OG  1 
ATOM   9055  N  N   . THR D  1 223 ? -7.117  116.437 58.416  1.00 58.70  ? 223  THR D N   1 
ATOM   9056  C  CA  . THR D  1 223 ? -8.195  117.221 58.995  1.00 52.38  ? 223  THR D CA  1 
ATOM   9057  C  C   . THR D  1 223 ? -8.635  116.578 60.299  1.00 50.88  ? 223  THR D C   1 
ATOM   9058  O  O   . THR D  1 223 ? -8.387  115.397 60.551  1.00 55.56  ? 223  THR D O   1 
ATOM   9059  C  CB  . THR D  1 223 ? -9.384  117.344 58.029  1.00 50.97  ? 223  THR D CB  1 
ATOM   9060  O  OG1 . THR D  1 223 ? -10.464 118.027 58.675  1.00 49.71  ? 223  THR D OG1 1 
ATOM   9061  C  CG2 . THR D  1 223 ? -9.859  115.977 57.578  1.00 44.79  ? 223  THR D CG2 1 
ATOM   9062  N  N   . LEU D  1 224 ? -9.294  117.378 61.129  1.00 53.43  ? 224  LEU D N   1 
ATOM   9063  C  CA  . LEU D  1 224 ? -9.910  116.884 62.349  1.00 53.10  ? 224  LEU D CA  1 
ATOM   9064  C  C   . LEU D  1 224 ? -11.399 116.627 62.178  1.00 55.95  ? 224  LEU D C   1 
ATOM   9065  O  O   . LEU D  1 224 ? -12.066 116.252 63.149  1.00 56.66  ? 224  LEU D O   1 
ATOM   9066  C  CB  . LEU D  1 224 ? -9.672  117.872 63.493  1.00 47.15  ? 224  LEU D CB  1 
ATOM   9067  C  CG  . LEU D  1 224 ? -8.193  118.156 63.739  1.00 51.41  ? 224  LEU D CG  1 
ATOM   9068  C  CD1 . LEU D  1 224 ? -8.022  119.338 64.717  1.00 56.47  ? 224  LEU D CD1 1 
ATOM   9069  C  CD2 . LEU D  1 224 ? -7.490  116.907 64.233  1.00 46.21  ? 224  LEU D CD2 1 
ATOM   9070  N  N   . GLY D  1 225 ? -11.934 116.825 60.972  1.00 54.23  ? 225  GLY D N   1 
ATOM   9071  C  CA  . GLY D  1 225 ? -13.319 116.508 60.674  1.00 51.15  ? 225  GLY D CA  1 
ATOM   9072  C  C   . GLY D  1 225 ? -14.057 117.582 59.905  1.00 49.37  ? 225  GLY D C   1 
ATOM   9073  O  O   . GLY D  1 225 ? -15.073 117.312 59.256  1.00 50.86  ? 225  GLY D O   1 
ATOM   9074  N  N   . ALA D  1 226 ? -13.543 118.808 59.947  1.00 50.04  ? 226  ALA D N   1 
ATOM   9075  C  CA  . ALA D  1 226 ? -14.258 119.926 59.348  1.00 47.27  ? 226  ALA D CA  1 
ATOM   9076  C  C   . ALA D  1 226 ? -13.981 120.073 57.857  1.00 48.50  ? 226  ALA D C   1 
ATOM   9077  O  O   . ALA D  1 226 ? -14.714 120.790 57.169  1.00 44.55  ? 226  ALA D O   1 
ATOM   9078  C  CB  . ALA D  1 226 ? -13.906 121.223 60.079  1.00 45.68  ? 226  ALA D CB  1 
ATOM   9079  N  N   . ASN D  1 227 ? -12.937 119.439 57.338  1.00 49.09  ? 227  ASN D N   1 
ATOM   9080  C  CA  . ASN D  1 227 ? -12.571 119.567 55.929  1.00 57.76  ? 227  ASN D CA  1 
ATOM   9081  C  C   . ASN D  1 227 ? -12.487 118.173 55.328  1.00 59.43  ? 227  ASN D C   1 
ATOM   9082  O  O   . ASN D  1 227 ? -11.395 117.614 55.167  1.00 60.14  ? 227  ASN D O   1 
ATOM   9083  C  CB  . ASN D  1 227 ? -11.261 120.337 55.754  1.00 55.45  ? 227  ASN D CB  1 
ATOM   9084  C  CG  . ASN D  1 227 ? -11.394 121.799 56.132  1.00 57.10  ? 227  ASN D CG  1 
ATOM   9085  O  OD1 . ASN D  1 227 ? -12.022 122.577 55.419  1.00 57.26  ? 227  ASN D OD1 1 
ATOM   9086  N  ND2 . ASN D  1 227 ? -10.799 122.181 57.257  1.00 58.20  ? 227  ASN D ND2 1 
ATOM   9087  N  N   . PRO D  1 228 ? -13.627 117.580 54.988  1.00 58.92  ? 228  PRO D N   1 
ATOM   9088  C  CA  . PRO D  1 228 ? -13.640 116.197 54.503  1.00 56.86  ? 228  PRO D CA  1 
ATOM   9089  C  C   . PRO D  1 228 ? -13.047 116.096 53.112  1.00 55.33  ? 228  PRO D C   1 
ATOM   9090  O  O   . PRO D  1 228 ? -13.017 117.087 52.362  1.00 54.80  ? 228  PRO D O   1 
ATOM   9091  C  CB  . PRO D  1 228 ? -15.135 115.847 54.489  1.00 53.06  ? 228  PRO D CB  1 
ATOM   9092  C  CG  . PRO D  1 228 ? -15.810 117.172 54.266  1.00 51.93  ? 228  PRO D CG  1 
ATOM   9093  C  CD  . PRO D  1 228 ? -14.975 118.175 55.015  1.00 53.21  ? 228  PRO D CD  1 
ATOM   9094  N  N   . PRO D  1 229 ? -12.572 114.915 52.724  1.00 60.11  ? 229  PRO D N   1 
ATOM   9095  C  CA  . PRO D  1 229 ? -12.202 114.689 51.323  1.00 57.18  ? 229  PRO D CA  1 
ATOM   9096  C  C   . PRO D  1 229 ? -13.441 114.646 50.434  1.00 55.44  ? 229  PRO D C   1 
ATOM   9097  O  O   . PRO D  1 229 ? -14.578 114.533 50.898  1.00 53.89  ? 229  PRO D O   1 
ATOM   9098  C  CB  . PRO D  1 229 ? -11.487 113.334 51.364  1.00 51.28  ? 229  PRO D CB  1 
ATOM   9099  C  CG  . PRO D  1 229 ? -12.131 112.623 52.525  1.00 52.40  ? 229  PRO D CG  1 
ATOM   9100  C  CD  . PRO D  1 229 ? -12.419 113.697 53.545  1.00 59.71  ? 229  PRO D CD  1 
ATOM   9101  N  N   . GLU D  1 230 ? -13.206 114.721 49.126  1.00 57.41  ? 230  GLU D N   1 
ATOM   9102  C  CA  . GLU D  1 230 ? -14.279 114.483 48.169  1.00 58.48  ? 230  GLU D CA  1 
ATOM   9103  C  C   . GLU D  1 230 ? -14.737 113.032 48.231  1.00 60.85  ? 230  GLU D C   1 
ATOM   9104  O  O   . GLU D  1 230 ? -13.934 112.123 48.456  1.00 59.81  ? 230  GLU D O   1 
ATOM   9105  C  CB  . GLU D  1 230 ? -13.819 114.827 46.759  1.00 58.93  ? 230  GLU D CB  1 
ATOM   9106  C  CG  . GLU D  1 230 ? -13.556 116.297 46.566  1.00 70.91  ? 230  GLU D CG  1 
ATOM   9107  C  CD  . GLU D  1 230 ? -14.757 117.140 46.953  1.00 83.89  ? 230  GLU D CD  1 
ATOM   9108  O  OE1 . GLU D  1 230 ? -14.671 117.888 47.955  1.00 88.83  ? 230  GLU D OE1 1 
ATOM   9109  O  OE2 . GLU D  1 230 ? -15.799 117.031 46.271  1.00 88.27  ? 230  GLU D OE2 1 
ATOM   9110  N  N   . TYR D  1 231 ? -16.044 112.823 48.039  1.00 60.86  ? 231  TYR D N   1 
ATOM   9111  C  CA  . TYR D  1 231 ? -16.617 111.484 47.949  1.00 52.40  ? 231  TYR D CA  1 
ATOM   9112  C  C   . TYR D  1 231 ? -16.038 110.762 46.745  1.00 56.91  ? 231  TYR D C   1 
ATOM   9113  O  O   . TYR D  1 231 ? -16.341 111.121 45.603  1.00 51.72  ? 231  TYR D O   1 
ATOM   9114  C  CB  . TYR D  1 231 ? -18.143 111.554 47.850  1.00 51.59  ? 231  TYR D CB  1 
ATOM   9115  C  CG  . TYR D  1 231 ? -18.863 110.220 47.702  1.00 55.66  ? 231  TYR D CG  1 
ATOM   9116  C  CD1 . TYR D  1 231 ? -19.039 109.639 46.447  1.00 58.03  ? 231  TYR D CD1 1 
ATOM   9117  C  CD2 . TYR D  1 231 ? -19.413 109.571 48.802  1.00 49.45  ? 231  TYR D CD2 1 
ATOM   9118  C  CE1 . TYR D  1 231 ? -19.701 108.437 46.296  1.00 50.82  ? 231  TYR D CE1 1 
ATOM   9119  C  CE2 . TYR D  1 231 ? -20.091 108.374 48.655  1.00 50.87  ? 231  TYR D CE2 1 
ATOM   9120  C  CZ  . TYR D  1 231 ? -20.222 107.808 47.398  1.00 49.92  ? 231  TYR D CZ  1 
ATOM   9121  O  OH  . TYR D  1 231 ? -20.892 106.618 47.230  1.00 49.96  ? 231  TYR D OH  1 
ATOM   9122  N  N   . ASN D  1 232 ? -15.226 109.739 46.989  1.00 55.72  ? 232  ASN D N   1 
ATOM   9123  C  CA  . ASN D  1 232 ? -14.579 109.013 45.906  1.00 59.94  ? 232  ASN D CA  1 
ATOM   9124  C  C   . ASN D  1 232 ? -13.945 107.748 46.467  1.00 60.00  ? 232  ASN D C   1 
ATOM   9125  O  O   . ASN D  1 232 ? -13.569 107.697 47.641  1.00 52.80  ? 232  ASN D O   1 
ATOM   9126  C  CB  . ASN D  1 232 ? -13.523 109.884 45.217  1.00 60.19  ? 232  ASN D CB  1 
ATOM   9127  C  CG  . ASN D  1 232 ? -13.166 109.383 43.835  1.00 60.17  ? 232  ASN D CG  1 
ATOM   9128  O  OD1 . ASN D  1 232 ? -13.828 108.502 43.284  1.00 54.26  ? 232  ASN D OD1 1 
ATOM   9129  N  ND2 . ASN D  1 232 ? -12.116 109.950 43.262  1.00 65.96  ? 232  ASN D ND2 1 
ATOM   9130  N  N   . THR D  1 233 ? -13.843 106.725 45.619  1.00 56.22  ? 233  THR D N   1 
ATOM   9131  C  CA  . THR D  1 233 ? -13.274 105.442 46.003  1.00 48.95  ? 233  THR D CA  1 
ATOM   9132  C  C   . THR D  1 233 ? -12.442 104.913 44.843  1.00 55.88  ? 233  THR D C   1 
ATOM   9133  O  O   . THR D  1 233 ? -12.400 105.505 43.757  1.00 54.51  ? 233  THR D O   1 
ATOM   9134  C  CB  . THR D  1 233 ? -14.359 104.415 46.338  1.00 46.81  ? 233  THR D CB  1 
ATOM   9135  O  OG1 . THR D  1 233 ? -15.053 104.082 45.131  1.00 41.33  ? 233  THR D OG1 1 
ATOM   9136  C  CG2 . THR D  1 233 ? -15.355 104.947 47.374  1.00 46.48  ? 233  THR D CG2 1 
ATOM   9137  N  N   . ASN D  1 234 ? -11.806 103.759 45.064  1.00 56.50  ? 234  ASN D N   1 
ATOM   9138  C  CA  . ASN D  1 234 ? -11.137 103.052 43.979  1.00 49.77  ? 234  ASN D CA  1 
ATOM   9139  C  C   . ASN D  1 234 ? -12.115 102.486 42.971  1.00 51.28  ? 234  ASN D C   1 
ATOM   9140  O  O   . ASN D  1 234 ? -11.686 101.935 41.954  1.00 58.91  ? 234  ASN D O   1 
ATOM   9141  C  CB  . ASN D  1 234 ? -10.263 101.923 44.522  1.00 51.66  ? 234  ASN D CB  1 
ATOM   9142  C  CG  . ASN D  1 234 ? -9.005  102.430 45.171  1.00 50.40  ? 234  ASN D CG  1 
ATOM   9143  O  OD1 . ASN D  1 234 ? -8.558  103.546 44.892  1.00 47.38  ? 234  ASN D OD1 1 
ATOM   9144  N  ND2 . ASN D  1 234 ? -8.399  101.601 46.023  1.00 51.28  ? 234  ASN D ND2 1 
ATOM   9145  N  N   . TYR D  1 235 ? -13.413 102.591 43.241  1.00 53.73  ? 235  TYR D N   1 
ATOM   9146  C  CA  . TYR D  1 235 ? -14.464 102.215 42.310  1.00 51.19  ? 235  TYR D CA  1 
ATOM   9147  C  C   . TYR D  1 235 ? -15.197 103.440 41.766  1.00 61.80  ? 235  TYR D C   1 
ATOM   9148  O  O   . TYR D  1 235 ? -16.341 103.327 41.320  1.00 67.00  ? 235  TYR D O   1 
ATOM   9149  C  CB  . TYR D  1 235 ? -15.426 101.252 43.003  1.00 51.52  ? 235  TYR D CB  1 
ATOM   9150  C  CG  . TYR D  1 235 ? -14.788 99.917  43.348  1.00 52.58  ? 235  TYR D CG  1 
ATOM   9151  C  CD1 . TYR D  1 235 ? -14.618 98.932  42.385  1.00 57.08  ? 235  TYR D CD1 1 
ATOM   9152  C  CD2 . TYR D  1 235 ? -14.272 99.680  44.623  1.00 50.44  ? 235  TYR D CD2 1 
ATOM   9153  C  CE1 . TYR D  1 235 ? -14.022 97.715  42.695  1.00 55.15  ? 235  TYR D CE1 1 
ATOM   9154  C  CE2 . TYR D  1 235 ? -13.660 98.475  44.940  1.00 53.55  ? 235  TYR D CE2 1 
ATOM   9155  C  CZ  . TYR D  1 235 ? -13.540 97.492  43.970  1.00 56.05  ? 235  TYR D CZ  1 
ATOM   9156  O  OH  . TYR D  1 235 ? -12.941 96.292  44.273  1.00 54.77  ? 235  TYR D OH  1 
ATOM   9157  N  N   . GLY D  1 236 ? -14.561 104.611 41.808  1.00 61.00  ? 236  GLY D N   1 
ATOM   9158  C  CA  . GLY D  1 236 ? -15.171 105.829 41.313  1.00 58.31  ? 236  GLY D CA  1 
ATOM   9159  C  C   . GLY D  1 236 ? -16.000 106.525 42.374  1.00 58.63  ? 236  GLY D C   1 
ATOM   9160  O  O   . GLY D  1 236 ? -15.999 106.165 43.556  1.00 60.96  ? 236  GLY D O   1 
ATOM   9161  N  N   . ASN D  1 237 ? -16.723 107.559 41.938  1.00 54.10  ? 237  ASN D N   1 
ATOM   9162  C  CA  . ASN D  1 237 ? -17.435 108.427 42.868  1.00 49.27  ? 237  ASN D CA  1 
ATOM   9163  C  C   . ASN D  1 237 ? -18.946 108.384 42.665  1.00 47.59  ? 237  ASN D C   1 
ATOM   9164  O  O   . ASN D  1 237 ? -19.646 109.299 43.101  1.00 54.30  ? 237  ASN D O   1 
ATOM   9165  C  CB  . ASN D  1 237 ? -16.926 109.867 42.776  1.00 48.56  ? 237  ASN D CB  1 
ATOM   9166  C  CG  . ASN D  1 237 ? -17.306 110.553 41.468  1.00 56.50  ? 237  ASN D CG  1 
ATOM   9167  O  OD1 . ASN D  1 237 ? -17.808 109.930 40.533  1.00 53.40  ? 237  ASN D OD1 1 
ATOM   9168  N  ND2 . ASN D  1 237 ? -17.066 111.854 41.408  1.00 59.23  ? 237  ASN D ND2 1 
ATOM   9169  N  N   . LYS D  1 238 ? -19.465 107.359 41.997  1.00 52.34  ? 238  LYS D N   1 
ATOM   9170  C  CA  . LYS D  1 238 ? -20.903 107.254 41.794  1.00 54.08  ? 238  LYS D CA  1 
ATOM   9171  C  C   . LYS D  1 238 ? -21.547 106.462 42.945  1.00 56.15  ? 238  LYS D C   1 
ATOM   9172  O  O   . LYS D  1 238 ? -20.885 105.709 43.666  1.00 51.40  ? 238  LYS D O   1 
ATOM   9173  C  CB  . LYS D  1 238 ? -21.197 106.594 40.448  1.00 71.47  ? 238  LYS D CB  1 
ATOM   9174  C  CG  . LYS D  1 238 ? -20.471 107.272 39.268  1.00 86.72  ? 238  LYS D CG  1 
ATOM   9175  C  CD  . LYS D  1 238 ? -20.673 108.791 39.166  1.00 90.61  ? 238  LYS D CD  1 
ATOM   9176  C  CE  . LYS D  1 238 ? -19.876 109.351 37.978  1.00 89.15  ? 238  LYS D CE  1 
ATOM   9177  N  NZ  . LYS D  1 238 ? -19.616 110.816 38.061  1.00 88.00  ? 238  LYS D NZ  1 
ATOM   9178  N  N   . VAL D  1 239 ? -22.851 106.654 43.122  1.00 50.80  ? 239  VAL D N   1 
ATOM   9179  C  CA  . VAL D  1 239 ? -23.606 105.926 44.139  1.00 52.92  ? 239  VAL D CA  1 
ATOM   9180  C  C   . VAL D  1 239 ? -23.990 104.560 43.584  1.00 54.73  ? 239  VAL D C   1 
ATOM   9181  O  O   . VAL D  1 239 ? -24.721 104.464 42.594  1.00 51.90  ? 239  VAL D O   1 
ATOM   9182  C  CB  . VAL D  1 239 ? -24.846 106.716 44.579  1.00 55.54  ? 239  VAL D CB  1 
ATOM   9183  C  CG1 . VAL D  1 239 ? -25.673 105.912 45.584  1.00 54.69  ? 239  VAL D CG1 1 
ATOM   9184  C  CG2 . VAL D  1 239 ? -24.427 108.041 45.177  1.00 52.24  ? 239  VAL D CG2 1 
ATOM   9185  N  N   . HIS D  1 240 ? -23.509 103.503 44.228  1.00 55.15  ? 240  HIS D N   1 
ATOM   9186  C  CA  . HIS D  1 240 ? -23.641 102.156 43.687  1.00 60.34  ? 240  HIS D CA  1 
ATOM   9187  C  C   . HIS D  1 240 ? -24.990 101.506 44.004  1.00 56.94  ? 240  HIS D C   1 
ATOM   9188  O  O   . HIS D  1 240 ? -25.585 101.708 45.067  1.00 53.35  ? 240  HIS D O   1 
ATOM   9189  C  CB  . HIS D  1 240 ? -22.523 101.259 44.215  1.00 60.51  ? 240  HIS D CB  1 
ATOM   9190  C  CG  . HIS D  1 240 ? -21.177 101.553 43.628  1.00 69.56  ? 240  HIS D CG  1 
ATOM   9191  N  ND1 . HIS D  1 240 ? -2