data_6QX2
# 
_entry.id   6QX2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6QX2         
WWPDB D_1292101083 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'Same inhibitor different DNA' 
_pdbx_database_related.db_id          6QX1 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6QX2 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name               'Bax, B.D.' 
_audit_author.pdbx_ordinal       1 
_audit_author.identifier_ORCID   0000-0003-1940-3785 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_id_ASTM           BMCLE8 
_citation.journal_id_CSD            1127 
_citation.journal_id_ISSN           1464-3405 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                1407 
_citation.page_last                 1412 
_citation.title                     'Structure-guided design of antibacterials that allosterically inhibit DNA gyrase.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2019.03.029 
_citation.pdbx_database_id_PubMed   30962087 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Thalji, R.K.'    1  ? 
primary 'Raha, K.'        2  ? 
primary 'Andreotti, D.'   3  ? 
primary 'Checchia, A.'    4  ? 
primary 'Cui, H.'         5  ? 
primary 'Meneghelli, G.'  6  ? 
primary 'Profeta, R.'     7  ? 
primary 'Tonelli, F.'     8  ? 
primary 'Tommasi, S.'     9  ? 
primary 'Bakshi, T.'      10 ? 
primary 'Donovan, B.T.'   11 ? 
primary 'Howells, A.'     12 ? 
primary 'Jain, S.'        13 ? 
primary 'Nixon, C.'       14 ? 
primary 'Quinque, G.'     15 ? 
primary 'McCloskey, L.'   16 ? 
primary 'Bax, B.D.'       17 ? 
primary 'Neu, M.'         18 ? 
primary 'Chan, P.F.'      19 ? 
primary 'Stavenger, R.A.' 20 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   120.22 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6QX2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     187.640 
_cell.length_a_esd                 ? 
_cell.length_b                     410.120 
_cell.length_b_esd                 ? 
_cell.length_c                     93.940 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        22 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6QX2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   20846.738 4  5.99.1.3,5.99.1.3 ? 
? ? 
2  polymer     man 'DNA gyrase subunit A'                                                        55537.312 11 5.99.1.3          
'123 phosphotyrosine' ? ? 
3  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   21111.018 3  5.99.1.3,5.99.1.3 ? 
? ? 
4  polymer     man 
;DNA (5'-D(*GP*AP*GP*CP*GP*TP*AP*CP*GP*GP*CP*CP*GP*TP*AP*CP*GP*CP*TP*T)-3')
;
6150.966  9  ?                 ?                     ? ? 
5  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   21009.914 1  5.99.1.3,5.99.1.3 ? 
? ? 
6  polymer     man 'DNA gyrase subunit A'                                                        54370.000 1  5.99.1.3          ? 
? ? 
7  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   21274.191 1  5.99.1.3,5.99.1.3 ? 
? ? 
8  polymer     man 
;DNA (5'-D(*GP*AP*GP*CP*GP*TP*AP*CP*GP*GP*CP*CP*GP*TP*AP*CP*GP*CP*TP*T)-3')
;
5846.773  2  ?                 ?                     ? ? 
9  polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   20363.156 1  5.99.1.3,5.99.1.3 ? 
? ? 
10 polymer     man 
;DNA (5'-D(*GP*AP*GP*CP*GP*TP*AP*CP*GP*GP*CP*CP*GP*TP*AP*CP*GP*CP*TP*T)-3')
;
5204.360  1  ?                 ?                     ? ? 
11 polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   21080.992 1  5.99.1.3,5.99.1.3 ? 
? ? 
12 polymer     man 'DNA gyrase subunit B,DNA gyrase subunit B'                                   21011.887 1  5.99.1.3,5.99.1.3 ? 
? ? 
13 non-polymer syn '(2~{R})-2-[[5-(2-chlorophenyl)-1,2-benzoxazol-3-yl]oxy]-2-phenyl-ethanamine' 364.825   12 ?                 ? 
? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAV
;
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAV
;
B,S,b,s               ? 
2  'polypeptide(L)'        no no 
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
A,C,L,R,T,a,c,j,l,r,t ? 
3  'polypeptide(L)'        no no 
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNAV
;
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNAV
;
D,U,m                 ? 
4  polydeoxyribonucleotide no no '(DG)(DA)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DG)(DC)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DT)(DT)' 
GAGCGTACGGCCGTACGCTT E,F,N,O,W,e,n,v,w     ? 
5  'polypeptide(L)'        no no 
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAVY
;
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAVY
;
K                     ? 
6  'polypeptide(L)'        no no 
;ERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAM
VRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLAN
GASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIE
ERGGGQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSF
GVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESL
QQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLG
;
;ERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAM
VRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLAN
GASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIE
ERGGGQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTSF
GVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMESL
QQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQLG
;
J                     ? 
7  'polypeptide(L)'        no no 
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNAVY
;
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNAVY
;
M                     ? 
8  polydeoxyribonucleotide no no '(DG)(DA)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DG)(DC)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DT)' 
GAGCGTACGGCCGTACGCT V,o                   ? 
9  'polypeptide(L)'        no no 
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGMNADQLWETTMNPEHRALLQVKLEDAIEADQ
TFEMLMGDVVENRRQFIEDNA
;
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGMNADQLWETTMNPEHRALLQVKLEDAIEADQ
TFEMLMGDVVENRRQFIEDNA
;
d                     ? 
10 polydeoxyribonucleotide no no '(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DG)(DC)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DT)' GCGTACGGCCGTACGCT f ? 
11 'polypeptide(L)'        no no 
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAVYA
;
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPKGLGEMNADQLWETTMNPEHRALLQVKLEDAI
EADQTFEMLMGDVVENRRQFIEDNAVYA
;
k                     ? 
12 'polypeptide(L)'        no no 
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNA
;
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPPTGYKGLGEMNADQLWETTMNPEHRALLQVKLED
AIEADQTFEMLMGDVVENRRQFIEDNA
;
u                     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   GLY n 
1  2   LYS n 
1  3   LEU n 
1  4   ALA n 
1  5   ASP n 
1  6   CYS n 
1  7   SER n 
1  8   SER n 
1  9   LYS n 
1  10  SER n 
1  11  PRO n 
1  12  GLU n 
1  13  GLU n 
1  14  CYS n 
1  15  GLU n 
1  16  ILE n 
1  17  PHE n 
1  18  LEU n 
1  19  VAL n 
1  20  GLU n 
1  21  GLY n 
1  22  ASP n 
1  23  SER n 
1  24  ALA n 
1  25  GLY n 
1  26  GLY n 
1  27  SER n 
1  28  THR n 
1  29  LYS n 
1  30  SER n 
1  31  GLY n 
1  32  ARG n 
1  33  ASP n 
1  34  SER n 
1  35  ARG n 
1  36  THR n 
1  37  GLN n 
1  38  ALA n 
1  39  ILE n 
1  40  LEU n 
1  41  PRO n 
1  42  LEU n 
1  43  ARG n 
1  44  GLY n 
1  45  LYS n 
1  46  ILE n 
1  47  LEU n 
1  48  ASN n 
1  49  VAL n 
1  50  GLU n 
1  51  LYS n 
1  52  ALA n 
1  53  ARG n 
1  54  LEU n 
1  55  ASP n 
1  56  ARG n 
1  57  ILE n 
1  58  LEU n 
1  59  ASN n 
1  60  ASN n 
1  61  ASN n 
1  62  GLU n 
1  63  ILE n 
1  64  ARG n 
1  65  GLN n 
1  66  MET n 
1  67  ILE n 
1  68  THR n 
1  69  ALA n 
1  70  PHE n 
1  71  GLY n 
1  72  THR n 
1  73  GLY n 
1  74  ILE n 
1  75  GLY n 
1  76  GLY n 
1  77  ASP n 
1  78  PHE n 
1  79  ASP n 
1  80  LEU n 
1  81  ALA n 
1  82  LYS n 
1  83  ALA n 
1  84  ARG n 
1  85  TYR n 
1  86  HIS n 
1  87  LYS n 
1  88  ILE n 
1  89  VAL n 
1  90  ILE n 
1  91  MET n 
1  92  THR n 
1  93  ASP n 
1  94  ALA n 
1  95  ASP n 
1  96  VAL n 
1  97  ASP n 
1  98  GLY n 
1  99  ALA n 
1  100 HIS n 
1  101 ILE n 
1  102 ARG n 
1  103 THR n 
1  104 LEU n 
1  105 LEU n 
1  106 LEU n 
1  107 THR n 
1  108 PHE n 
1  109 PHE n 
1  110 TYR n 
1  111 ARG n 
1  112 PHE n 
1  113 MET n 
1  114 ARG n 
1  115 PRO n 
1  116 LEU n 
1  117 ILE n 
1  118 GLU n 
1  119 ALA n 
1  120 GLY n 
1  121 TYR n 
1  122 VAL n 
1  123 TYR n 
1  124 ILE n 
1  125 ALA n 
1  126 GLN n 
1  127 PRO n 
1  128 PRO n 
1  129 LYS n 
1  130 GLY n 
1  131 LEU n 
1  132 GLY n 
1  133 GLU n 
1  134 MET n 
1  135 ASN n 
1  136 ALA n 
1  137 ASP n 
1  138 GLN n 
1  139 LEU n 
1  140 TRP n 
1  141 GLU n 
1  142 THR n 
1  143 THR n 
1  144 MET n 
1  145 ASN n 
1  146 PRO n 
1  147 GLU n 
1  148 HIS n 
1  149 ARG n 
1  150 ALA n 
1  151 LEU n 
1  152 LEU n 
1  153 GLN n 
1  154 VAL n 
1  155 LYS n 
1  156 LEU n 
1  157 GLU n 
1  158 ASP n 
1  159 ALA n 
1  160 ILE n 
1  161 GLU n 
1  162 ALA n 
1  163 ASP n 
1  164 GLN n 
1  165 THR n 
1  166 PHE n 
1  167 GLU n 
1  168 MET n 
1  169 LEU n 
1  170 MET n 
1  171 GLY n 
1  172 ASP n 
1  173 VAL n 
1  174 VAL n 
1  175 GLU n 
1  176 ASN n 
1  177 ARG n 
1  178 ARG n 
1  179 GLN n 
1  180 PHE n 
1  181 ILE n 
1  182 GLU n 
1  183 ASP n 
1  184 ASN n 
1  185 ALA n 
1  186 VAL n 
2  1   ALA n 
2  2   GLU n 
2  3   LEU n 
2  4   PRO n 
2  5   GLN n 
2  6   SER n 
2  7   ARG n 
2  8   ILE n 
2  9   ASN n 
2  10  GLU n 
2  11  ARG n 
2  12  ASN n 
2  13  ILE n 
2  14  THR n 
2  15  SER n 
2  16  GLU n 
2  17  MET n 
2  18  ARG n 
2  19  GLU n 
2  20  SER n 
2  21  PHE n 
2  22  LEU n 
2  23  ASP n 
2  24  TYR n 
2  25  ALA n 
2  26  MET n 
2  27  SER n 
2  28  VAL n 
2  29  ILE n 
2  30  VAL n 
2  31  ALA n 
2  32  ARG n 
2  33  ALA n 
2  34  LEU n 
2  35  PRO n 
2  36  ASP n 
2  37  VAL n 
2  38  ARG n 
2  39  ASP n 
2  40  GLY n 
2  41  LEU n 
2  42  LYS n 
2  43  PRO n 
2  44  VAL n 
2  45  HIS n 
2  46  ARG n 
2  47  ARG n 
2  48  ILE n 
2  49  LEU n 
2  50  TYR n 
2  51  GLY n 
2  52  LEU n 
2  53  ASN n 
2  54  GLU n 
2  55  GLN n 
2  56  GLY n 
2  57  MET n 
2  58  THR n 
2  59  PRO n 
2  60  ASP n 
2  61  LYS n 
2  62  SER n 
2  63  TYR n 
2  64  LYS n 
2  65  LYS n 
2  66  SER n 
2  67  ALA n 
2  68  ARG n 
2  69  ILE n 
2  70  VAL n 
2  71  GLY n 
2  72  ASP n 
2  73  VAL n 
2  74  MET n 
2  75  GLY n 
2  76  LYS n 
2  77  TYR n 
2  78  HIS n 
2  79  PRO n 
2  80  HIS n 
2  81  GLY n 
2  82  ASP n 
2  83  SER n 
2  84  SER n 
2  85  ILE n 
2  86  TYR n 
2  87  GLU n 
2  88  ALA n 
2  89  MET n 
2  90  VAL n 
2  91  ARG n 
2  92  MET n 
2  93  ALA n 
2  94  GLN n 
2  95  ASP n 
2  96  PHE n 
2  97  SER n 
2  98  TYR n 
2  99  ARG n 
2  100 TYR n 
2  101 PRO n 
2  102 LEU n 
2  103 VAL n 
2  104 ASP n 
2  105 GLY n 
2  106 GLN n 
2  107 GLY n 
2  108 ASN n 
2  109 PHE n 
2  110 GLY n 
2  111 SER n 
2  112 MET n 
2  113 ASP n 
2  114 GLY n 
2  115 ASP n 
2  116 GLY n 
2  117 ALA n 
2  118 ALA n 
2  119 ALA n 
2  120 MET n 
2  121 ARG n 
2  122 TYR n 
2  123 THR n 
2  124 GLU n 
2  125 ALA n 
2  126 ARG n 
2  127 MET n 
2  128 THR n 
2  129 LYS n 
2  130 ILE n 
2  131 THR n 
2  132 LEU n 
2  133 GLU n 
2  134 LEU n 
2  135 LEU n 
2  136 ARG n 
2  137 ASP n 
2  138 ILE n 
2  139 ASN n 
2  140 LYS n 
2  141 ASP n 
2  142 THR n 
2  143 ILE n 
2  144 ASP n 
2  145 PHE n 
2  146 ILE n 
2  147 ASP n 
2  148 ASN n 
2  149 TYR n 
2  150 ASP n 
2  151 GLY n 
2  152 ASN n 
2  153 GLU n 
2  154 ARG n 
2  155 GLU n 
2  156 PRO n 
2  157 SER n 
2  158 VAL n 
2  159 LEU n 
2  160 PRO n 
2  161 ALA n 
2  162 ARG n 
2  163 PHE n 
2  164 PRO n 
2  165 ASN n 
2  166 LEU n 
2  167 LEU n 
2  168 ALA n 
2  169 ASN n 
2  170 GLY n 
2  171 ALA n 
2  172 SER n 
2  173 GLY n 
2  174 ILE n 
2  175 ALA n 
2  176 VAL n 
2  177 GLY n 
2  178 MET n 
2  179 ALA n 
2  180 THR n 
2  181 ASN n 
2  182 ILE n 
2  183 PRO n 
2  184 PRO n 
2  185 HIS n 
2  186 ASN n 
2  187 LEU n 
2  188 THR n 
2  189 GLU n 
2  190 LEU n 
2  191 ILE n 
2  192 ASN n 
2  193 GLY n 
2  194 VAL n 
2  195 LEU n 
2  196 SER n 
2  197 LEU n 
2  198 SER n 
2  199 LYS n 
2  200 ASN n 
2  201 PRO n 
2  202 ASP n 
2  203 ILE n 
2  204 SER n 
2  205 ILE n 
2  206 ALA n 
2  207 GLU n 
2  208 LEU n 
2  209 MET n 
2  210 GLU n 
2  211 ASP n 
2  212 ILE n 
2  213 GLU n 
2  214 GLY n 
2  215 PRO n 
2  216 ASP n 
2  217 PHE n 
2  218 PRO n 
2  219 THR n 
2  220 ALA n 
2  221 GLY n 
2  222 LEU n 
2  223 ILE n 
2  224 LEU n 
2  225 GLY n 
2  226 LYS n 
2  227 SER n 
2  228 GLY n 
2  229 ILE n 
2  230 ARG n 
2  231 ARG n 
2  232 ALA n 
2  233 TYR n 
2  234 GLU n 
2  235 THR n 
2  236 GLY n 
2  237 ARG n 
2  238 GLY n 
2  239 SER n 
2  240 ILE n 
2  241 GLN n 
2  242 MET n 
2  243 ARG n 
2  244 SER n 
2  245 ARG n 
2  246 ALA n 
2  247 VAL n 
2  248 ILE n 
2  249 GLU n 
2  250 GLU n 
2  251 ARG n 
2  252 GLY n 
2  253 GLY n 
2  254 GLY n 
2  255 ARG n 
2  256 GLN n 
2  257 ARG n 
2  258 ILE n 
2  259 VAL n 
2  260 VAL n 
2  261 THR n 
2  262 GLU n 
2  263 ILE n 
2  264 PRO n 
2  265 PHE n 
2  266 GLN n 
2  267 VAL n 
2  268 ASN n 
2  269 LYS n 
2  270 ALA n 
2  271 ARG n 
2  272 MET n 
2  273 ILE n 
2  274 GLU n 
2  275 LYS n 
2  276 ILE n 
2  277 ALA n 
2  278 GLU n 
2  279 LEU n 
2  280 VAL n 
2  281 ARG n 
2  282 ASP n 
2  283 LYS n 
2  284 LYS n 
2  285 ILE n 
2  286 ASP n 
2  287 GLY n 
2  288 ILE n 
2  289 THR n 
2  290 ASP n 
2  291 LEU n 
2  292 ARG n 
2  293 ASP n 
2  294 GLU n 
2  295 THR n 
2  296 SER n 
2  297 LEU n 
2  298 ARG n 
2  299 THR n 
2  300 GLY n 
2  301 VAL n 
2  302 ARG n 
2  303 VAL n 
2  304 VAL n 
2  305 ILE n 
2  306 ASP n 
2  307 VAL n 
2  308 ARG n 
2  309 LYS n 
2  310 ASP n 
2  311 ALA n 
2  312 ASN n 
2  313 ALA n 
2  314 SER n 
2  315 VAL n 
2  316 ILE n 
2  317 LEU n 
2  318 ASN n 
2  319 ASN n 
2  320 LEU n 
2  321 TYR n 
2  322 LYS n 
2  323 GLN n 
2  324 THR n 
2  325 PRO n 
2  326 LEU n 
2  327 GLN n 
2  328 THR n 
2  329 SER n 
2  330 PHE n 
2  331 GLY n 
2  332 VAL n 
2  333 ASN n 
2  334 MET n 
2  335 ILE n 
2  336 ALA n 
2  337 LEU n 
2  338 VAL n 
2  339 ASN n 
2  340 GLY n 
2  341 ARG n 
2  342 PRO n 
2  343 LYS n 
2  344 LEU n 
2  345 ILE n 
2  346 ASN n 
2  347 LEU n 
2  348 LYS n 
2  349 GLU n 
2  350 ALA n 
2  351 LEU n 
2  352 VAL n 
2  353 HIS n 
2  354 TYR n 
2  355 LEU n 
2  356 GLU n 
2  357 HIS n 
2  358 GLN n 
2  359 LYS n 
2  360 THR n 
2  361 VAL n 
2  362 VAL n 
2  363 ARG n 
2  364 ARG n 
2  365 ARG n 
2  366 THR n 
2  367 GLN n 
2  368 TYR n 
2  369 ASN n 
2  370 LEU n 
2  371 ARG n 
2  372 LYS n 
2  373 ALA n 
2  374 LYS n 
2  375 ASP n 
2  376 ARG n 
2  377 ALA n 
2  378 HIS n 
2  379 ILE n 
2  380 LEU n 
2  381 GLU n 
2  382 GLY n 
2  383 LEU n 
2  384 ARG n 
2  385 ILE n 
2  386 ALA n 
2  387 LEU n 
2  388 ASP n 
2  389 HIS n 
2  390 ILE n 
2  391 ASP n 
2  392 GLU n 
2  393 ILE n 
2  394 ILE n 
2  395 SER n 
2  396 THR n 
2  397 ILE n 
2  398 ARG n 
2  399 GLU n 
2  400 SER n 
2  401 ASP n 
2  402 THR n 
2  403 ASP n 
2  404 LYS n 
2  405 VAL n 
2  406 ALA n 
2  407 MET n 
2  408 GLU n 
2  409 SER n 
2  410 LEU n 
2  411 GLN n 
2  412 GLN n 
2  413 ARG n 
2  414 PHE n 
2  415 LYS n 
2  416 LEU n 
2  417 SER n 
2  418 GLU n 
2  419 LYS n 
2  420 GLN n 
2  421 ALA n 
2  422 GLN n 
2  423 ALA n 
2  424 ILE n 
2  425 LEU n 
2  426 ASP n 
2  427 MET n 
2  428 ARG n 
2  429 LEU n 
2  430 ARG n 
2  431 ARG n 
2  432 LEU n 
2  433 THR n 
2  434 GLY n 
2  435 LEU n 
2  436 GLU n 
2  437 ARG n 
2  438 ASP n 
2  439 LYS n 
2  440 ILE n 
2  441 GLU n 
2  442 ALA n 
2  443 GLU n 
2  444 TYR n 
2  445 ASN n 
2  446 GLU n 
2  447 LEU n 
2  448 LEU n 
2  449 ASN n 
2  450 TYR n 
2  451 ILE n 
2  452 SER n 
2  453 GLU n 
2  454 LEU n 
2  455 GLU n 
2  456 THR n 
2  457 ILE n 
2  458 LEU n 
2  459 ALA n 
2  460 ASP n 
2  461 GLU n 
2  462 GLU n 
2  463 VAL n 
2  464 LEU n 
2  465 LEU n 
2  466 GLN n 
2  467 LEU n 
2  468 VAL n 
2  469 ARG n 
2  470 ASP n 
2  471 GLU n 
2  472 LEU n 
2  473 THR n 
2  474 GLU n 
2  475 ILE n 
2  476 ARG n 
2  477 ASP n 
2  478 ARG n 
2  479 PHE n 
2  480 GLY n 
2  481 ASP n 
2  482 ASP n 
2  483 ARG n 
2  484 ARG n 
2  485 THR n 
2  486 GLU n 
2  487 ILE n 
2  488 GLN n 
2  489 LEU n 
2  490 GLY n 
3  1   LYS n 
3  2   LEU n 
3  3   ALA n 
3  4   ASP n 
3  5   CYS n 
3  6   SER n 
3  7   SER n 
3  8   LYS n 
3  9   SER n 
3  10  PRO n 
3  11  GLU n 
3  12  GLU n 
3  13  CYS n 
3  14  GLU n 
3  15  ILE n 
3  16  PHE n 
3  17  LEU n 
3  18  VAL n 
3  19  GLU n 
3  20  GLY n 
3  21  ASP n 
3  22  SER n 
3  23  ALA n 
3  24  GLY n 
3  25  GLY n 
3  26  SER n 
3  27  THR n 
3  28  LYS n 
3  29  SER n 
3  30  GLY n 
3  31  ARG n 
3  32  ASP n 
3  33  SER n 
3  34  ARG n 
3  35  THR n 
3  36  GLN n 
3  37  ALA n 
3  38  ILE n 
3  39  LEU n 
3  40  PRO n 
3  41  LEU n 
3  42  ARG n 
3  43  GLY n 
3  44  LYS n 
3  45  ILE n 
3  46  LEU n 
3  47  ASN n 
3  48  VAL n 
3  49  GLU n 
3  50  LYS n 
3  51  ALA n 
3  52  ARG n 
3  53  LEU n 
3  54  ASP n 
3  55  ARG n 
3  56  ILE n 
3  57  LEU n 
3  58  ASN n 
3  59  ASN n 
3  60  ASN n 
3  61  GLU n 
3  62  ILE n 
3  63  ARG n 
3  64  GLN n 
3  65  MET n 
3  66  ILE n 
3  67  THR n 
3  68  ALA n 
3  69  PHE n 
3  70  GLY n 
3  71  THR n 
3  72  GLY n 
3  73  ILE n 
3  74  GLY n 
3  75  GLY n 
3  76  ASP n 
3  77  PHE n 
3  78  ASP n 
3  79  LEU n 
3  80  ALA n 
3  81  LYS n 
3  82  ALA n 
3  83  ARG n 
3  84  TYR n 
3  85  HIS n 
3  86  LYS n 
3  87  ILE n 
3  88  VAL n 
3  89  ILE n 
3  90  MET n 
3  91  THR n 
3  92  ASP n 
3  93  ALA n 
3  94  ASP n 
3  95  VAL n 
3  96  ASP n 
3  97  GLY n 
3  98  ALA n 
3  99  HIS n 
3  100 ILE n 
3  101 ARG n 
3  102 THR n 
3  103 LEU n 
3  104 LEU n 
3  105 LEU n 
3  106 THR n 
3  107 PHE n 
3  108 PHE n 
3  109 TYR n 
3  110 ARG n 
3  111 PHE n 
3  112 MET n 
3  113 ARG n 
3  114 PRO n 
3  115 LEU n 
3  116 ILE n 
3  117 GLU n 
3  118 ALA n 
3  119 GLY n 
3  120 TYR n 
3  121 VAL n 
3  122 TYR n 
3  123 ILE n 
3  124 ALA n 
3  125 GLN n 
3  126 PRO n 
3  127 PRO n 
3  128 THR n 
3  129 GLY n 
3  130 TYR n 
3  131 LYS n 
3  132 GLY n 
3  133 LEU n 
3  134 GLY n 
3  135 GLU n 
3  136 MET n 
3  137 ASN n 
3  138 ALA n 
3  139 ASP n 
3  140 GLN n 
3  141 LEU n 
3  142 TRP n 
3  143 GLU n 
3  144 THR n 
3  145 THR n 
3  146 MET n 
3  147 ASN n 
3  148 PRO n 
3  149 GLU n 
3  150 HIS n 
3  151 ARG n 
3  152 ALA n 
3  153 LEU n 
3  154 LEU n 
3  155 GLN n 
3  156 VAL n 
3  157 LYS n 
3  158 LEU n 
3  159 GLU n 
3  160 ASP n 
3  161 ALA n 
3  162 ILE n 
3  163 GLU n 
3  164 ALA n 
3  165 ASP n 
3  166 GLN n 
3  167 THR n 
3  168 PHE n 
3  169 GLU n 
3  170 MET n 
3  171 LEU n 
3  172 MET n 
3  173 GLY n 
3  174 ASP n 
3  175 VAL n 
3  176 VAL n 
3  177 GLU n 
3  178 ASN n 
3  179 ARG n 
3  180 ARG n 
3  181 GLN n 
3  182 PHE n 
3  183 ILE n 
3  184 GLU n 
3  185 ASP n 
3  186 ASN n 
3  187 ALA n 
3  188 VAL n 
4  1   DG  n 
4  2   DA  n 
4  3   DG  n 
4  4   DC  n 
4  5   DG  n 
4  6   DT  n 
4  7   DA  n 
4  8   DC  n 
4  9   DG  n 
4  10  DG  n 
4  11  DC  n 
4  12  DC  n 
4  13  DG  n 
4  14  DT  n 
4  15  DA  n 
4  16  DC  n 
4  17  DG  n 
4  18  DC  n 
4  19  DT  n 
4  20  DT  n 
5  1   GLY n 
5  2   LYS n 
5  3   LEU n 
5  4   ALA n 
5  5   ASP n 
5  6   CYS n 
5  7   SER n 
5  8   SER n 
5  9   LYS n 
5  10  SER n 
5  11  PRO n 
5  12  GLU n 
5  13  GLU n 
5  14  CYS n 
5  15  GLU n 
5  16  ILE n 
5  17  PHE n 
5  18  LEU n 
5  19  VAL n 
5  20  GLU n 
5  21  GLY n 
5  22  ASP n 
5  23  SER n 
5  24  ALA n 
5  25  GLY n 
5  26  GLY n 
5  27  SER n 
5  28  THR n 
5  29  LYS n 
5  30  SER n 
5  31  GLY n 
5  32  ARG n 
5  33  ASP n 
5  34  SER n 
5  35  ARG n 
5  36  THR n 
5  37  GLN n 
5  38  ALA n 
5  39  ILE n 
5  40  LEU n 
5  41  PRO n 
5  42  LEU n 
5  43  ARG n 
5  44  GLY n 
5  45  LYS n 
5  46  ILE n 
5  47  LEU n 
5  48  ASN n 
5  49  VAL n 
5  50  GLU n 
5  51  LYS n 
5  52  ALA n 
5  53  ARG n 
5  54  LEU n 
5  55  ASP n 
5  56  ARG n 
5  57  ILE n 
5  58  LEU n 
5  59  ASN n 
5  60  ASN n 
5  61  ASN n 
5  62  GLU n 
5  63  ILE n 
5  64  ARG n 
5  65  GLN n 
5  66  MET n 
5  67  ILE n 
5  68  THR n 
5  69  ALA n 
5  70  PHE n 
5  71  GLY n 
5  72  THR n 
5  73  GLY n 
5  74  ILE n 
5  75  GLY n 
5  76  GLY n 
5  77  ASP n 
5  78  PHE n 
5  79  ASP n 
5  80  LEU n 
5  81  ALA n 
5  82  LYS n 
5  83  ALA n 
5  84  ARG n 
5  85  TYR n 
5  86  HIS n 
5  87  LYS n 
5  88  ILE n 
5  89  VAL n 
5  90  ILE n 
5  91  MET n 
5  92  THR n 
5  93  ASP n 
5  94  ALA n 
5  95  ASP n 
5  96  VAL n 
5  97  ASP n 
5  98  GLY n 
5  99  ALA n 
5  100 HIS n 
5  101 ILE n 
5  102 ARG n 
5  103 THR n 
5  104 LEU n 
5  105 LEU n 
5  106 LEU n 
5  107 THR n 
5  108 PHE n 
5  109 PHE n 
5  110 TYR n 
5  111 ARG n 
5  112 PHE n 
5  113 MET n 
5  114 ARG n 
5  115 PRO n 
5  116 LEU n 
5  117 ILE n 
5  118 GLU n 
5  119 ALA n 
5  120 GLY n 
5  121 TYR n 
5  122 VAL n 
5  123 TYR n 
5  124 ILE n 
5  125 ALA n 
5  126 GLN n 
5  127 PRO n 
5  128 PRO n 
5  129 LYS n 
5  130 GLY n 
5  131 LEU n 
5  132 GLY n 
5  133 GLU n 
5  134 MET n 
5  135 ASN n 
5  136 ALA n 
5  137 ASP n 
5  138 GLN n 
5  139 LEU n 
5  140 TRP n 
5  141 GLU n 
5  142 THR n 
5  143 THR n 
5  144 MET n 
5  145 ASN n 
5  146 PRO n 
5  147 GLU n 
5  148 HIS n 
5  149 ARG n 
5  150 ALA n 
5  151 LEU n 
5  152 LEU n 
5  153 GLN n 
5  154 VAL n 
5  155 LYS n 
5  156 LEU n 
5  157 GLU n 
5  158 ASP n 
5  159 ALA n 
5  160 ILE n 
5  161 GLU n 
5  162 ALA n 
5  163 ASP n 
5  164 GLN n 
5  165 THR n 
5  166 PHE n 
5  167 GLU n 
5  168 MET n 
5  169 LEU n 
5  170 MET n 
5  171 GLY n 
5  172 ASP n 
5  173 VAL n 
5  174 VAL n 
5  175 GLU n 
5  176 ASN n 
5  177 ARG n 
5  178 ARG n 
5  179 GLN n 
5  180 PHE n 
5  181 ILE n 
5  182 GLU n 
5  183 ASP n 
5  184 ASN n 
5  185 ALA n 
5  186 VAL n 
5  187 TYR n 
6  1   GLU n 
6  2   ARG n 
6  3   ASN n 
6  4   ILE n 
6  5   THR n 
6  6   SER n 
6  7   GLU n 
6  8   MET n 
6  9   ARG n 
6  10  GLU n 
6  11  SER n 
6  12  PHE n 
6  13  LEU n 
6  14  ASP n 
6  15  TYR n 
6  16  ALA n 
6  17  MET n 
6  18  SER n 
6  19  VAL n 
6  20  ILE n 
6  21  VAL n 
6  22  ALA n 
6  23  ARG n 
6  24  ALA n 
6  25  LEU n 
6  26  PRO n 
6  27  ASP n 
6  28  VAL n 
6  29  ARG n 
6  30  ASP n 
6  31  GLY n 
6  32  LEU n 
6  33  LYS n 
6  34  PRO n 
6  35  VAL n 
6  36  HIS n 
6  37  ARG n 
6  38  ARG n 
6  39  ILE n 
6  40  LEU n 
6  41  TYR n 
6  42  GLY n 
6  43  LEU n 
6  44  ASN n 
6  45  GLU n 
6  46  GLN n 
6  47  GLY n 
6  48  MET n 
6  49  THR n 
6  50  PRO n 
6  51  ASP n 
6  52  LYS n 
6  53  SER n 
6  54  TYR n 
6  55  LYS n 
6  56  LYS n 
6  57  SER n 
6  58  ALA n 
6  59  ARG n 
6  60  ILE n 
6  61  VAL n 
6  62  GLY n 
6  63  ASP n 
6  64  VAL n 
6  65  MET n 
6  66  GLY n 
6  67  LYS n 
6  68  TYR n 
6  69  HIS n 
6  70  PRO n 
6  71  HIS n 
6  72  GLY n 
6  73  ASP n 
6  74  SER n 
6  75  SER n 
6  76  ILE n 
6  77  TYR n 
6  78  GLU n 
6  79  ALA n 
6  80  MET n 
6  81  VAL n 
6  82  ARG n 
6  83  MET n 
6  84  ALA n 
6  85  GLN n 
6  86  ASP n 
6  87  PHE n 
6  88  SER n 
6  89  TYR n 
6  90  ARG n 
6  91  TYR n 
6  92  PRO n 
6  93  LEU n 
6  94  VAL n 
6  95  ASP n 
6  96  GLY n 
6  97  GLN n 
6  98  GLY n 
6  99  ASN n 
6  100 PHE n 
6  101 GLY n 
6  102 SER n 
6  103 MET n 
6  104 ASP n 
6  105 GLY n 
6  106 ASP n 
6  107 GLY n 
6  108 ALA n 
6  109 ALA n 
6  110 ALA n 
6  111 MET n 
6  112 ARG n 
6  113 TYR n 
6  114 THR n 
6  115 GLU n 
6  116 ALA n 
6  117 ARG n 
6  118 MET n 
6  119 THR n 
6  120 LYS n 
6  121 ILE n 
6  122 THR n 
6  123 LEU n 
6  124 GLU n 
6  125 LEU n 
6  126 LEU n 
6  127 ARG n 
6  128 ASP n 
6  129 ILE n 
6  130 ASN n 
6  131 LYS n 
6  132 ASP n 
6  133 THR n 
6  134 ILE n 
6  135 ASP n 
6  136 PHE n 
6  137 ILE n 
6  138 ASP n 
6  139 ASN n 
6  140 TYR n 
6  141 ASP n 
6  142 GLY n 
6  143 ASN n 
6  144 GLU n 
6  145 ARG n 
6  146 GLU n 
6  147 PRO n 
6  148 SER n 
6  149 VAL n 
6  150 LEU n 
6  151 PRO n 
6  152 ALA n 
6  153 ARG n 
6  154 PHE n 
6  155 PRO n 
6  156 ASN n 
6  157 LEU n 
6  158 LEU n 
6  159 ALA n 
6  160 ASN n 
6  161 GLY n 
6  162 ALA n 
6  163 SER n 
6  164 GLY n 
6  165 ILE n 
6  166 ALA n 
6  167 VAL n 
6  168 GLY n 
6  169 MET n 
6  170 ALA n 
6  171 THR n 
6  172 ASN n 
6  173 ILE n 
6  174 PRO n 
6  175 PRO n 
6  176 HIS n 
6  177 ASN n 
6  178 LEU n 
6  179 THR n 
6  180 GLU n 
6  181 LEU n 
6  182 ILE n 
6  183 ASN n 
6  184 GLY n 
6  185 VAL n 
6  186 LEU n 
6  187 SER n 
6  188 LEU n 
6  189 SER n 
6  190 LYS n 
6  191 ASN n 
6  192 PRO n 
6  193 ASP n 
6  194 ILE n 
6  195 SER n 
6  196 ILE n 
6  197 ALA n 
6  198 GLU n 
6  199 LEU n 
6  200 MET n 
6  201 GLU n 
6  202 ASP n 
6  203 ILE n 
6  204 GLU n 
6  205 GLY n 
6  206 PRO n 
6  207 ASP n 
6  208 PHE n 
6  209 PRO n 
6  210 THR n 
6  211 ALA n 
6  212 GLY n 
6  213 LEU n 
6  214 ILE n 
6  215 LEU n 
6  216 GLY n 
6  217 LYS n 
6  218 SER n 
6  219 GLY n 
6  220 ILE n 
6  221 ARG n 
6  222 ARG n 
6  223 ALA n 
6  224 TYR n 
6  225 GLU n 
6  226 THR n 
6  227 GLY n 
6  228 ARG n 
6  229 GLY n 
6  230 SER n 
6  231 ILE n 
6  232 GLN n 
6  233 MET n 
6  234 ARG n 
6  235 SER n 
6  236 ARG n 
6  237 ALA n 
6  238 VAL n 
6  239 ILE n 
6  240 GLU n 
6  241 GLU n 
6  242 ARG n 
6  243 GLY n 
6  244 GLY n 
6  245 GLY n 
6  246 GLN n 
6  247 ARG n 
6  248 ILE n 
6  249 VAL n 
6  250 VAL n 
6  251 THR n 
6  252 GLU n 
6  253 ILE n 
6  254 PRO n 
6  255 PHE n 
6  256 GLN n 
6  257 VAL n 
6  258 ASN n 
6  259 LYS n 
6  260 ALA n 
6  261 ARG n 
6  262 MET n 
6  263 ILE n 
6  264 GLU n 
6  265 LYS n 
6  266 ILE n 
6  267 ALA n 
6  268 GLU n 
6  269 LEU n 
6  270 VAL n 
6  271 ARG n 
6  272 ASP n 
6  273 LYS n 
6  274 LYS n 
6  275 ILE n 
6  276 ASP n 
6  277 GLY n 
6  278 ILE n 
6  279 THR n 
6  280 ASP n 
6  281 LEU n 
6  282 ARG n 
6  283 ASP n 
6  284 GLU n 
6  285 THR n 
6  286 SER n 
6  287 LEU n 
6  288 ARG n 
6  289 THR n 
6  290 GLY n 
6  291 VAL n 
6  292 ARG n 
6  293 VAL n 
6  294 VAL n 
6  295 ILE n 
6  296 ASP n 
6  297 VAL n 
6  298 ARG n 
6  299 LYS n 
6  300 ASP n 
6  301 ALA n 
6  302 ASN n 
6  303 ALA n 
6  304 SER n 
6  305 VAL n 
6  306 ILE n 
6  307 LEU n 
6  308 ASN n 
6  309 ASN n 
6  310 LEU n 
6  311 TYR n 
6  312 LYS n 
6  313 GLN n 
6  314 THR n 
6  315 PRO n 
6  316 LEU n 
6  317 GLN n 
6  318 THR n 
6  319 SER n 
6  320 PHE n 
6  321 GLY n 
6  322 VAL n 
6  323 ASN n 
6  324 MET n 
6  325 ILE n 
6  326 ALA n 
6  327 LEU n 
6  328 VAL n 
6  329 ASN n 
6  330 GLY n 
6  331 ARG n 
6  332 PRO n 
6  333 LYS n 
6  334 LEU n 
6  335 ILE n 
6  336 ASN n 
6  337 LEU n 
6  338 LYS n 
6  339 GLU n 
6  340 ALA n 
6  341 LEU n 
6  342 VAL n 
6  343 HIS n 
6  344 TYR n 
6  345 LEU n 
6  346 GLU n 
6  347 HIS n 
6  348 GLN n 
6  349 LYS n 
6  350 THR n 
6  351 VAL n 
6  352 VAL n 
6  353 ARG n 
6  354 ARG n 
6  355 ARG n 
6  356 THR n 
6  357 GLN n 
6  358 TYR n 
6  359 ASN n 
6  360 LEU n 
6  361 ARG n 
6  362 LYS n 
6  363 ALA n 
6  364 LYS n 
6  365 ASP n 
6  366 ARG n 
6  367 ALA n 
6  368 HIS n 
6  369 ILE n 
6  370 LEU n 
6  371 GLU n 
6  372 GLY n 
6  373 LEU n 
6  374 ARG n 
6  375 ILE n 
6  376 ALA n 
6  377 LEU n 
6  378 ASP n 
6  379 HIS n 
6  380 ILE n 
6  381 ASP n 
6  382 GLU n 
6  383 ILE n 
6  384 ILE n 
6  385 SER n 
6  386 THR n 
6  387 ILE n 
6  388 ARG n 
6  389 GLU n 
6  390 SER n 
6  391 ASP n 
6  392 THR n 
6  393 ASP n 
6  394 LYS n 
6  395 VAL n 
6  396 ALA n 
6  397 MET n 
6  398 GLU n 
6  399 SER n 
6  400 LEU n 
6  401 GLN n 
6  402 GLN n 
6  403 ARG n 
6  404 PHE n 
6  405 LYS n 
6  406 LEU n 
6  407 SER n 
6  408 GLU n 
6  409 LYS n 
6  410 GLN n 
6  411 ALA n 
6  412 GLN n 
6  413 ALA n 
6  414 ILE n 
6  415 LEU n 
6  416 ASP n 
6  417 MET n 
6  418 ARG n 
6  419 LEU n 
6  420 ARG n 
6  421 ARG n 
6  422 LEU n 
6  423 THR n 
6  424 GLY n 
6  425 LEU n 
6  426 GLU n 
6  427 ARG n 
6  428 ASP n 
6  429 LYS n 
6  430 ILE n 
6  431 GLU n 
6  432 ALA n 
6  433 GLU n 
6  434 TYR n 
6  435 ASN n 
6  436 GLU n 
6  437 LEU n 
6  438 LEU n 
6  439 ASN n 
6  440 TYR n 
6  441 ILE n 
6  442 SER n 
6  443 GLU n 
6  444 LEU n 
6  445 GLU n 
6  446 THR n 
6  447 ILE n 
6  448 LEU n 
6  449 ALA n 
6  450 ASP n 
6  451 GLU n 
6  452 GLU n 
6  453 VAL n 
6  454 LEU n 
6  455 LEU n 
6  456 GLN n 
6  457 LEU n 
6  458 VAL n 
6  459 ARG n 
6  460 ASP n 
6  461 GLU n 
6  462 LEU n 
6  463 THR n 
6  464 GLU n 
6  465 ILE n 
6  466 ARG n 
6  467 ASP n 
6  468 ARG n 
6  469 PHE n 
6  470 GLY n 
6  471 ASP n 
6  472 ASP n 
6  473 ARG n 
6  474 ARG n 
6  475 THR n 
6  476 GLU n 
6  477 ILE n 
6  478 GLN n 
6  479 LEU n 
6  480 GLY n 
7  1   LYS n 
7  2   LEU n 
7  3   ALA n 
7  4   ASP n 
7  5   CYS n 
7  6   SER n 
7  7   SER n 
7  8   LYS n 
7  9   SER n 
7  10  PRO n 
7  11  GLU n 
7  12  GLU n 
7  13  CYS n 
7  14  GLU n 
7  15  ILE n 
7  16  PHE n 
7  17  LEU n 
7  18  VAL n 
7  19  GLU n 
7  20  GLY n 
7  21  ASP n 
7  22  SER n 
7  23  ALA n 
7  24  GLY n 
7  25  GLY n 
7  26  SER n 
7  27  THR n 
7  28  LYS n 
7  29  SER n 
7  30  GLY n 
7  31  ARG n 
7  32  ASP n 
7  33  SER n 
7  34  ARG n 
7  35  THR n 
7  36  GLN n 
7  37  ALA n 
7  38  ILE n 
7  39  LEU n 
7  40  PRO n 
7  41  LEU n 
7  42  ARG n 
7  43  GLY n 
7  44  LYS n 
7  45  ILE n 
7  46  LEU n 
7  47  ASN n 
7  48  VAL n 
7  49  GLU n 
7  50  LYS n 
7  51  ALA n 
7  52  ARG n 
7  53  LEU n 
7  54  ASP n 
7  55  ARG n 
7  56  ILE n 
7  57  LEU n 
7  58  ASN n 
7  59  ASN n 
7  60  ASN n 
7  61  GLU n 
7  62  ILE n 
7  63  ARG n 
7  64  GLN n 
7  65  MET n 
7  66  ILE n 
7  67  THR n 
7  68  ALA n 
7  69  PHE n 
7  70  GLY n 
7  71  THR n 
7  72  GLY n 
7  73  ILE n 
7  74  GLY n 
7  75  GLY n 
7  76  ASP n 
7  77  PHE n 
7  78  ASP n 
7  79  LEU n 
7  80  ALA n 
7  81  LYS n 
7  82  ALA n 
7  83  ARG n 
7  84  TYR n 
7  85  HIS n 
7  86  LYS n 
7  87  ILE n 
7  88  VAL n 
7  89  ILE n 
7  90  MET n 
7  91  THR n 
7  92  ASP n 
7  93  ALA n 
7  94  ASP n 
7  95  VAL n 
7  96  ASP n 
7  97  GLY n 
7  98  ALA n 
7  99  HIS n 
7  100 ILE n 
7  101 ARG n 
7  102 THR n 
7  103 LEU n 
7  104 LEU n 
7  105 LEU n 
7  106 THR n 
7  107 PHE n 
7  108 PHE n 
7  109 TYR n 
7  110 ARG n 
7  111 PHE n 
7  112 MET n 
7  113 ARG n 
7  114 PRO n 
7  115 LEU n 
7  116 ILE n 
7  117 GLU n 
7  118 ALA n 
7  119 GLY n 
7  120 TYR n 
7  121 VAL n 
7  122 TYR n 
7  123 ILE n 
7  124 ALA n 
7  125 GLN n 
7  126 PRO n 
7  127 PRO n 
7  128 THR n 
7  129 GLY n 
7  130 TYR n 
7  131 LYS n 
7  132 GLY n 
7  133 LEU n 
7  134 GLY n 
7  135 GLU n 
7  136 MET n 
7  137 ASN n 
7  138 ALA n 
7  139 ASP n 
7  140 GLN n 
7  141 LEU n 
7  142 TRP n 
7  143 GLU n 
7  144 THR n 
7  145 THR n 
7  146 MET n 
7  147 ASN n 
7  148 PRO n 
7  149 GLU n 
7  150 HIS n 
7  151 ARG n 
7  152 ALA n 
7  153 LEU n 
7  154 LEU n 
7  155 GLN n 
7  156 VAL n 
7  157 LYS n 
7  158 LEU n 
7  159 GLU n 
7  160 ASP n 
7  161 ALA n 
7  162 ILE n 
7  163 GLU n 
7  164 ALA n 
7  165 ASP n 
7  166 GLN n 
7  167 THR n 
7  168 PHE n 
7  169 GLU n 
7  170 MET n 
7  171 LEU n 
7  172 MET n 
7  173 GLY n 
7  174 ASP n 
7  175 VAL n 
7  176 VAL n 
7  177 GLU n 
7  178 ASN n 
7  179 ARG n 
7  180 ARG n 
7  181 GLN n 
7  182 PHE n 
7  183 ILE n 
7  184 GLU n 
7  185 ASP n 
7  186 ASN n 
7  187 ALA n 
7  188 VAL n 
7  189 TYR n 
8  1   DG  n 
8  2   DA  n 
8  3   DG  n 
8  4   DC  n 
8  5   DG  n 
8  6   DT  n 
8  7   DA  n 
8  8   DC  n 
8  9   DG  n 
8  10  DG  n 
8  11  DC  n 
8  12  DC  n 
8  13  DG  n 
8  14  DT  n 
8  15  DA  n 
8  16  DC  n 
8  17  DG  n 
8  18  DC  n 
8  19  DT  n 
9  1   LYS n 
9  2   LEU n 
9  3   ALA n 
9  4   ASP n 
9  5   CYS n 
9  6   SER n 
9  7   SER n 
9  8   LYS n 
9  9   SER n 
9  10  PRO n 
9  11  GLU n 
9  12  GLU n 
9  13  CYS n 
9  14  GLU n 
9  15  ILE n 
9  16  PHE n 
9  17  LEU n 
9  18  VAL n 
9  19  GLU n 
9  20  GLY n 
9  21  ASP n 
9  22  SER n 
9  23  ALA n 
9  24  GLY n 
9  25  GLY n 
9  26  SER n 
9  27  THR n 
9  28  LYS n 
9  29  SER n 
9  30  GLY n 
9  31  ARG n 
9  32  ASP n 
9  33  SER n 
9  34  ARG n 
9  35  THR n 
9  36  GLN n 
9  37  ALA n 
9  38  ILE n 
9  39  LEU n 
9  40  PRO n 
9  41  LEU n 
9  42  ARG n 
9  43  GLY n 
9  44  LYS n 
9  45  ILE n 
9  46  LEU n 
9  47  ASN n 
9  48  VAL n 
9  49  GLU n 
9  50  LYS n 
9  51  ALA n 
9  52  ARG n 
9  53  LEU n 
9  54  ASP n 
9  55  ARG n 
9  56  ILE n 
9  57  LEU n 
9  58  ASN n 
9  59  ASN n 
9  60  ASN n 
9  61  GLU n 
9  62  ILE n 
9  63  ARG n 
9  64  GLN n 
9  65  MET n 
9  66  ILE n 
9  67  THR n 
9  68  ALA n 
9  69  PHE n 
9  70  GLY n 
9  71  THR n 
9  72  GLY n 
9  73  ILE n 
9  74  GLY n 
9  75  GLY n 
9  76  ASP n 
9  77  PHE n 
9  78  ASP n 
9  79  LEU n 
9  80  ALA n 
9  81  LYS n 
9  82  ALA n 
9  83  ARG n 
9  84  TYR n 
9  85  HIS n 
9  86  LYS n 
9  87  ILE n 
9  88  VAL n 
9  89  ILE n 
9  90  MET n 
9  91  THR n 
9  92  ASP n 
9  93  ALA n 
9  94  ASP n 
9  95  VAL n 
9  96  ASP n 
9  97  GLY n 
9  98  ALA n 
9  99  HIS n 
9  100 ILE n 
9  101 ARG n 
9  102 THR n 
9  103 LEU n 
9  104 LEU n 
9  105 LEU n 
9  106 THR n 
9  107 PHE n 
9  108 PHE n 
9  109 TYR n 
9  110 ARG n 
9  111 PHE n 
9  112 MET n 
9  113 ARG n 
9  114 PRO n 
9  115 LEU n 
9  116 ILE n 
9  117 GLU n 
9  118 ALA n 
9  119 GLY n 
9  120 TYR n 
9  121 VAL n 
9  122 TYR n 
9  123 ILE n 
9  124 ALA n 
9  125 GLN n 
9  126 PRO n 
9  127 PRO n 
9  128 THR n 
9  129 GLY n 
9  130 MET n 
9  131 ASN n 
9  132 ALA n 
9  133 ASP n 
9  134 GLN n 
9  135 LEU n 
9  136 TRP n 
9  137 GLU n 
9  138 THR n 
9  139 THR n 
9  140 MET n 
9  141 ASN n 
9  142 PRO n 
9  143 GLU n 
9  144 HIS n 
9  145 ARG n 
9  146 ALA n 
9  147 LEU n 
9  148 LEU n 
9  149 GLN n 
9  150 VAL n 
9  151 LYS n 
9  152 LEU n 
9  153 GLU n 
9  154 ASP n 
9  155 ALA n 
9  156 ILE n 
9  157 GLU n 
9  158 ALA n 
9  159 ASP n 
9  160 GLN n 
9  161 THR n 
9  162 PHE n 
9  163 GLU n 
9  164 MET n 
9  165 LEU n 
9  166 MET n 
9  167 GLY n 
9  168 ASP n 
9  169 VAL n 
9  170 VAL n 
9  171 GLU n 
9  172 ASN n 
9  173 ARG n 
9  174 ARG n 
9  175 GLN n 
9  176 PHE n 
9  177 ILE n 
9  178 GLU n 
9  179 ASP n 
9  180 ASN n 
9  181 ALA n 
10 1   DG  n 
10 2   DC  n 
10 3   DG  n 
10 4   DT  n 
10 5   DA  n 
10 6   DC  n 
10 7   DG  n 
10 8   DG  n 
10 9   DC  n 
10 10  DC  n 
10 11  DG  n 
10 12  DT  n 
10 13  DA  n 
10 14  DC  n 
10 15  DG  n 
10 16  DC  n 
10 17  DT  n 
11 1   GLY n 
11 2   LYS n 
11 3   LEU n 
11 4   ALA n 
11 5   ASP n 
11 6   CYS n 
11 7   SER n 
11 8   SER n 
11 9   LYS n 
11 10  SER n 
11 11  PRO n 
11 12  GLU n 
11 13  GLU n 
11 14  CYS n 
11 15  GLU n 
11 16  ILE n 
11 17  PHE n 
11 18  LEU n 
11 19  VAL n 
11 20  GLU n 
11 21  GLY n 
11 22  ASP n 
11 23  SER n 
11 24  ALA n 
11 25  GLY n 
11 26  GLY n 
11 27  SER n 
11 28  THR n 
11 29  LYS n 
11 30  SER n 
11 31  GLY n 
11 32  ARG n 
11 33  ASP n 
11 34  SER n 
11 35  ARG n 
11 36  THR n 
11 37  GLN n 
11 38  ALA n 
11 39  ILE n 
11 40  LEU n 
11 41  PRO n 
11 42  LEU n 
11 43  ARG n 
11 44  GLY n 
11 45  LYS n 
11 46  ILE n 
11 47  LEU n 
11 48  ASN n 
11 49  VAL n 
11 50  GLU n 
11 51  LYS n 
11 52  ALA n 
11 53  ARG n 
11 54  LEU n 
11 55  ASP n 
11 56  ARG n 
11 57  ILE n 
11 58  LEU n 
11 59  ASN n 
11 60  ASN n 
11 61  ASN n 
11 62  GLU n 
11 63  ILE n 
11 64  ARG n 
11 65  GLN n 
11 66  MET n 
11 67  ILE n 
11 68  THR n 
11 69  ALA n 
11 70  PHE n 
11 71  GLY n 
11 72  THR n 
11 73  GLY n 
11 74  ILE n 
11 75  GLY n 
11 76  GLY n 
11 77  ASP n 
11 78  PHE n 
11 79  ASP n 
11 80  LEU n 
11 81  ALA n 
11 82  LYS n 
11 83  ALA n 
11 84  ARG n 
11 85  TYR n 
11 86  HIS n 
11 87  LYS n 
11 88  ILE n 
11 89  VAL n 
11 90  ILE n 
11 91  MET n 
11 92  THR n 
11 93  ASP n 
11 94  ALA n 
11 95  ASP n 
11 96  VAL n 
11 97  ASP n 
11 98  GLY n 
11 99  ALA n 
11 100 HIS n 
11 101 ILE n 
11 102 ARG n 
11 103 THR n 
11 104 LEU n 
11 105 LEU n 
11 106 LEU n 
11 107 THR n 
11 108 PHE n 
11 109 PHE n 
11 110 TYR n 
11 111 ARG n 
11 112 PHE n 
11 113 MET n 
11 114 ARG n 
11 115 PRO n 
11 116 LEU n 
11 117 ILE n 
11 118 GLU n 
11 119 ALA n 
11 120 GLY n 
11 121 TYR n 
11 122 VAL n 
11 123 TYR n 
11 124 ILE n 
11 125 ALA n 
11 126 GLN n 
11 127 PRO n 
11 128 PRO n 
11 129 LYS n 
11 130 GLY n 
11 131 LEU n 
11 132 GLY n 
11 133 GLU n 
11 134 MET n 
11 135 ASN n 
11 136 ALA n 
11 137 ASP n 
11 138 GLN n 
11 139 LEU n 
11 140 TRP n 
11 141 GLU n 
11 142 THR n 
11 143 THR n 
11 144 MET n 
11 145 ASN n 
11 146 PRO n 
11 147 GLU n 
11 148 HIS n 
11 149 ARG n 
11 150 ALA n 
11 151 LEU n 
11 152 LEU n 
11 153 GLN n 
11 154 VAL n 
11 155 LYS n 
11 156 LEU n 
11 157 GLU n 
11 158 ASP n 
11 159 ALA n 
11 160 ILE n 
11 161 GLU n 
11 162 ALA n 
11 163 ASP n 
11 164 GLN n 
11 165 THR n 
11 166 PHE n 
11 167 GLU n 
11 168 MET n 
11 169 LEU n 
11 170 MET n 
11 171 GLY n 
11 172 ASP n 
11 173 VAL n 
11 174 VAL n 
11 175 GLU n 
11 176 ASN n 
11 177 ARG n 
11 178 ARG n 
11 179 GLN n 
11 180 PHE n 
11 181 ILE n 
11 182 GLU n 
11 183 ASP n 
11 184 ASN n 
11 185 ALA n 
11 186 VAL n 
11 187 TYR n 
11 188 ALA n 
12 1   LYS n 
12 2   LEU n 
12 3   ALA n 
12 4   ASP n 
12 5   CYS n 
12 6   SER n 
12 7   SER n 
12 8   LYS n 
12 9   SER n 
12 10  PRO n 
12 11  GLU n 
12 12  GLU n 
12 13  CYS n 
12 14  GLU n 
12 15  ILE n 
12 16  PHE n 
12 17  LEU n 
12 18  VAL n 
12 19  GLU n 
12 20  GLY n 
12 21  ASP n 
12 22  SER n 
12 23  ALA n 
12 24  GLY n 
12 25  GLY n 
12 26  SER n 
12 27  THR n 
12 28  LYS n 
12 29  SER n 
12 30  GLY n 
12 31  ARG n 
12 32  ASP n 
12 33  SER n 
12 34  ARG n 
12 35  THR n 
12 36  GLN n 
12 37  ALA n 
12 38  ILE n 
12 39  LEU n 
12 40  PRO n 
12 41  LEU n 
12 42  ARG n 
12 43  GLY n 
12 44  LYS n 
12 45  ILE n 
12 46  LEU n 
12 47  ASN n 
12 48  VAL n 
12 49  GLU n 
12 50  LYS n 
12 51  ALA n 
12 52  ARG n 
12 53  LEU n 
12 54  ASP n 
12 55  ARG n 
12 56  ILE n 
12 57  LEU n 
12 58  ASN n 
12 59  ASN n 
12 60  ASN n 
12 61  GLU n 
12 62  ILE n 
12 63  ARG n 
12 64  GLN n 
12 65  MET n 
12 66  ILE n 
12 67  THR n 
12 68  ALA n 
12 69  PHE n 
12 70  GLY n 
12 71  THR n 
12 72  GLY n 
12 73  ILE n 
12 74  GLY n 
12 75  GLY n 
12 76  ASP n 
12 77  PHE n 
12 78  ASP n 
12 79  LEU n 
12 80  ALA n 
12 81  LYS n 
12 82  ALA n 
12 83  ARG n 
12 84  TYR n 
12 85  HIS n 
12 86  LYS n 
12 87  ILE n 
12 88  VAL n 
12 89  ILE n 
12 90  MET n 
12 91  THR n 
12 92  ASP n 
12 93  ALA n 
12 94  ASP n 
12 95  VAL n 
12 96  ASP n 
12 97  GLY n 
12 98  ALA n 
12 99  HIS n 
12 100 ILE n 
12 101 ARG n 
12 102 THR n 
12 103 LEU n 
12 104 LEU n 
12 105 LEU n 
12 106 THR n 
12 107 PHE n 
12 108 PHE n 
12 109 TYR n 
12 110 ARG n 
12 111 PHE n 
12 112 MET n 
12 113 ARG n 
12 114 PRO n 
12 115 LEU n 
12 116 ILE n 
12 117 GLU n 
12 118 ALA n 
12 119 GLY n 
12 120 TYR n 
12 121 VAL n 
12 122 TYR n 
12 123 ILE n 
12 124 ALA n 
12 125 GLN n 
12 126 PRO n 
12 127 PRO n 
12 128 THR n 
12 129 GLY n 
12 130 TYR n 
12 131 LYS n 
12 132 GLY n 
12 133 LEU n 
12 134 GLY n 
12 135 GLU n 
12 136 MET n 
12 137 ASN n 
12 138 ALA n 
12 139 ASP n 
12 140 GLN n 
12 141 LEU n 
12 142 TRP n 
12 143 GLU n 
12 144 THR n 
12 145 THR n 
12 146 MET n 
12 147 ASN n 
12 148 PRO n 
12 149 GLU n 
12 150 HIS n 
12 151 ARG n 
12 152 ALA n 
12 153 LEU n 
12 154 LEU n 
12 155 GLN n 
12 156 VAL n 
12 157 LYS n 
12 158 LEU n 
12 159 GLU n 
12 160 ASP n 
12 161 ALA n 
12 162 ILE n 
12 163 GLU n 
12 164 ALA n 
12 165 ASP n 
12 166 GLN n 
12 167 THR n 
12 168 PHE n 
12 169 GLU n 
12 170 MET n 
12 171 LEU n 
12 172 MET n 
12 173 GLY n 
12 174 ASP n 
12 175 VAL n 
12 176 VAL n 
12 177 GLU n 
12 178 ASN n 
12 179 ARG n 
12 180 ARG n 
12 181 GLN n 
12 182 PHE n 
12 183 ILE n 
12 184 GLU n 
12 185 ASP n 
12 186 ASN n 
12 187 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1  1 sample 'Biological sequence' 1   128 ? ? gyrB                  ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1  2 sample 'Biological sequence' 129 186 ? ? 'gyrB, SAV0005'       ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 'Biological sequence' 1   490 ? ? 'gyrA, SA0006'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 'Biological sequence' 1   127 ? ? gyrB                  ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  2 sample 'Biological sequence' 128 188 ? ? 'gyrB, SAR0005'       ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 'Biological sequence' 1   20  ? ? ?                     ? ? ? ? ? ? 'synthetic construct'   32630 ? ? ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 'Biological sequence' 1   128 ? ? 'gyrB, SA0005'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  2 sample 'Biological sequence' 129 187 ? ? 'gyrB, SAUSA300_0005' ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 'Biological sequence' 1   480 ? ? 'gyrA, SA0006'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 'Biological sequence' 1   127 ? ? 'gyrB, SA0005'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  2 sample 'Biological sequence' 128 189 ? ? 'gyrB, SAUSA300_0005' ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 'Biological sequence' 1   19  ? ? ?                     ? ? ? ? ? ? 'synthetic construct'   32630 ? ? ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 'Biological sequence' 1   128 ? ? 'gyrB, SA0005'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  2 sample 'Biological sequence' 129 181 ? ? 'gyrB, SAR0005'       ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 'Biological sequence' 1   17  ? ? ?                     ? ? ? ? ? ? 'synthetic construct'   32630 ? ? ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 'Biological sequence' 1   128 ? ? 'gyrB, SA0005'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 2 sample 'Biological sequence' 129 188 ? ? 'gyrB, SAR0005'       ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 'Biological sequence' 1   127 ? ? 'gyrB, SA0005'        ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 2 sample 'Biological sequence' 128 187 ? ? 'gyrB, SAUSA300_0005' ? ? ? ? ? ? 'Staphylococcus aureus' 1280  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP GYRB_STAAU P0A0K8 ? 1  
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
416 
2  UNP GYRB_STAAM P66936 ? 1  KGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAV 581 
3  UNP GYRA_STAAN Q99XG5 ? 2  
;AELPQSRINERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPH
GDSSIYEAMVRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLP
ARFPNLLANGASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSI
QMRSRAVIEERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNL
YKQTPLQTSFGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRES
DTDKVAMESLQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFG
DDRRTEIQLG
;
2   
4  UNP GYRB_STAAU P0A0K8 ? 3  
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
417 
5  UNP GYRB_STAAR Q6GKU0 ? 3  YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAV 580 
6  PDB 6QX2       6QX2   ? 4  ? 1   
7  UNP GYRB_STAAN P66937 ? 5  
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
416 
8  UNP GYRB_STAA3 Q2FKQ1 ? 5  KGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVY 581 
9  UNP GYRA_STAAN Q99XG5 ? 6  
;ERNITSEMRESFLDYAMSVIVARALPDVRDGLKPVHRRILYGLNEQGMTPDKSYKKSARIVGDVMGKYHPHGDSSIYEAM
VRMAQDFSYRYPLVDGQGNFGSMDGDGAAAMRYTEARMTKITLELLRDINKDTIDFIDNYDGNEREPSVLPARFPNLLAN
GASGIAVGMATNIPPHNLTELINGVLSLSKNPDISIAELMEDIEGPDFPTAGLILGKSGIRRAYETGRGSIQMRSRAVIE
ERGGGRQRIVVTEIPFQVNKARMIEKIAELVRDKKIDGITDLRDETSLRTGVRVVIDVRKDANASVILNNLYKQTPLQTS
FGVNMIALVNGRPKLINLKEALVHYLEHQKTVVRRRTQYNLRKAKDRAHILEGLRIALDHIDEIISTIRESDTDKVAMES
LQQRFKLSEKQAQAILDMRLRRLTGLERDKIEAEYNELLNYISELETILADEEVLLQLVRDELTEIRDRFGDDRRTEIQL
G
;
11  
10 UNP GYRB_STAAN P66937 ? 7  
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
417 
11 UNP GYRB_STAA3 Q2FKQ1 ? 7  YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVY 580 
12 PDB 6QX2       6QX2   ? 8  ? 1   
13 UNP GYRB_STAAN P66937 ? 9  
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
417 
14 UNP GYRB_STAAR Q6GKU0 ? 9  MNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNA 586 
15 PDB 6QX2       6QX2   ? 10 ? 1   
16 UNP GYRB_STAAN P66937 ? 11 
;GKLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDL
AKARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
416 
17 UNP GYRB_STAAR Q6GKU0 ? 11 KGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNAVYA 581 
18 UNP GYRB_STAAN P66937 ? 12 
;KLADCSSKSPEECEIFLVEGDSAGGSTKSGRDSRTQAILPLRGKILNVEKARLDRILNNNEIRQMITAFGTGIGGDFDLA
KARYHKIVIMTDADVDGAHIRTLLLTFFYRFMRPLIEAGYVYIAQPP
;
417 
19 UNP GYRB_STAA3 Q2FKQ1 ? 12 YKGLGEMNADQLWETTMNPEHRALLQVKLEDAIEADQTFEMLMGDVVENRRQFIEDNA 580 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  6QX2 B 1   ? 128 ? P0A0K8 416 ? 543  ? 416 543  
2  2  6QX2 B 129 ? 186 ? P66936 581 ? 638  ? 581 638  
3  3  6QX2 A 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
4  4  6QX2 D 1   ? 127 ? P0A0K8 417 ? 543  ? 417 543  
5  5  6QX2 D 130 ? 188 ? Q6GKU0 580 ? 638  ? 580 638  
6  3  6QX2 C 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
7  6  6QX2 E 1   ? 20  ? 6QX2   1   ? 20   ? 1   20   
8  6  6QX2 F 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
9  7  6QX2 K 1   ? 128 ? P66937 416 ? 543  ? 416 543  
10 8  6QX2 K 129 ? 187 ? Q2FKQ1 581 ? 639  ? 581 639  
11 9  6QX2 J 1   ? 480 ? Q99XG5 11  ? 491  ? 11  491  
12 10 6QX2 M 1   ? 127 ? P66937 417 ? 543  ? 417 543  
13 11 6QX2 M 130 ? 189 ? Q2FKQ1 580 ? 639  ? 580 639  
14 3  6QX2 L 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
15 6  6QX2 N 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
16 6  6QX2 O 1   ? 20  ? 6QX2   1   ? 20   ? 1   20   
17 1  6QX2 S 1   ? 128 ? P0A0K8 416 ? 543  ? 416 543  
18 2  6QX2 S 129 ? 186 ? P66936 581 ? 638  ? 581 638  
19 3  6QX2 R 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
20 4  6QX2 U 1   ? 127 ? P0A0K8 417 ? 543  ? 417 543  
21 5  6QX2 U 130 ? 188 ? Q6GKU0 580 ? 638  ? 580 638  
22 3  6QX2 T 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
23 12 6QX2 V 1   ? 19  ? 6QX2   1   ? 2019 ? 1   2019 
24 6  6QX2 W 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
25 1  6QX2 b 1   ? 128 ? P0A0K8 416 ? 543  ? 416 543  
26 2  6QX2 b 129 ? 186 ? P66936 581 ? 638  ? 581 638  
27 3  6QX2 a 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
28 13 6QX2 d 1   ? 127 ? P66937 417 ? 543  ? 417 543  
29 14 6QX2 d 130 ? 181 ? Q6GKU0 586 ? 637  ? 586 637  
30 3  6QX2 c 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
31 6  6QX2 e 1   ? 20  ? 6QX2   1   ? 20   ? 1   20   
32 15 6QX2 f 1   ? 17  ? 6QX2   3   ? 19   ? 3   19   
33 16 6QX2 k 1   ? 128 ? P66937 416 ? 543  ? 416 543  
34 17 6QX2 k 129 ? 188 ? Q6GKU0 581 ? 640  ? 581 640  
35 3  6QX2 j 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
36 4  6QX2 m 1   ? 127 ? P0A0K8 417 ? 543  ? 417 543  
37 5  6QX2 m 130 ? 188 ? Q6GKU0 580 ? 638  ? 580 638  
38 3  6QX2 l 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
39 6  6QX2 n 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
40 12 6QX2 o 1   ? 19  ? 6QX2   1   ? 2019 ? 1   2019 
41 1  6QX2 s 1   ? 128 ? P0A0K8 416 ? 543  ? 416 543  
42 2  6QX2 s 129 ? 186 ? P66936 581 ? 638  ? 581 638  
43 3  6QX2 r 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
44 18 6QX2 u 1   ? 127 ? P66937 417 ? 543  ? 417 543  
45 19 6QX2 u 130 ? 187 ? Q2FKQ1 580 ? 637  ? 580 637  
46 3  6QX2 t 1   ? 490 ? Q99XG5 2   ? 491  ? 2   491  
47 6  6QX2 v 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
48 6  6QX2 w 1   ? 20  ? 6QX2   1   ? 2020 ? 1   2020 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4  6QX2 THR D 128 ? UNP P0A0K8 ?   ?   linker   544 1  
4  6QX2 GLY D 129 ? UNP P0A0K8 ?   ?   linker   545 2  
11 6QX2 ?   J ?   ? UNP Q99XG5 ARG 256 deletion ?   3  
12 6QX2 THR M 128 ? UNP P66937 ?   ?   linker   544 4  
12 6QX2 GLY M 129 ? UNP P66937 ?   ?   linker   545 5  
20 6QX2 THR U 128 ? UNP P0A0K8 ?   ?   linker   544 6  
20 6QX2 GLY U 129 ? UNP P0A0K8 ?   ?   linker   545 7  
28 6QX2 THR d 128 ? UNP P66937 ?   ?   linker   544 8  
28 6QX2 GLY d 129 ? UNP P66937 ?   ?   linker   545 9  
36 6QX2 THR m 128 ? UNP P0A0K8 ?   ?   linker   544 10 
36 6QX2 GLY m 129 ? UNP P0A0K8 ?   ?   linker   545 11 
44 6QX2 THR u 128 ? UNP P66937 ?   ?   linker   544 12 
44 6QX2 GLY u 129 ? UNP P66937 ?   ?   linker   545 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                       ? 'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                                                                      ? 'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                    ? 'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                               ? 'C4 H7 N O4'       
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                      ? 'C3 H7 N O2 S'     
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O6 P'  
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                           ? 'C9 H14 N3 O7 P'   
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                          ? 'C10 H14 N5 O7 P'  
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                  ? 'C10 H15 N2 O8 P'  
322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                     ? 'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                               ? 'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                                                                       ? 'C2 H5 N O2'       
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                     ? 'C6 H10 N3 O2 1'   
156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                    ? 'C6 H13 N O2'      
131.173 
JK8 non-polymer         . '(2~{R})-2-[[5-(2-chlorophenyl)-1,2-benzoxazol-3-yl]oxy]-2-phenyl-ethanamine' ? 'C21 H17 Cl N2 O2' 
364.825 
LEU 'L-peptide linking' y LEUCINE                                                                       ? 'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                                                                        ? 'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                                                                    ? 'C5 H11 N O2 S'    
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                 ? 'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                                                                       ? 'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                                                                        ? 'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                                                                     ? 'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                    ? 'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                      ? 'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                                                                        ? 'C5 H11 N O2'      
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6QX2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.20 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.55 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          MICROBATCH 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '10% perg 5k mme, 150mM Bis Tris pH6.2 - see paper for details.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-04-18 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I23' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I23 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6QX2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.4 
_reflns.d_resolution_low                 162.15 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       135780 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             81.1 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.1 
_reflns.pdbx_Rmerge_I_obs                0.121 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.144 
_reflns.pdbx_Rpim_I_all                  0.077 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.40 
_reflns_shell.d_res_low                   3.58 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           20498 
_reflns_shell.percent_possible_all        83.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.369 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             0.440 
_reflns_shell.pdbx_Rpim_I_all             0.237 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            7.76 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.93 
_refine.aniso_B[2][2]                            15.83 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -23.59 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               53.745 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.911 
_refine.correlation_coeff_Fo_to_Fc_free          0.879 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6QX2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.40 
_refine.ls_d_res_low                             162.15 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     128993 
_refine.ls_number_reflns_R_free                  6786 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    80.35 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.17787 
_refine.ls_R_factor_R_free                       0.20834 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17627 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2XCS 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.119 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             20.499 
_refine.overall_SU_ML                            0.343 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6QX2 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        162.15 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               66709 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        61755 
_refine_hist.pdbx_number_atoms_nucleic_acid   4642 
_refine_hist.pdbx_number_atoms_ligand         312 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  0.013  69826  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.017  62645  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.479  1.611  95659  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 1.237  1.642  144583 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.147  5.000  8294   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 30.382 21.451 3735   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.820 15.000 11236  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.574 15.000 652    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.058  0.200  9378   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.020  77551  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  15141  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 5.195  5.766  32804  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 5.195  5.766  32803  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 8.430  8.640  41197  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.430  8.640  41198  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.944  6.025  37022  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.944  6.025  37023  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 8.069  8.940  54454  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 15.951 ?      284993 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 15.951 ?      284994 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?      ? r_sphericity_bonded          ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_asym_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_rms 
_refine_ls_restr_ncs.pdbx_weight 
_refine_ls_restr_ncs.pdbx_ens_id 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 1   'interatomic distance' ? B 5576  ? ? 1   
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 2   'interatomic distance' ? D 5576  ? ? 1   
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 3   'interatomic distance' ? B 5763  ? ? 2   
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 4   'interatomic distance' ? K 5763  ? ? 2   
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 5   'interatomic distance' ? B 5567  ? ? 3   
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 6   'interatomic distance' ? M 5567  ? ? 3   
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 7   'interatomic distance' ? B 5788  ? ? 4   
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 8   'interatomic distance' ? S 5788  ? ? 4   
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 9   'interatomic distance' ? B 5585  ? ? 5   
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 10  'interatomic distance' ? U 5585  ? ? 5   
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 11  'interatomic distance' ? B 5766  ? ? 6   
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 12  'interatomic distance' ? b 5766  ? ? 6   
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 13  'interatomic distance' ? B 5408  ? ? 7   
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 14  'interatomic distance' ? d 5408  ? ? 7   
'X-RAY DIFFRACTION' 1 ? ? 0.02 ? 0.05 15  'interatomic distance' ? B 5756  ? ? 8   
'X-RAY DIFFRACTION' 2 ? ? 0.02 ? 0.05 16  'interatomic distance' ? k 5756  ? ? 8   
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 17  'interatomic distance' ? B 5559  ? ? 9   
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 18  'interatomic distance' ? m 5559  ? ? 9   
'X-RAY DIFFRACTION' 1 ? ? 0.02 ? 0.05 19  'interatomic distance' ? B 5770  ? ? 10  
'X-RAY DIFFRACTION' 2 ? ? 0.02 ? 0.05 20  'interatomic distance' ? s 5770  ? ? 10  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 21  'interatomic distance' ? B 5555  ? ? 11  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 22  'interatomic distance' ? u 5555  ? ? 11  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 23  'interatomic distance' ? A 15445 ? ? 12  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 24  'interatomic distance' ? C 15445 ? ? 12  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 25  'interatomic distance' ? A 15829 ? ? 13  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 26  'interatomic distance' ? J 15829 ? ? 13  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 27  'interatomic distance' ? A 15444 ? ? 14  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 28  'interatomic distance' ? L 15444 ? ? 14  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 29  'interatomic distance' ? A 15744 ? ? 15  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 30  'interatomic distance' ? R 15744 ? ? 15  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 31  'interatomic distance' ? A 15463 ? ? 16  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 32  'interatomic distance' ? T 15463 ? ? 16  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 33  'interatomic distance' ? A 15783 ? ? 17  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 34  'interatomic distance' ? a 15783 ? ? 17  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 35  'interatomic distance' ? A 15482 ? ? 18  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 36  'interatomic distance' ? c 15482 ? ? 18  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 37  'interatomic distance' ? A 15805 ? ? 19  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 38  'interatomic distance' ? j 15805 ? ? 19  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 39  'interatomic distance' ? A 15486 ? ? 20  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 40  'interatomic distance' ? l 15486 ? ? 20  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 41  'interatomic distance' ? A 15818 ? ? 21  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 42  'interatomic distance' ? r 15818 ? ? 21  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 43  'interatomic distance' ? A 15492 ? ? 22  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 44  'interatomic distance' ? t 15492 ? ? 22  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 45  'interatomic distance' ? D 5499  ? ? 23  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 46  'interatomic distance' ? K 5499  ? ? 23  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 47  'interatomic distance' ? D 5856  ? ? 24  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 48  'interatomic distance' ? M 5856  ? ? 24  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 49  'interatomic distance' ? D 5457  ? ? 25  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 50  'interatomic distance' ? S 5457  ? ? 25  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 51  'interatomic distance' ? D 5897  ? ? 26  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 52  'interatomic distance' ? U 5897  ? ? 26  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 53  'interatomic distance' ? D 5436  ? ? 27  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 54  'interatomic distance' ? b 5436  ? ? 27  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 55  'interatomic distance' ? D 5647  ? ? 28  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 56  'interatomic distance' ? d 5647  ? ? 28  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 57  'interatomic distance' ? D 5461  ? ? 29  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 58  'interatomic distance' ? k 5461  ? ? 29  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 59  'interatomic distance' ? D 5857  ? ? 30  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 60  'interatomic distance' ? m 5857  ? ? 30  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 61  'interatomic distance' ? D 5469  ? ? 31  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 62  'interatomic distance' ? s 5469  ? ? 31  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 63  'interatomic distance' ? D 5842  ? ? 32  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 64  'interatomic distance' ? u 5842  ? ? 32  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 65  'interatomic distance' ? C 15405 ? ? 33  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 66  'interatomic distance' ? J 15405 ? ? 33  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 67  'interatomic distance' ? C 15810 ? ? 34  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 68  'interatomic distance' ? L 15810 ? ? 34  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 69  'interatomic distance' ? C 15402 ? ? 35  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 70  'interatomic distance' ? R 15402 ? ? 35  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 71  'interatomic distance' ? C 15800 ? ? 36  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 72  'interatomic distance' ? T 15800 ? ? 36  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 73  'interatomic distance' ? C 15453 ? ? 37  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 74  'interatomic distance' ? a 15453 ? ? 37  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 75  'interatomic distance' ? C 15882 ? ? 38  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 76  'interatomic distance' ? c 15882 ? ? 38  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 77  'interatomic distance' ? C 15422 ? ? 39  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 78  'interatomic distance' ? j 15422 ? ? 39  
'X-RAY DIFFRACTION' 1 ? ? 0.02 ? 0.05 79  'interatomic distance' ? C 15859 ? ? 40  
'X-RAY DIFFRACTION' 2 ? ? 0.02 ? 0.05 80  'interatomic distance' ? l 15859 ? ? 40  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 81  'interatomic distance' ? C 15458 ? ? 41  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 82  'interatomic distance' ? r 15458 ? ? 41  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 83  'interatomic distance' ? C 15865 ? ? 42  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 84  'interatomic distance' ? t 15865 ? ? 42  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 85  'interatomic distance' ? E 1323  ? ? 43  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 86  'interatomic distance' ? F 1323  ? ? 43  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 87  'interatomic distance' ? E 1338  ? ? 44  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 88  'interatomic distance' ? N 1338  ? ? 44  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 89  'interatomic distance' ? E 1330  ? ? 45  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 90  'interatomic distance' ? O 1330  ? ? 45  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 91  'interatomic distance' ? E 1238  ? ? 46  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 92  'interatomic distance' ? V 1238  ? ? 46  
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 93  'interatomic distance' ? E 1326  ? ? 47  
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 94  'interatomic distance' ? W 1326  ? ? 47  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 95  'interatomic distance' ? E 1307  ? ? 48  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 96  'interatomic distance' ? e 1307  ? ? 48  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 97  'interatomic distance' ? E 1243  ? ? 49  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 98  'interatomic distance' ? f 1243  ? ? 49  
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 99  'interatomic distance' ? E 1309  ? ? 50  
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 100 'interatomic distance' ? n 1309  ? ? 50  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 101 'interatomic distance' ? E 1222  ? ? 51  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 102 'interatomic distance' ? o 1222  ? ? 51  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 103 'interatomic distance' ? E 1321  ? ? 52  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 104 'interatomic distance' ? v 1321  ? ? 52  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 105 'interatomic distance' ? E 1314  ? ? 53  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 106 'interatomic distance' ? w 1314  ? ? 53  
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 107 'interatomic distance' ? F 1489  ? ? 54  
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 108 'interatomic distance' ? N 1489  ? ? 54  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 109 'interatomic distance' ? F 1525  ? ? 55  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 110 'interatomic distance' ? O 1525  ? ? 55  
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 111 'interatomic distance' ? F 1377  ? ? 56  
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 112 'interatomic distance' ? V 1377  ? ? 56  
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 113 'interatomic distance' ? F 1478  ? ? 57  
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 114 'interatomic distance' ? W 1478  ? ? 57  
'X-RAY DIFFRACTION' 1 ? ? 0.12 ? 0.05 115 'interatomic distance' ? F 1425  ? ? 58  
'X-RAY DIFFRACTION' 2 ? ? 0.12 ? 0.05 116 'interatomic distance' ? e 1425  ? ? 58  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 117 'interatomic distance' ? F 1239  ? ? 59  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 118 'interatomic distance' ? f 1239  ? ? 59  
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 119 'interatomic distance' ? F 1471  ? ? 60  
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 120 'interatomic distance' ? n 1471  ? ? 60  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 121 'interatomic distance' ? F 1321  ? ? 61  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 122 'interatomic distance' ? o 1321  ? ? 61  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 123 'interatomic distance' ? F 1407  ? ? 62  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 124 'interatomic distance' ? v 1407  ? ? 62  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 125 'interatomic distance' ? F 1497  ? ? 63  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 126 'interatomic distance' ? w 1497  ? ? 63  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 127 'interatomic distance' ? K 5583  ? ? 64  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 128 'interatomic distance' ? M 5583  ? ? 64  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 129 'interatomic distance' ? K 5721  ? ? 65  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 130 'interatomic distance' ? S 5721  ? ? 65  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 131 'interatomic distance' ? K 5581  ? ? 66  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 132 'interatomic distance' ? U 5581  ? ? 66  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 133 'interatomic distance' ? K 5699  ? ? 67  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 134 'interatomic distance' ? b 5699  ? ? 67  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 135 'interatomic distance' ? K 5413  ? ? 68  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 136 'interatomic distance' ? d 5413  ? ? 68  
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 137 'interatomic distance' ? K 5749  ? ? 69  
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 138 'interatomic distance' ? k 5749  ? ? 69  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 139 'interatomic distance' ? K 5565  ? ? 70  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 140 'interatomic distance' ? m 5565  ? ? 70  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 141 'interatomic distance' ? K 5750  ? ? 71  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 142 'interatomic distance' ? s 5750  ? ? 71  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 143 'interatomic distance' ? K 5565  ? ? 72  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 144 'interatomic distance' ? u 5565  ? ? 72  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 145 'interatomic distance' ? J 15616 ? ? 73  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 146 'interatomic distance' ? L 15616 ? ? 73  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 147 'interatomic distance' ? J 16003 ? ? 74  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 148 'interatomic distance' ? R 16003 ? ? 74  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 149 'interatomic distance' ? J 15599 ? ? 75  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 150 'interatomic distance' ? T 15599 ? ? 75  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 151 'interatomic distance' ? J 16007 ? ? 76  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 152 'interatomic distance' ? a 16007 ? ? 76  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 153 'interatomic distance' ? J 15649 ? ? 77  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 154 'interatomic distance' ? c 15649 ? ? 77  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 155 'interatomic distance' ? J 16054 ? ? 78  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 156 'interatomic distance' ? j 16054 ? ? 78  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 157 'interatomic distance' ? J 15668 ? ? 79  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 158 'interatomic distance' ? l 15668 ? ? 79  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 159 'interatomic distance' ? J 16020 ? ? 80  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 160 'interatomic distance' ? r 16020 ? ? 80  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 161 'interatomic distance' ? J 15647 ? ? 81  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 162 'interatomic distance' ? t 15647 ? ? 81  
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 163 'interatomic distance' ? M 5472  ? ? 82  
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 164 'interatomic distance' ? S 5472  ? ? 82  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 165 'interatomic distance' ? M 5913  ? ? 83  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 166 'interatomic distance' ? U 5913  ? ? 83  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 167 'interatomic distance' ? M 5459  ? ? 84  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 168 'interatomic distance' ? b 5459  ? ? 84  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 169 'interatomic distance' ? M 5663  ? ? 85  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 170 'interatomic distance' ? d 5663  ? ? 85  
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 171 'interatomic distance' ? M 5505  ? ? 86  
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 172 'interatomic distance' ? k 5505  ? ? 86  
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 173 'interatomic distance' ? M 5878  ? ? 87  
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 174 'interatomic distance' ? m 5878  ? ? 87  
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 175 'interatomic distance' ? M 5479  ? ? 88  
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 176 'interatomic distance' ? s 5479  ? ? 88  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 177 'interatomic distance' ? M 5882  ? ? 89  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 178 'interatomic distance' ? u 5882  ? ? 89  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 179 'interatomic distance' ? L 15333 ? ? 90  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 180 'interatomic distance' ? R 15333 ? ? 90  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 181 'interatomic distance' ? L 15748 ? ? 91  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 182 'interatomic distance' ? T 15748 ? ? 91  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 183 'interatomic distance' ? L 15342 ? ? 92  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 184 'interatomic distance' ? a 15342 ? ? 92  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 185 'interatomic distance' ? L 15777 ? ? 93  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 186 'interatomic distance' ? c 15777 ? ? 93  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 187 'interatomic distance' ? L 15330 ? ? 94  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 188 'interatomic distance' ? j 15330 ? ? 94  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 189 'interatomic distance' ? L 15770 ? ? 95  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 190 'interatomic distance' ? l 15770 ? ? 95  
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 191 'interatomic distance' ? L 15429 ? ? 96  
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 192 'interatomic distance' ? r 15429 ? ? 96  
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 193 'interatomic distance' ? L 15804 ? ? 97  
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 194 'interatomic distance' ? t 15804 ? ? 97  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 195 'interatomic distance' ? N 1343  ? ? 98  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 196 'interatomic distance' ? O 1343  ? ? 98  
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 197 'interatomic distance' ? N 1236  ? ? 99  
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 198 'interatomic distance' ? V 1236  ? ? 99  
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 199 'interatomic distance' ? N 1328  ? ? 100 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 200 'interatomic distance' ? W 1328  ? ? 100 
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 201 'interatomic distance' ? N 1317  ? ? 101 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 202 'interatomic distance' ? e 1317  ? ? 101 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 203 'interatomic distance' ? N 1240  ? ? 102 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 204 'interatomic distance' ? f 1240  ? ? 102 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 205 'interatomic distance' ? N 1339  ? ? 103 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 206 'interatomic distance' ? n 1339  ? ? 103 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 207 'interatomic distance' ? N 1228  ? ? 104 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 208 'interatomic distance' ? o 1228  ? ? 104 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 209 'interatomic distance' ? N 1323  ? ? 105 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 210 'interatomic distance' ? v 1323  ? ? 105 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 211 'interatomic distance' ? N 1310  ? ? 106 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 212 'interatomic distance' ? w 1310  ? ? 106 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 213 'interatomic distance' ? O 1378  ? ? 107 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 214 'interatomic distance' ? V 1378  ? ? 107 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 215 'interatomic distance' ? O 1480  ? ? 108 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 216 'interatomic distance' ? W 1480  ? ? 108 
'X-RAY DIFFRACTION' 1 ? ? 0.11 ? 0.05 217 'interatomic distance' ? O 1434  ? ? 109 
'X-RAY DIFFRACTION' 2 ? ? 0.11 ? 0.05 218 'interatomic distance' ? e 1434  ? ? 109 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 219 'interatomic distance' ? O 1242  ? ? 110 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 220 'interatomic distance' ? f 1242  ? ? 110 
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 221 'interatomic distance' ? O 1487  ? ? 111 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 222 'interatomic distance' ? n 1487  ? ? 111 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 223 'interatomic distance' ? O 1335  ? ? 112 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 224 'interatomic distance' ? o 1335  ? ? 112 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 225 'interatomic distance' ? O 1407  ? ? 113 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 226 'interatomic distance' ? v 1407  ? ? 113 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 227 'interatomic distance' ? O 1497  ? ? 114 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 228 'interatomic distance' ? w 1497  ? ? 114 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 229 'interatomic distance' ? S 5587  ? ? 115 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 230 'interatomic distance' ? U 5587  ? ? 115 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 231 'interatomic distance' ? S 5784  ? ? 116 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 232 'interatomic distance' ? b 5784  ? ? 116 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 233 'interatomic distance' ? S 5424  ? ? 117 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 234 'interatomic distance' ? d 5424  ? ? 117 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 235 'interatomic distance' ? S 5767  ? ? 118 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 236 'interatomic distance' ? k 5767  ? ? 118 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 237 'interatomic distance' ? S 5577  ? ? 119 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 238 'interatomic distance' ? m 5577  ? ? 119 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 239 'interatomic distance' ? S 5784  ? ? 120 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 240 'interatomic distance' ? s 5784  ? ? 120 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 241 'interatomic distance' ? S 5571  ? ? 121 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 242 'interatomic distance' ? u 5571  ? ? 121 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 243 'interatomic distance' ? R 15517 ? ? 122 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 244 'interatomic distance' ? T 15517 ? ? 122 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 245 'interatomic distance' ? R 15895 ? ? 123 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 246 'interatomic distance' ? a 15895 ? ? 123 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 247 'interatomic distance' ? R 15554 ? ? 124 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 248 'interatomic distance' ? c 15554 ? ? 124 
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 249 'interatomic distance' ? R 15912 ? ? 125 
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 250 'interatomic distance' ? j 15912 ? ? 125 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 251 'interatomic distance' ? R 15604 ? ? 126 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 252 'interatomic distance' ? l 15604 ? ? 126 
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 253 'interatomic distance' ? R 15911 ? ? 127 
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 254 'interatomic distance' ? r 15911 ? ? 127 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 255 'interatomic distance' ? R 15537 ? ? 128 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 256 'interatomic distance' ? t 15537 ? ? 128 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 257 'interatomic distance' ? U 5472  ? ? 129 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 258 'interatomic distance' ? b 5472  ? ? 129 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 259 'interatomic distance' ? U 5683  ? ? 130 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 260 'interatomic distance' ? d 5683  ? ? 130 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 261 'interatomic distance' ? U 5492  ? ? 131 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 262 'interatomic distance' ? k 5492  ? ? 131 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 263 'interatomic distance' ? U 5932  ? ? 132 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 264 'interatomic distance' ? m 5932  ? ? 132 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 265 'interatomic distance' ? U 5497  ? ? 133 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 266 'interatomic distance' ? s 5497  ? ? 133 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 267 'interatomic distance' ? U 5925  ? ? 134 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 268 'interatomic distance' ? u 5925  ? ? 134 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 269 'interatomic distance' ? T 15347 ? ? 135 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 270 'interatomic distance' ? a 15347 ? ? 135 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 271 'interatomic distance' ? T 15807 ? ? 136 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 272 'interatomic distance' ? c 15807 ? ? 136 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 273 'interatomic distance' ? T 15363 ? ? 137 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 274 'interatomic distance' ? j 15363 ? ? 137 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 275 'interatomic distance' ? T 15810 ? ? 138 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 276 'interatomic distance' ? l 15810 ? ? 138 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 277 'interatomic distance' ? T 15397 ? ? 139 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 278 'interatomic distance' ? r 15397 ? ? 139 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 279 'interatomic distance' ? T 15873 ? ? 140 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 280 'interatomic distance' ? t 15873 ? ? 140 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 281 'interatomic distance' ? V 1375  ? ? 141 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 282 'interatomic distance' ? W 1375  ? ? 141 
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 283 'interatomic distance' ? V 1334  ? ? 142 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 284 'interatomic distance' ? e 1334  ? ? 142 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 285 'interatomic distance' ? V 1225  ? ? 143 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 286 'interatomic distance' ? f 1225  ? ? 143 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 287 'interatomic distance' ? V 1366  ? ? 144 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 288 'interatomic distance' ? n 1366  ? ? 144 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 289 'interatomic distance' ? V 1304  ? ? 145 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 290 'interatomic distance' ? o 1304  ? ? 145 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 291 'interatomic distance' ? V 1319  ? ? 146 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 292 'interatomic distance' ? v 1319  ? ? 146 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 293 'interatomic distance' ? V 1368  ? ? 147 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 294 'interatomic distance' ? w 1368  ? ? 147 
'X-RAY DIFFRACTION' 1 ? ? 0.12 ? 0.05 295 'interatomic distance' ? W 1425  ? ? 148 
'X-RAY DIFFRACTION' 2 ? ? 0.12 ? 0.05 296 'interatomic distance' ? e 1425  ? ? 148 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 297 'interatomic distance' ? W 1225  ? ? 149 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 298 'interatomic distance' ? f 1225  ? ? 149 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 299 'interatomic distance' ? W 1469  ? ? 150 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 300 'interatomic distance' ? n 1469  ? ? 150 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 301 'interatomic distance' ? W 1322  ? ? 151 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 302 'interatomic distance' ? o 1322  ? ? 151 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 303 'interatomic distance' ? W 1404  ? ? 152 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 304 'interatomic distance' ? v 1404  ? ? 152 
'X-RAY DIFFRACTION' 1 ? ? 0.11 ? 0.05 305 'interatomic distance' ? W 1486  ? ? 153 
'X-RAY DIFFRACTION' 2 ? ? 0.11 ? 0.05 306 'interatomic distance' ? w 1486  ? ? 153 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 307 'interatomic distance' ? b 5406  ? ? 154 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 308 'interatomic distance' ? d 5406  ? ? 154 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 309 'interatomic distance' ? b 5714  ? ? 155 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 310 'interatomic distance' ? k 5714  ? ? 155 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 311 'interatomic distance' ? b 5552  ? ? 156 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 312 'interatomic distance' ? m 5552  ? ? 156 
'X-RAY DIFFRACTION' 1 ? ? 0.02 ? 0.05 313 'interatomic distance' ? b 5730  ? ? 157 
'X-RAY DIFFRACTION' 2 ? ? 0.02 ? 0.05 314 'interatomic distance' ? s 5730  ? ? 157 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 315 'interatomic distance' ? b 5542  ? ? 158 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 316 'interatomic distance' ? u 5542  ? ? 158 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 317 'interatomic distance' ? a 15546 ? ? 159 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 318 'interatomic distance' ? c 15546 ? ? 159 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 319 'interatomic distance' ? a 15917 ? ? 160 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 320 'interatomic distance' ? j 15917 ? ? 160 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 321 'interatomic distance' ? a 15559 ? ? 161 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 322 'interatomic distance' ? l 15559 ? ? 161 
'X-RAY DIFFRACTION' 1 ? ? 0.04 ? 0.05 323 'interatomic distance' ? a 15927 ? ? 162 
'X-RAY DIFFRACTION' 2 ? ? 0.04 ? 0.05 324 'interatomic distance' ? r 15927 ? ? 162 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 325 'interatomic distance' ? a 15536 ? ? 163 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 326 'interatomic distance' ? t 15536 ? ? 163 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 327 'interatomic distance' ? d 5284  ? ? 164 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 328 'interatomic distance' ? k 5284  ? ? 164 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 329 'interatomic distance' ? d 5640  ? ? 165 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 330 'interatomic distance' ? m 5640  ? ? 165 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 331 'interatomic distance' ? d 5310  ? ? 166 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 332 'interatomic distance' ? s 5310  ? ? 166 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 333 'interatomic distance' ? d 5650  ? ? 167 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 334 'interatomic distance' ? u 5650  ? ? 167 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 335 'interatomic distance' ? c 15392 ? ? 168 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 336 'interatomic distance' ? j 15392 ? ? 168 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 337 'interatomic distance' ? c 15827 ? ? 169 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 338 'interatomic distance' ? l 15827 ? ? 169 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 339 'interatomic distance' ? c 15439 ? ? 170 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 340 'interatomic distance' ? r 15439 ? ? 170 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 341 'interatomic distance' ? c 15852 ? ? 171 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 342 'interatomic distance' ? t 15852 ? ? 171 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 343 'interatomic distance' ? e 1211  ? ? 172 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 344 'interatomic distance' ? f 1211  ? ? 172 
'X-RAY DIFFRACTION' 1 ? ? 0.12 ? 0.05 345 'interatomic distance' ? e 1414  ? ? 173 
'X-RAY DIFFRACTION' 2 ? ? 0.12 ? 0.05 346 'interatomic distance' ? n 1414  ? ? 173 
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 347 'interatomic distance' ? e 1304  ? ? 174 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 348 'interatomic distance' ? o 1304  ? ? 174 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 349 'interatomic distance' ? e 1368  ? ? 175 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 350 'interatomic distance' ? v 1368  ? ? 175 
'X-RAY DIFFRACTION' 1 ? ? 0.11 ? 0.05 351 'interatomic distance' ? e 1407  ? ? 176 
'X-RAY DIFFRACTION' 2 ? ? 0.11 ? 0.05 352 'interatomic distance' ? w 1407  ? ? 176 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 353 'interatomic distance' ? f 1214  ? ? 177 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 354 'interatomic distance' ? n 1214  ? ? 177 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 355 'interatomic distance' ? f 1219  ? ? 178 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 356 'interatomic distance' ? o 1219  ? ? 178 
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 357 'interatomic distance' ? f 1225  ? ? 179 
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 358 'interatomic distance' ? v 1225  ? ? 179 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 359 'interatomic distance' ? f 1221  ? ? 180 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 360 'interatomic distance' ? w 1221  ? ? 180 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 361 'interatomic distance' ? k 5538  ? ? 181 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 362 'interatomic distance' ? m 5538  ? ? 181 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 363 'interatomic distance' ? k 5755  ? ? 182 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 364 'interatomic distance' ? s 5755  ? ? 182 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 365 'interatomic distance' ? k 5512  ? ? 183 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 366 'interatomic distance' ? u 5512  ? ? 183 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 367 'interatomic distance' ? j 15624 ? ? 184 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 368 'interatomic distance' ? l 15624 ? ? 184 
'X-RAY DIFFRACTION' 1 ? ? 0.05 ? 0.05 369 'interatomic distance' ? j 15967 ? ? 185 
'X-RAY DIFFRACTION' 2 ? ? 0.05 ? 0.05 370 'interatomic distance' ? r 15967 ? ? 185 
'X-RAY DIFFRACTION' 1 ? ? 0.06 ? 0.05 371 'interatomic distance' ? j 15590 ? ? 186 
'X-RAY DIFFRACTION' 2 ? ? 0.06 ? 0.05 372 'interatomic distance' ? t 15590 ? ? 186 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 373 'interatomic distance' ? m 5424  ? ? 187 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 374 'interatomic distance' ? s 5424  ? ? 187 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 375 'interatomic distance' ? m 5830  ? ? 188 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 376 'interatomic distance' ? u 5830  ? ? 188 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 377 'interatomic distance' ? l 15376 ? ? 189 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 378 'interatomic distance' ? r 15376 ? ? 189 
'X-RAY DIFFRACTION' 1 ? ? 0.03 ? 0.05 379 'interatomic distance' ? l 15794 ? ? 190 
'X-RAY DIFFRACTION' 2 ? ? 0.03 ? 0.05 380 'interatomic distance' ? t 15794 ? ? 190 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 381 'interatomic distance' ? n 1321  ? ? 191 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 382 'interatomic distance' ? o 1321  ? ? 191 
'X-RAY DIFFRACTION' 1 ? ? 0.09 ? 0.05 383 'interatomic distance' ? n 1391  ? ? 192 
'X-RAY DIFFRACTION' 2 ? ? 0.09 ? 0.05 384 'interatomic distance' ? v 1391  ? ? 192 
'X-RAY DIFFRACTION' 1 ? ? 0.10 ? 0.05 385 'interatomic distance' ? n 1442  ? ? 193 
'X-RAY DIFFRACTION' 2 ? ? 0.10 ? 0.05 386 'interatomic distance' ? w 1442  ? ? 193 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 387 'interatomic distance' ? o 1310  ? ? 194 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 388 'interatomic distance' ? v 1310  ? ? 194 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 389 'interatomic distance' ? o 1313  ? ? 195 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 390 'interatomic distance' ? w 1313  ? ? 195 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 391 'interatomic distance' ? s 5531  ? ? 196 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 392 'interatomic distance' ? u 5531  ? ? 196 
'X-RAY DIFFRACTION' 1 ? ? 0.07 ? 0.05 393 'interatomic distance' ? r 15696 ? ? 197 
'X-RAY DIFFRACTION' 2 ? ? 0.07 ? 0.05 394 'interatomic distance' ? t 15696 ? ? 197 
'X-RAY DIFFRACTION' 1 ? ? 0.08 ? 0.05 395 'interatomic distance' ? v 1394  ? ? 198 
'X-RAY DIFFRACTION' 2 ? ? 0.08 ? 0.05 396 'interatomic distance' ? w 1394  ? ? 198 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       3.390 
_refine_ls_shell.d_res_low                        3.478 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             451 
_refine_ls_shell.number_reflns_R_work             8831 
_refine_ls_shell.percent_reflns_obs               74.07 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.276 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.209 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 B 1   
2 D 1   
1 B 2   
2 K 2   
1 B 3   
2 M 3   
1 B 4   
2 S 4   
1 B 5   
2 U 5   
1 B 6   
2 b 6   
1 B 7   
2 d 7   
1 B 8   
2 k 8   
1 B 9   
2 m 9   
1 B 10  
2 s 10  
1 B 11  
2 u 11  
1 A 12  
2 C 12  
1 A 13  
2 J 13  
1 A 14  
2 L 14  
1 A 15  
2 R 15  
1 A 16  
2 T 16  
1 A 17  
2 a 17  
1 A 18  
2 c 18  
1 A 19  
2 j 19  
1 A 20  
2 l 20  
1 A 21  
2 r 21  
1 A 22  
2 t 22  
1 D 23  
2 K 23  
1 D 24  
2 M 24  
1 D 25  
2 S 25  
1 D 26  
2 U 26  
1 D 27  
2 b 27  
1 D 28  
2 d 28  
1 D 29  
2 k 29  
1 D 30  
2 m 30  
1 D 31  
2 s 31  
1 D 32  
2 u 32  
1 C 33  
2 J 33  
1 C 34  
2 L 34  
1 C 35  
2 R 35  
1 C 36  
2 T 36  
1 C 37  
2 a 37  
1 C 38  
2 c 38  
1 C 39  
2 j 39  
1 C 40  
2 l 40  
1 C 41  
2 r 41  
1 C 42  
2 t 42  
1 E 43  
2 F 43  
1 E 44  
2 N 44  
1 E 45  
2 O 45  
1 E 46  
2 V 46  
1 E 47  
2 W 47  
1 E 48  
2 e 48  
1 E 49  
2 f 49  
1 E 50  
2 n 50  
1 E 51  
2 o 51  
1 E 52  
2 v 52  
1 E 53  
2 w 53  
1 F 54  
2 N 54  
1 F 55  
2 O 55  
1 F 56  
2 V 56  
1 F 57  
2 W 57  
1 F 58  
2 e 58  
1 F 59  
2 f 59  
1 F 60  
2 n 60  
1 F 61  
2 o 61  
1 F 62  
2 v 62  
1 F 63  
2 w 63  
1 K 64  
2 M 64  
1 K 65  
2 S 65  
1 K 66  
2 U 66  
1 K 67  
2 b 67  
1 K 68  
2 d 68  
1 K 69  
2 k 69  
1 K 70  
2 m 70  
1 K 71  
2 s 71  
1 K 72  
2 u 72  
1 J 73  
2 L 73  
1 J 74  
2 R 74  
1 J 75  
2 T 75  
1 J 76  
2 a 76  
1 J 77  
2 c 77  
1 J 78  
2 j 78  
1 J 79  
2 l 79  
1 J 80  
2 r 80  
1 J 81  
2 t 81  
1 M 82  
2 S 82  
1 M 83  
2 U 83  
1 M 84  
2 b 84  
1 M 85  
2 d 85  
1 M 86  
2 k 86  
1 M 87  
2 m 87  
1 M 88  
2 s 88  
1 M 89  
2 u 89  
1 L 90  
2 R 90  
1 L 91  
2 T 91  
1 L 92  
2 a 92  
1 L 93  
2 c 93  
1 L 94  
2 j 94  
1 L 95  
2 l 95  
1 L 96  
2 r 96  
1 L 97  
2 t 97  
1 N 98  
2 O 98  
1 N 99  
2 V 99  
1 N 100 
2 W 100 
1 N 101 
2 e 101 
1 N 102 
2 f 102 
1 N 103 
2 n 103 
1 N 104 
2 o 104 
1 N 105 
2 v 105 
1 N 106 
2 w 106 
1 O 107 
2 V 107 
1 O 108 
2 W 108 
1 O 109 
2 e 109 
1 O 110 
2 f 110 
1 O 111 
2 n 111 
1 O 112 
2 o 112 
1 O 113 
2 v 113 
1 O 114 
2 w 114 
1 S 115 
2 U 115 
1 S 116 
2 b 116 
1 S 117 
2 d 117 
1 S 118 
2 k 118 
1 S 119 
2 m 119 
1 S 120 
2 s 120 
1 S 121 
2 u 121 
1 R 122 
2 T 122 
1 R 123 
2 a 123 
1 R 124 
2 c 124 
1 R 125 
2 j 125 
1 R 126 
2 l 126 
1 R 127 
2 r 127 
1 R 128 
2 t 128 
1 U 129 
2 b 129 
1 U 130 
2 d 130 
1 U 131 
2 k 131 
1 U 132 
2 m 132 
1 U 133 
2 s 133 
1 U 134 
2 u 134 
1 T 135 
2 a 135 
1 T 136 
2 c 136 
1 T 137 
2 j 137 
1 T 138 
2 l 138 
1 T 139 
2 r 139 
1 T 140 
2 t 140 
1 V 141 
2 W 141 
1 V 142 
2 e 142 
1 V 143 
2 f 143 
1 V 144 
2 n 144 
1 V 145 
2 o 145 
1 V 146 
2 v 146 
1 V 147 
2 w 147 
1 W 148 
2 e 148 
1 W 149 
2 f 149 
1 W 150 
2 n 150 
1 W 151 
2 o 151 
1 W 152 
2 v 152 
1 W 153 
2 w 153 
1 b 154 
2 d 154 
1 b 155 
2 k 155 
1 b 156 
2 m 156 
1 b 157 
2 s 157 
1 b 158 
2 u 158 
1 a 159 
2 c 159 
1 a 160 
2 j 160 
1 a 161 
2 l 161 
1 a 162 
2 r 162 
1 a 163 
2 t 163 
1 d 164 
2 k 164 
1 d 165 
2 m 165 
1 d 166 
2 s 166 
1 d 167 
2 u 167 
1 c 168 
2 j 168 
1 c 169 
2 l 169 
1 c 170 
2 r 170 
1 c 171 
2 t 171 
1 e 172 
2 f 172 
1 e 173 
2 n 173 
1 e 174 
2 o 174 
1 e 175 
2 v 175 
1 e 176 
2 w 176 
1 f 177 
2 n 177 
1 f 178 
2 o 178 
1 f 179 
2 v 179 
1 f 180 
2 w 180 
1 k 181 
2 m 181 
1 k 182 
2 s 182 
1 k 183 
2 u 183 
1 j 184 
2 l 184 
1 j 185 
2 r 185 
1 j 186 
2 t 186 
1 m 187 
2 s 187 
1 m 188 
2 u 188 
1 l 189 
2 r 189 
1 l 190 
2 t 190 
1 n 191 
2 o 191 
1 n 192 
2 v 192 
1 n 193 
2 w 193 
1 o 194 
2 v 194 
1 o 195 
2 w 195 
1 s 196 
2 u 196 
1 r 197 
2 t 197 
1 v 198 
2 w 198 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 1   ? 
2 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 1   ? 
1 B 417 B 637  0 0 ? ? ? ? ? ? ? ? 2   ? 
2 K 417 K 637  0 0 ? ? ? ? ? ? ? ? 2   ? 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 3   ? 
2 M 417 M 638  0 0 ? ? ? ? ? ? ? ? 3   ? 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 4   ? 
2 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 4   ? 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 5   ? 
2 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 5   ? 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 6   ? 
2 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 6   ? 
1 B 417 B 637  0 0 ? ? ? ? ? ? ? ? 7   ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 7   ? 
1 B 417 B 637  0 0 ? ? ? ? ? ? ? ? 8   ? 
2 k 417 k 637  0 0 ? ? ? ? ? ? ? ? 8   ? 
1 B 417 B 638  0 0 ? ? ? ? ? ? ? ? 9   ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 9   ? 
1 B 417 B 637  0 0 ? ? ? ? ? ? ? ? 10  ? 
2 s 417 s 637  0 0 ? ? ? ? ? ? ? ? 10  ? 
1 B 417 B 637  0 0 ? ? ? ? ? ? ? ? 11  ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 11  ? 
1 A 11  A 489  0 0 ? ? ? ? ? ? ? ? 12  ? 
2 C 11  C 489  0 0 ? ? ? ? ? ? ? ? 12  ? 
1 A 11  A 491  0 0 ? ? ? ? ? ? ? ? 13  ? 
2 J 11  J 491  0 0 ? ? ? ? ? ? ? ? 13  ? 
1 A 11  A 490  0 0 ? ? ? ? ? ? ? ? 14  ? 
2 L 11  L 490  0 0 ? ? ? ? ? ? ? ? 14  ? 
1 A 11  A 491  0 0 ? ? ? ? ? ? ? ? 15  ? 
2 R 11  R 491  0 0 ? ? ? ? ? ? ? ? 15  ? 
1 A 11  A 490  0 0 ? ? ? ? ? ? ? ? 16  ? 
2 T 11  T 490  0 0 ? ? ? ? ? ? ? ? 16  ? 
1 A 11  A 491  0 0 ? ? ? ? ? ? ? ? 17  ? 
2 a 11  a 491  0 0 ? ? ? ? ? ? ? ? 17  ? 
1 A 11  A 489  0 0 ? ? ? ? ? ? ? ? 18  ? 
2 c 11  c 489  0 0 ? ? ? ? ? ? ? ? 18  ? 
1 A 11  A 491  0 0 ? ? ? ? ? ? ? ? 19  ? 
2 j 11  j 491  0 0 ? ? ? ? ? ? ? ? 19  ? 
1 A 11  A 490  0 0 ? ? ? ? ? ? ? ? 20  ? 
2 l 11  l 490  0 0 ? ? ? ? ? ? ? ? 20  ? 
1 A 11  A 490  0 0 ? ? ? ? ? ? ? ? 21  ? 
2 r 11  r 490  0 0 ? ? ? ? ? ? ? ? 21  ? 
1 A 11  A 490  0 0 ? ? ? ? ? ? ? ? 22  ? 
2 t 11  t 490  0 0 ? ? ? ? ? ? ? ? 22  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 23  ? 
2 K 417 K 638  0 0 ? ? ? ? ? ? ? ? 23  ? 
1 D 417 D 637  0 0 ? ? ? ? ? ? ? ? 24  ? 
2 M 417 M 637  0 0 ? ? ? ? ? ? ? ? 24  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 25  ? 
2 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 25  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 26  ? 
2 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 26  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 27  ? 
2 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 27  ? 
1 D 417 D 637  0 0 ? ? ? ? ? ? ? ? 28  ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 28  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 29  ? 
2 k 417 k 638  0 0 ? ? ? ? ? ? ? ? 29  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 30  ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 30  ? 
1 D 417 D 638  0 0 ? ? ? ? ? ? ? ? 31  ? 
2 s 417 s 638  0 0 ? ? ? ? ? ? ? ? 31  ? 
1 D 417 D 636  0 0 ? ? ? ? ? ? ? ? 32  ? 
2 u 417 u 636  0 0 ? ? ? ? ? ? ? ? 32  ? 
1 C 11  C 489  0 0 ? ? ? ? ? ? ? ? 33  ? 
2 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 33  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 34  ? 
2 L 10  L 489  0 0 ? ? ? ? ? ? ? ? 34  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 35  ? 
2 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 35  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 36  ? 
2 T 10  T 489  0 0 ? ? ? ? ? ? ? ? 36  ? 
1 C 11  C 489  0 0 ? ? ? ? ? ? ? ? 37  ? 
2 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 37  ? 
1 C 9   C 490  0 0 ? ? ? ? ? ? ? ? 38  ? 
2 c 9   c 490  0 0 ? ? ? ? ? ? ? ? 38  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 39  ? 
2 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 39  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 40  ? 
2 l 10  l 489  0 0 ? ? ? ? ? ? ? ? 40  ? 
1 C 9   C 489  0 0 ? ? ? ? ? ? ? ? 41  ? 
2 r 9   r 489  0 0 ? ? ? ? ? ? ? ? 41  ? 
1 C 10  C 489  0 0 ? ? ? ? ? ? ? ? 42  ? 
2 t 10  t 489  0 0 ? ? ? ? ? ? ? ? 42  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 43  ? 
2 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 43  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 44  ? 
2 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 44  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 45  ? 
2 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 45  ? 
1 E 1   E 18   0 0 ? ? ? ? ? ? ? ? 46  ? 
2 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 46  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 47  ? 
2 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 47  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 48  ? 
2 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 48  ? 
1 E 3   E 18   0 0 ? ? ? ? ? ? ? ? 49  ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 49  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 50  ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 50  ? 
1 E 2   E 18   0 0 ? ? ? ? ? ? ? ? 51  ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 51  ? 
1 E 2   E 19   0 0 ? ? ? ? ? ? ? ? 52  ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 52  ? 
1 E 1   E 20   0 0 ? ? ? ? ? ? ? ? 53  ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 53  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 54  ? 
2 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 54  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 55  ? 
2 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 55  ? 
1 F 1   F 2018 0 0 ? ? ? ? ? ? ? ? 56  ? 
2 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 56  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 57  ? 
2 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 57  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 58  ? 
2 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 58  ? 
1 F 3   F 2018 0 0 ? ? ? ? ? ? ? ? 59  ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 59  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 60  ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 60  ? 
1 F 2   F 2018 0 0 ? ? ? ? ? ? ? ? 61  ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 61  ? 
1 F 2   F 2019 0 0 ? ? ? ? ? ? ? ? 62  ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 62  ? 
1 F 1   F 2020 0 0 ? ? ? ? ? ? ? ? 63  ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 63  ? 
1 K 417 K 639  0 0 ? ? ? ? ? ? ? ? 64  ? 
2 M 417 M 639  0 0 ? ? ? ? ? ? ? ? 64  ? 
1 K 417 K 637  0 0 ? ? ? ? ? ? ? ? 65  ? 
2 S 417 S 637  0 0 ? ? ? ? ? ? ? ? 65  ? 
1 K 417 K 638  0 0 ? ? ? ? ? ? ? ? 66  ? 
2 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 66  ? 
1 K 417 K 637  0 0 ? ? ? ? ? ? ? ? 67  ? 
2 b 417 b 637  0 0 ? ? ? ? ? ? ? ? 67  ? 
1 K 417 K 637  0 0 ? ? ? ? ? ? ? ? 68  ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 68  ? 
1 K 416 K 638  0 0 ? ? ? ? ? ? ? ? 69  ? 
2 k 416 k 638  0 0 ? ? ? ? ? ? ? ? 69  ? 
1 K 417 K 638  0 0 ? ? ? ? ? ? ? ? 70  ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 70  ? 
1 K 416 K 637  0 0 ? ? ? ? ? ? ? ? 71  ? 
2 s 416 s 637  0 0 ? ? ? ? ? ? ? ? 71  ? 
1 K 417 K 637  0 0 ? ? ? ? ? ? ? ? 72  ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 72  ? 
1 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 73  ? 
2 L 11  L 489  0 0 ? ? ? ? ? ? ? ? 73  ? 
1 J 11  J 491  0 0 ? ? ? ? ? ? ? ? 74  ? 
2 R 11  R 491  0 0 ? ? ? ? ? ? ? ? 74  ? 
1 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 75  ? 
2 T 11  T 489  0 0 ? ? ? ? ? ? ? ? 75  ? 
1 J 11  J 491  0 0 ? ? ? ? ? ? ? ? 76  ? 
2 a 11  a 491  0 0 ? ? ? ? ? ? ? ? 76  ? 
1 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 77  ? 
2 c 11  c 489  0 0 ? ? ? ? ? ? ? ? 77  ? 
1 J 11  J 491  0 0 ? ? ? ? ? ? ? ? 78  ? 
2 j 11  j 491  0 0 ? ? ? ? ? ? ? ? 78  ? 
1 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 79  ? 
2 l 11  l 489  0 0 ? ? ? ? ? ? ? ? 79  ? 
1 J 11  J 490  0 0 ? ? ? ? ? ? ? ? 80  ? 
2 r 11  r 490  0 0 ? ? ? ? ? ? ? ? 80  ? 
1 J 11  J 489  0 0 ? ? ? ? ? ? ? ? 81  ? 
2 t 11  t 489  0 0 ? ? ? ? ? ? ? ? 81  ? 
1 M 417 M 638  0 0 ? ? ? ? ? ? ? ? 82  ? 
2 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 82  ? 
1 M 417 M 637  0 0 ? ? ? ? ? ? ? ? 83  ? 
2 U 417 U 637  0 0 ? ? ? ? ? ? ? ? 83  ? 
1 M 417 M 638  0 0 ? ? ? ? ? ? ? ? 84  ? 
2 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 84  ? 
1 M 417 M 637  0 0 ? ? ? ? ? ? ? ? 85  ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 85  ? 
1 M 417 M 639  0 0 ? ? ? ? ? ? ? ? 86  ? 
2 k 417 k 639  0 0 ? ? ? ? ? ? ? ? 86  ? 
1 M 417 M 637  0 0 ? ? ? ? ? ? ? ? 87  ? 
2 m 417 m 637  0 0 ? ? ? ? ? ? ? ? 87  ? 
1 M 417 M 638  0 0 ? ? ? ? ? ? ? ? 88  ? 
2 s 417 s 638  0 0 ? ? ? ? ? ? ? ? 88  ? 
1 M 417 M 636  0 0 ? ? ? ? ? ? ? ? 89  ? 
2 u 417 u 636  0 0 ? ? ? ? ? ? ? ? 89  ? 
1 L 10  L 489  0 0 ? ? ? ? ? ? ? ? 90  ? 
2 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 90  ? 
1 L 10  L 490  0 0 ? ? ? ? ? ? ? ? 91  ? 
2 T 10  T 490  0 0 ? ? ? ? ? ? ? ? 91  ? 
1 L 11  L 489  0 0 ? ? ? ? ? ? ? ? 92  ? 
2 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 92  ? 
1 L 10  L 489  0 0 ? ? ? ? ? ? ? ? 93  ? 
2 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 93  ? 
1 L 10  L 489  0 0 ? ? ? ? ? ? ? ? 94  ? 
2 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 94  ? 
1 L 10  L 490  0 0 ? ? ? ? ? ? ? ? 95  ? 
2 l 10  l 490  0 0 ? ? ? ? ? ? ? ? 95  ? 
1 L 10  L 489  0 0 ? ? ? ? ? ? ? ? 96  ? 
2 r 10  r 489  0 0 ? ? ? ? ? ? ? ? 96  ? 
1 L 10  L 490  0 0 ? ? ? ? ? ? ? ? 97  ? 
2 t 10  t 490  0 0 ? ? ? ? ? ? ? ? 97  ? 
1 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 98  ? 
2 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 98  ? 
1 N 1   N 2018 0 0 ? ? ? ? ? ? ? ? 99  ? 
2 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 99  ? 
1 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 100 ? 
2 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 100 ? 
1 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 101 ? 
2 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 101 ? 
1 N 3   N 2018 0 0 ? ? ? ? ? ? ? ? 102 ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 102 ? 
1 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 103 ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 103 ? 
1 N 2   N 2018 0 0 ? ? ? ? ? ? ? ? 104 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 104 ? 
1 N 2   N 2019 0 0 ? ? ? ? ? ? ? ? 105 ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 105 ? 
1 N 1   N 2020 0 0 ? ? ? ? ? ? ? ? 106 ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 106 ? 
1 O 1   O 18   0 0 ? ? ? ? ? ? ? ? 107 ? 
2 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 107 ? 
1 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 108 ? 
2 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 108 ? 
1 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 109 ? 
2 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 109 ? 
1 O 3   O 18   0 0 ? ? ? ? ? ? ? ? 110 ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 110 ? 
1 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 111 ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 111 ? 
1 O 2   O 18   0 0 ? ? ? ? ? ? ? ? 112 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 112 ? 
1 O 2   O 19   0 0 ? ? ? ? ? ? ? ? 113 ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 113 ? 
1 O 1   O 20   0 0 ? ? ? ? ? ? ? ? 114 ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 114 ? 
1 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 115 ? 
2 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 115 ? 
1 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 116 ? 
2 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 116 ? 
1 S 417 S 637  0 0 ? ? ? ? ? ? ? ? 117 ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 117 ? 
1 S 417 S 637  0 0 ? ? ? ? ? ? ? ? 118 ? 
2 k 417 k 637  0 0 ? ? ? ? ? ? ? ? 118 ? 
1 S 417 S 638  0 0 ? ? ? ? ? ? ? ? 119 ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 119 ? 
1 S 417 S 637  0 0 ? ? ? ? ? ? ? ? 120 ? 
2 s 417 s 637  0 0 ? ? ? ? ? ? ? ? 120 ? 
1 S 417 S 637  0 0 ? ? ? ? ? ? ? ? 121 ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 121 ? 
1 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 122 ? 
2 T 10  T 489  0 0 ? ? ? ? ? ? ? ? 122 ? 
1 R 11  R 490  0 0 ? ? ? ? ? ? ? ? 123 ? 
2 a 11  a 490  0 0 ? ? ? ? ? ? ? ? 123 ? 
1 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 124 ? 
2 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 124 ? 
1 R 10  R 491  0 0 ? ? ? ? ? ? ? ? 125 ? 
2 j 10  j 491  0 0 ? ? ? ? ? ? ? ? 125 ? 
1 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 126 ? 
2 l 10  l 489  0 0 ? ? ? ? ? ? ? ? 126 ? 
1 R 10  R 490  0 0 ? ? ? ? ? ? ? ? 127 ? 
2 r 10  r 490  0 0 ? ? ? ? ? ? ? ? 127 ? 
1 R 10  R 489  0 0 ? ? ? ? ? ? ? ? 128 ? 
2 t 10  t 489  0 0 ? ? ? ? ? ? ? ? 128 ? 
1 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 129 ? 
2 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 129 ? 
1 U 417 U 637  0 0 ? ? ? ? ? ? ? ? 130 ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 130 ? 
1 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 131 ? 
2 k 417 k 638  0 0 ? ? ? ? ? ? ? ? 131 ? 
1 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 132 ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 132 ? 
1 U 417 U 638  0 0 ? ? ? ? ? ? ? ? 133 ? 
2 s 417 s 638  0 0 ? ? ? ? ? ? ? ? 133 ? 
1 U 417 U 636  0 0 ? ? ? ? ? ? ? ? 134 ? 
2 u 417 u 636  0 0 ? ? ? ? ? ? ? ? 134 ? 
1 T 11  T 489  0 0 ? ? ? ? ? ? ? ? 135 ? 
2 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 135 ? 
1 T 10  T 489  0 0 ? ? ? ? ? ? ? ? 136 ? 
2 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 136 ? 
1 T 10  T 489  0 0 ? ? ? ? ? ? ? ? 137 ? 
2 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 137 ? 
1 T 10  T 490  0 0 ? ? ? ? ? ? ? ? 138 ? 
2 l 10  l 490  0 0 ? ? ? ? ? ? ? ? 138 ? 
1 T 10  T 489  0 0 ? ? ? ? ? ? ? ? 139 ? 
2 r 10  r 489  0 0 ? ? ? ? ? ? ? ? 139 ? 
1 T 10  T 490  0 0 ? ? ? ? ? ? ? ? 140 ? 
2 t 10  t 490  0 0 ? ? ? ? ? ? ? ? 140 ? 
1 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 141 ? 
2 W 1   W 2018 0 0 ? ? ? ? ? ? ? ? 141 ? 
1 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 142 ? 
2 e 1   e 18   0 0 ? ? ? ? ? ? ? ? 142 ? 
1 V 3   V 2018 0 0 ? ? ? ? ? ? ? ? 143 ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 143 ? 
1 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 144 ? 
2 n 1   n 2018 0 0 ? ? ? ? ? ? ? ? 144 ? 
1 V 2   V 2018 0 0 ? ? ? ? ? ? ? ? 145 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 145 ? 
1 V 2   V 2018 0 0 ? ? ? ? ? ? ? ? 146 ? 
2 v 2   v 2018 0 0 ? ? ? ? ? ? ? ? 146 ? 
1 V 1   V 2018 0 0 ? ? ? ? ? ? ? ? 147 ? 
2 w 1   w 2018 0 0 ? ? ? ? ? ? ? ? 147 ? 
1 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 148 ? 
2 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 148 ? 
1 W 3   W 2018 0 0 ? ? ? ? ? ? ? ? 149 ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 149 ? 
1 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 150 ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 150 ? 
1 W 2   W 2018 0 0 ? ? ? ? ? ? ? ? 151 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 151 ? 
1 W 2   W 2019 0 0 ? ? ? ? ? ? ? ? 152 ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 152 ? 
1 W 1   W 2020 0 0 ? ? ? ? ? ? ? ? 153 ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 153 ? 
1 b 417 b 637  0 0 ? ? ? ? ? ? ? ? 154 ? 
2 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 154 ? 
1 b 417 b 637  0 0 ? ? ? ? ? ? ? ? 155 ? 
2 k 417 k 637  0 0 ? ? ? ? ? ? ? ? 155 ? 
1 b 417 b 638  0 0 ? ? ? ? ? ? ? ? 156 ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 156 ? 
1 b 417 b 637  0 0 ? ? ? ? ? ? ? ? 157 ? 
2 s 417 s 637  0 0 ? ? ? ? ? ? ? ? 157 ? 
1 b 417 b 637  0 0 ? ? ? ? ? ? ? ? 158 ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 158 ? 
1 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 159 ? 
2 c 11  c 489  0 0 ? ? ? ? ? ? ? ? 159 ? 
1 a 11  a 490  0 0 ? ? ? ? ? ? ? ? 160 ? 
2 j 11  j 490  0 0 ? ? ? ? ? ? ? ? 160 ? 
1 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 161 ? 
2 l 11  l 489  0 0 ? ? ? ? ? ? ? ? 161 ? 
1 a 11  a 490  0 0 ? ? ? ? ? ? ? ? 162 ? 
2 r 11  r 490  0 0 ? ? ? ? ? ? ? ? 162 ? 
1 a 11  a 489  0 0 ? ? ? ? ? ? ? ? 163 ? 
2 t 11  t 489  0 0 ? ? ? ? ? ? ? ? 163 ? 
1 d 417 d 636  0 0 ? ? ? ? ? ? ? ? 164 ? 
2 k 417 k 636  0 0 ? ? ? ? ? ? ? ? 164 ? 
1 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 165 ? 
2 m 417 m 637  0 0 ? ? ? ? ? ? ? ? 165 ? 
1 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 166 ? 
2 s 417 s 637  0 0 ? ? ? ? ? ? ? ? 166 ? 
1 d 417 d 637  0 0 ? ? ? ? ? ? ? ? 167 ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 167 ? 
1 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 168 ? 
2 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 168 ? 
1 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 169 ? 
2 l 10  l 489  0 0 ? ? ? ? ? ? ? ? 169 ? 
1 c 9   c 489  0 0 ? ? ? ? ? ? ? ? 170 ? 
2 r 9   r 489  0 0 ? ? ? ? ? ? ? ? 170 ? 
1 c 10  c 489  0 0 ? ? ? ? ? ? ? ? 171 ? 
2 t 10  t 489  0 0 ? ? ? ? ? ? ? ? 171 ? 
1 e 3   e 18   0 0 ? ? ? ? ? ? ? ? 172 ? 
2 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 172 ? 
1 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 173 ? 
2 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 173 ? 
1 e 2   e 18   0 0 ? ? ? ? ? ? ? ? 174 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 174 ? 
1 e 2   e 19   0 0 ? ? ? ? ? ? ? ? 175 ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 175 ? 
1 e 1   e 20   0 0 ? ? ? ? ? ? ? ? 176 ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 176 ? 
1 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 177 ? 
2 n 3   n 2018 0 0 ? ? ? ? ? ? ? ? 177 ? 
1 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 178 ? 
2 o 3   o 2018 0 0 ? ? ? ? ? ? ? ? 178 ? 
1 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 179 ? 
2 v 3   v 2018 0 0 ? ? ? ? ? ? ? ? 179 ? 
1 f 3   f 18   0 0 ? ? ? ? ? ? ? ? 180 ? 
2 w 3   w 2018 0 0 ? ? ? ? ? ? ? ? 180 ? 
1 k 417 k 638  0 0 ? ? ? ? ? ? ? ? 181 ? 
2 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 181 ? 
1 k 416 k 637  0 0 ? ? ? ? ? ? ? ? 182 ? 
2 s 416 s 637  0 0 ? ? ? ? ? ? ? ? 182 ? 
1 k 417 k 636  0 0 ? ? ? ? ? ? ? ? 183 ? 
2 u 417 u 636  0 0 ? ? ? ? ? ? ? ? 183 ? 
1 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 184 ? 
2 l 10  l 489  0 0 ? ? ? ? ? ? ? ? 184 ? 
1 j 10  j 490  0 0 ? ? ? ? ? ? ? ? 185 ? 
2 r 10  r 490  0 0 ? ? ? ? ? ? ? ? 185 ? 
1 j 10  j 489  0 0 ? ? ? ? ? ? ? ? 186 ? 
2 t 10  t 489  0 0 ? ? ? ? ? ? ? ? 186 ? 
1 m 417 m 638  0 0 ? ? ? ? ? ? ? ? 187 ? 
2 s 417 s 638  0 0 ? ? ? ? ? ? ? ? 187 ? 
1 m 417 m 636  0 0 ? ? ? ? ? ? ? ? 188 ? 
2 u 417 u 636  0 0 ? ? ? ? ? ? ? ? 188 ? 
1 l 10  l 489  0 0 ? ? ? ? ? ? ? ? 189 ? 
2 r 10  r 489  0 0 ? ? ? ? ? ? ? ? 189 ? 
1 l 10  l 490  0 0 ? ? ? ? ? ? ? ? 190 ? 
2 t 10  t 490  0 0 ? ? ? ? ? ? ? ? 190 ? 
1 n 2   n 2018 0 0 ? ? ? ? ? ? ? ? 191 ? 
2 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 191 ? 
1 n 2   n 2019 0 0 ? ? ? ? ? ? ? ? 192 ? 
2 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 192 ? 
1 n 1   n 2020 0 0 ? ? ? ? ? ? ? ? 193 ? 
2 w 1   w 2020 0 0 ? ? ? ? ? ? ? ? 193 ? 
1 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 194 ? 
2 v 2   v 2018 0 0 ? ? ? ? ? ? ? ? 194 ? 
1 o 2   o 2018 0 0 ? ? ? ? ? ? ? ? 195 ? 
2 w 2   w 2018 0 0 ? ? ? ? ? ? ? ? 195 ? 
1 s 417 s 637  0 0 ? ? ? ? ? ? ? ? 196 ? 
2 u 417 u 637  0 0 ? ? ? ? ? ? ? ? 196 ? 
1 r 10  r 489  0 0 ? ? ? ? ? ? ? ? 197 ? 
2 t 10  t 489  0 0 ? ? ? ? ? ? ? ? 197 ? 
1 v 2   v 2019 0 0 ? ? ? ? ? ? ? ? 198 ? 
2 w 2   w 2019 0 0 ? ? ? ? ? ? ? ? 198 ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1   ? 
2   ? 
3   ? 
4   ? 
5   ? 
6   ? 
7   ? 
8   ? 
9   ? 
10  ? 
11  ? 
12  ? 
13  ? 
14  ? 
15  ? 
16  ? 
17  ? 
18  ? 
19  ? 
20  ? 
21  ? 
22  ? 
23  ? 
24  ? 
25  ? 
26  ? 
27  ? 
28  ? 
29  ? 
30  ? 
31  ? 
32  ? 
33  ? 
34  ? 
35  ? 
36  ? 
37  ? 
38  ? 
39  ? 
40  ? 
41  ? 
42  ? 
43  ? 
44  ? 
45  ? 
46  ? 
47  ? 
48  ? 
49  ? 
50  ? 
51  ? 
52  ? 
53  ? 
54  ? 
55  ? 
56  ? 
57  ? 
58  ? 
59  ? 
60  ? 
61  ? 
62  ? 
63  ? 
64  ? 
65  ? 
66  ? 
67  ? 
68  ? 
69  ? 
70  ? 
71  ? 
72  ? 
73  ? 
74  ? 
75  ? 
76  ? 
77  ? 
78  ? 
79  ? 
80  ? 
81  ? 
82  ? 
83  ? 
84  ? 
85  ? 
86  ? 
87  ? 
88  ? 
89  ? 
90  ? 
91  ? 
92  ? 
93  ? 
94  ? 
95  ? 
96  ? 
97  ? 
98  ? 
99  ? 
100 ? 
101 ? 
102 ? 
103 ? 
104 ? 
105 ? 
106 ? 
107 ? 
108 ? 
109 ? 
110 ? 
111 ? 
112 ? 
113 ? 
114 ? 
115 ? 
116 ? 
117 ? 
118 ? 
119 ? 
120 ? 
121 ? 
122 ? 
123 ? 
124 ? 
125 ? 
126 ? 
127 ? 
128 ? 
129 ? 
130 ? 
131 ? 
132 ? 
133 ? 
134 ? 
135 ? 
136 ? 
137 ? 
138 ? 
139 ? 
140 ? 
141 ? 
142 ? 
143 ? 
144 ? 
145 ? 
146 ? 
147 ? 
148 ? 
149 ? 
150 ? 
151 ? 
152 ? 
153 ? 
154 ? 
155 ? 
156 ? 
157 ? 
158 ? 
159 ? 
160 ? 
161 ? 
162 ? 
163 ? 
164 ? 
165 ? 
166 ? 
167 ? 
168 ? 
169 ? 
170 ? 
171 ? 
172 ? 
173 ? 
174 ? 
175 ? 
176 ? 
177 ? 
178 ? 
179 ? 
180 ? 
181 ? 
182 ? 
183 ? 
184 ? 
185 ? 
186 ? 
187 ? 
188 ? 
189 ? 
190 ? 
191 ? 
192 ? 
193 ? 
194 ? 
195 ? 
196 ? 
197 ? 
198 ? 
# 
_struct.entry_id                     6QX2 
_struct.title                        '3.4A structure of benzoisoxazole 3 with S.aureus DNA gyrase and DNA' 
_struct.pdbx_descriptor              'DNA gyrase subunit B, DNA gyrase subunit A/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6QX2 
_struct_keywords.text            'Inhibitor, DNA complex, isomerase' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 2  ? 
E  N N 4  ? 
F  N N 4  ? 
G  N N 5  ? 
H  N N 6  ? 
I  N N 7  ? 
J  N N 2  ? 
K  N N 4  ? 
L  N N 4  ? 
M  N N 1  ? 
N  N N 2  ? 
O  N N 3  ? 
P  N N 2  ? 
Q  N N 8  ? 
R  N N 4  ? 
S  N N 1  ? 
T  N N 2  ? 
U  N N 9  ? 
V  N N 2  ? 
W  N N 4  ? 
X  N N 10 ? 
Y  N N 11 ? 
Z  N N 2  ? 
AA N N 3  ? 
BA N N 2  ? 
CA N N 4  ? 
DA N N 8  ? 
EA N N 1  ? 
FA N N 2  ? 
GA N N 12 ? 
HA N N 2  ? 
IA N N 4  ? 
JA N N 4  ? 
KA N N 13 ? 
LA N N 13 ? 
MA N N 13 ? 
NA N N 13 ? 
OA N N 13 ? 
PA N N 13 ? 
QA N N 13 ? 
RA N N 13 ? 
SA N N 13 ? 
TA N N 13 ? 
UA N N 13 ? 
VA N N 13 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A  10  ? CYS A  14  ? SER B 425 CYS B 429 5 ? 5  
HELX_P HELX_P2   AA2 GLY A  21  ? ARG A  32  ? GLY B 436 ARG B 447 1 ? 12 
HELX_P HELX_P3   AA3 ARG A  53  ? ASN A  60  ? ARG B 468 ASN B 475 1 ? 8  
HELX_P HELX_P4   AA4 ASN A  60  ? GLY A  71  ? ASN B 475 GLY B 486 1 ? 12 
HELX_P HELX_P5   AA5 ILE A  74  ? PHE A  78  ? ILE B 489 PHE B 493 5 ? 5  
HELX_P HELX_P6   AA6 ASP A  79  ? ALA A  83  ? ASP B 494 ALA B 498 5 ? 5  
HELX_P HELX_P7   AA7 ASP A  95  ? MET A  113 ? ASP B 510 MET B 528 1 ? 19 
HELX_P HELX_P8   AA8 MET A  113 ? ALA A  119 ? MET B 528 ALA B 534 1 ? 7  
HELX_P HELX_P9   AA9 ASN A  135 ? MET A  144 ? ASN B 587 MET B 596 1 ? 10 
HELX_P HELX_P10  AB1 ASP A  158 ? GLY A  171 ? ASP B 610 GLY B 623 1 ? 14 
HELX_P HELX_P11  AB2 VAL A  173 ? ALA A  185 ? VAL B 625 ALA B 637 1 ? 13 
HELX_P HELX_P12  AB3 ILE B  13  ? ALA B  31  ? ILE A 14  ALA A 32  1 ? 19 
HELX_P HELX_P13  AB4 LYS B  42  ? GLN B  55  ? LYS A 43  GLN A 56  1 ? 14 
HELX_P HELX_P14  AB5 SER B  66  ? TYR B  77  ? SER A 67  TYR A 78  1 ? 12 
HELX_P HELX_P15  AB6 GLY B  81  ? MET B  92  ? GLY A 82  MET A 93  1 ? 12 
HELX_P HELX_P16  AB7 ILE B  130 ? ARG B  136 ? ILE A 131 ARG A 137 1 ? 7  
HELX_P HELX_P17  AB8 PRO B  164 ? GLY B  170 ? PRO A 165 GLY A 171 1 ? 7  
HELX_P HELX_P18  AB9 ASN B  186 ? ASN B  200 ? ASN A 187 ASN A 201 1 ? 15 
HELX_P HELX_P19  AC1 SER B  204 ? MET B  209 ? SER A 205 MET A 210 1 ? 6  
HELX_P HELX_P20  AC2 LYS B  226 ? GLY B  236 ? LYS A 227 GLY A 237 1 ? 11 
HELX_P HELX_P21  AC3 ASN B  268 ? ASP B  282 ? ASN A 269 ASP A 283 1 ? 15 
HELX_P HELX_P22  AC4 ASN B  312 ? THR B  324 ? ASN A 313 THR A 325 1 ? 13 
HELX_P HELX_P23  AC5 ASN B  346 ? HIS B  389 ? ASN A 347 HIS A 390 1 ? 44 
HELX_P HELX_P24  AC6 HIS B  389 ? GLU B  399 ? HIS A 390 GLU A 400 1 ? 11 
HELX_P HELX_P25  AC7 THR B  402 ? LYS B  415 ? THR A 403 LYS A 416 1 ? 14 
HELX_P HELX_P26  AC8 SER B  417 ? MET B  427 ? SER A 418 MET A 428 1 ? 11 
HELX_P HELX_P27  AC9 ARG B  428 ? LEU B  432 ? ARG A 429 LEU A 433 5 ? 5  
HELX_P HELX_P28  AD1 THR B  433 ? ASP B  460 ? THR A 434 ASP A 461 1 ? 28 
HELX_P HELX_P29  AD2 ASP B  460 ? GLY B  480 ? ASP A 461 GLY A 481 1 ? 21 
HELX_P HELX_P30  AD3 SER C  9   ? CYS C  13  ? SER D 425 CYS D 429 5 ? 5  
HELX_P HELX_P31  AD4 GLY C  20  ? ARG C  31  ? GLY D 436 ARG D 447 1 ? 12 
HELX_P HELX_P32  AD5 ARG C  52  ? ASN C  59  ? ARG D 468 ASN D 475 1 ? 8  
HELX_P HELX_P33  AD6 ASN C  59  ? GLY C  70  ? ASN D 475 GLY D 486 1 ? 12 
HELX_P HELX_P34  AD7 ILE C  73  ? PHE C  77  ? ILE D 489 PHE D 493 5 ? 5  
HELX_P HELX_P35  AD8 ASP C  78  ? ALA C  82  ? ASP D 494 ALA D 498 5 ? 5  
HELX_P HELX_P36  AD9 ASP C  94  ? MET C  112 ? ASP D 510 MET D 528 1 ? 19 
HELX_P HELX_P37  AE1 MET C  112 ? ALA C  118 ? MET D 528 ALA D 534 1 ? 7  
HELX_P HELX_P38  AE2 ASN C  137 ? MET C  146 ? ASN D 587 MET D 596 1 ? 10 
HELX_P HELX_P39  AE3 ASP C  160 ? GLY C  173 ? ASP D 610 GLY D 623 1 ? 14 
HELX_P HELX_P40  AE4 VAL C  175 ? ALA C  187 ? VAL D 625 ALA D 637 1 ? 13 
HELX_P HELX_P41  AE5 ILE D  13  ? ALA D  31  ? ILE C 14  ALA C 32  1 ? 19 
HELX_P HELX_P42  AE6 LYS D  42  ? GLN D  55  ? LYS C 43  GLN C 56  1 ? 14 
HELX_P HELX_P43  AE7 SER D  66  ? TYR D  77  ? SER C 67  TYR C 78  1 ? 12 
HELX_P HELX_P44  AE8 GLY D  81  ? MET D  92  ? GLY C 82  MET C 93  1 ? 12 
HELX_P HELX_P45  AE9 ILE D  130 ? ARG D  136 ? ILE C 131 ARG C 137 1 ? 7  
HELX_P HELX_P46  AF1 PRO D  164 ? GLY D  170 ? PRO C 165 GLY C 171 1 ? 7  
HELX_P HELX_P47  AF2 ASN D  186 ? ASN D  200 ? ASN C 187 ASN C 201 1 ? 15 
HELX_P HELX_P48  AF3 SER D  204 ? MET D  209 ? SER C 205 MET C 210 1 ? 6  
HELX_P HELX_P49  AF4 LYS D  226 ? GLY D  236 ? LYS C 227 GLY C 237 1 ? 11 
HELX_P HELX_P50  AF5 ASN D  268 ? ASP D  282 ? ASN C 269 ASP C 283 1 ? 15 
HELX_P HELX_P51  AF6 ASN D  312 ? THR D  324 ? ASN C 313 THR C 325 1 ? 13 
HELX_P HELX_P52  AF7 ASN D  346 ? HIS D  389 ? ASN C 347 HIS C 390 1 ? 44 
HELX_P HELX_P53  AF8 HIS D  389 ? GLU D  399 ? HIS C 390 GLU C 400 1 ? 11 
HELX_P HELX_P54  AF9 THR D  402 ? LYS D  415 ? THR C 403 LYS C 416 1 ? 14 
HELX_P HELX_P55  AG1 SER D  417 ? ASP D  426 ? SER C 418 ASP C 427 1 ? 10 
HELX_P HELX_P56  AG2 ARG D  428 ? LEU D  432 ? ARG C 429 LEU C 433 5 ? 5  
HELX_P HELX_P57  AG3 THR D  433 ? ASP D  460 ? THR C 434 ASP C 461 1 ? 28 
HELX_P HELX_P58  AG4 ASP D  460 ? GLY D  480 ? ASP C 461 GLY C 481 1 ? 21 
HELX_P HELX_P59  AG5 SER G  10  ? CYS G  14  ? SER K 425 CYS K 429 5 ? 5  
HELX_P HELX_P60  AG6 GLY G  21  ? ARG G  32  ? GLY K 436 ARG K 447 1 ? 12 
HELX_P HELX_P61  AG7 ARG G  53  ? ASN G  60  ? ARG K 468 ASN K 475 1 ? 8  
HELX_P HELX_P62  AG8 ASN G  60  ? GLY G  71  ? ASN K 475 GLY K 486 1 ? 12 
HELX_P HELX_P63  AG9 ILE G  74  ? PHE G  78  ? ILE K 489 PHE K 493 5 ? 5  
HELX_P HELX_P64  AH1 ASP G  79  ? ALA G  83  ? ASP K 494 ALA K 498 5 ? 5  
HELX_P HELX_P65  AH2 ASP G  95  ? MET G  113 ? ASP K 510 MET K 528 1 ? 19 
HELX_P HELX_P66  AH3 MET G  113 ? ALA G  119 ? MET K 528 ALA K 534 1 ? 7  
HELX_P HELX_P67  AH4 ASN G  135 ? MET G  144 ? ASN K 587 MET K 596 1 ? 10 
HELX_P HELX_P68  AH5 ASP G  158 ? GLY G  171 ? ASP K 610 GLY K 623 1 ? 14 
HELX_P HELX_P69  AH6 VAL G  173 ? ALA G  185 ? VAL K 625 ALA K 637 1 ? 13 
HELX_P HELX_P70  AH7 ILE H  4   ? ALA H  22  ? ILE J 14  ALA J 32  1 ? 19 
HELX_P HELX_P71  AH8 LYS H  33  ? GLN H  46  ? LYS J 43  GLN J 56  1 ? 14 
HELX_P HELX_P72  AH9 SER H  57  ? TYR H  68  ? SER J 67  TYR J 78  1 ? 12 
HELX_P HELX_P73  AI1 GLY H  72  ? MET H  83  ? GLY J 82  MET J 93  1 ? 12 
HELX_P HELX_P74  AI2 ILE H  121 ? ARG H  127 ? ILE J 131 ARG J 137 1 ? 7  
HELX_P HELX_P75  AI3 PRO H  155 ? GLY H  161 ? PRO J 165 GLY J 171 1 ? 7  
HELX_P HELX_P76  AI4 ASN H  177 ? ASN H  191 ? ASN J 187 ASN J 201 1 ? 15 
HELX_P HELX_P77  AI5 SER H  195 ? MET H  200 ? SER J 205 MET J 210 1 ? 6  
HELX_P HELX_P78  AI6 LYS H  217 ? GLY H  227 ? LYS J 227 GLY J 237 1 ? 11 
HELX_P HELX_P79  AI7 ASN H  258 ? ASP H  272 ? ASN J 269 ASP J 283 1 ? 15 
HELX_P HELX_P80  AI8 ASN H  302 ? THR H  314 ? ASN J 313 THR J 325 1 ? 13 
HELX_P HELX_P81  AI9 ASN H  336 ? HIS H  379 ? ASN J 347 HIS J 390 1 ? 44 
HELX_P HELX_P82  AJ1 HIS H  379 ? GLU H  389 ? HIS J 390 GLU J 400 1 ? 11 
HELX_P HELX_P83  AJ2 THR H  392 ? LYS H  405 ? THR J 403 LYS J 416 1 ? 14 
HELX_P HELX_P84  AJ3 SER H  407 ? MET H  417 ? SER J 418 MET J 428 1 ? 11 
HELX_P HELX_P85  AJ4 ARG H  418 ? LEU H  422 ? ARG J 429 LEU J 433 5 ? 5  
HELX_P HELX_P86  AJ5 THR H  423 ? ASP H  450 ? THR J 434 ASP J 461 1 ? 28 
HELX_P HELX_P87  AJ6 ASP H  450 ? GLY H  470 ? ASP J 461 GLY J 481 1 ? 21 
HELX_P HELX_P88  AJ7 SER I  9   ? CYS I  13  ? SER M 425 CYS M 429 5 ? 5  
HELX_P HELX_P89  AJ8 GLY I  20  ? ARG I  31  ? GLY M 436 ARG M 447 1 ? 12 
HELX_P HELX_P90  AJ9 ARG I  52  ? ASN I  59  ? ARG M 468 ASN M 475 1 ? 8  
HELX_P HELX_P91  AK1 ASN I  59  ? GLY I  70  ? ASN M 475 GLY M 486 1 ? 12 
HELX_P HELX_P92  AK2 ILE I  73  ? PHE I  77  ? ILE M 489 PHE M 493 5 ? 5  
HELX_P HELX_P93  AK3 ASP I  78  ? ALA I  82  ? ASP M 494 ALA M 498 5 ? 5  
HELX_P HELX_P94  AK4 ASP I  94  ? MET I  112 ? ASP M 510 MET M 528 1 ? 19 
HELX_P HELX_P95  AK5 MET I  112 ? ALA I  118 ? MET M 528 ALA M 534 1 ? 7  
HELX_P HELX_P96  AK6 ASN I  137 ? MET I  146 ? ASN M 587 MET M 596 1 ? 10 
HELX_P HELX_P97  AK7 ASP I  160 ? GLY I  173 ? ASP M 610 GLY M 623 1 ? 14 
HELX_P HELX_P98  AK8 VAL I  175 ? ALA I  187 ? VAL M 625 ALA M 637 1 ? 13 
HELX_P HELX_P99  AK9 ILE J  13  ? ALA J  31  ? ILE L 14  ALA L 32  1 ? 19 
HELX_P HELX_P100 AL1 LYS J  42  ? GLN J  55  ? LYS L 43  GLN L 56  1 ? 14 
HELX_P HELX_P101 AL2 SER J  66  ? TYR J  77  ? SER L 67  TYR L 78  1 ? 12 
HELX_P HELX_P102 AL3 GLY J  81  ? MET J  92  ? GLY L 82  MET L 93  1 ? 12 
HELX_P HELX_P103 AL4 ILE J  130 ? ARG J  136 ? ILE L 131 ARG L 137 1 ? 7  
HELX_P HELX_P104 AL5 PRO J  164 ? GLY J  170 ? PRO L 165 GLY L 171 1 ? 7  
HELX_P HELX_P105 AL6 ASN J  186 ? ASN J  200 ? ASN L 187 ASN L 201 1 ? 15 
HELX_P HELX_P106 AL7 SER J  204 ? MET J  209 ? SER L 205 MET L 210 1 ? 6  
HELX_P HELX_P107 AL8 LYS J  226 ? GLY J  236 ? LYS L 227 GLY L 237 1 ? 11 
HELX_P HELX_P108 AL9 ASN J  268 ? ASP J  282 ? ASN L 269 ASP L 283 1 ? 15 
HELX_P HELX_P109 AM1 ASN J  312 ? THR J  324 ? ASN L 313 THR L 325 1 ? 13 
HELX_P HELX_P110 AM2 ASN J  346 ? HIS J  389 ? ASN L 347 HIS L 390 1 ? 44 
HELX_P HELX_P111 AM3 HIS J  389 ? GLU J  399 ? HIS L 390 GLU L 400 1 ? 11 
HELX_P HELX_P112 AM4 THR J  402 ? LYS J  415 ? THR L 403 LYS L 416 1 ? 14 
HELX_P HELX_P113 AM5 SER J  417 ? ASP J  426 ? SER L 418 ASP L 427 1 ? 10 
HELX_P HELX_P114 AM6 ARG J  428 ? LEU J  432 ? ARG L 429 LEU L 433 5 ? 5  
HELX_P HELX_P115 AM7 THR J  433 ? ASP J  460 ? THR L 434 ASP L 461 1 ? 28 
HELX_P HELX_P116 AM8 ASP J  460 ? GLY J  480 ? ASP L 461 GLY L 481 1 ? 21 
HELX_P HELX_P117 AM9 SER M  10  ? CYS M  14  ? SER S 425 CYS S 429 5 ? 5  
HELX_P HELX_P118 AN1 GLY M  21  ? ARG M  32  ? GLY S 436 ARG S 447 1 ? 12 
HELX_P HELX_P119 AN2 ARG M  53  ? ASN M  60  ? ARG S 468 ASN S 475 1 ? 8  
HELX_P HELX_P120 AN3 ASN M  60  ? GLY M  71  ? ASN S 475 GLY S 486 1 ? 12 
HELX_P HELX_P121 AN4 ILE M  74  ? PHE M  78  ? ILE S 489 PHE S 493 5 ? 5  
HELX_P HELX_P122 AN5 ASP M  79  ? ALA M  83  ? ASP S 494 ALA S 498 5 ? 5  
HELX_P HELX_P123 AN6 ASP M  95  ? MET M  113 ? ASP S 510 MET S 528 1 ? 19 
HELX_P HELX_P124 AN7 MET M  113 ? ALA M  119 ? MET S 528 ALA S 534 1 ? 7  
HELX_P HELX_P125 AN8 ASN M  135 ? MET M  144 ? ASN S 587 MET S 596 1 ? 10 
HELX_P HELX_P126 AN9 ASP M  158 ? GLY M  171 ? ASP S 610 GLY S 623 1 ? 14 
HELX_P HELX_P127 AO1 VAL M  173 ? ALA M  185 ? VAL S 625 ALA S 637 1 ? 13 
HELX_P HELX_P128 AO2 ILE N  13  ? ALA N  31  ? ILE R 14  ALA R 32  1 ? 19 
HELX_P HELX_P129 AO3 LYS N  42  ? GLN N  55  ? LYS R 43  GLN R 56  1 ? 14 
HELX_P HELX_P130 AO4 SER N  66  ? TYR N  77  ? SER R 67  TYR R 78  1 ? 12 
HELX_P HELX_P131 AO5 GLY N  81  ? MET N  92  ? GLY R 82  MET R 93  1 ? 12 
HELX_P HELX_P132 AO6 ILE N  130 ? ARG N  136 ? ILE R 131 ARG R 137 1 ? 7  
HELX_P HELX_P133 AO7 PRO N  164 ? GLY N  170 ? PRO R 165 GLY R 171 1 ? 7  
HELX_P HELX_P134 AO8 ASN N  186 ? ASN N  200 ? ASN R 187 ASN R 201 1 ? 15 
HELX_P HELX_P135 AO9 SER N  204 ? MET N  209 ? SER R 205 MET R 210 1 ? 6  
HELX_P HELX_P136 AP1 LYS N  226 ? GLY N  236 ? LYS R 227 GLY R 237 1 ? 11 
HELX_P HELX_P137 AP2 ASN N  268 ? ASP N  282 ? ASN R 269 ASP R 283 1 ? 15 
HELX_P HELX_P138 AP3 ASN N  312 ? THR N  324 ? ASN R 313 THR R 325 1 ? 13 
HELX_P HELX_P139 AP4 ASN N  346 ? HIS N  389 ? ASN R 347 HIS R 390 1 ? 44 
HELX_P HELX_P140 AP5 HIS N  389 ? GLU N  399 ? HIS R 390 GLU R 400 1 ? 11 
HELX_P HELX_P141 AP6 THR N  402 ? LYS N  415 ? THR R 403 LYS R 416 1 ? 14 
HELX_P HELX_P142 AP7 SER N  417 ? MET N  427 ? SER R 418 MET R 428 1 ? 11 
HELX_P HELX_P143 AP8 ARG N  428 ? LEU N  432 ? ARG R 429 LEU R 433 5 ? 5  
HELX_P HELX_P144 AP9 THR N  433 ? ASP N  460 ? THR R 434 ASP R 461 1 ? 28 
HELX_P HELX_P145 AQ1 ASP N  460 ? GLY N  480 ? ASP R 461 GLY R 481 1 ? 21 
HELX_P HELX_P146 AQ2 SER O  9   ? CYS O  13  ? SER U 425 CYS U 429 5 ? 5  
HELX_P HELX_P147 AQ3 GLY O  20  ? ARG O  31  ? GLY U 436 ARG U 447 1 ? 12 
HELX_P HELX_P148 AQ4 ARG O  52  ? ASN O  59  ? ARG U 468 ASN U 475 1 ? 8  
HELX_P HELX_P149 AQ5 ASN O  59  ? GLY O  70  ? ASN U 475 GLY U 486 1 ? 12 
HELX_P HELX_P150 AQ6 ILE O  73  ? PHE O  77  ? ILE U 489 PHE U 493 5 ? 5  
HELX_P HELX_P151 AQ7 ASP O  78  ? ALA O  82  ? ASP U 494 ALA U 498 5 ? 5  
HELX_P HELX_P152 AQ8 ASP O  94  ? MET O  112 ? ASP U 510 MET U 528 1 ? 19 
HELX_P HELX_P153 AQ9 MET O  112 ? ALA O  118 ? MET U 528 ALA U 534 1 ? 7  
HELX_P HELX_P154 AR1 ASN O  137 ? MET O  146 ? ASN U 587 MET U 596 1 ? 10 
HELX_P HELX_P155 AR2 ASP O  160 ? GLY O  173 ? ASP U 610 GLY U 623 1 ? 14 
HELX_P HELX_P156 AR3 VAL O  175 ? ALA O  187 ? VAL U 625 ALA U 637 1 ? 13 
HELX_P HELX_P157 AR4 ILE P  13  ? ALA P  31  ? ILE T 14  ALA T 32  1 ? 19 
HELX_P HELX_P158 AR5 LYS P  42  ? GLN P  55  ? LYS T 43  GLN T 56  1 ? 14 
HELX_P HELX_P159 AR6 SER P  66  ? TYR P  77  ? SER T 67  TYR T 78  1 ? 12 
HELX_P HELX_P160 AR7 GLY P  81  ? MET P  92  ? GLY T 82  MET T 93  1 ? 12 
HELX_P HELX_P161 AR8 ILE P  130 ? ARG P  136 ? ILE T 131 ARG T 137 1 ? 7  
HELX_P HELX_P162 AR9 PRO P  164 ? GLY P  170 ? PRO T 165 GLY T 171 1 ? 7  
HELX_P HELX_P163 AS1 ASN P  186 ? ASN P  200 ? ASN T 187 ASN T 201 1 ? 15 
HELX_P HELX_P164 AS2 SER P  204 ? MET P  209 ? SER T 205 MET T 210 1 ? 6  
HELX_P HELX_P165 AS3 LYS P  226 ? GLY P  236 ? LYS T 227 GLY T 237 1 ? 11 
HELX_P HELX_P166 AS4 ASN P  268 ? ASP P  282 ? ASN T 269 ASP T 283 1 ? 15 
HELX_P HELX_P167 AS5 ASN P  312 ? THR P  324 ? ASN T 313 THR T 325 1 ? 13 
HELX_P HELX_P168 AS6 ASN P  346 ? HIS P  389 ? ASN T 347 HIS T 390 1 ? 44 
HELX_P HELX_P169 AS7 HIS P  389 ? GLU P  399 ? HIS T 390 GLU T 400 1 ? 11 
HELX_P HELX_P170 AS8 THR P  402 ? LYS P  415 ? THR T 403 LYS T 416 1 ? 14 
HELX_P HELX_P171 AS9 SER P  417 ? ASP P  426 ? SER T 418 ASP T 427 1 ? 10 
HELX_P HELX_P172 AT1 ARG P  428 ? LEU P  432 ? ARG T 429 LEU T 433 5 ? 5  
HELX_P HELX_P173 AT2 THR P  433 ? ASP P  460 ? THR T 434 ASP T 461 1 ? 28 
HELX_P HELX_P174 AT3 ASP P  460 ? GLY P  480 ? ASP T 461 GLY T 481 1 ? 21 
HELX_P HELX_P175 AT4 SER S  10  ? CYS S  14  ? SER b 425 CYS b 429 5 ? 5  
HELX_P HELX_P176 AT5 GLY S  21  ? ARG S  32  ? GLY b 436 ARG b 447 1 ? 12 
HELX_P HELX_P177 AT6 ARG S  53  ? ASN S  60  ? ARG b 468 ASN b 475 1 ? 8  
HELX_P HELX_P178 AT7 ASN S  60  ? GLY S  71  ? ASN b 475 GLY b 486 1 ? 12 
HELX_P HELX_P179 AT8 ILE S  74  ? PHE S  78  ? ILE b 489 PHE b 493 5 ? 5  
HELX_P HELX_P180 AT9 ASP S  79  ? ALA S  83  ? ASP b 494 ALA b 498 5 ? 5  
HELX_P HELX_P181 AU1 ASP S  95  ? MET S  113 ? ASP b 510 MET b 528 1 ? 19 
HELX_P HELX_P182 AU2 MET S  113 ? ALA S  119 ? MET b 528 ALA b 534 1 ? 7  
HELX_P HELX_P183 AU3 ASN S  135 ? MET S  144 ? ASN b 587 MET b 596 1 ? 10 
HELX_P HELX_P184 AU4 ASP S  158 ? GLY S  171 ? ASP b 610 GLY b 623 1 ? 14 
HELX_P HELX_P185 AU5 VAL S  173 ? ALA S  185 ? VAL b 625 ALA b 637 1 ? 13 
HELX_P HELX_P186 AU6 ILE T  13  ? ALA T  31  ? ILE a 14  ALA a 32  1 ? 19 
HELX_P HELX_P187 AU7 LYS T  42  ? GLN T  55  ? LYS a 43  GLN a 56  1 ? 14 
HELX_P HELX_P188 AU8 SER T  66  ? TYR T  77  ? SER a 67  TYR a 78  1 ? 12 
HELX_P HELX_P189 AU9 GLY T  81  ? MET T  92  ? GLY a 82  MET a 93  1 ? 12 
HELX_P HELX_P190 AV1 ILE T  130 ? ARG T  136 ? ILE a 131 ARG a 137 1 ? 7  
HELX_P HELX_P191 AV2 PRO T  164 ? GLY T  170 ? PRO a 165 GLY a 171 1 ? 7  
HELX_P HELX_P192 AV3 ASN T  186 ? ASN T  200 ? ASN a 187 ASN a 201 1 ? 15 
HELX_P HELX_P193 AV4 SER T  204 ? MET T  209 ? SER a 205 MET a 210 1 ? 6  
HELX_P HELX_P194 AV5 LYS T  226 ? GLY T  236 ? LYS a 227 GLY a 237 1 ? 11 
HELX_P HELX_P195 AV6 ASN T  268 ? ASP T  282 ? ASN a 269 ASP a 283 1 ? 15 
HELX_P HELX_P196 AV7 ASN T  312 ? THR T  324 ? ASN a 313 THR a 325 1 ? 13 
HELX_P HELX_P197 AV8 ASN T  346 ? HIS T  389 ? ASN a 347 HIS a 390 1 ? 44 
HELX_P HELX_P198 AV9 HIS T  389 ? GLU T  399 ? HIS a 390 GLU a 400 1 ? 11 
HELX_P HELX_P199 AW1 THR T  402 ? LYS T  415 ? THR a 403 LYS a 416 1 ? 14 
HELX_P HELX_P200 AW2 SER T  417 ? MET T  427 ? SER a 418 MET a 428 1 ? 11 
HELX_P HELX_P201 AW3 ARG T  428 ? LEU T  432 ? ARG a 429 LEU a 433 5 ? 5  
HELX_P HELX_P202 AW4 THR T  433 ? ASP T  460 ? THR a 434 ASP a 461 1 ? 28 
HELX_P HELX_P203 AW5 ASP T  460 ? GLY T  480 ? ASP a 461 GLY a 481 1 ? 21 
HELX_P HELX_P204 AW6 SER U  9   ? CYS U  13  ? SER d 425 CYS d 429 5 ? 5  
HELX_P HELX_P205 AW7 GLY U  20  ? ARG U  31  ? GLY d 436 ARG d 447 1 ? 12 
HELX_P HELX_P206 AW8 ARG U  52  ? ASN U  59  ? ARG d 468 ASN d 475 1 ? 8  
HELX_P HELX_P207 AW9 ASN U  59  ? GLY U  70  ? ASN d 475 GLY d 486 1 ? 12 
HELX_P HELX_P208 AX1 ILE U  73  ? PHE U  77  ? ILE d 489 PHE d 493 5 ? 5  
HELX_P HELX_P209 AX2 ASP U  78  ? ALA U  82  ? ASP d 494 ALA d 498 5 ? 5  
HELX_P HELX_P210 AX3 ASP U  94  ? MET U  112 ? ASP d 510 MET d 528 1 ? 19 
HELX_P HELX_P211 AX4 MET U  112 ? ALA U  118 ? MET d 528 ALA d 534 1 ? 7  
HELX_P HELX_P212 AX5 ASN U  131 ? MET U  140 ? ASN d 587 MET d 596 1 ? 10 
HELX_P HELX_P213 AX6 ASP U  154 ? GLY U  167 ? ASP d 610 GLY d 623 1 ? 14 
HELX_P HELX_P214 AX7 VAL U  169 ? ALA U  181 ? VAL d 625 ALA d 637 1 ? 13 
HELX_P HELX_P215 AX8 ILE V  13  ? ALA V  31  ? ILE c 14  ALA c 32  1 ? 19 
HELX_P HELX_P216 AX9 LYS V  42  ? GLN V  55  ? LYS c 43  GLN c 56  1 ? 14 
HELX_P HELX_P217 AY1 SER V  66  ? TYR V  77  ? SER c 67  TYR c 78  1 ? 12 
HELX_P HELX_P218 AY2 GLY V  81  ? MET V  92  ? GLY c 82  MET c 93  1 ? 12 
HELX_P HELX_P219 AY3 ILE V  130 ? ARG V  136 ? ILE c 131 ARG c 137 1 ? 7  
HELX_P HELX_P220 AY4 PRO V  164 ? GLY V  170 ? PRO c 165 GLY c 171 1 ? 7  
HELX_P HELX_P221 AY5 ASN V  186 ? ASN V  200 ? ASN c 187 ASN c 201 1 ? 15 
HELX_P HELX_P222 AY6 SER V  204 ? MET V  209 ? SER c 205 MET c 210 1 ? 6  
HELX_P HELX_P223 AY7 LYS V  226 ? GLY V  236 ? LYS c 227 GLY c 237 1 ? 11 
HELX_P HELX_P224 AY8 ASN V  268 ? ASP V  282 ? ASN c 269 ASP c 283 1 ? 15 
HELX_P HELX_P225 AY9 ASN V  312 ? THR V  324 ? ASN c 313 THR c 325 1 ? 13 
HELX_P HELX_P226 AZ1 ASN V  346 ? HIS V  389 ? ASN c 347 HIS c 390 1 ? 44 
HELX_P HELX_P227 AZ2 HIS V  389 ? GLU V  399 ? HIS c 390 GLU c 400 1 ? 11 
HELX_P HELX_P228 AZ3 THR V  402 ? LYS V  415 ? THR c 403 LYS c 416 1 ? 14 
HELX_P HELX_P229 AZ4 SER V  417 ? MET V  427 ? SER c 418 MET c 428 1 ? 11 
HELX_P HELX_P230 AZ5 ARG V  428 ? LEU V  432 ? ARG c 429 LEU c 433 5 ? 5  
HELX_P HELX_P231 AZ6 THR V  433 ? ASP V  460 ? THR c 434 ASP c 461 1 ? 28 
HELX_P HELX_P232 AZ7 ASP V  460 ? GLY V  480 ? ASP c 461 GLY c 481 1 ? 21 
HELX_P HELX_P233 AZ8 SER Y  10  ? CYS Y  14  ? SER k 425 CYS k 429 5 ? 5  
HELX_P HELX_P234 AZ9 GLY Y  21  ? ARG Y  32  ? GLY k 436 ARG k 447 1 ? 12 
HELX_P HELX_P235 BA1 ARG Y  53  ? ASN Y  60  ? ARG k 468 ASN k 475 1 ? 8  
HELX_P HELX_P236 BA2 ASN Y  60  ? GLY Y  71  ? ASN k 475 GLY k 486 1 ? 12 
HELX_P HELX_P237 BA3 ILE Y  74  ? PHE Y  78  ? ILE k 489 PHE k 493 5 ? 5  
HELX_P HELX_P238 BA4 ASP Y  79  ? ALA Y  83  ? ASP k 494 ALA k 498 5 ? 5  
HELX_P HELX_P239 BA5 ASP Y  95  ? MET Y  113 ? ASP k 510 MET k 528 1 ? 19 
HELX_P HELX_P240 BA6 MET Y  113 ? ALA Y  119 ? MET k 528 ALA k 534 1 ? 7  
HELX_P HELX_P241 BA7 ASN Y  135 ? MET Y  144 ? ASN k 587 MET k 596 1 ? 10 
HELX_P HELX_P242 BA8 ASP Y  158 ? GLY Y  171 ? ASP k 610 GLY k 623 1 ? 14 
HELX_P HELX_P243 BA9 VAL Y  173 ? ALA Y  185 ? VAL k 625 ALA k 637 1 ? 13 
HELX_P HELX_P244 BB1 ILE Z  13  ? ALA Z  31  ? ILE j 14  ALA j 32  1 ? 19 
HELX_P HELX_P245 BB2 LYS Z  42  ? GLN Z  55  ? LYS j 43  GLN j 56  1 ? 14 
HELX_P HELX_P246 BB3 SER Z  66  ? TYR Z  77  ? SER j 67  TYR j 78  1 ? 12 
HELX_P HELX_P247 BB4 GLY Z  81  ? MET Z  92  ? GLY j 82  MET j 93  1 ? 12 
HELX_P HELX_P248 BB5 ILE Z  130 ? ARG Z  136 ? ILE j 131 ARG j 137 1 ? 7  
HELX_P HELX_P249 BB6 PRO Z  164 ? GLY Z  170 ? PRO j 165 GLY j 171 1 ? 7  
HELX_P HELX_P250 BB7 ASN Z  186 ? ASN Z  200 ? ASN j 187 ASN j 201 1 ? 15 
HELX_P HELX_P251 BB8 SER Z  204 ? MET Z  209 ? SER j 205 MET j 210 1 ? 6  
HELX_P HELX_P252 BB9 LYS Z  226 ? GLY Z  236 ? LYS j 227 GLY j 237 1 ? 11 
HELX_P HELX_P253 BC1 ASN Z  268 ? ASP Z  282 ? ASN j 269 ASP j 283 1 ? 15 
HELX_P HELX_P254 BC2 ASN Z  312 ? THR Z  324 ? ASN j 313 THR j 325 1 ? 13 
HELX_P HELX_P255 BC3 ASN Z  346 ? HIS Z  389 ? ASN j 347 HIS j 390 1 ? 44 
HELX_P HELX_P256 BC4 HIS Z  389 ? GLU Z  399 ? HIS j 390 GLU j 400 1 ? 11 
HELX_P HELX_P257 BC5 THR Z  402 ? LYS Z  415 ? THR j 403 LYS j 416 1 ? 14 
HELX_P HELX_P258 BC6 SER Z  417 ? MET Z  427 ? SER j 418 MET j 428 1 ? 11 
HELX_P HELX_P259 BC7 ARG Z  428 ? LEU Z  432 ? ARG j 429 LEU j 433 5 ? 5  
HELX_P HELX_P260 BC8 THR Z  433 ? ASP Z  460 ? THR j 434 ASP j 461 1 ? 28 
HELX_P HELX_P261 BC9 ASP Z  460 ? GLY Z  480 ? ASP j 461 GLY j 481 1 ? 21 
HELX_P HELX_P262 BD1 SER AA 9   ? CYS AA 13  ? SER m 425 CYS m 429 5 ? 5  
HELX_P HELX_P263 BD2 GLY AA 20  ? ARG AA 31  ? GLY m 436 ARG m 447 1 ? 12 
HELX_P HELX_P264 BD3 ARG AA 52  ? ASN AA 59  ? ARG m 468 ASN m 475 1 ? 8  
HELX_P HELX_P265 BD4 ASN AA 59  ? GLY AA 70  ? ASN m 475 GLY m 486 1 ? 12 
HELX_P HELX_P266 BD5 ILE AA 73  ? PHE AA 77  ? ILE m 489 PHE m 493 5 ? 5  
HELX_P HELX_P267 BD6 ASP AA 78  ? ALA AA 82  ? ASP m 494 ALA m 498 5 ? 5  
HELX_P HELX_P268 BD7 ASP AA 94  ? MET AA 112 ? ASP m 510 MET m 528 1 ? 19 
HELX_P HELX_P269 BD8 MET AA 112 ? ALA AA 118 ? MET m 528 ALA m 534 1 ? 7  
HELX_P HELX_P270 BD9 ASN AA 137 ? MET AA 146 ? ASN m 587 MET m 596 1 ? 10 
HELX_P HELX_P271 BE1 ASP AA 160 ? GLY AA 173 ? ASP m 610 GLY m 623 1 ? 14 
HELX_P HELX_P272 BE2 VAL AA 175 ? ASN AA 186 ? VAL m 625 ASN m 636 1 ? 12 
HELX_P HELX_P273 BE3 ILE BA 13  ? ALA BA 31  ? ILE l 14  ALA l 32  1 ? 19 
HELX_P HELX_P274 BE4 LYS BA 42  ? GLN BA 55  ? LYS l 43  GLN l 56  1 ? 14 
HELX_P HELX_P275 BE5 SER BA 66  ? TYR BA 77  ? SER l 67  TYR l 78  1 ? 12 
HELX_P HELX_P276 BE6 GLY BA 81  ? MET BA 92  ? GLY l 82  MET l 93  1 ? 12 
HELX_P HELX_P277 BE7 ILE BA 130 ? ARG BA 136 ? ILE l 131 ARG l 137 1 ? 7  
HELX_P HELX_P278 BE8 PRO BA 164 ? GLY BA 170 ? PRO l 165 GLY l 171 1 ? 7  
HELX_P HELX_P279 BE9 ASN BA 186 ? ASN BA 200 ? ASN l 187 ASN l 201 1 ? 15 
HELX_P HELX_P280 BF1 SER BA 204 ? MET BA 209 ? SER l 205 MET l 210 1 ? 6  
HELX_P HELX_P281 BF2 LYS BA 226 ? GLY BA 236 ? LYS l 227 GLY l 237 1 ? 11 
HELX_P HELX_P282 BF3 ASN BA 268 ? ASP BA 282 ? ASN l 269 ASP l 283 1 ? 15 
HELX_P HELX_P283 BF4 ASN BA 312 ? THR BA 324 ? ASN l 313 THR l 325 1 ? 13 
HELX_P HELX_P284 BF5 ASN BA 346 ? HIS BA 389 ? ASN l 347 HIS l 390 1 ? 44 
HELX_P HELX_P285 BF6 HIS BA 389 ? GLU BA 399 ? HIS l 390 GLU l 400 1 ? 11 
HELX_P HELX_P286 BF7 THR BA 402 ? LYS BA 415 ? THR l 403 LYS l 416 1 ? 14 
HELX_P HELX_P287 BF8 SER BA 417 ? ASP BA 426 ? SER l 418 ASP l 427 1 ? 10 
HELX_P HELX_P288 BF9 ARG BA 428 ? LEU BA 432 ? ARG l 429 LEU l 433 5 ? 5  
HELX_P HELX_P289 BG1 THR BA 433 ? ASP BA 460 ? THR l 434 ASP l 461 1 ? 28 
HELX_P HELX_P290 BG2 ASP BA 460 ? GLY BA 480 ? ASP l 461 GLY l 481 1 ? 21 
HELX_P HELX_P291 BG3 SER EA 10  ? CYS EA 14  ? SER s 425 CYS s 429 5 ? 5  
HELX_P HELX_P292 BG4 GLY EA 21  ? ARG EA 32  ? GLY s 436 ARG s 447 1 ? 12 
HELX_P HELX_P293 BG5 ARG EA 53  ? ASN EA 60  ? ARG s 468 ASN s 475 1 ? 8  
HELX_P HELX_P294 BG6 ASN EA 60  ? GLY EA 71  ? ASN s 475 GLY s 486 1 ? 12 
HELX_P HELX_P295 BG7 ILE EA 74  ? PHE EA 78  ? ILE s 489 PHE s 493 5 ? 5  
HELX_P HELX_P296 BG8 ASP EA 79  ? ALA EA 83  ? ASP s 494 ALA s 498 5 ? 5  
HELX_P HELX_P297 BG9 ASP EA 95  ? MET EA 113 ? ASP s 510 MET s 528 1 ? 19 
HELX_P HELX_P298 BH1 MET EA 113 ? ALA EA 119 ? MET s 528 ALA s 534 1 ? 7  
HELX_P HELX_P299 BH2 ASN EA 135 ? MET EA 144 ? ASN s 587 MET s 596 1 ? 10 
HELX_P HELX_P300 BH3 ASP EA 158 ? GLY EA 171 ? ASP s 610 GLY s 623 1 ? 14 
HELX_P HELX_P301 BH4 VAL EA 173 ? ALA EA 185 ? VAL s 625 ALA s 637 1 ? 13 
HELX_P HELX_P302 BH5 ILE FA 13  ? ALA FA 31  ? ILE r 14  ALA r 32  1 ? 19 
HELX_P HELX_P303 BH6 LYS FA 42  ? GLN FA 55  ? LYS r 43  GLN r 56  1 ? 14 
HELX_P HELX_P304 BH7 SER FA 66  ? TYR FA 77  ? SER r 67  TYR r 78  1 ? 12 
HELX_P HELX_P305 BH8 GLY FA 81  ? MET FA 92  ? GLY r 82  MET r 93  1 ? 12 
HELX_P HELX_P306 BH9 ILE FA 130 ? ARG FA 136 ? ILE r 131 ARG r 137 1 ? 7  
HELX_P HELX_P307 BI1 PRO FA 164 ? GLY FA 170 ? PRO r 165 GLY r 171 1 ? 7  
HELX_P HELX_P308 BI2 ASN FA 186 ? ASN FA 200 ? ASN r 187 ASN r 201 1 ? 15 
HELX_P HELX_P309 BI3 SER FA 204 ? MET FA 209 ? SER r 205 MET r 210 1 ? 6  
HELX_P HELX_P310 BI4 LYS FA 226 ? GLY FA 236 ? LYS r 227 GLY r 237 1 ? 11 
HELX_P HELX_P311 BI5 ASN FA 268 ? ASP FA 282 ? ASN r 269 ASP r 283 1 ? 15 
HELX_P HELX_P312 BI6 ASN FA 312 ? THR FA 324 ? ASN r 313 THR r 325 1 ? 13 
HELX_P HELX_P313 BI7 ASN FA 346 ? HIS FA 389 ? ASN r 347 HIS r 390 1 ? 44 
HELX_P HELX_P314 BI8 HIS FA 389 ? GLU FA 399 ? HIS r 390 GLU r 400 1 ? 11 
HELX_P HELX_P315 BI9 THR FA 402 ? LYS FA 415 ? THR r 403 LYS r 416 1 ? 14 
HELX_P HELX_P316 BJ1 SER FA 417 ? MET FA 427 ? SER r 418 MET r 428 1 ? 11 
HELX_P HELX_P317 BJ2 ARG FA 428 ? LEU FA 432 ? ARG r 429 LEU r 433 5 ? 5  
HELX_P HELX_P318 BJ3 THR FA 433 ? ASP FA 460 ? THR r 434 ASP r 461 1 ? 28 
HELX_P HELX_P319 BJ4 ASP FA 460 ? GLY FA 480 ? ASP r 461 GLY r 481 1 ? 21 
HELX_P HELX_P320 BJ5 SER GA 9   ? CYS GA 13  ? SER u 425 CYS u 429 5 ? 5  
HELX_P HELX_P321 BJ6 GLY GA 20  ? ARG GA 31  ? GLY u 436 ARG u 447 1 ? 12 
HELX_P HELX_P322 BJ7 ARG GA 52  ? ASN GA 59  ? ARG u 468 ASN u 475 1 ? 8  
HELX_P HELX_P323 BJ8 ASN GA 59  ? GLY GA 70  ? ASN u 475 GLY u 486 1 ? 12 
HELX_P HELX_P324 BJ9 ILE GA 73  ? PHE GA 77  ? ILE u 489 PHE u 493 5 ? 5  
HELX_P HELX_P325 BK1 ASP GA 78  ? ALA GA 82  ? ASP u 494 ALA u 498 5 ? 5  
HELX_P HELX_P326 BK2 ASP GA 94  ? MET GA 112 ? ASP u 510 MET u 528 1 ? 19 
HELX_P HELX_P327 BK3 MET GA 112 ? ALA GA 118 ? MET u 528 ALA u 534 1 ? 7  
HELX_P HELX_P328 BK4 ASN GA 137 ? MET GA 146 ? ASN u 587 MET u 596 1 ? 10 
HELX_P HELX_P329 BK5 ASP GA 160 ? GLY GA 173 ? ASP u 610 GLY u 623 1 ? 14 
HELX_P HELX_P330 BK6 VAL GA 175 ? ASN GA 186 ? VAL u 625 ASN u 636 1 ? 12 
HELX_P HELX_P331 BK7 ILE HA 13  ? ALA HA 31  ? ILE t 14  ALA t 32  1 ? 19 
HELX_P HELX_P332 BK8 LYS HA 42  ? GLN HA 55  ? LYS t 43  GLN t 56  1 ? 14 
HELX_P HELX_P333 BK9 SER HA 66  ? TYR HA 77  ? SER t 67  TYR t 78  1 ? 12 
HELX_P HELX_P334 BL1 GLY HA 81  ? MET HA 92  ? GLY t 82  MET t 93  1 ? 12 
HELX_P HELX_P335 BL2 ILE HA 130 ? ARG HA 136 ? ILE t 131 ARG t 137 1 ? 7  
HELX_P HELX_P336 BL3 PRO HA 164 ? GLY HA 170 ? PRO t 165 GLY t 171 1 ? 7  
HELX_P HELX_P337 BL4 ASN HA 186 ? ASN HA 200 ? ASN t 187 ASN t 201 1 ? 15 
HELX_P HELX_P338 BL5 SER HA 204 ? MET HA 209 ? SER t 205 MET t 210 1 ? 6  
HELX_P HELX_P339 BL6 LYS HA 226 ? GLY HA 236 ? LYS t 227 GLY t 237 1 ? 11 
HELX_P HELX_P340 BL7 ASN HA 268 ? ASP HA 282 ? ASN t 269 ASP t 283 1 ? 15 
HELX_P HELX_P341 BL8 ASN HA 312 ? THR HA 324 ? ASN t 313 THR t 325 1 ? 13 
HELX_P HELX_P342 BL9 ASN HA 346 ? HIS HA 389 ? ASN t 347 HIS t 390 1 ? 44 
HELX_P HELX_P343 BM1 HIS HA 389 ? GLU HA 399 ? HIS t 390 GLU t 400 1 ? 11 
HELX_P HELX_P344 BM2 THR HA 402 ? LYS HA 415 ? THR t 403 LYS t 416 1 ? 14 
HELX_P HELX_P345 BM3 SER HA 417 ? MET HA 427 ? SER t 418 MET t 428 1 ? 11 
HELX_P HELX_P346 BM4 ARG HA 428 ? LEU HA 432 ? ARG t 429 LEU t 433 5 ? 5  
HELX_P HELX_P347 BM5 THR HA 433 ? ASP HA 460 ? THR t 434 ASP t 461 1 ? 28 
HELX_P HELX_P348 BM6 ASP HA 460 ? GLY HA 480 ? ASP t 461 GLY t 481 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale one ? B  TYR 122 OH ? ? ? 1_555 F  DG 9  P  ? ? A TYR 123  F DG 2009 1_555 ? ? ? ? ? ? ?                       
1.571 ? 
covale2   covale one ? J  TYR 122 OH ? ? ? 1_555 K  DG 9  P  ? ? L TYR 123  N DG 2009 1_555 ? ? ? ? ? ? ?                       
1.613 ? 
covale3   covale one ? N  TYR 122 OH ? ? ? 1_555 R  DG 9  P  ? ? R TYR 123  W DG 2009 1_555 ? ? ? ? ? ? ?                       
1.721 ? 
covale4   covale one ? P  TYR 122 OH ? ? ? 1_555 Q  DG 9  P  ? ? T TYR 123  V DG 2009 1_555 ? ? ? ? ? ? ?                       
1.545 ? 
covale5   covale one ? BA TYR 122 OH ? ? ? 1_555 CA DG 9  P  ? ? l TYR 123  n DG 2009 1_555 ? ? ? ? ? ? ?                       
1.462 ? 
covale6   covale one ? FA TYR 122 OH ? ? ? 1_555 JA DG 9  P  ? ? r TYR 123  w DG 2009 1_555 ? ? ? ? ? ? ?                       
1.660 ? 
covale7   covale one ? HA TYR 122 OH ? ? ? 1_555 IA DG 9  P  ? ? t TYR 123  v DG 2009 1_555 ? ? ? ? ? ? ?                       
1.652 ? 
hydrog1   hydrog ?   ? E  DA  2   N1 A ? ? 1_555 F  DT 19 N3 ? ? E DA  2    F DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog2   hydrog ?   ? E  DA  2   N1 B ? ? 1_555 F  DT 19 N3 ? ? E DA  2    F DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog3   hydrog ?   ? E  DA  2   N6 A ? ? 1_555 F  DT 19 O4 ? ? E DA  2    F DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog4   hydrog ?   ? E  DA  2   N6 B ? ? 1_555 F  DT 19 O4 ? ? E DA  2    F DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog5   hydrog ?   ? E  DG  3   N1 A ? ? 1_555 F  DC 18 N3 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog6   hydrog ?   ? E  DG  3   N1 B ? ? 1_555 F  DC 18 N3 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog7   hydrog ?   ? E  DG  3   N2 A ? ? 1_555 F  DC 18 O2 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog8   hydrog ?   ? E  DG  3   N2 B ? ? 1_555 F  DC 18 O2 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog9   hydrog ?   ? E  DG  3   O6 A ? ? 1_555 F  DC 18 N4 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog10  hydrog ?   ? E  DG  3   O6 B ? ? 1_555 F  DC 18 N4 ? ? E DG  3    F DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog11  hydrog ?   ? E  DC  4   N3 ? ? ? 1_555 F  DG 17 N1 ? ? E DC  4    F DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog12  hydrog ?   ? E  DC  4   N4 ? ? ? 1_555 F  DG 17 O6 ? ? E DC  4    F DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog13  hydrog ?   ? E  DC  4   O2 ? ? ? 1_555 F  DG 17 N2 ? ? E DC  4    F DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog14  hydrog ?   ? E  DG  5   N1 ? ? ? 1_555 F  DC 16 N3 ? ? E DG  5    F DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog15  hydrog ?   ? E  DG  5   N2 ? ? ? 1_555 F  DC 16 O2 ? ? E DG  5    F DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog16  hydrog ?   ? E  DG  5   O6 ? ? ? 1_555 F  DC 16 N4 ? ? E DG  5    F DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog17  hydrog ?   ? E  DT  6   N3 ? ? ? 1_555 F  DA 15 N1 ? ? E DT  6    F DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog18  hydrog ?   ? E  DT  6   O4 ? ? ? 1_555 F  DA 15 N6 ? ? E DT  6    F DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog19  hydrog ?   ? E  DA  7   N1 ? ? ? 1_555 F  DT 14 N3 ? ? E DA  7    F DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog20  hydrog ?   ? E  DA  7   N6 ? ? ? 1_555 F  DT 14 O4 ? ? E DA  7    F DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog21  hydrog ?   ? E  DC  8   N3 ? ? ? 1_555 F  DG 13 N1 ? ? E DC  8    F DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog22  hydrog ?   ? E  DC  8   N4 ? ? ? 1_555 F  DG 13 O6 ? ? E DC  8    F DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog23  hydrog ?   ? E  DC  8   O2 ? ? ? 1_555 F  DG 13 N2 ? ? E DC  8    F DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog24  hydrog ?   ? E  DG  9   N1 ? ? ? 1_555 F  DC 12 N3 ? ? E DG  9    F DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog25  hydrog ?   ? E  DG  9   N2 ? ? ? 1_555 F  DC 12 O2 ? ? E DG  9    F DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog26  hydrog ?   ? E  DG  9   O6 ? ? ? 1_555 F  DC 12 N4 ? ? E DG  9    F DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog27  hydrog ?   ? E  DG  10  N1 ? ? ? 1_555 F  DC 11 N3 ? ? E DG  10   F DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog28  hydrog ?   ? E  DG  10  N2 ? ? ? 1_555 F  DC 11 O2 ? ? E DG  10   F DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog29  hydrog ?   ? E  DG  10  O6 ? ? ? 1_555 F  DC 11 N4 ? ? E DG  10   F DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog30  hydrog ?   ? E  DC  11  N3 ? ? ? 1_555 F  DG 10 N1 ? ? E DC  11   F DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog31  hydrog ?   ? E  DC  11  N4 ? ? ? 1_555 F  DG 10 O6 ? ? E DC  11   F DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog32  hydrog ?   ? E  DC  11  O2 ? ? ? 1_555 F  DG 10 N2 ? ? E DC  11   F DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog33  hydrog ?   ? E  DC  12  N3 ? ? ? 1_555 F  DG 9  N1 ? ? E DC  12   F DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog34  hydrog ?   ? E  DC  12  N4 ? ? ? 1_555 F  DG 9  O6 ? ? E DC  12   F DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog35  hydrog ?   ? E  DC  12  O2 ? ? ? 1_555 F  DG 9  N2 ? ? E DC  12   F DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog36  hydrog ?   ? E  DG  13  N1 ? ? ? 1_555 F  DC 8  N3 ? ? E DG  13   F DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog37  hydrog ?   ? E  DG  13  N2 ? ? ? 1_555 F  DC 8  O2 ? ? E DG  13   F DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog38  hydrog ?   ? E  DG  13  O6 ? ? ? 1_555 F  DC 8  N4 ? ? E DG  13   F DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog39  hydrog ?   ? E  DT  14  N3 ? ? ? 1_555 F  DA 7  N1 ? ? E DT  14   F DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog40  hydrog ?   ? E  DT  14  O4 ? ? ? 1_555 F  DA 7  N6 ? ? E DT  14   F DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog41  hydrog ?   ? E  DA  15  N1 ? ? ? 1_555 F  DT 6  N3 ? ? E DA  15   F DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog42  hydrog ?   ? E  DA  15  N6 ? ? ? 1_555 F  DT 6  O4 ? ? E DA  15   F DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog43  hydrog ?   ? E  DC  16  N3 ? ? ? 1_555 F  DG 5  N1 ? ? E DC  16   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog44  hydrog ?   ? E  DC  16  N4 ? ? ? 1_555 F  DG 5  O6 ? ? E DC  16   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog45  hydrog ?   ? E  DC  16  O2 ? ? ? 1_555 F  DG 5  N2 ? ? E DC  16   F DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog46  hydrog ?   ? E  DG  17  N1 ? ? ? 1_555 F  DC 4  N3 ? ? E DG  17   F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog47  hydrog ?   ? E  DG  17  N2 ? ? ? 1_555 F  DC 4  O2 ? ? E DG  17   F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog48  hydrog ?   ? E  DG  17  O6 ? ? ? 1_555 F  DC 4  N4 ? ? E DG  17   F DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog49  hydrog ?   ? E  DC  18  N3 ? ? ? 1_555 F  DG 3  N1 ? ? E DC  18   F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog50  hydrog ?   ? E  DC  18  N4 ? ? ? 1_555 F  DG 3  O6 ? ? E DC  18   F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog51  hydrog ?   ? E  DC  18  O2 ? ? ? 1_555 F  DG 3  N2 ? ? E DC  18   F DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog52  hydrog ?   ? E  DT  19  N3 ? ? ? 1_555 F  DA 2  N1 ? ? E DT  19   F DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog53  hydrog ?   ? E  DT  19  O4 ? ? ? 1_555 F  DA 2  N6 ? ? E DT  19   F DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog54  hydrog ?   ? K  DA  2   N1 A ? ? 1_555 L  DT 19 N3 ? ? N DA  2    O DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog55  hydrog ?   ? K  DA  2   N1 B ? ? 1_555 L  DT 19 N3 ? ? N DA  2    O DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog56  hydrog ?   ? K  DA  2   N6 A ? ? 1_555 L  DT 19 O4 ? ? N DA  2    O DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog57  hydrog ?   ? K  DA  2   N6 B ? ? 1_555 L  DT 19 O4 ? ? N DA  2    O DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog58  hydrog ?   ? K  DG  3   N1 A ? ? 1_555 L  DC 18 N3 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog59  hydrog ?   ? K  DG  3   N1 B ? ? 1_555 L  DC 18 N3 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog60  hydrog ?   ? K  DG  3   N2 A ? ? 1_555 L  DC 18 O2 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog61  hydrog ?   ? K  DG  3   N2 B ? ? 1_555 L  DC 18 O2 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog62  hydrog ?   ? K  DG  3   O6 A ? ? 1_555 L  DC 18 N4 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog63  hydrog ?   ? K  DG  3   O6 B ? ? 1_555 L  DC 18 N4 ? ? N DG  3    O DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog64  hydrog ?   ? K  DC  4   N3 ? ? ? 1_555 L  DG 17 N1 ? ? N DC  4    O DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog65  hydrog ?   ? K  DC  4   N4 ? ? ? 1_555 L  DG 17 O6 ? ? N DC  4    O DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog66  hydrog ?   ? K  DC  4   O2 ? ? ? 1_555 L  DG 17 N2 ? ? N DC  4    O DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog67  hydrog ?   ? K  DG  5   N1 ? ? ? 1_555 L  DC 16 N3 ? ? N DG  5    O DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog68  hydrog ?   ? K  DG  5   N2 ? ? ? 1_555 L  DC 16 O2 ? ? N DG  5    O DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog69  hydrog ?   ? K  DG  5   O6 ? ? ? 1_555 L  DC 16 N4 ? ? N DG  5    O DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog70  hydrog ?   ? K  DT  6   N3 ? ? ? 1_555 L  DA 15 N1 ? ? N DT  6    O DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog71  hydrog ?   ? K  DT  6   O4 ? ? ? 1_555 L  DA 15 N6 ? ? N DT  6    O DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog72  hydrog ?   ? K  DA  7   N1 ? ? ? 1_555 L  DT 14 N3 ? ? N DA  7    O DT 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog73  hydrog ?   ? K  DA  7   N6 ? ? ? 1_555 L  DT 14 O4 ? ? N DA  7    O DT 14   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog74  hydrog ?   ? K  DC  8   N3 ? ? ? 1_555 L  DG 13 N1 ? ? N DC  8    O DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog75  hydrog ?   ? K  DC  8   N4 ? ? ? 1_555 L  DG 13 O6 ? ? N DC  8    O DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog76  hydrog ?   ? K  DC  8   O2 ? ? ? 1_555 L  DG 13 N2 ? ? N DC  8    O DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog77  hydrog ?   ? K  DG  9   N2 ? ? ? 1_555 L  DC 12 O2 ? ? N DG  2009 O DC 12   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog78  hydrog ?   ? K  DG  10  N1 ? ? ? 1_555 L  DC 11 N3 ? ? N DG  2010 O DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog79  hydrog ?   ? K  DG  10  N2 ? ? ? 1_555 L  DC 11 O2 ? ? N DG  2010 O DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog80  hydrog ?   ? K  DG  10  O6 ? ? ? 1_555 L  DC 11 N4 ? ? N DG  2010 O DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog81  hydrog ?   ? K  DC  11  N3 ? ? ? 1_555 L  DG 10 N1 ? ? N DC  2011 O DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog82  hydrog ?   ? K  DC  11  N4 ? ? ? 1_555 L  DG 10 O6 ? ? N DC  2011 O DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog83  hydrog ?   ? K  DC  11  O2 ? ? ? 1_555 L  DG 10 N2 ? ? N DC  2011 O DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog84  hydrog ?   ? K  DC  12  O2 ? ? ? 1_555 L  DG 9  N2 ? ? N DC  2012 O DG 9    1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog85  hydrog ?   ? K  DG  13  N1 ? ? ? 1_555 L  DC 8  N3 ? ? N DG  2013 O DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog86  hydrog ?   ? K  DG  13  N2 ? ? ? 1_555 L  DC 8  O2 ? ? N DG  2013 O DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog87  hydrog ?   ? K  DG  13  O6 ? ? ? 1_555 L  DC 8  N4 ? ? N DG  2013 O DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog88  hydrog ?   ? K  DT  14  N3 ? ? ? 1_555 L  DA 7  N1 ? ? N DT  2014 O DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog89  hydrog ?   ? K  DT  14  O4 ? ? ? 1_555 L  DA 7  N6 ? ? N DT  2014 O DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog90  hydrog ?   ? K  DA  15  N1 ? ? ? 1_555 L  DT 6  N3 ? ? N DA  2015 O DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog91  hydrog ?   ? K  DA  15  N6 ? ? ? 1_555 L  DT 6  O4 ? ? N DA  2015 O DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog92  hydrog ?   ? K  DC  16  N3 ? ? ? 1_555 L  DG 5  N1 ? ? N DC  2016 O DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog93  hydrog ?   ? K  DC  16  N4 ? ? ? 1_555 L  DG 5  O6 ? ? N DC  2016 O DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog94  hydrog ?   ? K  DC  16  O2 ? ? ? 1_555 L  DG 5  N2 ? ? N DC  2016 O DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog95  hydrog ?   ? K  DG  17  N1 ? ? ? 1_555 L  DC 4  N3 ? ? N DG  2017 O DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog96  hydrog ?   ? K  DG  17  N2 ? ? ? 1_555 L  DC 4  O2 ? ? N DG  2017 O DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog97  hydrog ?   ? K  DG  17  O6 ? ? ? 1_555 L  DC 4  N4 ? ? N DG  2017 O DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog98  hydrog ?   ? K  DC  18  N3 ? ? ? 1_555 L  DG 3  N1 ? ? N DC  2018 O DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog99  hydrog ?   ? K  DC  18  N4 ? ? ? 1_555 L  DG 3  O6 ? ? N DC  2018 O DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog100 hydrog ?   ? K  DC  18  O2 ? ? ? 1_555 L  DG 3  N2 ? ? N DC  2018 O DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog101 hydrog ?   ? K  DT  19  N3 ? ? ? 1_555 L  DA 2  N1 ? ? N DT  2019 O DA 2    1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog102 hydrog ?   ? Q  DA  2   N1 ? ? ? 1_555 R  DT 19 N3 ? ? V DA  2    W DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog103 hydrog ?   ? Q  DA  2   N6 ? ? ? 1_555 R  DT 19 O4 ? ? V DA  2    W DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog104 hydrog ?   ? Q  DG  3   N1 ? ? ? 1_555 R  DC 18 N3 ? ? V DG  3    W DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog105 hydrog ?   ? Q  DG  3   N2 ? ? ? 1_555 R  DC 18 O2 ? ? V DG  3    W DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog106 hydrog ?   ? Q  DG  3   O6 ? ? ? 1_555 R  DC 18 N4 ? ? V DG  3    W DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog107 hydrog ?   ? Q  DC  4   N3 ? ? ? 1_555 R  DG 17 N1 ? ? V DC  4    W DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog108 hydrog ?   ? Q  DC  4   N4 ? ? ? 1_555 R  DG 17 O6 ? ? V DC  4    W DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog109 hydrog ?   ? Q  DC  4   O2 ? ? ? 1_555 R  DG 17 N2 ? ? V DC  4    W DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog110 hydrog ?   ? Q  DG  5   N1 ? ? ? 1_555 R  DC 16 N3 ? ? V DG  5    W DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog111 hydrog ?   ? Q  DG  5   N2 ? ? ? 1_555 R  DC 16 O2 ? ? V DG  5    W DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog112 hydrog ?   ? Q  DG  5   O6 ? ? ? 1_555 R  DC 16 N4 ? ? V DG  5    W DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog113 hydrog ?   ? Q  DT  6   N3 ? ? ? 1_555 R  DA 15 N1 ? ? V DT  6    W DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog114 hydrog ?   ? Q  DT  6   O4 ? ? ? 1_555 R  DA 15 N6 ? ? V DT  6    W DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog115 hydrog ?   ? Q  DA  7   N1 ? ? ? 1_555 R  DT 14 N3 ? ? V DA  7    W DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog116 hydrog ?   ? Q  DA  7   N6 ? ? ? 1_555 R  DT 14 O4 ? ? V DA  7    W DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog117 hydrog ?   ? Q  DC  8   N3 ? ? ? 1_555 R  DG 13 N1 ? ? V DC  8    W DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog118 hydrog ?   ? Q  DC  8   N4 ? ? ? 1_555 R  DG 13 O6 ? ? V DC  8    W DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog119 hydrog ?   ? Q  DC  8   O2 ? ? ? 1_555 R  DG 13 N2 ? ? V DC  8    W DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog120 hydrog ?   ? Q  DG  9   N2 ? ? ? 1_555 R  DC 12 O2 ? ? V DG  2009 W DC 2012 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog121 hydrog ?   ? Q  DG  10  N1 ? ? ? 1_555 R  DC 11 O2 ? ? V DG  2010 W DC 2011 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog122 hydrog ?   ? Q  DG  10  N2 ? ? ? 1_555 R  DC 11 N3 ? ? V DG  2010 W DC 2011 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog123 hydrog ?   ? Q  DC  11  N3 ? ? ? 1_555 R  DG 10 N2 ? ? V DC  2011 W DG 2010 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog124 hydrog ?   ? Q  DC  11  O2 ? ? ? 1_555 R  DG 10 N1 ? ? V DC  2011 W DG 2010 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? 
? 
hydrog125 hydrog ?   ? Q  DC  12  N3 ? ? ? 1_555 R  DG 9  N1 ? ? V DC  2012 W DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog126 hydrog ?   ? Q  DC  12  N4 ? ? ? 1_555 R  DG 9  O6 ? ? V DC  2012 W DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog127 hydrog ?   ? Q  DC  12  O2 ? ? ? 1_555 R  DG 9  N2 ? ? V DC  2012 W DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog128 hydrog ?   ? Q  DG  13  N1 ? ? ? 1_555 R  DC 8  N3 ? ? V DG  2013 W DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog129 hydrog ?   ? Q  DG  13  N2 ? ? ? 1_555 R  DC 8  O2 ? ? V DG  2013 W DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog130 hydrog ?   ? Q  DG  13  O6 ? ? ? 1_555 R  DC 8  N4 ? ? V DG  2013 W DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog131 hydrog ?   ? Q  DT  14  N3 ? ? ? 1_555 R  DA 7  N1 ? ? V DT  2014 W DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog132 hydrog ?   ? Q  DT  14  O4 ? ? ? 1_555 R  DA 7  N6 ? ? V DT  2014 W DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog133 hydrog ?   ? Q  DA  15  N1 ? ? ? 1_555 R  DT 6  N3 ? ? V DA  2015 W DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog134 hydrog ?   ? Q  DA  15  N6 ? ? ? 1_555 R  DT 6  O4 ? ? V DA  2015 W DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog135 hydrog ?   ? Q  DC  16  N3 ? ? ? 1_555 R  DG 5  N1 ? ? V DC  2016 W DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog136 hydrog ?   ? Q  DC  16  N4 ? ? ? 1_555 R  DG 5  O6 ? ? V DC  2016 W DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog137 hydrog ?   ? Q  DC  16  O2 ? ? ? 1_555 R  DG 5  N2 ? ? V DC  2016 W DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog138 hydrog ?   ? Q  DG  17  N1 ? ? ? 1_555 R  DC 4  N3 ? ? V DG  2017 W DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog139 hydrog ?   ? Q  DG  17  N2 ? ? ? 1_555 R  DC 4  O2 ? ? V DG  2017 W DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog140 hydrog ?   ? Q  DG  17  O6 ? ? ? 1_555 R  DC 4  N4 ? ? V DG  2017 W DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog141 hydrog ?   ? Q  DC  18  N3 ? ? ? 1_555 R  DG 3  N1 ? ? V DC  2018 W DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog142 hydrog ?   ? Q  DC  18  N4 ? ? ? 1_555 R  DG 3  O6 ? ? V DC  2018 W DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog143 hydrog ?   ? Q  DC  18  O2 ? ? ? 1_555 R  DG 3  N2 ? ? V DC  2018 W DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog144 hydrog ?   ? W  DG  3   N1 ? ? ? 1_555 X  DC 16 N3 ? ? e DG  3    f DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog145 hydrog ?   ? W  DG  3   N2 ? ? ? 1_555 X  DC 16 O2 ? ? e DG  3    f DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog146 hydrog ?   ? W  DG  3   O6 ? ? ? 1_555 X  DC 16 N4 ? ? e DG  3    f DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog147 hydrog ?   ? W  DC  4   N3 ? ? ? 1_555 X  DG 15 N1 ? ? e DC  4    f DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog148 hydrog ?   ? W  DC  4   N4 ? ? ? 1_555 X  DG 15 O6 ? ? e DC  4    f DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog149 hydrog ?   ? W  DC  4   O2 ? ? ? 1_555 X  DG 15 N2 ? ? e DC  4    f DG 17   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog150 hydrog ?   ? W  DG  5   N1 ? ? ? 1_555 X  DC 14 N3 ? ? e DG  5    f DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog151 hydrog ?   ? W  DG  5   N2 ? ? ? 1_555 X  DC 14 O2 ? ? e DG  5    f DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog152 hydrog ?   ? W  DG  5   O6 ? ? ? 1_555 X  DC 14 N4 ? ? e DG  5    f DC 16   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog153 hydrog ?   ? W  DT  6   N3 ? ? ? 1_555 X  DA 13 N1 ? ? e DT  6    f DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog154 hydrog ?   ? W  DT  6   O4 ? ? ? 1_555 X  DA 13 N6 ? ? e DT  6    f DA 15   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog155 hydrog ?   ? W  DA  7   N1 ? ? ? 1_555 X  DT 12 N3 ? ? e DA  7    f DT 14   1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog156 hydrog ?   ? W  DC  8   N3 ? ? ? 1_555 X  DG 11 N1 ? ? e DC  8    f DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog157 hydrog ?   ? W  DC  8   N4 ? ? ? 1_555 X  DG 11 O6 ? ? e DC  8    f DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog158 hydrog ?   ? W  DC  8   O2 ? ? ? 1_555 X  DG 11 N2 ? ? e DC  8    f DG 13   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog159 hydrog ?   ? W  DG  9   N1 ? ? ? 1_555 X  DC 10 N3 ? ? e DG  9    f DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog160 hydrog ?   ? W  DG  9   N2 ? ? ? 1_555 X  DC 10 O2 ? ? e DG  9    f DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog161 hydrog ?   ? W  DG  9   O6 ? ? ? 1_555 X  DC 10 N4 ? ? e DG  9    f DC 12   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog162 hydrog ?   ? W  DG  10  N2 ? ? ? 1_555 X  DC 9  O2 ? ? e DG  10   f DC 11   1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog163 hydrog ?   ? W  DC  11  N3 ? ? ? 1_555 X  DG 8  N1 ? ? e DC  11   f DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog164 hydrog ?   ? W  DC  11  N4 ? ? ? 1_555 X  DG 8  O6 ? ? e DC  11   f DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog165 hydrog ?   ? W  DC  11  O2 ? ? ? 1_555 X  DG 8  N2 ? ? e DC  11   f DG 10   1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog166 hydrog ?   ? W  DG  13  N1 ? ? ? 1_555 X  DC 6  N3 ? ? e DG  13   f DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog167 hydrog ?   ? W  DG  13  N2 ? ? ? 1_555 X  DC 6  O2 ? ? e DG  13   f DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog168 hydrog ?   ? W  DG  13  O6 ? ? ? 1_555 X  DC 6  N4 ? ? e DG  13   f DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog169 hydrog ?   ? W  DT  14  N3 ? ? ? 1_555 X  DA 5  N1 ? ? e DT  14   f DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog170 hydrog ?   ? W  DT  14  O4 ? ? ? 1_555 X  DA 5  N6 ? ? e DT  14   f DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog171 hydrog ?   ? W  DA  15  N1 ? ? ? 1_555 X  DG 3  N1 ? ? e DA  15   f DG 5    1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog172 hydrog ?   ? W  DA  15  N6 ? ? ? 1_555 X  DG 3  O6 ? ? e DA  15   f DG 5    1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? 
? 
hydrog173 hydrog ?   ? W  DA  15  N1 ? ? ? 1_555 X  DT 4  N3 ? ? e DA  15   f DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog174 hydrog ?   ? W  DA  15  N6 ? ? ? 1_555 X  DT 4  O4 ? ? e DA  15   f DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog175 hydrog ?   ? W  DC  16  N3 ? ? ? 1_555 X  DG 3  N1 ? ? e DC  16   f DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog176 hydrog ?   ? W  DC  16  N4 ? ? ? 1_555 X  DG 3  O6 ? ? e DC  16   f DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog177 hydrog ?   ? W  DC  16  O2 ? ? ? 1_555 X  DG 3  N2 ? ? e DC  16   f DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog178 hydrog ?   ? W  DG  17  N2 ? ? ? 1_555 X  DC 2  O2 ? ? e DG  17   f DC 4    1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog179 hydrog ?   ? W  DC  18  O2 ? ? ? 1_555 X  DG 1  N2 ? ? e DC  18   f DG 3    1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog180 hydrog ?   ? CA DA  2   N1 ? ? ? 1_555 DA DT 19 N3 ? ? n DA  2    o DT 2019 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? 
? 
hydrog181 hydrog ?   ? CA DG  3   N1 ? ? ? 1_555 DA DC 18 N3 ? ? n DG  3    o DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog182 hydrog ?   ? CA DG  3   N2 ? ? ? 1_555 DA DC 18 O2 ? ? n DG  3    o DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog183 hydrog ?   ? CA DG  3   O6 ? ? ? 1_555 DA DC 18 N4 ? ? n DG  3    o DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog184 hydrog ?   ? CA DC  4   N3 ? ? ? 1_555 DA DG 17 N1 ? ? n DC  4    o DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog185 hydrog ?   ? CA DC  4   N4 ? ? ? 1_555 DA DG 17 O6 ? ? n DC  4    o DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog186 hydrog ?   ? CA DC  4   O2 ? ? ? 1_555 DA DG 17 N2 ? ? n DC  4    o DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog187 hydrog ?   ? CA DG  5   N1 ? ? ? 1_555 DA DC 16 N3 ? ? n DG  5    o DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog188 hydrog ?   ? CA DG  5   N2 ? ? ? 1_555 DA DC 16 O2 ? ? n DG  5    o DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog189 hydrog ?   ? CA DG  5   O6 ? ? ? 1_555 DA DC 16 N4 ? ? n DG  5    o DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog190 hydrog ?   ? CA DT  6   N3 ? ? ? 1_555 DA DA 15 N1 ? ? n DT  6    o DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog191 hydrog ?   ? CA DT  6   O4 ? ? ? 1_555 DA DA 15 N6 ? ? n DT  6    o DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog192 hydrog ?   ? CA DA  7   N1 ? ? ? 1_555 DA DT 14 N3 ? ? n DA  7    o DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog193 hydrog ?   ? CA DA  7   N6 ? ? ? 1_555 DA DT 14 O4 ? ? n DA  7    o DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog194 hydrog ?   ? CA DC  8   N3 ? ? ? 1_555 DA DG 13 N1 ? ? n DC  8    o DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog195 hydrog ?   ? CA DC  8   N4 ? ? ? 1_555 DA DG 13 O6 ? ? n DC  8    o DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog196 hydrog ?   ? CA DC  8   O2 ? ? ? 1_555 DA DG 13 N2 ? ? n DC  8    o DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog197 hydrog ?   ? CA DG  9   N2 ? ? ? 1_555 DA DC 12 O2 ? ? n DG  2009 o DC 2012 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? 
? 
hydrog198 hydrog ?   ? CA DG  10  N1 ? ? ? 1_555 DA DC 11 N3 ? ? n DG  2010 o DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog199 hydrog ?   ? CA DG  10  N2 ? ? ? 1_555 DA DC 11 O2 ? ? n DG  2010 o DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog200 hydrog ?   ? CA DG  10  O6 ? ? ? 1_555 DA DC 11 N4 ? ? n DG  2010 o DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog201 hydrog ?   ? CA DG  10  N1 ? ? ? 1_555 DA DC 12 N3 ? ? n DG  2010 o DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog202 hydrog ?   ? CA DG  10  N2 ? ? ? 1_555 DA DC 12 O2 ? ? n DG  2010 o DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog203 hydrog ?   ? CA DG  10  O6 ? ? ? 1_555 DA DC 12 N4 ? ? n DG  2010 o DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog204 hydrog ?   ? CA DC  11  N3 ? ? ? 1_555 DA DG 10 N1 ? ? n DC  2011 o DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog205 hydrog ?   ? CA DC  11  N4 ? ? ? 1_555 DA DG 10 O6 ? ? n DC  2011 o DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog206 hydrog ?   ? CA DC  11  O2 ? ? ? 1_555 DA DG 10 N2 ? ? n DC  2011 o DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog207 hydrog ?   ? CA DC  12  O2 ? ? ? 1_555 DA DG 9  N2 ? ? n DC  2012 o DG 2009 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? 
? 
hydrog208 hydrog ?   ? CA DG  13  N1 ? ? ? 1_555 DA DC 8  N3 ? ? n DG  2013 o DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog209 hydrog ?   ? CA DG  13  N2 ? ? ? 1_555 DA DC 8  O2 ? ? n DG  2013 o DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog210 hydrog ?   ? CA DG  13  O6 ? ? ? 1_555 DA DC 8  N4 ? ? n DG  2013 o DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog211 hydrog ?   ? CA DT  14  N3 ? ? ? 1_555 DA DA 7  N1 ? ? n DT  2014 o DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog212 hydrog ?   ? CA DT  14  O4 ? ? ? 1_555 DA DA 7  N6 ? ? n DT  2014 o DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog213 hydrog ?   ? CA DA  15  N1 ? ? ? 1_555 DA DT 6  N3 ? ? n DA  2015 o DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog214 hydrog ?   ? CA DA  15  N6 ? ? ? 1_555 DA DT 6  O4 ? ? n DA  2015 o DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog215 hydrog ?   ? CA DC  16  N3 ? ? ? 1_555 DA DG 5  N1 ? ? n DC  2016 o DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog216 hydrog ?   ? CA DC  16  N4 ? ? ? 1_555 DA DG 5  O6 ? ? n DC  2016 o DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog217 hydrog ?   ? CA DC  16  O2 ? ? ? 1_555 DA DG 5  N2 ? ? n DC  2016 o DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog218 hydrog ?   ? CA DG  17  N1 ? ? ? 1_555 DA DC 4  N3 ? ? n DG  2017 o DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog219 hydrog ?   ? CA DG  17  N2 ? ? ? 1_555 DA DC 4  O2 ? ? n DG  2017 o DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog220 hydrog ?   ? CA DG  17  O6 ? ? ? 1_555 DA DC 4  N4 ? ? n DG  2017 o DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog221 hydrog ?   ? CA DC  18  N3 ? ? ? 1_555 DA DG 3  N1 ? ? n DC  2018 o DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog222 hydrog ?   ? CA DC  18  N4 ? ? ? 1_555 DA DG 3  O6 ? ? n DC  2018 o DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog223 hydrog ?   ? CA DC  18  O2 ? ? ? 1_555 DA DG 3  N2 ? ? n DC  2018 o DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog224 hydrog ?   ? CA DT  19  N3 A ? ? 1_555 DA DA 2  N1 ? ? n DT  2019 o DA 2    1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog225 hydrog ?   ? CA DT  19  N3 B ? ? 1_555 DA DA 2  N1 ? ? n DT  2019 o DA 2    1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? 
? 
hydrog226 hydrog ?   ? IA DA  2   N1 ? ? ? 1_555 JA DT 19 N3 ? ? v DA  2    w DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog227 hydrog ?   ? IA DA  2   N6 ? ? ? 1_555 JA DT 19 O4 ? ? v DA  2    w DT 2019 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog228 hydrog ?   ? IA DG  3   N1 ? ? ? 1_555 JA DC 18 N3 ? ? v DG  3    w DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog229 hydrog ?   ? IA DG  3   N2 ? ? ? 1_555 JA DC 18 O2 ? ? v DG  3    w DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog230 hydrog ?   ? IA DG  3   O6 ? ? ? 1_555 JA DC 18 N4 ? ? v DG  3    w DC 2018 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog231 hydrog ?   ? IA DC  4   N3 ? ? ? 1_555 JA DG 17 N1 ? ? v DC  4    w DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog232 hydrog ?   ? IA DC  4   N4 ? ? ? 1_555 JA DG 17 O6 ? ? v DC  4    w DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog233 hydrog ?   ? IA DC  4   O2 ? ? ? 1_555 JA DG 17 N2 ? ? v DC  4    w DG 2017 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog234 hydrog ?   ? IA DG  5   N1 ? ? ? 1_555 JA DC 16 N3 ? ? v DG  5    w DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog235 hydrog ?   ? IA DG  5   N2 ? ? ? 1_555 JA DC 16 O2 ? ? v DG  5    w DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog236 hydrog ?   ? IA DG  5   O6 ? ? ? 1_555 JA DC 16 N4 ? ? v DG  5    w DC 2016 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog237 hydrog ?   ? IA DT  6   N3 ? ? ? 1_555 JA DA 15 N1 ? ? v DT  6    w DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog238 hydrog ?   ? IA DT  6   O4 ? ? ? 1_555 JA DA 15 N6 ? ? v DT  6    w DA 2015 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog239 hydrog ?   ? IA DA  7   N1 ? ? ? 1_555 JA DT 14 N3 ? ? v DA  7    w DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog240 hydrog ?   ? IA DA  7   N6 ? ? ? 1_555 JA DT 14 O4 ? ? v DA  7    w DT 2014 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog241 hydrog ?   ? IA DC  8   N3 ? ? ? 1_555 JA DG 13 N1 ? ? v DC  8    w DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog242 hydrog ?   ? IA DC  8   N4 ? ? ? 1_555 JA DG 13 O6 ? ? v DC  8    w DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog243 hydrog ?   ? IA DC  8   O2 ? ? ? 1_555 JA DG 13 N2 ? ? v DC  8    w DG 2013 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog244 hydrog ?   ? IA DG  9   N1 ? ? ? 1_555 JA DC 12 N3 ? ? v DG  2009 w DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog245 hydrog ?   ? IA DG  9   N2 ? ? ? 1_555 JA DC 12 O2 ? ? v DG  2009 w DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog246 hydrog ?   ? IA DG  9   O6 ? ? ? 1_555 JA DC 12 N4 ? ? v DG  2009 w DC 2012 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog247 hydrog ?   ? IA DG  10  N1 ? ? ? 1_555 JA DC 11 N3 ? ? v DG  2010 w DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog248 hydrog ?   ? IA DG  10  N2 ? ? ? 1_555 JA DC 11 O2 ? ? v DG  2010 w DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog249 hydrog ?   ? IA DG  10  O6 ? ? ? 1_555 JA DC 11 N4 ? ? v DG  2010 w DC 2011 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog250 hydrog ?   ? IA DC  11  N3 ? ? ? 1_555 JA DG 10 N1 ? ? v DC  2011 w DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog251 hydrog ?   ? IA DC  11  N4 ? ? ? 1_555 JA DG 10 O6 ? ? v DC  2011 w DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog252 hydrog ?   ? IA DC  11  O2 ? ? ? 1_555 JA DG 10 N2 ? ? v DC  2011 w DG 2010 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog253 hydrog ?   ? IA DC  12  N3 ? ? ? 1_555 JA DG 9  N1 ? ? v DC  2012 w DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog254 hydrog ?   ? IA DC  12  N4 ? ? ? 1_555 JA DG 9  O6 ? ? v DC  2012 w DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog255 hydrog ?   ? IA DC  12  O2 ? ? ? 1_555 JA DG 9  N2 ? ? v DC  2012 w DG 2009 1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog256 hydrog ?   ? IA DG  13  N1 ? ? ? 1_555 JA DC 8  N3 ? ? v DG  2013 w DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog257 hydrog ?   ? IA DG  13  N2 ? ? ? 1_555 JA DC 8  O2 ? ? v DG  2013 w DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog258 hydrog ?   ? IA DG  13  O6 ? ? ? 1_555 JA DC 8  N4 ? ? v DG  2013 w DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog259 hydrog ?   ? IA DT  14  N3 ? ? ? 1_555 JA DA 7  N1 ? ? v DT  2014 w DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog260 hydrog ?   ? IA DT  14  O4 ? ? ? 1_555 JA DA 7  N6 ? ? v DT  2014 w DA 7    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog261 hydrog ?   ? IA DA  15  N1 ? ? ? 1_555 JA DT 6  N3 ? ? v DA  2015 w DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog262 hydrog ?   ? IA DA  15  N6 ? ? ? 1_555 JA DT 6  O4 ? ? v DA  2015 w DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog263 hydrog ?   ? IA DC  16  N3 ? ? ? 1_555 JA DG 5  N1 ? ? v DC  2016 w DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog264 hydrog ?   ? IA DC  16  N4 ? ? ? 1_555 JA DG 5  O6 ? ? v DC  2016 w DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog265 hydrog ?   ? IA DC  16  O2 ? ? ? 1_555 JA DG 5  N2 ? ? v DC  2016 w DG 5    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog266 hydrog ?   ? IA DG  17  N1 ? ? ? 1_555 JA DC 4  N3 ? ? v DG  2017 w DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog267 hydrog ?   ? IA DG  17  N2 ? ? ? 1_555 JA DC 4  O2 ? ? v DG  2017 w DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog268 hydrog ?   ? IA DG  17  O6 ? ? ? 1_555 JA DC 4  N4 ? ? v DG  2017 w DC 4    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog269 hydrog ?   ? IA DC  18  N3 ? ? ? 1_555 JA DG 3  N1 ? ? v DC  2018 w DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog270 hydrog ?   ? IA DC  18  N4 ? ? ? 1_555 JA DG 3  O6 ? ? v DC  2018 w DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog271 hydrog ?   ? IA DC  18  O2 ? ? ? 1_555 JA DG 3  N2 ? ? v DC  2018 w DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog272 hydrog ?   ? IA DT  19  N3 A ? ? 1_555 JA DA 2  N1 ? ? v DT  2019 w DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog273 hydrog ?   ? IA DT  19  N3 B ? ? 1_555 JA DA 2  N1 ? ? v DT  2019 w DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog274 hydrog ?   ? IA DT  19  O4 A ? ? 1_555 JA DA 2  N6 ? ? v DT  2019 w DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
hydrog275 hydrog ?   ? IA DT  19  O4 B ? ? 1_555 JA DA 2  N6 ? ? v DT  2019 w DA 2    1_555 ? ? ? ? ? ? WATSON-CRICK            ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
AA9 ? 3 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 6 ? 
AB7 ? 3 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 4 ? 
AC2 ? 4 ? 
AC3 ? 2 ? 
AC4 ? 6 ? 
AC5 ? 3 ? 
AC6 ? 2 ? 
AC7 ? 2 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 2 ? 
AD2 ? 6 ? 
AD3 ? 3 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 4 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 6 ? 
AE1 ? 3 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 4 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 6 ? 
AE8 ? 3 ? 
AE9 ? 2 ? 
AF1 ? 2 ? 
AF2 ? 4 ? 
AF3 ? 4 ? 
AF4 ? 2 ? 
AF5 ? 6 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 2 ? 
AF9 ? 4 ? 
AG1 ? 4 ? 
AG2 ? 2 ? 
AG3 ? 6 ? 
AG4 ? 3 ? 
AG5 ? 2 ? 
AG6 ? 2 ? 
AG7 ? 4 ? 
AG8 ? 4 ? 
AG9 ? 2 ? 
AH1 ? 6 ? 
AH2 ? 3 ? 
AH3 ? 2 ? 
AH4 ? 2 ? 
AH5 ? 4 ? 
AH6 ? 4 ? 
AH7 ? 2 ? 
AH8 ? 6 ? 
AH9 ? 3 ? 
AI1 ? 2 ? 
AI2 ? 2 ? 
AI3 ? 4 ? 
AI4 ? 4 ? 
AI5 ? 2 ? 
AI6 ? 6 ? 
AI7 ? 3 ? 
AI8 ? 2 ? 
AI9 ? 2 ? 
AJ1 ? 4 ? 
AJ2 ? 4 ? 
AJ3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? parallel      
AB6 2 3 ? parallel      
AB6 3 4 ? parallel      
AB6 4 5 ? anti-parallel 
AB6 5 6 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? parallel      
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? parallel      
AC4 3 4 ? parallel      
AC4 4 5 ? anti-parallel 
AC4 5 6 ? parallel      
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? parallel      
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? parallel      
AD9 2 3 ? parallel      
AD9 3 4 ? parallel      
AD9 4 5 ? anti-parallel 
AD9 5 6 ? parallel      
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? parallel      
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE6 1 2 ? anti-parallel 
AE7 1 2 ? parallel      
AE7 2 3 ? parallel      
AE7 3 4 ? parallel      
AE7 4 5 ? anti-parallel 
AE7 5 6 ? parallel      
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? parallel      
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF5 1 2 ? parallel      
AF5 2 3 ? parallel      
AF5 3 4 ? parallel      
AF5 4 5 ? anti-parallel 
AF5 5 6 ? parallel      
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? parallel      
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG3 1 2 ? parallel      
AG3 2 3 ? parallel      
AG3 3 4 ? parallel      
AG3 4 5 ? anti-parallel 
AG3 5 6 ? parallel      
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG6 1 2 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG7 3 4 ? parallel      
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG8 3 4 ? anti-parallel 
AG9 1 2 ? anti-parallel 
AH1 1 2 ? parallel      
AH1 2 3 ? parallel      
AH1 3 4 ? parallel      
AH1 4 5 ? anti-parallel 
AH1 5 6 ? parallel      
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH3 1 2 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? parallel      
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH8 1 2 ? parallel      
AH8 2 3 ? parallel      
AH8 3 4 ? parallel      
AH8 4 5 ? anti-parallel 
AH8 5 6 ? parallel      
AH9 1 2 ? anti-parallel 
AH9 2 3 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI3 1 2 ? anti-parallel 
AI3 2 3 ? anti-parallel 
AI3 3 4 ? parallel      
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI4 3 4 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI6 1 2 ? parallel      
AI6 2 3 ? parallel      
AI6 3 4 ? parallel      
AI6 4 5 ? anti-parallel 
AI6 5 6 ? parallel      
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI9 1 2 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ1 2 3 ? anti-parallel 
AJ1 3 4 ? parallel      
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A  37  ? PRO A  41  ? GLN B 452 PRO B 456 
AA1 2 GLU A  15  ? VAL A  19  ? GLU B 430 VAL B 434 
AA1 3 ILE A  88  ? ILE A  90  ? ILE B 503 ILE B 505 
AA1 4 VAL A  122 ? ILE A  124 ? VAL B 537 ILE B 539 
AA1 5 LEU A  152 ? LYS A  155 ? LEU B 604 LYS B 607 
AA1 6 ARG B  11  ? ASN B  12  ? ARG A 12  ASN A 13  
AA2 1 LYS B  64  ? LYS B  65  ? LYS A 65  LYS A 66  
AA2 2 GLU B  124 ? MET B  127 ? GLU A 125 MET A 128 
AA2 3 VAL B  103 ? GLN B  106 ? VAL A 104 GLN A 107 
AA3 1 PHE B  145 ? ASP B  147 ? PHE A 146 ASP A 148 
AA3 2 ARG B  154 ? PRO B  156 ? ARG A 155 PRO A 157 
AA4 1 ALA B  171 ? ILE B  174 ? ALA A 172 ILE A 175 
AA4 2 ALA B  179 ? ILE B  182 ? ALA A 180 ILE A 183 
AA5 1 GLN B  327 ? ASN B  333 ? GLN A 328 ASN A 334 
AA5 2 ARG B  237 ? ARG B  243 ? ARG A 238 ARG A 244 
AA5 3 LEU B  222 ? LEU B  224 ? LEU A 223 LEU A 225 
AA5 4 GLU B  486 ? GLN B  488 ? GLU A 487 GLN A 489 
AA6 1 ARG B  245 ? GLU B  250 ? ARG A 246 GLU A 251 
AA6 2 GLN B  256 ? GLU B  262 ? GLN A 257 GLU A 263 
AA6 3 VAL B  303 ? VAL B  307 ? VAL A 304 VAL A 308 
AA6 4 ILE B  288 ? ASP B  293 ? ILE A 289 ASP A 294 
AA7 1 ILE B  335 ? VAL B  338 ? ILE A 336 VAL A 339 
AA7 2 ARG B  341 ? LEU B  344 ? ARG A 342 LEU A 345 
AA8 1 GLN C  36  ? PRO C  40  ? GLN D 452 PRO D 456 
AA8 2 GLU C  14  ? VAL C  18  ? GLU D 430 VAL D 434 
AA8 3 ILE C  87  ? ILE C  89  ? ILE D 503 ILE D 505 
AA8 4 VAL C  121 ? ILE C  123 ? VAL D 537 ILE D 539 
AA8 5 LEU C  154 ? LYS C  157 ? LEU D 604 LYS D 607 
AA8 6 GLU D  10  ? ASN D  12  ? GLU C 11  ASN C 13  
AA9 1 LYS D  64  ? LYS D  65  ? LYS C 65  LYS C 66  
AA9 2 GLU D  124 ? MET D  127 ? GLU C 125 MET C 128 
AA9 3 VAL D  103 ? GLN D  106 ? VAL C 104 GLN C 107 
AB1 1 PHE D  145 ? ASP D  147 ? PHE C 146 ASP C 148 
AB1 2 ARG D  154 ? PRO D  156 ? ARG C 155 PRO C 157 
AB2 1 ALA D  171 ? ILE D  174 ? ALA C 172 ILE C 175 
AB2 2 ALA D  179 ? ILE D  182 ? ALA C 180 ILE C 183 
AB3 1 GLN D  327 ? ASN D  333 ? GLN C 328 ASN C 334 
AB3 2 ARG D  237 ? ARG D  243 ? ARG C 238 ARG C 244 
AB3 3 LEU D  222 ? LEU D  224 ? LEU C 223 LEU C 225 
AB3 4 GLU D  486 ? GLN D  488 ? GLU C 487 GLN C 489 
AB4 1 ARG D  245 ? GLY D  252 ? ARG C 246 GLY C 253 
AB4 2 ARG D  255 ? GLU D  262 ? ARG C 256 GLU C 263 
AB4 3 VAL D  303 ? VAL D  307 ? VAL C 304 VAL C 308 
AB4 4 ILE D  288 ? ASP D  293 ? ILE C 289 ASP C 294 
AB5 1 ILE D  335 ? VAL D  338 ? ILE C 336 VAL C 339 
AB5 2 ARG D  341 ? LEU D  344 ? ARG C 342 LEU C 345 
AB6 1 GLN G  37  ? PRO G  41  ? GLN K 452 PRO K 456 
AB6 2 GLU G  15  ? VAL G  19  ? GLU K 430 VAL K 434 
AB6 3 ILE G  88  ? ILE G  90  ? ILE K 503 ILE K 505 
AB6 4 VAL G  122 ? ILE G  124 ? VAL K 537 ILE K 539 
AB6 5 LEU G  152 ? LYS G  155 ? LEU K 604 LYS K 607 
AB6 6 ARG H  2   ? ASN H  3   ? ARG J 12  ASN J 13  
AB7 1 LYS H  55  ? LYS H  56  ? LYS J 65  LYS J 66  
AB7 2 GLU H  115 ? MET H  118 ? GLU J 125 MET J 128 
AB7 3 VAL H  94  ? GLN H  97  ? VAL J 104 GLN J 107 
AB8 1 PHE H  136 ? ASP H  138 ? PHE J 146 ASP J 148 
AB8 2 ARG H  145 ? PRO H  147 ? ARG J 155 PRO J 157 
AB9 1 ALA H  162 ? ILE H  165 ? ALA J 172 ILE J 175 
AB9 2 ALA H  170 ? ILE H  173 ? ALA J 180 ILE J 183 
AC1 1 GLN H  317 ? ASN H  323 ? GLN J 328 ASN J 334 
AC1 2 ARG H  228 ? ARG H  234 ? ARG J 238 ARG J 244 
AC1 3 LEU H  213 ? LEU H  215 ? LEU J 223 LEU J 225 
AC1 4 GLU H  476 ? GLN H  478 ? GLU J 487 GLN J 489 
AC2 1 ARG H  236 ? GLU H  240 ? ARG J 246 GLU J 250 
AC2 2 ARG H  247 ? GLU H  252 ? ARG J 258 GLU J 263 
AC2 3 VAL H  293 ? VAL H  297 ? VAL J 304 VAL J 308 
AC2 4 ILE H  278 ? ASP H  283 ? ILE J 289 ASP J 294 
AC3 1 ILE H  325 ? VAL H  328 ? ILE J 336 VAL J 339 
AC3 2 ARG H  331 ? LEU H  334 ? ARG J 342 LEU J 345 
AC4 1 GLN I  36  ? PRO I  40  ? GLN M 452 PRO M 456 
AC4 2 GLU I  14  ? VAL I  18  ? GLU M 430 VAL M 434 
AC4 3 ILE I  87  ? ILE I  89  ? ILE M 503 ILE M 505 
AC4 4 VAL I  121 ? ILE I  123 ? VAL M 537 ILE M 539 
AC4 5 LEU I  154 ? LYS I  157 ? LEU M 604 LYS M 607 
AC4 6 GLU J  10  ? ASN J  12  ? GLU L 11  ASN L 13  
AC5 1 LYS J  64  ? LYS J  65  ? LYS L 65  LYS L 66  
AC5 2 GLU J  124 ? MET J  127 ? GLU L 125 MET L 128 
AC5 3 VAL J  103 ? GLN J  106 ? VAL L 104 GLN L 107 
AC6 1 PHE J  145 ? ASP J  147 ? PHE L 146 ASP L 148 
AC6 2 ARG J  154 ? PRO J  156 ? ARG L 155 PRO L 157 
AC7 1 ALA J  171 ? ILE J  174 ? ALA L 172 ILE L 175 
AC7 2 ALA J  179 ? ILE J  182 ? ALA L 180 ILE L 183 
AC8 1 GLN J  327 ? ASN J  333 ? GLN L 328 ASN L 334 
AC8 2 ARG J  237 ? ARG J  243 ? ARG L 238 ARG L 244 
AC8 3 LEU J  222 ? LEU J  224 ? LEU L 223 LEU L 225 
AC8 4 GLU J  486 ? GLN J  488 ? GLU L 487 GLN L 489 
AC9 1 ARG J  245 ? GLY J  252 ? ARG L 246 GLY L 253 
AC9 2 ARG J  255 ? GLU J  262 ? ARG L 256 GLU L 263 
AC9 3 VAL J  303 ? VAL J  307 ? VAL L 304 VAL L 308 
AC9 4 ILE J  288 ? ASP J  293 ? ILE L 289 ASP L 294 
AD1 1 ILE J  335 ? VAL J  338 ? ILE L 336 VAL L 339 
AD1 2 ARG J  341 ? LEU J  344 ? ARG L 342 LEU L 345 
AD2 1 GLN M  37  ? PRO M  41  ? GLN S 452 PRO S 456 
AD2 2 GLU M  15  ? VAL M  19  ? GLU S 430 VAL S 434 
AD2 3 ILE M  88  ? ILE M  90  ? ILE S 503 ILE S 505 
AD2 4 VAL M  122 ? ILE M  124 ? VAL S 537 ILE S 539 
AD2 5 LEU M  152 ? LYS M  155 ? LEU S 604 LYS S 607 
AD2 6 GLU N  10  ? ASN N  12  ? GLU R 11  ASN R 13  
AD3 1 LYS N  64  ? LYS N  65  ? LYS R 65  LYS R 66  
AD3 2 GLU N  124 ? MET N  127 ? GLU R 125 MET R 128 
AD3 3 VAL N  103 ? GLN N  106 ? VAL R 104 GLN R 107 
AD4 1 PHE N  145 ? ASP N  147 ? PHE R 146 ASP R 148 
AD4 2 ARG N  154 ? PRO N  156 ? ARG R 155 PRO R 157 
AD5 1 ALA N  171 ? ILE N  174 ? ALA R 172 ILE R 175 
AD5 2 ALA N  179 ? ILE N  182 ? ALA R 180 ILE R 183 
AD6 1 GLN N  327 ? ASN N  333 ? GLN R 328 ASN R 334 
AD6 2 ARG N  237 ? ARG N  243 ? ARG R 238 ARG R 244 
AD6 3 LEU N  222 ? LEU N  224 ? LEU R 223 LEU R 225 
AD6 4 GLU N  486 ? GLN N  488 ? GLU R 487 GLN R 489 
AD7 1 ARG N  245 ? GLY N  252 ? ARG R 246 GLY R 253 
AD7 2 ARG N  255 ? GLU N  262 ? ARG R 256 GLU R 263 
AD7 3 VAL N  303 ? VAL N  307 ? VAL R 304 VAL R 308 
AD7 4 ILE N  288 ? ASP N  293 ? ILE R 289 ASP R 294 
AD8 1 ILE N  335 ? VAL N  338 ? ILE R 336 VAL R 339 
AD8 2 ARG N  341 ? LEU N  344 ? ARG R 342 LEU R 345 
AD9 1 GLN O  36  ? PRO O  40  ? GLN U 452 PRO U 456 
AD9 2 GLU O  14  ? VAL O  18  ? GLU U 430 VAL U 434 
AD9 3 ILE O  87  ? ILE O  89  ? ILE U 503 ILE U 505 
AD9 4 VAL O  121 ? ILE O  123 ? VAL U 537 ILE U 539 
AD9 5 LEU O  154 ? LYS O  157 ? LEU U 604 LYS U 607 
AD9 6 GLU P  10  ? ASN P  12  ? GLU T 11  ASN T 13  
AE1 1 LYS P  64  ? LYS P  65  ? LYS T 65  LYS T 66  
AE1 2 GLU P  124 ? MET P  127 ? GLU T 125 MET T 128 
AE1 3 VAL P  103 ? GLN P  106 ? VAL T 104 GLN T 107 
AE2 1 PHE P  145 ? ASP P  147 ? PHE T 146 ASP T 148 
AE2 2 ARG P  154 ? PRO P  156 ? ARG T 155 PRO T 157 
AE3 1 ALA P  171 ? ILE P  174 ? ALA T 172 ILE T 175 
AE3 2 ALA P  179 ? ILE P  182 ? ALA T 180 ILE T 183 
AE4 1 GLN P  327 ? ASN P  333 ? GLN T 328 ASN T 334 
AE4 2 ARG P  237 ? ARG P  243 ? ARG T 238 ARG T 244 
AE4 3 LEU P  222 ? LEU P  224 ? LEU T 223 LEU T 225 
AE4 4 GLU P  486 ? GLN P  488 ? GLU T 487 GLN T 489 
AE5 1 ARG P  245 ? GLY P  252 ? ARG T 246 GLY T 253 
AE5 2 ARG P  255 ? GLU P  262 ? ARG T 256 GLU T 263 
AE5 3 VAL P  303 ? VAL P  307 ? VAL T 304 VAL T 308 
AE5 4 ILE P  288 ? ASP P  293 ? ILE T 289 ASP T 294 
AE6 1 ILE P  335 ? VAL P  338 ? ILE T 336 VAL T 339 
AE6 2 ARG P  341 ? LEU P  344 ? ARG T 342 LEU T 345 
AE7 1 GLN S  37  ? PRO S  41  ? GLN b 452 PRO b 456 
AE7 2 GLU S  15  ? VAL S  19  ? GLU b 430 VAL b 434 
AE7 3 ILE S  88  ? ILE S  90  ? ILE b 503 ILE b 505 
AE7 4 VAL S  122 ? ILE S  124 ? VAL b 537 ILE b 539 
AE7 5 LEU S  152 ? LYS S  155 ? LEU b 604 LYS b 607 
AE7 6 ARG T  11  ? ASN T  12  ? ARG a 12  ASN a 13  
AE8 1 LYS T  64  ? LYS T  65  ? LYS a 65  LYS a 66  
AE8 2 GLU T  124 ? MET T  127 ? GLU a 125 MET a 128 
AE8 3 VAL T  103 ? GLN T  106 ? VAL a 104 GLN a 107 
AE9 1 PHE T  145 ? ASP T  147 ? PHE a 146 ASP a 148 
AE9 2 ARG T  154 ? PRO T  156 ? ARG a 155 PRO a 157 
AF1 1 ALA T  171 ? ILE T  174 ? ALA a 172 ILE a 175 
AF1 2 ALA T  179 ? ILE T  182 ? ALA a 180 ILE a 183 
AF2 1 GLN T  327 ? ASN T  333 ? GLN a 328 ASN a 334 
AF2 2 ARG T  237 ? ARG T  243 ? ARG a 238 ARG a 244 
AF2 3 LEU T  222 ? LEU T  224 ? LEU a 223 LEU a 225 
AF2 4 GLU T  486 ? GLN T  488 ? GLU a 487 GLN a 489 
AF3 1 ARG T  245 ? GLY T  252 ? ARG a 246 GLY a 253 
AF3 2 ARG T  255 ? GLU T  262 ? ARG a 256 GLU a 263 
AF3 3 VAL T  303 ? VAL T  307 ? VAL a 304 VAL a 308 
AF3 4 ILE T  288 ? ASP T  293 ? ILE a 289 ASP a 294 
AF4 1 ILE T  335 ? VAL T  338 ? ILE a 336 VAL a 339 
AF4 2 ARG T  341 ? LEU T  344 ? ARG a 342 LEU a 345 
AF5 1 GLN U  36  ? PRO U  40  ? GLN d 452 PRO d 456 
AF5 2 GLU U  14  ? VAL U  18  ? GLU d 430 VAL d 434 
AF5 3 ILE U  87  ? ILE U  89  ? ILE d 503 ILE d 505 
AF5 4 VAL U  121 ? ILE U  123 ? VAL d 537 ILE d 539 
AF5 5 LEU U  148 ? LYS U  151 ? LEU d 604 LYS d 607 
AF5 6 GLU V  10  ? ASN V  12  ? GLU c 11  ASN c 13  
AF6 1 LYS V  64  ? LYS V  65  ? LYS c 65  LYS c 66  
AF6 2 GLU V  124 ? MET V  127 ? GLU c 125 MET c 128 
AF6 3 VAL V  103 ? GLN V  106 ? VAL c 104 GLN c 107 
AF7 1 PHE V  145 ? ASP V  147 ? PHE c 146 ASP c 148 
AF7 2 ARG V  154 ? PRO V  156 ? ARG c 155 PRO c 157 
AF8 1 ALA V  171 ? ILE V  174 ? ALA c 172 ILE c 175 
AF8 2 ALA V  179 ? ILE V  182 ? ALA c 180 ILE c 183 
AF9 1 GLN V  327 ? ASN V  333 ? GLN c 328 ASN c 334 
AF9 2 ARG V  237 ? ARG V  243 ? ARG c 238 ARG c 244 
AF9 3 LEU V  222 ? LEU V  224 ? LEU c 223 LEU c 225 
AF9 4 GLU V  486 ? GLN V  488 ? GLU c 487 GLN c 489 
AG1 1 ARG V  245 ? GLY V  252 ? ARG c 246 GLY c 253 
AG1 2 ARG V  255 ? GLU V  262 ? ARG c 256 GLU c 263 
AG1 3 VAL V  303 ? VAL V  307 ? VAL c 304 VAL c 308 
AG1 4 ILE V  288 ? ASP V  293 ? ILE c 289 ASP c 294 
AG2 1 ILE V  335 ? VAL V  338 ? ILE c 336 VAL c 339 
AG2 2 ARG V  341 ? LEU V  344 ? ARG c 342 LEU c 345 
AG3 1 GLN Y  37  ? PRO Y  41  ? GLN k 452 PRO k 456 
AG3 2 GLU Y  15  ? VAL Y  19  ? GLU k 430 VAL k 434 
AG3 3 ILE Y  88  ? ILE Y  90  ? ILE k 503 ILE k 505 
AG3 4 VAL Y  122 ? ILE Y  124 ? VAL k 537 ILE k 539 
AG3 5 LEU Y  152 ? LYS Y  155 ? LEU k 604 LYS k 607 
AG3 6 ARG Z  11  ? ASN Z  12  ? ARG j 12  ASN j 13  
AG4 1 LYS Z  64  ? LYS Z  65  ? LYS j 65  LYS j 66  
AG4 2 GLU Z  124 ? MET Z  127 ? GLU j 125 MET j 128 
AG4 3 VAL Z  103 ? GLN Z  106 ? VAL j 104 GLN j 107 
AG5 1 PHE Z  145 ? ASP Z  147 ? PHE j 146 ASP j 148 
AG5 2 ARG Z  154 ? PRO Z  156 ? ARG j 155 PRO j 157 
AG6 1 ALA Z  171 ? ILE Z  174 ? ALA j 172 ILE j 175 
AG6 2 ALA Z  179 ? ILE Z  182 ? ALA j 180 ILE j 183 
AG7 1 GLN Z  327 ? ASN Z  333 ? GLN j 328 ASN j 334 
AG7 2 ARG Z  237 ? ARG Z  243 ? ARG j 238 ARG j 244 
AG7 3 LEU Z  222 ? LEU Z  224 ? LEU j 223 LEU j 225 
AG7 4 GLU Z  486 ? GLN Z  488 ? GLU j 487 GLN j 489 
AG8 1 ARG Z  245 ? GLU Z  250 ? ARG j 246 GLU j 251 
AG8 2 GLN Z  256 ? GLU Z  262 ? GLN j 257 GLU j 263 
AG8 3 VAL Z  303 ? VAL Z  307 ? VAL j 304 VAL j 308 
AG8 4 ILE Z  288 ? ASP Z  293 ? ILE j 289 ASP j 294 
AG9 1 ILE Z  335 ? VAL Z  338 ? ILE j 336 VAL j 339 
AG9 2 ARG Z  341 ? LEU Z  344 ? ARG j 342 LEU j 345 
AH1 1 GLN AA 36  ? PRO AA 40  ? GLN m 452 PRO m 456 
AH1 2 GLU AA 14  ? VAL AA 18  ? GLU m 430 VAL m 434 
AH1 3 ILE AA 87  ? ILE AA 89  ? ILE m 503 ILE m 505 
AH1 4 VAL AA 121 ? ILE AA 123 ? VAL m 537 ILE m 539 
AH1 5 LEU AA 154 ? LYS AA 157 ? LEU m 604 LYS m 607 
AH1 6 GLU BA 10  ? ASN BA 12  ? GLU l 11  ASN l 13  
AH2 1 LYS BA 64  ? LYS BA 65  ? LYS l 65  LYS l 66  
AH2 2 GLU BA 124 ? MET BA 127 ? GLU l 125 MET l 128 
AH2 3 VAL BA 103 ? GLN BA 106 ? VAL l 104 GLN l 107 
AH3 1 PHE BA 145 ? ASP BA 147 ? PHE l 146 ASP l 148 
AH3 2 ARG BA 154 ? PRO BA 156 ? ARG l 155 PRO l 157 
AH4 1 ALA BA 171 ? ILE BA 174 ? ALA l 172 ILE l 175 
AH4 2 ALA BA 179 ? ILE BA 182 ? ALA l 180 ILE l 183 
AH5 1 GLN BA 327 ? ASN BA 333 ? GLN l 328 ASN l 334 
AH5 2 ARG BA 237 ? ARG BA 243 ? ARG l 238 ARG l 244 
AH5 3 LEU BA 222 ? LEU BA 224 ? LEU l 223 LEU l 225 
AH5 4 GLU BA 486 ? GLN BA 488 ? GLU l 487 GLN l 489 
AH6 1 ARG BA 245 ? GLY BA 252 ? ARG l 246 GLY l 253 
AH6 2 ARG BA 255 ? GLU BA 262 ? ARG l 256 GLU l 263 
AH6 3 VAL BA 303 ? VAL BA 307 ? VAL l 304 VAL l 308 
AH6 4 ILE BA 288 ? ASP BA 293 ? ILE l 289 ASP l 294 
AH7 1 ILE BA 335 ? VAL BA 338 ? ILE l 336 VAL l 339 
AH7 2 ARG BA 341 ? LEU BA 344 ? ARG l 342 LEU l 345 
AH8 1 GLN EA 37  ? PRO EA 41  ? GLN s 452 PRO s 456 
AH8 2 GLU EA 15  ? VAL EA 19  ? GLU s 430 VAL s 434 
AH8 3 ILE EA 88  ? ILE EA 90  ? ILE s 503 ILE s 505 
AH8 4 VAL EA 122 ? ILE EA 124 ? VAL s 537 ILE s 539 
AH8 5 LEU EA 152 ? LYS EA 155 ? LEU s 604 LYS s 607 
AH8 6 ARG FA 11  ? ASN FA 12  ? ARG r 12  ASN r 13  
AH9 1 LYS FA 64  ? LYS FA 65  ? LYS r 65  LYS r 66  
AH9 2 GLU FA 124 ? MET FA 127 ? GLU r 125 MET r 128 
AH9 3 VAL FA 103 ? GLN FA 106 ? VAL r 104 GLN r 107 
AI1 1 PHE FA 145 ? ASP FA 147 ? PHE r 146 ASP r 148 
AI1 2 ARG FA 154 ? PRO FA 156 ? ARG r 155 PRO r 157 
AI2 1 ALA FA 171 ? ILE FA 174 ? ALA r 172 ILE r 175 
AI2 2 ALA FA 179 ? ILE FA 182 ? ALA r 180 ILE r 183 
AI3 1 GLN FA 327 ? ASN FA 333 ? GLN r 328 ASN r 334 
AI3 2 ARG FA 237 ? ARG FA 243 ? ARG r 238 ARG r 244 
AI3 3 LEU FA 222 ? LEU FA 224 ? LEU r 223 LEU r 225 
AI3 4 GLU FA 486 ? GLN FA 488 ? GLU r 487 GLN r 489 
AI4 1 ARG FA 245 ? GLY FA 252 ? ARG r 246 GLY r 253 
AI4 2 ARG FA 255 ? GLU FA 262 ? ARG r 256 GLU r 263 
AI4 3 VAL FA 303 ? VAL FA 307 ? VAL r 304 VAL r 308 
AI4 4 ILE FA 288 ? ASP FA 293 ? ILE r 289 ASP r 294 
AI5 1 ILE FA 335 ? VAL FA 338 ? ILE r 336 VAL r 339 
AI5 2 ARG FA 341 ? LEU FA 344 ? ARG r 342 LEU r 345 
AI6 1 GLN GA 36  ? PRO GA 40  ? GLN u 452 PRO u 456 
AI6 2 GLU GA 14  ? VAL GA 18  ? GLU u 430 VAL u 434 
AI6 3 ILE GA 87  ? ILE GA 89  ? ILE u 503 ILE u 505 
AI6 4 VAL GA 121 ? ILE GA 123 ? VAL u 537 ILE u 539 
AI6 5 LEU GA 154 ? LYS GA 157 ? LEU u 604 LYS u 607 
AI6 6 ARG HA 11  ? ASN HA 12  ? ARG t 12  ASN t 13  
AI7 1 LYS HA 64  ? LYS HA 65  ? LYS t 65  LYS t 66  
AI7 2 GLU HA 124 ? MET HA 127 ? GLU t 125 MET t 128 
AI7 3 VAL HA 103 ? GLN HA 106 ? VAL t 104 GLN t 107 
AI8 1 PHE HA 145 ? ASP HA 147 ? PHE t 146 ASP t 148 
AI8 2 ARG HA 154 ? PRO HA 156 ? ARG t 155 PRO t 157 
AI9 1 ALA HA 171 ? ILE HA 174 ? ALA t 172 ILE t 175 
AI9 2 ALA HA 179 ? ILE HA 182 ? ALA t 180 ILE t 183 
AJ1 1 GLN HA 327 ? ASN HA 333 ? GLN t 328 ASN t 334 
AJ1 2 ARG HA 237 ? ARG HA 243 ? ARG t 238 ARG t 244 
AJ1 3 LEU HA 222 ? LEU HA 224 ? LEU t 223 LEU t 225 
AJ1 4 GLU HA 486 ? GLN HA 488 ? GLU t 487 GLN t 489 
AJ2 1 ARG HA 245 ? GLU HA 250 ? ARG t 246 GLU t 251 
AJ2 2 GLN HA 256 ? GLU HA 262 ? GLN t 257 GLU t 263 
AJ2 3 VAL HA 303 ? VAL HA 307 ? VAL t 304 VAL t 308 
AJ2 4 ILE HA 288 ? ASP HA 293 ? ILE t 289 ASP t 294 
AJ3 1 ILE HA 335 ? VAL HA 338 ? ILE t 336 VAL t 339 
AJ3 2 ARG HA 341 ? LEU HA 344 ? ARG t 342 LEU t 345 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ALA A  38  ? O ALA B 453 N GLU A  15  ? N GLU B 430 
AA1 2 3 N ILE A  16  ? N ILE B 431 O VAL A  89  ? O VAL B 504 
AA1 3 4 N ILE A  88  ? N ILE B 503 O TYR A  123 ? O TYR B 538 
AA1 4 5 N VAL A  122 ? N VAL B 537 O VAL A  154 ? O VAL B 606 
AA1 5 6 N LYS A  155 ? N LYS B 607 O ARG B  11  ? O ARG A 12  
AA2 1 2 N LYS B  64  ? N LYS A 65  O ALA B  125 ? O ALA A 126 
AA2 2 3 O ARG B  126 ? O ARG A 127 N ASP B  104 ? N ASP A 105 
AA3 1 2 N ILE B  146 ? N ILE A 147 O GLU B  155 ? O GLU A 156 
AA4 1 2 N ALA B  171 ? N ALA A 172 O ILE B  182 ? O ILE A 183 
AA5 1 2 O PHE B  330 ? O PHE A 331 N ILE B  240 ? N ILE A 241 
AA5 2 3 O ARG B  243 ? O ARG A 244 N LEU B  222 ? N LEU A 223 
AA5 3 4 N ILE B  223 ? N ILE A 224 O GLU B  486 ? O GLU A 487 
AA6 1 2 N VAL B  247 ? N VAL A 248 O VAL B  259 ? O VAL A 260 
AA6 2 3 N ILE B  258 ? N ILE A 259 O ILE B  305 ? O ILE A 306 
AA6 3 4 O VAL B  304 ? O VAL A 305 N ARG B  292 ? N ARG A 293 
AA7 1 2 N VAL B  338 ? N VAL A 339 O ARG B  341 ? O ARG A 342 
AA8 1 2 O ALA C  37  ? O ALA D 453 N GLU C  14  ? N GLU D 430 
AA8 2 3 N ILE C  15  ? N ILE D 431 O VAL C  88  ? O VAL D 504 
AA8 3 4 N ILE C  87  ? N ILE D 503 O TYR C  122 ? O TYR D 538 
AA8 4 5 N VAL C  121 ? N VAL D 537 O VAL C  156 ? O VAL D 606 
AA8 5 6 N GLN C  155 ? N GLN D 605 O ARG D  11  ? O ARG C 12  
AA9 1 2 N LYS D  64  ? N LYS C 65  O ALA D  125 ? O ALA C 126 
AA9 2 3 O ARG D  126 ? O ARG C 127 N ASP D  104 ? N ASP C 105 
AB1 1 2 N ILE D  146 ? N ILE C 147 O GLU D  155 ? O GLU C 156 
AB2 1 2 N ALA D  171 ? N ALA C 172 O ILE D  182 ? O ILE C 183 
AB3 1 2 O PHE D  330 ? O PHE C 331 N ILE D  240 ? N ILE C 241 
AB3 2 3 O ARG D  243 ? O ARG C 244 N LEU D  222 ? N LEU C 223 
AB3 3 4 N ILE D  223 ? N ILE C 224 O GLU D  486 ? O GLU C 487 
AB4 1 2 N VAL D  247 ? N VAL C 248 O VAL D  259 ? O VAL C 260 
AB4 2 3 N ILE D  258 ? N ILE C 259 O ILE D  305 ? O ILE C 306 
AB4 3 4 O VAL D  304 ? O VAL C 305 N ARG D  292 ? N ARG C 293 
AB5 1 2 N VAL D  338 ? N VAL C 339 O ARG D  341 ? O ARG C 342 
AB6 1 2 O ALA G  38  ? O ALA K 453 N GLU G  15  ? N GLU K 430 
AB6 2 3 N ILE G  16  ? N ILE K 431 O VAL G  89  ? O VAL K 504 
AB6 3 4 N ILE G  88  ? N ILE K 503 O TYR G  123 ? O TYR K 538 
AB6 4 5 N VAL G  122 ? N VAL K 537 O VAL G  154 ? O VAL K 606 
AB6 5 6 N GLN G  153 ? N GLN K 605 O ARG H  2   ? O ARG J 12  
AB7 1 2 N LYS H  55  ? N LYS J 65  O ALA H  116 ? O ALA J 126 
AB7 2 3 O ARG H  117 ? O ARG J 127 N ASP H  95  ? N ASP J 105 
AB8 1 2 N ILE H  137 ? N ILE J 147 O GLU H  146 ? O GLU J 156 
AB9 1 2 N ALA H  162 ? N ALA J 172 O ILE H  173 ? O ILE J 183 
AC1 1 2 O PHE H  320 ? O PHE J 331 N ILE H  231 ? N ILE J 241 
AC1 2 3 O ARG H  234 ? O ARG J 244 N LEU H  213 ? N LEU J 223 
AC1 3 4 N ILE H  214 ? N ILE J 224 O GLU H  476 ? O GLU J 487 
AC2 1 2 N VAL H  238 ? N VAL J 248 O VAL H  249 ? O VAL J 260 
AC2 2 3 N ILE H  248 ? N ILE J 259 O ILE H  295 ? O ILE J 306 
AC2 3 4 O VAL H  294 ? O VAL J 305 N ARG H  282 ? N ARG J 293 
AC3 1 2 N VAL H  328 ? N VAL J 339 O ARG H  331 ? O ARG J 342 
AC4 1 2 O ALA I  37  ? O ALA M 453 N GLU I  14  ? N GLU M 430 
AC4 2 3 N ILE I  15  ? N ILE M 431 O VAL I  88  ? O VAL M 504 
AC4 3 4 N ILE I  87  ? N ILE M 503 O TYR I  122 ? O TYR M 538 
AC4 4 5 N VAL I  121 ? N VAL M 537 O VAL I  156 ? O VAL M 606 
AC4 5 6 N GLN I  155 ? N GLN M 605 O ARG J  11  ? O ARG L 12  
AC5 1 2 N LYS J  64  ? N LYS L 65  O ALA J  125 ? O ALA L 126 
AC5 2 3 O ARG J  126 ? O ARG L 127 N ASP J  104 ? N ASP L 105 
AC6 1 2 N ILE J  146 ? N ILE L 147 O GLU J  155 ? O GLU L 156 
AC7 1 2 N ALA J  171 ? N ALA L 172 O ILE J  182 ? O ILE L 183 
AC8 1 2 O PHE J  330 ? O PHE L 331 N ILE J  240 ? N ILE L 241 
AC8 2 3 O ARG J  243 ? O ARG L 244 N LEU J  222 ? N LEU L 223 
AC8 3 4 N ILE J  223 ? N ILE L 224 O GLN J  488 ? O GLN L 489 
AC9 1 2 N VAL J  247 ? N VAL L 248 O VAL J  259 ? O VAL L 260 
AC9 2 3 N VAL J  260 ? N VAL L 261 O VAL J  303 ? O VAL L 304 
AC9 3 4 O VAL J  304 ? O VAL L 305 N ARG J  292 ? N ARG L 293 
AD1 1 2 N VAL J  338 ? N VAL L 339 O ARG J  341 ? O ARG L 342 
AD2 1 2 O ALA M  38  ? O ALA S 453 N GLU M  15  ? N GLU S 430 
AD2 2 3 N ILE M  16  ? N ILE S 431 O VAL M  89  ? O VAL S 504 
AD2 3 4 N ILE M  88  ? N ILE S 503 O TYR M  123 ? O TYR S 538 
AD2 4 5 N VAL M  122 ? N VAL S 537 O VAL M  154 ? O VAL S 606 
AD2 5 6 N LYS M  155 ? N LYS S 607 O ARG N  11  ? O ARG R 12  
AD3 1 2 N LYS N  64  ? N LYS R 65  O ALA N  125 ? O ALA R 126 
AD3 2 3 O ARG N  126 ? O ARG R 127 N ASP N  104 ? N ASP R 105 
AD4 1 2 N ILE N  146 ? N ILE R 147 O GLU N  155 ? O GLU R 156 
AD5 1 2 N ALA N  171 ? N ALA R 172 O ILE N  182 ? O ILE R 183 
AD6 1 2 O PHE N  330 ? O PHE R 331 N ILE N  240 ? N ILE R 241 
AD6 2 3 O ARG N  243 ? O ARG R 244 N LEU N  222 ? N LEU R 223 
AD6 3 4 N ILE N  223 ? N ILE R 224 O GLN N  488 ? O GLN R 489 
AD7 1 2 N VAL N  247 ? N VAL R 248 O VAL N  259 ? O VAL R 260 
AD7 2 3 N ILE N  258 ? N ILE R 259 O ILE N  305 ? O ILE R 306 
AD7 3 4 O VAL N  304 ? O VAL R 305 N ARG N  292 ? N ARG R 293 
AD8 1 2 N VAL N  338 ? N VAL R 339 O ARG N  341 ? O ARG R 342 
AD9 1 2 O ALA O  37  ? O ALA U 453 N GLU O  14  ? N GLU U 430 
AD9 2 3 N ILE O  15  ? N ILE U 431 O VAL O  88  ? O VAL U 504 
AD9 3 4 N ILE O  87  ? N ILE U 503 O TYR O  122 ? O TYR U 538 
AD9 4 5 N VAL O  121 ? N VAL U 537 O VAL O  156 ? O VAL U 606 
AD9 5 6 N LYS O  157 ? N LYS U 607 O ARG P  11  ? O ARG T 12  
AE1 1 2 N LYS P  64  ? N LYS T 65  O ALA P  125 ? O ALA T 126 
AE1 2 3 O ARG P  126 ? O ARG T 127 N ASP P  104 ? N ASP T 105 
AE2 1 2 N ILE P  146 ? N ILE T 147 O GLU P  155 ? O GLU T 156 
AE3 1 2 N ALA P  171 ? N ALA T 172 O ILE P  182 ? O ILE T 183 
AE4 1 2 O PHE P  330 ? O PHE T 331 N ILE P  240 ? N ILE T 241 
AE4 2 3 O ARG P  243 ? O ARG T 244 N LEU P  222 ? N LEU T 223 
AE4 3 4 N ILE P  223 ? N ILE T 224 O GLU P  486 ? O GLU T 487 
AE5 1 2 N VAL P  247 ? N VAL T 248 O VAL P  259 ? O VAL T 260 
AE5 2 3 N ILE P  258 ? N ILE T 259 O ILE P  305 ? O ILE T 306 
AE5 3 4 O VAL P  304 ? O VAL T 305 N ARG P  292 ? N ARG T 293 
AE6 1 2 N VAL P  338 ? N VAL T 339 O ARG P  341 ? O ARG T 342 
AE7 1 2 O ALA S  38  ? O ALA b 453 N GLU S  15  ? N GLU b 430 
AE7 2 3 N ILE S  16  ? N ILE b 431 O VAL S  89  ? O VAL b 504 
AE7 3 4 N ILE S  88  ? N ILE b 503 O TYR S  123 ? O TYR b 538 
AE7 4 5 N VAL S  122 ? N VAL b 537 O VAL S  154 ? O VAL b 606 
AE7 5 6 N LYS S  155 ? N LYS b 607 O ARG T  11  ? O ARG a 12  
AE8 1 2 N LYS T  64  ? N LYS a 65  O ALA T  125 ? O ALA a 126 
AE8 2 3 O ARG T  126 ? O ARG a 127 N ASP T  104 ? N ASP a 105 
AE9 1 2 N ILE T  146 ? N ILE a 147 O GLU T  155 ? O GLU a 156 
AF1 1 2 N ALA T  171 ? N ALA a 172 O ILE T  182 ? O ILE a 183 
AF2 1 2 O PHE T  330 ? O PHE a 331 N ILE T  240 ? N ILE a 241 
AF2 2 3 O ARG T  243 ? O ARG a 244 N LEU T  222 ? N LEU a 223 
AF2 3 4 N ILE T  223 ? N ILE a 224 O GLU T  486 ? O GLU a 487 
AF3 1 2 N VAL T  247 ? N VAL a 248 O VAL T  259 ? O VAL a 260 
AF3 2 3 N ILE T  258 ? N ILE a 259 O ILE T  305 ? O ILE a 306 
AF3 3 4 O VAL T  304 ? O VAL a 305 N ARG T  292 ? N ARG a 293 
AF4 1 2 N VAL T  338 ? N VAL a 339 O ARG T  341 ? O ARG a 342 
AF5 1 2 O ALA U  37  ? O ALA d 453 N GLU U  14  ? N GLU d 430 
AF5 2 3 N ILE U  15  ? N ILE d 431 O VAL U  88  ? O VAL d 504 
AF5 3 4 N ILE U  87  ? N ILE d 503 O TYR U  122 ? O TYR d 538 
AF5 4 5 N VAL U  121 ? N VAL d 537 O VAL U  150 ? O VAL d 606 
AF5 5 6 N LYS U  151 ? N LYS d 607 O ARG V  11  ? O ARG c 12  
AF6 1 2 N LYS V  64  ? N LYS c 65  O ALA V  125 ? O ALA c 126 
AF6 2 3 O ARG V  126 ? O ARG c 127 N ASP V  104 ? N ASP c 105 
AF7 1 2 N ILE V  146 ? N ILE c 147 O GLU V  155 ? O GLU c 156 
AF8 1 2 N ALA V  171 ? N ALA c 172 O ILE V  182 ? O ILE c 183 
AF9 1 2 O PHE V  330 ? O PHE c 331 N ILE V  240 ? N ILE c 241 
AF9 2 3 O ARG V  243 ? O ARG c 244 N LEU V  222 ? N LEU c 223 
AF9 3 4 N ILE V  223 ? N ILE c 224 O GLN V  488 ? O GLN c 489 
AG1 1 2 N VAL V  247 ? N VAL c 248 O VAL V  259 ? O VAL c 260 
AG1 2 3 N VAL V  260 ? N VAL c 261 O VAL V  303 ? O VAL c 304 
AG1 3 4 O VAL V  304 ? O VAL c 305 N ARG V  292 ? N ARG c 293 
AG2 1 2 N VAL V  338 ? N VAL c 339 O ARG V  341 ? O ARG c 342 
AG3 1 2 O ALA Y  38  ? O ALA k 453 N GLU Y  15  ? N GLU k 430 
AG3 2 3 N ILE Y  16  ? N ILE k 431 O VAL Y  89  ? O VAL k 504 
AG3 3 4 N ILE Y  88  ? N ILE k 503 O TYR Y  123 ? O TYR k 538 
AG3 4 5 N VAL Y  122 ? N VAL k 537 O VAL Y  154 ? O VAL k 606 
AG3 5 6 N GLN Y  153 ? N GLN k 605 O ARG Z  11  ? O ARG j 12  
AG4 1 2 N LYS Z  64  ? N LYS j 65  O ALA Z  125 ? O ALA j 126 
AG4 2 3 O ARG Z  126 ? O ARG j 127 N ASP Z  104 ? N ASP j 105 
AG5 1 2 N ILE Z  146 ? N ILE j 147 O GLU Z  155 ? O GLU j 156 
AG6 1 2 N ALA Z  171 ? N ALA j 172 O ILE Z  182 ? O ILE j 183 
AG7 1 2 O PHE Z  330 ? O PHE j 331 N ILE Z  240 ? N ILE j 241 
AG7 2 3 O ARG Z  243 ? O ARG j 244 N LEU Z  222 ? N LEU j 223 
AG7 3 4 N ILE Z  223 ? N ILE j 224 O GLU Z  486 ? O GLU j 487 
AG8 1 2 N VAL Z  247 ? N VAL j 248 O VAL Z  259 ? O VAL j 260 
AG8 2 3 N ILE Z  258 ? N ILE j 259 O ILE Z  305 ? O ILE j 306 
AG8 3 4 O VAL Z  304 ? O VAL j 305 N ARG Z  292 ? N ARG j 293 
AG9 1 2 N VAL Z  338 ? N VAL j 339 O ARG Z  341 ? O ARG j 342 
AH1 1 2 O ALA AA 37  ? O ALA m 453 N GLU AA 14  ? N GLU m 430 
AH1 2 3 N ILE AA 15  ? N ILE m 431 O VAL AA 88  ? O VAL m 504 
AH1 3 4 N ILE AA 87  ? N ILE m 503 O TYR AA 122 ? O TYR m 538 
AH1 4 5 N VAL AA 121 ? N VAL m 537 O VAL AA 156 ? O VAL m 606 
AH1 5 6 N LYS AA 157 ? N LYS m 607 O ARG BA 11  ? O ARG l 12  
AH2 1 2 N LYS BA 64  ? N LYS l 65  O ALA BA 125 ? O ALA l 126 
AH2 2 3 O ARG BA 126 ? O ARG l 127 N ASP BA 104 ? N ASP l 105 
AH3 1 2 N ILE BA 146 ? N ILE l 147 O GLU BA 155 ? O GLU l 156 
AH4 1 2 N ALA BA 171 ? N ALA l 172 O ILE BA 182 ? O ILE l 183 
AH5 1 2 O PHE BA 330 ? O PHE l 331 N ILE BA 240 ? N ILE l 241 
AH5 2 3 O ARG BA 243 ? O ARG l 244 N LEU BA 222 ? N LEU l 223 
AH5 3 4 N ILE BA 223 ? N ILE l 224 O GLN BA 488 ? O GLN l 489 
AH6 1 2 N VAL BA 247 ? N VAL l 248 O VAL BA 259 ? O VAL l 260 
AH6 2 3 N ILE BA 258 ? N ILE l 259 O ILE BA 305 ? O ILE l 306 
AH6 3 4 O VAL BA 304 ? O VAL l 305 N ARG BA 292 ? N ARG l 293 
AH7 1 2 N VAL BA 338 ? N VAL l 339 O ARG BA 341 ? O ARG l 342 
AH8 1 2 O ALA EA 38  ? O ALA s 453 N GLU EA 15  ? N GLU s 430 
AH8 2 3 N ILE EA 16  ? N ILE s 431 O VAL EA 89  ? O VAL s 504 
AH8 3 4 N ILE EA 88  ? N ILE s 503 O TYR EA 123 ? O TYR s 538 
AH8 4 5 N VAL EA 122 ? N VAL s 537 O VAL EA 154 ? O VAL s 606 
AH8 5 6 N GLN EA 153 ? N GLN s 605 O ARG FA 11  ? O ARG r 12  
AH9 1 2 N LYS FA 64  ? N LYS r 65  O ALA FA 125 ? O ALA r 126 
AH9 2 3 O ARG FA 126 ? O ARG r 127 N ASP FA 104 ? N ASP r 105 
AI1 1 2 N ILE FA 146 ? N ILE r 147 O GLU FA 155 ? O GLU r 156 
AI2 1 2 N ALA FA 171 ? N ALA r 172 O ILE FA 182 ? O ILE r 183 
AI3 1 2 O PHE FA 330 ? O PHE r 331 N ILE FA 240 ? N ILE r 241 
AI3 2 3 O ARG FA 243 ? O ARG r 244 N LEU FA 222 ? N LEU r 223 
AI3 3 4 N ILE FA 223 ? N ILE r 224 O GLU FA 486 ? O GLU r 487 
AI4 1 2 N VAL FA 247 ? N VAL r 248 O VAL FA 259 ? O VAL r 260 
AI4 2 3 N ILE FA 258 ? N ILE r 259 O ILE FA 305 ? O ILE r 306 
AI4 3 4 O VAL FA 304 ? O VAL r 305 N ARG FA 292 ? N ARG r 293 
AI5 1 2 N VAL FA 338 ? N VAL r 339 O ARG FA 341 ? O ARG r 342 
AI6 1 2 O ALA GA 37  ? O ALA u 453 N GLU GA 14  ? N GLU u 430 
AI6 2 3 N ILE GA 15  ? N ILE u 431 O VAL GA 88  ? O VAL u 504 
AI6 3 4 N ILE GA 87  ? N ILE u 503 O TYR GA 122 ? O TYR u 538 
AI6 4 5 N VAL GA 121 ? N VAL u 537 O VAL GA 156 ? O VAL u 606 
AI6 5 6 N GLN GA 155 ? N GLN u 605 O ARG HA 11  ? O ARG t 12  
AI7 1 2 N LYS HA 64  ? N LYS t 65  O ALA HA 125 ? O ALA t 126 
AI7 2 3 O ARG HA 126 ? O ARG t 127 N ASP HA 104 ? N ASP t 105 
AI8 1 2 N ILE HA 146 ? N ILE t 147 O GLU HA 155 ? O GLU t 156 
AI9 1 2 N ALA HA 171 ? N ALA t 172 O ILE HA 182 ? O ILE t 183 
AJ1 1 2 O PHE HA 330 ? O PHE t 331 N ILE HA 240 ? N ILE t 241 
AJ1 2 3 O ARG HA 243 ? O ARG t 244 N LEU HA 222 ? N LEU t 223 
AJ1 3 4 N ILE HA 223 ? N ILE t 224 O GLN HA 488 ? O GLN t 489 
AJ2 1 2 N VAL HA 247 ? N VAL t 248 O VAL HA 259 ? O VAL t 260 
AJ2 2 3 N ILE HA 258 ? N ILE t 259 O ILE HA 305 ? O ILE t 306 
AJ2 3 4 O VAL HA 304 ? O VAL t 305 N ARG HA 292 ? N ARG t 293 
AJ3 1 2 N VAL HA 338 ? N VAL t 339 O ARG HA 341 ? O ARG t 342 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A JK8 501  ? 9  'binding site for residue JK8 A 501'                     
AC2 Software C JK8 501  ? 10 'binding site for residue JK8 C 501'                     
AC3 Software J JK8 501  ? 9  'binding site for residue JK8 J 501'                     
AC4 Software L JK8 501  ? 8  'binding site for residue JK8 L 501'                     
AC5 Software R JK8 501  ? 8  'binding site for residue JK8 R 501'                     
AC6 Software U JK8 701  ? 7  'binding site for residue JK8 U 701'                     
AC7 Software b JK8 701  ? 7  'binding site for residue JK8 b 701'                     
AC8 Software d JK8 701  ? 6  'binding site for residue JK8 d 701'                     
AC9 Software k JK8 701  ? 7  'binding site for residue JK8 k 701'                     
AD1 Software l JK8 501  ? 11 'binding site for residue JK8 l 501'                     
AD2 Software s JK8 701  ? 5  'binding site for residue JK8 s 701'                     
AD3 Software t JK8 501  ? 9  'binding site for residue JK8 t 501'                     
AD4 Software n DG  2009 ? 12 'binding site for Di-nucleotide DG n 2009 and TYR l 123' 
AD5 Software v DG  2009 ? 10 'binding site for Di-nucleotide DG v 2009 and TYR t 123' 
AD6 Software w DG  2009 ? 11 'binding site for Di-nucleotide DG w 2009 and TYR r 123' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  MET B  26  ? MET A 27   . ? 1_555 ? 
2   AC1 9  VAL B  30  ? VAL A 31   . ? 1_555 ? 
3   AC1 9  MET B  178 ? MET A 179  . ? 1_555 ? 
4   AC1 9  ARG B  341 ? ARG A 342  . ? 1_555 ? 
5   AC1 9  PRO B  342 ? PRO A 343  . ? 1_555 ? 
6   AC1 9  LEU B  344 ? LEU A 345  . ? 1_555 ? 
7   AC1 9  ARG A  178 ? ARG B 630  . ? 1_555 ? 
8   AC1 9  ILE A  181 ? ILE B 633  . ? 1_555 ? 
9   AC1 9  ALA A  185 ? ALA B 637  . ? 1_555 ? 
10  AC2 10 MET D  26  ? MET C 27   . ? 1_555 ? 
11  AC2 10 MET D  178 ? MET C 179  . ? 1_555 ? 
12  AC2 10 ILE D  335 ? ILE C 336  . ? 1_555 ? 
13  AC2 10 ARG D  341 ? ARG C 342  . ? 1_555 ? 
14  AC2 10 LEU D  344 ? LEU C 345  . ? 1_555 ? 
15  AC2 10 ARG C  180 ? ARG D 630  . ? 1_555 ? 
16  AC2 10 ILE C  183 ? ILE D 633  . ? 1_555 ? 
17  AC2 10 GLU C  184 ? GLU D 634  . ? 1_555 ? 
18  AC2 10 ALA C  187 ? ALA D 637  . ? 1_555 ? 
19  AC2 10 VAL C  188 ? VAL D 638  . ? 1_555 ? 
20  AC3 9  MET H  17  ? MET J 27   . ? 1_555 ? 
21  AC3 9  VAL H  21  ? VAL J 31   . ? 1_555 ? 
22  AC3 9  MET H  169 ? MET J 179  . ? 1_555 ? 
23  AC3 9  ARG H  331 ? ARG J 342  . ? 1_555 ? 
24  AC3 9  PRO H  332 ? PRO J 343  . ? 1_555 ? 
25  AC3 9  LYS H  333 ? LYS J 344  . ? 1_555 ? 
26  AC3 9  LEU H  334 ? LEU J 345  . ? 1_555 ? 
27  AC3 9  GLU G  182 ? GLU K 634  . ? 1_555 ? 
28  AC3 9  GLU BA 234 ? GLU l 235  . ? 1_555 ? 
29  AC4 8  MET J  26  ? MET L 27   . ? 1_555 ? 
30  AC4 8  MET J  178 ? MET L 179  . ? 1_555 ? 
31  AC4 8  ARG J  341 ? ARG L 342  . ? 1_555 ? 
32  AC4 8  PRO J  342 ? PRO L 343  . ? 1_555 ? 
33  AC4 8  LEU J  344 ? LEU L 345  . ? 1_555 ? 
34  AC4 8  ARG I  180 ? ARG M 630  . ? 1_555 ? 
35  AC4 8  GLU I  184 ? GLU M 634  . ? 1_555 ? 
36  AC4 8  ALA I  187 ? ALA M 637  . ? 1_555 ? 
37  AC5 8  MET N  26  ? MET R 27   . ? 1_555 ? 
38  AC5 8  MET N  178 ? MET R 179  . ? 1_555 ? 
39  AC5 8  ARG N  341 ? ARG R 342  . ? 1_555 ? 
40  AC5 8  PRO N  342 ? PRO R 343  . ? 1_555 ? 
41  AC5 8  ARG M  178 ? ARG S 630  . ? 1_555 ? 
42  AC5 8  ILE M  181 ? ILE S 633  . ? 1_555 ? 
43  AC5 8  GLU M  182 ? GLU S 634  . ? 1_555 ? 
44  AC5 8  ALA M  185 ? ALA S 637  . ? 1_555 ? 
45  AC6 7  MET P  178 ? MET T 179  . ? 1_555 ? 
46  AC6 7  ILE P  335 ? ILE T 336  . ? 1_555 ? 
47  AC6 7  ARG P  341 ? ARG T 342  . ? 1_555 ? 
48  AC6 7  PRO P  342 ? PRO T 343  . ? 1_555 ? 
49  AC6 7  ARG O  180 ? ARG U 630  . ? 1_555 ? 
50  AC6 7  GLU O  184 ? GLU U 634  . ? 1_555 ? 
51  AC6 7  ALA O  187 ? ALA U 637  . ? 1_555 ? 
52  AC7 7  MET T  26  ? MET a 27   . ? 1_555 ? 
53  AC7 7  MET T  178 ? MET a 179  . ? 1_555 ? 
54  AC7 7  PRO T  342 ? PRO a 343  . ? 1_555 ? 
55  AC7 7  LEU T  344 ? LEU a 345  . ? 1_555 ? 
56  AC7 7  ARG S  178 ? ARG b 630  . ? 1_555 ? 
57  AC7 7  GLU S  182 ? GLU b 634  . ? 1_555 ? 
58  AC7 7  ALA S  185 ? ALA b 637  . ? 1_555 ? 
59  AC8 6  MET V  26  ? MET c 27   . ? 1_555 ? 
60  AC8 6  MET V  178 ? MET c 179  . ? 1_555 ? 
61  AC8 6  LEU V  344 ? LEU c 345  . ? 1_555 ? 
62  AC8 6  ARG U  174 ? ARG d 630  . ? 1_555 ? 
63  AC8 6  GLU U  178 ? GLU d 634  . ? 1_555 ? 
64  AC8 6  ALA U  181 ? ALA d 637  . ? 1_555 ? 
65  AC9 7  MET Z  26  ? MET j 27   . ? 1_555 ? 
66  AC9 7  VAL Z  30  ? VAL j 31   . ? 1_555 ? 
67  AC9 7  MET Z  178 ? MET j 179  . ? 1_555 ? 
68  AC9 7  PRO Z  342 ? PRO j 343  . ? 1_555 ? 
69  AC9 7  LEU Z  344 ? LEU j 345  . ? 1_555 ? 
70  AC9 7  ARG Y  178 ? ARG k 630  . ? 1_555 ? 
71  AC9 7  GLU Y  182 ? GLU k 634  . ? 1_555 ? 
72  AD1 11 GLU H  225 ? GLU J 235  . ? 1_555 ? 
73  AD1 11 MET BA 178 ? MET l 179  . ? 1_555 ? 
74  AD1 11 ILE BA 335 ? ILE l 336  . ? 1_555 ? 
75  AD1 11 ARG BA 341 ? ARG l 342  . ? 1_555 ? 
76  AD1 11 PRO BA 342 ? PRO l 343  . ? 1_555 ? 
77  AD1 11 LYS BA 343 ? LYS l 344  . ? 1_555 ? 
78  AD1 11 LEU BA 344 ? LEU l 345  . ? 1_555 ? 
79  AD1 11 ARG AA 180 ? ARG m 630  . ? 1_555 ? 
80  AD1 11 ILE AA 183 ? ILE m 633  . ? 1_555 ? 
81  AD1 11 GLU AA 184 ? GLU m 634  . ? 1_555 ? 
82  AD1 11 ALA AA 187 ? ALA m 637  . ? 1_555 ? 
83  AD2 5  MET FA 178 ? MET r 179  . ? 1_555 ? 
84  AD2 5  ARG EA 178 ? ARG s 630  . ? 1_555 ? 
85  AD2 5  ILE EA 181 ? ILE s 633  . ? 1_555 ? 
86  AD2 5  GLU EA 182 ? GLU s 634  . ? 1_555 ? 
87  AD2 5  ALA EA 185 ? ALA s 637  . ? 1_555 ? 
88  AD3 9  MET HA 26  ? MET t 27   . ? 1_555 ? 
89  AD3 9  MET HA 178 ? MET t 179  . ? 1_555 ? 
90  AD3 9  ILE HA 335 ? ILE t 336  . ? 1_555 ? 
91  AD3 9  ARG HA 341 ? ARG t 342  . ? 1_555 ? 
92  AD3 9  PRO HA 342 ? PRO t 343  . ? 1_555 ? 
93  AD3 9  ARG GA 180 ? ARG u 630  . ? 1_555 ? 
94  AD3 9  ILE GA 183 ? ILE u 633  . ? 1_555 ? 
95  AD3 9  GLU GA 184 ? GLU u 634  . ? 1_555 ? 
96  AD3 9  ALA GA 187 ? ALA u 637  . ? 1_555 ? 
97  AD4 12 GLY Y  21  ? GLY k 436  . ? 1_555 ? 
98  AD4 12 SER Y  23  ? SER k 438  . ? 1_555 ? 
99  AD4 12 GLY Y  44  ? GLY k 459  . ? 1_555 ? 
100 AD4 12 GLU Y  133 ? GLU k 585  . ? 1_555 ? 
101 AD4 12 ALA BA 119 ? ALA l 120  . ? 1_555 ? 
102 AD4 12 MET BA 120 ? MET l 121  . ? 1_555 ? 
103 AD4 12 ARG BA 121 ? ARG l 122  . ? 1_555 ? 
104 AD4 12 THR BA 123 ? THR l 124  . ? 1_555 ? 
105 AD4 12 DC  CA 8   ? DC  n 8    . ? 1_555 ? 
106 AD4 12 DG  CA 10  ? DG  n 2010 . ? 1_555 ? 
107 AD4 12 DC  DA 12  ? DC  o 2012 . ? 1_555 ? 
108 AD4 12 DG  DA 13  ? DG  o 2013 . ? 1_555 ? 
109 AD5 10 SER EA 23  ? SER s 438  . ? 1_555 ? 
110 AD5 10 GLU EA 133 ? GLU s 585  . ? 1_555 ? 
111 AD5 10 ALA HA 119 ? ALA t 120  . ? 1_555 ? 
112 AD5 10 MET HA 120 ? MET t 121  . ? 1_555 ? 
113 AD5 10 ARG HA 121 ? ARG t 122  . ? 1_555 ? 
114 AD5 10 THR HA 123 ? THR t 124  . ? 1_555 ? 
115 AD5 10 DC  IA 8   ? DC  v 8    . ? 1_555 ? 
116 AD5 10 DG  IA 10  ? DG  v 2010 . ? 1_555 ? 
117 AD5 10 DC  JA 12  ? DC  w 2012 . ? 1_555 ? 
118 AD5 10 DG  JA 13  ? DG  w 2013 . ? 1_555 ? 
119 AD6 11 ALA FA 119 ? ALA r 120  . ? 1_555 ? 
120 AD6 11 MET FA 120 ? MET r 121  . ? 1_555 ? 
121 AD6 11 ARG FA 121 ? ARG r 122  . ? 1_555 ? 
122 AD6 11 THR FA 123 ? THR r 124  . ? 1_555 ? 
123 AD6 11 GLU GA 19  ? GLU u 435  . ? 1_555 ? 
124 AD6 11 SER GA 22  ? SER u 438  . ? 1_555 ? 
125 AD6 11 GLU GA 135 ? GLU u 585  . ? 1_555 ? 
126 AD6 11 DC  IA 12  ? DC  v 2012 . ? 1_555 ? 
127 AD6 11 DG  IA 13  ? DG  v 2013 . ? 1_555 ? 
128 AD6 11 DC  JA 8   ? DC  w 8    . ? 1_555 ? 
129 AD6 11 DG  JA 10  ? DG  w 2010 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6QX2 
_atom_sites.fract_transf_matrix[1][1]   0.005329 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003104 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002438 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012319 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A  1  2   ? 28.759   -40.637 67.313   1.00 54.38  ? 417  LYS B N     1 
ATOM   2     C  CA    . LYS A  1  2   ? 27.322   -40.891 67.007   1.00 58.16  ? 417  LYS B CA    1 
ATOM   3     C  C     . LYS A  1  2   ? 27.050   -42.414 66.896   1.00 65.61  ? 417  LYS B C     1 
ATOM   4     O  O     . LYS A  1  2   ? 25.943   -42.780 66.438   1.00 69.78  ? 417  LYS B O     1 
ATOM   5     C  CB    . LYS A  1  2   ? 26.964   -40.054 65.760   1.00 52.57  ? 417  LYS B CB    1 
ATOM   6     N  N     . LEU A  1  3   ? 27.999   -43.277 67.305   1.00 69.91  ? 418  LEU B N     1 
ATOM   7     C  CA    . LEU A  1  3   ? 27.935   -44.759 67.179   1.00 76.50  ? 418  LEU B CA    1 
ATOM   8     C  C     . LEU A  1  3   ? 27.060   -45.319 68.313   1.00 83.80  ? 418  LEU B C     1 
ATOM   9     O  O     . LEU A  1  3   ? 27.313   -44.972 69.486   1.00 91.77  ? 418  LEU B O     1 
ATOM   10    C  CB    . LEU A  1  3   ? 29.370   -45.307 67.248   1.00 74.71  ? 418  LEU B CB    1 
ATOM   11    C  CG    . LEU A  1  3   ? 29.617   -46.817 67.058   1.00 68.09  ? 418  LEU B CG    1 
ATOM   12    C  CD1   . LEU A  1  3   ? 29.091   -47.347 65.741   1.00 63.85  ? 418  LEU B CD1   1 
ATOM   13    C  CD2   . LEU A  1  3   ? 31.086   -47.142 67.209   1.00 64.09  ? 418  LEU B CD2   1 
ATOM   14    N  N     . ALA A  1  4   ? 26.057   -46.133 67.976   1.00 87.60  ? 419  ALA B N     1 
ATOM   15    C  CA    . ALA A  1  4   ? 25.275   -46.929 68.951   1.00 93.21  ? 419  ALA B CA    1 
ATOM   16    C  C     . ALA A  1  4   ? 25.729   -48.383 68.837   1.00 91.33  ? 419  ALA B C     1 
ATOM   17    O  O     . ALA A  1  4   ? 25.163   -49.114 67.998   1.00 86.29  ? 419  ALA B O     1 
ATOM   18    C  CB    . ALA A  1  4   ? 23.800   -46.774 68.684   1.00 100.59 ? 419  ALA B CB    1 
ATOM   19    N  N     A ASP A  1  5   ? 26.723   -48.778 69.636   0.50 91.34  ? 420  ASP B N     1 
ATOM   20    N  N     B ASP A  1  5   ? 26.724   -48.777 69.637   0.50 92.05  ? 420  ASP B N     1 
ATOM   21    C  CA    A ASP A  1  5   ? 27.392   -50.106 69.536   0.50 91.83  ? 420  ASP B CA    1 
ATOM   22    C  CA    B ASP A  1  5   ? 27.393   -50.104 69.536   0.50 93.01  ? 420  ASP B CA    1 
ATOM   23    C  C     A ASP A  1  5   ? 26.468   -51.189 70.112   0.50 86.40  ? 420  ASP B C     1 
ATOM   24    C  C     B ASP A  1  5   ? 26.467   -51.184 70.117   0.50 87.48  ? 420  ASP B C     1 
ATOM   25    O  O     A ASP A  1  5   ? 25.553   -50.832 70.888   0.50 83.40  ? 420  ASP B O     1 
ATOM   26    O  O     B ASP A  1  5   ? 25.553   -50.831 70.889   0.50 84.38  ? 420  ASP B O     1 
ATOM   27    C  CB    A ASP A  1  5   ? 28.765   -50.099 70.217   0.50 95.11  ? 420  ASP B CB    1 
ATOM   28    C  CB    B ASP A  1  5   ? 28.773   -50.101 70.207   0.50 96.90  ? 420  ASP B CB    1 
ATOM   29    C  CG    A ASP A  1  5   ? 29.768   -51.053 69.587   0.50 92.36  ? 420  ASP B CG    1 
ATOM   30    C  CG    B ASP A  1  5   ? 29.775   -51.068 69.585   0.50 94.57  ? 420  ASP B CG    1 
ATOM   31    O  OD1   A ASP A  1  5   ? 29.335   -52.071 68.986   0.50 87.91  ? 420  ASP B OD1   1 
ATOM   32    O  OD1   B ASP A  1  5   ? 29.334   -52.073 68.984   0.50 90.25  ? 420  ASP B OD1   1 
ATOM   33    O  OD2   A ASP A  1  5   ? 30.979   -50.739 69.673   0.50 84.52  ? 420  ASP B OD2   1 
ATOM   34    O  OD2   B ASP A  1  5   ? 30.996   -50.796 69.686   0.50 88.01  ? 420  ASP B OD2   1 
ATOM   35    N  N     A CYS A  1  6   ? 26.696   -52.454 69.721   0.60 83.73  ? 421  CYS B N     1 
ATOM   36    N  N     B CYS A  1  6   ? 26.691   -52.447 69.728   0.40 84.63  ? 421  CYS B N     1 
ATOM   37    C  CA    A CYS A  1  6   ? 25.983   -53.658 70.231   0.60 79.16  ? 421  CYS B CA    1 
ATOM   38    C  CA    B CYS A  1  6   ? 25.985   -53.658 70.237   0.40 80.78  ? 421  CYS B CA    1 
ATOM   39    C  C     A CYS A  1  6   ? 26.700   -54.177 71.483   0.60 72.62  ? 421  CYS B C     1 
ATOM   40    C  C     B CYS A  1  6   ? 26.697   -54.182 71.491   0.40 75.26  ? 421  CYS B C     1 
ATOM   41    O  O     A CYS A  1  6   ? 27.883   -53.827 71.665   0.60 75.02  ? 421  CYS B O     1 
ATOM   42    O  O     B CYS A  1  6   ? 27.879   -53.834 71.677   0.40 76.70  ? 421  CYS B O     1 
ATOM   43    C  CB    A CYS A  1  6   ? 25.898   -54.748 69.169   0.60 79.21  ? 421  CYS B CB    1 
ATOM   44    C  CB    B CYS A  1  6   ? 25.898   -54.748 69.170   0.40 81.10  ? 421  CYS B CB    1 
ATOM   45    S  SG    A CYS A  1  6   ? 27.504   -55.270 68.504   0.60 76.14  ? 421  CYS B SG    1 
ATOM   46    S  SG    B CYS A  1  6   ? 27.503   -55.275 68.509   0.40 79.61  ? 421  CYS B SG    1 
ATOM   47    N  N     A SER A  1  7   ? 26.002   -54.980 72.304   0.50 70.55  ? 422  SER B N     1 
ATOM   48    N  N     B SER A  1  7   ? 25.997   -54.983 72.308   0.50 72.11  ? 422  SER B N     1 
ATOM   49    C  CA    A SER A  1  7   ? 26.466   -55.525 73.611   0.50 75.72  ? 422  SER B CA    1 
ATOM   50    C  CA    B SER A  1  7   ? 26.465   -55.527 73.613   0.50 76.94  ? 422  SER B CA    1 
ATOM   51    C  C     A SER A  1  7   ? 27.574   -56.567 73.406   0.50 78.18  ? 422  SER B C     1 
ATOM   52    C  C     B SER A  1  7   ? 27.574   -56.567 73.407   0.50 78.92  ? 422  SER B C     1 
ATOM   53    O  O     A SER A  1  7   ? 28.604   -56.471 74.108   0.50 78.09  ? 422  SER B O     1 
ATOM   54    O  O     B SER A  1  7   ? 28.604   -56.471 74.108   0.50 78.78  ? 422  SER B O     1 
ATOM   55    C  CB    A SER A  1  7   ? 25.319   -56.105 74.398   0.50 77.45  ? 422  SER B CB    1 
ATOM   56    C  CB    B SER A  1  7   ? 25.318   -56.106 74.398   0.50 78.70  ? 422  SER B CB    1 
ATOM   57    O  OG    A SER A  1  7   ? 24.786   -57.250 73.754   0.50 82.48  ? 422  SER B OG    1 
ATOM   58    O  OG    B SER A  1  7   ? 24.786   -57.251 73.754   0.50 83.81  ? 422  SER B OG    1 
ATOM   59    N  N     . SER A  1  8   ? 27.358   -57.530 72.502   1.00 82.11  ? 423  SER B N     1 
ATOM   60    C  CA    . SER A  1  8   ? 28.324   -58.610 72.161   1.00 86.03  ? 423  SER B CA    1 
ATOM   61    C  C     . SER A  1  8   ? 29.663   -57.998 71.736   1.00 93.97  ? 423  SER B C     1 
ATOM   62    O  O     . SER A  1  8   ? 29.646   -57.016 70.960   1.00 103.32 ? 423  SER B O     1 
ATOM   63    C  CB    . SER A  1  8   ? 27.790   -59.509 71.068   1.00 85.10  ? 423  SER B CB    1 
ATOM   64    O  OG    . SER A  1  8   ? 28.801   -60.379 70.573   1.00 72.99  ? 423  SER B OG    1 
ATOM   65    N  N     . LYS A  1  9   ? 30.771   -58.559 72.235   1.00 92.93  ? 424  LYS B N     1 
ATOM   66    C  CA    . LYS A  1  9   ? 32.153   -58.190 71.831   1.00 88.37  ? 424  LYS B CA    1 
ATOM   67    C  C     . LYS A  1  9   ? 32.765   -59.354 71.029   1.00 83.99  ? 424  LYS B C     1 
ATOM   68    O  O     . LYS A  1  9   ? 34.003   -59.425 70.975   1.00 72.05  ? 424  LYS B O     1 
ATOM   69    C  CB    . LYS A  1  9   ? 32.963   -57.795 73.072   1.00 80.46  ? 424  LYS B CB    1 
ATOM   70    N  N     . SER A  1  10  ? 31.931   -60.202 70.399   1.00 84.32  ? 425  SER B N     1 
ATOM   71    C  CA    . SER A  1  10  ? 32.345   -61.307 69.487   1.00 87.90  ? 425  SER B CA    1 
ATOM   72    C  C     . SER A  1  10  ? 32.147   -60.898 68.026   1.00 98.21  ? 425  SER B C     1 
ATOM   73    O  O     . SER A  1  10  ? 31.089   -61.164 67.447   1.00 112.54 ? 425  SER B O     1 
ATOM   74    C  CB    . SER A  1  10  ? 31.589   -62.581 69.783   1.00 81.96  ? 425  SER B CB    1 
ATOM   75    O  OG    . SER A  1  10  ? 31.552   -62.848 71.172   1.00 89.96  ? 425  SER B OG    1 
ATOM   76    N  N     . PRO A  1  11  ? 33.155   -60.268 67.369   1.00 94.77  ? 426  PRO B N     1 
ATOM   77    C  CA    . PRO A  1  11  ? 33.025   -59.809 65.981   1.00 93.80  ? 426  PRO B CA    1 
ATOM   78    C  C     . PRO A  1  11  ? 32.363   -60.765 64.970   1.00 102.23 ? 426  PRO B C     1 
ATOM   79    O  O     . PRO A  1  11  ? 31.700   -60.288 64.061   1.00 97.10  ? 426  PRO B O     1 
ATOM   80    C  CB    . PRO A  1  11  ? 34.492   -59.568 65.572   1.00 84.71  ? 426  PRO B CB    1 
ATOM   81    C  CG    . PRO A  1  11  ? 35.172   -59.145 66.858   1.00 77.44  ? 426  PRO B CG    1 
ATOM   82    C  CD    . PRO A  1  11  ? 34.471   -59.934 67.940   1.00 84.27  ? 426  PRO B CD    1 
ATOM   83    N  N     . GLU A  1  12  ? 32.544   -62.083 65.140   1.00 112.75 ? 427  GLU B N     1 
ATOM   84    C  CA    . GLU A  1  12  ? 32.068   -63.117 64.178   1.00 110.20 ? 427  GLU B CA    1 
ATOM   85    C  C     . GLU A  1  12  ? 30.540   -63.060 64.039   1.00 105.15 ? 427  GLU B C     1 
ATOM   86    O  O     . GLU A  1  12  ? 30.051   -63.471 62.978   1.00 90.75  ? 427  GLU B O     1 
ATOM   87    C  CB    . GLU A  1  12  ? 32.555   -64.505 64.596   1.00 120.01 ? 427  GLU B CB    1 
ATOM   88    C  CG    . GLU A  1  12  ? 31.787   -65.136 65.746   1.00 135.58 ? 427  GLU B CG    1 
ATOM   89    C  CD    . GLU A  1  12  ? 30.770   -66.190 65.320   1.00 147.65 ? 427  GLU B CD    1 
ATOM   90    O  OE1   . GLU A  1  12  ? 29.632   -66.164 65.823   1.00 139.28 ? 427  GLU B OE1   1 
ATOM   91    O  OE2   . GLU A  1  12  ? 31.115   -67.016 64.458   1.00 166.60 ? 427  GLU B OE2   1 
ATOM   92    N  N     . GLU A  1  13  ? 29.825   -62.595 65.073   1.00 118.22 ? 428  GLU B N     1 
ATOM   93    C  CA    . GLU A  1  13  ? 28.330   -62.566 65.126   1.00 120.75 ? 428  GLU B CA    1 
ATOM   94    C  C     . GLU A  1  13  ? 27.789   -61.127 65.209   1.00 111.11 ? 428  GLU B C     1 
ATOM   95    O  O     . GLU A  1  13  ? 26.551   -60.966 65.290   1.00 101.16 ? 428  GLU B O     1 
ATOM   96    C  CB    . GLU A  1  13  ? 27.810   -63.384 66.316   1.00 123.13 ? 428  GLU B CB    1 
ATOM   97    C  CG    . GLU A  1  13  ? 28.139   -62.791 67.685   1.00 123.59 ? 428  GLU B CG    1 
ATOM   98    C  CD    . GLU A  1  13  ? 27.343   -63.341 68.860   1.00 117.76 ? 428  GLU B CD    1 
ATOM   99    O  OE1   . GLU A  1  13  ? 26.533   -64.268 68.650   1.00 116.46 ? 428  GLU B OE1   1 
ATOM   100   O  OE2   . GLU A  1  13  ? 27.559   -62.874 69.992   1.00 106.70 ? 428  GLU B OE2   1 
ATOM   101   N  N     A CYS A  1  14  ? 28.673   -60.125 65.191   0.60 105.38 ? 429  CYS B N     1 
ATOM   102   N  N     B CYS A  1  14  ? 28.673   -60.125 65.190   0.40 105.54 ? 429  CYS B N     1 
ATOM   103   C  CA    A CYS A  1  14  ? 28.311   -58.685 65.244   0.60 103.68 ? 429  CYS B CA    1 
ATOM   104   C  CA    B CYS A  1  14  ? 28.311   -58.684 65.244   0.40 103.25 ? 429  CYS B CA    1 
ATOM   105   C  C     A CYS A  1  14  ? 28.217   -58.121 63.822   0.60 98.87  ? 429  CYS B C     1 
ATOM   106   C  C     B CYS A  1  14  ? 28.217   -58.121 63.822   0.40 98.54  ? 429  CYS B C     1 
ATOM   107   O  O     A CYS A  1  14  ? 28.919   -58.644 62.923   0.60 86.95  ? 429  CYS B O     1 
ATOM   108   O  O     B CYS A  1  14  ? 28.919   -58.643 62.925   0.40 90.86  ? 429  CYS B O     1 
ATOM   109   C  CB    A CYS A  1  14  ? 29.320   -57.885 66.058   0.60 103.14 ? 429  CYS B CB    1 
ATOM   110   C  CB    B CYS A  1  14  ? 29.319   -57.885 66.059   0.40 103.06 ? 429  CYS B CB    1 
ATOM   111   S  SG    A CYS A  1  14  ? 29.213   -58.209 67.837   0.60 98.31  ? 429  CYS B SG    1 
ATOM   112   S  SG    B CYS A  1  14  ? 29.211   -58.207 67.838   0.40 100.15 ? 429  CYS B SG    1 
ATOM   113   N  N     . GLU A  1  15  ? 27.369   -57.102 63.641   1.00 93.65  ? 430  GLU B N     1 
ATOM   114   C  CA    . GLU A  1  15  ? 27.191   -56.368 62.360   1.00 83.15  ? 430  GLU B CA    1 
ATOM   115   C  C     . GLU A  1  15  ? 26.951   -54.883 62.666   1.00 69.26  ? 430  GLU B C     1 
ATOM   116   O  O     . GLU A  1  15  ? 26.274   -54.591 63.675   1.00 72.01  ? 430  GLU B O     1 
ATOM   117   C  CB    . GLU A  1  15  ? 26.063   -56.982 61.523   1.00 85.80  ? 430  GLU B CB    1 
ATOM   118   C  CG    . GLU A  1  15  ? 24.893   -57.550 62.316   1.00 88.38  ? 430  GLU B CG    1 
ATOM   119   C  CD    . GLU A  1  15  ? 23.983   -58.468 61.507   1.00 85.57  ? 430  GLU B CD    1 
ATOM   120   O  OE1   . GLU A  1  15  ? 24.507   -59.336 60.771   1.00 87.06  ? 430  GLU B OE1   1 
ATOM   121   O  OE2   . GLU A  1  15  ? 22.750   -58.330 61.619   1.00 93.54  ? 430  GLU B OE2   1 
ATOM   122   N  N     . ILE A  1  16  ? 27.516   -53.996 61.835   1.00 63.20  ? 431  ILE B N     1 
ATOM   123   C  CA    . ILE A  1  16  ? 27.364   -52.509 61.927   1.00 65.08  ? 431  ILE B CA    1 
ATOM   124   C  C     . ILE A  1  16  ? 26.590   -52.011 60.697   1.00 64.87  ? 431  ILE B C     1 
ATOM   125   O  O     . ILE A  1  16  ? 26.928   -52.425 59.567   1.00 64.42  ? 431  ILE B O     1 
ATOM   126   C  CB    . ILE A  1  16  ? 28.728   -51.793 62.089   1.00 61.52  ? 431  ILE B CB    1 
ATOM   127   C  CG1   . ILE A  1  16  ? 28.538   -50.293 62.346   1.00 54.72  ? 431  ILE B CG1   1 
ATOM   128   C  CG2   . ILE A  1  16  ? 29.654   -52.049 60.907   1.00 60.88  ? 431  ILE B CG2   1 
ATOM   129   C  CD1   . ILE A  1  16  ? 29.759   -49.593 62.896   1.00 53.33  ? 431  ILE B CD1   1 
ATOM   130   N  N     . PHE A  1  17  ? 25.582   -51.166 60.925   1.00 60.94  ? 432  PHE B N     1 
ATOM   131   C  CA    . PHE A  1  17  ? 24.729   -50.549 59.879   1.00 63.25  ? 432  PHE B CA    1 
ATOM   132   C  C     . PHE A  1  17  ? 25.127   -49.078 59.719   1.00 66.42  ? 432  PHE B C     1 
ATOM   133   O  O     . PHE A  1  17  ? 25.088   -48.320 60.714   1.00 68.32  ? 432  PHE B O     1 
ATOM   134   C  CB    . PHE A  1  17  ? 23.250   -50.723 60.234   1.00 65.89  ? 432  PHE B CB    1 
ATOM   135   C  CG    . PHE A  1  17  ? 22.752   -52.146 60.153   1.00 68.33  ? 432  PHE B CG    1 
ATOM   136   C  CD1   . PHE A  1  17  ? 22.991   -53.046 61.180   1.00 65.40  ? 432  PHE B CD1   1 
ATOM   137   C  CD2   . PHE A  1  17  ? 22.051   -52.590 59.042   1.00 76.51  ? 432  PHE B CD2   1 
ATOM   138   C  CE1   . PHE A  1  17  ? 22.542   -54.356 61.099   1.00 64.23  ? 432  PHE B CE1   1 
ATOM   139   C  CE2   . PHE A  1  17  ? 21.606   -53.903 58.960   1.00 77.58  ? 432  PHE B CE2   1 
ATOM   140   C  CZ    . PHE A  1  17  ? 21.852   -54.785 59.989   1.00 71.62  ? 432  PHE B CZ    1 
ATOM   141   N  N     . LEU A  1  18  ? 25.531   -48.700 58.501   1.00 74.53  ? 433  LEU B N     1 
ATOM   142   C  CA    . LEU A  1  18  ? 25.847   -47.303 58.093   1.00 82.47  ? 433  LEU B CA    1 
ATOM   143   C  C     . LEU A  1  18  ? 24.600   -46.684 57.445   1.00 85.99  ? 433  LEU B C     1 
ATOM   144   O  O     . LEU A  1  18  ? 24.125   -47.236 56.428   1.00 79.56  ? 433  LEU B O     1 
ATOM   145   C  CB    . LEU A  1  18  ? 27.027   -47.331 57.117   1.00 89.00  ? 433  LEU B CB    1 
ATOM   146   C  CG    . LEU A  1  18  ? 28.265   -48.084 57.606   1.00 94.58  ? 433  LEU B CG    1 
ATOM   147   C  CD1   . LEU A  1  18  ? 29.266   -48.272 56.480   1.00 98.15  ? 433  LEU B CD1   1 
ATOM   148   C  CD2   . LEU A  1  18  ? 28.906   -47.370 58.789   1.00 89.97  ? 433  LEU B CD2   1 
ATOM   149   N  N     . VAL A  1  19  ? 24.100   -45.577 58.006   1.00 96.89  ? 434  VAL B N     1 
ATOM   150   C  CA    . VAL A  1  19  ? 22.817   -44.920 57.599   1.00 108.06 ? 434  VAL B CA    1 
ATOM   151   C  C     . VAL A  1  19  ? 23.093   -43.427 57.350   1.00 123.86 ? 434  VAL B C     1 
ATOM   152   O  O     . VAL A  1  19  ? 24.118   -42.933 57.859   1.00 124.58 ? 434  VAL B O     1 
ATOM   153   C  CB    . VAL A  1  19  ? 21.724   -45.166 58.661   1.00 111.21 ? 434  VAL B CB    1 
ATOM   154   C  CG1   . VAL A  1  19  ? 21.273   -46.622 58.666   1.00 114.19 ? 434  VAL B CG1   1 
ATOM   155   C  CG2   . VAL A  1  19  ? 22.159   -44.749 60.061   1.00 104.40 ? 434  VAL B CG2   1 
ATOM   156   N  N     . GLU A  1  20  ? 22.219   -42.748 56.594   1.00 144.48 ? 435  GLU B N     1 
ATOM   157   C  CA    . GLU A  1  20  ? 22.488   -41.422 55.952   1.00 146.84 ? 435  GLU B CA    1 
ATOM   158   C  C     . GLU A  1  20  ? 22.484   -40.293 56.987   1.00 133.00 ? 435  GLU B C     1 
ATOM   159   O  O     . GLU A  1  20  ? 23.237   -39.330 56.774   1.00 128.27 ? 435  GLU B O     1 
ATOM   160   C  CB    . GLU A  1  20  ? 21.499   -41.066 54.835   1.00 151.69 ? 435  GLU B CB    1 
ATOM   161   C  CG    . GLU A  1  20  ? 20.103   -41.661 54.954   1.00 156.25 ? 435  GLU B CG    1 
ATOM   162   C  CD    . GLU A  1  20  ? 19.989   -43.172 54.814   1.00 161.47 ? 435  GLU B CD    1 
ATOM   163   O  OE1   . GLU A  1  20  ? 18.858   -43.666 54.884   1.00 184.91 ? 435  GLU B OE1   1 
ATOM   164   O  OE2   . GLU A  1  20  ? 21.029   -43.859 54.685   1.00 154.82 ? 435  GLU B OE2   1 
ATOM   165   N  N     . GLY A  1  21  ? 21.649   -40.377 58.022   1.00 115.10 ? 436  GLY B N     1 
ATOM   166   C  CA    . GLY A  1  21  ? 21.583   -39.347 59.079   1.00 107.14 ? 436  GLY B CA    1 
ATOM   167   C  C     . GLY A  1  21  ? 20.838   -39.826 60.309   1.00 109.02 ? 436  GLY B C     1 
ATOM   168   O  O     . GLY A  1  21  ? 20.497   -41.018 60.367   1.00 135.56 ? 436  GLY B O     1 
ATOM   169   N  N     . ASP A  1  22  ? 20.616   -38.910 61.261   1.00 96.84  ? 437  ASP B N     1 
ATOM   170   C  CA    . ASP A  1  22  ? 19.899   -39.160 62.542   1.00 93.99  ? 437  ASP B CA    1 
ATOM   171   C  C     . ASP A  1  22  ? 18.435   -39.521 62.262   1.00 90.50  ? 437  ASP B C     1 
ATOM   172   O  O     . ASP A  1  22  ? 17.855   -40.253 63.074   1.00 93.01  ? 437  ASP B O     1 
ATOM   173   C  CB    . ASP A  1  22  ? 20.048   -37.972 63.495   1.00 90.88  ? 437  ASP B CB    1 
ATOM   174   C  CG    . ASP A  1  22  ? 21.500   -37.649 63.830   1.00 91.62  ? 437  ASP B CG    1 
ATOM   175   O  OD1   . ASP A  1  22  ? 22.386   -38.509 63.565   1.00 84.25  ? 437  ASP B OD1   1 
ATOM   176   O  OD2   . ASP A  1  22  ? 21.749   -36.532 64.336   1.00 97.07  ? 437  ASP B OD2   1 
ATOM   177   N  N     . SER A  1  23  ? 17.873   -39.061 61.149   1.00 95.52  ? 438  SER B N     1 
ATOM   178   C  CA    . SER A  1  23  ? 16.534   -39.470 60.645   1.00 116.62 ? 438  SER B CA    1 
ATOM   179   C  C     . SER A  1  23  ? 16.437   -40.999 60.652   1.00 123.11 ? 438  SER B C     1 
ATOM   180   O  O     . SER A  1  23  ? 15.598   -41.545 61.397   1.00 135.21 ? 438  SER B O     1 
ATOM   181   C  CB    . SER A  1  23  ? 16.253   -38.940 59.256   1.00 124.52 ? 438  SER B CB    1 
ATOM   182   O  OG    . SER A  1  23  ? 17.025   -37.782 58.947   1.00 135.37 ? 438  SER B OG    1 
ATOM   183   N  N     . ALA A  1  24  ? 17.277   -41.649 59.842   1.00 116.33 ? 439  ALA B N     1 
ATOM   184   C  CA    . ALA A  1  24  ? 17.361   -43.120 59.711   1.00 103.36 ? 439  ALA B CA    1 
ATOM   185   C  C     . ALA A  1  24  ? 17.984   -43.705 60.979   1.00 102.47 ? 439  ALA B C     1 
ATOM   186   O  O     . ALA A  1  24  ? 17.494   -44.745 61.437   1.00 113.73 ? 439  ALA B O     1 
ATOM   187   C  CB    . ALA A  1  24  ? 18.146   -43.492 58.479   1.00 99.06  ? 439  ALA B CB    1 
ATOM   188   N  N     . GLY A  1  25  ? 19.011   -43.050 61.521   1.00 92.22  ? 440  GLY B N     1 
ATOM   189   C  CA    . GLY A  1  25  ? 19.684   -43.439 62.777   1.00 97.67  ? 440  GLY B CA    1 
ATOM   190   C  C     . GLY A  1  25  ? 18.706   -43.860 63.869   1.00 99.45  ? 440  GLY B C     1 
ATOM   191   O  O     . GLY A  1  25  ? 18.853   -44.988 64.401   1.00 102.50 ? 440  GLY B O     1 
ATOM   192   N  N     . GLY A  1  26  ? 17.737   -42.997 64.191   1.00 103.85 ? 441  GLY B N     1 
ATOM   193   C  CA    . GLY A  1  26  ? 16.788   -43.209 65.301   1.00 112.29 ? 441  GLY B CA    1 
ATOM   194   C  C     . GLY A  1  26  ? 15.851   -44.377 65.034   1.00 115.71 ? 441  GLY B C     1 
ATOM   195   O  O     . GLY A  1  26  ? 15.676   -45.224 65.946   1.00 117.24 ? 441  GLY B O     1 
ATOM   196   N  N     . SER A  1  27  ? 15.260   -44.412 63.834   1.00 113.64 ? 442  SER B N     1 
ATOM   197   C  CA    . SER A  1  27  ? 14.328   -45.476 63.375   1.00 113.99 ? 442  SER B CA    1 
ATOM   198   C  C     . SER A  1  27  ? 15.028   -46.838 63.471   1.00 111.75 ? 442  SER B C     1 
ATOM   199   O  O     . SER A  1  27  ? 14.394   -47.817 63.938   1.00 116.83 ? 442  SER B O     1 
ATOM   200   C  CB    . SER A  1  27  ? 13.845   -45.197 61.968   1.00 104.83 ? 442  SER B CB    1 
ATOM   201   O  OG    . SER A  1  27  ? 13.119   -43.976 61.916   1.00 91.91  ? 442  SER B OG    1 
ATOM   202   N  N     . THR A  1  28  ? 16.299   -46.867 63.060   1.00 96.39  ? 443  THR B N     1 
ATOM   203   C  CA    . THR A  1  28  ? 17.188   -48.055 63.031   1.00 95.00  ? 443  THR B CA    1 
ATOM   204   C  C     . THR A  1  28  ? 17.511   -48.505 64.462   1.00 86.25  ? 443  THR B C     1 
ATOM   205   O  O     . THR A  1  28  ? 17.366   -49.717 64.734   1.00 74.93  ? 443  THR B O     1 
ATOM   206   C  CB    . THR A  1  28  ? 18.453   -47.740 62.222   1.00 99.24  ? 443  THR B CB    1 
ATOM   207   O  OG1   . THR A  1  28  ? 18.053   -47.211 60.958   1.00 96.59  ? 443  THR B OG1   1 
ATOM   208   C  CG2   . THR A  1  28  ? 19.321   -48.954 61.975   1.00 105.80 ? 443  THR B CG2   1 
ATOM   209   N  N     . LYS A  1  29  ? 17.932   -47.575 65.331   1.00 83.29  ? 444  LYS B N     1 
ATOM   210   C  CA    . LYS A  1  29  ? 18.320   -47.869 66.742   1.00 77.89  ? 444  LYS B CA    1 
ATOM   211   C  C     . LYS A  1  29  ? 17.142   -48.504 67.482   1.00 76.81  ? 444  LYS B C     1 
ATOM   212   O  O     . LYS A  1  29  ? 17.399   -49.340 68.350   1.00 90.80  ? 444  LYS B O     1 
ATOM   213   C  CB    . LYS A  1  29  ? 18.820   -46.612 67.466   1.00 77.56  ? 444  LYS B CB    1 
ATOM   214   C  CG    . LYS A  1  29  ? 20.286   -46.295 67.203   1.00 80.89  ? 444  LYS B CG    1 
ATOM   215   C  CD    . LYS A  1  29  ? 20.706   -44.854 67.393   1.00 83.91  ? 444  LYS B CD    1 
ATOM   216   C  CE    . LYS A  1  29  ? 21.923   -44.528 66.546   1.00 83.21  ? 444  LYS B CE    1 
ATOM   217   N  NZ    . LYS A  1  29  ? 22.663   -43.356 67.067   1.00 81.10  ? 444  LYS B NZ    1 
ATOM   218   N  N     . SER A  1  30  ? 15.904   -48.121 67.156   1.00 75.21  ? 445  SER B N     1 
ATOM   219   C  CA    . SER A  1  30  ? 14.668   -48.702 67.748   1.00 70.68  ? 445  SER B CA    1 
ATOM   220   C  C     . SER A  1  30  ? 14.446   -50.123 67.211   1.00 68.89  ? 445  SER B C     1 
ATOM   221   O  O     . SER A  1  30  ? 14.159   -51.030 68.025   1.00 61.13  ? 445  SER B O     1 
ATOM   222   C  CB    . SER A  1  30  ? 13.482   -47.814 67.493   1.00 70.25  ? 445  SER B CB    1 
ATOM   223   O  OG    . SER A  1  30  ? 13.485   -46.720 68.404   1.00 59.85  ? 445  SER B OG    1 
ATOM   224   N  N     . GLY A  1  31  ? 14.579   -50.297 65.890   1.00 66.71  ? 446  GLY B N     1 
ATOM   225   C  CA    . GLY A  1  31  ? 14.284   -51.553 65.169   1.00 63.80  ? 446  GLY B CA    1 
ATOM   226   C  C     . GLY A  1  31  ? 15.253   -52.668 65.511   1.00 68.02  ? 446  GLY B C     1 
ATOM   227   O  O     . GLY A  1  31  ? 14.813   -53.838 65.565   1.00 75.06  ? 446  GLY B O     1 
ATOM   228   N  N     . ARG A  1  32  ? 16.520   -52.317 65.757   1.00 74.14  ? 447  ARG B N     1 
ATOM   229   C  CA    . ARG A  1  32  ? 17.679   -53.257 65.764   1.00 77.38  ? 447  ARG B CA    1 
ATOM   230   C  C     . ARG A  1  32  ? 17.601   -54.245 66.937   1.00 78.50  ? 447  ARG B C     1 
ATOM   231   O  O     . ARG A  1  32  ? 16.907   -53.952 67.925   1.00 65.26  ? 447  ARG B O     1 
ATOM   232   C  CB    . ARG A  1  32  ? 19.003   -52.488 65.836   1.00 75.25  ? 447  ARG B CB    1 
ATOM   233   C  CG    . ARG A  1  32  ? 19.153   -51.592 67.057   1.00 70.13  ? 447  ARG B CG    1 
ATOM   234   C  CD    . ARG A  1  32  ? 20.591   -51.492 67.517   1.00 67.60  ? 447  ARG B CD    1 
ATOM   235   N  NE    . ARG A  1  32  ? 20.770   -50.592 68.641   1.00 72.14  ? 447  ARG B NE    1 
ATOM   236   C  CZ    . ARG A  1  32  ? 21.938   -50.325 69.211   1.00 82.35  ? 447  ARG B CZ    1 
ATOM   237   N  NH1   . ARG A  1  32  ? 22.009   -49.499 70.244   1.00 86.48  ? 447  ARG B NH1   1 
ATOM   238   N  NH2   . ARG A  1  32  ? 23.045   -50.879 68.750   1.00 88.44  ? 447  ARG B NH2   1 
ATOM   239   N  N     . ASP A  1  33  ? 18.308   -55.374 66.802   1.00 90.17  ? 448  ASP B N     1 
ATOM   240   C  CA    . ASP A  1  33  ? 18.699   -56.289 67.909   1.00 97.20  ? 448  ASP B CA    1 
ATOM   241   C  C     . ASP A  1  33  ? 20.003   -55.740 68.508   1.00 98.97  ? 448  ASP B C     1 
ATOM   242   O  O     . ASP A  1  33  ? 21.080   -56.049 67.961   1.00 92.73  ? 448  ASP B O     1 
ATOM   243   C  CB    . ASP A  1  33  ? 18.817   -57.736 67.408   1.00 103.69 ? 448  ASP B CB    1 
ATOM   244   C  CG    . ASP A  1  33  ? 19.387   -58.741 68.408   1.00 112.00 ? 448  ASP B CG    1 
ATOM   245   O  OD1   . ASP A  1  33  ? 19.345   -58.469 69.633   1.00 121.30 ? 448  ASP B OD1   1 
ATOM   246   O  OD2   . ASP A  1  33  ? 19.881   -59.799 67.970   1.00 104.99 ? 448  ASP B OD2   1 
ATOM   247   N  N     . SER A  1  34  ? 19.914   -54.945 69.582   1.00 100.88 ? 449  SER B N     1 
ATOM   248   C  CA    . SER A  1  34  ? 21.060   -54.203 70.172   1.00 97.70  ? 449  SER B CA    1 
ATOM   249   C  C     . SER A  1  34  ? 22.085   -55.170 70.786   1.00 104.85 ? 449  SER B C     1 
ATOM   250   O  O     . SER A  1  34  ? 23.135   -54.688 71.230   1.00 104.94 ? 449  SER B O     1 
ATOM   251   C  CB    . SER A  1  34  ? 20.600   -53.156 71.163   1.00 90.32  ? 449  SER B CB    1 
ATOM   252   O  OG    . SER A  1  34  ? 19.830   -53.724 72.211   1.00 84.13  ? 449  SER B OG    1 
ATOM   253   N  N     . ARG A  1  35  ? 21.813   -56.480 70.790   1.00 111.58 ? 450  ARG B N     1 
ATOM   254   C  CA    . ARG A  1  35  ? 22.781   -57.524 71.230   1.00 103.09 ? 450  ARG B CA    1 
ATOM   255   C  C     . ARG A  1  35  ? 23.895   -57.686 70.178   1.00 96.71  ? 450  ARG B C     1 
ATOM   256   O  O     . ARG A  1  35  ? 25.057   -57.830 70.599   1.00 100.78 ? 450  ARG B O     1 
ATOM   257   C  CB    . ARG A  1  35  ? 22.068   -58.851 71.524   1.00 93.72  ? 450  ARG B CB    1 
ATOM   258   N  N     . THR A  1  36  ? 23.570   -57.645 68.876   1.00 88.37  ? 451  THR B N     1 
ATOM   259   C  CA    . THR A  1  36  ? 24.500   -57.987 67.756   1.00 88.55  ? 451  THR B CA    1 
ATOM   260   C  C     . THR A  1  36  ? 24.551   -56.917 66.647   1.00 82.64  ? 451  THR B C     1 
ATOM   261   O  O     . THR A  1  36  ? 25.387   -57.072 65.732   1.00 64.67  ? 451  THR B O     1 
ATOM   262   C  CB    . THR A  1  36  ? 24.124   -59.332 67.119   1.00 88.12  ? 451  THR B CB    1 
ATOM   263   O  OG1   . THR A  1  36  ? 22.723   -59.329 66.816   1.00 83.94  ? 451  THR B OG1   1 
ATOM   264   C  CG2   . THR A  1  36  ? 24.480   -60.501 68.012   1.00 87.89  ? 451  THR B CG2   1 
ATOM   265   N  N     . GLN A  1  37  ? 23.704   -55.886 66.691   1.00 78.10  ? 452  GLN B N     1 
ATOM   266   C  CA    . GLN A  1  37  ? 23.570   -54.897 65.584   1.00 73.29  ? 452  GLN B CA    1 
ATOM   267   C  C     . GLN A  1  37  ? 23.965   -53.505 66.090   1.00 73.87  ? 452  GLN B C     1 
ATOM   268   O  O     . GLN A  1  37  ? 23.245   -52.962 66.935   1.00 81.47  ? 452  GLN B O     1 
ATOM   269   C  CB    . GLN A  1  37  ? 22.147   -54.925 65.030   1.00 66.14  ? 452  GLN B CB    1 
ATOM   270   C  CG    . GLN A  1  37  ? 21.804   -56.238 64.348   1.00 67.03  ? 452  GLN B CG    1 
ATOM   271   C  CD    . GLN A  1  37  ? 20.443   -56.196 63.692   1.00 71.07  ? 452  GLN B CD    1 
ATOM   272   O  OE1   . GLN A  1  37  ? 19.496   -55.639 64.238   1.00 77.05  ? 452  GLN B OE1   1 
ATOM   273   N  NE2   . GLN A  1  37  ? 20.336   -56.783 62.510   1.00 74.92  ? 452  GLN B NE2   1 
ATOM   274   N  N     . ALA A  1  38  ? 25.084   -52.968 65.607   1.00 67.41  ? 453  ALA B N     1 
ATOM   275   C  CA    . ALA A  1  38  ? 25.553   -51.594 65.893   1.00 63.79  ? 453  ALA B CA    1 
ATOM   276   C  C     . ALA A  1  38  ? 25.044   -50.663 64.789   1.00 69.22  ? 453  ALA B C     1 
ATOM   277   O  O     . ALA A  1  38  ? 24.698   -51.175 63.709   1.00 63.91  ? 453  ALA B O     1 
ATOM   278   C  CB    . ALA A  1  38  ? 27.058   -51.567 65.994   1.00 65.42  ? 453  ALA B CB    1 
ATOM   279   N  N     . ILE A  1  39  ? 24.993   -49.354 65.054   1.00 78.46  ? 454  ILE B N     1 
ATOM   280   C  CA    . ILE A  1  39  ? 24.548   -48.327 64.064   1.00 77.24  ? 454  ILE B CA    1 
ATOM   281   C  C     . ILE A  1  39  ? 25.486   -47.122 64.116   1.00 72.87  ? 454  ILE B C     1 
ATOM   282   O  O     . ILE A  1  39  ? 25.688   -46.563 65.218   1.00 65.48  ? 454  ILE B O     1 
ATOM   283   C  CB    . ILE A  1  39  ? 23.084   -47.927 64.313   1.00 82.48  ? 454  ILE B CB    1 
ATOM   284   C  CG1   . ILE A  1  39  ? 22.149   -49.096 64.002   1.00 95.90  ? 454  ILE B CG1   1 
ATOM   285   C  CG2   . ILE A  1  39  ? 22.705   -46.681 63.525   1.00 77.67  ? 454  ILE B CG2   1 
ATOM   286   C  CD1   . ILE A  1  39  ? 20.984   -49.185 64.938   1.00 107.59 ? 454  ILE B CD1   1 
ATOM   287   N  N     . LEU A  1  40  ? 26.035   -46.756 62.955   1.00 75.88  ? 455  LEU B N     1 
ATOM   288   C  CA    . LEU A  1  40  ? 26.832   -45.520 62.756   1.00 79.59  ? 455  LEU B CA    1 
ATOM   289   C  C     . LEU A  1  40  ? 26.085   -44.628 61.772   1.00 74.51  ? 455  LEU B C     1 
ATOM   290   O  O     . LEU A  1  40  ? 26.148   -44.867 60.568   1.00 66.59  ? 455  LEU B O     1 
ATOM   291   C  CB    . LEU A  1  40  ? 28.224   -45.878 62.226   1.00 79.24  ? 455  LEU B CB    1 
ATOM   292   C  CG    . LEU A  1  40  ? 29.160   -44.683 62.037   1.00 76.73  ? 455  LEU B CG    1 
ATOM   293   C  CD1   . LEU A  1  40  ? 29.260   -43.849 63.324   1.00 78.68  ? 455  LEU B CD1   1 
ATOM   294   C  CD2   . LEU A  1  40  ? 30.545   -45.149 61.581   1.00 73.42  ? 455  LEU B CD2   1 
ATOM   295   N  N     . PRO A  1  41  ? 25.353   -43.595 62.250   1.00 75.31  ? 456  PRO B N     1 
ATOM   296   C  CA    . PRO A  1  41  ? 24.718   -42.633 61.360   1.00 76.28  ? 456  PRO B CA    1 
ATOM   297   C  C     . PRO A  1  41  ? 25.815   -41.676 60.881   1.00 82.76  ? 456  PRO B C     1 
ATOM   298   O  O     . PRO A  1  41  ? 26.516   -41.141 61.716   1.00 77.87  ? 456  PRO B O     1 
ATOM   299   C  CB    . PRO A  1  41  ? 23.638   -41.930 62.198   1.00 73.02  ? 456  PRO B CB    1 
ATOM   300   C  CG    . PRO A  1  41  ? 23.939   -42.319 63.659   1.00 72.39  ? 456  PRO B CG    1 
ATOM   301   C  CD    . PRO A  1  41  ? 25.142   -43.248 63.662   1.00 71.43  ? 456  PRO B CD    1 
ATOM   302   N  N     . LEU A  1  42  ? 25.946   -41.533 59.559   1.00 95.59  ? 457  LEU B N     1 
ATOM   303   C  CA    . LEU A  1  42  ? 26.855   -40.572 58.883   1.00 101.36 ? 457  LEU B CA    1 
ATOM   304   C  C     . LEU A  1  42  ? 26.150   -39.215 58.779   1.00 108.27 ? 457  LEU B C     1 
ATOM   305   O  O     . LEU A  1  42  ? 25.000   -39.094 59.247   1.00 125.55 ? 457  LEU B O     1 
ATOM   306   C  CB    . LEU A  1  42  ? 27.215   -41.127 57.500   1.00 105.27 ? 457  LEU B CB    1 
ATOM   307   C  CG    . LEU A  1  42  ? 27.838   -42.523 57.491   1.00 100.10 ? 457  LEU B CG    1 
ATOM   308   C  CD1   . LEU A  1  42  ? 27.967   -43.046 56.070   1.00 95.50  ? 457  LEU B CD1   1 
ATOM   309   C  CD2   . LEU A  1  42  ? 29.187   -42.519 58.193   1.00 99.88  ? 457  LEU B CD2   1 
ATOM   310   N  N     A ARG A  1  43  ? 26.826   -38.225 58.194   0.50 109.41 ? 458  ARG B N     1 
ATOM   311   N  N     B ARG A  1  43  ? 26.826   -38.224 58.195   0.50 105.91 ? 458  ARG B N     1 
ATOM   312   C  CA    A ARG A  1  43  ? 26.331   -36.831 58.092   0.50 105.16 ? 458  ARG B CA    1 
ATOM   313   C  CA    B ARG A  1  43  ? 26.329   -36.829 58.095   0.50 99.58  ? 458  ARG B CA    1 
ATOM   314   C  C     A ARG A  1  43  ? 26.278   -36.449 56.612   0.50 94.79  ? 458  ARG B C     1 
ATOM   315   C  C     B ARG A  1  43  ? 26.279   -36.449 56.613   0.50 91.78  ? 458  ARG B C     1 
ATOM   316   O  O     A ARG A  1  43  ? 27.046   -35.569 56.195   0.50 91.10  ? 458  ARG B O     1 
ATOM   317   O  O     B ARG A  1  43  ? 27.046   -35.570 56.196   0.50 88.35  ? 458  ARG B O     1 
ATOM   318   C  CB    A ARG A  1  43  ? 27.219   -35.928 58.945   0.50 111.27 ? 458  ARG B CB    1 
ATOM   319   C  CB    B ARG A  1  43  ? 27.199   -35.925 58.974   0.50 101.18 ? 458  ARG B CB    1 
ATOM   320   C  CG    A ARG A  1  43  ? 27.060   -34.440 58.673   0.50 114.63 ? 458  ARG B CG    1 
ATOM   321   C  CG    B ARG A  1  43  ? 27.143   -36.272 60.461   0.50 98.96  ? 458  ARG B CG    1 
ATOM   322   C  CD    A ARG A  1  43  ? 27.854   -33.642 59.690   0.50 112.77 ? 458  ARG B CD    1 
ATOM   323   C  CD    B ARG A  1  43  ? 26.191   -35.556 61.364   0.50 96.21  ? 458  ARG B CD    1 
ATOM   324   N  NE    A ARG A  1  43  ? 29.269   -33.963 59.596   0.50 106.26 ? 458  ARG B NE    1 
ATOM   325   N  NE    B ARG A  1  43  ? 26.801   -34.490 62.153   0.50 96.12  ? 458  ARG B NE    1 
ATOM   326   C  CZ    A ARG A  1  43  ? 30.224   -33.058 59.402   0.50 98.78  ? 458  ARG B CZ    1 
ATOM   327   C  CZ    B ARG A  1  43  ? 27.311   -33.369 61.647   0.50 101.37 ? 458  ARG B CZ    1 
ATOM   328   N  NH1   A ARG A  1  43  ? 29.918   -31.775 59.333   0.50 93.49  ? 458  ARG B NH1   1 
ATOM   329   N  NH1   B ARG A  1  43  ? 27.306   -33.161 60.340   0.50 104.71 ? 458  ARG B NH1   1 
ATOM   330   N  NH2   A ARG A  1  43  ? 31.484   -33.439 59.309   0.50 96.29  ? 458  ARG B NH2   1 
ATOM   331   N  NH2   B ARG A  1  43  ? 27.812   -32.448 62.450   0.50 101.88 ? 458  ARG B NH2   1 
ATOM   332   N  N     . GLY A  1  44  ? 25.403   -37.122 55.861   1.00 88.93  ? 459  GLY B N     1 
ATOM   333   C  CA    . GLY A  1  44  ? 25.129   -36.831 54.441   1.00 89.15  ? 459  GLY B CA    1 
ATOM   334   C  C     . GLY A  1  44  ? 26.251   -37.308 53.546   1.00 86.83  ? 459  GLY B C     1 
ATOM   335   O  O     . GLY A  1  44  ? 26.935   -38.276 53.946   1.00 96.99  ? 459  GLY B O     1 
ATOM   336   N  N     . LYS A  1  45  ? 26.436   -36.658 52.390   1.00 75.46  ? 460  LYS B N     1 
ATOM   337   C  CA    . LYS A  1  45  ? 27.505   -37.000 51.414   1.00 73.37  ? 460  LYS B CA    1 
ATOM   338   C  C     . LYS A  1  45  ? 28.827   -37.072 52.186   1.00 69.84  ? 460  LYS B C     1 
ATOM   339   O  O     . LYS A  1  45  ? 29.114   -36.166 52.996   1.00 53.47  ? 460  LYS B O     1 
ATOM   340   C  CB    . LYS A  1  45  ? 27.570   -35.996 50.260   1.00 79.37  ? 460  LYS B CB    1 
ATOM   341   C  CG    . LYS A  1  45  ? 26.308   -35.851 49.417   1.00 85.48  ? 460  LYS B CG    1 
ATOM   342   C  CD    . LYS A  1  45  ? 26.033   -37.029 48.527   1.00 86.19  ? 460  LYS B CD    1 
ATOM   343   C  CE    . LYS A  1  45  ? 24.642   -37.042 47.924   1.00 93.42  ? 460  LYS B CE    1 
ATOM   344   N  NZ    . LYS A  1  45  ? 24.506   -36.137 46.753   1.00 92.07  ? 460  LYS B NZ    1 
ATOM   345   N  N     . ILE A  1  46  ? 29.567   -38.173 52.000   1.00 75.42  ? 461  ILE B N     1 
ATOM   346   C  CA    . ILE A  1  46  ? 30.896   -38.403 52.632   1.00 78.01  ? 461  ILE B CA    1 
ATOM   347   C  C     . ILE A  1  46  ? 31.938   -37.971 51.586   1.00 78.25  ? 461  ILE B C     1 
ATOM   348   O  O     . ILE A  1  46  ? 31.588   -37.853 50.385   1.00 62.57  ? 461  ILE B O     1 
ATOM   349   C  CB    . ILE A  1  46  ? 31.011   -39.883 53.059   1.00 79.07  ? 461  ILE B CB    1 
ATOM   350   C  CG1   . ILE A  1  46  ? 32.056   -40.145 54.151   1.00 83.79  ? 461  ILE B CG1   1 
ATOM   351   C  CG2   . ILE A  1  46  ? 31.183   -40.753 51.825   1.00 79.37  ? 461  ILE B CG2   1 
ATOM   352   C  CD1   . ILE A  1  46  ? 31.743   -41.308 55.024   1.00 88.32  ? 461  ILE B CD1   1 
ATOM   353   N  N     . LEU A  1  47  ? 33.171   -37.740 52.026   1.00 82.32  ? 462  LEU B N     1 
ATOM   354   C  CA    . LEU A  1  47  ? 34.308   -37.313 51.175   1.00 84.81  ? 462  LEU B CA    1 
ATOM   355   C  C     . LEU A  1  47  ? 34.537   -38.326 50.042   1.00 88.40  ? 462  LEU B C     1 
ATOM   356   O  O     . LEU A  1  47  ? 34.578   -39.526 50.328   1.00 94.72  ? 462  LEU B O     1 
ATOM   357   C  CB    . LEU A  1  47  ? 35.524   -37.146 52.089   1.00 84.52  ? 462  LEU B CB    1 
ATOM   358   C  CG    . LEU A  1  47  ? 36.688   -36.364 51.499   1.00 94.10  ? 462  LEU B CG    1 
ATOM   359   C  CD1   . LEU A  1  47  ? 36.314   -34.929 51.110   1.00 94.24  ? 462  LEU B CD1   1 
ATOM   360   C  CD2   . LEU A  1  47  ? 37.872   -36.359 52.464   1.00 101.22 ? 462  LEU B CD2   1 
ATOM   361   N  N     . ASN A  1  48  ? 34.664   -37.853 48.796   1.00 90.35  ? 463  ASN B N     1 
ATOM   362   C  CA    . ASN A  1  48  ? 35.118   -38.673 47.645   1.00 87.60  ? 463  ASN B CA    1 
ATOM   363   C  C     . ASN A  1  48  ? 36.640   -38.814 47.755   1.00 90.10  ? 463  ASN B C     1 
ATOM   364   O  O     . ASN A  1  48  ? 37.341   -37.882 47.313   1.00 80.86  ? 463  ASN B O     1 
ATOM   365   C  CB    . ASN A  1  48  ? 34.720   -38.072 46.293   1.00 84.70  ? 463  ASN B CB    1 
ATOM   366   C  CG    . ASN A  1  48  ? 35.153   -38.937 45.125   1.00 85.96  ? 463  ASN B CG    1 
ATOM   367   O  OD1   . ASN A  1  48  ? 35.973   -39.834 45.292   1.00 88.04  ? 463  ASN B OD1   1 
ATOM   368   N  ND2   . ASN A  1  48  ? 34.613   -38.689 43.941   1.00 89.55  ? 463  ASN B ND2   1 
ATOM   369   N  N     . VAL A  1  49  ? 37.114   -39.936 48.319   1.00 91.80  ? 464  VAL B N     1 
ATOM   370   C  CA    . VAL A  1  49  ? 38.557   -40.189 48.648   1.00 87.05  ? 464  VAL B CA    1 
ATOM   371   C  C     . VAL A  1  49  ? 39.382   -40.321 47.358   1.00 87.45  ? 464  VAL B C     1 
ATOM   372   O  O     . VAL A  1  49  ? 40.607   -40.100 47.440   1.00 80.04  ? 464  VAL B O     1 
ATOM   373   C  CB    . VAL A  1  49  ? 38.753   -41.416 49.560   1.00 77.13  ? 464  VAL B CB    1 
ATOM   374   C  CG1   . VAL A  1  49  ? 38.161   -41.180 50.938   1.00 77.52  ? 464  VAL B CG1   1 
ATOM   375   C  CG2   . VAL A  1  49  ? 38.209   -42.694 48.953   1.00 76.12  ? 464  VAL B CG2   1 
ATOM   376   N  N     . GLU A  1  50  ? 38.742   -40.664 46.231   1.00 93.14  ? 465  GLU B N     1 
ATOM   377   C  CA    . GLU A  1  50  ? 39.378   -40.787 44.891   1.00 89.09  ? 465  GLU B CA    1 
ATOM   378   C  C     . GLU A  1  50  ? 39.844   -39.408 44.394   1.00 86.82  ? 465  GLU B C     1 
ATOM   379   O  O     . GLU A  1  50  ? 40.850   -39.368 43.672   1.00 86.07  ? 465  GLU B O     1 
ATOM   380   C  CB    . GLU A  1  50  ? 38.397   -41.408 43.892   1.00 88.00  ? 465  GLU B CB    1 
ATOM   381   C  CG    . GLU A  1  50  ? 39.044   -41.900 42.610   1.00 89.31  ? 465  GLU B CG    1 
ATOM   382   C  CD    . GLU A  1  50  ? 39.817   -43.196 42.752   1.00 85.84  ? 465  GLU B CD    1 
ATOM   383   O  OE1   . GLU A  1  50  ? 40.419   -43.657 41.750   1.00 71.31  ? 465  GLU B OE1   1 
ATOM   384   O  OE2   . GLU A  1  50  ? 39.789   -43.757 43.863   1.00 96.49  ? 465  GLU B OE2   1 
ATOM   385   N  N     . LYS A  1  51  ? 39.124   -38.333 44.749   1.00 78.48  ? 466  LYS B N     1 
ATOM   386   C  CA    . LYS A  1  51  ? 39.410   -36.931 44.336   1.00 68.39  ? 466  LYS B CA    1 
ATOM   387   C  C     . LYS A  1  51  ? 40.199   -36.199 45.425   1.00 61.95  ? 466  LYS B C     1 
ATOM   388   O  O     . LYS A  1  51  ? 40.996   -35.334 45.068   1.00 56.01  ? 466  LYS B O     1 
ATOM   389   C  CB    . LYS A  1  51  ? 38.113   -36.165 44.052   1.00 67.28  ? 466  LYS B CB    1 
ATOM   390   C  CG    . LYS A  1  51  ? 37.443   -36.501 42.724   1.00 69.71  ? 466  LYS B CG    1 
ATOM   391   C  CD    . LYS A  1  51  ? 36.117   -35.786 42.491   1.00 67.96  ? 466  LYS B CD    1 
ATOM   392   C  CE    . LYS A  1  51  ? 35.367   -36.366 41.305   1.00 70.58  ? 466  LYS B CE    1 
ATOM   393   N  NZ    . LYS A  1  51  ? 34.139   -35.602 40.987   1.00 70.82  ? 466  LYS B NZ    1 
ATOM   394   N  N     . ALA A  1  52  ? 39.943   -36.493 46.698   1.00 68.34  ? 467  ALA B N     1 
ATOM   395   C  CA    . ALA A  1  52  ? 40.478   -35.745 47.859   1.00 84.39  ? 467  ALA B CA    1 
ATOM   396   C  C     . ALA A  1  52  ? 41.937   -36.132 48.105   1.00 88.84  ? 467  ALA B C     1 
ATOM   397   O  O     . ALA A  1  52  ? 42.295   -37.282 47.799   1.00 77.17  ? 467  ALA B O     1 
ATOM   398   C  CB    . ALA A  1  52  ? 39.644   -36.015 49.085   1.00 90.31  ? 467  ALA B CB    1 
ATOM   399   N  N     . ARG A  1  53  ? 42.718   -35.186 48.641   1.00 100.23 ? 468  ARG B N     1 
ATOM   400   C  CA    . ARG A  1  53  ? 44.123   -35.364 49.102   1.00 96.63  ? 468  ARG B CA    1 
ATOM   401   C  C     . ARG A  1  53  ? 44.119   -36.073 50.464   1.00 94.48  ? 468  ARG B C     1 
ATOM   402   O  O     . ARG A  1  53  ? 43.153   -35.872 51.233   1.00 85.94  ? 468  ARG B O     1 
ATOM   403   C  CB    . ARG A  1  53  ? 44.826   -34.001 49.173   1.00 94.96  ? 468  ARG B CB    1 
ATOM   404   C  CG    . ARG A  1  53  ? 45.147   -33.441 47.799   1.00 92.72  ? 468  ARG B CG    1 
ATOM   405   C  CD    . ARG A  1  53  ? 44.906   -31.952 47.533   1.00 90.92  ? 468  ARG B CD    1 
ATOM   406   N  NE    . ARG A  1  53  ? 44.626   -31.778 46.105   1.00 91.03  ? 468  ARG B NE    1 
ATOM   407   C  CZ    . ARG A  1  53  ? 44.922   -30.707 45.364   1.00 91.20  ? 468  ARG B CZ    1 
ATOM   408   N  NH1   . ARG A  1  53  ? 45.537   -29.662 45.895   1.00 96.64  ? 468  ARG B NH1   1 
ATOM   409   N  NH2   . ARG A  1  53  ? 44.620   -30.708 44.078   1.00 88.97  ? 468  ARG B NH2   1 
ATOM   410   N  N     . LEU A  1  54  ? 45.174   -36.852 50.748   1.00 93.92  ? 469  LEU B N     1 
ATOM   411   C  CA    . LEU A  1  54  ? 45.265   -37.745 51.939   1.00 92.00  ? 469  LEU B CA    1 
ATOM   412   C  C     . LEU A  1  54  ? 45.171   -36.934 53.237   1.00 91.70  ? 469  LEU B C     1 
ATOM   413   O  O     . LEU A  1  54  ? 44.535   -37.431 54.168   1.00 92.74  ? 469  LEU B O     1 
ATOM   414   C  CB    . LEU A  1  54  ? 46.574   -38.540 51.878   1.00 88.37  ? 469  LEU B CB    1 
ATOM   415   C  CG    . LEU A  1  54  ? 46.798   -39.517 53.025   1.00 85.45  ? 469  LEU B CG    1 
ATOM   416   C  CD1   . LEU A  1  54  ? 45.745   -40.619 53.047   1.00 80.90  ? 469  LEU B CD1   1 
ATOM   417   C  CD2   . LEU A  1  54  ? 48.171   -40.168 52.886   1.00 88.54  ? 469  LEU B CD2   1 
ATOM   418   N  N     . ASP A  1  55  ? 45.774   -35.744 53.297   1.00 100.41 ? 470  ASP B N     1 
ATOM   419   C  CA    . ASP A  1  55  ? 45.698   -34.816 54.467   1.00 99.62  ? 470  ASP B CA    1 
ATOM   420   C  C     . ASP A  1  55  ? 44.233   -34.628 54.881   1.00 96.89  ? 470  ASP B C     1 
ATOM   421   O  O     . ASP A  1  55  ? 43.932   -34.815 56.080   1.00 100.06 ? 470  ASP B O     1 
ATOM   422   C  CB    . ASP A  1  55  ? 46.326   -33.449 54.180   1.00 100.71 ? 470  ASP B CB    1 
ATOM   423   C  CG    . ASP A  1  55  ? 45.833   -32.728 52.936   1.00 107.45 ? 470  ASP B CG    1 
ATOM   424   O  OD1   . ASP A  1  55  ? 44.805   -33.110 52.337   1.00 112.63 ? 470  ASP B OD1   1 
ATOM   425   O  OD2   . ASP A  1  55  ? 46.497   -31.768 52.568   1.00 126.78 ? 470  ASP B OD2   1 
ATOM   426   N  N     . ARG A  1  56  ? 43.366   -34.258 53.926   1.00 97.06  ? 471  ARG B N     1 
ATOM   427   C  CA    . ARG A  1  56  ? 41.924   -33.953 54.129   1.00 90.26  ? 471  ARG B CA    1 
ATOM   428   C  C     . ARG A  1  56  ? 41.192   -35.220 54.585   1.00 83.93  ? 471  ARG B C     1 
ATOM   429   O  O     . ARG A  1  56  ? 40.379   -35.115 55.526   1.00 81.30  ? 471  ARG B O     1 
ATOM   430   C  CB    . ARG A  1  56  ? 41.331   -33.405 52.827   1.00 88.91  ? 471  ARG B CB    1 
ATOM   431   C  CG    . ARG A  1  56  ? 39.952   -32.783 52.943   1.00 90.46  ? 471  ARG B CG    1 
ATOM   432   C  CD    . ARG A  1  56  ? 39.440   -32.657 51.519   1.00 91.74  ? 471  ARG B CD    1 
ATOM   433   N  NE    . ARG A  1  56  ? 38.139   -32.003 51.441   1.00 97.97  ? 471  ARG B NE    1 
ATOM   434   C  CZ    . ARG A  1  56  ? 37.610   -31.572 50.288   1.00 106.07 ? 471  ARG B CZ    1 
ATOM   435   N  NH1   . ARG A  1  56  ? 36.407   -31.005 50.328   1.00 112.05 ? 471  ARG B NH1   1 
ATOM   436   N  NH2   . ARG A  1  56  ? 38.247   -31.641 49.032   1.00 107.03 ? 471  ARG B NH2   1 
ATOM   437   N  N     . ILE A  1  57  ? 41.499   -36.365 53.960   1.00 72.03  ? 472  ILE B N     1 
ATOM   438   C  CA    . ILE A  1  57  ? 40.851   -37.688 54.218   1.00 65.58  ? 472  ILE B CA    1 
ATOM   439   C  C     . ILE A  1  57  ? 41.044   -38.057 55.697   1.00 71.22  ? 472  ILE B C     1 
ATOM   440   O  O     . ILE A  1  57  ? 40.042   -38.378 56.360   1.00 76.07  ? 472  ILE B O     1 
ATOM   441   C  CB    . ILE A  1  57  ? 41.398   -38.773 53.268   1.00 57.92  ? 472  ILE B CB    1 
ATOM   442   C  CG1   . ILE A  1  57  ? 41.037   -38.479 51.811   1.00 53.02  ? 472  ILE B CG1   1 
ATOM   443   C  CG2   . ILE A  1  57  ? 40.912   -40.155 53.686   1.00 58.37  ? 472  ILE B CG2   1 
ATOM   444   C  CD1   . ILE A  1  57  ? 41.667   -39.413 50.807   1.00 52.97  ? 472  ILE B CD1   1 
ATOM   445   N  N     . LEU A  1  58  ? 42.279   -37.992 56.197   1.00 75.14  ? 473  LEU B N     1 
ATOM   446   C  CA    . LEU A  1  58  ? 42.632   -38.422 57.579   1.00 75.07  ? 473  LEU B CA    1 
ATOM   447   C  C     . LEU A  1  58  ? 42.081   -37.425 58.607   1.00 76.74  ? 473  LEU B C     1 
ATOM   448   O  O     . LEU A  1  58  ? 41.878   -37.853 59.751   1.00 76.94  ? 473  LEU B O     1 
ATOM   449   C  CB    . LEU A  1  58  ? 44.153   -38.560 57.703   1.00 70.10  ? 473  LEU B CB    1 
ATOM   450   C  CG    . LEU A  1  58  ? 44.812   -39.540 56.737   1.00 65.45  ? 473  LEU B CG    1 
ATOM   451   C  CD1   . LEU A  1  58  ? 46.327   -39.532 56.915   1.00 63.50  ? 473  LEU B CD1   1 
ATOM   452   C  CD2   . LEU A  1  58  ? 44.243   -40.945 56.904   1.00 66.92  ? 473  LEU B CD2   1 
ATOM   453   N  N     . ASN A  1  59  ? 41.848   -36.165 58.217   1.00 77.09  ? 474  ASN B N     1 
ATOM   454   C  CA    . ASN A  1  59  ? 41.303   -35.093 59.102   1.00 76.62  ? 474  ASN B CA    1 
ATOM   455   C  C     . ASN A  1  59  ? 39.766   -35.104 59.087   1.00 73.63  ? 474  ASN B C     1 
ATOM   456   O  O     . ASN A  1  59  ? 39.191   -34.552 60.053   1.00 65.27  ? 474  ASN B O     1 
ATOM   457   C  CB    . ASN A  1  59  ? 41.854   -33.709 58.743   1.00 72.44  ? 474  ASN B CB    1 
ATOM   458   N  N     . ASN A  1  60  ? 39.136   -35.722 58.075   1.00 75.34  ? 475  ASN B N     1 
ATOM   459   C  CA    . ASN A  1  60  ? 37.654   -35.823 57.924   1.00 73.81  ? 475  ASN B CA    1 
ATOM   460   C  C     . ASN A  1  60  ? 37.087   -36.575 59.133   1.00 82.16  ? 475  ASN B C     1 
ATOM   461   O  O     . ASN A  1  60  ? 37.622   -37.655 59.469   1.00 70.68  ? 475  ASN B O     1 
ATOM   462   C  CB    . ASN A  1  60  ? 37.259   -36.524 56.618   1.00 66.72  ? 475  ASN B CB    1 
ATOM   463   C  CG    . ASN A  1  60  ? 35.776   -36.476 56.317   1.00 60.00  ? 475  ASN B CG    1 
ATOM   464   O  OD1   . ASN A  1  60  ? 34.970   -37.108 56.998   1.00 55.59  ? 475  ASN B OD1   1 
ATOM   465   N  ND2   . ASN A  1  60  ? 35.418   -35.788 55.247   1.00 57.15  ? 475  ASN B ND2   1 
ATOM   466   N  N     . ASN A  1  61  ? 36.031   -36.022 59.745   1.00 94.40  ? 476  ASN B N     1 
ATOM   467   C  CA    . ASN A  1  61  ? 35.424   -36.521 61.011   1.00 98.37  ? 476  ASN B CA    1 
ATOM   468   C  C     . ASN A  1  61  ? 34.613   -37.803 60.730   1.00 88.41  ? 476  ASN B C     1 
ATOM   469   O  O     . ASN A  1  61  ? 34.708   -38.731 61.551   1.00 83.53  ? 476  ASN B O     1 
ATOM   470   C  CB    . ASN A  1  61  ? 34.653   -35.385 61.696   1.00 106.52 ? 476  ASN B CB    1 
ATOM   471   C  CG    . ASN A  1  61  ? 33.774   -35.844 62.837   1.00 116.52 ? 476  ASN B CG    1 
ATOM   472   O  OD1   . ASN A  1  61  ? 34.201   -36.621 63.685   1.00 133.12 ? 476  ASN B OD1   1 
ATOM   473   N  ND2   . ASN A  1  61  ? 32.547   -35.358 62.866   1.00 127.74 ? 476  ASN B ND2   1 
ATOM   474   N  N     . GLU A  1  62  ? 33.893   -37.891 59.603   1.00 90.51  ? 477  GLU B N     1 
ATOM   475   C  CA    . GLU A  1  62  ? 33.084   -39.088 59.212   1.00 93.69  ? 477  GLU B CA    1 
ATOM   476   C  C     . GLU A  1  62  ? 34.004   -40.261 58.848   1.00 92.83  ? 477  GLU B C     1 
ATOM   477   O  O     . GLU A  1  62  ? 33.674   -41.407 59.236   1.00 92.28  ? 477  GLU B O     1 
ATOM   478   C  CB    . GLU A  1  62  ? 32.129   -38.781 58.048   1.00 98.84  ? 477  GLU B CB    1 
ATOM   479   C  CG    . GLU A  1  62  ? 30.732   -38.394 58.508   1.00 104.74 ? 477  GLU B CG    1 
ATOM   480   C  CD    . GLU A  1  62  ? 30.704   -37.405 59.661   1.00 113.02 ? 477  GLU B CD    1 
ATOM   481   O  OE1   . GLU A  1  62  ? 31.351   -36.355 59.565   1.00 117.08 ? 477  GLU B OE1   1 
ATOM   482   O  OE2   . GLU A  1  62  ? 30.053   -37.696 60.674   1.00 122.81 ? 477  GLU B OE2   1 
ATOM   483   N  N     . ILE A  1  63  ? 35.100   -40.001 58.126   1.00 88.59  ? 478  ILE B N     1 
ATOM   484   C  CA    . ILE A  1  63  ? 36.127   -41.032 57.782   1.00 82.26  ? 478  ILE B CA    1 
ATOM   485   C  C     . ILE A  1  63  ? 36.753   -41.549 59.082   1.00 75.70  ? 478  ILE B C     1 
ATOM   486   O  O     . ILE A  1  63  ? 36.899   -42.772 59.218   1.00 76.16  ? 478  ILE B O     1 
ATOM   487   C  CB    . ILE A  1  63  ? 37.196   -40.474 56.817   1.00 81.32  ? 478  ILE B CB    1 
ATOM   488   C  CG1   . ILE A  1  63  ? 36.598   -40.078 55.463   1.00 84.80  ? 478  ILE B CG1   1 
ATOM   489   C  CG2   . ILE A  1  63  ? 38.343   -41.456 56.652   1.00 78.18  ? 478  ILE B CG2   1 
ATOM   490   C  CD1   . ILE A  1  63  ? 36.127   -41.237 54.619   1.00 81.25  ? 478  ILE B CD1   1 
ATOM   491   N  N     . ARG A  1  64  ? 37.100   -40.651 60.000   1.00 81.64  ? 479  ARG B N     1 
ATOM   492   C  CA    . ARG A  1  64  ? 37.719   -41.003 61.309   1.00 88.08  ? 479  ARG B CA    1 
ATOM   493   C  C     . ARG A  1  64  ? 36.777   -41.914 62.112   1.00 80.53  ? 479  ARG B C     1 
ATOM   494   O  O     . ARG A  1  64  ? 37.248   -42.950 62.613   1.00 71.63  ? 479  ARG B O     1 
ATOM   495   C  CB    . ARG A  1  64  ? 38.163   -39.721 62.034   1.00 88.66  ? 479  ARG B CB    1 
ATOM   496   C  CG    . ARG A  1  64  ? 39.572   -39.333 61.605   1.00 86.29  ? 479  ARG B CG    1 
ATOM   497   C  CD    . ARG A  1  64  ? 39.927   -37.976 62.134   1.00 84.69  ? 479  ARG B CD    1 
ATOM   498   N  NE    . ARG A  1  64  ? 40.179   -38.010 63.550   1.00 84.27  ? 479  ARG B NE    1 
ATOM   499   C  CZ    . ARG A  1  64  ? 40.725   -36.977 64.235   1.00 86.63  ? 479  ARG B CZ    1 
ATOM   500   N  NH1   . ARG A  1  64  ? 41.008   -35.831 63.616   1.00 89.84  ? 479  ARG B NH1   1 
ATOM   501   N  NH2   . ARG A  1  64  ? 40.955   -37.087 65.536   1.00 84.89  ? 479  ARG B NH2   1 
ATOM   502   N  N     . GLN A  1  65  ? 35.493   -41.565 62.218   1.00 81.24  ? 480  GLN B N     1 
ATOM   503   C  CA    . GLN A  1  65  ? 34.504   -42.332 63.031   1.00 84.50  ? 480  GLN B CA    1 
ATOM   504   C  C     . GLN A  1  65  ? 34.392   -43.761 62.489   1.00 89.42  ? 480  GLN B C     1 
ATOM   505   O  O     . GLN A  1  65  ? 34.261   -44.686 63.309   1.00 77.19  ? 480  GLN B O     1 
ATOM   506   C  CB    . GLN A  1  65  ? 33.133   -41.652 63.057   1.00 87.70  ? 480  GLN B CB    1 
ATOM   507   C  CG    . GLN A  1  65  ? 33.117   -40.360 63.870   1.00 89.67  ? 480  GLN B CG    1 
ATOM   508   C  CD    . GLN A  1  65  ? 31.719   -39.894 64.208   1.00 93.43  ? 480  GLN B CD    1 
ATOM   509   O  OE1   . GLN A  1  65  ? 30.821   -40.693 64.474   1.00 95.81  ? 480  GLN B OE1   1 
ATOM   510   N  NE2   . GLN A  1  65  ? 31.521   -38.581 64.218   1.00 97.19  ? 480  GLN B NE2   1 
ATOM   511   N  N     . MET A  1  66  ? 34.444   -43.938 61.164   1.00 99.90  ? 481  MET B N     1 
ATOM   512   C  CA    . MET A  1  66  ? 34.291   -45.271 60.512   1.00 104.42 ? 481  MET B CA    1 
ATOM   513   C  C     . MET A  1  66  ? 35.530   -46.124 60.810   1.00 104.22 ? 481  MET B C     1 
ATOM   514   O  O     . MET A  1  66  ? 35.361   -47.306 61.178   1.00 102.86 ? 481  MET B O     1 
ATOM   515   C  CB    . MET A  1  66  ? 34.101   -45.146 58.996   1.00 105.40 ? 481  MET B CB    1 
ATOM   516   C  CG    . MET A  1  66  ? 32.663   -44.897 58.576   1.00 103.59 ? 481  MET B CG    1 
ATOM   517   S  SD    . MET A  1  66  ? 32.414   -45.143 56.788   1.00 104.58 ? 481  MET B SD    1 
ATOM   518   C  CE    . MET A  1  66  ? 33.503   -43.869 56.144   1.00 106.79 ? 481  MET B CE    1 
ATOM   519   N  N     . ILE A  1  67  ? 36.722   -45.541 60.671   1.00 110.66 ? 482  ILE B N     1 
ATOM   520   C  CA    . ILE A  1  67  ? 38.021   -46.198 61.004   1.00 120.70 ? 482  ILE B CA    1 
ATOM   521   C  C     . ILE A  1  67  ? 37.981   -46.641 62.475   1.00 117.93 ? 482  ILE B C     1 
ATOM   522   O  O     . ILE A  1  67  ? 38.328   -47.805 62.745   1.00 99.32  ? 482  ILE B O     1 
ATOM   523   C  CB    . ILE A  1  67  ? 39.202   -45.254 60.689   1.00 129.57 ? 482  ILE B CB    1 
ATOM   524   C  CG1   . ILE A  1  67  ? 39.365   -45.059 59.179   1.00 136.58 ? 482  ILE B CG1   1 
ATOM   525   C  CG2   . ILE A  1  67  ? 40.494   -45.739 61.338   1.00 131.37 ? 482  ILE B CG2   1 
ATOM   526   C  CD1   . ILE A  1  67  ? 40.229   -43.873 58.805   1.00 144.60 ? 482  ILE B CD1   1 
ATOM   527   N  N     . THR A  1  68  ? 37.556   -45.761 63.389   1.00 111.28 ? 483  THR B N     1 
ATOM   528   C  CA    . THR A  1  68  ? 37.515   -46.029 64.855   1.00 97.65  ? 483  THR B CA    1 
ATOM   529   C  C     . THR A  1  68  ? 36.550   -47.189 65.128   1.00 92.16  ? 483  THR B C     1 
ATOM   530   O  O     . THR A  1  68  ? 36.900   -48.062 65.940   1.00 95.39  ? 483  THR B O     1 
ATOM   531   C  CB    . THR A  1  68  ? 37.115   -44.779 65.655   1.00 89.55  ? 483  THR B CB    1 
ATOM   532   O  OG1   . THR A  1  68  ? 38.004   -43.722 65.303   1.00 77.73  ? 483  THR B OG1   1 
ATOM   533   C  CG2   . THR A  1  68  ? 37.151   -44.992 67.156   1.00 82.68  ? 483  THR B CG2   1 
ATOM   534   N  N     . ALA A  1  69  ? 35.384   -47.178 64.480   1.00 86.47  ? 484  ALA B N     1 
ATOM   535   C  CA    . ALA A  1  69  ? 34.282   -48.145 64.688   1.00 87.15  ? 484  ALA B CA    1 
ATOM   536   C  C     . ALA A  1  69  ? 34.742   -49.549 64.286   1.00 85.30  ? 484  ALA B C     1 
ATOM   537   O  O     . ALA A  1  69  ? 34.473   -50.495 65.060   1.00 76.86  ? 484  ALA B O     1 
ATOM   538   C  CB    . ALA A  1  69  ? 33.065   -47.724 63.899   1.00 95.60  ? 484  ALA B CB    1 
ATOM   539   N  N     . PHE A  1  70  ? 35.406   -49.672 63.129   1.00 88.55  ? 485  PHE B N     1 
ATOM   540   C  CA    . PHE A  1  70  ? 35.881   -50.962 62.560   1.00 96.69  ? 485  PHE B CA    1 
ATOM   541   C  C     . PHE A  1  70  ? 37.112   -51.451 63.340   1.00 101.14 ? 485  PHE B C     1 
ATOM   542   O  O     . PHE A  1  70  ? 37.263   -52.683 63.522   1.00 105.10 ? 485  PHE B O     1 
ATOM   543   C  CB    . PHE A  1  70  ? 36.180   -50.822 61.062   1.00 93.73  ? 485  PHE B CB    1 
ATOM   544   C  CG    . PHE A  1  70  ? 35.053   -50.308 60.196   1.00 94.14  ? 485  PHE B CG    1 
ATOM   545   C  CD1   . PHE A  1  70  ? 33.720   -50.522 60.516   1.00 93.13  ? 485  PHE B CD1   1 
ATOM   546   C  CD2   . PHE A  1  70  ? 35.338   -49.638 59.015   1.00 95.50  ? 485  PHE B CD2   1 
ATOM   547   C  CE1   . PHE A  1  70  ? 32.708   -50.053 59.688   1.00 91.16  ? 485  PHE B CE1   1 
ATOM   548   C  CE2   . PHE A  1  70  ? 34.324   -49.172 58.193   1.00 88.32  ? 485  PHE B CE2   1 
ATOM   549   C  CZ    . PHE A  1  70  ? 33.011   -49.383 58.527   1.00 89.82  ? 485  PHE B CZ    1 
ATOM   550   N  N     . GLY A  1  71  ? 37.969   -50.513 63.769   1.00 98.75  ? 486  GLY B N     1 
ATOM   551   C  CA    . GLY A  1  71  ? 39.197   -50.762 64.555   1.00 99.56  ? 486  GLY B CA    1 
ATOM   552   C  C     . GLY A  1  71  ? 40.248   -51.558 63.792   1.00 96.83  ? 486  GLY B C     1 
ATOM   553   O  O     . GLY A  1  71  ? 41.034   -52.265 64.450   1.00 99.74  ? 486  GLY B O     1 
ATOM   554   N  N     . THR A  1  72  ? 40.284   -51.448 62.458   1.00 91.30  ? 487  THR B N     1 
ATOM   555   C  CA    . THR A  1  72  ? 41.217   -52.192 61.573   1.00 92.00  ? 487  THR B CA    1 
ATOM   556   C  C     . THR A  1  72  ? 42.389   -51.305 61.144   1.00 88.95  ? 487  THR B C     1 
ATOM   557   O  O     . THR A  1  72  ? 43.408   -51.884 60.727   1.00 83.27  ? 487  THR B O     1 
ATOM   558   C  CB    . THR A  1  72  ? 40.517   -52.737 60.321   1.00 93.93  ? 487  THR B CB    1 
ATOM   559   O  OG1   . THR A  1  72  ? 40.063   -51.635 59.536   1.00 79.24  ? 487  THR B OG1   1 
ATOM   560   C  CG2   . THR A  1  72  ? 39.357   -53.659 60.633   1.00 99.39  ? 487  THR B CG2   1 
ATOM   561   N  N     . GLY A  1  73  ? 42.255   -49.973 61.231   1.00 90.16  ? 488  GLY B N     1 
ATOM   562   C  CA    . GLY A  1  73  ? 43.202   -49.020 60.614   1.00 92.30  ? 488  GLY B CA    1 
ATOM   563   C  C     . GLY A  1  73  ? 43.120   -49.076 59.095   1.00 88.30  ? 488  GLY B C     1 
ATOM   564   O  O     . GLY A  1  73  ? 42.236   -49.787 58.581   1.00 93.92  ? 488  GLY B O     1 
ATOM   565   N  N     . ILE A  1  74  ? 44.012   -48.382 58.385   1.00 83.98  ? 489  ILE B N     1 
ATOM   566   C  CA    . ILE A  1  74  ? 43.870   -48.150 56.913   1.00 88.35  ? 489  ILE B CA    1 
ATOM   567   C  C     . ILE A  1  74  ? 45.190   -48.438 56.181   1.00 100.28 ? 489  ILE B C     1 
ATOM   568   O  O     . ILE A  1  74  ? 46.266   -48.323 56.808   1.00 114.82 ? 489  ILE B O     1 
ATOM   569   C  CB    . ILE A  1  74  ? 43.361   -46.721 56.633   1.00 79.25  ? 489  ILE B CB    1 
ATOM   570   C  CG1   . ILE A  1  74  ? 44.121   -45.668 57.443   1.00 77.59  ? 489  ILE B CG1   1 
ATOM   571   C  CG2   . ILE A  1  74  ? 41.870   -46.630 56.876   1.00 78.32  ? 489  ILE B CG2   1 
ATOM   572   C  CD1   . ILE A  1  74  ? 44.193   -44.313 56.786   1.00 73.24  ? 489  ILE B CD1   1 
ATOM   573   N  N     . GLY A  1  75  ? 45.082   -48.794 54.893   1.00 100.87 ? 490  GLY B N     1 
ATOM   574   C  CA    . GLY A  1  75  ? 46.206   -48.969 53.951   1.00 92.65  ? 490  GLY B CA    1 
ATOM   575   C  C     . GLY A  1  75  ? 47.094   -50.137 54.343   1.00 87.14  ? 490  GLY B C     1 
ATOM   576   O  O     . GLY A  1  75  ? 46.573   -51.279 54.412   1.00 81.34  ? 490  GLY B O     1 
ATOM   577   N  N     . GLY A  1  76  ? 48.380   -49.855 54.593   1.00 84.30  ? 491  GLY B N     1 
ATOM   578   C  CA    . GLY A  1  76  ? 49.400   -50.827 55.028   1.00 86.77  ? 491  GLY B CA    1 
ATOM   579   C  C     . GLY A  1  76  ? 49.111   -51.375 56.413   1.00 91.01  ? 491  GLY B C     1 
ATOM   580   O  O     . GLY A  1  76  ? 49.223   -52.608 56.583   1.00 97.87  ? 491  GLY B O     1 
ATOM   581   N  N     . ASP A  1  77  ? 48.726   -50.509 57.363   1.00 92.77  ? 492  ASP B N     1 
ATOM   582   C  CA    . ASP A  1  77  ? 48.447   -50.876 58.782   1.00 91.39  ? 492  ASP B CA    1 
ATOM   583   C  C     . ASP A  1  77  ? 47.093   -51.583 58.923   1.00 96.56  ? 492  ASP B C     1 
ATOM   584   O  O     . ASP A  1  77  ? 46.761   -51.959 60.073   1.00 92.86  ? 492  ASP B O     1 
ATOM   585   C  CB    . ASP A  1  77  ? 48.467   -49.660 59.716   1.00 81.66  ? 492  ASP B CB    1 
ATOM   586   C  CG    . ASP A  1  77  ? 49.813   -48.954 59.727   1.00 75.87  ? 492  ASP B CG    1 
ATOM   587   O  OD1   . ASP A  1  77  ? 50.417   -48.892 58.657   1.00 77.08  ? 492  ASP B OD1   1 
ATOM   588   O  OD2   . ASP A  1  77  ? 50.267   -48.468 60.818   1.00 65.02  ? 492  ASP B OD2   1 
ATOM   589   N  N     . PHE A  1  78  ? 46.329   -51.748 57.835   1.00 104.49 ? 493  PHE B N     1 
ATOM   590   C  CA    . PHE A  1  78  ? 45.029   -52.469 57.862   1.00 117.85 ? 493  PHE B CA    1 
ATOM   591   C  C     . PHE A  1  78  ? 45.276   -53.900 58.358   1.00 118.41 ? 493  PHE B C     1 
ATOM   592   O  O     . PHE A  1  78  ? 46.165   -54.572 57.815   1.00 111.79 ? 493  PHE B O     1 
ATOM   593   C  CB    . PHE A  1  78  ? 44.315   -52.467 56.505   1.00 130.95 ? 493  PHE B CB    1 
ATOM   594   C  CG    . PHE A  1  78  ? 43.033   -53.267 56.523   1.00 142.46 ? 493  PHE B CG    1 
ATOM   595   C  CD1   . PHE A  1  78  ? 43.045   -54.624 56.235   1.00 135.45 ? 493  PHE B CD1   1 
ATOM   596   C  CD2   . PHE A  1  78  ? 41.829   -52.686 56.903   1.00 156.31 ? 493  PHE B CD2   1 
ATOM   597   C  CE1   . PHE A  1  78  ? 41.874   -55.367 56.290   1.00 138.19 ? 493  PHE B CE1   1 
ATOM   598   C  CE2   . PHE A  1  78  ? 40.664   -53.436 56.955   1.00 153.37 ? 493  PHE B CE2   1 
ATOM   599   C  CZ    . PHE A  1  78  ? 40.686   -54.771 56.637   1.00 143.82 ? 493  PHE B CZ    1 
ATOM   600   N  N     . ASP A  1  79  ? 44.505   -54.327 59.363   1.00 130.29 ? 494  ASP B N     1 
ATOM   601   C  CA    . ASP A  1  79  ? 44.592   -55.659 60.020   1.00 135.63 ? 494  ASP B CA    1 
ATOM   602   C  C     . ASP A  1  79  ? 43.185   -56.271 60.101   1.00 134.66 ? 494  ASP B C     1 
ATOM   603   O  O     . ASP A  1  79  ? 42.400   -55.832 60.976   1.00 128.77 ? 494  ASP B O     1 
ATOM   604   C  CB    . ASP A  1  79  ? 45.233   -55.515 61.405   1.00 143.75 ? 494  ASP B CB    1 
ATOM   605   C  CG    . ASP A  1  79  ? 45.311   -56.806 62.199   1.00 153.84 ? 494  ASP B CG    1 
ATOM   606   O  OD1   . ASP A  1  79  ? 44.924   -57.865 61.654   1.00 160.28 ? 494  ASP B OD1   1 
ATOM   607   O  OD2   . ASP A  1  79  ? 45.756   -56.738 63.362   1.00 166.67 ? 494  ASP B OD2   1 
ATOM   608   N  N     . LEU A  1  80  ? 42.888   -57.263 59.251   1.00 128.36 ? 495  LEU B N     1 
ATOM   609   C  CA    . LEU A  1  80  ? 41.536   -57.881 59.116   1.00 126.84 ? 495  LEU B CA    1 
ATOM   610   C  C     . LEU A  1  80  ? 41.115   -58.557 60.430   1.00 125.52 ? 495  LEU B C     1 
ATOM   611   O  O     . LEU A  1  80  ? 39.900   -58.635 60.678   1.00 123.64 ? 495  LEU B O     1 
ATOM   612   C  CB    . LEU A  1  80  ? 41.543   -58.886 57.958   1.00 126.78 ? 495  LEU B CB    1 
ATOM   613   C  CG    . LEU A  1  80  ? 40.240   -59.655 57.738   1.00 129.71 ? 495  LEU B CG    1 
ATOM   614   C  CD1   . LEU A  1  80  ? 39.150   -58.766 57.158   1.00 127.52 ? 495  LEU B CD1   1 
ATOM   615   C  CD2   . LEU A  1  80  ? 40.469   -60.846 56.824   1.00 135.19 ? 495  LEU B CD2   1 
ATOM   616   N  N     . ALA A  1  81  ? 42.069   -59.032 61.239   1.00 126.05 ? 496  ALA B N     1 
ATOM   617   C  CA    . ALA A  1  81  ? 41.814   -59.797 62.486   1.00 117.84 ? 496  ALA B CA    1 
ATOM   618   C  C     . ALA A  1  81  ? 41.376   -58.864 63.627   1.00 107.57 ? 496  ALA B C     1 
ATOM   619   O  O     . ALA A  1  81  ? 40.724   -59.367 64.562   1.00 85.90  ? 496  ALA B O     1 
ATOM   620   C  CB    . ALA A  1  81  ? 43.043   -60.587 62.860   1.00 116.97 ? 496  ALA B CB    1 
ATOM   621   N  N     . LYS A  1  82  ? 41.720   -57.568 63.559   1.00 112.72 ? 497  LYS B N     1 
ATOM   622   C  CA    . LYS A  1  82  ? 41.354   -56.540 64.579   1.00 114.42 ? 497  LYS B CA    1 
ATOM   623   C  C     . LYS A  1  82  ? 39.954   -55.970 64.273   1.00 115.05 ? 497  LYS B C     1 
ATOM   624   O  O     . LYS A  1  82  ? 39.500   -55.087 65.032   1.00 106.31 ? 497  LYS B O     1 
ATOM   625   C  CB    . LYS A  1  82  ? 42.430   -55.446 64.645   1.00 105.07 ? 497  LYS B CB    1 
ATOM   626   N  N     . ALA A  1  83  ? 39.286   -56.460 63.219   1.00 120.88 ? 498  ALA B N     1 
ATOM   627   C  CA    . ALA A  1  83  ? 37.913   -56.061 62.818   1.00 123.34 ? 498  ALA B CA    1 
ATOM   628   C  C     . ALA A  1  83  ? 36.936   -56.345 63.967   1.00 120.70 ? 498  ALA B C     1 
ATOM   629   O  O     . ALA A  1  83  ? 36.977   -57.458 64.527   1.00 124.19 ? 498  ALA B O     1 
ATOM   630   C  CB    . ALA A  1  83  ? 37.492   -56.780 61.552   1.00 132.44 ? 498  ALA B CB    1 
ATOM   631   N  N     . ARG A  1  84  ? 36.077   -55.373 64.275   1.00 119.15 ? 499  ARG B N     1 
ATOM   632   C  CA    . ARG A  1  84  ? 35.129   -55.394 65.424   1.00 111.16 ? 499  ARG B CA    1 
ATOM   633   C  C     . ARG A  1  84  ? 33.743   -55.869 64.956   1.00 103.38 ? 499  ARG B C     1 
ATOM   634   O  O     . ARG A  1  84  ? 32.901   -56.141 65.833   1.00 94.48  ? 499  ARG B O     1 
ATOM   635   C  CB    . ARG A  1  84  ? 35.133   -54.002 66.064   1.00 109.02 ? 499  ARG B CB    1 
ATOM   636   C  CG    . ARG A  1  84  ? 34.353   -53.864 67.364   1.00 110.41 ? 499  ARG B CG    1 
ATOM   637   C  CD    . ARG A  1  84  ? 34.864   -52.754 68.235   1.00 110.31 ? 499  ARG B CD    1 
ATOM   638   N  NE    . ARG A  1  84  ? 34.347   -51.449 67.865   1.00 108.60 ? 499  ARG B NE    1 
ATOM   639   C  CZ    . ARG A  1  84  ? 34.441   -50.383 68.643   1.00 104.43 ? 499  ARG B CZ    1 
ATOM   640   N  NH1   . ARG A  1  84  ? 35.102   -50.451 69.789   1.00 99.69  ? 499  ARG B NH1   1 
ATOM   641   N  NH2   . ARG A  1  84  ? 33.995   -49.210 68.226   1.00 107.32 ? 499  ARG B NH2   1 
ATOM   642   N  N     . TYR A  1  85  ? 33.523   -55.979 63.637   1.00 102.37 ? 500  TYR B N     1 
ATOM   643   C  CA    . TYR A  1  85  ? 32.287   -56.509 62.988   1.00 102.32 ? 500  TYR B CA    1 
ATOM   644   C  C     . TYR A  1  85  ? 32.716   -57.352 61.779   1.00 103.52 ? 500  TYR B C     1 
ATOM   645   O  O     . TYR A  1  85  ? 33.718   -56.982 61.141   1.00 101.14 ? 500  TYR B O     1 
ATOM   646   C  CB    . TYR A  1  85  ? 31.335   -55.366 62.584   1.00 102.06 ? 500  TYR B CB    1 
ATOM   647   C  CG    . TYR A  1  85  ? 31.153   -54.294 63.633   1.00 101.86 ? 500  TYR B CG    1 
ATOM   648   C  CD1   . TYR A  1  85  ? 30.145   -54.385 64.588   1.00 98.44  ? 500  TYR B CD1   1 
ATOM   649   C  CD2   . TYR A  1  85  ? 32.010   -53.199 63.700   1.00 92.31  ? 500  TYR B CD2   1 
ATOM   650   C  CE1   . TYR A  1  85  ? 29.996   -53.419 65.574   1.00 92.19  ? 500  TYR B CE1   1 
ATOM   651   C  CE2   . TYR A  1  85  ? 31.871   -52.230 64.682   1.00 86.85  ? 500  TYR B CE2   1 
ATOM   652   C  CZ    . TYR A  1  85  ? 30.862   -52.339 65.623   1.00 87.17  ? 500  TYR B CZ    1 
ATOM   653   O  OH    . TYR A  1  85  ? 30.723   -51.390 66.596   1.00 85.68  ? 500  TYR B OH    1 
ATOM   654   N  N     . HIS A  1  86  ? 32.021   -58.461 61.497   1.00 106.52 ? 501  HIS B N     1 
ATOM   655   C  CA    . HIS A  1  86  ? 32.276   -59.350 60.325   1.00 100.85 ? 501  HIS B CA    1 
ATOM   656   C  C     . HIS A  1  86  ? 31.211   -59.089 59.249   1.00 97.16  ? 501  HIS B C     1 
ATOM   657   O  O     . HIS A  1  86  ? 31.231   -59.788 58.204   1.00 102.77 ? 501  HIS B O     1 
ATOM   658   C  CB    . HIS A  1  86  ? 32.351   -60.826 60.757   1.00 94.84  ? 501  HIS B CB    1 
ATOM   659   C  CG    . HIS A  1  86  ? 33.653   -61.233 61.372   1.00 92.52  ? 501  HIS B CG    1 
ATOM   660   N  ND1   . HIS A  1  86  ? 34.169   -62.509 61.232   1.00 91.98  ? 501  HIS B ND1   1 
ATOM   661   C  CD2   . HIS A  1  86  ? 34.539   -60.552 62.134   1.00 93.36  ? 501  HIS B CD2   1 
ATOM   662   C  CE1   . HIS A  1  86  ? 35.312   -62.596 61.879   1.00 94.38  ? 501  HIS B CE1   1 
ATOM   663   N  NE2   . HIS A  1  86  ? 35.564   -61.406 62.442   1.00 97.42  ? 501  HIS B NE2   1 
ATOM   664   N  N     . LYS A  1  87  ? 30.320   -58.122 59.503   1.00 84.82  ? 502  LYS B N     1 
ATOM   665   C  CA    . LYS A  1  87  ? 29.316   -57.592 58.544   1.00 71.21  ? 502  LYS B CA    1 
ATOM   666   C  C     . LYS A  1  87  ? 29.241   -56.067 58.703   1.00 67.74  ? 502  LYS B C     1 
ATOM   667   O  O     . LYS A  1  87  ? 28.705   -55.599 59.720   1.00 67.17  ? 502  LYS B O     1 
ATOM   668   C  CB    . LYS A  1  87  ? 27.943   -58.229 58.783   1.00 70.83  ? 502  LYS B CB    1 
ATOM   669   C  CG    . LYS A  1  87  ? 27.804   -59.698 58.400   1.00 68.80  ? 502  LYS B CG    1 
ATOM   670   C  CD    . LYS A  1  87  ? 26.448   -59.979 57.766   1.00 68.20  ? 502  LYS B CD    1 
ATOM   671   C  CE    . LYS A  1  87  ? 26.105   -61.442 57.662   1.00 61.22  ? 502  LYS B CE    1 
ATOM   672   N  NZ    . LYS A  1  87  ? 26.160   -62.073 58.991   1.00 64.43  ? 502  LYS B NZ    1 
ATOM   673   N  N     . ILE A  1  88  ? 29.800   -55.327 57.745   1.00 68.79  ? 503  ILE B N     1 
ATOM   674   C  CA    . ILE A  1  88  ? 29.604   -53.858 57.575   1.00 63.52  ? 503  ILE B CA    1 
ATOM   675   C  C     . ILE A  1  88  ? 28.506   -53.679 56.523   1.00 57.07  ? 503  ILE B C     1 
ATOM   676   O  O     . ILE A  1  88  ? 28.777   -53.965 55.344   1.00 49.67  ? 503  ILE B O     1 
ATOM   677   C  CB    . ILE A  1  88  ? 30.931   -53.170 57.183   1.00 73.87  ? 503  ILE B CB    1 
ATOM   678   C  CG1   . ILE A  1  88  ? 31.995   -53.310 58.276   1.00 84.18  ? 503  ILE B CG1   1 
ATOM   679   C  CG2   . ILE A  1  88  ? 30.709   -51.707 56.840   1.00 79.71  ? 503  ILE B CG2   1 
ATOM   680   C  CD1   . ILE A  1  88  ? 32.839   -54.561 58.169   1.00 87.79  ? 503  ILE B CD1   1 
ATOM   681   N  N     . VAL A  1  89  ? 27.310   -53.254 56.944   1.00 60.64  ? 504  VAL B N     1 
ATOM   682   C  CA    . VAL A  1  89  ? 26.100   -53.121 56.073   1.00 66.95  ? 504  VAL B CA    1 
ATOM   683   C  C     . VAL A  1  89  ? 25.899   -51.646 55.694   1.00 69.22  ? 504  VAL B C     1 
ATOM   684   O  O     . VAL A  1  89  ? 25.673   -50.819 56.597   1.00 65.38  ? 504  VAL B O     1 
ATOM   685   C  CB    . VAL A  1  89  ? 24.840   -53.684 56.762   1.00 67.53  ? 504  VAL B CB    1 
ATOM   686   C  CG1   . VAL A  1  89  ? 23.692   -53.853 55.782   1.00 69.30  ? 504  VAL B CG1   1 
ATOM   687   C  CG2   . VAL A  1  89  ? 25.123   -54.999 57.472   1.00 66.65  ? 504  VAL B CG2   1 
ATOM   688   N  N     . ILE A  1  90  ? 26.000   -51.340 54.399   1.00 75.22  ? 505  ILE B N     1 
ATOM   689   C  CA    . ILE A  1  90  ? 25.650   -50.019 53.795   1.00 82.00  ? 505  ILE B CA    1 
ATOM   690   C  C     . ILE A  1  90  ? 24.132   -50.004 53.601   1.00 82.30  ? 505  ILE B C     1 
ATOM   691   O  O     . ILE A  1  90  ? 23.645   -50.783 52.773   1.00 81.60  ? 505  ILE B O     1 
ATOM   692   C  CB    . ILE A  1  90  ? 26.421   -49.794 52.479   1.00 86.94  ? 505  ILE B CB    1 
ATOM   693   C  CG1   . ILE A  1  90  ? 27.936   -49.723 52.719   1.00 93.09  ? 505  ILE B CG1   1 
ATOM   694   C  CG2   . ILE A  1  90  ? 25.922   -48.559 51.746   1.00 90.26  ? 505  ILE B CG2   1 
ATOM   695   C  CD1   . ILE A  1  90  ? 28.768   -49.854 51.462   1.00 98.97  ? 505  ILE B CD1   1 
ATOM   696   N  N     . MET A  1  91  ? 23.417   -49.175 54.363   1.00 84.08  ? 506  MET B N     1 
ATOM   697   C  CA    . MET A  1  91  ? 21.934   -49.074 54.325   1.00 80.33  ? 506  MET B CA    1 
ATOM   698   C  C     . MET A  1  91  ? 21.536   -47.640 53.962   1.00 76.16  ? 506  MET B C     1 
ATOM   699   O  O     . MET A  1  91  ? 21.111   -46.873 54.844   1.00 63.30  ? 506  MET B O     1 
ATOM   700   C  CB    . MET A  1  91  ? 21.333   -49.478 55.672   1.00 82.13  ? 506  MET B CB    1 
ATOM   701   C  CG    . MET A  1  91  ? 19.847   -49.782 55.602   1.00 81.39  ? 506  MET B CG    1 
ATOM   702   S  SD    . MET A  1  91  ? 19.320   -50.818 56.995   1.00 76.85  ? 506  MET B SD    1 
ATOM   703   C  CE    . MET A  1  91  ? 19.318   -49.605 58.312   1.00 82.08  ? 506  MET B CE    1 
ATOM   704   N  N     . THR A  1  92  ? 21.704   -47.294 52.686   1.00 83.78  ? 507  THR B N     1 
ATOM   705   C  CA    . THR A  1  92  ? 21.297   -45.997 52.087   1.00 96.54  ? 507  THR B CA    1 
ATOM   706   C  C     . THR A  1  92  ? 19.874   -46.129 51.547   1.00 108.85 ? 507  THR B C     1 
ATOM   707   O  O     . THR A  1  92  ? 19.445   -47.275 51.307   1.00 102.91 ? 507  THR B O     1 
ATOM   708   C  CB    . THR A  1  92  ? 22.271   -45.560 50.990   1.00 96.96  ? 507  THR B CB    1 
ATOM   709   O  OG1   . THR A  1  92  ? 22.279   -46.581 49.990   1.00 105.32 ? 507  THR B OG1   1 
ATOM   710   C  CG2   . THR A  1  92  ? 23.673   -45.315 51.507   1.00 96.06  ? 507  THR B CG2   1 
ATOM   711   N  N     . ASP A  1  93  ? 19.181   -44.996 51.368   1.00 120.17 ? 508  ASP B N     1 
ATOM   712   C  CA    . ASP A  1  93  ? 17.780   -44.941 50.866   1.00 126.91 ? 508  ASP B CA    1 
ATOM   713   C  C     . ASP A  1  93  ? 17.734   -45.524 49.454   1.00 111.20 ? 508  ASP B C     1 
ATOM   714   O  O     . ASP A  1  93  ? 18.784   -45.640 48.834   1.00 90.07  ? 508  ASP B O     1 
ATOM   715   C  CB    . ASP A  1  93  ? 17.179   -43.531 50.963   1.00 141.32 ? 508  ASP B CB    1 
ATOM   716   C  CG    . ASP A  1  93  ? 16.617   -43.180 52.329   1.00 148.93 ? 508  ASP B CG    1 
ATOM   717   O  OD1   . ASP A  1  93  ? 16.379   -44.106 53.102   1.00 172.66 ? 508  ASP B OD1   1 
ATOM   718   O  OD2   . ASP A  1  93  ? 16.477   -41.988 52.627   1.00 148.38 ? 508  ASP B OD2   1 
ATOM   719   N  N     . ALA A  1  94  ? 16.524   -45.856 48.993   1.00 109.90 ? 509  ALA B N     1 
ATOM   720   C  CA    . ALA A  1  94  ? 16.220   -46.505 47.696   1.00 118.37 ? 509  ALA B CA    1 
ATOM   721   C  C     . ALA A  1  94  ? 16.104   -45.451 46.586   1.00 119.05 ? 509  ALA B C     1 
ATOM   722   O  O     . ALA A  1  94  ? 15.464   -45.751 45.551   1.00 116.51 ? 509  ALA B O     1 
ATOM   723   C  CB    . ALA A  1  94  ? 14.942   -47.306 47.841   1.00 123.25 ? 509  ALA B CB    1 
ATOM   724   N  N     . ASP A  1  95  ? 16.735   -44.280 46.766   1.00 131.58 ? 510  ASP B N     1 
ATOM   725   C  CA    . ASP A  1  95  ? 16.647   -43.112 45.847   1.00 148.35 ? 510  ASP B CA    1 
ATOM   726   C  C     . ASP A  1  95  ? 18.000   -42.911 45.142   1.00 146.34 ? 510  ASP B C     1 
ATOM   727   O  O     . ASP A  1  95  ? 18.861   -43.810 45.225   1.00 160.00 ? 510  ASP B O     1 
ATOM   728   C  CB    . ASP A  1  95  ? 16.128   -41.874 46.598   1.00 174.27 ? 510  ASP B CB    1 
ATOM   729   C  CG    . ASP A  1  95  ? 16.916   -41.451 47.835   1.00 197.07 ? 510  ASP B CG    1 
ATOM   730   O  OD1   . ASP A  1  95  ? 18.145   -41.690 47.879   1.00 207.61 ? 510  ASP B OD1   1 
ATOM   731   O  OD2   . ASP A  1  95  ? 16.294   -40.880 48.751   1.00 220.29 ? 510  ASP B OD2   1 
ATOM   732   N  N     . VAL A  1  96  ? 18.176   -41.781 44.456   1.00 128.70 ? 511  VAL B N     1 
ATOM   733   C  CA    . VAL A  1  96  ? 19.385   -41.491 43.633   1.00 113.13 ? 511  VAL B CA    1 
ATOM   734   C  C     . VAL A  1  96  ? 20.517   -41.003 44.549   1.00 101.51 ? 511  VAL B C     1 
ATOM   735   O  O     . VAL A  1  96  ? 21.677   -41.344 44.264   1.00 95.13  ? 511  VAL B O     1 
ATOM   736   C  CB    . VAL A  1  96  ? 19.059   -40.485 42.512   1.00 107.35 ? 511  VAL B CB    1 
ATOM   737   C  CG1   . VAL A  1  96  ? 17.866   -40.956 41.685   1.00 104.21 ? 511  VAL B CG1   1 
ATOM   738   C  CG2   . VAL A  1  96  ? 18.840   -39.076 43.049   1.00 101.37 ? 511  VAL B CG2   1 
ATOM   739   N  N     . ASP A  1  97  ? 20.203   -40.229 45.596   1.00 87.25  ? 512  ASP B N     1 
ATOM   740   C  CA    . ASP A  1  97  ? 21.220   -39.681 46.538   1.00 76.66  ? 512  ASP B CA    1 
ATOM   741   C  C     . ASP A  1  97  ? 21.705   -40.806 47.460   1.00 73.54  ? 512  ASP B C     1 
ATOM   742   O  O     . ASP A  1  97  ? 22.844   -40.699 47.983   1.00 63.55  ? 512  ASP B O     1 
ATOM   743   C  CB    . ASP A  1  97  ? 20.688   -38.487 47.331   1.00 64.67  ? 512  ASP B CB    1 
ATOM   744   N  N     . GLY A  1  98  ? 20.866   -41.833 47.645   1.00 80.56  ? 513  GLY B N     1 
ATOM   745   C  CA    . GLY A  1  98  ? 21.251   -43.107 48.271   1.00 84.86  ? 513  GLY B CA    1 
ATOM   746   C  C     . GLY A  1  98  ? 22.340   -43.784 47.463   1.00 77.74  ? 513  GLY B C     1 
ATOM   747   O  O     . GLY A  1  98  ? 23.393   -44.118 48.041   1.00 74.71  ? 513  GLY B O     1 
ATOM   748   N  N     . ALA A  1  99  ? 22.112   -43.939 46.158   1.00 72.37  ? 514  ALA B N     1 
ATOM   749   C  CA    . ALA A  1  99  ? 23.055   -44.576 45.213   1.00 79.52  ? 514  ALA B CA    1 
ATOM   750   C  C     . ALA A  1  99  ? 24.395   -43.835 45.252   1.00 90.80  ? 514  ALA B C     1 
ATOM   751   O  O     . ALA A  1  99  ? 25.437   -44.514 45.259   1.00 113.66 ? 514  ALA B O     1 
ATOM   752   C  CB    . ALA A  1  99  ? 22.484   -44.617 43.816   1.00 78.80  ? 514  ALA B CB    1 
ATOM   753   N  N     . HIS A  1  100 ? 24.385   -42.497 45.315   1.00 86.66  ? 515  HIS B N     1 
ATOM   754   C  CA    . HIS A  1  100 ? 25.627   -41.684 45.368   1.00 83.83  ? 515  HIS B CA    1 
ATOM   755   C  C     . HIS A  1  100 ? 26.402   -41.980 46.653   1.00 79.79  ? 515  HIS B C     1 
ATOM   756   O  O     . HIS A  1  100 ? 27.607   -42.233 46.532   1.00 86.37  ? 515  HIS B O     1 
ATOM   757   C  CB    . HIS A  1  100 ? 25.343   -40.187 45.218   1.00 88.72  ? 515  HIS B CB    1 
ATOM   758   C  CG    . HIS A  1  100 ? 26.575   -39.391 44.940   1.00 91.08  ? 515  HIS B CG    1 
ATOM   759   N  ND1   . HIS A  1  100 ? 26.775   -38.142 45.473   1.00 96.76  ? 515  HIS B ND1   1 
ATOM   760   C  CD2   . HIS A  1  100 ? 27.681   -39.671 44.217   1.00 90.36  ? 515  HIS B CD2   1 
ATOM   761   C  CE1   . HIS A  1  100 ? 27.941   -37.676 45.081   1.00 97.74  ? 515  HIS B CE1   1 
ATOM   762   N  NE2   . HIS A  1  100 ? 28.515   -38.591 44.303   1.00 89.97  ? 515  HIS B NE2   1 
ATOM   763   N  N     . ILE A  1  101 ? 25.749   -41.957 47.825   1.00 80.41  ? 516  ILE B N     1 
ATOM   764   C  CA    . ILE A  1  101 ? 26.426   -42.194 49.137   1.00 83.33  ? 516  ILE B CA    1 
ATOM   765   C  C     . ILE A  1  101 ? 26.948   -43.635 49.156   1.00 91.13  ? 516  ILE B C     1 
ATOM   766   O  O     . ILE A  1  101 ? 28.007   -43.871 49.779   1.00 112.83 ? 516  ILE B O     1 
ATOM   767   C  CB    . ILE A  1  101 ? 25.521   -41.891 50.347   1.00 82.70  ? 516  ILE B CB    1 
ATOM   768   C  CG1   . ILE A  1  101 ? 25.048   -40.436 50.357   1.00 81.64  ? 516  ILE B CG1   1 
ATOM   769   C  CG2   . ILE A  1  101 ? 26.242   -42.249 51.644   1.00 88.77  ? 516  ILE B CG2   1 
ATOM   770   C  CD1   . ILE A  1  101 ? 24.028   -40.102 51.428   1.00 83.78  ? 516  ILE B CD1   1 
ATOM   771   N  N     . ARG A  1  102 ? 26.245   -44.553 48.481   1.00 88.67  ? 517  ARG B N     1 
ATOM   772   C  CA    . ARG A  1  102 ? 26.688   -45.962 48.316   1.00 73.40  ? 517  ARG B CA    1 
ATOM   773   C  C     . ARG A  1  102 ? 27.997   -46.007 47.509   1.00 67.78  ? 517  ARG B C     1 
ATOM   774   O  O     . ARG A  1  102 ? 28.944   -46.642 48.003   1.00 68.51  ? 517  ARG B O     1 
ATOM   775   C  CB    . ARG A  1  102 ? 25.589   -46.805 47.663   1.00 65.28  ? 517  ARG B CB    1 
ATOM   776   C  CG    . ARG A  1  102 ? 25.888   -48.292 47.666   1.00 61.20  ? 517  ARG B CG    1 
ATOM   777   C  CD    . ARG A  1  102 ? 24.639   -49.117 47.534   1.00 61.99  ? 517  ARG B CD    1 
ATOM   778   N  NE    . ARG A  1  102 ? 23.935   -48.811 46.301   1.00 58.07  ? 517  ARG B NE    1 
ATOM   779   C  CZ    . ARG A  1  102 ? 22.773   -48.182 46.225   1.00 57.45  ? 517  ARG B CZ    1 
ATOM   780   N  NH1   . ARG A  1  102 ? 22.150   -47.781 47.321   1.00 56.06  ? 517  ARG B NH1   1 
ATOM   781   N  NH2   . ARG A  1  102 ? 22.235   -47.948 45.038   1.00 60.14  ? 517  ARG B NH2   1 
ATOM   782   N  N     . THR A  1  103 ? 28.074   -45.342 46.346   1.00 59.04  ? 518  THR B N     1 
ATOM   783   C  CA    . THR A  1  103 ? 29.312   -45.291 45.510   1.00 60.92  ? 518  THR B CA    1 
ATOM   784   C  C     . THR A  1  103 ? 30.452   -44.617 46.285   1.00 57.60  ? 518  THR B C     1 
ATOM   785   O  O     . THR A  1  103 ? 31.611   -44.987 46.040   1.00 61.25  ? 518  THR B O     1 
ATOM   786   C  CB    . THR A  1  103 ? 29.150   -44.558 44.165   1.00 67.72  ? 518  THR B CB    1 
ATOM   787   O  OG1   . THR A  1  103 ? 28.960   -43.155 44.381   1.00 63.85  ? 518  THR B OG1   1 
ATOM   788   C  CG2   . THR A  1  103 ? 28.038   -45.123 43.305   1.00 73.03  ? 518  THR B CG2   1 
ATOM   789   N  N     . LEU A  1  104 ? 30.154   -43.657 47.162   1.00 54.84  ? 519  LEU B N     1 
ATOM   790   C  CA    . LEU A  1  104 ? 31.193   -42.853 47.861   1.00 56.94  ? 519  LEU B CA    1 
ATOM   791   C  C     . LEU A  1  104 ? 31.828   -43.708 48.959   1.00 62.17  ? 519  LEU B C     1 
ATOM   792   O  O     . LEU A  1  104 ? 33.068   -43.599 49.149   1.00 70.14  ? 519  LEU B O     1 
ATOM   793   C  CB    . LEU A  1  104 ? 30.572   -41.577 48.442   1.00 56.91  ? 519  LEU B CB    1 
ATOM   794   C  CG    . LEU A  1  104 ? 30.279   -40.469 47.436   1.00 63.81  ? 519  LEU B CG    1 
ATOM   795   C  CD1   . LEU A  1  104 ? 29.337   -39.445 48.027   1.00 72.79  ? 519  LEU B CD1   1 
ATOM   796   C  CD2   . LEU A  1  104 ? 31.542   -39.786 46.975   1.00 68.23  ? 519  LEU B CD2   1 
ATOM   797   N  N     . LEU A  1  105 ? 31.007   -44.508 49.654   1.00 60.38  ? 520  LEU B N     1 
ATOM   798   C  CA    . LEU A  1  105 ? 31.445   -45.418 50.746   1.00 56.45  ? 520  LEU B CA    1 
ATOM   799   C  C     . LEU A  1  105 ? 32.257   -46.566 50.142   1.00 58.04  ? 520  LEU B C     1 
ATOM   800   O  O     . LEU A  1  105 ? 33.346   -46.870 50.687   1.00 64.89  ? 520  LEU B O     1 
ATOM   801   C  CB    . LEU A  1  105 ? 30.217   -45.951 51.494   1.00 54.47  ? 520  LEU B CB    1 
ATOM   802   C  CG    . LEU A  1  105 ? 29.604   -45.018 52.536   1.00 50.35  ? 520  LEU B CG    1 
ATOM   803   C  CD1   . LEU A  1  105 ? 28.256   -45.557 52.999   1.00 48.52  ? 520  LEU B CD1   1 
ATOM   804   C  CD2   . LEU A  1  105 ? 30.559   -44.828 53.718   1.00 49.41  ? 520  LEU B CD2   1 
ATOM   805   N  N     . LEU A  1  106 ? 31.738   -47.183 49.070   1.00 56.31  ? 521  LEU B N     1 
ATOM   806   C  CA    . LEU A  1  106 ? 32.407   -48.288 48.336   1.00 56.25  ? 521  LEU B CA    1 
ATOM   807   C  C     . LEU A  1  106 ? 33.782   -47.823 47.845   1.00 58.96  ? 521  LEU B C     1 
ATOM   808   O  O     . LEU A  1  106 ? 34.727   -48.637 47.892   1.00 66.40  ? 521  LEU B O     1 
ATOM   809   C  CB    . LEU A  1  106 ? 31.522   -48.746 47.170   1.00 53.65  ? 521  LEU B CB    1 
ATOM   810   C  CG    . LEU A  1  106 ? 30.357   -49.653 47.548   1.00 52.79  ? 521  LEU B CG    1 
ATOM   811   C  CD1   . LEU A  1  106 ? 29.603   -50.092 46.300   1.00 54.56  ? 521  LEU B CD1   1 
ATOM   812   C  CD2   . LEU A  1  106 ? 30.834   -50.862 48.334   1.00 51.26  ? 521  LEU B CD2   1 
ATOM   813   N  N     . THR A  1  107 ? 33.898   -46.568 47.408   1.00 59.25  ? 522  THR B N     1 
ATOM   814   C  CA    . THR A  1  107 ? 35.172   -45.969 46.936   1.00 62.73  ? 522  THR B CA    1 
ATOM   815   C  C     . THR A  1  107 ? 36.143   -45.902 48.119   1.00 68.41  ? 522  THR B C     1 
ATOM   816   O  O     . THR A  1  107 ? 37.318   -46.232 47.912   1.00 64.91  ? 522  THR B O     1 
ATOM   817   C  CB    . THR A  1  107 ? 34.936   -44.619 46.253   1.00 58.13  ? 522  THR B CB    1 
ATOM   818   O  OG1   . THR A  1  107 ? 34.074   -44.884 45.148   1.00 50.82  ? 522  THR B OG1   1 
ATOM   819   C  CG2   . THR A  1  107 ? 36.213   -43.961 45.777   1.00 59.87  ? 522  THR B CG2   1 
ATOM   820   N  N     . PHE A  1  108 ? 35.665   -45.521 49.306   1.00 76.11  ? 523  PHE B N     1 
ATOM   821   C  CA    . PHE A  1  108 ? 36.489   -45.443 50.541   1.00 83.07  ? 523  PHE B CA    1 
ATOM   822   C  C     . PHE A  1  108 ? 36.962   -46.847 50.924   1.00 88.77  ? 523  PHE B C     1 
ATOM   823   O  O     . PHE A  1  108 ? 38.176   -47.021 51.149   1.00 102.87 ? 523  PHE B O     1 
ATOM   824   C  CB    . PHE A  1  108 ? 35.736   -44.787 51.700   1.00 87.24  ? 523  PHE B CB    1 
ATOM   825   C  CG    . PHE A  1  108 ? 36.413   -44.942 53.040   1.00 94.13  ? 523  PHE B CG    1 
ATOM   826   C  CD1   . PHE A  1  108 ? 37.647   -44.359 53.289   1.00 95.14  ? 523  PHE B CD1   1 
ATOM   827   C  CD2   . PHE A  1  108 ? 35.822   -45.676 54.053   1.00 103.35 ? 523  PHE B CD2   1 
ATOM   828   C  CE1   . PHE A  1  108 ? 38.267   -44.498 54.521   1.00 96.53  ? 523  PHE B CE1   1 
ATOM   829   C  CE2   . PHE A  1  108 ? 36.443   -45.820 55.286   1.00 102.93 ? 523  PHE B CE2   1 
ATOM   830   C  CZ    . PHE A  1  108 ? 37.663   -45.229 55.520   1.00 99.47  ? 523  PHE B CZ    1 
ATOM   831   N  N     . PHE A  1  109 ? 36.038   -47.810 50.995   1.00 90.62  ? 524  PHE B N     1 
ATOM   832   C  CA    . PHE A  1  109 ? 36.344   -49.214 51.376   1.00 90.41  ? 524  PHE B CA    1 
ATOM   833   C  C     . PHE A  1  109 ? 37.359   -49.807 50.389   1.00 96.20  ? 524  PHE B C     1 
ATOM   834   O  O     . PHE A  1  109 ? 38.306   -50.455 50.848   1.00 104.85 ? 524  PHE B O     1 
ATOM   835   C  CB    . PHE A  1  109 ? 35.076   -50.069 51.455   1.00 89.30  ? 524  PHE B CB    1 
ATOM   836   C  CG    . PHE A  1  109 ? 34.152   -49.726 52.594   1.00 86.87  ? 524  PHE B CG    1 
ATOM   837   C  CD1   . PHE A  1  109 ? 34.651   -49.290 53.811   1.00 83.21  ? 524  PHE B CD1   1 
ATOM   838   C  CD2   . PHE A  1  109 ? 32.778   -49.855 52.453   1.00 93.68  ? 524  PHE B CD2   1 
ATOM   839   C  CE1   . PHE A  1  109 ? 33.797   -48.967 54.852   1.00 83.69  ? 524  PHE B CE1   1 
ATOM   840   C  CE2   . PHE A  1  109 ? 31.924   -49.534 53.498   1.00 98.78  ? 524  PHE B CE2   1 
ATOM   841   C  CZ    . PHE A  1  109 ? 32.439   -49.095 54.699   1.00 91.29  ? 524  PHE B CZ    1 
ATOM   842   N  N     . TYR A  1  110 ? 37.189   -49.585 49.086   1.00 90.91  ? 525  TYR B N     1 
ATOM   843   C  CA    . TYR A  1  110 ? 38.034   -50.212 48.036   1.00 88.08  ? 525  TYR B CA    1 
ATOM   844   C  C     . TYR A  1  110 ? 39.448   -49.622 48.049   1.00 81.76  ? 525  TYR B C     1 
ATOM   845   O  O     . TYR A  1  110 ? 40.375   -50.346 47.701   1.00 71.36  ? 525  TYR B O     1 
ATOM   846   C  CB    . TYR A  1  110 ? 37.423   -50.078 46.637   1.00 90.20  ? 525  TYR B CB    1 
ATOM   847   C  CG    . TYR A  1  110 ? 38.236   -50.779 45.581   1.00 94.41  ? 525  TYR B CG    1 
ATOM   848   C  CD1   . TYR A  1  110 ? 38.143   -52.152 45.399   1.00 104.34 ? 525  TYR B CD1   1 
ATOM   849   C  CD2   . TYR A  1  110 ? 39.139   -50.082 44.800   1.00 98.66  ? 525  TYR B CD2   1 
ATOM   850   C  CE1   . TYR A  1  110 ? 38.886   -52.806 44.428   1.00 106.59 ? 525  TYR B CE1   1 
ATOM   851   C  CE2   . TYR A  1  110 ? 39.907   -50.725 43.841   1.00 105.05 ? 525  TYR B CE2   1 
ATOM   852   C  CZ    . TYR A  1  110 ? 39.798   -52.097 43.664   1.00 102.73 ? 525  TYR B CZ    1 
ATOM   853   O  OH    . TYR A  1  110 ? 40.557   -52.721 42.718   1.00 92.84  ? 525  TYR B OH    1 
ATOM   854   N  N     . ARG A  1  111 ? 39.607   -48.346 48.403   1.00 84.58  ? 526  ARG B N     1 
ATOM   855   C  CA    . ARG A  1  111 ? 40.919   -47.644 48.315   1.00 83.87  ? 526  ARG B CA    1 
ATOM   856   C  C     . ARG A  1  111 ? 41.683   -47.788 49.635   1.00 76.42  ? 526  ARG B C     1 
ATOM   857   O  O     . ARG A  1  111 ? 42.916   -47.750 49.576   1.00 75.40  ? 526  ARG B O     1 
ATOM   858   C  CB    . ARG A  1  111 ? 40.761   -46.165 47.933   1.00 84.49  ? 526  ARG B CB    1 
ATOM   859   C  CG    . ARG A  1  111 ? 40.457   -45.904 46.461   1.00 84.80  ? 526  ARG B CG    1 
ATOM   860   C  CD    . ARG A  1  111 ? 41.527   -46.396 45.489   1.00 89.96  ? 526  ARG B CD    1 
ATOM   861   N  NE    . ARG A  1  111 ? 41.113   -46.284 44.094   1.00 102.42 ? 526  ARG B NE    1 
ATOM   862   C  CZ    . ARG A  1  111 ? 41.590   -47.003 43.072   1.00 112.57 ? 526  ARG B CZ    1 
ATOM   863   N  NH1   . ARG A  1  111 ? 42.523   -47.922 43.269   1.00 113.55 ? 526  ARG B NH1   1 
ATOM   864   N  NH2   . ARG A  1  111 ? 41.127   -46.798 41.849   1.00 114.18 ? 526  ARG B NH2   1 
ATOM   865   N  N     . PHE A  1  112 ? 40.997   -47.934 50.773   1.00 72.70  ? 527  PHE B N     1 
ATOM   866   C  CA    . PHE A  1  112 ? 41.626   -47.827 52.121   1.00 71.88  ? 527  PHE B CA    1 
ATOM   867   C  C     . PHE A  1  112 ? 41.462   -49.105 52.950   1.00 71.09  ? 527  PHE B C     1 
ATOM   868   O  O     . PHE A  1  112 ? 42.215   -49.254 53.932   1.00 59.10  ? 527  PHE B O     1 
ATOM   869   C  CB    . PHE A  1  112 ? 41.057   -46.622 52.869   1.00 72.52  ? 527  PHE B CB    1 
ATOM   870   C  CG    . PHE A  1  112 ? 41.652   -45.314 52.423   1.00 71.06  ? 527  PHE B CG    1 
ATOM   871   C  CD1   . PHE A  1  112 ? 41.417   -44.834 51.147   1.00 72.02  ? 527  PHE B CD1   1 
ATOM   872   C  CD2   . PHE A  1  112 ? 42.453   -44.572 53.273   1.00 70.08  ? 527  PHE B CD2   1 
ATOM   873   C  CE1   . PHE A  1  112 ? 41.977   -43.639 50.723   1.00 76.16  ? 527  PHE B CE1   1 
ATOM   874   C  CE2   . PHE A  1  112 ? 43.013   -43.374 52.856   1.00 71.47  ? 527  PHE B CE2   1 
ATOM   875   C  CZ    . PHE A  1  112 ? 42.762   -42.905 51.584   1.00 78.40  ? 527  PHE B CZ    1 
ATOM   876   N  N     . MET A  1  113 ? 40.511   -49.975 52.604   1.00 79.74  ? 528  MET B N     1 
ATOM   877   C  CA    . MET A  1  113 ? 40.205   -51.216 53.363   1.00 87.98  ? 528  MET B CA    1 
ATOM   878   C  C     . MET A  1  113 ? 39.815   -52.327 52.384   1.00 94.28  ? 528  MET B C     1 
ATOM   879   O  O     . MET A  1  113 ? 38.794   -53.001 52.623   1.00 96.56  ? 528  MET B O     1 
ATOM   880   C  CB    . MET A  1  113 ? 39.052   -50.981 54.343   1.00 94.90  ? 528  MET B CB    1 
ATOM   881   C  CG    . MET A  1  113 ? 39.333   -49.909 55.362   1.00 102.45 ? 528  MET B CG    1 
ATOM   882   S  SD    . MET A  1  113 ? 37.890   -49.582 56.394   1.00 118.71 ? 528  MET B SD    1 
ATOM   883   C  CE    . MET A  1  113 ? 38.622   -48.529 57.640   1.00 116.27 ? 528  MET B CE    1 
ATOM   884   N  N     . ARG A  1  114 ? 40.598   -52.513 51.317   1.00 92.99  ? 529  ARG B N     1 
ATOM   885   C  CA    . ARG A  1  114 ? 40.277   -53.480 50.238   1.00 88.32  ? 529  ARG B CA    1 
ATOM   886   C  C     . ARG A  1  114 ? 40.118   -54.889 50.811   1.00 90.37  ? 529  ARG B C     1 
ATOM   887   O  O     . ARG A  1  114 ? 39.194   -55.596 50.409   1.00 88.58  ? 529  ARG B O     1 
ATOM   888   C  CB    . ARG A  1  114 ? 41.336   -53.434 49.136   1.00 82.66  ? 529  ARG B CB    1 
ATOM   889   C  CG    . ARG A  1  114 ? 40.969   -54.255 47.909   1.00 81.14  ? 529  ARG B CG    1 
ATOM   890   C  CD    . ARG A  1  114 ? 41.954   -53.994 46.787   1.00 79.12  ? 529  ARG B CD    1 
ATOM   891   N  NE    . ARG A  1  114 ? 42.402   -55.159 46.052   1.00 81.48  ? 529  ARG B NE    1 
ATOM   892   C  CZ    . ARG A  1  114 ? 43.077   -55.101 44.912   1.00 84.48  ? 529  ARG B CZ    1 
ATOM   893   N  NH1   . ARG A  1  114 ? 43.334   -53.927 44.356   1.00 89.85  ? 529  ARG B NH1   1 
ATOM   894   N  NH2   . ARG A  1  114 ? 43.471   -56.213 44.321   1.00 86.67  ? 529  ARG B NH2   1 
ATOM   895   N  N     . PRO A  1  115 ? 40.985   -55.351 51.749   1.00 90.25  ? 530  PRO B N     1 
ATOM   896   C  CA    . PRO A  1  115 ? 40.880   -56.710 52.290   1.00 105.69 ? 530  PRO B CA    1 
ATOM   897   C  C     . PRO A  1  115 ? 39.558   -57.027 53.016   1.00 123.65 ? 530  PRO B C     1 
ATOM   898   O  O     . PRO A  1  115 ? 39.189   -58.198 53.072   1.00 140.34 ? 530  PRO B O     1 
ATOM   899   C  CB    . PRO A  1  115 ? 42.052   -56.796 53.285   1.00 97.83  ? 530  PRO B CB    1 
ATOM   900   C  CG    . PRO A  1  115 ? 43.020   -55.727 52.832   1.00 85.69  ? 530  PRO B CG    1 
ATOM   901   C  CD    . PRO A  1  115 ? 42.134   -54.622 52.308   1.00 84.75  ? 530  PRO B CD    1 
ATOM   902   N  N     . LEU A  1  116 ? 38.897   -55.997 53.562   1.00 118.94 ? 531  LEU B N     1 
ATOM   903   C  CA    . LEU A  1  116 ? 37.528   -56.075 54.145   1.00 109.52 ? 531  LEU B CA    1 
ATOM   904   C  C     . LEU A  1  116 ? 36.529   -56.552 53.079   1.00 100.19 ? 531  LEU B C     1 
ATOM   905   O  O     . LEU A  1  116 ? 35.668   -57.381 53.411   1.00 85.50  ? 531  LEU B O     1 
ATOM   906   C  CB    . LEU A  1  116 ? 37.146   -54.688 54.665   1.00 116.66 ? 531  LEU B CB    1 
ATOM   907   C  CG    . LEU A  1  116 ? 36.113   -54.641 55.778   1.00 138.58 ? 531  LEU B CG    1 
ATOM   908   C  CD1   . LEU A  1  116 ? 36.662   -55.241 57.064   1.00 138.65 ? 531  LEU B CD1   1 
ATOM   909   C  CD2   . LEU A  1  116 ? 35.676   -53.199 55.991   1.00 149.27 ? 531  LEU B CD2   1 
ATOM   910   N  N     . ILE A  1  117 ? 36.632   -56.034 51.852   1.00 103.24 ? 532  ILE B N     1 
ATOM   911   C  CA    . ILE A  1  117 ? 35.754   -56.419 50.702   1.00 106.57 ? 532  ILE B CA    1 
ATOM   912   C  C     . ILE A  1  117 ? 36.098   -57.847 50.273   1.00 108.72 ? 532  ILE B C     1 
ATOM   913   O  O     . ILE A  1  117 ? 35.144   -58.621 50.013   1.00 109.25 ? 532  ILE B O     1 
ATOM   914   C  CB    . ILE A  1  117 ? 35.895   -55.438 49.521   1.00 104.88 ? 532  ILE B CB    1 
ATOM   915   C  CG1   . ILE A  1  117 ? 35.395   -54.039 49.889   1.00 106.38 ? 532  ILE B CG1   1 
ATOM   916   C  CG2   . ILE A  1  117 ? 35.180   -55.978 48.289   1.00 101.11 ? 532  ILE B CG2   1 
ATOM   917   C  CD1   . ILE A  1  117 ? 35.850   -52.950 48.969   1.00 103.69 ? 532  ILE B CD1   1 
ATOM   918   N  N     . GLU A  1  118 ? 37.401   -58.145 50.163   1.00 107.07 ? 533  GLU B N     1 
ATOM   919   C  CA    . GLU A  1  118 ? 37.951   -59.478 49.795   1.00 99.70  ? 533  GLU B CA    1 
ATOM   920   C  C     . GLU A  1  118 ? 37.396   -60.530 50.764   1.00 90.05  ? 533  GLU B C     1 
ATOM   921   O  O     . GLU A  1  118 ? 36.847   -61.529 50.279   1.00 72.31  ? 533  GLU B O     1 
ATOM   922   C  CB    . GLU A  1  118 ? 39.484   -59.457 49.799   1.00 90.78  ? 533  GLU B CB    1 
ATOM   923   N  N     . ALA A  1  119 ? 37.487   -60.276 52.076   1.00 89.92  ? 534  ALA B N     1 
ATOM   924   C  CA    . ALA A  1  119 ? 37.004   -61.167 53.165   1.00 84.43  ? 534  ALA B CA    1 
ATOM   925   C  C     . ALA A  1  119 ? 35.476   -61.349 53.122   1.00 82.79  ? 534  ALA B C     1 
ATOM   926   O  O     . ALA A  1  119 ? 34.978   -62.212 53.858   1.00 65.50  ? 534  ALA B O     1 
ATOM   927   C  CB    . ALA A  1  119 ? 37.447   -60.622 54.503   1.00 79.29  ? 534  ALA B CB    1 
ATOM   928   N  N     . GLY A  1  120 ? 34.757   -60.546 52.329   1.00 101.96 ? 535  GLY B N     1 
ATOM   929   C  CA    . GLY A  1  120 ? 33.288   -60.617 52.160   1.00 104.67 ? 535  GLY B CA    1 
ATOM   930   C  C     . GLY A  1  120 ? 32.540   -60.022 53.344   1.00 103.59 ? 535  GLY B C     1 
ATOM   931   O  O     . GLY A  1  120 ? 31.415   -60.491 53.616   1.00 92.84  ? 535  GLY B O     1 
ATOM   932   N  N     . TYR A  1  121 ? 33.127   -59.022 54.014   1.00 107.16 ? 536  TYR B N     1 
ATOM   933   C  CA    . TYR A  1  121 ? 32.581   -58.372 55.236   1.00 106.76 ? 536  TYR B CA    1 
ATOM   934   C  C     . TYR A  1  121 ? 31.687   -57.185 54.852   1.00 94.83  ? 536  TYR B C     1 
ATOM   935   O  O     . TYR A  1  121 ? 30.939   -56.697 55.724   1.00 98.83  ? 536  TYR B O     1 
ATOM   936   C  CB    . TYR A  1  121 ? 33.705   -57.882 56.155   1.00 113.52 ? 536  TYR B CB    1 
ATOM   937   C  CG    . TYR A  1  121 ? 34.434   -58.935 56.956   1.00 117.55 ? 536  TYR B CG    1 
ATOM   938   C  CD1   . TYR A  1  121 ? 34.337   -60.287 56.663   1.00 113.64 ? 536  TYR B CD1   1 
ATOM   939   C  CD2   . TYR A  1  121 ? 35.264   -58.560 58.002   1.00 119.70 ? 536  TYR B CD2   1 
ATOM   940   C  CE1   . TYR A  1  121 ? 35.026   -61.236 57.402   1.00 114.12 ? 536  TYR B CE1   1 
ATOM   941   C  CE2   . TYR A  1  121 ? 35.966   -59.493 58.747   1.00 117.99 ? 536  TYR B CE2   1 
ATOM   942   C  CZ    . TYR A  1  121 ? 35.845   -60.838 58.445   1.00 117.05 ? 536  TYR B CZ    1 
ATOM   943   O  OH    . TYR A  1  121 ? 36.526   -61.765 59.176   1.00 124.91 ? 536  TYR B OH    1 
ATOM   944   N  N     . VAL A  1  122 ? 31.777   -56.706 53.608   1.00 80.73  ? 537  VAL B N     1 
ATOM   945   C  CA    . VAL A  1  122 ? 30.971   -55.542 53.137   1.00 83.72  ? 537  VAL B CA    1 
ATOM   946   C  C     . VAL A  1  122 ? 29.702   -56.076 52.468   1.00 85.27  ? 537  VAL B C     1 
ATOM   947   O  O     . VAL A  1  122 ? 29.823   -56.927 51.559   1.00 77.39  ? 537  VAL B O     1 
ATOM   948   C  CB    . VAL A  1  122 ? 31.789   -54.616 52.214   1.00 78.58  ? 537  VAL B CB    1 
ATOM   949   C  CG1   . VAL A  1  122 ? 30.934   -53.504 51.620   1.00 74.97  ? 537  VAL B CG1   1 
ATOM   950   C  CG2   . VAL A  1  122 ? 32.984   -54.027 52.953   1.00 73.68  ? 537  VAL B CG2   1 
ATOM   951   N  N     . TYR A  1  123 ? 28.545   -55.601 52.940   1.00 94.92  ? 538  TYR B N     1 
ATOM   952   C  CA    . TYR A  1  123 ? 27.185   -55.930 52.437   1.00 101.85 ? 538  TYR B CA    1 
ATOM   953   C  C     . TYR A  1  123 ? 26.400   -54.646 52.127   1.00 104.22 ? 538  TYR B C     1 
ATOM   954   O  O     . TYR A  1  123 ? 26.784   -53.551 52.588   1.00 102.56 ? 538  TYR B O     1 
ATOM   955   C  CB    . TYR A  1  123 ? 26.414   -56.754 53.472   1.00 112.77 ? 538  TYR B CB    1 
ATOM   956   C  CG    . TYR A  1  123 ? 27.038   -58.077 53.827   1.00 118.15 ? 538  TYR B CG    1 
ATOM   957   C  CD1   . TYR A  1  123 ? 28.106   -58.146 54.708   1.00 121.49 ? 538  TYR B CD1   1 
ATOM   958   C  CD2   . TYR A  1  123 ? 26.545   -59.264 53.308   1.00 118.88 ? 538  TYR B CD2   1 
ATOM   959   C  CE1   . TYR A  1  123 ? 28.685   -59.356 55.049   1.00 125.20 ? 538  TYR B CE1   1 
ATOM   960   C  CE2   . TYR A  1  123 ? 27.114   -60.485 53.637   1.00 119.41 ? 538  TYR B CE2   1 
ATOM   961   C  CZ    . TYR A  1  123 ? 28.188   -60.528 54.509   1.00 122.57 ? 538  TYR B CZ    1 
ATOM   962   O  OH    . TYR A  1  123 ? 28.765   -61.713 54.847   1.00 135.37 ? 538  TYR B OH    1 
ATOM   963   N  N     . ILE A  1  124 ? 25.301   -54.801 51.383   1.00 105.89 ? 539  ILE B N     1 
ATOM   964   C  CA    . ILE A  1  124 ? 24.393   -53.714 50.914   1.00 106.72 ? 539  ILE B CA    1 
ATOM   965   C  C     . ILE A  1  124 ? 22.948   -54.113 51.230   1.00 108.12 ? 539  ILE B C     1 
ATOM   966   O  O     . ILE A  1  124 ? 22.404   -54.964 50.506   1.00 116.58 ? 539  ILE B O     1 
ATOM   967   C  CB    . ILE A  1  124 ? 24.602   -53.468 49.404   1.00 108.32 ? 539  ILE B CB    1 
ATOM   968   C  CG1   . ILE A  1  124 ? 25.965   -52.839 49.110   1.00 107.44 ? 539  ILE B CG1   1 
ATOM   969   C  CG2   . ILE A  1  124 ? 23.467   -52.652 48.802   1.00 113.70 ? 539  ILE B CG2   1 
ATOM   970   C  CD1   . ILE A  1  124 ? 26.277   -52.763 47.635   1.00 112.38 ? 539  ILE B CD1   1 
ATOM   971   N  N     . ALA A  1  125 ? 22.341   -53.514 52.258   1.00 104.90 ? 540  ALA B N     1 
ATOM   972   C  CA    . ALA A  1  125 ? 20.913   -53.695 52.624   1.00 105.52 ? 540  ALA B CA    1 
ATOM   973   C  C     . ALA A  1  125 ? 20.031   -53.265 51.442   1.00 111.61 ? 540  ALA B C     1 
ATOM   974   O  O     . ALA A  1  125 ? 20.497   -52.486 50.605   1.00 115.30 ? 540  ALA B O     1 
ATOM   975   C  CB    . ALA A  1  125 ? 20.582   -52.908 53.865   1.00 100.28 ? 540  ALA B CB    1 
ATOM   976   N  N     . GLN A  1  126 ? 18.805   -53.771 51.382   1.00 113.94 ? 541  GLN B N     1 
ATOM   977   C  CA    . GLN A  1  126 ? 17.849   -53.520 50.275   1.00 115.98 ? 541  GLN B CA    1 
ATOM   978   C  C     . GLN A  1  126 ? 16.492   -53.163 50.870   1.00 117.93 ? 541  GLN B C     1 
ATOM   979   O  O     . GLN A  1  126 ? 15.593   -54.000 50.908   1.00 132.53 ? 541  GLN B O     1 
ATOM   980   C  CB    . GLN A  1  126 ? 17.748   -54.739 49.367   1.00 116.37 ? 541  GLN B CB    1 
ATOM   981   C  CG    . GLN A  1  126 ? 19.026   -55.037 48.609   1.00 115.41 ? 541  GLN B CG    1 
ATOM   982   C  CD    . GLN A  1  126 ? 18.812   -56.214 47.690   1.00 106.55 ? 541  GLN B CD    1 
ATOM   983   O  OE1   . GLN A  1  126 ? 19.228   -57.332 47.982   1.00 108.22 ? 541  GLN B OE1   1 
ATOM   984   N  NE2   . GLN A  1  126 ? 18.115   -55.988 46.588   1.00 92.86  ? 541  GLN B NE2   1 
ATOM   985   N  N     . PRO A  1  127 ? 16.294   -51.910 51.341   1.00 119.46 ? 542  PRO B N     1 
ATOM   986   C  CA    . PRO A  1  127 ? 14.999   -51.495 51.884   1.00 120.99 ? 542  PRO B CA    1 
ATOM   987   C  C     . PRO A  1  127 ? 13.908   -51.571 50.812   1.00 120.68 ? 542  PRO B C     1 
ATOM   988   O  O     . PRO A  1  127 ? 14.187   -51.352 49.634   1.00 116.59 ? 542  PRO B O     1 
ATOM   989   C  CB    . PRO A  1  127 ? 15.244   -50.046 52.345   1.00 120.29 ? 542  PRO B CB    1 
ATOM   990   C  CG    . PRO A  1  127 ? 16.439   -49.583 51.526   1.00 116.33 ? 542  PRO B CG    1 
ATOM   991   C  CD    . PRO A  1  127 ? 17.286   -50.827 51.342   1.00 115.65 ? 542  PRO B CD    1 
ATOM   992   N  N     . PRO A  1  128 ? 12.654   -51.930 51.183   1.00 111.80 ? 543  PRO B N     1 
ATOM   993   C  CA    . PRO A  1  128 ? 11.670   -52.348 50.188   1.00 104.65 ? 543  PRO B CA    1 
ATOM   994   C  C     . PRO A  1  128 ? 11.276   -51.171 49.289   1.00 99.36  ? 543  PRO B C     1 
ATOM   995   O  O     . PRO A  1  128 ? 11.180   -51.449 48.124   1.00 82.57  ? 543  PRO B O     1 
ATOM   996   C  CB    . PRO A  1  128 ? 10.476   -52.883 51.007   1.00 103.87 ? 543  PRO B CB    1 
ATOM   997   C  CG    . PRO A  1  128 ? 10.679   -52.362 52.443   1.00 105.66 ? 543  PRO B CG    1 
ATOM   998   C  CD    . PRO A  1  128 ? 12.160   -52.064 52.559   1.00 106.32 ? 543  PRO B CD    1 
ATOM   999   N  N     . LYS A  1  129 ? 9.180    -43.188 50.780   1.00 102.96 ? 581  LYS B N     1 
ATOM   1000  C  CA    . LYS A  1  129 ? 10.217   -43.354 49.720   1.00 93.23  ? 581  LYS B CA    1 
ATOM   1001  C  C     . LYS A  1  129 ? 11.511   -43.895 50.336   1.00 86.50  ? 581  LYS B C     1 
ATOM   1002  O  O     . LYS A  1  129 ? 12.041   -44.896 49.815   1.00 68.36  ? 581  LYS B O     1 
ATOM   1003  C  CB    . LYS A  1  129 ? 10.484   -42.021 49.011   1.00 84.25  ? 581  LYS B CB    1 
ATOM   1004  N  N     . GLY A  1  130 ? 11.994   -43.227 51.392   1.00 93.80  ? 582  GLY B N     1 
ATOM   1005  C  CA    . GLY A  1  130 ? 13.209   -43.554 52.151   1.00 102.92 ? 582  GLY B CA    1 
ATOM   1006  C  C     . GLY A  1  130 ? 12.876   -44.353 53.398   1.00 110.39 ? 582  GLY B C     1 
ATOM   1007  O  O     . GLY A  1  130 ? 11.665   -44.592 53.651   1.00 117.28 ? 582  GLY B O     1 
ATOM   1008  N  N     . LEU A  1  131 ? 13.885   -44.868 54.100   1.00 102.89 ? 583  LEU B N     1 
ATOM   1009  C  CA    . LEU A  1  131 ? 13.701   -45.639 55.354   1.00 100.53 ? 583  LEU B CA    1 
ATOM   1010  C  C     . LEU A  1  131 ? 13.789   -44.684 56.557   1.00 111.94 ? 583  LEU B C     1 
ATOM   1011  O  O     . LEU A  1  131 ? 13.429   -45.109 57.683   1.00 128.15 ? 583  LEU B O     1 
ATOM   1012  C  CB    . LEU A  1  131 ? 14.732   -46.769 55.409   1.00 93.45  ? 583  LEU B CB    1 
ATOM   1013  C  CG    . LEU A  1  131 ? 16.199   -46.362 55.295   1.00 92.49  ? 583  LEU B CG    1 
ATOM   1014  C  CD1   . LEU A  1  131 ? 16.813   -46.106 56.674   1.00 92.76  ? 583  LEU B CD1   1 
ATOM   1015  C  CD2   . LEU A  1  131 ? 17.011   -47.410 54.528   1.00 91.69  ? 583  LEU B CD2   1 
ATOM   1016  N  N     . GLY A  1  132 ? 14.216   -43.430 56.343   1.00 117.14 ? 584  GLY B N     1 
ATOM   1017  C  CA    . GLY A  1  132 ? 14.126   -42.334 57.336   1.00 121.94 ? 584  GLY B CA    1 
ATOM   1018  C  C     . GLY A  1  132 ? 12.678   -41.944 57.621   1.00 128.47 ? 584  GLY B C     1 
ATOM   1019  O  O     . GLY A  1  132 ? 12.440   -41.258 58.645   1.00 132.44 ? 584  GLY B O     1 
ATOM   1020  N  N     . GLU A  1  133 ? 11.755   -42.357 56.729   1.00 118.64 ? 585  GLU B N     1 
ATOM   1021  C  CA    . GLU A  1  133 ? 10.288   -42.082 56.749   1.00 108.26 ? 585  GLU B CA    1 
ATOM   1022  C  C     . GLU A  1  133 ? 9.506    -43.314 57.229   1.00 111.48 ? 585  GLU B C     1 
ATOM   1023  O  O     . GLU A  1  133 ? 8.296    -43.175 57.475   1.00 115.38 ? 585  GLU B O     1 
ATOM   1024  C  CB    . GLU A  1  133 ? 9.820    -41.655 55.350   1.00 93.40  ? 585  GLU B CB    1 
ATOM   1025  C  CG    . GLU A  1  133 ? 10.356   -40.309 54.884   1.00 92.43  ? 585  GLU B CG    1 
ATOM   1026  C  CD    . GLU A  1  133 ? 11.510   -40.330 53.881   1.00 94.41  ? 585  GLU B CD    1 
ATOM   1027  O  OE1   . GLU A  1  133 ? 12.553   -40.913 54.230   1.00 100.09 ? 585  GLU B OE1   1 
ATOM   1028  O  OE2   . GLU A  1  133 ? 11.357   -39.825 52.766   1.00 85.13  ? 585  GLU B OE2   1 
ATOM   1029  N  N     . MET A  1  134 ? 10.134   -44.490 57.331   1.00 115.88 ? 586  MET B N     1 
ATOM   1030  C  CA    . MET A  1  134 ? 9.487    -45.742 57.800   1.00 123.59 ? 586  MET B CA    1 
ATOM   1031  C  C     . MET A  1  134 ? 9.500    -45.792 59.337   1.00 119.81 ? 586  MET B C     1 
ATOM   1032  O  O     . MET A  1  134 ? 10.388   -45.120 59.940   1.00 111.05 ? 586  MET B O     1 
ATOM   1033  C  CB    . MET A  1  134 ? 10.216   -46.975 57.248   1.00 121.51 ? 586  MET B CB    1 
ATOM   1034  C  CG    . MET A  1  134 ? 10.107   -47.152 55.763   1.00 109.93 ? 586  MET B CG    1 
ATOM   1035  S  SD    . MET A  1  134 ? 11.301   -48.395 55.154   1.00 116.05 ? 586  MET B SD    1 
ATOM   1036  C  CE    . MET A  1  134 ? 10.645   -49.940 55.795   1.00 104.60 ? 586  MET B CE    1 
ATOM   1037  N  N     . ASN A  1  135 ? 8.628    -46.621 59.917   1.00 120.40 ? 587  ASN B N     1 
ATOM   1038  C  CA    . ASN A  1  135 ? 8.606    -46.971 61.356   1.00 121.47 ? 587  ASN B CA    1 
ATOM   1039  C  C     . ASN A  1  135 ? 9.614    -48.102 61.602   1.00 118.29 ? 587  ASN B C     1 
ATOM   1040  O  O     . ASN A  1  135 ? 9.911    -48.872 60.663   1.00 112.76 ? 587  ASN B O     1 
ATOM   1041  C  CB    . ASN A  1  135 ? 7.205    -47.412 61.818   1.00 112.89 ? 587  ASN B CB    1 
ATOM   1042  C  CG    . ASN A  1  135 ? 6.156    -46.329 61.716   1.00 104.44 ? 587  ASN B CG    1 
ATOM   1043  O  OD1   . ASN A  1  135 ? 6.461    -45.137 61.663   1.00 106.45 ? 587  ASN B OD1   1 
ATOM   1044  N  ND2   . ASN A  1  135 ? 4.908    -46.755 61.705   1.00 91.19  ? 587  ASN B ND2   1 
ATOM   1045  N  N     . ALA A  1  136 ? 10.097   -48.200 62.847   1.00 108.53 ? 588  ALA B N     1 
ATOM   1046  C  CA    . ALA A  1  136 ? 11.110   -49.167 63.316   1.00 104.23 ? 588  ALA B CA    1 
ATOM   1047  C  C     . ALA A  1  136 ? 10.610   -50.614 63.166   1.00 104.45 ? 588  ALA B C     1 
ATOM   1048  O  O     . ALA A  1  136 ? 11.428   -51.459 62.769   1.00 110.86 ? 588  ALA B O     1 
ATOM   1049  C  CB    . ALA A  1  136 ? 11.475   -48.824 64.740   1.00 100.82 ? 588  ALA B CB    1 
ATOM   1050  N  N     . ASP A  1  137 ? 9.336    -50.899 63.470   1.00 95.64  ? 589  ASP B N     1 
ATOM   1051  C  CA    . ASP A  1  137 ? 8.751    -52.268 63.406   1.00 96.81  ? 589  ASP B CA    1 
ATOM   1052  C  C     . ASP A  1  137 ? 8.938    -52.835 61.991   1.00 111.40 ? 589  ASP B C     1 
ATOM   1053  O  O     . ASP A  1  137 ? 9.357    -54.016 61.853   1.00 128.59 ? 589  ASP B O     1 
ATOM   1054  C  CB    . ASP A  1  137 ? 7.271    -52.267 63.809   1.00 87.24  ? 589  ASP B CB    1 
ATOM   1055  N  N     . GLN A  1  138 ? 8.648    -52.010 60.979   1.00 115.85 ? 590  GLN B N     1 
ATOM   1056  C  CA    . GLN A  1  138 ? 8.603    -52.405 59.543   1.00 109.93 ? 590  GLN B CA    1 
ATOM   1057  C  C     . GLN A  1  138 ? 10.033   -52.441 58.990   1.00 99.65  ? 590  GLN B C     1 
ATOM   1058  O  O     . GLN A  1  138 ? 10.327   -53.337 58.178   1.00 101.62 ? 590  GLN B O     1 
ATOM   1059  C  CB    . GLN A  1  138 ? 7.672    -51.445 58.794   1.00 113.41 ? 590  GLN B CB    1 
ATOM   1060  C  CG    . GLN A  1  138 ? 7.420    -51.767 57.330   1.00 109.53 ? 590  GLN B CG    1 
ATOM   1061  C  CD    . GLN A  1  138 ? 7.053    -50.508 56.576   1.00 107.97 ? 590  GLN B CD    1 
ATOM   1062  O  OE1   . GLN A  1  138 ? 6.938    -49.430 57.154   1.00 89.30  ? 590  GLN B OE1   1 
ATOM   1063  N  NE2   . GLN A  1  138 ? 6.872    -50.635 55.272   1.00 113.81 ? 590  GLN B NE2   1 
ATOM   1064  N  N     . LEU A  1  139 ? 10.888   -51.521 59.447   1.00 92.51  ? 591  LEU B N     1 
ATOM   1065  C  CA    . LEU A  1  139 ? 12.324   -51.412 59.069   1.00 85.15  ? 591  LEU B CA    1 
ATOM   1066  C  C     . LEU A  1  139 ? 13.090   -52.655 59.541   1.00 74.41  ? 591  LEU B C     1 
ATOM   1067  O  O     . LEU A  1  139 ? 13.985   -53.104 58.809   1.00 68.47  ? 591  LEU B O     1 
ATOM   1068  C  CB    . LEU A  1  139 ? 12.893   -50.145 59.710   1.00 93.84  ? 591  LEU B CB    1 
ATOM   1069  C  CG    . LEU A  1  139 ? 14.332   -49.790 59.342   1.00 101.33 ? 591  LEU B CG    1 
ATOM   1070  C  CD1   . LEU A  1  139 ? 14.487   -49.594 57.841   1.00 104.52 ? 591  LEU B CD1   1 
ATOM   1071  C  CD2   . LEU A  1  139 ? 14.775   -48.536 60.082   1.00 108.05 ? 591  LEU B CD2   1 
ATOM   1072  N  N     . TRP A  1  140 ? 12.761   -53.176 60.724   1.00 83.04  ? 592  TRP B N     1 
ATOM   1073  C  CA    . TRP A  1  140 ? 13.343   -54.428 61.281   1.00 87.76  ? 592  TRP B CA    1 
ATOM   1074  C  C     . TRP A  1  140 ? 12.956   -55.612 60.389   1.00 92.54  ? 592  TRP B C     1 
ATOM   1075  O  O     . TRP A  1  140 ? 13.868   -56.338 59.943   1.00 96.34  ? 592  TRP B O     1 
ATOM   1076  C  CB    . TRP A  1  140 ? 12.904   -54.640 62.741   1.00 84.97  ? 592  TRP B CB    1 
ATOM   1077  C  CG    . TRP A  1  140 ? 13.032   -56.048 63.233   1.00 88.33  ? 592  TRP B CG    1 
ATOM   1078  C  CD1   . TRP A  1  140 ? 12.031   -56.970 63.347   1.00 89.22  ? 592  TRP B CD1   1 
ATOM   1079  C  CD2   . TRP A  1  140 ? 14.234   -56.708 63.673   1.00 91.13  ? 592  TRP B CD2   1 
ATOM   1080  N  NE1   . TRP A  1  140 ? 12.524   -58.154 63.822   1.00 89.67  ? 592  TRP B NE1   1 
ATOM   1081  C  CE2   . TRP A  1  140 ? 13.871   -58.026 64.033   1.00 88.12  ? 592  TRP B CE2   1 
ATOM   1082  C  CE3   . TRP A  1  140 ? 15.576   -56.326 63.788   1.00 88.11  ? 592  TRP B CE3   1 
ATOM   1083  C  CZ2   . TRP A  1  140 ? 14.799   -58.952 64.505   1.00 79.76  ? 592  TRP B CZ2   1 
ATOM   1084  C  CZ3   . TRP A  1  140 ? 16.493   -57.243 64.257   1.00 83.81  ? 592  TRP B CZ3   1 
ATOM   1085  C  CH2   . TRP A  1  140 ? 16.106   -58.536 64.612   1.00 79.52  ? 592  TRP B CH2   1 
ATOM   1086  N  N     . GLU A  1  141 ? 11.656   -55.779 60.123   1.00 100.14 ? 593  GLU B N     1 
ATOM   1087  C  CA    . GLU A  1  141 ? 11.079   -57.017 59.528   1.00 99.88  ? 593  GLU B CA    1 
ATOM   1088  C  C     . GLU A  1  141 ? 11.552   -57.186 58.075   1.00 95.17  ? 593  GLU B C     1 
ATOM   1089  O  O     . GLU A  1  141 ? 11.799   -58.345 57.670   1.00 95.80  ? 593  GLU B O     1 
ATOM   1090  C  CB    . GLU A  1  141 ? 9.551    -57.005 59.647   1.00 101.55 ? 593  GLU B CB    1 
ATOM   1091  N  N     . THR A  1  142 ? 11.701   -56.086 57.331   1.00 87.09  ? 594  THR B N     1 
ATOM   1092  C  CA    . THR A  1  142 ? 12.039   -56.087 55.882   1.00 82.31  ? 594  THR B CA    1 
ATOM   1093  C  C     . THR A  1  142 ? 13.561   -56.114 55.665   1.00 81.83  ? 594  THR B C     1 
ATOM   1094  O  O     . THR A  1  142 ? 13.996   -56.794 54.719   1.00 72.31  ? 594  THR B O     1 
ATOM   1095  C  CB    . THR A  1  142 ? 11.408   -54.883 55.167   1.00 79.74  ? 594  THR B CB    1 
ATOM   1096  O  OG1   . THR A  1  142 ? 11.928   -53.678 55.732   1.00 75.64  ? 594  THR B OG1   1 
ATOM   1097  C  CG2   . THR A  1  142 ? 9.894    -54.888 55.255   1.00 78.30  ? 594  THR B CG2   1 
ATOM   1098  N  N     . THR A  1  143 ? 14.344   -55.422 56.503   1.00 79.23  ? 595  THR B N     1 
ATOM   1099  C  CA    . THR A  1  143 ? 15.719   -54.966 56.157   1.00 70.67  ? 595  THR B CA    1 
ATOM   1100  C  C     . THR A  1  143 ? 16.791   -55.438 57.150   1.00 75.46  ? 595  THR B C     1 
ATOM   1101  O  O     . THR A  1  143 ? 17.932   -55.604 56.688   1.00 71.54  ? 595  THR B O     1 
ATOM   1102  C  CB    . THR A  1  143 ? 15.737   -53.439 56.055   1.00 71.99  ? 595  THR B CB    1 
ATOM   1103  O  OG1   . THR A  1  143 ? 14.555   -53.081 55.336   1.00 68.23  ? 595  THR B OG1   1 
ATOM   1104  C  CG2   . THR A  1  143 ? 16.979   -52.888 55.382   1.00 77.03  ? 595  THR B CG2   1 
ATOM   1105  N  N     . MET A  1  144 ? 16.476   -55.601 58.443   1.00 91.33  ? 596  MET B N     1 
ATOM   1106  C  CA    . MET A  1  144 ? 17.479   -55.841 59.527   1.00 103.44 ? 596  MET B CA    1 
ATOM   1107  C  C     . MET A  1  144 ? 17.329   -57.229 60.169   1.00 103.15 ? 596  MET B C     1 
ATOM   1108  O  O     . MET A  1  144 ? 18.293   -57.658 60.828   1.00 86.99  ? 596  MET B O     1 
ATOM   1109  C  CB    . MET A  1  144 ? 17.343   -54.801 60.645   1.00 110.67 ? 596  MET B CB    1 
ATOM   1110  C  CG    . MET A  1  144 ? 17.441   -53.366 60.171   1.00 109.41 ? 596  MET B CG    1 
ATOM   1111  S  SD    . MET A  1  144 ? 17.491   -52.214 61.564   1.00 116.37 ? 596  MET B SD    1 
ATOM   1112  C  CE    . MET A  1  144 ? 19.138   -52.548 62.194   1.00 123.45 ? 596  MET B CE    1 
ATOM   1113  N  N     . ASN A  1  145 ? 16.167   -57.879 60.045   1.00 124.49 ? 597  ASN B N     1 
ATOM   1114  C  CA    . ASN A  1  145 ? 15.878   -59.195 60.681   1.00 134.42 ? 597  ASN B CA    1 
ATOM   1115  C  C     . ASN A  1  145 ? 16.577   -60.296 59.884   1.00 131.88 ? 597  ASN B C     1 
ATOM   1116  O  O     . ASN A  1  145 ? 16.220   -60.526 58.730   1.00 124.92 ? 597  ASN B O     1 
ATOM   1117  C  CB    . ASN A  1  145 ? 14.372   -59.471 60.773   1.00 136.28 ? 597  ASN B CB    1 
ATOM   1118  C  CG    . ASN A  1  145 ? 14.046   -60.759 61.499   1.00 134.28 ? 597  ASN B CG    1 
ATOM   1119  O  OD1   . ASN A  1  145 ? 14.857   -61.272 62.266   1.00 146.48 ? 597  ASN B OD1   1 
ATOM   1120  N  ND2   . ASN A  1  145 ? 12.860   -61.296 61.265   1.00 128.68 ? 597  ASN B ND2   1 
ATOM   1121  N  N     . PRO A  1  146 ? 17.571   -61.017 60.453   1.00 123.74 ? 598  PRO B N     1 
ATOM   1122  C  CA    . PRO A  1  146 ? 18.269   -62.075 59.717   1.00 109.51 ? 598  PRO B CA    1 
ATOM   1123  C  C     . PRO A  1  146 ? 17.351   -63.197 59.198   1.00 95.71  ? 598  PRO B C     1 
ATOM   1124  O  O     . PRO A  1  146 ? 17.777   -63.965 58.370   1.00 78.40  ? 598  PRO B O     1 
ATOM   1125  C  CB    . PRO A  1  146 ? 19.286   -62.661 60.718   1.00 110.45 ? 598  PRO B CB    1 
ATOM   1126  C  CG    . PRO A  1  146 ? 18.932   -62.073 62.083   1.00 113.39 ? 598  PRO B CG    1 
ATOM   1127  C  CD    . PRO A  1  146 ? 18.080   -60.852 61.821   1.00 123.35 ? 598  PRO B CD    1 
ATOM   1128  N  N     . GLU A  1  147 ? 16.121   -63.270 59.711   1.00 95.52  ? 599  GLU B N     1 
ATOM   1129  C  CA    . GLU A  1  147 ? 15.121   -64.299 59.331   1.00 103.47 ? 599  GLU B CA    1 
ATOM   1130  C  C     . GLU A  1  147 ? 14.487   -63.957 57.978   1.00 96.50  ? 599  GLU B C     1 
ATOM   1131  O  O     . GLU A  1  147 ? 14.197   -64.907 57.238   1.00 108.25 ? 599  GLU B O     1 
ATOM   1132  C  CB    . GLU A  1  147 ? 14.056   -64.447 60.417   1.00 114.26 ? 599  GLU B CB    1 
ATOM   1133  C  CG    . GLU A  1  147 ? 14.620   -64.850 61.773   1.00 117.35 ? 599  GLU B CG    1 
ATOM   1134  C  CD    . GLU A  1  147 ? 13.598   -65.160 62.852   1.00 125.11 ? 599  GLU B CD    1 
ATOM   1135  O  OE1   . GLU A  1  147 ? 14.016   -65.332 64.009   1.00 133.70 ? 599  GLU B OE1   1 
ATOM   1136  O  OE2   . GLU A  1  147 ? 12.392   -65.259 62.536   1.00 125.00 ? 599  GLU B OE2   1 
ATOM   1137  N  N     . HIS A  1  148 ? 14.262   -62.677 57.659   1.00 93.62  ? 600  HIS B N     1 
ATOM   1138  C  CA    . HIS A  1  148 ? 13.526   -62.264 56.429   1.00 89.45  ? 600  HIS B CA    1 
ATOM   1139  C  C     . HIS A  1  148 ? 14.322   -61.282 55.547   1.00 88.00  ? 600  HIS B C     1 
ATOM   1140  O  O     . HIS A  1  148 ? 13.870   -61.076 54.406   1.00 86.01  ? 600  HIS B O     1 
ATOM   1141  C  CB    . HIS A  1  148 ? 12.152   -61.692 56.804   1.00 82.12  ? 600  HIS B CB    1 
ATOM   1142  N  N     . ARG A  1  149 ? 15.429   -60.697 56.027   1.00 80.56  ? 601  ARG B N     1 
ATOM   1143  C  CA    . ARG A  1  149 ? 16.150   -59.614 55.295   1.00 76.21  ? 601  ARG B CA    1 
ATOM   1144  C  C     . ARG A  1  149 ? 16.860   -60.195 54.074   1.00 65.69  ? 601  ARG B C     1 
ATOM   1145  O  O     . ARG A  1  149 ? 17.077   -61.418 54.047   1.00 69.85  ? 601  ARG B O     1 
ATOM   1146  C  CB    . ARG A  1  149 ? 17.200   -58.922 56.169   1.00 85.49  ? 601  ARG B CB    1 
ATOM   1147  C  CG    . ARG A  1  149 ? 18.489   -59.712 56.367   1.00 93.66  ? 601  ARG B CG    1 
ATOM   1148  C  CD    . ARG A  1  149 ? 19.275   -59.147 57.527   1.00 96.95  ? 601  ARG B CD    1 
ATOM   1149  N  NE    . ARG A  1  149 ? 20.552   -59.811 57.735   1.00 97.10  ? 601  ARG B NE    1 
ATOM   1150  C  CZ    . ARG A  1  149 ? 21.338   -59.611 58.788   1.00 93.37  ? 601  ARG B CZ    1 
ATOM   1151  N  NH1   . ARG A  1  149 ? 20.983   -58.748 59.726   1.00 86.89  ? 601  ARG B NH1   1 
ATOM   1152  N  NH2   . ARG A  1  149 ? 22.483   -60.262 58.897   1.00 98.52  ? 601  ARG B NH2   1 
ATOM   1153  N  N     . ALA A  1  150 ? 17.239   -59.329 53.132   1.00 57.72  ? 602  ALA B N     1 
ATOM   1154  C  CA    . ALA A  1  150 ? 17.904   -59.671 51.857   1.00 59.57  ? 602  ALA B CA    1 
ATOM   1155  C  C     . ALA A  1  150 ? 19.139   -58.784 51.657   1.00 62.01  ? 602  ALA B C     1 
ATOM   1156  O  O     . ALA A  1  150 ? 19.029   -57.794 50.915   1.00 61.94  ? 602  ALA B O     1 
ATOM   1157  C  CB    . ALA A  1  150 ? 16.908   -59.507 50.731   1.00 56.27  ? 602  ALA B CB    1 
ATOM   1158  N  N     . LEU A  1  151 ? 20.261   -59.122 52.297   1.00 61.21  ? 603  LEU B N     1 
ATOM   1159  C  CA    . LEU A  1  151 ? 21.561   -58.412 52.106   1.00 62.28  ? 603  LEU B CA    1 
ATOM   1160  C  C     . LEU A  1  151 ? 22.198   -58.880 50.795   1.00 61.33  ? 603  LEU B C     1 
ATOM   1161  O  O     . LEU A  1  151 ? 21.989   -60.046 50.422   1.00 53.86  ? 603  LEU B O     1 
ATOM   1162  C  CB    . LEU A  1  151 ? 22.503   -58.677 53.282   1.00 65.48  ? 603  LEU B CB    1 
ATOM   1163  C  CG    . LEU A  1  151 ? 21.935   -58.364 54.662   1.00 70.11  ? 603  LEU B CG    1 
ATOM   1164  C  CD1   . LEU A  1  151 ? 23.053   -58.337 55.699   1.00 68.35  ? 603  LEU B CD1   1 
ATOM   1165  C  CD2   . LEU A  1  151 ? 21.172   -57.043 54.633   1.00 74.45  ? 603  LEU B CD2   1 
ATOM   1166  N  N     . LEU A  1  152 ? 22.905   -57.980 50.109   1.00 62.77  ? 604  LEU B N     1 
ATOM   1167  C  CA    . LEU A  1  152 ? 23.798   -58.301 48.972   1.00 67.21  ? 604  LEU B CA    1 
ATOM   1168  C  C     . LEU A  1  152 ? 25.230   -58.248 49.506   1.00 73.74  ? 604  LEU B C     1 
ATOM   1169  O  O     . LEU A  1  152 ? 25.605   -57.214 50.076   1.00 69.98  ? 604  LEU B O     1 
ATOM   1170  C  CB    . LEU A  1  152 ? 23.572   -57.291 47.843   1.00 60.08  ? 604  LEU B CB    1 
ATOM   1171  N  N     . GLN A  1  153 ? 25.976   -59.343 49.383   1.00 82.68  ? 605  GLN B N     1 
ATOM   1172  C  CA    . GLN A  1  153 ? 27.413   -59.388 49.760   1.00 87.58  ? 605  GLN B CA    1 
ATOM   1173  C  C     . GLN A  1  153 ? 28.229   -58.819 48.595   1.00 93.12  ? 605  GLN B C     1 
ATOM   1174  O  O     . GLN A  1  153 ? 28.072   -59.326 47.467   1.00 102.15 ? 605  GLN B O     1 
ATOM   1175  C  CB    . GLN A  1  153 ? 27.837   -60.816 50.100   1.00 87.27  ? 605  GLN B CB    1 
ATOM   1176  C  CG    . GLN A  1  153 ? 29.283   -60.907 50.561   1.00 86.76  ? 605  GLN B CG    1 
ATOM   1177  C  CD    . GLN A  1  153 ? 29.680   -62.307 50.932   1.00 90.48  ? 605  GLN B CD    1 
ATOM   1178  O  OE1   . GLN A  1  153 ? 29.232   -63.278 50.328   1.00 105.20 ? 605  GLN B OE1   1 
ATOM   1179  N  NE2   . GLN A  1  153 ? 30.530   -62.417 51.933   1.00 96.17  ? 605  GLN B NE2   1 
ATOM   1180  N  N     . VAL A  1  154 ? 29.054   -57.802 48.847   1.00 96.05  ? 606  VAL B N     1 
ATOM   1181  C  CA    . VAL A  1  154 ? 29.911   -57.177 47.798   1.00 102.54 ? 606  VAL B CA    1 
ATOM   1182  C  C     . VAL A  1  154 ? 31.081   -58.128 47.528   1.00 108.97 ? 606  VAL B C     1 
ATOM   1183  O  O     . VAL A  1  154 ? 31.882   -58.359 48.484   1.00 111.95 ? 606  VAL B O     1 
ATOM   1184  C  CB    . VAL A  1  154 ? 30.399   -55.771 48.199   1.00 109.57 ? 606  VAL B CB    1 
ATOM   1185  C  CG1   . VAL A  1  154 ? 31.287   -55.151 47.126   1.00 107.26 ? 606  VAL B CG1   1 
ATOM   1186  C  CG2   . VAL A  1  154 ? 29.234   -54.844 48.514   1.00 115.64 ? 606  VAL B CG2   1 
ATOM   1187  N  N     . LYS A  1  155 ? 31.135   -58.670 46.302   1.00 114.50 ? 607  LYS B N     1 
ATOM   1188  C  CA    . LYS A  1  155 ? 32.180   -59.614 45.813   1.00 125.34 ? 607  LYS B CA    1 
ATOM   1189  C  C     . LYS A  1  155 ? 33.059   -58.880 44.793   1.00 129.39 ? 607  LYS B C     1 
ATOM   1190  O  O     . LYS A  1  155 ? 32.493   -58.301 43.841   1.00 127.23 ? 607  LYS B O     1 
ATOM   1191  C  CB    . LYS A  1  155 ? 31.553   -60.867 45.189   1.00 124.78 ? 607  LYS B CB    1 
ATOM   1192  N  N     . LEU A  1  156 ? 34.378   -58.870 45.017   1.00 125.31 ? 608  LEU B N     1 
ATOM   1193  C  CA    . LEU A  1  156 ? 35.390   -58.292 44.091   1.00 122.70 ? 608  LEU B CA    1 
ATOM   1194  C  C     . LEU A  1  156 ? 35.916   -59.412 43.180   1.00 126.48 ? 608  LEU B C     1 
ATOM   1195  O  O     . LEU A  1  156 ? 36.642   -60.277 43.694   1.00 130.22 ? 608  LEU B O     1 
ATOM   1196  C  CB    . LEU A  1  156 ? 36.518   -57.674 44.927   1.00 120.24 ? 608  LEU B CB    1 
ATOM   1197  C  CG    . LEU A  1  156 ? 37.813   -57.341 44.183   1.00 117.65 ? 608  LEU B CG    1 
ATOM   1198  C  CD1   . LEU A  1  156 ? 37.560   -56.516 42.924   1.00 112.09 ? 608  LEU B CD1   1 
ATOM   1199  C  CD2   . LEU A  1  156 ? 38.764   -56.589 45.110   1.00 117.25 ? 608  LEU B CD2   1 
ATOM   1200  N  N     . GLU A  1  157 ? 35.576   -59.394 41.886   1.00 126.11 ? 609  GLU B N     1 
ATOM   1201  C  CA    . GLU A  1  157 ? 35.965   -60.452 40.909   1.00 114.43 ? 609  GLU B CA    1 
ATOM   1202  C  C     . GLU A  1  157 ? 37.307   -60.068 40.267   1.00 99.77  ? 609  GLU B C     1 
ATOM   1203  O  O     . GLU A  1  157 ? 38.303   -60.758 40.536   1.00 94.45  ? 609  GLU B O     1 
ATOM   1204  C  CB    . GLU A  1  157 ? 34.896   -60.662 39.828   1.00 114.08 ? 609  GLU B CB    1 
ATOM   1205  C  CG    . GLU A  1  157 ? 33.571   -61.208 40.329   1.00 113.33 ? 609  GLU B CG    1 
ATOM   1206  C  CD    . GLU A  1  157 ? 33.625   -62.471 41.174   1.00 116.60 ? 609  GLU B CD    1 
ATOM   1207  O  OE1   . GLU A  1  157 ? 34.488   -63.341 40.898   1.00 110.31 ? 609  GLU B OE1   1 
ATOM   1208  O  OE2   . GLU A  1  157 ? 32.791   -62.588 42.110   1.00 117.59 ? 609  GLU B OE2   1 
ATOM   1209  N  N     . ASP A  1  158 ? 37.342   -59.001 39.461   1.00 85.08  ? 610  ASP B N     1 
ATOM   1210  C  CA    . ASP A  1  158 ? 38.535   -58.547 38.698   1.00 93.72  ? 610  ASP B CA    1 
ATOM   1211  C  C     . ASP A  1  158 ? 39.065   -57.247 39.320   1.00 93.08  ? 610  ASP B C     1 
ATOM   1212  O  O     . ASP A  1  158 ? 38.404   -56.205 39.157   1.00 111.06 ? 610  ASP B O     1 
ATOM   1213  C  CB    . ASP A  1  158 ? 38.189   -58.377 37.213   1.00 103.82 ? 610  ASP B CB    1 
ATOM   1214  C  CG    . ASP A  1  158 ? 39.382   -58.142 36.293   1.00 110.25 ? 610  ASP B CG    1 
ATOM   1215  O  OD1   . ASP A  1  158 ? 40.464   -57.787 36.797   1.00 117.89 ? 610  ASP B OD1   1 
ATOM   1216  O  OD2   . ASP A  1  158 ? 39.221   -58.309 35.067   1.00 101.87 ? 610  ASP B OD2   1 
ATOM   1217  N  N     . ALA A  1  159 ? 40.225   -57.300 39.984   1.00 88.20  ? 611  ALA B N     1 
ATOM   1218  C  CA    . ALA A  1  159 ? 40.858   -56.145 40.672   1.00 92.01  ? 611  ALA B CA    1 
ATOM   1219  C  C     . ALA A  1  159 ? 41.323   -55.088 39.659   1.00 91.04  ? 611  ALA B C     1 
ATOM   1220  O  O     . ALA A  1  159 ? 41.242   -53.905 39.994   1.00 93.04  ? 611  ALA B O     1 
ATOM   1221  C  CB    . ALA A  1  159 ? 42.001   -56.616 41.535   1.00 98.09  ? 611  ALA B CB    1 
ATOM   1222  N  N     . ILE A  1  160 ? 41.792   -55.493 38.474   1.00 90.82  ? 612  ILE B N     1 
ATOM   1223  C  CA    . ILE A  1  160 ? 42.226   -54.561 37.383   1.00 95.75  ? 612  ILE B CA    1 
ATOM   1224  C  C     . ILE A  1  160 ? 40.998   -53.774 36.892   1.00 92.76  ? 612  ILE B C     1 
ATOM   1225  O  O     . ILE A  1  160 ? 41.094   -52.538 36.782   1.00 82.31  ? 612  ILE B O     1 
ATOM   1226  C  CB    . ILE A  1  160 ? 42.936   -55.315 36.232   1.00 95.30  ? 612  ILE B CB    1 
ATOM   1227  C  CG1   . ILE A  1  160 ? 44.272   -55.923 36.669   1.00 89.50  ? 612  ILE B CG1   1 
ATOM   1228  C  CG2   . ILE A  1  160 ? 43.116   -54.415 35.013   1.00 89.69  ? 612  ILE B CG2   1 
ATOM   1229  C  CD1   . ILE A  1  160 ? 44.768   -57.014 35.753   1.00 87.72  ? 612  ILE B CD1   1 
ATOM   1230  N  N     . GLU A  1  161 ? 39.891   -54.469 36.614   1.00 96.86  ? 613  GLU B N     1 
ATOM   1231  C  CA    . GLU A  1  161 ? 38.631   -53.871 36.092   1.00 100.75 ? 613  GLU B CA    1 
ATOM   1232  C  C     . GLU A  1  161 ? 38.019   -52.954 37.157   1.00 103.85 ? 613  GLU B C     1 
ATOM   1233  O  O     . GLU A  1  161 ? 37.452   -51.914 36.784   1.00 107.75 ? 613  GLU B O     1 
ATOM   1234  C  CB    . GLU A  1  161 ? 37.625   -54.944 35.668   1.00 97.45  ? 613  GLU B CB    1 
ATOM   1235  C  CG    . GLU A  1  161 ? 36.565   -54.415 34.708   1.00 93.45  ? 613  GLU B CG    1 
ATOM   1236  C  CD    . GLU A  1  161 ? 35.880   -55.467 33.844   1.00 85.23  ? 613  GLU B CD    1 
ATOM   1237  O  OE1   . GLU A  1  161 ? 35.727   -56.591 34.351   1.00 85.55  ? 613  GLU B OE1   1 
ATOM   1238  O  OE2   . GLU A  1  161 ? 35.510   -55.168 32.669   1.00 69.88  ? 613  GLU B OE2   1 
ATOM   1239  N  N     . ALA A  1  162 ? 38.130   -53.331 38.433   1.00 98.17  ? 614  ALA B N     1 
ATOM   1240  C  CA    . ALA A  1  162 ? 37.659   -52.535 39.593   1.00 88.21  ? 614  ALA B CA    1 
ATOM   1241  C  C     . ALA A  1  162 ? 38.459   -51.225 39.682   1.00 90.48  ? 614  ALA B C     1 
ATOM   1242  O  O     . ALA A  1  162 ? 37.823   -50.163 39.799   1.00 106.28 ? 614  ALA B O     1 
ATOM   1243  C  CB    . ALA A  1  162 ? 37.755   -53.351 40.857   1.00 76.72  ? 614  ALA B CB    1 
ATOM   1244  N  N     . ASP A  1  163 ? 39.795   -51.292 39.602   1.00 86.25  ? 615  ASP B N     1 
ATOM   1245  C  CA    . ASP A  1  163 ? 40.702   -50.111 39.654   1.00 93.14  ? 615  ASP B CA    1 
ATOM   1246  C  C     . ASP A  1  163 ? 40.323   -49.109 38.559   1.00 91.71  ? 615  ASP B C     1 
ATOM   1247  O  O     . ASP A  1  163 ? 40.397   -47.900 38.831   1.00 89.83  ? 615  ASP B O     1 
ATOM   1248  C  CB    . ASP A  1  163 ? 42.175   -50.490 39.471   1.00 98.59  ? 615  ASP B CB    1 
ATOM   1249  C  CG    . ASP A  1  163 ? 42.806   -51.182 40.669   1.00 98.78  ? 615  ASP B CG    1 
ATOM   1250  O  OD1   . ASP A  1  163 ? 42.616   -50.698 41.801   1.00 88.53  ? 615  ASP B OD1   1 
ATOM   1251  O  OD2   . ASP A  1  163 ? 43.489   -52.203 40.458   1.00 100.68 ? 615  ASP B OD2   1 
ATOM   1252  N  N     . GLN A  1  164 ? 39.974   -49.594 37.364   1.00 88.75  ? 616  GLN B N     1 
ATOM   1253  C  CA    . GLN A  1  164 ? 39.636   -48.736 36.193   1.00 94.23  ? 616  GLN B CA    1 
ATOM   1254  C  C     . GLN A  1  164 ? 38.265   -48.091 36.442   1.00 92.78  ? 616  GLN B C     1 
ATOM   1255  O  O     . GLN A  1  164 ? 38.112   -46.904 36.101   1.00 94.25  ? 616  GLN B O     1 
ATOM   1256  C  CB    . GLN A  1  164 ? 39.685   -49.532 34.882   1.00 108.02 ? 616  GLN B CB    1 
ATOM   1257  C  CG    . GLN A  1  164 ? 41.079   -49.999 34.480   1.00 124.80 ? 616  GLN B CG    1 
ATOM   1258  C  CD    . GLN A  1  164 ? 41.058   -51.148 33.498   1.00 141.16 ? 616  GLN B CD    1 
ATOM   1259  O  OE1   . GLN A  1  164 ? 40.052   -51.834 33.328   1.00 145.57 ? 616  GLN B OE1   1 
ATOM   1260  N  NE2   . GLN A  1  164 ? 42.185   -51.378 32.837   1.00 161.73 ? 616  GLN B NE2   1 
ATOM   1261  N  N     . THR A  1  165 ? 37.320   -48.828 37.038   1.00 94.12  ? 617  THR B N     1 
ATOM   1262  C  CA    . THR A  1  165 ? 35.907   -48.392 37.234   1.00 87.01  ? 617  THR B CA    1 
ATOM   1263  C  C     . THR A  1  165 ? 35.855   -47.287 38.299   1.00 79.07  ? 617  THR B C     1 
ATOM   1264  O  O     . THR A  1  165 ? 35.164   -46.291 38.062   1.00 61.00  ? 617  THR B O     1 
ATOM   1265  C  CB    . THR A  1  165 ? 34.984   -49.580 37.537   1.00 87.28  ? 617  THR B CB    1 
ATOM   1266  O  OG1   . THR A  1  165 ? 34.931   -50.377 36.356   1.00 78.18  ? 617  THR B OG1   1 
ATOM   1267  C  CG2   . THR A  1  165 ? 33.575   -49.169 37.909   1.00 93.92  ? 617  THR B CG2   1 
ATOM   1268  N  N     . PHE A  1  166 ? 36.555   -47.443 39.421   1.00 77.68  ? 618  PHE B N     1 
ATOM   1269  C  CA    . PHE A  1  166 ? 36.634   -46.415 40.495   1.00 80.35  ? 618  PHE B CA    1 
ATOM   1270  C  C     . PHE A  1  166 ? 37.321   -45.157 39.953   1.00 80.76  ? 618  PHE B C     1 
ATOM   1271  O  O     . PHE A  1  166 ? 36.823   -44.048 40.201   1.00 84.45  ? 618  PHE B O     1 
ATOM   1272  C  CB    . PHE A  1  166 ? 37.323   -46.969 41.743   1.00 81.79  ? 618  PHE B CB    1 
ATOM   1273  C  CG    . PHE A  1  166 ? 36.423   -47.830 42.593   1.00 83.34  ? 618  PHE B CG    1 
ATOM   1274  C  CD1   . PHE A  1  166 ? 35.543   -47.254 43.501   1.00 83.38  ? 618  PHE B CD1   1 
ATOM   1275  C  CD2   . PHE A  1  166 ? 36.456   -49.212 42.487   1.00 84.50  ? 618  PHE B CD2   1 
ATOM   1276  C  CE1   . PHE A  1  166 ? 34.704   -48.043 44.275   1.00 79.08  ? 618  PHE B CE1   1 
ATOM   1277  C  CE2   . PHE A  1  166 ? 35.630   -49.999 43.273   1.00 80.03  ? 618  PHE B CE2   1 
ATOM   1278  C  CZ    . PHE A  1  166 ? 34.756   -49.416 44.167   1.00 76.03  ? 618  PHE B CZ    1 
ATOM   1279  N  N     . GLU A  1  167 ? 38.417   -45.320 39.210   1.00 83.12  ? 619  GLU B N     1 
ATOM   1280  C  CA    . GLU A  1  167 ? 39.192   -44.188 38.625   1.00 88.07  ? 619  GLU B CA    1 
ATOM   1281  C  C     . GLU A  1  167 ? 38.314   -43.436 37.612   1.00 91.16  ? 619  GLU B C     1 
ATOM   1282  O  O     . GLU A  1  167 ? 38.446   -42.207 37.538   1.00 94.02  ? 619  GLU B O     1 
ATOM   1283  C  CB    . GLU A  1  167 ? 40.480   -44.711 37.999   1.00 84.98  ? 619  GLU B CB    1 
ATOM   1284  C  CG    . GLU A  1  167 ? 41.454   -43.645 37.550   1.00 79.59  ? 619  GLU B CG    1 
ATOM   1285  C  CD    . GLU A  1  167 ? 42.727   -44.197 36.940   1.00 81.46  ? 619  GLU B CD    1 
ATOM   1286  O  OE1   . GLU A  1  167 ? 42.899   -45.447 36.809   1.00 70.41  ? 619  GLU B OE1   1 
ATOM   1287  O  OE2   . GLU A  1  167 ? 43.577   -43.361 36.587   1.00 94.34  ? 619  GLU B OE2   1 
ATOM   1288  N  N     . MET A  1  168 ? 37.448   -44.133 36.875   1.00 90.46  ? 620  MET B N     1 
ATOM   1289  C  CA    . MET A  1  168 ? 36.593   -43.531 35.812   1.00 84.89  ? 620  MET B CA    1 
ATOM   1290  C  C     . MET A  1  168 ? 35.410   -42.784 36.447   1.00 87.30  ? 620  MET B C     1 
ATOM   1291  O  O     . MET A  1  168 ? 35.168   -41.649 36.049   1.00 85.31  ? 620  MET B O     1 
ATOM   1292  C  CB    . MET A  1  168 ? 36.053   -44.605 34.859   1.00 78.49  ? 620  MET B CB    1 
ATOM   1293  C  CG    . MET A  1  168 ? 34.990   -44.125 33.929   1.00 79.10  ? 620  MET B CG    1 
ATOM   1294  S  SD    . MET A  1  168 ? 34.411   -45.424 32.846   1.00 86.76  ? 620  MET B SD    1 
ATOM   1295  C  CE    . MET A  1  168 ? 33.323   -46.281 33.971   1.00 89.39  ? 620  MET B CE    1 
ATOM   1296  N  N     . LEU A  1  169 ? 34.674   -43.425 37.363   1.00 86.16  ? 621  LEU B N     1 
ATOM   1297  C  CA    . LEU A  1  169 ? 33.449   -42.863 37.988   1.00 86.20  ? 621  LEU B CA    1 
ATOM   1298  C  C     . LEU A  1  169 ? 33.822   -41.801 39.026   1.00 87.41  ? 621  LEU B C     1 
ATOM   1299  O  O     . LEU A  1  169 ? 33.146   -40.752 39.052   1.00 96.56  ? 621  LEU B O     1 
ATOM   1300  C  CB    . LEU A  1  169 ? 32.637   -43.974 38.655   1.00 84.32  ? 621  LEU B CB    1 
ATOM   1301  C  CG    . LEU A  1  169 ? 32.146   -45.107 37.772   1.00 85.67  ? 621  LEU B CG    1 
ATOM   1302  C  CD1   . LEU A  1  169 ? 31.259   -46.050 38.578   1.00 89.85  ? 621  LEU B CD1   1 
ATOM   1303  C  CD2   . LEU A  1  169 ? 31.414   -44.569 36.553   1.00 79.74  ? 621  LEU B CD2   1 
ATOM   1304  N  N     . MET A  1  170 ? 34.826   -42.063 39.868   1.00 83.57  ? 622  MET B N     1 
ATOM   1305  C  CA    . MET A  1  170 ? 35.091   -41.251 41.086   1.00 83.17  ? 622  MET B CA    1 
ATOM   1306  C  C     . MET A  1  170 ? 36.372   -40.416 40.942   1.00 79.04  ? 622  MET B C     1 
ATOM   1307  O  O     . MET A  1  170 ? 36.661   -39.656 41.879   1.00 73.02  ? 622  MET B O     1 
ATOM   1308  C  CB    . MET A  1  170 ? 35.213   -42.154 42.319   1.00 85.81  ? 622  MET B CB    1 
ATOM   1309  C  CG    . MET A  1  170 ? 34.152   -43.227 42.401   1.00 85.52  ? 622  MET B CG    1 
ATOM   1310  S  SD    . MET A  1  170 ? 32.466   -42.571 42.315   1.00 98.57  ? 622  MET B SD    1 
ATOM   1311  C  CE    . MET A  1  170 ? 32.330   -41.812 43.930   1.00 96.91  ? 622  MET B CE    1 
ATOM   1312  N  N     . GLY A  1  171 ? 37.105   -40.543 39.826   1.00 72.00  ? 623  GLY B N     1 
ATOM   1313  C  CA    . GLY A  1  171 ? 38.381   -39.836 39.593   1.00 65.31  ? 623  GLY B CA    1 
ATOM   1314  C  C     . GLY A  1  171 ? 38.172   -38.398 39.155   1.00 69.20  ? 623  GLY B C     1 
ATOM   1315  O  O     . GLY A  1  171 ? 37.027   -38.020 38.857   1.00 60.79  ? 623  GLY B O     1 
ATOM   1316  N  N     . ASP A  1  172 ? 39.248   -37.611 39.100   1.00 76.76  ? 624  ASP B N     1 
ATOM   1317  C  CA    . ASP A  1  172 ? 39.217   -36.166 38.750   1.00 81.21  ? 624  ASP B CA    1 
ATOM   1318  C  C     . ASP A  1  172 ? 39.046   -35.969 37.233   1.00 77.06  ? 624  ASP B C     1 
ATOM   1319  O  O     . ASP A  1  172 ? 38.706   -34.840 36.855   1.00 78.78  ? 624  ASP B O     1 
ATOM   1320  C  CB    . ASP A  1  172 ? 40.434   -35.422 39.308   1.00 90.19  ? 624  ASP B CB    1 
ATOM   1321  C  CG    . ASP A  1  172 ? 41.749   -36.174 39.210   1.00 98.64  ? 624  ASP B CG    1 
ATOM   1322  O  OD1   . ASP A  1  172 ? 41.858   -37.067 38.342   1.00 92.48  ? 624  ASP B OD1   1 
ATOM   1323  O  OD2   . ASP A  1  172 ? 42.653   -35.871 40.022   1.00 117.25 ? 624  ASP B OD2   1 
ATOM   1324  N  N     . VAL A  1  173 ? 39.224   -36.994 36.401   1.00 73.15  ? 625  VAL B N     1 
ATOM   1325  C  CA    . VAL A  1  173 ? 39.091   -36.880 34.912   1.00 74.16  ? 625  VAL B CA    1 
ATOM   1326  C  C     . VAL A  1  173 ? 37.606   -36.934 34.519   1.00 73.75  ? 625  VAL B C     1 
ATOM   1327  O  O     . VAL A  1  173 ? 37.013   -38.030 34.555   1.00 68.50  ? 625  VAL B O     1 
ATOM   1328  C  CB    . VAL A  1  173 ? 39.894   -37.960 34.154   1.00 72.48  ? 625  VAL B CB    1 
ATOM   1329  C  CG1   . VAL A  1  173 ? 39.783   -37.770 32.644   1.00 65.93  ? 625  VAL B CG1   1 
ATOM   1330  C  CG2   . VAL A  1  173 ? 41.348   -38.030 34.589   1.00 74.28  ? 625  VAL B CG2   1 
ATOM   1331  N  N     . VAL A  1  174 ? 37.053   -35.795 34.096   1.00 76.75  ? 626  VAL B N     1 
ATOM   1332  C  CA    . VAL A  1  174 ? 35.599   -35.605 33.812   1.00 85.11  ? 626  VAL B CA    1 
ATOM   1333  C  C     . VAL A  1  174 ? 35.228   -36.323 32.508   1.00 86.41  ? 626  VAL B C     1 
ATOM   1334  O  O     . VAL A  1  174 ? 34.104   -36.844 32.444   1.00 80.99  ? 626  VAL B O     1 
ATOM   1335  C  CB    . VAL A  1  174 ? 35.246   -34.106 33.748   1.00 94.44  ? 626  VAL B CB    1 
ATOM   1336  C  CG1   . VAL A  1  174 ? 33.842   -33.850 33.204   1.00 96.49  ? 626  VAL B CG1   1 
ATOM   1337  C  CG2   . VAL A  1  174 ? 35.412   -33.466 35.121   1.00 101.34 ? 626  VAL B CG2   1 
ATOM   1338  N  N     . GLU A  1  175 ? 36.110   -36.342 31.507   1.00 92.07  ? 627  GLU B N     1 
ATOM   1339  C  CA    . GLU A  1  175 ? 35.748   -36.782 30.130   1.00 98.29  ? 627  GLU B CA    1 
ATOM   1340  C  C     . GLU A  1  175 ? 35.407   -38.285 30.133   1.00 96.26  ? 627  GLU B C     1 
ATOM   1341  O  O     . GLU A  1  175 ? 34.406   -38.662 29.485   1.00 94.94  ? 627  GLU B O     1 
ATOM   1342  C  CB    . GLU A  1  175 ? 36.866   -36.413 29.155   1.00 106.29 ? 627  GLU B CB    1 
ATOM   1343  C  CG    . GLU A  1  175 ? 36.608   -36.828 27.716   1.00 117.64 ? 627  GLU B CG    1 
ATOM   1344  C  CD    . GLU A  1  175 ? 35.227   -36.533 27.143   1.00 119.20 ? 627  GLU B CD    1 
ATOM   1345  O  OE1   . GLU A  1  175 ? 34.551   -35.590 27.623   1.00 104.26 ? 627  GLU B OE1   1 
ATOM   1346  O  OE2   . GLU A  1  175 ? 34.812   -37.274 26.213   1.00 141.02 ? 627  GLU B OE2   1 
ATOM   1347  N  N     . ASN A  1  176 ? 36.175   -39.114 30.849   1.00 96.10  ? 628  ASN B N     1 
ATOM   1348  C  CA    . ASN A  1  176 ? 35.932   -40.581 30.941   1.00 101.50 ? 628  ASN B CA    1 
ATOM   1349  C  C     . ASN A  1  176 ? 34.573   -40.844 31.603   1.00 97.11  ? 628  ASN B C     1 
ATOM   1350  O  O     . ASN A  1  176 ? 33.835   -41.728 31.126   1.00 88.43  ? 628  ASN B O     1 
ATOM   1351  C  CB    . ASN A  1  176 ? 37.060   -41.285 31.699   1.00 106.22 ? 628  ASN B CB    1 
ATOM   1352  C  CG    . ASN A  1  176 ? 38.410   -41.058 31.064   1.00 109.44 ? 628  ASN B CG    1 
ATOM   1353  O  OD1   . ASN A  1  176 ? 38.514   -40.929 29.846   1.00 107.22 ? 628  ASN B OD1   1 
ATOM   1354  N  ND2   . ASN A  1  176 ? 39.442   -40.988 31.891   1.00 111.53 ? 628  ASN B ND2   1 
ATOM   1355  N  N     . ARG A  1  177 ? 34.270   -40.099 32.664   1.00 91.04  ? 629  ARG B N     1 
ATOM   1356  C  CA    . ARG A  1  177 ? 32.987   -40.152 33.417   1.00 85.82  ? 629  ARG B CA    1 
ATOM   1357  C  C     . ARG A  1  177 ? 31.830   -39.773 32.483   1.00 81.81  ? 629  ARG B C     1 
ATOM   1358  O  O     . ARG A  1  177 ? 30.840   -40.501 32.471   1.00 70.23  ? 629  ARG B O     1 
ATOM   1359  C  CB    . ARG A  1  177 ? 33.071   -39.230 34.642   1.00 79.89  ? 629  ARG B CB    1 
ATOM   1360  C  CG    . ARG A  1  177 ? 31.755   -39.035 35.374   1.00 71.41  ? 629  ARG B CG    1 
ATOM   1361  C  CD    . ARG A  1  177 ? 31.933   -38.518 36.792   1.00 64.88  ? 629  ARG B CD    1 
ATOM   1362  N  NE    . ARG A  1  177 ? 32.917   -37.451 36.871   1.00 63.98  ? 629  ARG B NE    1 
ATOM   1363  C  CZ    . ARG A  1  177 ? 34.150   -37.566 37.353   1.00 63.38  ? 629  ARG B CZ    1 
ATOM   1364  N  NH1   . ARG A  1  177 ? 34.575   -38.733 37.808   1.00 62.63  ? 629  ARG B NH1   1 
ATOM   1365  N  NH2   . ARG A  1  177 ? 34.955   -36.508 37.367   1.00 61.41  ? 629  ARG B NH2   1 
ATOM   1366  N  N     . ARG A  1  178 ? 31.962   -38.677 31.731   1.00 87.78  ? 630  ARG B N     1 
ATOM   1367  C  CA    . ARG A  1  178 ? 30.913   -38.175 30.799   1.00 96.64  ? 630  ARG B CA    1 
ATOM   1368  C  C     . ARG A  1  178 ? 30.674   -39.222 29.708   1.00 101.42 ? 630  ARG B C     1 
ATOM   1369  O  O     . ARG A  1  178 ? 29.490   -39.487 29.397   1.00 96.69  ? 630  ARG B O     1 
ATOM   1370  C  CB    . ARG A  1  178 ? 31.310   -36.833 30.178   1.00 105.66 ? 630  ARG B CB    1 
ATOM   1371  C  CG    . ARG A  1  178 ? 30.247   -36.228 29.268   1.00 111.18 ? 630  ARG B CG    1 
ATOM   1372  C  CD    . ARG A  1  178 ? 30.835   -35.387 28.154   1.00 116.22 ? 630  ARG B CD    1 
ATOM   1373  N  NE    . ARG A  1  178 ? 31.579   -36.216 27.222   1.00 119.22 ? 630  ARG B NE    1 
ATOM   1374  C  CZ    . ARG A  1  178 ? 31.036   -37.026 26.315   1.00 121.89 ? 630  ARG B CZ    1 
ATOM   1375  N  NH1   . ARG A  1  178 ? 29.721   -37.135 26.191   1.00 125.67 ? 630  ARG B NH1   1 
ATOM   1376  N  NH2   . ARG A  1  178 ? 31.819   -37.741 25.528   1.00 117.49 ? 630  ARG B NH2   1 
ATOM   1377  N  N     . GLN A  1  179 ? 31.761   -39.785 29.161   1.00 113.61 ? 631  GLN B N     1 
ATOM   1378  C  CA    . GLN A  1  179 ? 31.722   -40.808 28.085   1.00 116.63 ? 631  GLN B CA    1 
ATOM   1379  C  C     . GLN A  1  179 ? 30.892   -41.996 28.583   1.00 122.19 ? 631  GLN B C     1 
ATOM   1380  O  O     . GLN A  1  179 ? 29.979   -42.423 27.859   1.00 121.65 ? 631  GLN B O     1 
ATOM   1381  C  CB    . GLN A  1  179 ? 33.134   -41.264 27.706   1.00 111.00 ? 631  GLN B CB    1 
ATOM   1382  C  CG    . GLN A  1  179 ? 33.176   -42.169 26.478   1.00 110.00 ? 631  GLN B CG    1 
ATOM   1383  C  CD    . GLN A  1  179 ? 32.674   -41.463 25.243   1.00 109.59 ? 631  GLN B CD    1 
ATOM   1384  O  OE1   . GLN A  1  179 ? 33.114   -40.356 24.916   1.00 116.02 ? 631  GLN B OE1   1 
ATOM   1385  N  NE2   . GLN A  1  179 ? 31.741   -42.098 24.553   1.00 106.76 ? 631  GLN B NE2   1 
ATOM   1386  N  N     . PHE A  1  180 ? 31.211   -42.478 29.787   1.00 110.69 ? 632  PHE B N     1 
ATOM   1387  C  CA    . PHE A  1  180 ? 30.544   -43.621 30.462   1.00 101.18 ? 632  PHE B CA    1 
ATOM   1388  C  C     . PHE A  1  180 ? 29.032   -43.378 30.529   1.00 96.35  ? 632  PHE B C     1 
ATOM   1389  O  O     . PHE A  1  180 ? 28.268   -44.324 30.234   1.00 76.99  ? 632  PHE B O     1 
ATOM   1390  C  CB    . PHE A  1  180 ? 31.119   -43.850 31.863   1.00 97.55  ? 632  PHE B CB    1 
ATOM   1391  C  CG    . PHE A  1  180 ? 30.233   -44.701 32.731   1.00 94.94  ? 632  PHE B CG    1 
ATOM   1392  C  CD1   . PHE A  1  180 ? 29.998   -46.027 32.417   1.00 104.58 ? 632  PHE B CD1   1 
ATOM   1393  C  CD2   . PHE A  1  180 ? 29.582   -44.158 33.826   1.00 87.35  ? 632  PHE B CD2   1 
ATOM   1394  C  CE1   . PHE A  1  180 ? 29.147   -46.800 33.194   1.00 108.96 ? 632  PHE B CE1   1 
ATOM   1395  C  CE2   . PHE A  1  180 ? 28.731   -44.930 34.600   1.00 89.71  ? 632  PHE B CE2   1 
ATOM   1396  C  CZ    . PHE A  1  180 ? 28.496   -46.246 34.270   1.00 95.87  ? 632  PHE B CZ    1 
ATOM   1397  N  N     . ILE A  1  181 ? 28.620   -42.161 30.910   1.00 107.86 ? 633  ILE B N     1 
ATOM   1398  C  CA    . ILE A  1  181 ? 27.187   -41.778 31.112   1.00 112.60 ? 633  ILE B CA    1 
ATOM   1399  C  C     . ILE A  1  181 ? 26.478   -41.835 29.756   1.00 108.86 ? 633  ILE B C     1 
ATOM   1400  O  O     . ILE A  1  181 ? 25.431   -42.504 29.679   1.00 101.60 ? 633  ILE B O     1 
ATOM   1401  C  CB    . ILE A  1  181 ? 27.031   -40.396 31.783   1.00 122.79 ? 633  ILE B CB    1 
ATOM   1402  C  CG1   . ILE A  1  181 ? 27.670   -40.352 33.175   1.00 138.03 ? 633  ILE B CG1   1 
ATOM   1403  C  CG2   . ILE A  1  181 ? 25.564   -40.007 31.857   1.00 119.92 ? 633  ILE B CG2   1 
ATOM   1404  C  CD1   . ILE A  1  181 ? 27.918   -38.956 33.704   1.00 144.22 ? 633  ILE B CD1   1 
ATOM   1405  N  N     . GLU A  1  182 ? 27.030   -41.166 28.739   1.00 105.58 ? 634  GLU B N     1 
ATOM   1406  C  CA    . GLU A  1  182 ? 26.456   -41.122 27.362   1.00 94.88  ? 634  GLU B CA    1 
ATOM   1407  C  C     . GLU A  1  182 ? 26.299   -42.560 26.846   1.00 95.47  ? 634  GLU B C     1 
ATOM   1408  O  O     . GLU A  1  182 ? 25.200   -42.894 26.353   1.00 90.00  ? 634  GLU B O     1 
ATOM   1409  C  CB    . GLU A  1  182 ? 27.309   -40.288 26.403   1.00 87.60  ? 634  GLU B CB    1 
ATOM   1410  C  CG    . GLU A  1  182 ? 26.660   -40.179 25.040   1.00 82.29  ? 634  GLU B CG    1 
ATOM   1411  C  CD    . GLU A  1  182 ? 27.398   -39.489 23.920   1.00 81.16  ? 634  GLU B CD    1 
ATOM   1412  O  OE1   . GLU A  1  182 ? 26.861   -39.564 22.828   1.00 74.73  ? 634  GLU B OE1   1 
ATOM   1413  O  OE2   . GLU A  1  182 ? 28.472   -38.870 24.125   1.00 92.22  ? 634  GLU B OE2   1 
ATOM   1414  N  N     . ASP A  1  183 ? 27.357   -43.368 26.972   1.00 96.50  ? 635  ASP B N     1 
ATOM   1415  C  CA    . ASP A  1  183 ? 27.424   -44.778 26.495   1.00 98.39  ? 635  ASP B CA    1 
ATOM   1416  C  C     . ASP A  1  183 ? 26.313   -45.606 27.155   1.00 100.47 ? 635  ASP B C     1 
ATOM   1417  O  O     . ASP A  1  183 ? 25.647   -46.369 26.435   1.00 97.45  ? 635  ASP B O     1 
ATOM   1418  C  CB    . ASP A  1  183 ? 28.787   -45.417 26.789   1.00 95.81  ? 635  ASP B CB    1 
ATOM   1419  C  CG    . ASP A  1  183 ? 29.931   -44.923 25.913   1.00 89.32  ? 635  ASP B CG    1 
ATOM   1420  O  OD1   . ASP A  1  183 ? 29.651   -44.252 24.893   1.00 81.63  ? 635  ASP B OD1   1 
ATOM   1421  O  OD2   . ASP A  1  183 ? 31.102   -45.217 26.263   1.00 84.52  ? 635  ASP B OD2   1 
ATOM   1422  N  N     . ASN A  1  184 ? 26.125   -45.448 28.466   1.00 99.62  ? 636  ASN B N     1 
ATOM   1423  C  CA    . ASN A  1  184 ? 25.243   -46.308 29.296   1.00 107.08 ? 636  ASN B CA    1 
ATOM   1424  C  C     . ASN A  1  184 ? 23.886   -45.632 29.552   1.00 107.56 ? 636  ASN B C     1 
ATOM   1425  O  O     . ASN A  1  184 ? 23.081   -46.230 30.273   1.00 111.25 ? 636  ASN B O     1 
ATOM   1426  C  CB    . ASN A  1  184 ? 25.905   -46.652 30.630   1.00 113.20 ? 636  ASN B CB    1 
ATOM   1427  C  CG    . ASN A  1  184 ? 27.049   -47.633 30.478   1.00 109.85 ? 636  ASN B CG    1 
ATOM   1428  O  OD1   . ASN A  1  184 ? 26.949   -48.776 30.930   1.00 95.58  ? 636  ASN B OD1   1 
ATOM   1429  N  ND2   . ASN A  1  184 ? 28.137   -47.200 29.855   1.00 110.41 ? 636  ASN B ND2   1 
ATOM   1430  N  N     . ALA A  1  185 ? 23.614   -44.457 28.977   1.00 102.58 ? 637  ALA B N     1 
ATOM   1431  C  CA    . ALA A  1  185 ? 22.331   -43.746 29.170   1.00 99.00  ? 637  ALA B CA    1 
ATOM   1432  C  C     . ALA A  1  185 ? 21.214   -44.626 28.591   1.00 95.05  ? 637  ALA B C     1 
ATOM   1433  O  O     . ALA A  1  185 ? 21.358   -45.118 27.447   1.00 95.75  ? 637  ALA B O     1 
ATOM   1434  C  CB    . ALA A  1  185 ? 22.331   -42.381 28.520   1.00 103.50 ? 637  ALA B CB    1 
ATOM   1435  N  N     . VAL A  1  186 ? 20.143   -44.803 29.358   1.00 84.77  ? 638  VAL B N     1 
ATOM   1436  C  CA    . VAL A  1  186 ? 18.853   -45.392 28.868   1.00 75.99  ? 638  VAL B CA    1 
ATOM   1437  C  C     . VAL A  1  186 ? 17.675   -44.576 29.428   1.00 64.52  ? 638  VAL B C     1 
ATOM   1438  O  O     . VAL A  1  186 ? 17.002   -43.795 28.736   1.00 54.15  ? 638  VAL B O     1 
ATOM   1439  C  CB    . VAL A  1  186 ? 18.805   -46.890 29.237   1.00 75.53  ? 638  VAL B CB    1 
ATOM   1440  C  CG1   . VAL A  1  186 ? 17.385   -47.461 29.275   1.00 73.22  ? 638  VAL B CG1   1 
ATOM   1441  C  CG2   . VAL A  1  186 ? 19.704   -47.717 28.326   1.00 70.11  ? 638  VAL B CG2   1 
ATOM   1442  N  N     . GLU B  2  10  ? 24.625   -62.043 46.759   1.00 84.50  ? 11   GLU A N     1 
ATOM   1443  C  CA    . GLU B  2  10  ? 25.967   -61.818 46.097   1.00 83.14  ? 11   GLU A CA    1 
ATOM   1444  C  C     . GLU B  2  10  ? 25.820   -60.721 45.035   1.00 84.56  ? 11   GLU A C     1 
ATOM   1445  O  O     . GLU B  2  10  ? 24.811   -60.774 44.279   1.00 84.03  ? 11   GLU A O     1 
ATOM   1446  C  CB    . GLU B  2  10  ? 26.481   -63.071 45.401   1.00 76.77  ? 11   GLU A CB    1 
ATOM   1447  C  CG    . GLU B  2  10  ? 27.103   -64.106 46.317   1.00 72.01  ? 11   GLU A CG    1 
ATOM   1448  C  CD    . GLU B  2  10  ? 27.709   -65.272 45.561   1.00 68.99  ? 11   GLU A CD    1 
ATOM   1449  O  OE1   . GLU B  2  10  ? 27.509   -66.441 45.991   1.00 68.75  ? 11   GLU A OE1   1 
ATOM   1450  O  OE2   . GLU B  2  10  ? 28.413   -65.028 44.552   1.00 62.94  ? 11   GLU A OE2   1 
ATOM   1451  N  N     . ARG B  2  11  ? 26.765   -59.774 44.991   1.00 86.02  ? 12   ARG A N     1 
ATOM   1452  C  CA    . ARG B  2  11  ? 26.706   -58.575 44.115   1.00 86.76  ? 12   ARG A CA    1 
ATOM   1453  C  C     . ARG B  2  11  ? 28.130   -58.192 43.688   1.00 83.79  ? 12   ARG A C     1 
ATOM   1454  O  O     . ARG B  2  11  ? 28.966   -57.910 44.583   1.00 69.64  ? 12   ARG A O     1 
ATOM   1455  C  CB    . ARG B  2  11  ? 26.019   -57.403 44.839   1.00 93.33  ? 12   ARG A CB    1 
ATOM   1456  C  CG    . ARG B  2  11  ? 25.826   -56.179 43.976   1.00 101.08 ? 12   ARG A CG    1 
ATOM   1457  C  CD    . ARG B  2  11  ? 25.026   -56.389 42.703   1.00 107.21 ? 12   ARG A CD    1 
ATOM   1458  N  NE    . ARG B  2  11  ? 24.492   -55.117 42.240   1.00 112.95 ? 12   ARG A NE    1 
ATOM   1459  C  CZ    . ARG B  2  11  ? 24.272   -54.780 40.969   1.00 103.11 ? 12   ARG A CZ    1 
ATOM   1460  N  NH1   . ARG B  2  11  ? 24.531   -55.627 39.989   1.00 101.23 ? 12   ARG A NH1   1 
ATOM   1461  N  NH2   . ARG B  2  11  ? 23.797   -53.581 40.675   1.00 106.93 ? 12   ARG A NH2   1 
ATOM   1462  N  N     . ASN B  2  12  ? 28.401   -58.180 42.376   1.00 88.63  ? 13   ASN A N     1 
ATOM   1463  C  CA    . ASN B  2  12  ? 29.720   -57.804 41.802   1.00 89.94  ? 13   ASN A CA    1 
ATOM   1464  C  C     . ASN B  2  12  ? 29.951   -56.314 42.083   1.00 94.20  ? 13   ASN A C     1 
ATOM   1465  O  O     . ASN B  2  12  ? 29.032   -55.510 41.787   1.00 103.86 ? 13   ASN A O     1 
ATOM   1466  C  CB    . ASN B  2  12  ? 29.807   -58.113 40.305   1.00 93.11  ? 13   ASN A CB    1 
ATOM   1467  C  CG    . ASN B  2  12  ? 31.162   -57.765 39.721   1.00 94.02  ? 13   ASN A CG    1 
ATOM   1468  O  OD1   . ASN B  2  12  ? 31.310   -56.772 39.008   1.00 86.92  ? 13   ASN A OD1   1 
ATOM   1469  N  ND2   . ASN B  2  12  ? 32.174   -58.533 40.083   1.00 95.25  ? 13   ASN A ND2   1 
ATOM   1470  N  N     . ILE B  2  13  ? 31.114   -55.958 42.648   1.00 88.88  ? 14   ILE A N     1 
ATOM   1471  C  CA    . ILE B  2  13  ? 31.426   -54.558 43.076   1.00 82.16  ? 14   ILE A CA    1 
ATOM   1472  C  C     . ILE B  2  13  ? 31.390   -53.625 41.861   1.00 71.95  ? 14   ILE A C     1 
ATOM   1473  O  O     . ILE B  2  13  ? 30.883   -52.506 42.004   1.00 77.42  ? 14   ILE A O     1 
ATOM   1474  C  CB    . ILE B  2  13  ? 32.767   -54.467 43.830   1.00 83.31  ? 14   ILE A CB    1 
ATOM   1475  C  CG1   . ILE B  2  13  ? 32.924   -53.110 44.515   1.00 89.58  ? 14   ILE A CG1   1 
ATOM   1476  C  CG2   . ILE B  2  13  ? 33.943   -54.762 42.915   1.00 86.92  ? 14   ILE A CG2   1 
ATOM   1477  C  CD1   . ILE B  2  13  ? 33.948   -53.104 45.630   1.00 95.37  ? 14   ILE A CD1   1 
ATOM   1478  N  N     . THR B  2  14  ? 31.902   -54.069 40.714   1.00 66.37  ? 15   THR A N     1 
ATOM   1479  C  CA    . THR B  2  14  ? 31.950   -53.279 39.455   1.00 64.68  ? 15   THR A CA    1 
ATOM   1480  C  C     . THR B  2  14  ? 30.517   -52.997 38.987   1.00 61.73  ? 15   THR A C     1 
ATOM   1481  O  O     . THR B  2  14  ? 30.236   -51.824 38.686   1.00 67.37  ? 15   THR A O     1 
ATOM   1482  C  CB    . THR B  2  14  ? 32.846   -53.970 38.418   1.00 72.40  ? 15   THR A CB    1 
ATOM   1483  O  OG1   . THR B  2  14  ? 34.192   -53.705 38.817   1.00 70.44  ? 15   THR A OG1   1 
ATOM   1484  C  CG2   . THR B  2  14  ? 32.626   -53.493 36.997   1.00 76.35  ? 15   THR A CG2   1 
ATOM   1485  N  N     . SER B  2  15  ? 29.647   -54.010 38.953   1.00 65.73  ? 16   SER A N     1 
ATOM   1486  C  CA    . SER B  2  15  ? 28.222   -53.884 38.536   1.00 70.90  ? 16   SER A CA    1 
ATOM   1487  C  C     . SER B  2  15  ? 27.503   -52.883 39.449   1.00 79.39  ? 16   SER A C     1 
ATOM   1488  O  O     . SER B  2  15  ? 26.744   -52.030 38.921   1.00 87.63  ? 16   SER A O     1 
ATOM   1489  C  CB    . SER B  2  15  ? 27.509   -55.215 38.556   1.00 73.29  ? 16   SER A CB    1 
ATOM   1490  O  OG    . SER B  2  15  ? 28.286   -56.219 37.924   1.00 69.34  ? 16   SER A OG    1 
ATOM   1491  N  N     . GLU B  2  16  ? 27.733   -52.992 40.763   1.00 81.29  ? 17   GLU A N     1 
ATOM   1492  C  CA    . GLU B  2  16  ? 27.080   -52.152 41.799   1.00 90.46  ? 17   GLU A CA    1 
ATOM   1493  C  C     . GLU B  2  16  ? 27.479   -50.688 41.589   1.00 99.28  ? 17   GLU A C     1 
ATOM   1494  O  O     . GLU B  2  16  ? 26.577   -49.841 41.528   1.00 104.97 ? 17   GLU A O     1 
ATOM   1495  C  CB    . GLU B  2  16  ? 27.460   -52.628 43.202   1.00 91.00  ? 17   GLU A CB    1 
ATOM   1496  C  CG    . GLU B  2  16  ? 26.877   -51.775 44.312   1.00 90.68  ? 17   GLU A CG    1 
ATOM   1497  C  CD    . GLU B  2  16  ? 25.357   -51.692 44.330   1.00 89.01  ? 17   GLU A CD    1 
ATOM   1498  O  OE1   . GLU B  2  16  ? 24.699   -52.635 43.844   1.00 77.92  ? 17   GLU A OE1   1 
ATOM   1499  O  OE2   . GLU B  2  16  ? 24.834   -50.683 44.832   1.00 91.91  ? 17   GLU A OE2   1 
ATOM   1500  N  N     . MET B  2  17  ? 28.783   -50.415 41.483   1.00 95.59  ? 18   MET A N     1 
ATOM   1501  C  CA    . MET B  2  17  ? 29.338   -49.062 41.211   1.00 88.32  ? 18   MET A CA    1 
ATOM   1502  C  C     . MET B  2  17  ? 28.715   -48.486 39.939   1.00 83.31  ? 18   MET A C     1 
ATOM   1503  O  O     . MET B  2  17  ? 28.211   -47.365 39.988   1.00 95.33  ? 18   MET A O     1 
ATOM   1504  C  CB    . MET B  2  17  ? 30.858   -49.113 41.033   1.00 89.46  ? 18   MET A CB    1 
ATOM   1505  C  CG    . MET B  2  17  ? 31.592   -49.337 42.344   1.00 98.16  ? 18   MET A CG    1 
ATOM   1506  S  SD    . MET B  2  17  ? 31.234   -48.049 43.573   1.00 101.82 ? 18   MET A SD    1 
ATOM   1507  C  CE    . MET B  2  17  ? 31.869   -46.628 42.689   1.00 108.74 ? 18   MET A CE    1 
ATOM   1508  N  N     . ARG B  2  18  ? 28.760   -49.222 38.834   1.00 71.53  ? 19   ARG A N     1 
ATOM   1509  C  CA    . ARG B  2  18  ? 28.384   -48.682 37.500   1.00 70.03  ? 19   ARG A CA    1 
ATOM   1510  C  C     . ARG B  2  18  ? 26.892   -48.332 37.498   1.00 65.45  ? 19   ARG A C     1 
ATOM   1511  O  O     . ARG B  2  18  ? 26.551   -47.245 36.997   1.00 65.19  ? 19   ARG A O     1 
ATOM   1512  C  CB    . ARG B  2  18  ? 28.801   -49.651 36.395   1.00 72.69  ? 19   ARG A CB    1 
ATOM   1513  C  CG    . ARG B  2  18  ? 30.322   -49.745 36.245   1.00 71.66  ? 19   ARG A CG    1 
ATOM   1514  C  CD    . ARG B  2  18  ? 30.798   -50.853 35.318   1.00 72.52  ? 19   ARG A CD    1 
ATOM   1515  N  NE    . ARG B  2  18  ? 30.118   -50.735 34.031   1.00 75.27  ? 19   ARG A NE    1 
ATOM   1516  C  CZ    . ARG B  2  18  ? 30.517   -49.987 32.999   1.00 77.00  ? 19   ARG A CZ    1 
ATOM   1517  N  NH1   . ARG B  2  18  ? 31.637   -49.286 33.069   1.00 72.57  ? 19   ARG A NH1   1 
ATOM   1518  N  NH2   . ARG B  2  18  ? 29.771   -49.935 31.910   1.00 83.46  ? 19   ARG A NH2   1 
ATOM   1519  N  N     . GLU B  2  19  ? 26.044   -49.193 38.063   1.00 61.74  ? 20   GLU A N     1 
ATOM   1520  C  CA    . GLU B  2  19  ? 24.565   -49.012 38.053   1.00 64.80  ? 20   GLU A CA    1 
ATOM   1521  C  C     . GLU B  2  19  ? 24.165   -47.947 39.093   1.00 73.40  ? 20   GLU A C     1 
ATOM   1522  O  O     . GLU B  2  19  ? 23.270   -47.127 38.768   1.00 80.42  ? 20   GLU A O     1 
ATOM   1523  C  CB    . GLU B  2  19  ? 23.853   -50.337 38.326   1.00 58.81  ? 20   GLU A CB    1 
ATOM   1524  C  CG    . GLU B  2  19  ? 23.898   -51.286 37.151   1.00 51.77  ? 20   GLU A CG    1 
ATOM   1525  C  CD    . GLU B  2  19  ? 23.341   -52.669 37.428   1.00 45.47  ? 20   GLU A CD    1 
ATOM   1526  O  OE1   . GLU B  2  19  ? 23.731   -53.600 36.710   1.00 42.79  ? 20   GLU A OE1   1 
ATOM   1527  O  OE2   . GLU B  2  19  ? 22.522   -52.833 38.351   1.00 40.72  ? 20   GLU A OE2   1 
ATOM   1528  N  N     . SER B  2  20  ? 24.800   -47.960 40.280   1.00 64.59  ? 21   SER A N     1 
ATOM   1529  C  CA    . SER B  2  20  ? 24.539   -46.997 41.382   1.00 56.73  ? 21   SER A CA    1 
ATOM   1530  C  C     . SER B  2  20  ? 24.910   -45.574 40.937   1.00 57.12  ? 21   SER A C     1 
ATOM   1531  O  O     . SER B  2  20  ? 24.080   -44.654 41.093   1.00 46.73  ? 21   SER A O     1 
ATOM   1532  C  CB    . SER B  2  20  ? 25.291   -47.365 42.647   1.00 51.77  ? 21   SER A CB    1 
ATOM   1533  O  OG    . SER B  2  20  ? 24.592   -48.314 43.417   1.00 51.70  ? 21   SER A OG    1 
ATOM   1534  N  N     . PHE B  2  21  ? 26.133   -45.402 40.430   1.00 62.78  ? 22   PHE A N     1 
ATOM   1535  C  CA    . PHE B  2  21  ? 26.682   -44.089 40.012   1.00 65.57  ? 22   PHE A CA    1 
ATOM   1536  C  C     . PHE B  2  21  ? 25.864   -43.549 38.840   1.00 60.21  ? 22   PHE A C     1 
ATOM   1537  O  O     . PHE B  2  21  ? 25.601   -42.335 38.839   1.00 57.70  ? 22   PHE A O     1 
ATOM   1538  C  CB    . PHE B  2  21  ? 28.159   -44.169 39.619   1.00 74.11  ? 22   PHE A CB    1 
ATOM   1539  C  CG    . PHE B  2  21  ? 28.800   -42.815 39.502   1.00 87.72  ? 22   PHE A CG    1 
ATOM   1540  C  CD1   . PHE B  2  21  ? 29.346   -42.205 40.618   1.00 92.49  ? 22   PHE A CD1   1 
ATOM   1541  C  CD2   . PHE B  2  21  ? 28.809   -42.126 38.299   1.00 97.96  ? 22   PHE A CD2   1 
ATOM   1542  C  CE1   . PHE B  2  21  ? 29.942   -40.951 40.530   1.00 95.90  ? 22   PHE A CE1   1 
ATOM   1543  C  CE2   . PHE B  2  21  ? 29.368   -40.860 38.216   1.00 106.34 ? 22   PHE A CE2   1 
ATOM   1544  C  CZ    . PHE B  2  21  ? 29.950   -40.281 39.329   1.00 100.00 ? 22   PHE A CZ    1 
ATOM   1545  N  N     . LEU B  2  22  ? 25.488   -44.406 37.884   1.00 60.19  ? 23   LEU A N     1 
ATOM   1546  C  CA    . LEU B  2  22  ? 24.705   -43.992 36.690   1.00 58.99  ? 23   LEU A CA    1 
ATOM   1547  C  C     . LEU B  2  22  ? 23.347   -43.450 37.151   1.00 57.45  ? 23   LEU A C     1 
ATOM   1548  O  O     . LEU B  2  22  ? 22.892   -42.429 36.601   1.00 54.37  ? 23   LEU A O     1 
ATOM   1549  C  CB    . LEU B  2  22  ? 24.532   -45.176 35.734   1.00 60.66  ? 23   LEU A CB    1 
ATOM   1550  C  CG    . LEU B  2  22  ? 23.838   -44.808 34.412   1.00 57.83  ? 23   LEU A CG    1 
ATOM   1551  C  CD1   . LEU B  2  22  ? 24.747   -43.995 33.482   1.00 55.82  ? 23   LEU A CD1   1 
ATOM   1552  C  CD2   . LEU B  2  22  ? 23.319   -46.028 33.676   1.00 56.19  ? 23   LEU A CD2   1 
ATOM   1553  N  N     . ASP B  2  23  ? 22.736   -44.112 38.134   1.00 60.38  ? 24   ASP A N     1 
ATOM   1554  C  CA    . ASP B  2  23  ? 21.403   -43.743 38.688   1.00 68.55  ? 24   ASP A CA    1 
ATOM   1555  C  C     . ASP B  2  23  ? 21.473   -42.324 39.256   1.00 76.22  ? 24   ASP A C     1 
ATOM   1556  O  O     . ASP B  2  23  ? 20.589   -41.508 38.937   1.00 77.11  ? 24   ASP A O     1 
ATOM   1557  C  CB    . ASP B  2  23  ? 20.932   -44.737 39.750   1.00 67.12  ? 24   ASP A CB    1 
ATOM   1558  C  CG    . ASP B  2  23  ? 20.161   -45.909 39.153   1.00 64.81  ? 24   ASP A CG    1 
ATOM   1559  O  OD1   . ASP B  2  23  ? 20.425   -46.277 37.999   1.00 62.77  ? 24   ASP A OD1   1 
ATOM   1560  O  OD2   . ASP B  2  23  ? 19.286   -46.437 39.835   1.00 67.49  ? 24   ASP A OD2   1 
ATOM   1561  N  N     . TYR B  2  24  ? 22.489   -42.068 40.079   1.00 86.61  ? 25   TYR A N     1 
ATOM   1562  C  CA    . TYR B  2  24  ? 22.807   -40.740 40.666   1.00 84.86  ? 25   TYR A CA    1 
ATOM   1563  C  C     . TYR B  2  24  ? 23.062   -39.713 39.554   1.00 70.34  ? 25   TYR A C     1 
ATOM   1564  O  O     . TYR B  2  24  ? 22.331   -38.701 39.477   1.00 63.56  ? 25   TYR A O     1 
ATOM   1565  C  CB    . TYR B  2  24  ? 24.026   -40.837 41.581   1.00 86.37  ? 25   TYR A CB    1 
ATOM   1566  C  CG    . TYR B  2  24  ? 24.422   -39.504 42.152   1.00 89.01  ? 25   TYR A CG    1 
ATOM   1567  C  CD1   . TYR B  2  24  ? 23.544   -38.805 42.968   1.00 91.14  ? 25   TYR A CD1   1 
ATOM   1568  C  CD2   . TYR B  2  24  ? 25.639   -38.918 41.847   1.00 88.73  ? 25   TYR A CD2   1 
ATOM   1569  C  CE1   . TYR B  2  24  ? 23.878   -37.574 43.500   1.00 92.85  ? 25   TYR A CE1   1 
ATOM   1570  C  CE2   . TYR B  2  24  ? 25.999   -37.696 42.396   1.00 89.66  ? 25   TYR A CE2   1 
ATOM   1571  C  CZ    . TYR B  2  24  ? 25.110   -37.017 43.215   1.00 90.67  ? 25   TYR A CZ    1 
ATOM   1572  O  OH    . TYR B  2  24  ? 25.416   -35.805 43.757   1.00 82.78  ? 25   TYR A OH    1 
ATOM   1573  N  N     . ALA B  2  25  ? 24.076   -39.972 38.726   1.00 63.65  ? 26   ALA A N     1 
ATOM   1574  C  CA    . ALA B  2  25  ? 24.556   -39.060 37.657   1.00 66.73  ? 26   ALA A CA    1 
ATOM   1575  C  C     . ALA B  2  25  ? 23.385   -38.653 36.753   1.00 61.61  ? 26   ALA A C     1 
ATOM   1576  O  O     . ALA B  2  25  ? 23.220   -37.461 36.497   1.00 54.91  ? 26   ALA A O     1 
ATOM   1577  C  CB    . ALA B  2  25  ? 25.664   -39.721 36.863   1.00 65.10  ? 26   ALA A CB    1 
ATOM   1578  N  N     . MET B  2  26  ? 22.619   -39.624 36.273   1.00 66.61  ? 27   MET A N     1 
ATOM   1579  C  CA    . MET B  2  26  ? 21.495   -39.380 35.323   1.00 70.00  ? 27   MET A CA    1 
ATOM   1580  C  C     . MET B  2  26  ? 20.468   -38.474 36.004   1.00 69.22  ? 27   MET A C     1 
ATOM   1581  O  O     . MET B  2  26  ? 19.961   -37.566 35.338   1.00 69.46  ? 27   MET A O     1 
ATOM   1582  C  CB    . MET B  2  26  ? 20.839   -40.697 34.892   1.00 74.50  ? 27   MET A CB    1 
ATOM   1583  C  CG    . MET B  2  26  ? 21.584   -41.380 33.761   1.00 78.93  ? 27   MET A CG    1 
ATOM   1584  S  SD    . MET B  2  26  ? 21.369   -40.458 32.185   1.00 89.52  ? 27   MET A SD    1 
ATOM   1585  C  CE    . MET B  2  26  ? 19.586   -40.270 32.118   1.00 84.35  ? 27   MET A CE    1 
ATOM   1586  N  N     . SER B  2  27  ? 20.209   -38.718 37.289   1.00 70.78  ? 28   SER A N     1 
ATOM   1587  C  CA    . SER B  2  27  ? 19.186   -38.017 38.110   1.00 69.50  ? 28   SER A CA    1 
ATOM   1588  C  C     . SER B  2  27  ? 19.589   -36.549 38.304   1.00 65.71  ? 28   SER A C     1 
ATOM   1589  O  O     . SER B  2  27  ? 18.706   -35.651 38.150   1.00 58.34  ? 28   SER A O     1 
ATOM   1590  C  CB    . SER B  2  27  ? 18.995   -38.707 39.421   1.00 68.90  ? 28   SER A CB    1 
ATOM   1591  O  OG    . SER B  2  27  ? 18.138   -37.943 40.254   1.00 66.83  ? 28   SER A OG    1 
ATOM   1592  N  N     . VAL B  2  28  ? 20.870   -36.313 38.612   1.00 65.15  ? 29   VAL A N     1 
ATOM   1593  C  CA    . VAL B  2  28  ? 21.453   -34.951 38.784   1.00 65.67  ? 29   VAL A CA    1 
ATOM   1594  C  C     . VAL B  2  28  ? 21.379   -34.189 37.457   1.00 59.58  ? 29   VAL A C     1 
ATOM   1595  O  O     . VAL B  2  28  ? 21.220   -32.965 37.491   1.00 63.58  ? 29   VAL A O     1 
ATOM   1596  C  CB    . VAL B  2  28  ? 22.903   -35.040 39.299   1.00 72.98  ? 29   VAL A CB    1 
ATOM   1597  C  CG1   . VAL B  2  28  ? 23.640   -33.708 39.178   1.00 74.68  ? 29   VAL A CG1   1 
ATOM   1598  C  CG2   . VAL B  2  28  ? 22.967   -35.573 40.724   1.00 72.83  ? 29   VAL A CG2   1 
ATOM   1599  N  N     . ILE B  2  29  ? 21.497   -34.876 36.328   1.00 61.26  ? 30   ILE A N     1 
ATOM   1600  C  CA    . ILE B  2  29  ? 21.545   -34.248 34.972   1.00 67.43  ? 30   ILE A CA    1 
ATOM   1601  C  C     . ILE B  2  29  ? 20.131   -33.850 34.521   1.00 71.71  ? 30   ILE A C     1 
ATOM   1602  O  O     . ILE B  2  29  ? 19.964   -32.721 34.076   1.00 75.94  ? 30   ILE A O     1 
ATOM   1603  C  CB    . ILE B  2  29  ? 22.254   -35.191 33.979   1.00 65.74  ? 30   ILE A CB    1 
ATOM   1604  C  CG1   . ILE B  2  29  ? 23.767   -35.244 34.255   1.00 65.86  ? 30   ILE A CG1   1 
ATOM   1605  C  CG2   . ILE B  2  29  ? 21.947   -34.834 32.546   1.00 61.11  ? 30   ILE A CG2   1 
ATOM   1606  C  CD1   . ILE B  2  29  ? 24.429   -36.488 33.702   1.00 68.57  ? 30   ILE A CD1   1 
ATOM   1607  N  N     . VAL B  2  30  ? 19.148   -34.742 34.615   1.00 77.10  ? 31   VAL A N     1 
ATOM   1608  C  CA    . VAL B  2  30  ? 17.813   -34.571 33.954   1.00 80.04  ? 31   VAL A CA    1 
ATOM   1609  C  C     . VAL B  2  30  ? 16.766   -34.061 34.951   1.00 70.68  ? 31   VAL A C     1 
ATOM   1610  O  O     . VAL B  2  30  ? 15.637   -33.776 34.511   1.00 59.29  ? 31   VAL A O     1 
ATOM   1611  C  CB    . VAL B  2  30  ? 17.339   -35.876 33.279   1.00 91.64  ? 31   VAL A CB    1 
ATOM   1612  C  CG1   . VAL B  2  30  ? 18.374   -36.415 32.313   1.00 93.67  ? 31   VAL A CG1   1 
ATOM   1613  C  CG2   . VAL B  2  30  ? 16.961   -36.939 34.300   1.00 89.62  ? 31   VAL A CG2   1 
ATOM   1614  N  N     . ALA B  2  31  ? 17.105   -33.971 36.239   1.00 70.31  ? 32   ALA A N     1 
ATOM   1615  C  CA    . ALA B  2  31  ? 16.134   -33.639 37.307   1.00 75.88  ? 32   ALA A CA    1 
ATOM   1616  C  C     . ALA B  2  31  ? 16.835   -33.005 38.505   1.00 80.64  ? 32   ALA A C     1 
ATOM   1617  O  O     . ALA B  2  31  ? 16.485   -33.390 39.636   1.00 88.14  ? 32   ALA A O     1 
ATOM   1618  C  CB    . ALA B  2  31  ? 15.393   -34.895 37.699   1.00 77.07  ? 32   ALA A CB    1 
ATOM   1619  N  N     . ARG B  2  32  ? 17.759   -32.058 38.280   1.00 84.83  ? 33   ARG A N     1 
ATOM   1620  C  CA    . ARG B  2  32  ? 18.318   -31.231 39.388   1.00 83.75  ? 33   ARG A CA    1 
ATOM   1621  C  C     . ARG B  2  32  ? 19.046   -29.986 38.874   1.00 86.36  ? 33   ARG A C     1 
ATOM   1622  O  O     . ARG B  2  32  ? 18.525   -28.863 39.104   1.00 90.18  ? 33   ARG A O     1 
ATOM   1623  C  CB    . ARG B  2  32  ? 19.264   -32.068 40.243   1.00 84.97  ? 33   ARG A CB    1 
ATOM   1624  C  CG    . ARG B  2  32  ? 19.595   -31.446 41.588   1.00 91.08  ? 33   ARG A CG    1 
ATOM   1625  C  CD    . ARG B  2  32  ? 20.323   -32.401 42.521   1.00 92.11  ? 33   ARG A CD    1 
ATOM   1626  N  NE    . ARG B  2  32  ? 19.503   -33.538 42.944   1.00 95.75  ? 33   ARG A NE    1 
ATOM   1627  C  CZ    . ARG B  2  32  ? 19.928   -34.544 43.662   1.00 97.72  ? 33   ARG A CZ    1 
ATOM   1628  N  NH1   . ARG B  2  32  ? 21.159   -34.554 44.148   1.00 101.52 ? 33   ARG A NH1   1 
ATOM   1629  N  NH2   . ARG B  2  32  ? 19.100   -35.538 43.944   1.00 94.89  ? 33   ARG A NH2   1 
ATOM   1630  N  N     . ALA B  2  33  ? 20.196   -30.165 38.224   1.00 88.40  ? 34   ALA A N     1 
ATOM   1631  C  CA    . ALA B  2  33  ? 21.241   -29.125 38.064   1.00 97.15  ? 34   ALA A CA    1 
ATOM   1632  C  C     . ALA B  2  33  ? 21.153   -28.423 36.696   1.00 98.49  ? 34   ALA A C     1 
ATOM   1633  O  O     . ALA B  2  33  ? 21.660   -27.283 36.588   1.00 107.49 ? 34   ALA A O     1 
ATOM   1634  C  CB    . ALA B  2  33  ? 22.604   -29.754 38.282   1.00 99.93  ? 34   ALA A CB    1 
ATOM   1635  N  N     . LEU B  2  34  ? 20.571   -29.069 35.683   1.00 85.29  ? 35   LEU A N     1 
ATOM   1636  C  CA    . LEU B  2  34  ? 20.497   -28.513 34.308   1.00 79.42  ? 35   LEU A CA    1 
ATOM   1637  C  C     . LEU B  2  34  ? 19.085   -28.018 34.028   1.00 79.11  ? 35   LEU A C     1 
ATOM   1638  O  O     . LEU B  2  34  ? 18.112   -28.711 34.317   1.00 66.65  ? 35   LEU A O     1 
ATOM   1639  C  CB    . LEU B  2  34  ? 20.897   -29.579 33.283   1.00 79.35  ? 35   LEU A CB    1 
ATOM   1640  C  CG    . LEU B  2  34  ? 22.323   -30.114 33.392   1.00 79.46  ? 35   LEU A CG    1 
ATOM   1641  C  CD1   . LEU B  2  34  ? 22.621   -31.036 32.215   1.00 82.54  ? 35   LEU A CD1   1 
ATOM   1642  C  CD2   . LEU B  2  34  ? 23.343   -28.990 33.449   1.00 86.32  ? 35   LEU A CD2   1 
ATOM   1643  N  N     . PRO B  2  35  ? 18.949   -26.822 33.416   1.00 85.89  ? 36   PRO A N     1 
ATOM   1644  C  CA    . PRO B  2  35  ? 17.647   -26.276 33.048   1.00 84.60  ? 36   PRO A CA    1 
ATOM   1645  C  C     . PRO B  2  35  ? 17.117   -26.877 31.744   1.00 76.68  ? 36   PRO A C     1 
ATOM   1646  O  O     . PRO B  2  35  ? 17.931   -27.246 30.923   1.00 85.68  ? 36   PRO A O     1 
ATOM   1647  C  CB    . PRO B  2  35  ? 17.954   -24.789 32.822   1.00 85.21  ? 36   PRO A CB    1 
ATOM   1648  C  CG    . PRO B  2  35  ? 19.353   -24.816 32.249   1.00 89.90  ? 36   PRO A CG    1 
ATOM   1649  C  CD    . PRO B  2  35  ? 20.047   -25.941 32.993   1.00 88.99  ? 36   PRO A CD    1 
ATOM   1650  N  N     . ASP B  2  36  ? 15.792   -26.910 31.580   1.00 69.01  ? 37   ASP A N     1 
ATOM   1651  C  CA    . ASP B  2  36  ? 15.121   -27.217 30.290   1.00 68.66  ? 37   ASP A CA    1 
ATOM   1652  C  C     . ASP B  2  36  ? 15.334   -26.033 29.343   1.00 66.22  ? 37   ASP A C     1 
ATOM   1653  O  O     . ASP B  2  36  ? 15.253   -24.892 29.795   1.00 68.71  ? 37   ASP A O     1 
ATOM   1654  C  CB    . ASP B  2  36  ? 13.634   -27.533 30.478   1.00 70.77  ? 37   ASP A CB    1 
ATOM   1655  C  CG    . ASP B  2  36  ? 12.967   -28.179 29.278   1.00 77.49  ? 37   ASP A CG    1 
ATOM   1656  O  OD1   . ASP B  2  36  ? 12.834   -27.503 28.227   1.00 87.77  ? 37   ASP A OD1   1 
ATOM   1657  O  OD2   . ASP B  2  36  ? 12.562   -29.345 29.425   1.00 83.01  ? 37   ASP A OD2   1 
ATOM   1658  N  N     . VAL B  2  37  ? 15.581   -26.315 28.066   1.00 72.01  ? 38   VAL A N     1 
ATOM   1659  C  CA    . VAL B  2  37  ? 15.840   -25.304 26.999   1.00 77.05  ? 38   VAL A CA    1 
ATOM   1660  C  C     . VAL B  2  37  ? 14.582   -24.455 26.752   1.00 74.47  ? 38   VAL A C     1 
ATOM   1661  O  O     . VAL B  2  37  ? 14.726   -23.313 26.241   1.00 85.77  ? 38   VAL A O     1 
ATOM   1662  C  CB    . VAL B  2  37  ? 16.312   -25.995 25.707   1.00 82.88  ? 38   VAL A CB    1 
ATOM   1663  C  CG1   . VAL B  2  37  ? 15.180   -26.760 25.034   1.00 83.57  ? 38   VAL A CG1   1 
ATOM   1664  C  CG2   . VAL B  2  37  ? 16.951   -25.007 24.741   1.00 90.49  ? 38   VAL A CG2   1 
ATOM   1665  N  N     . ARG B  2  38  ? 13.401   -24.990 27.074   1.00 65.65  ? 39   ARG A N     1 
ATOM   1666  C  CA    . ARG B  2  38  ? 12.090   -24.370 26.727   1.00 65.60  ? 39   ARG A CA    1 
ATOM   1667  C  C     . ARG B  2  38  ? 11.776   -23.208 27.681   1.00 66.30  ? 39   ARG A C     1 
ATOM   1668  O  O     . ARG B  2  38  ? 11.577   -22.081 27.185   1.00 75.71  ? 39   ARG A O     1 
ATOM   1669  C  CB    . ARG B  2  38  ? 10.991   -25.439 26.701   1.00 72.73  ? 39   ARG A CB    1 
ATOM   1670  C  CG    . ARG B  2  38  ? 11.121   -26.396 25.522   1.00 76.64  ? 39   ARG A CG    1 
ATOM   1671  C  CD    . ARG B  2  38  ? 10.175   -27.578 25.595   1.00 75.36  ? 39   ARG A CD    1 
ATOM   1672  N  NE    . ARG B  2  38  ? 10.490   -28.395 26.758   1.00 75.09  ? 39   ARG A NE    1 
ATOM   1673  C  CZ    . ARG B  2  38  ? 9.740    -29.391 27.214   1.00 70.87  ? 39   ARG A CZ    1 
ATOM   1674  N  NH1   . ARG B  2  38  ? 8.614    -29.725 26.605   1.00 71.09  ? 39   ARG A NH1   1 
ATOM   1675  N  NH2   . ARG B  2  38  ? 10.123   -30.055 28.288   1.00 64.73  ? 39   ARG A NH2   1 
ATOM   1676  N  N     . ASP B  2  39  ? 11.734   -23.454 28.993   1.00 66.26  ? 40   ASP A N     1 
ATOM   1677  C  CA    . ASP B  2  39  ? 11.321   -22.429 29.997   1.00 57.75  ? 40   ASP A CA    1 
ATOM   1678  C  C     . ASP B  2  39  ? 12.531   -21.946 30.812   1.00 50.17  ? 40   ASP A C     1 
ATOM   1679  O  O     . ASP B  2  39  ? 12.346   -21.061 31.664   1.00 43.66  ? 40   ASP A O     1 
ATOM   1680  C  CB    . ASP B  2  39  ? 10.210   -22.968 30.899   1.00 56.55  ? 40   ASP A CB    1 
ATOM   1681  C  CG    . ASP B  2  39  ? 10.639   -24.127 31.777   1.00 55.76  ? 40   ASP A CG    1 
ATOM   1682  O  OD1   . ASP B  2  39  ? 11.761   -24.640 31.558   1.00 56.27  ? 40   ASP A OD1   1 
ATOM   1683  O  OD2   . ASP B  2  39  ? 9.844    -24.511 32.679   1.00 56.06  ? 40   ASP A OD2   1 
ATOM   1684  N  N     . GLY B  2  40  ? 13.716   -22.510 30.575   1.00 47.62  ? 41   GLY A N     1 
ATOM   1685  C  CA    . GLY B  2  40  ? 14.965   -22.096 31.240   1.00 50.40  ? 41   GLY A CA    1 
ATOM   1686  C  C     . GLY B  2  40  ? 15.035   -22.503 32.700   1.00 54.11  ? 41   GLY A C     1 
ATOM   1687  O  O     . GLY B  2  40  ? 15.958   -22.034 33.394   1.00 64.92  ? 41   GLY A O     1 
ATOM   1688  N  N     . LEU B  2  41  ? 14.137   -23.374 33.163   1.00 52.43  ? 42   LEU A N     1 
ATOM   1689  C  CA    . LEU B  2  41  ? 13.984   -23.663 34.611   1.00 56.54  ? 42   LEU A CA    1 
ATOM   1690  C  C     . LEU B  2  41  ? 14.569   -25.034 34.977   1.00 64.79  ? 42   LEU A C     1 
ATOM   1691  O  O     . LEU B  2  41  ? 14.380   -26.010 34.212   1.00 64.43  ? 42   LEU A O     1 
ATOM   1692  C  CB    . LEU B  2  41  ? 12.498   -23.573 34.958   1.00 50.87  ? 42   LEU A CB    1 
ATOM   1693  C  CG    . LEU B  2  41  ? 11.880   -22.195 34.757   1.00 52.51  ? 42   LEU A CG    1 
ATOM   1694  C  CD1   . LEU B  2  41  ? 10.428   -22.179 35.187   1.00 53.97  ? 42   LEU A CD1   1 
ATOM   1695  C  CD2   . LEU B  2  41  ? 12.665   -21.129 35.501   1.00 57.52  ? 42   LEU A CD2   1 
ATOM   1696  N  N     . LYS B  2  42  ? 15.246   -25.107 36.119   1.00 66.85  ? 43   LYS A N     1 
ATOM   1697  C  CA    . LYS B  2  42  ? 15.538   -26.393 36.790   1.00 72.47  ? 43   LYS A CA    1 
ATOM   1698  C  C     . LYS B  2  42  ? 14.262   -26.827 37.495   1.00 68.47  ? 43   LYS A C     1 
ATOM   1699  O  O     . LYS B  2  42  ? 13.422   -25.985 37.809   1.00 59.68  ? 43   LYS A O     1 
ATOM   1700  C  CB    . LYS B  2  42  ? 16.679   -26.233 37.798   1.00 77.21  ? 43   LYS A CB    1 
ATOM   1701  C  CG    . LYS B  2  42  ? 17.980   -25.709 37.215   1.00 77.04  ? 43   LYS A CG    1 
ATOM   1702  C  CD    . LYS B  2  42  ? 19.036   -25.522 38.278   1.00 77.19  ? 43   LYS A CD    1 
ATOM   1703  C  CE    . LYS B  2  42  ? 20.138   -24.571 37.879   1.00 75.48  ? 43   LYS A CE    1 
ATOM   1704  N  NZ    . LYS B  2  42  ? 21.166   -24.511 38.941   1.00 76.10  ? 43   LYS A NZ    1 
ATOM   1705  N  N     . PRO B  2  43  ? 14.079   -28.139 37.775   1.00 67.43  ? 44   PRO A N     1 
ATOM   1706  C  CA    . PRO B  2  43  ? 12.971   -28.615 38.598   1.00 65.17  ? 44   PRO A CA    1 
ATOM   1707  C  C     . PRO B  2  43  ? 12.579   -27.723 39.783   1.00 66.39  ? 44   PRO A C     1 
ATOM   1708  O  O     . PRO B  2  43  ? 11.434   -27.343 39.881   1.00 67.20  ? 44   PRO A O     1 
ATOM   1709  C  CB    . PRO B  2  43  ? 13.540   -29.937 39.121   1.00 67.69  ? 44   PRO A CB    1 
ATOM   1710  C  CG    . PRO B  2  43  ? 14.335   -30.471 37.965   1.00 69.87  ? 44   PRO A CG    1 
ATOM   1711  C  CD    . PRO B  2  43  ? 14.922   -29.244 37.297   1.00 71.45  ? 44   PRO A CD    1 
ATOM   1712  N  N     . VAL B  2  44  ? 13.527   -27.400 40.660   1.00 69.56  ? 45   VAL A N     1 
ATOM   1713  C  CA    . VAL B  2  44  ? 13.216   -26.679 41.928   1.00 69.61  ? 45   VAL A CA    1 
ATOM   1714  C  C     . VAL B  2  44  ? 12.587   -25.328 41.606   1.00 56.51  ? 45   VAL A C     1 
ATOM   1715  O  O     . VAL B  2  44  ? 11.664   -24.945 42.329   1.00 52.04  ? 45   VAL A O     1 
ATOM   1716  C  CB    . VAL B  2  44  ? 14.439   -26.530 42.844   1.00 83.23  ? 45   VAL A CB    1 
ATOM   1717  C  CG1   . VAL B  2  44  ? 15.543   -25.687 42.214   1.00 83.18  ? 45   VAL A CG1   1 
ATOM   1718  C  CG2   . VAL B  2  44  ? 14.006   -25.978 44.191   1.00 89.17  ? 45   VAL A CG2   1 
ATOM   1719  N  N     . HIS B  2  45  ? 13.062   -24.626 40.573   1.00 54.89  ? 46   HIS A N     1 
ATOM   1720  C  CA    . HIS B  2  45  ? 12.547   -23.291 40.165   1.00 61.49  ? 46   HIS A CA    1 
ATOM   1721  C  C     . HIS B  2  45  ? 11.113   -23.450 39.666   1.00 57.33  ? 46   HIS A C     1 
ATOM   1722  O  O     . HIS B  2  45  ? 10.236   -22.688 40.122   1.00 53.24  ? 46   HIS A O     1 
ATOM   1723  C  CB    . HIS B  2  45  ? 13.436   -22.648 39.095   1.00 70.73  ? 46   HIS A CB    1 
ATOM   1724  C  CG    . HIS B  2  45  ? 14.818   -22.393 39.565   1.00 83.63  ? 46   HIS A CG    1 
ATOM   1725  N  ND1   . HIS B  2  45  ? 15.925   -22.957 38.972   1.00 95.89  ? 46   HIS A ND1   1 
ATOM   1726  C  CD2   . HIS B  2  45  ? 15.272   -21.691 40.614   1.00 88.09  ? 46   HIS A CD2   1 
ATOM   1727  C  CE1   . HIS B  2  45  ? 17.009   -22.586 39.612   1.00 91.75  ? 46   HIS A CE1   1 
ATOM   1728  N  NE2   . HIS B  2  45  ? 16.642   -21.813 40.630   1.00 89.99  ? 46   HIS A NE2   1 
ATOM   1729  N  N     . ARG B  2  46  ? 10.903   -24.416 38.768   1.00 58.74  ? 47   ARG A N     1 
ATOM   1730  C  CA    . ARG B  2  46  ? 9.586    -24.704 38.155   1.00 57.55  ? 47   ARG A CA    1 
ATOM   1731  C  C     . ARG B  2  46  ? 8.567    -25.003 39.253   1.00 54.23  ? 47   ARG A C     1 
ATOM   1732  O  O     . ARG B  2  46  ? 7.470    -24.422 39.205   1.00 47.95  ? 47   ARG A O     1 
ATOM   1733  C  CB    . ARG B  2  46  ? 9.667    -25.889 37.193   1.00 59.45  ? 47   ARG A CB    1 
ATOM   1734  C  CG    . ARG B  2  46  ? 8.383    -26.102 36.419   1.00 59.44  ? 47   ARG A CG    1 
ATOM   1735  C  CD    . ARG B  2  46  ? 8.507    -27.110 35.323   1.00 59.17  ? 47   ARG A CD    1 
ATOM   1736  N  NE    . ARG B  2  46  ? 9.568    -26.814 34.354   1.00 55.55  ? 47   ARG A NE    1 
ATOM   1737  C  CZ    . ARG B  2  46  ? 10.779   -27.349 34.376   1.00 55.90  ? 47   ARG A CZ    1 
ATOM   1738  N  NH1   . ARG B  2  46  ? 11.106   -28.205 35.327   1.00 63.62  ? 47   ARG A NH1   1 
ATOM   1739  N  NH2   . ARG B  2  46  ? 11.659   -27.028 33.451   1.00 50.03  ? 47   ARG A NH2   1 
ATOM   1740  N  N     . ARG B  2  47  ? 8.932    -25.859 40.211   1.00 53.90  ? 48   ARG A N     1 
ATOM   1741  C  CA    . ARG B  2  47  ? 8.026    -26.310 41.298   1.00 51.92  ? 48   ARG A CA    1 
ATOM   1742  C  C     . ARG B  2  47  ? 7.649    -25.122 42.188   1.00 49.94  ? 48   ARG A C     1 
ATOM   1743  O  O     . ARG B  2  47  ? 6.471    -25.066 42.605   1.00 52.57  ? 48   ARG A O     1 
ATOM   1744  C  CB    . ARG B  2  47  ? 8.667    -27.448 42.090   1.00 55.00  ? 48   ARG A CB    1 
ATOM   1745  C  CG    . ARG B  2  47  ? 8.609    -28.766 41.341   1.00 57.11  ? 48   ARG A CG    1 
ATOM   1746  C  CD    . ARG B  2  47  ? 9.542    -29.809 41.909   1.00 52.71  ? 48   ARG A CD    1 
ATOM   1747  N  NE    . ARG B  2  47  ? 9.472    -31.014 41.098   1.00 48.98  ? 48   ARG A NE    1 
ATOM   1748  C  CZ    . ARG B  2  47  ? 10.364   -31.995 41.101   1.00 52.10  ? 48   ARG A CZ    1 
ATOM   1749  N  NH1   . ARG B  2  47  ? 11.426   -31.969 41.890   1.00 54.55  ? 48   ARG A NH1   1 
ATOM   1750  N  NH2   . ARG B  2  47  ? 10.180   -33.027 40.306   1.00 56.31  ? 48   ARG A NH2   1 
ATOM   1751  N  N     . ILE B  2  48  ? 8.593    -24.213 42.456   1.00 46.96  ? 49   ILE A N     1 
ATOM   1752  C  CA    . ILE B  2  48  ? 8.332    -22.979 43.254   1.00 47.89  ? 49   ILE A CA    1 
ATOM   1753  C  C     . ILE B  2  48  ? 7.314    -22.101 42.506   1.00 52.89  ? 49   ILE A C     1 
ATOM   1754  O  O     . ILE B  2  48  ? 6.293    -21.727 43.127   1.00 49.81  ? 49   ILE A O     1 
ATOM   1755  C  CB    . ILE B  2  48  ? 9.636    -22.222 43.581   1.00 44.16  ? 49   ILE A CB    1 
ATOM   1756  C  CG1   . ILE B  2  48  ? 10.515   -23.020 44.540   1.00 45.04  ? 49   ILE A CG1   1 
ATOM   1757  C  CG2   . ILE B  2  48  ? 9.320    -20.844 44.143   1.00 45.51  ? 49   ILE A CG2   1 
ATOM   1758  C  CD1   . ILE B  2  48  ? 11.961   -22.605 44.574   1.00 45.16  ? 49   ILE A CD1   1 
ATOM   1759  N  N     . LEU B  2  49  ? 7.562    -21.785 41.231   1.00 59.44  ? 50   LEU A N     1 
ATOM   1760  C  CA    . LEU B  2  49  ? 6.698    -20.854 40.449   1.00 64.07  ? 50   LEU A CA    1 
ATOM   1761  C  C     . LEU B  2  49  ? 5.304    -21.467 40.290   1.00 72.28  ? 50   LEU A C     1 
ATOM   1762  O  O     . LEU B  2  49  ? 4.317    -20.710 40.355   1.00 72.69  ? 50   LEU A O     1 
ATOM   1763  C  CB    . LEU B  2  49  ? 7.327    -20.552 39.088   1.00 64.24  ? 50   LEU A CB    1 
ATOM   1764  C  CG    . LEU B  2  49  ? 8.654    -19.794 39.145   1.00 74.98  ? 50   LEU A CG    1 
ATOM   1765  C  CD1   . LEU B  2  49  ? 9.088    -19.333 37.768   1.00 80.18  ? 50   LEU A CD1   1 
ATOM   1766  C  CD2   . LEU B  2  49  ? 8.574    -18.599 40.079   1.00 78.41  ? 50   LEU A CD2   1 
ATOM   1767  N  N     . TYR B  2  50  ? 5.223    -22.788 40.105   1.00 78.74  ? 51   TYR A N     1 
ATOM   1768  C  CA    . TYR B  2  50  ? 3.939    -23.514 39.938   1.00 73.23  ? 51   TYR A CA    1 
ATOM   1769  C  C     . TYR B  2  50  ? 3.197    -23.524 41.274   1.00 68.90  ? 51   TYR A C     1 
ATOM   1770  O  O     . TYR B  2  50  ? 1.961    -23.385 41.270   1.00 64.18  ? 51   TYR A O     1 
ATOM   1771  C  CB    . TYR B  2  50  ? 4.161    -24.936 39.430   1.00 74.66  ? 51   TYR A CB    1 
ATOM   1772  C  CG    . TYR B  2  50  ? 2.884    -25.724 39.299   1.00 76.57  ? 51   TYR A CG    1 
ATOM   1773  C  CD1   . TYR B  2  50  ? 1.950    -25.383 38.345   1.00 76.71  ? 51   TYR A CD1   1 
ATOM   1774  C  CD2   . TYR B  2  50  ? 2.590    -26.774 40.152   1.00 74.55  ? 51   TYR A CD2   1 
ATOM   1775  C  CE1   . TYR B  2  50  ? 0.763    -26.077 38.218   1.00 79.48  ? 51   TYR A CE1   1 
ATOM   1776  C  CE2   . TYR B  2  50  ? 1.408    -27.495 40.030   1.00 75.02  ? 51   TYR A CE2   1 
ATOM   1777  C  CZ    . TYR B  2  50  ? 0.488    -27.138 39.068   1.00 79.66  ? 51   TYR A CZ    1 
ATOM   1778  O  OH    . TYR B  2  50  ? -0.683   -27.831 38.953   1.00 83.77  ? 51   TYR A OH    1 
ATOM   1779  N  N     . GLY B  2  51  ? 3.939    -23.691 42.373   1.00 66.50  ? 52   GLY A N     1 
ATOM   1780  C  CA    . GLY B  2  51  ? 3.407    -23.638 43.746   1.00 77.37  ? 52   GLY A CA    1 
ATOM   1781  C  C     . GLY B  2  51  ? 2.835    -22.256 44.057   1.00 76.35  ? 52   GLY A C     1 
ATOM   1782  O  O     . GLY B  2  51  ? 1.759    -22.190 44.688   1.00 83.62  ? 52   GLY A O     1 
ATOM   1783  N  N     . LEU B  2  52  ? 3.518    -21.187 43.639   1.00 62.43  ? 53   LEU A N     1 
ATOM   1784  C  CA    . LEU B  2  52  ? 3.022    -19.804 43.829   1.00 56.60  ? 53   LEU A CA    1 
ATOM   1785  C  C     . LEU B  2  52  ? 1.677    -19.681 43.121   1.00 57.21  ? 53   LEU A C     1 
ATOM   1786  O  O     . LEU B  2  52  ? 0.767    -19.059 43.684   1.00 51.57  ? 53   LEU A O     1 
ATOM   1787  C  CB    . LEU B  2  52  ? 4.030    -18.796 43.275   1.00 52.76  ? 53   LEU A CB    1 
ATOM   1788  C  CG    . LEU B  2  52  ? 5.314    -18.658 44.093   1.00 53.95  ? 53   LEU A CG    1 
ATOM   1789  C  CD1   . LEU B  2  52  ? 6.322    -17.784 43.378   1.00 54.54  ? 53   LEU A CD1   1 
ATOM   1790  C  CD2   . LEU B  2  52  ? 5.032    -18.111 45.486   1.00 51.24  ? 53   LEU A CD2   1 
ATOM   1791  N  N     . ASN B  2  53  ? 1.573    -20.287 41.944   1.00 65.02  ? 54   ASN A N     1 
ATOM   1792  C  CA    . ASN B  2  53  ? 0.426    -20.138 41.012   1.00 69.65  ? 54   ASN A CA    1 
ATOM   1793  C  C     . ASN B  2  53  ? -0.776   -20.930 41.540   1.00 76.43  ? 54   ASN A C     1 
ATOM   1794  O  O     . ASN B  2  53  ? -1.900   -20.413 41.436   1.00 76.93  ? 54   ASN A O     1 
ATOM   1795  C  CB    . ASN B  2  53  ? 0.835    -20.568 39.601   1.00 57.95  ? 54   ASN A CB    1 
ATOM   1796  C  CG    . ASN B  2  53  ? -0.189   -20.227 38.548   1.00 48.31  ? 54   ASN A CG    1 
ATOM   1797  O  OD1   . ASN B  2  53  ? -0.537   -19.067 38.363   1.00 43.01  ? 54   ASN A OD1   1 
ATOM   1798  N  ND2   . ASN B  2  53  ? -0.674   -21.236 37.854   1.00 38.48  ? 54   ASN A ND2   1 
ATOM   1799  N  N     . GLU B  2  54  ? -0.527   -22.120 42.087   1.00 81.28  ? 55   GLU A N     1 
ATOM   1800  C  CA    . GLU B  2  54  ? -1.574   -23.028 42.615   1.00 96.05  ? 55   GLU A CA    1 
ATOM   1801  C  C     . GLU B  2  54  ? -2.187   -22.433 43.879   1.00 91.34  ? 55   GLU A C     1 
ATOM   1802  O  O     . GLU B  2  54  ? -3.356   -22.733 44.118   1.00 89.94  ? 55   GLU A O     1 
ATOM   1803  C  CB    . GLU B  2  54  ? -1.026   -24.430 42.912   1.00 118.40 ? 55   GLU A CB    1 
ATOM   1804  C  CG    . GLU B  2  54  ? -0.800   -25.262 41.672   1.00 129.55 ? 55   GLU A CG    1 
ATOM   1805  C  CD    . GLU B  2  54  ? -1.913   -25.168 40.637   1.00 140.04 ? 55   GLU A CD    1 
ATOM   1806  O  OE1   . GLU B  2  54  ? -2.988   -25.759 40.875   1.00 147.38 ? 55   GLU A OE1   1 
ATOM   1807  O  OE2   . GLU B  2  54  ? -1.717   -24.478 39.604   1.00 149.06 ? 55   GLU A OE2   1 
ATOM   1808  N  N     . GLN B  2  55  ? -1.432   -21.643 44.654   1.00 94.38  ? 56   GLN A N     1 
ATOM   1809  C  CA    . GLN B  2  55  ? -1.968   -20.947 45.858   1.00 92.18  ? 56   GLN A CA    1 
ATOM   1810  C  C     . GLN B  2  55  ? -2.285   -19.490 45.492   1.00 82.45  ? 56   GLN A C     1 
ATOM   1811  O  O     . GLN B  2  55  ? -2.263   -18.648 46.412   1.00 79.57  ? 56   GLN A O     1 
ATOM   1812  C  CB    . GLN B  2  55  ? -0.984   -20.973 47.031   1.00 93.27  ? 56   GLN A CB    1 
ATOM   1813  C  CG    . GLN B  2  55  ? -0.350   -22.331 47.337   1.00 97.95  ? 56   GLN A CG    1 
ATOM   1814  C  CD    . GLN B  2  55  ? -1.363   -23.426 47.584   1.00 98.11  ? 56   GLN A CD    1 
ATOM   1815  O  OE1   . GLN B  2  55  ? -2.082   -23.399 48.577   1.00 97.49  ? 56   GLN A OE1   1 
ATOM   1816  N  NE2   . GLN B  2  55  ? -1.407   -24.410 46.705   1.00 89.24  ? 56   GLN A NE2   1 
ATOM   1817  N  N     . GLY B  2  56  ? -2.505   -19.203 44.206   1.00 77.33  ? 57   GLY A N     1 
ATOM   1818  C  CA    . GLY B  2  56  ? -2.786   -17.859 43.668   1.00 72.58  ? 57   GLY A CA    1 
ATOM   1819  C  C     . GLY B  2  56  ? -2.076   -16.731 44.404   1.00 72.56  ? 57   GLY A C     1 
ATOM   1820  O  O     . GLY B  2  56  ? -2.747   -15.729 44.722   1.00 73.19  ? 57   GLY A O     1 
ATOM   1821  N  N     A MET B  2  57  ? -0.773   -16.876 44.665   0.50 71.74  ? 58   MET A N     1 
ATOM   1822  N  N     B MET B  2  57  ? -0.774   -16.878 44.660   0.50 73.28  ? 58   MET A N     1 
ATOM   1823  C  CA    A MET B  2  57  ? 0.093    -15.783 45.185   0.50 70.89  ? 58   MET A CA    1 
ATOM   1824  C  CA    B MET B  2  57  ? 0.093    -15.788 45.177   0.50 73.38  ? 58   MET A CA    1 
ATOM   1825  C  C     A MET B  2  57  ? 0.554    -14.946 43.994   0.50 73.07  ? 58   MET A C     1 
ATOM   1826  C  C     B MET B  2  57  ? 0.555    -14.946 43.992   0.50 74.49  ? 58   MET A C     1 
ATOM   1827  O  O     A MET B  2  57  ? 1.693    -15.132 43.537   0.50 70.59  ? 58   MET A O     1 
ATOM   1828  O  O     B MET B  2  57  ? 1.693    -15.132 43.536   0.50 71.80  ? 58   MET A O     1 
ATOM   1829  C  CB    A MET B  2  57  ? 1.309    -16.329 45.937   0.50 69.14  ? 58   MET A CB    1 
ATOM   1830  C  CB    B MET B  2  57  ? 1.301    -16.319 45.949   0.50 73.36  ? 58   MET A CB    1 
ATOM   1831  C  CG    A MET B  2  57  ? 1.044    -17.611 46.682   0.50 66.89  ? 58   MET A CG    1 
ATOM   1832  C  CG    B MET B  2  57  ? 1.800    -15.206 46.833   0.50 74.88  ? 58   MET A CG    1 
ATOM   1833  S  SD    A MET B  2  57  ? 0.447    -17.420 48.357   0.50 66.43  ? 58   MET A SD    1 
ATOM   1834  S  SD    B MET B  2  57  ? 0.704    -13.751 46.592   0.50 68.14  ? 58   MET A SD    1 
ATOM   1835  C  CE    A MET B  2  57  ? 0.848    -19.022 49.043   0.50 62.37  ? 58   MET A CE    1 
ATOM   1836  C  CE    B MET B  2  57  ? -0.827   -14.369 47.292   0.50 67.51  ? 58   MET A CE    1 
ATOM   1837  N  N     . THR B  2  58  ? -0.342   -14.093 43.491   1.00 78.58  ? 59   THR A N     1 
ATOM   1838  C  CA    . THR B  2  58  ? -0.166   -13.295 42.249   1.00 86.77  ? 59   THR A CA    1 
ATOM   1839  C  C     . THR B  2  58  ? 0.238    -11.886 42.661   1.00 95.22  ? 59   THR A C     1 
ATOM   1840  O  O     . THR B  2  58  ? 0.144    -11.567 43.847   1.00 109.02 ? 59   THR A O     1 
ATOM   1841  C  CB    . THR B  2  58  ? -1.462   -13.358 41.436   1.00 89.39  ? 59   THR A CB    1 
ATOM   1842  O  OG1   . THR B  2  58  ? -2.511   -13.111 42.373   1.00 91.10  ? 59   THR A OG1   1 
ATOM   1843  C  CG2   . THR B  2  58  ? -1.719   -14.705 40.793   1.00 88.51  ? 59   THR A CG2   1 
ATOM   1844  N  N     . PRO B  2  59  ? 0.732    -11.029 41.738   1.00 99.70  ? 60   PRO A N     1 
ATOM   1845  C  CA    . PRO B  2  59  ? 1.224    -9.693  42.098   1.00 98.49  ? 60   PRO A CA    1 
ATOM   1846  C  C     . PRO B  2  59  ? 0.180    -8.788  42.776   1.00 93.29  ? 60   PRO A C     1 
ATOM   1847  O  O     . PRO B  2  59  ? 0.572    -7.990  43.612   1.00 85.94  ? 60   PRO A O     1 
ATOM   1848  C  CB    . PRO B  2  59  ? 1.632    -9.084  40.744   1.00 99.10  ? 60   PRO A CB    1 
ATOM   1849  C  CG    . PRO B  2  59  ? 1.965    -10.285 39.892   1.00 105.13 ? 60   PRO A CG    1 
ATOM   1850  C  CD    . PRO B  2  59  ? 0.920    -11.311 40.308   1.00 102.10 ? 60   PRO A CD    1 
ATOM   1851  N  N     . ASP B  2  60  ? -1.096   -8.937  42.394   1.00 83.50  ? 61   ASP A N     1 
ATOM   1852  C  CA    . ASP B  2  60  ? -2.264   -8.144  42.879   1.00 72.17  ? 61   ASP A CA    1 
ATOM   1853  C  C     . ASP B  2  60  ? -2.598   -8.516  44.326   1.00 64.19  ? 61   ASP A C     1 
ATOM   1854  O  O     . ASP B  2  60  ? -2.906   -7.603  45.099   1.00 58.64  ? 61   ASP A O     1 
ATOM   1855  C  CB    . ASP B  2  60  ? -3.501   -8.354  41.998   1.00 77.74  ? 61   ASP A CB    1 
ATOM   1856  C  CG    . ASP B  2  60  ? -3.875   -9.820  41.801   1.00 82.83  ? 61   ASP A CG    1 
ATOM   1857  O  OD1   . ASP B  2  60  ? -2.970   -10.621 41.478   1.00 83.61  ? 61   ASP A OD1   1 
ATOM   1858  O  OD2   . ASP B  2  60  ? -5.063   -10.156 41.977   1.00 85.36  ? 61   ASP A OD2   1 
ATOM   1859  N  N     . LYS B  2  61  ? -2.552   -9.808  44.670   1.00 66.57  ? 62   LYS A N     1 
ATOM   1860  C  CA    . LYS B  2  61  ? -2.771   -10.326 46.057   1.00 60.20  ? 62   LYS A CA    1 
ATOM   1861  C  C     . LYS B  2  61  ? -1.525   -10.057 46.919   1.00 56.10  ? 62   LYS A C     1 
ATOM   1862  O  O     . LYS B  2  61  ? -0.427   -9.817  46.358   1.00 55.06  ? 62   LYS A O     1 
ATOM   1863  C  CB    . LYS B  2  61  ? -3.095   -11.824 46.038   1.00 50.29  ? 62   LYS A CB    1 
ATOM   1864  C  CG    . LYS B  2  61  ? -4.299   -12.230 45.199   1.00 44.15  ? 62   LYS A CG    1 
ATOM   1865  N  N     . SER B  2  62  ? -1.672   -10.131 48.239   1.00 51.02  ? 63   SER A N     1 
ATOM   1866  C  CA    . SER B  2  62  ? -0.639   -9.716  49.223   1.00 55.57  ? 63   SER A CA    1 
ATOM   1867  C  C     . SER B  2  62  ? 0.392    -10.826 49.433   1.00 55.20  ? 63   SER A C     1 
ATOM   1868  O  O     . SER B  2  62  ? 0.042    -12.016 49.268   1.00 63.59  ? 63   SER A O     1 
ATOM   1869  C  CB    . SER B  2  62  ? -1.271   -9.360  50.541   1.00 56.83  ? 63   SER A CB    1 
ATOM   1870  O  OG    . SER B  2  62  ? -1.580   -10.536 51.272   1.00 52.55  ? 63   SER A OG    1 
ATOM   1871  N  N     . TYR B  2  63  ? 1.607    -10.432 49.823   1.00 52.52  ? 64   TYR A N     1 
ATOM   1872  C  CA    . TYR B  2  63  ? 2.766    -11.327 50.087   1.00 54.05  ? 64   TYR A CA    1 
ATOM   1873  C  C     . TYR B  2  63  ? 2.359    -12.383 51.112   1.00 56.60  ? 64   TYR A C     1 
ATOM   1874  O  O     . TYR B  2  63  ? 1.719    -12.037 52.104   1.00 62.14  ? 64   TYR A O     1 
ATOM   1875  C  CB    . TYR B  2  63  ? 3.951    -10.564 50.673   1.00 55.88  ? 64   TYR A CB    1 
ATOM   1876  C  CG    . TYR B  2  63  ? 4.559    -9.517  49.781   1.00 63.15  ? 64   TYR A CG    1 
ATOM   1877  C  CD1   . TYR B  2  63  ? 5.570    -9.845  48.898   1.00 65.87  ? 64   TYR A CD1   1 
ATOM   1878  C  CD2   . TYR B  2  63  ? 4.141    -8.193  49.837   1.00 69.81  ? 64   TYR A CD2   1 
ATOM   1879  C  CE1   . TYR B  2  63  ? 6.147    -8.884  48.078   1.00 66.84  ? 64   TYR A CE1   1 
ATOM   1880  C  CE2   . TYR B  2  63  ? 4.706    -7.223  49.023   1.00 64.74  ? 64   TYR A CE2   1 
ATOM   1881  C  CZ    . TYR B  2  63  ? 5.711    -7.571  48.140   1.00 59.59  ? 64   TYR A CZ    1 
ATOM   1882  O  OH    . TYR B  2  63  ? 6.266    -6.634  47.330   1.00 44.77  ? 64   TYR A OH    1 
ATOM   1883  N  N     A LYS B  2  64  ? 2.753    -13.632 50.874   0.50 58.88  ? 65   LYS A N     1 
ATOM   1884  N  N     B LYS B  2  64  ? 2.752    -13.634 50.873   0.50 57.33  ? 65   LYS A N     1 
ATOM   1885  C  CA    A LYS B  2  64  ? 2.536    -14.786 51.789   0.50 57.69  ? 65   LYS A CA    1 
ATOM   1886  C  CA    B LYS B  2  64  ? 2.533    -14.783 51.793   0.50 55.27  ? 65   LYS A CA    1 
ATOM   1887  C  C     A LYS B  2  64  ? 3.892    -15.185 52.393   0.50 55.18  ? 65   LYS A C     1 
ATOM   1888  C  C     B LYS B  2  64  ? 3.891    -15.185 52.392   0.50 53.81  ? 65   LYS A C     1 
ATOM   1889  O  O     A LYS B  2  64  ? 4.931    -14.989 51.718   0.50 53.64  ? 65   LYS A O     1 
ATOM   1890  O  O     B LYS B  2  64  ? 4.931    -14.989 51.718   0.50 52.40  ? 65   LYS A O     1 
ATOM   1891  C  CB    A LYS B  2  64  ? 1.826    -15.904 51.011   0.50 58.65  ? 65   LYS A CB    1 
ATOM   1892  C  CB    B LYS B  2  64  ? 1.782    -15.903 51.054   0.50 54.43  ? 65   LYS A CB    1 
ATOM   1893  C  CG    A LYS B  2  64  ? 2.010    -17.326 51.530   0.50 58.04  ? 65   LYS A CG    1 
ATOM   1894  C  CG    B LYS B  2  64  ? 0.311    -15.606 50.773   0.50 51.52  ? 65   LYS A CG    1 
ATOM   1895  N  N     . LYS B  2  65  ? 3.886    -15.700 53.627   1.00 54.66  ? 66   LYS A N     1 
ATOM   1896  C  CA    . LYS B  2  65  ? 5.114    -16.128 54.362   1.00 51.57  ? 66   LYS A CA    1 
ATOM   1897  C  C     . LYS B  2  65  ? 5.867    -17.179 53.550   1.00 48.89  ? 66   LYS A C     1 
ATOM   1898  O  O     . LYS B  2  65  ? 5.216    -18.077 52.996   1.00 48.98  ? 66   LYS A O     1 
ATOM   1899  C  CB    . LYS B  2  65  ? 4.785    -16.707 55.744   1.00 43.06  ? 66   LYS A CB    1 
ATOM   1900  N  N     . SER B  2  66  ? 7.188    -17.066 53.503   1.00 51.44  ? 67   SER A N     1 
ATOM   1901  C  CA    . SER B  2  66  ? 8.077    -17.970 52.733   1.00 55.32  ? 67   SER A CA    1 
ATOM   1902  C  C     . SER B  2  66  ? 7.976    -19.396 53.294   1.00 56.05  ? 67   SER A C     1 
ATOM   1903  O  O     . SER B  2  66  ? 7.875    -20.350 52.504   1.00 52.47  ? 67   SER A O     1 
ATOM   1904  C  CB    . SER B  2  66  ? 9.489    -17.440 52.745   1.00 55.30  ? 67   SER A CB    1 
ATOM   1905  O  OG    . SER B  2  66  ? 9.532    -16.156 52.138   1.00 50.69  ? 67   SER A OG    1 
ATOM   1906  N  N     . ALA B  2  67  ? 7.951    -19.548 54.611   1.00 58.67  ? 68   ALA A N     1 
ATOM   1907  C  CA    . ALA B  2  67  ? 7.818    -20.862 55.282   1.00 60.24  ? 68   ALA A CA    1 
ATOM   1908  C  C     . ALA B  2  67  ? 6.541    -21.577 54.806   1.00 57.18  ? 68   ALA A C     1 
ATOM   1909  O  O     . ALA B  2  67  ? 6.572    -22.815 54.703   1.00 52.29  ? 68   ALA A O     1 
ATOM   1910  C  CB    . ALA B  2  67  ? 7.843    -20.691 56.782   1.00 65.80  ? 68   ALA A CB    1 
ATOM   1911  N  N     A ARG B  2  68  ? 5.463    -20.835 54.521   0.50 54.78  ? 69   ARG A N     1 
ATOM   1912  N  N     B ARG B  2  68  ? 5.463    -20.834 54.521   0.50 57.35  ? 69   ARG A N     1 
ATOM   1913  C  CA    A ARG B  2  68  ? 4.181    -21.380 53.988   0.50 51.96  ? 69   ARG A CA    1 
ATOM   1914  C  CA    B ARG B  2  68  ? 4.183    -21.380 53.989   0.50 55.81  ? 69   ARG A CA    1 
ATOM   1915  C  C     A ARG B  2  68  ? 4.435    -21.920 52.575   0.50 53.72  ? 69   ARG A C     1 
ATOM   1916  C  C     B ARG B  2  68  ? 4.436    -21.920 52.575   0.50 55.99  ? 69   ARG A C     1 
ATOM   1917  O  O     A ARG B  2  68  ? 4.001    -23.055 52.285   0.50 52.32  ? 69   ARG A O     1 
ATOM   1918  O  O     B ARG B  2  68  ? 4.001    -23.055 52.285   0.50 54.39  ? 69   ARG A O     1 
ATOM   1919  C  CB    A ARG B  2  68  ? 3.085    -20.303 54.036   0.50 47.04  ? 69   ARG A CB    1 
ATOM   1920  C  CB    B ARG B  2  68  ? 3.070    -20.322 54.016   0.50 53.30  ? 69   ARG A CB    1 
ATOM   1921  C  CG    A ARG B  2  68  ? 1.750    -20.684 53.405   0.50 44.68  ? 69   ARG A CG    1 
ATOM   1922  C  CG    B ARG B  2  68  ? 1.748    -20.830 53.441   0.50 53.04  ? 69   ARG A CG    1 
ATOM   1923  C  CD    A ARG B  2  68  ? 1.144    -19.482 52.696   0.50 42.93  ? 69   ARG A CD    1 
ATOM   1924  C  CD    B ARG B  2  68  ? 0.500    -20.044 53.822   0.50 53.32  ? 69   ARG A CD    1 
ATOM   1925  N  NE    A ARG B  2  68  ? -0.247   -19.611 52.275   0.50 39.70  ? 69   ARG A NE    1 
ATOM   1926  N  NE    B ARG B  2  68  ? -0.752   -20.557 53.257   0.50 52.34  ? 69   ARG A NE    1 
ATOM   1927  C  CZ    A ARG B  2  68  ? -1.262   -18.985 52.859   0.50 38.02  ? 69   ARG A CZ    1 
ATOM   1928  C  CZ    B ARG B  2  68  ? -0.913   -21.753 52.688   0.50 50.94  ? 69   ARG A CZ    1 
ATOM   1929  N  NH1   A ARG B  2  68  ? -1.042   -18.206 53.904   0.50 37.70  ? 69   ARG A NH1   1 
ATOM   1930  N  NH1   B ARG B  2  68  ? 0.104    -22.588 52.598   0.50 50.82  ? 69   ARG A NH1   1 
ATOM   1931  N  NH2   A ARG B  2  68  ? -2.493   -19.141 52.404   0.50 37.76  ? 69   ARG A NH2   1 
ATOM   1932  N  NH2   B ARG B  2  68  ? -2.093   -22.119 52.219   0.50 50.04  ? 69   ARG A NH2   1 
ATOM   1933  N  N     . ILE B  2  69  ? 5.158    -21.150 51.750   1.00 55.64  ? 70   ILE A N     1 
ATOM   1934  C  CA    . ILE B  2  69  ? 5.429    -21.468 50.319   1.00 54.51  ? 70   ILE A CA    1 
ATOM   1935  C  C     . ILE B  2  69  ? 6.358    -22.680 50.253   1.00 57.18  ? 70   ILE A C     1 
ATOM   1936  O  O     . ILE B  2  69  ? 6.051    -23.609 49.491   1.00 68.20  ? 70   ILE A O     1 
ATOM   1937  C  CB    . ILE B  2  69  ? 6.021    -20.248 49.583   1.00 52.15  ? 70   ILE A CB    1 
ATOM   1938  C  CG1   . ILE B  2  69  ? 5.047    -19.065 49.572   1.00 49.08  ? 70   ILE A CG1   1 
ATOM   1939  C  CG2   . ILE B  2  69  ? 6.455    -20.626 48.174   1.00 56.12  ? 70   ILE A CG2   1 
ATOM   1940  C  CD1   . ILE B  2  69  ? 5.683    -17.761 49.120   1.00 52.57  ? 70   ILE A CD1   1 
ATOM   1941  N  N     . VAL B  2  70  ? 7.451    -22.663 51.015   1.00 55.85  ? 71   VAL A N     1 
ATOM   1942  C  CA    . VAL B  2  70  ? 8.497    -23.733 51.008   1.00 56.87  ? 71   VAL A CA    1 
ATOM   1943  C  C     . VAL B  2  70  ? 7.856    -25.039 51.485   1.00 61.20  ? 71   VAL A C     1 
ATOM   1944  O  O     . VAL B  2  70  ? 8.154    -26.090 50.901   1.00 56.04  ? 71   VAL A O     1 
ATOM   1945  C  CB    . VAL B  2  70  ? 9.717    -23.354 51.873   1.00 55.90  ? 71   VAL A CB    1 
ATOM   1946  C  CG1   . VAL B  2  70  ? 10.702   -24.509 51.993   1.00 58.45  ? 71   VAL A CG1   1 
ATOM   1947  C  CG2   . VAL B  2  70  ? 10.434   -22.120 51.361   1.00 58.95  ? 71   VAL A CG2   1 
ATOM   1948  N  N     . GLY B  2  71  ? 7.021    -24.976 52.524   1.00 78.91  ? 72   GLY A N     1 
ATOM   1949  C  CA    . GLY B  2  71  ? 6.295    -26.140 53.076   1.00 83.14  ? 72   GLY A CA    1 
ATOM   1950  C  C     . GLY B  2  71  ? 5.413    -26.773 52.019   1.00 82.87  ? 72   GLY A C     1 
ATOM   1951  O  O     . GLY B  2  71  ? 5.492    -28.006 51.837   1.00 81.29  ? 72   GLY A O     1 
ATOM   1952  N  N     A ASP B  2  72  ? 4.618    -25.951 51.325   0.50 75.89  ? 73   ASP A N     1 
ATOM   1953  N  N     B ASP B  2  72  ? 4.618    -25.949 51.327   0.50 81.96  ? 73   ASP A N     1 
ATOM   1954  C  CA    A ASP B  2  72  ? 3.672    -26.376 50.261   0.50 68.98  ? 73   ASP A CA    1 
ATOM   1955  C  CA    B ASP B  2  72  ? 3.673    -26.381 50.265   0.50 78.25  ? 73   ASP A CA    1 
ATOM   1956  C  C     A ASP B  2  72  ? 4.466    -27.035 49.126   0.50 68.35  ? 73   ASP A C     1 
ATOM   1957  C  C     B ASP B  2  72  ? 4.466    -27.036 49.127   0.50 73.51  ? 73   ASP A C     1 
ATOM   1958  O  O     A ASP B  2  72  ? 4.060    -28.119 48.693   0.50 69.30  ? 73   ASP A O     1 
ATOM   1959  O  O     B ASP B  2  72  ? 4.060    -28.119 48.692   0.50 74.11  ? 73   ASP A O     1 
ATOM   1960  C  CB    A ASP B  2  72  ? 2.810    -25.184 49.820   0.50 65.65  ? 73   ASP A CB    1 
ATOM   1961  C  CB    B ASP B  2  72  ? 2.812    -25.219 49.758   0.50 82.09  ? 73   ASP A CB    1 
ATOM   1962  C  CG    A ASP B  2  72  ? 2.038    -25.338 48.518   0.50 63.29  ? 73   ASP A CG    1 
ATOM   1963  C  CG    B ASP B  2  72  ? 1.957    -24.514 50.784   0.50 89.12  ? 73   ASP A CG    1 
ATOM   1964  O  OD1   A ASP B  2  72  ? 1.044    -26.098 48.505   0.50 62.16  ? 73   ASP A OD1   1 
ATOM   1965  O  OD1   B ASP B  2  72  ? 1.865    -25.025 51.931   0.50 81.60  ? 73   ASP A OD1   1 
ATOM   1966  O  OD2   A ASP B  2  72  ? 2.420    -24.666 47.533   0.50 62.05  ? 73   ASP A OD2   1 
ATOM   1967  O  OD2   B ASP B  2  72  ? 1.392    -23.442 50.404   0.50 105.05 ? 73   ASP A OD2   1 
ATOM   1968  N  N     . VAL B  2  73  ? 5.566    -26.420 48.685   1.00 69.97  ? 74   VAL A N     1 
ATOM   1969  C  CA    . VAL B  2  73  ? 6.387    -26.910 47.538   1.00 73.87  ? 74   VAL A CA    1 
ATOM   1970  C  C     . VAL B  2  73  ? 7.045    -28.239 47.928   1.00 85.88  ? 74   VAL A C     1 
ATOM   1971  O  O     . VAL B  2  73  ? 7.005    -29.172 47.119   1.00 90.22  ? 74   VAL A O     1 
ATOM   1972  C  CB    . VAL B  2  73  ? 7.413    -25.859 47.074   1.00 64.07  ? 74   VAL A CB    1 
ATOM   1973  C  CG1   . VAL B  2  73  ? 8.461    -26.443 46.142   1.00 63.40  ? 74   VAL A CG1   1 
ATOM   1974  C  CG2   . VAL B  2  73  ? 6.737    -24.669 46.413   1.00 60.47  ? 74   VAL A CG2   1 
ATOM   1975  N  N     . MET B  2  74  ? 7.603    -28.322 49.135   1.00 94.65  ? 75   MET A N     1 
ATOM   1976  C  CA    . MET B  2  74  ? 8.318    -29.519 49.665   1.00 91.17  ? 75   MET A CA    1 
ATOM   1977  C  C     . MET B  2  74  ? 7.329    -30.676 49.844   1.00 92.84  ? 75   MET A C     1 
ATOM   1978  O  O     . MET B  2  74  ? 7.693    -31.839 49.524   1.00 103.73 ? 75   MET A O     1 
ATOM   1979  C  CB    . MET B  2  74  ? 8.988    -29.191 51.003   1.00 92.26  ? 75   MET A CB    1 
ATOM   1980  C  CG    . MET B  2  74  ? 9.573    -30.396 51.707   1.00 89.27  ? 75   MET A CG    1 
ATOM   1981  S  SD    . MET B  2  74  ? 10.850   -30.046 52.934   1.00 99.37  ? 75   MET A SD    1 
ATOM   1982  C  CE    . MET B  2  74  ? 10.484   -28.336 53.349   1.00 105.22 ? 75   MET A CE    1 
ATOM   1983  N  N     . GLY B  2  75  ? 6.122    -30.368 50.327   1.00 93.09  ? 76   GLY A N     1 
ATOM   1984  C  CA    . GLY B  2  75  ? 5.037    -31.344 50.541   1.00 97.78  ? 76   GLY A CA    1 
ATOM   1985  C  C     . GLY B  2  75  ? 4.576    -31.986 49.246   1.00 91.58  ? 76   GLY A C     1 
ATOM   1986  O  O     . GLY B  2  75  ? 4.459    -33.216 49.226   1.00 96.29  ? 76   GLY A O     1 
ATOM   1987  N  N     . LYS B  2  76  ? 4.355    -31.188 48.196   1.00 73.09  ? 77   LYS A N     1 
ATOM   1988  C  CA    . LYS B  2  76  ? 3.531    -31.571 47.019   1.00 65.23  ? 77   LYS A CA    1 
ATOM   1989  C  C     . LYS B  2  76  ? 4.377    -31.924 45.793   1.00 63.24  ? 77   LYS A C     1 
ATOM   1990  O  O     . LYS B  2  76  ? 3.870    -32.710 44.976   1.00 71.17  ? 77   LYS A O     1 
ATOM   1991  C  CB    . LYS B  2  76  ? 2.590    -30.414 46.669   1.00 64.78  ? 77   LYS A CB    1 
ATOM   1992  C  CG    . LYS B  2  76  ? 1.538    -30.115 47.729   1.00 63.73  ? 77   LYS A CG    1 
ATOM   1993  C  CD    . LYS B  2  76  ? 0.463    -29.166 47.251   1.00 65.67  ? 77   LYS A CD    1 
ATOM   1994  C  CE    . LYS B  2  76  ? -0.614   -28.875 48.265   1.00 69.62  ? 77   LYS A CE    1 
ATOM   1995  N  NZ    . LYS B  2  76  ? -1.279   -27.578 47.984   1.00 68.14  ? 77   LYS A NZ    1 
ATOM   1996  N  N     . TYR B  2  77  ? 5.570    -31.352 45.624   1.00 58.15  ? 78   TYR A N     1 
ATOM   1997  C  CA    . TYR B  2  77  ? 6.314    -31.384 44.334   1.00 55.79  ? 78   TYR A CA    1 
ATOM   1998  C  C     . TYR B  2  77  ? 7.796    -31.764 44.516   1.00 58.61  ? 78   TYR A C     1 
ATOM   1999  O  O     . TYR B  2  77  ? 8.291    -32.581 43.711   1.00 67.93  ? 78   TYR A O     1 
ATOM   2000  C  CB    . TYR B  2  77  ? 6.193    -30.032 43.632   1.00 51.34  ? 78   TYR A CB    1 
ATOM   2001  C  CG    . TYR B  2  77  ? 4.812    -29.421 43.630   1.00 53.10  ? 78   TYR A CG    1 
ATOM   2002  C  CD1   . TYR B  2  77  ? 3.740    -30.047 43.021   1.00 54.69  ? 78   TYR A CD1   1 
ATOM   2003  C  CD2   . TYR B  2  77  ? 4.583    -28.184 44.208   1.00 56.99  ? 78   TYR A CD2   1 
ATOM   2004  C  CE1   . TYR B  2  77  ? 2.477    -29.483 43.001   1.00 54.18  ? 78   TYR A CE1   1 
ATOM   2005  C  CE2   . TYR B  2  77  ? 3.327    -27.591 44.209   1.00 57.41  ? 78   TYR A CE2   1 
ATOM   2006  C  CZ    . TYR B  2  77  ? 2.269    -28.250 43.603   1.00 57.01  ? 78   TYR A CZ    1 
ATOM   2007  O  OH    . TYR B  2  77  ? 1.029    -27.671 43.593   1.00 56.58  ? 78   TYR A OH    1 
ATOM   2008  N  N     . HIS B  2  78  ? 8.487    -31.169 45.496   1.00 58.09  ? 79   HIS A N     1 
ATOM   2009  C  CA    . HIS B  2  78  ? 9.968    -31.178 45.638   1.00 61.43  ? 79   HIS A CA    1 
ATOM   2010  C  C     . HIS B  2  78  ? 10.394   -31.881 46.924   1.00 72.44  ? 79   HIS A C     1 
ATOM   2011  O  O     . HIS B  2  78  ? 10.611   -31.235 47.948   1.00 81.32  ? 79   HIS A O     1 
ATOM   2012  C  CB    . HIS B  2  78  ? 10.501   -29.743 45.579   1.00 58.66  ? 79   HIS A CB    1 
ATOM   2013  C  CG    . HIS B  2  78  ? 11.913   -29.674 45.118   1.00 53.36  ? 79   HIS A CG    1 
ATOM   2014  N  ND1   . HIS B  2  78  ? 12.238   -29.831 43.798   1.00 52.33  ? 79   HIS A ND1   1 
ATOM   2015  C  CD2   . HIS B  2  78  ? 13.075   -29.493 45.778   1.00 49.47  ? 79   HIS A CD2   1 
ATOM   2016  C  CE1   . HIS B  2  78  ? 13.543   -29.752 43.658   1.00 49.47  ? 79   HIS A CE1   1 
ATOM   2017  N  NE2   . HIS B  2  78  ? 14.081   -29.542 44.850   1.00 48.08  ? 79   HIS A NE2   1 
ATOM   2018  N  N     . PRO B  2  79  ? 10.572   -33.220 46.913   1.00 83.50  ? 80   PRO A N     1 
ATOM   2019  C  CA    . PRO B  2  79  ? 10.854   -33.964 48.144   1.00 83.21  ? 80   PRO A CA    1 
ATOM   2020  C  C     . PRO B  2  79  ? 12.343   -33.876 48.519   1.00 79.50  ? 80   PRO A C     1 
ATOM   2021  O  O     . PRO B  2  79  ? 13.034   -34.886 48.434   1.00 90.50  ? 80   PRO A O     1 
ATOM   2022  C  CB    . PRO B  2  79  ? 10.461   -35.392 47.737   1.00 85.98  ? 80   PRO A CB    1 
ATOM   2023  C  CG    . PRO B  2  79  ? 10.852   -35.471 46.267   1.00 83.84  ? 80   PRO A CG    1 
ATOM   2024  C  CD    . PRO B  2  79  ? 10.561   -34.085 45.716   1.00 84.11  ? 80   PRO A CD    1 
ATOM   2025  N  N     . HIS B  2  80  ? 12.805   -32.677 48.898   1.00 70.35  ? 81   HIS A N     1 
ATOM   2026  C  CA    . HIS B  2  80  ? 14.218   -32.384 49.257   1.00 70.40  ? 81   HIS A CA    1 
ATOM   2027  C  C     . HIS B  2  80  ? 14.257   -31.333 50.367   1.00 68.80  ? 81   HIS A C     1 
ATOM   2028  O  O     . HIS B  2  80  ? 13.172   -30.968 50.885   1.00 62.56  ? 81   HIS A O     1 
ATOM   2029  C  CB    . HIS B  2  80  ? 15.022   -31.935 48.032   1.00 75.75  ? 81   HIS A CB    1 
ATOM   2030  C  CG    . HIS B  2  80  ? 15.010   -32.893 46.888   1.00 82.64  ? 81   HIS A CG    1 
ATOM   2031  N  ND1   . HIS B  2  80  ? 15.876   -33.962 46.816   1.00 83.12  ? 81   HIS A ND1   1 
ATOM   2032  C  CD2   . HIS B  2  80  ? 14.258   -32.932 45.762   1.00 85.49  ? 81   HIS A CD2   1 
ATOM   2033  C  CE1   . HIS B  2  80  ? 15.654   -34.622 45.696   1.00 84.12  ? 81   HIS A CE1   1 
ATOM   2034  N  NE2   . HIS B  2  80  ? 14.670   -34.007 45.030   1.00 81.76  ? 81   HIS A NE2   1 
ATOM   2035  N  N     . GLY B  2  81  ? 15.459   -30.858 50.713   1.00 71.03  ? 82   GLY A N     1 
ATOM   2036  C  CA    . GLY B  2  81  ? 15.694   -29.941 51.843   1.00 76.36  ? 82   GLY A CA    1 
ATOM   2037  C  C     . GLY B  2  81  ? 14.943   -28.635 51.691   1.00 75.48  ? 82   GLY A C     1 
ATOM   2038  O  O     . GLY B  2  81  ? 14.827   -28.162 50.556   1.00 76.61  ? 82   GLY A O     1 
ATOM   2039  N  N     . ASP B  2  82  ? 14.467   -28.072 52.802   1.00 72.41  ? 83   ASP A N     1 
ATOM   2040  C  CA    . ASP B  2  82  ? 13.863   -26.712 52.869   1.00 69.40  ? 83   ASP A CA    1 
ATOM   2041  C  C     . ASP B  2  82  ? 14.917   -25.676 52.437   1.00 64.07  ? 83   ASP A C     1 
ATOM   2042  O  O     . ASP B  2  82  ? 14.557   -24.742 51.702   1.00 49.90  ? 83   ASP A O     1 
ATOM   2043  C  CB    . ASP B  2  82  ? 13.298   -26.425 54.266   1.00 67.82  ? 83   ASP A CB    1 
ATOM   2044  C  CG    . ASP B  2  82  ? 14.295   -26.696 55.373   1.00 73.85  ? 83   ASP A CG    1 
ATOM   2045  O  OD1   . ASP B  2  82  ? 14.812   -27.821 55.412   1.00 72.82  ? 83   ASP A OD1   1 
ATOM   2046  O  OD2   . ASP B  2  82  ? 14.569   -25.774 56.172   1.00 84.80  ? 83   ASP A OD2   1 
ATOM   2047  N  N     . SER B  2  83  ? 16.183   -25.823 52.840   1.00 65.19  ? 84   SER A N     1 
ATOM   2048  C  CA    . SER B  2  83  ? 17.256   -24.875 52.442   1.00 74.02  ? 84   SER A CA    1 
ATOM   2049  C  C     . SER B  2  83  ? 17.421   -24.862 50.913   1.00 85.11  ? 84   SER A C     1 
ATOM   2050  O  O     . SER B  2  83  ? 17.557   -23.756 50.355   1.00 95.94  ? 84   SER A O     1 
ATOM   2051  C  CB    . SER B  2  83  ? 18.557   -25.153 53.146   1.00 71.24  ? 84   SER A CB    1 
ATOM   2052  O  OG    . SER B  2  83  ? 18.671   -26.530 53.468   1.00 75.97  ? 84   SER A OG    1 
ATOM   2053  N  N     . SER B  2  84  ? 17.410   -26.020 50.248   1.00 93.36  ? 85   SER A N     1 
ATOM   2054  C  CA    . SER B  2  84  ? 17.585   -26.121 48.770   1.00 96.47  ? 85   SER A CA    1 
ATOM   2055  C  C     . SER B  2  84  ? 16.487   -25.300 48.085   1.00 92.12  ? 85   SER A C     1 
ATOM   2056  O  O     . SER B  2  84  ? 16.805   -24.575 47.125   1.00 93.40  ? 85   SER A O     1 
ATOM   2057  C  CB    . SER B  2  84  ? 17.572   -27.553 48.254   1.00 93.14  ? 85   SER A CB    1 
ATOM   2058  O  OG    . SER B  2  84  ? 18.589   -28.351 48.841   1.00 91.10  ? 85   SER A OG    1 
ATOM   2059  N  N     . ILE B  2  85  ? 15.251   -25.411 48.579   1.00 89.04  ? 86   ILE A N     1 
ATOM   2060  C  CA    . ILE B  2  85  ? 14.047   -24.734 48.014   1.00 90.65  ? 86   ILE A CA    1 
ATOM   2061  C  C     . ILE B  2  85  ? 14.125   -23.238 48.310   1.00 87.62  ? 86   ILE A C     1 
ATOM   2062  O  O     . ILE B  2  85  ? 14.004   -22.445 47.371   1.00 93.52  ? 86   ILE A O     1 
ATOM   2063  C  CB    . ILE B  2  85  ? 12.742   -25.360 48.546   1.00 91.70  ? 86   ILE A CB    1 
ATOM   2064  C  CG1   . ILE B  2  85  ? 12.583   -26.813 48.096   1.00 89.84  ? 86   ILE A CG1   1 
ATOM   2065  C  CG2   . ILE B  2  85  ? 11.538   -24.519 48.160   1.00 85.75  ? 86   ILE A CG2   1 
ATOM   2066  C  CD1   . ILE B  2  85  ? 11.593   -27.603 48.923   1.00 89.60  ? 86   ILE A CD1   1 
ATOM   2067  N  N     . TYR B  2  86  ? 14.298   -22.866 49.574   1.00 81.71  ? 87   TYR A N     1 
ATOM   2068  C  CA    . TYR B  2  86  ? 14.235   -21.446 49.995   1.00 77.13  ? 87   TYR A CA    1 
ATOM   2069  C  C     . TYR B  2  86  ? 15.321   -20.630 49.282   1.00 75.85  ? 87   TYR A C     1 
ATOM   2070  O  O     . TYR B  2  86  ? 15.011   -19.533 48.781   1.00 69.45  ? 87   TYR A O     1 
ATOM   2071  C  CB    . TYR B  2  86  ? 14.402   -21.291 51.502   1.00 68.48  ? 87   TYR A CB    1 
ATOM   2072  C  CG    . TYR B  2  86  ? 14.278   -19.857 51.948   1.00 58.61  ? 87   TYR A CG    1 
ATOM   2073  C  CD1   . TYR B  2  86  ? 13.150   -19.104 51.646   1.00 53.12  ? 87   TYR A CD1   1 
ATOM   2074  C  CD2   . TYR B  2  86  ? 15.295   -19.246 52.658   1.00 59.77  ? 87   TYR A CD2   1 
ATOM   2075  C  CE1   . TYR B  2  86  ? 13.028   -17.792 52.059   1.00 53.89  ? 87   TYR A CE1   1 
ATOM   2076  C  CE2   . TYR B  2  86  ? 15.188   -17.933 53.075   1.00 59.32  ? 87   TYR A CE2   1 
ATOM   2077  C  CZ    . TYR B  2  86  ? 14.050   -17.206 52.781   1.00 57.22  ? 87   TYR A CZ    1 
ATOM   2078  O  OH    . TYR B  2  86  ? 13.943   -15.916 53.207   1.00 66.91  ? 87   TYR A OH    1 
ATOM   2079  N  N     . GLU B  2  87  ? 16.557   -21.130 49.255   1.00 70.72  ? 88   GLU A N     1 
ATOM   2080  C  CA    A GLU B  2  87  ? 17.703   -20.395 48.654   0.50 74.14  ? 88   GLU A CA    1 
ATOM   2081  C  CA    B GLU B  2  87  ? 17.700   -20.393 48.653   0.50 69.33  ? 88   GLU A CA    1 
ATOM   2082  C  C     . GLU B  2  87  ? 17.449   -20.212 47.152   1.00 71.89  ? 88   GLU A C     1 
ATOM   2083  O  O     . GLU B  2  87  ? 17.847   -19.171 46.618   1.00 74.84  ? 88   GLU A O     1 
ATOM   2084  C  CB    A GLU B  2  87  ? 19.025   -21.131 48.899   0.50 75.67  ? 88   GLU A CB    1 
ATOM   2085  C  CB    B GLU B  2  87  ? 19.022   -21.107 48.935   0.50 64.68  ? 88   GLU A CB    1 
ATOM   2086  C  CG    A GLU B  2  87  ? 19.561   -21.015 50.309   0.50 79.53  ? 88   GLU A CG    1 
ATOM   2087  C  CG    B GLU B  2  87  ? 19.490   -20.914 50.377   0.50 62.15  ? 88   GLU A CG    1 
ATOM   2088  C  CD    A GLU B  2  87  ? 20.787   -21.891 50.529   0.50 79.84  ? 88   GLU A CD    1 
ATOM   2089  C  CD    B GLU B  2  87  ? 19.339   -19.467 50.856   0.50 57.43  ? 88   GLU A CD    1 
ATOM   2090  O  OE1   A GLU B  2  87  ? 21.324   -21.905 51.653   0.50 76.01  ? 88   GLU A OE1   1 
ATOM   2091  O  OE1   B GLU B  2  87  ? 19.578   -18.524 50.049   0.50 49.09  ? 88   GLU A OE1   1 
ATOM   2092  O  OE2   A GLU B  2  87  ? 21.230   -22.535 49.559   0.50 85.03  ? 88   GLU A OE2   1 
ATOM   2093  O  OE2   B GLU B  2  87  ? 18.962   -19.272 52.033   0.50 52.52  ? 88   GLU A OE2   1 
ATOM   2094  N  N     . ALA B  2  88  ? 16.810   -21.191 46.505   1.00 71.66  ? 89   ALA A N     1 
ATOM   2095  C  CA    . ALA B  2  88  ? 16.494   -21.140 45.057   1.00 62.44  ? 89   ALA A CA    1 
ATOM   2096  C  C     . ALA B  2  88  ? 15.438   -20.064 44.809   1.00 58.20  ? 89   ALA A C     1 
ATOM   2097  O  O     . ALA B  2  88  ? 15.507   -19.405 43.762   1.00 58.82  ? 89   ALA A O     1 
ATOM   2098  C  CB    . ALA B  2  88  ? 16.021   -22.481 44.568   1.00 62.84  ? 89   ALA A CB    1 
ATOM   2099  N  N     . MET B  2  89  ? 14.495   -19.907 45.739   1.00 57.41  ? 90   MET A N     1 
ATOM   2100  C  CA    . MET B  2  89  ? 13.428   -18.880 45.661   1.00 62.05  ? 90   MET A CA    1 
ATOM   2101  C  C     . MET B  2  89  ? 14.055   -17.505 45.907   1.00 65.07  ? 90   MET A C     1 
ATOM   2102  O  O     . MET B  2  89  ? 13.742   -16.565 45.156   1.00 62.90  ? 90   MET A O     1 
ATOM   2103  C  CB    . MET B  2  89  ? 12.321   -19.141 46.682   1.00 62.67  ? 90   MET A CB    1 
ATOM   2104  C  CG    . MET B  2  89  ? 11.104   -18.252 46.466   1.00 64.85  ? 90   MET A CG    1 
ATOM   2105  S  SD    . MET B  2  89  ? 9.883    -18.399 47.773   1.00 72.36  ? 90   MET A SD    1 
ATOM   2106  C  CE    . MET B  2  89  ? 10.693   -17.426 49.045   1.00 78.51  ? 90   MET A CE    1 
ATOM   2107  N  N     . VAL B  2  90  ? 14.926   -17.405 46.910   1.00 59.83  ? 91   VAL A N     1 
ATOM   2108  C  CA    . VAL B  2  90  ? 15.628   -16.142 47.275   1.00 60.64  ? 91   VAL A CA    1 
ATOM   2109  C  C     . VAL B  2  90  ? 16.314   -15.572 46.022   1.00 56.07  ? 91   VAL A C     1 
ATOM   2110  O  O     . VAL B  2  90  ? 16.073   -14.397 45.696   1.00 53.38  ? 91   VAL A O     1 
ATOM   2111  C  CB    . VAL B  2  90  ? 16.620   -16.392 48.427   1.00 61.99  ? 91   VAL A CB    1 
ATOM   2112  C  CG1   . VAL B  2  90  ? 17.635   -15.267 48.570   1.00 61.94  ? 91   VAL A CG1   1 
ATOM   2113  C  CG2   . VAL B  2  90  ? 15.885   -16.632 49.740   1.00 65.49  ? 91   VAL A CG2   1 
ATOM   2114  N  N     . ARG B  2  91  ? 17.135   -16.384 45.347   1.00 55.14  ? 92   ARG A N     1 
ATOM   2115  C  CA    . ARG B  2  91  ? 17.945   -15.990 44.159   1.00 53.76  ? 92   ARG A CA    1 
ATOM   2116  C  C     . ARG B  2  91  ? 17.027   -15.404 43.076   1.00 52.80  ? 92   ARG A C     1 
ATOM   2117  O  O     . ARG B  2  91  ? 17.413   -14.388 42.481   1.00 50.78  ? 92   ARG A O     1 
ATOM   2118  C  CB    . ARG B  2  91  ? 18.714   -17.198 43.620   1.00 56.46  ? 92   ARG A CB    1 
ATOM   2119  C  CG    . ARG B  2  91  ? 20.197   -16.970 43.359   1.00 60.56  ? 92   ARG A CG    1 
ATOM   2120  C  CD    . ARG B  2  91  ? 20.837   -18.206 42.704   1.00 66.85  ? 92   ARG A CD    1 
ATOM   2121  N  NE    . ARG B  2  91  ? 20.164   -18.714 41.500   1.00 63.54  ? 92   ARG A NE    1 
ATOM   2122  C  CZ    . ARG B  2  91  ? 20.375   -18.304 40.266   1.00 60.45  ? 92   ARG A CZ    1 
ATOM   2123  N  NH1   . ARG B  2  91  ? 19.676   -18.847 39.285   1.00 56.85  ? 92   ARG A NH1   1 
ATOM   2124  N  NH2   . ARG B  2  91  ? 21.319   -17.421 39.978   1.00 62.95  ? 92   ARG A NH2   1 
ATOM   2125  N  N     . MET B  2  92  ? 15.871   -16.025 42.832   1.00 48.41  ? 93   MET A N     1 
ATOM   2126  C  CA    . MET B  2  92  ? 14.883   -15.591 41.806   1.00 45.22  ? 93   MET A CA    1 
ATOM   2127  C  C     . MET B  2  92  ? 14.323   -14.211 42.168   1.00 40.51  ? 93   MET A C     1 
ATOM   2128  O  O     . MET B  2  92  ? 13.675   -13.587 41.300   1.00 43.07  ? 93   MET A O     1 
ATOM   2129  C  CB    . MET B  2  92  ? 13.710   -16.579 41.715   1.00 45.93  ? 93   MET A CB    1 
ATOM   2130  C  CG    . MET B  2  92  ? 14.069   -17.905 41.071   1.00 46.66  ? 93   MET A CG    1 
ATOM   2131  S  SD    . MET B  2  92  ? 12.610   -18.891 40.641   1.00 43.14  ? 93   MET A SD    1 
ATOM   2132  C  CE    . MET B  2  92  ? 12.154   -19.566 42.231   1.00 42.57  ? 93   MET A CE    1 
ATOM   2133  N  N     . ALA B  2  93  ? 14.515   -13.768 43.413   1.00 36.57  ? 94   ALA A N     1 
ATOM   2134  C  CA    . ALA B  2  93  ? 13.949   -12.513 43.949   1.00 37.93  ? 94   ALA A CA    1 
ATOM   2135  C  C     . ALA B  2  93  ? 15.020   -11.420 44.018   1.00 39.10  ? 94   ALA A C     1 
ATOM   2136  O  O     . ALA B  2  93  ? 14.654   -10.267 44.298   1.00 37.76  ? 94   ALA A O     1 
ATOM   2137  C  CB    . ALA B  2  93  ? 13.348   -12.776 45.303   1.00 38.05  ? 94   ALA A CB    1 
ATOM   2138  N  N     . GLN B  2  94  ? 16.286   -11.761 43.770   1.00 41.58  ? 95   GLN A N     1 
ATOM   2139  C  CA    . GLN B  2  94  ? 17.423   -10.809 43.867   1.00 45.61  ? 95   GLN A CA    1 
ATOM   2140  C  C     . GLN B  2  94  ? 17.617   -10.114 42.517   1.00 51.21  ? 95   GLN A C     1 
ATOM   2141  O  O     . GLN B  2  94  ? 17.912   -10.806 41.520   1.00 49.13  ? 95   GLN A O     1 
ATOM   2142  C  CB    . GLN B  2  94  ? 18.694   -11.539 44.295   1.00 41.31  ? 95   GLN A CB    1 
ATOM   2143  C  CG    . GLN B  2  94  ? 18.626   -12.047 45.721   1.00 39.43  ? 95   GLN A CG    1 
ATOM   2144  C  CD    . GLN B  2  94  ? 19.770   -12.961 46.058   1.00 40.91  ? 95   GLN A CD    1 
ATOM   2145  O  OE1   . GLN B  2  94  ? 20.508   -13.415 45.184   1.00 44.04  ? 95   GLN A OE1   1 
ATOM   2146  N  NE2   . GLN B  2  94  ? 19.922   -13.236 47.343   1.00 41.67  ? 95   GLN A NE2   1 
ATOM   2147  N  N     . ASP B  2  95  ? 17.498   -8.789  42.502   1.00 51.45  ? 96   ASP A N     1 
ATOM   2148  C  CA    . ASP B  2  95  ? 17.587   -7.979  41.264   1.00 53.50  ? 96   ASP A CA    1 
ATOM   2149  C  C     . ASP B  2  95  ? 19.039   -7.933  40.780   1.00 52.55  ? 96   ASP A C     1 
ATOM   2150  O  O     . ASP B  2  95  ? 19.230   -7.495  39.636   1.00 59.67  ? 96   ASP A O     1 
ATOM   2151  C  CB    . ASP B  2  95  ? 16.991   -6.586  41.454   1.00 53.26  ? 96   ASP A CB    1 
ATOM   2152  C  CG    . ASP B  2  95  ? 17.758   -5.731  42.437   1.00 54.35  ? 96   ASP A CG    1 
ATOM   2153  O  OD1   . ASP B  2  95  ? 18.826   -6.192  42.912   1.00 61.77  ? 96   ASP A OD1   1 
ATOM   2154  O  OD2   . ASP B  2  95  ? 17.222   -4.645  42.804   1.00 46.43  ? 96   ASP A OD2   1 
ATOM   2155  N  N     . PHE B  2  96  ? 20.004   -8.371  41.594   1.00 52.77  ? 97   PHE A N     1 
ATOM   2156  C  CA    . PHE B  2  96  ? 21.454   -8.452  41.252   1.00 64.00  ? 97   PHE A CA    1 
ATOM   2157  C  C     . PHE B  2  96  ? 21.835   -9.876  40.796   1.00 79.63  ? 97   PHE A C     1 
ATOM   2158  O  O     . PHE B  2  96  ? 22.998   -10.080 40.357   1.00 88.77  ? 97   PHE A O     1 
ATOM   2159  C  CB    . PHE B  2  96  ? 22.350   -8.017  42.417   1.00 61.98  ? 97   PHE A CB    1 
ATOM   2160  C  CG    . PHE B  2  96  ? 22.070   -8.691  43.738   1.00 63.62  ? 97   PHE A CG    1 
ATOM   2161  C  CD1   . PHE B  2  96  ? 22.624   -9.923  44.048   1.00 63.10  ? 97   PHE A CD1   1 
ATOM   2162  C  CD2   . PHE B  2  96  ? 21.252   -8.084  44.684   1.00 65.58  ? 97   PHE A CD2   1 
ATOM   2163  C  CE1   . PHE B  2  96  ? 22.340   -10.539 45.256   1.00 64.02  ? 97   PHE A CE1   1 
ATOM   2164  C  CE2   . PHE B  2  96  ? 20.964   -8.702  45.889   1.00 63.99  ? 97   PHE A CE2   1 
ATOM   2165  C  CZ    . PHE B  2  96  ? 21.512   -9.927  46.175   1.00 64.52  ? 97   PHE A CZ    1 
ATOM   2166  N  N     . SER B  2  97  ? 20.918   -10.843 40.906   1.00 74.58  ? 98   SER A N     1 
ATOM   2167  C  CA    . SER B  2  97  ? 21.145   -12.249 40.478   1.00 62.49  ? 98   SER A CA    1 
ATOM   2168  C  C     . SER B  2  97  ? 20.371   -12.513 39.189   1.00 57.34  ? 98   SER A C     1 
ATOM   2169  O  O     . SER B  2  97  ? 20.985   -12.986 38.224   1.00 61.15  ? 98   SER A O     1 
ATOM   2170  C  CB    . SER B  2  97  ? 20.757   -13.231 41.557   1.00 61.35  ? 98   SER A CB    1 
ATOM   2171  O  OG    . SER B  2  97  ? 21.603   -13.087 42.686   1.00 58.95  ? 98   SER A OG    1 
ATOM   2172  N  N     . TYR B  2  98  ? 19.082   -12.175 39.189   1.00 54.64  ? 99   TYR A N     1 
ATOM   2173  C  CA    . TYR B  2  98  ? 18.129   -12.363 38.064   1.00 53.26  ? 99   TYR A CA    1 
ATOM   2174  C  C     . TYR B  2  98  ? 17.944   -11.031 37.322   1.00 49.50  ? 99   TYR A C     1 
ATOM   2175  O  O     . TYR B  2  98  ? 17.557   -10.001 37.927   1.00 48.44  ? 99   TYR A O     1 
ATOM   2176  C  CB    . TYR B  2  98  ? 16.811   -12.939 38.598   1.00 58.08  ? 99   TYR A CB    1 
ATOM   2177  C  CG    . TYR B  2  98  ? 16.751   -14.445 38.606   1.00 60.15  ? 99   TYR A CG    1 
ATOM   2178  C  CD1   . TYR B  2  98  ? 17.521   -15.207 39.473   1.00 60.53  ? 99   TYR A CD1   1 
ATOM   2179  C  CD2   . TYR B  2  98  ? 15.916   -15.115 37.735   1.00 65.07  ? 99   TYR A CD2   1 
ATOM   2180  C  CE1   . TYR B  2  98  ? 17.466   -16.596 39.465   1.00 62.38  ? 99   TYR A CE1   1 
ATOM   2181  C  CE2   . TYR B  2  98  ? 15.854   -16.500 37.705   1.00 63.73  ? 99   TYR A CE2   1 
ATOM   2182  C  CZ    . TYR B  2  98  ? 16.634   -17.243 38.566   1.00 63.23  ? 99   TYR A CZ    1 
ATOM   2183  O  OH    . TYR B  2  98  ? 16.544   -18.602 38.507   1.00 64.17  ? 99   TYR A OH    1 
ATOM   2184  N  N     . ARG B  2  99  ? 18.243   -11.047 36.022   1.00 47.14  ? 100  ARG A N     1 
ATOM   2185  C  CA    . ARG B  2  99  ? 18.088   -9.892  35.100   1.00 45.92  ? 100  ARG A CA    1 
ATOM   2186  C  C     . ARG B  2  99  ? 16.611   -9.484  35.035   1.00 41.56  ? 100  ARG A C     1 
ATOM   2187  O  O     . ARG B  2  99  ? 16.321   -8.276  34.986   1.00 45.32  ? 100  ARG A O     1 
ATOM   2188  C  CB    . ARG B  2  99  ? 18.600   -10.303 33.717   1.00 51.00  ? 100  ARG A CB    1 
ATOM   2189  C  CG    . ARG B  2  99  ? 18.633   -9.166  32.714   1.00 52.60  ? 100  ARG A CG    1 
ATOM   2190  C  CD    . ARG B  2  99  ? 19.597   -8.084  33.173   1.00 52.48  ? 100  ARG A CD    1 
ATOM   2191  N  NE    . ARG B  2  99  ? 19.575   -6.960  32.247   1.00 52.69  ? 100  ARG A NE    1 
ATOM   2192  C  CZ    . ARG B  2  99  ? 18.532   -6.144  32.085   1.00 51.07  ? 100  ARG A CZ    1 
ATOM   2193  N  NH1   . ARG B  2  99  ? 17.424   -6.319  32.789   1.00 51.87  ? 100  ARG A NH1   1 
ATOM   2194  N  NH2   . ARG B  2  99  ? 18.604   -5.156  31.219   1.00 55.27  ? 100  ARG A NH2   1 
ATOM   2195  N  N     . TYR B  2  100 ? 15.717   -10.472 35.009   1.00 39.27  ? 101  TYR A N     1 
ATOM   2196  C  CA    . TYR B  2  100 ? 14.246   -10.303 35.135   1.00 41.46  ? 101  TYR A CA    1 
ATOM   2197  C  C     . TYR B  2  100 ? 13.781   -11.168 36.304   1.00 44.06  ? 101  TYR A C     1 
ATOM   2198  O  O     . TYR B  2  100 ? 13.473   -12.342 36.135   1.00 40.20  ? 101  TYR A O     1 
ATOM   2199  C  CB    . TYR B  2  100 ? 13.570   -10.587 33.792   1.00 42.20  ? 101  TYR A CB    1 
ATOM   2200  C  CG    . TYR B  2  100 ? 14.155   -9.747  32.689   1.00 45.00  ? 101  TYR A CG    1 
ATOM   2201  C  CD1   . TYR B  2  100 ? 13.723   -8.446  32.500   1.00 42.80  ? 101  TYR A CD1   1 
ATOM   2202  C  CD2   . TYR B  2  100 ? 15.209   -10.212 31.901   1.00 47.71  ? 101  TYR A CD2   1 
ATOM   2203  C  CE1   . TYR B  2  100 ? 14.279   -7.643  31.518   1.00 45.35  ? 101  TYR A CE1   1 
ATOM   2204  C  CE2   . TYR B  2  100 ? 15.785   -9.410  30.932   1.00 50.07  ? 101  TYR A CE2   1 
ATOM   2205  C  CZ    . TYR B  2  100 ? 15.315   -8.121  30.734   1.00 48.71  ? 101  TYR A CZ    1 
ATOM   2206  O  OH    . TYR B  2  100 ? 15.855   -7.320  29.772   1.00 46.10  ? 101  TYR A OH    1 
ATOM   2207  N  N     . PRO B  2  101 ? 13.779   -10.618 37.537   1.00 51.82  ? 102  PRO A N     1 
ATOM   2208  C  CA    . PRO B  2  101 ? 13.319   -11.345 38.717   1.00 55.27  ? 102  PRO A CA    1 
ATOM   2209  C  C     . PRO B  2  101 ? 11.955   -12.015 38.506   1.00 55.44  ? 102  PRO A C     1 
ATOM   2210  O  O     . PRO B  2  101 ? 11.082   -11.401 37.947   1.00 49.52  ? 102  PRO A O     1 
ATOM   2211  C  CB    . PRO B  2  101 ? 13.217   -10.242 39.783   1.00 61.32  ? 102  PRO A CB    1 
ATOM   2212  C  CG    . PRO B  2  101 ? 14.285   -9.255  39.377   1.00 63.14  ? 102  PRO A CG    1 
ATOM   2213  C  CD    . PRO B  2  101 ? 14.234   -9.256  37.866   1.00 60.20  ? 102  PRO A CD    1 
ATOM   2214  N  N     . LEU B  2  102 ? 11.836   -13.262 38.960   1.00 63.06  ? 103  LEU A N     1 
ATOM   2215  C  CA    . LEU B  2  102 ? 10.625   -14.111 38.829   1.00 64.69  ? 103  LEU A CA    1 
ATOM   2216  C  C     . LEU B  2  102 ? 9.865    -14.149 40.160   1.00 66.40  ? 103  LEU A C     1 
ATOM   2217  O  O     . LEU B  2  102 ? 8.720    -14.644 40.172   1.00 70.37  ? 103  LEU A O     1 
ATOM   2218  C  CB    . LEU B  2  102 ? 11.071   -15.511 38.397   1.00 69.99  ? 103  LEU A CB    1 
ATOM   2219  C  CG    . LEU B  2  102 ? 11.908   -15.548 37.118   1.00 73.36  ? 103  LEU A CG    1 
ATOM   2220  C  CD1   . LEU B  2  102 ? 12.229   -16.978 36.699   1.00 70.10  ? 103  LEU A CD1   1 
ATOM   2221  C  CD2   . LEU B  2  102 ? 11.192   -14.808 36.002   1.00 79.70  ? 103  LEU A CD2   1 
ATOM   2222  N  N     . VAL B  2  103 ? 10.468   -13.650 41.244   1.00 62.70  ? 104  VAL A N     1 
ATOM   2223  C  CA    . VAL B  2  103 ? 9.834    -13.652 42.593   1.00 64.43  ? 104  VAL A CA    1 
ATOM   2224  C  C     . VAL B  2  103 ? 9.935    -12.254 43.196   1.00 71.92  ? 104  VAL A C     1 
ATOM   2225  O  O     . VAL B  2  103 ? 11.015   -11.642 43.110   1.00 71.52  ? 104  VAL A O     1 
ATOM   2226  C  CB    . VAL B  2  103 ? 10.462   -14.701 43.526   1.00 64.31  ? 104  VAL A CB    1 
ATOM   2227  C  CG1   . VAL B  2  103 ? 9.852    -14.632 44.925   1.00 58.72  ? 104  VAL A CG1   1 
ATOM   2228  C  CG2   . VAL B  2  103 ? 10.361   -16.107 42.949   1.00 68.63  ? 104  VAL A CG2   1 
ATOM   2229  N  N     . ASP B  2  104 ? 8.833    -11.788 43.777   1.00 84.62  ? 105  ASP A N     1 
ATOM   2230  C  CA    . ASP B  2  104 ? 8.724    -10.456 44.418   1.00 84.27  ? 105  ASP A CA    1 
ATOM   2231  C  C     . ASP B  2  104 ? 8.803    -10.704 45.930   1.00 82.66  ? 105  ASP A C     1 
ATOM   2232  O  O     . ASP B  2  104 ? 7.846    -11.281 46.492   1.00 75.77  ? 105  ASP A O     1 
ATOM   2233  C  CB    . ASP B  2  104 ? 7.458    -9.755  43.932   1.00 86.35  ? 105  ASP A CB    1 
ATOM   2234  C  CG    . ASP B  2  104 ? 7.107    -8.472  44.674   1.00 93.67  ? 105  ASP A CG    1 
ATOM   2235  O  OD1   . ASP B  2  104 ? 7.939    -8.006  45.474   1.00 96.55  ? 105  ASP A OD1   1 
ATOM   2236  O  OD2   . ASP B  2  104 ? 5.990    -7.958  44.453   1.00 107.42 ? 105  ASP A OD2   1 
ATOM   2237  N  N     . GLY B  2  105 ? 9.929    -10.319 46.539   1.00 85.07  ? 106  GLY A N     1 
ATOM   2238  C  CA    . GLY B  2  105 ? 10.246   -10.562 47.959   1.00 85.73  ? 106  GLY A CA    1 
ATOM   2239  C  C     . GLY B  2  105 ? 9.908    -9.375  48.839   1.00 91.14  ? 106  GLY A C     1 
ATOM   2240  O  O     . GLY B  2  105 ? 9.987    -8.241  48.353   1.00 94.30  ? 106  GLY A O     1 
ATOM   2241  N  N     . GLN B  2  106 ? 9.505    -9.648  50.079   1.00 93.86  ? 107  GLN A N     1 
ATOM   2242  C  CA    . GLN B  2  106 ? 9.298    -8.636  51.143   1.00 91.39  ? 107  GLN A CA    1 
ATOM   2243  C  C     . GLN B  2  106 ? 10.207   -9.015  52.312   1.00 92.70  ? 107  GLN A C     1 
ATOM   2244  O  O     . GLN B  2  106 ? 9.959    -10.057 52.924   1.00 89.50  ? 107  GLN A O     1 
ATOM   2245  C  CB    . GLN B  2  106 ? 7.828    -8.597  51.565   1.00 94.36  ? 107  GLN A CB    1 
ATOM   2246  C  CG    . GLN B  2  106 ? 7.549    -7.675  52.737   1.00 98.21  ? 107  GLN A CG    1 
ATOM   2247  C  CD    . GLN B  2  106 ? 7.731    -6.196  52.461   1.00 95.60  ? 107  GLN A CD    1 
ATOM   2248  O  OE1   . GLN B  2  106 ? 7.190    -5.596  51.531   1.00 95.71  ? 107  GLN A OE1   1 
ATOM   2249  N  NE2   . GLN B  2  106 ? 8.558    -5.603  53.287   1.00 93.68  ? 107  GLN A NE2   1 
ATOM   2250  N  N     . GLY B  2  107 ? 11.242   -8.215  52.578   1.00 89.78  ? 108  GLY A N     1 
ATOM   2251  C  CA    . GLY B  2  107 ? 12.186   -8.420  53.695   1.00 78.50  ? 108  GLY A CA    1 
ATOM   2252  C  C     . GLY B  2  107 ? 13.618   -8.569  53.216   1.00 68.17  ? 108  GLY A C     1 
ATOM   2253  O  O     . GLY B  2  107 ? 13.924   -8.176  52.081   1.00 63.05  ? 108  GLY A O     1 
ATOM   2254  N  N     . ASN B  2  108 ? 14.482   -9.107  54.074   1.00 67.08  ? 109  ASN A N     1 
ATOM   2255  C  CA    . ASN B  2  108 ? 15.935   -9.269  53.803   1.00 74.02  ? 109  ASN A CA    1 
ATOM   2256  C  C     . ASN B  2  108 ? 16.140   -10.494 52.906   1.00 72.15  ? 109  ASN A C     1 
ATOM   2257  O  O     . ASN B  2  108 ? 16.240   -11.607 53.460   1.00 62.57  ? 109  ASN A O     1 
ATOM   2258  C  CB    . ASN B  2  108 ? 16.731   -9.389  55.108   1.00 84.30  ? 109  ASN A CB    1 
ATOM   2259  C  CG    . ASN B  2  108 ? 18.226   -9.535  54.916   1.00 92.42  ? 109  ASN A CG    1 
ATOM   2260  O  OD1   . ASN B  2  108 ? 18.732   -9.414  53.798   1.00 111.15 ? 109  ASN A OD1   1 
ATOM   2261  N  ND2   . ASN B  2  108 ? 18.933   -9.763  56.015   1.00 94.59  ? 109  ASN A ND2   1 
ATOM   2262  N  N     . PHE B  2  109 ? 16.207   -10.306 51.583   1.00 69.48  ? 110  PHE A N     1 
ATOM   2263  C  CA    . PHE B  2  109 ? 16.573   -11.319 50.555   1.00 63.39  ? 110  PHE A CA    1 
ATOM   2264  C  C     . PHE B  2  109 ? 18.044   -11.190 50.138   1.00 66.97  ? 110  PHE A C     1 
ATOM   2265  O  O     . PHE B  2  109 ? 18.398   -11.596 49.007   1.00 63.57  ? 110  PHE A O     1 
ATOM   2266  C  CB    . PHE B  2  109 ? 15.651   -11.238 49.344   1.00 56.56  ? 110  PHE A CB    1 
ATOM   2267  C  CG    . PHE B  2  109 ? 14.344   -11.953 49.526   1.00 56.42  ? 110  PHE A CG    1 
ATOM   2268  C  CD1   . PHE B  2  109 ? 14.183   -12.929 50.489   1.00 60.98  ? 110  PHE A CD1   1 
ATOM   2269  C  CD2   . PHE B  2  109 ? 13.276   -11.640 48.720   1.00 57.39  ? 110  PHE A CD2   1 
ATOM   2270  C  CE1   . PHE B  2  109 ? 12.967   -13.583 50.638   1.00 64.60  ? 110  PHE A CE1   1 
ATOM   2271  C  CE2   . PHE B  2  109 ? 12.061   -12.293 48.874   1.00 60.66  ? 110  PHE A CE2   1 
ATOM   2272  C  CZ    . PHE B  2  109 ? 11.892   -13.232 49.851   1.00 63.25  ? 110  PHE A CZ    1 
ATOM   2273  N  N     . GLY B  2  110 ? 18.880   -10.687 51.042   1.00 79.94  ? 111  GLY A N     1 
ATOM   2274  C  CA    . GLY B  2  110 ? 20.339   -10.579 50.858   1.00 84.60  ? 111  GLY A CA    1 
ATOM   2275  C  C     . GLY B  2  110 ? 20.735   -9.296  50.144   1.00 96.98  ? 111  GLY A C     1 
ATOM   2276  O  O     . GLY B  2  110 ? 19.844   -8.507  49.782   1.00 102.47 ? 111  GLY A O     1 
ATOM   2277  N  N     . SER B  2  111 ? 22.043   -9.123  49.952   1.00 95.83  ? 112  SER A N     1 
ATOM   2278  C  CA    . SER B  2  111 ? 22.696   -7.971  49.287   1.00 88.95  ? 112  SER A CA    1 
ATOM   2279  C  C     . SER B  2  111 ? 23.805   -8.485  48.371   1.00 88.86  ? 112  SER A C     1 
ATOM   2280  O  O     . SER B  2  111 ? 24.065   -9.714  48.374   1.00 83.45  ? 112  SER A O     1 
ATOM   2281  C  CB    . SER B  2  111 ? 23.279   -7.047  50.304   1.00 86.64  ? 112  SER A CB    1 
ATOM   2282  O  OG    . SER B  2  111 ? 24.451   -7.630  50.868   1.00 86.12  ? 112  SER A OG    1 
ATOM   2283  N  N     . MET B  2  112 ? 24.474   -7.573  47.665   1.00 88.11  ? 113  MET A N     1 
ATOM   2284  C  CA    . MET B  2  112 ? 25.615   -7.892  46.769   1.00 92.42  ? 113  MET A CA    1 
ATOM   2285  C  C     . MET B  2  112 ? 26.854   -8.266  47.596   1.00 94.15  ? 113  MET A C     1 
ATOM   2286  O  O     . MET B  2  112 ? 27.799   -8.851  47.002   1.00 114.65 ? 113  MET A O     1 
ATOM   2287  C  CB    . MET B  2  112 ? 25.945   -6.704  45.866   1.00 91.06  ? 113  MET A CB    1 
ATOM   2288  C  CG    . MET B  2  112 ? 24.752   -6.179  45.117   1.00 87.37  ? 113  MET A CG    1 
ATOM   2289  S  SD    . MET B  2  112 ? 25.229   -5.255  43.655   1.00 92.42  ? 113  MET A SD    1 
ATOM   2290  C  CE    . MET B  2  112 ? 23.723   -4.324  43.369   1.00 89.82  ? 113  MET A CE    1 
ATOM   2291  N  N     . ASP B  2  113 ? 26.848   -7.988  48.907   1.00 86.04  ? 114  ASP A N     1 
ATOM   2292  C  CA    . ASP B  2  113 ? 27.987   -8.305  49.814   1.00 89.94  ? 114  ASP A CA    1 
ATOM   2293  C  C     . ASP B  2  113 ? 27.953   -9.783  50.231   1.00 85.37  ? 114  ASP A C     1 
ATOM   2294  O  O     . ASP B  2  113 ? 28.850   -10.204 50.985   1.00 83.54  ? 114  ASP A O     1 
ATOM   2295  C  CB    . ASP B  2  113 ? 27.992   -7.383  51.040   1.00 91.31  ? 114  ASP A CB    1 
ATOM   2296  C  CG    . ASP B  2  113 ? 28.422   -5.955  50.741   1.00 82.71  ? 114  ASP A CG    1 
ATOM   2297  O  OD1   . ASP B  2  113 ? 29.525   -5.770  50.157   1.00 77.34  ? 114  ASP A OD1   1 
ATOM   2298  O  OD2   . ASP B  2  113 ? 27.628   -5.036  51.086   1.00 64.56  ? 114  ASP A OD2   1 
ATOM   2299  N  N     . GLY B  2  114 ? 26.954   -10.546 49.787   1.00 80.13  ? 115  GLY A N     1 
ATOM   2300  C  CA    . GLY B  2  114 ? 26.886   -11.995 50.038   1.00 88.56  ? 115  GLY A CA    1 
ATOM   2301  C  C     . GLY B  2  114 ? 26.377   -12.311 51.436   1.00 98.46  ? 115  GLY A C     1 
ATOM   2302  O  O     . GLY B  2  114 ? 26.481   -13.483 51.847   1.00 109.38 ? 115  GLY A O     1 
ATOM   2303  N  N     . ASP B  2  115 ? 25.834   -11.319 52.152   1.00 99.81  ? 116  ASP A N     1 
ATOM   2304  C  CA    . ASP B  2  115 ? 24.983   -11.560 53.346   1.00 94.63  ? 116  ASP A CA    1 
ATOM   2305  C  C     . ASP B  2  115 ? 23.791   -12.368 52.830   1.00 99.62  ? 116  ASP A C     1 
ATOM   2306  O  O     . ASP B  2  115 ? 23.203   -11.945 51.800   1.00 104.72 ? 116  ASP A O     1 
ATOM   2307  C  CB    . ASP B  2  115 ? 24.410   -10.300 54.008   1.00 93.44  ? 116  ASP A CB    1 
ATOM   2308  C  CG    . ASP B  2  115 ? 25.362   -9.165  54.294   1.00 99.43  ? 116  ASP A CG    1 
ATOM   2309  O  OD1   . ASP B  2  115 ? 25.785   -9.042  55.464   1.00 112.07 ? 116  ASP A OD1   1 
ATOM   2310  O  OD2   . ASP B  2  115 ? 25.613   -8.392  53.362   1.00 100.24 ? 116  ASP A OD2   1 
ATOM   2311  N  N     . GLY B  2  116 ? 23.456   -13.492 53.469   1.00 100.39 ? 117  GLY A N     1 
ATOM   2312  C  CA    . GLY B  2  116 ? 22.327   -14.327 53.016   1.00 96.33  ? 117  GLY A CA    1 
ATOM   2313  C  C     . GLY B  2  116 ? 21.000   -13.602 53.192   1.00 86.48  ? 117  GLY A C     1 
ATOM   2314  O  O     . GLY B  2  116 ? 20.976   -12.552 53.866   1.00 87.87  ? 117  GLY A O     1 
ATOM   2315  N  N     . ALA B  2  117 ? 19.924   -14.146 52.625   1.00 77.54  ? 118  ALA A N     1 
ATOM   2316  C  CA    . ALA B  2  117 ? 18.538   -13.794 52.987   1.00 75.14  ? 118  ALA A CA    1 
ATOM   2317  C  C     . ALA B  2  117 ? 18.316   -14.136 54.466   1.00 73.64  ? 118  ALA A C     1 
ATOM   2318  O  O     . ALA B  2  117 ? 18.929   -15.096 54.955   1.00 67.61  ? 118  ALA A O     1 
ATOM   2319  C  CB    . ALA B  2  117 ? 17.568   -14.537 52.109   1.00 78.85  ? 118  ALA A CB    1 
ATOM   2320  N  N     . ALA B  2  118 ? 17.467   -13.385 55.166   1.00 75.24  ? 119  ALA A N     1 
ATOM   2321  C  CA    . ALA B  2  118 ? 16.935   -13.800 56.478   1.00 84.03  ? 119  ALA A CA    1 
ATOM   2322  C  C     . ALA B  2  118 ? 16.297   -15.191 56.322   1.00 86.28  ? 119  ALA A C     1 
ATOM   2323  O  O     . ALA B  2  118 ? 15.916   -15.552 55.184   1.00 91.35  ? 119  ALA A O     1 
ATOM   2324  C  CB    . ALA B  2  118 ? 15.949   -12.770 56.976   1.00 94.76  ? 119  ALA A CB    1 
ATOM   2325  N  N     . ALA B  2  119 ? 16.188   -15.949 57.416   1.00 90.87  ? 120  ALA A N     1 
ATOM   2326  C  CA    . ALA B  2  119 ? 15.513   -17.269 57.462   1.00 86.45  ? 120  ALA A CA    1 
ATOM   2327  C  C     . ALA B  2  119 ? 14.066   -17.125 56.962   1.00 87.68  ? 120  ALA A C     1 
ATOM   2328  O  O     . ALA B  2  119 ? 13.510   -16.001 57.025   1.00 90.04  ? 120  ALA A O     1 
ATOM   2329  C  CB    . ALA B  2  119 ? 15.569   -17.828 58.861   1.00 85.76  ? 120  ALA A CB    1 
ATOM   2330  N  N     . MET B  2  120 ? 13.470   -18.221 56.484   1.00 83.37  ? 121  MET A N     1 
ATOM   2331  C  CA    . MET B  2  120 ? 12.157   -18.204 55.778   1.00 87.46  ? 121  MET A CA    1 
ATOM   2332  C  C     . MET B  2  120 ? 11.027   -17.775 56.724   1.00 94.62  ? 121  MET A C     1 
ATOM   2333  O  O     . MET B  2  120 ? 9.974    -17.354 56.210   1.00 87.52  ? 121  MET A O     1 
ATOM   2334  C  CB    . MET B  2  120 ? 11.829   -19.565 55.146   1.00 84.42  ? 121  MET A CB    1 
ATOM   2335  C  CG    . MET B  2  120 ? 11.680   -20.732 56.118   1.00 83.30  ? 121  MET A CG    1 
ATOM   2336  S  SD    . MET B  2  120 ? 12.134   -22.330 55.307   1.00 78.34  ? 121  MET A SD    1 
ATOM   2337  C  CE    . MET B  2  120 ? 12.612   -23.365 56.686   1.00 74.07  ? 121  MET A CE    1 
ATOM   2338  N  N     . ARG B  2  121 ? 11.220   -17.864 58.042   1.00 92.78  ? 122  ARG A N     1 
ATOM   2339  C  CA    . ARG B  2  121 ? 10.211   -17.378 59.028   1.00 78.66  ? 122  ARG A CA    1 
ATOM   2340  C  C     . ARG B  2  121 ? 10.036   -15.861 58.868   1.00 77.17  ? 122  ARG A C     1 
ATOM   2341  O  O     . ARG B  2  121 ? 8.898    -15.376 59.058   1.00 73.87  ? 122  ARG A O     1 
ATOM   2342  C  CB    . ARG B  2  121 ? 10.588   -17.721 60.470   1.00 70.85  ? 122  ARG A CB    1 
ATOM   2343  C  CG    . ARG B  2  121 ? 11.179   -19.111 60.674   1.00 70.83  ? 122  ARG A CG    1 
ATOM   2344  C  CD    . ARG B  2  121 ? 12.621   -19.301 60.187   1.00 68.19  ? 122  ARG A CD    1 
ATOM   2345  N  NE    . ARG B  2  121 ? 13.740   -19.199 61.127   1.00 73.97  ? 122  ARG A NE    1 
ATOM   2346  C  CZ    . ARG B  2  121 ? 14.055   -18.125 61.858   1.00 73.23  ? 122  ARG A CZ    1 
ATOM   2347  N  NH1   . ARG B  2  121 ? 13.292   -17.051 61.825   1.00 75.15  ? 122  ARG A NH1   1 
ATOM   2348  N  NH2   . ARG B  2  121 ? 15.121   -18.121 62.633   1.00 69.16  ? 122  ARG A NH2   1 
ATOM   2349  N  N     . TYR B  2  122 ? 11.093   -15.161 58.453   1.00 76.06  ? 123  TYR A N     1 
ATOM   2350  C  CA    . TYR B  2  122 ? 11.182   -13.682 58.463   1.00 72.64  ? 123  TYR A CA    1 
ATOM   2351  C  C     . TYR B  2  122 ? 10.665   -13.070 57.156   1.00 76.22  ? 123  TYR A C     1 
ATOM   2352  O  O     . TYR B  2  122 ? 10.204   -11.907 57.211   1.00 77.38  ? 123  TYR A O     1 
ATOM   2353  C  CB    . TYR B  2  122 ? 12.623   -13.235 58.699   1.00 69.06  ? 123  TYR A CB    1 
ATOM   2354  C  CG    . TYR B  2  122 ? 13.192   -13.586 60.042   1.00 70.24  ? 123  TYR A CG    1 
ATOM   2355  C  CD1   . TYR B  2  122 ? 12.622   -13.141 61.227   1.00 69.69  ? 123  TYR A CD1   1 
ATOM   2356  C  CD2   . TYR B  2  122 ? 14.359   -14.324 60.119   1.00 69.69  ? 123  TYR A CD2   1 
ATOM   2357  C  CE1   . TYR B  2  122 ? 13.164   -13.474 62.453   1.00 67.57  ? 123  TYR A CE1   1 
ATOM   2358  C  CE2   . TYR B  2  122 ? 14.946   -14.627 61.341   1.00 77.23  ? 123  TYR A CE2   1 
ATOM   2359  C  CZ    . TYR B  2  122 ? 14.339   -14.204 62.516   1.00 77.14  ? 123  TYR A CZ    1 
ATOM   2360  O  OH    . TYR B  2  122 ? 14.892   -14.541 63.720   1.00 73.97  ? 123  TYR A OH    1 
ATOM   2361  N  N     . THR B  2  123 ? 10.729   -13.786 56.025   1.00 72.80  ? 124  THR A N     1 
ATOM   2362  C  CA    . THR B  2  123 ? 10.482   -13.190 54.687   1.00 69.10  ? 124  THR A CA    1 
ATOM   2363  C  C     . THR B  2  123 ? 9.101    -13.596 54.174   1.00 67.67  ? 124  THR A C     1 
ATOM   2364  O  O     . THR B  2  123 ? 8.560    -14.594 54.653   1.00 73.25  ? 124  THR A O     1 
ATOM   2365  C  CB    . THR B  2  123 ? 11.598   -13.530 53.694   1.00 61.54  ? 124  THR A CB    1 
ATOM   2366  O  OG1   . THR B  2  123 ? 11.491   -14.893 53.283   1.00 60.28  ? 124  THR A OG1   1 
ATOM   2367  C  CG2   . THR B  2  123 ? 12.973   -13.284 54.284   1.00 57.17  ? 124  THR A CG2   1 
ATOM   2368  N  N     . GLU B  2  124 ? 8.562    -12.805 53.250   1.00 71.13  ? 125  GLU A N     1 
ATOM   2369  C  CA    . GLU B  2  124 ? 7.298    -13.077 52.523   1.00 78.71  ? 125  GLU A CA    1 
ATOM   2370  C  C     . GLU B  2  124 ? 7.594    -12.912 51.028   1.00 76.87  ? 125  GLU A C     1 
ATOM   2371  O  O     . GLU B  2  124 ? 8.618    -12.275 50.702   1.00 79.41  ? 125  GLU A O     1 
ATOM   2372  C  CB    . GLU B  2  124 ? 6.207    -12.127 53.011   1.00 85.94  ? 125  GLU A CB    1 
ATOM   2373  C  CG    . GLU B  2  124 ? 5.809    -12.344 54.461   1.00 90.10  ? 125  GLU A CG    1 
ATOM   2374  C  CD    . GLU B  2  124 ? 4.505    -11.665 54.848   1.00 92.65  ? 125  GLU A CD    1 
ATOM   2375  O  OE1   . GLU B  2  124 ? 4.257    -10.546 54.341   1.00 105.19 ? 125  GLU A OE1   1 
ATOM   2376  O  OE2   . GLU B  2  124 ? 3.726    -12.255 55.640   1.00 83.01  ? 125  GLU A OE2   1 
ATOM   2377  N  N     . ALA B  2  125 ? 6.768    -13.476 50.147   1.00 69.13  ? 126  ALA A N     1 
ATOM   2378  C  CA    . ALA B  2  125 ? 7.066    -13.545 48.701   1.00 63.27  ? 126  ALA A CA    1 
ATOM   2379  C  C     . ALA B  2  125 ? 5.779    -13.688 47.887   1.00 62.52  ? 126  ALA A C     1 
ATOM   2380  O  O     . ALA B  2  125 ? 4.768    -14.183 48.450   1.00 51.63  ? 126  ALA A O     1 
ATOM   2381  C  CB    . ALA B  2  125 ? 7.984    -14.712 48.444   1.00 58.24  ? 126  ALA A CB    1 
ATOM   2382  N  N     . ARG B  2  126 ? 5.855    -13.321 46.598   1.00 60.77  ? 127  ARG A N     1 
ATOM   2383  C  CA    . ARG B  2  126 ? 4.805    -13.568 45.581   1.00 60.87  ? 127  ARG A CA    1 
ATOM   2384  C  C     . ARG B  2  126 ? 5.420    -13.592 44.179   1.00 60.54  ? 127  ARG A C     1 
ATOM   2385  O  O     . ARG B  2  126 ? 6.643    -13.429 44.068   1.00 61.31  ? 127  ARG A O     1 
ATOM   2386  C  CB    . ARG B  2  126 ? 3.729    -12.489 45.680   1.00 62.67  ? 127  ARG A CB    1 
ATOM   2387  C  CG    . ARG B  2  126 ? 4.242    -11.081 45.476   1.00 64.53  ? 127  ARG A CG    1 
ATOM   2388  C  CD    . ARG B  2  126 ? 3.134    -10.099 45.812   1.00 75.30  ? 127  ARG A CD    1 
ATOM   2389  N  NE    . ARG B  2  126 ? 3.576    -8.720  45.743   1.00 82.36  ? 127  ARG A NE    1 
ATOM   2390  C  CZ    . ARG B  2  126 ? 2.865    -7.686  46.171   1.00 78.49  ? 127  ARG A CZ    1 
ATOM   2391  N  NH1   . ARG B  2  126 ? 1.659    -7.874  46.695   1.00 74.29  ? 127  ARG A NH1   1 
ATOM   2392  N  NH2   . ARG B  2  126 ? 3.365    -6.465  46.078   1.00 75.31  ? 127  ARG A NH2   1 
ATOM   2393  N  N     . MET B  2  127 ? 4.590    -13.773 43.145   1.00 63.58  ? 128  MET A N     1 
ATOM   2394  C  CA    . MET B  2  127 ? 5.008    -13.663 41.722   1.00 62.68  ? 128  MET A CA    1 
ATOM   2395  C  C     . MET B  2  127 ? 5.366    -12.208 41.401   1.00 63.10  ? 128  MET A C     1 
ATOM   2396  O  O     . MET B  2  127 ? 4.758    -11.280 42.012   1.00 64.29  ? 128  MET A O     1 
ATOM   2397  C  CB    . MET B  2  127 ? 3.888    -14.076 40.769   1.00 66.92  ? 128  MET A CB    1 
ATOM   2398  C  CG    . MET B  2  127 ? 3.618    -15.556 40.729   1.00 70.30  ? 128  MET A CG    1 
ATOM   2399  S  SD    . MET B  2  127 ? 2.264    -15.887 39.554   1.00 77.50  ? 128  MET A SD    1 
ATOM   2400  C  CE    . MET B  2  127 ? 1.349    -17.088 40.526   1.00 76.56  ? 128  MET A CE    1 
ATOM   2401  N  N     . THR B  2  128 ? 6.289    -12.027 40.461   1.00 67.54  ? 129  THR A N     1 
ATOM   2402  C  CA    . THR B  2  128 ? 6.521    -10.758 39.728   1.00 75.38  ? 129  THR A CA    1 
ATOM   2403  C  C     . THR B  2  128 ? 5.521    -10.722 38.567   1.00 70.65  ? 129  THR A C     1 
ATOM   2404  O  O     . THR B  2  128 ? 5.049    -11.815 38.182   1.00 71.92  ? 129  THR A O     1 
ATOM   2405  C  CB    . THR B  2  128 ? 7.987    -10.667 39.274   1.00 88.98  ? 129  THR A CB    1 
ATOM   2406  O  OG1   . THR B  2  128 ? 8.270    -11.768 38.413   1.00 101.75 ? 129  THR A OG1   1 
ATOM   2407  C  CG2   . THR B  2  128 ? 8.953    -10.705 40.432   1.00 91.42  ? 129  THR A CG2   1 
ATOM   2408  N  N     . LYS B  2  129 ? 5.207    -9.537  38.033   1.00 64.32  ? 130  LYS A N     1 
ATOM   2409  C  CA    . LYS B  2  129 ? 4.279    -9.381  36.883   1.00 66.54  ? 130  LYS A CA    1 
ATOM   2410  C  C     . LYS B  2  129 ? 4.785    -10.234 35.702   1.00 69.07  ? 130  LYS A C     1 
ATOM   2411  O  O     . LYS B  2  129 ? 3.936    -10.827 35.002   1.00 75.06  ? 130  LYS A O     1 
ATOM   2412  C  CB    . LYS B  2  129 ? 4.113    -7.904  36.519   1.00 58.58  ? 130  LYS A CB    1 
ATOM   2413  N  N     . ILE B  2  130 ? 6.101    -10.339 35.503   1.00 65.10  ? 131  ILE A N     1 
ATOM   2414  C  CA    . ILE B  2  130 ? 6.670    -11.084 34.340   1.00 66.18  ? 131  ILE A CA    1 
ATOM   2415  C  C     . ILE B  2  130 ? 6.502    -12.598 34.557   1.00 76.32  ? 131  ILE A C     1 
ATOM   2416  O  O     . ILE B  2  130 ? 6.473    -13.333 33.555   1.00 101.22 ? 131  ILE A O     1 
ATOM   2417  C  CB    . ILE B  2  130 ? 8.135    -10.696 34.046   1.00 61.84  ? 131  ILE A CB    1 
ATOM   2418  C  CG1   . ILE B  2  130 ? 8.469    -10.911 32.565   1.00 64.02  ? 131  ILE A CG1   1 
ATOM   2419  C  CG2   . ILE B  2  130 ? 9.104    -11.422 34.962   1.00 57.54  ? 131  ILE A CG2   1 
ATOM   2420  C  CD1   . ILE B  2  130 ? 9.843    -10.402 32.172   1.00 70.00  ? 131  ILE A CD1   1 
ATOM   2421  N  N     . THR B  2  131 ? 6.388    -13.074 35.800   1.00 71.47  ? 132  THR A N     1 
ATOM   2422  C  CA    . THR B  2  131 ? 6.233    -14.530 36.085   1.00 74.94  ? 132  THR A CA    1 
ATOM   2423  C  C     . THR B  2  131 ? 4.845    -14.979 35.616   1.00 81.19  ? 132  THR A C     1 
ATOM   2424  O  O     . THR B  2  131 ? 4.699    -16.181 35.300   1.00 89.69  ? 132  THR A O     1 
ATOM   2425  C  CB    . THR B  2  131 ? 6.547    -14.865 37.549   1.00 74.53  ? 132  THR A CB    1 
ATOM   2426  O  OG1   . THR B  2  131 ? 7.960    -14.717 37.691   1.00 68.73  ? 132  THR A OG1   1 
ATOM   2427  C  CG2   . THR B  2  131 ? 6.147    -16.265 37.975   1.00 74.22  ? 132  THR A CG2   1 
ATOM   2428  N  N     . LEU B  2  132 ? 3.878    -14.062 35.531   1.00 85.75  ? 133  LEU A N     1 
ATOM   2429  C  CA    . LEU B  2  132 ? 2.556    -14.346 34.906   1.00 94.59  ? 133  LEU A CA    1 
ATOM   2430  C  C     . LEU B  2  132 ? 2.762    -14.808 33.459   1.00 103.80 ? 133  LEU A C     1 
ATOM   2431  O  O     . LEU B  2  132 ? 2.015    -15.720 33.030   1.00 121.40 ? 133  LEU A O     1 
ATOM   2432  C  CB    . LEU B  2  132 ? 1.649    -13.113 34.965   1.00 90.05  ? 133  LEU A CB    1 
ATOM   2433  C  CG    . LEU B  2  132 ? 1.284    -12.641 36.374   1.00 90.99  ? 133  LEU A CG    1 
ATOM   2434  C  CD1   . LEU B  2  132 ? 0.425    -11.388 36.318   1.00 87.16  ? 133  LEU A CD1   1 
ATOM   2435  C  CD2   . LEU B  2  132 ? 0.577    -13.743 37.156   1.00 91.96  ? 133  LEU A CD2   1 
ATOM   2436  N  N     . GLU B  2  133 ? 3.737    -14.222 32.745   1.00 100.93 ? 134  GLU A N     1 
ATOM   2437  C  CA    . GLU B  2  133 ? 4.012    -14.575 31.329   1.00 89.58  ? 134  GLU A CA    1 
ATOM   2438  C  C     . GLU B  2  133 ? 4.635    -15.988 31.282   1.00 79.13  ? 134  GLU A C     1 
ATOM   2439  O  O     . GLU B  2  133 ? 4.375    -16.703 30.304   1.00 79.17  ? 134  GLU A O     1 
ATOM   2440  C  CB    . GLU B  2  133 ? 4.922    -13.543 30.668   1.00 94.17  ? 134  GLU A CB    1 
ATOM   2441  C  CG    . GLU B  2  133 ? 4.314    -12.140 30.569   1.00 96.09  ? 134  GLU A CG    1 
ATOM   2442  C  CD    . GLU B  2  133 ? 2.848    -12.089 30.184   1.00 98.08  ? 134  GLU A CD    1 
ATOM   2443  O  OE1   . GLU B  2  133 ? 2.089    -11.395 30.915   1.00 95.88  ? 134  GLU A OE1   1 
ATOM   2444  O  OE2   . GLU B  2  133 ? 2.475    -12.709 29.141   1.00 108.96 ? 134  GLU A OE2   1 
ATOM   2445  N  N     . LEU B  2  134 ? 5.423    -16.395 32.286   1.00 68.73  ? 135  LEU A N     1 
ATOM   2446  C  CA    . LEU B  2  134 ? 5.956    -17.778 32.363   1.00 70.19  ? 135  LEU A CA    1 
ATOM   2447  C  C     . LEU B  2  134 ? 4.803    -18.777 32.499   1.00 72.59  ? 135  LEU A C     1 
ATOM   2448  O  O     . LEU B  2  134 ? 4.915    -19.890 31.929   1.00 83.97  ? 135  LEU A O     1 
ATOM   2449  C  CB    . LEU B  2  134 ? 6.910    -17.913 33.553   1.00 72.76  ? 135  LEU A CB    1 
ATOM   2450  C  CG    . LEU B  2  134 ? 8.349    -17.497 33.293   1.00 75.37  ? 135  LEU A CG    1 
ATOM   2451  C  CD1   . LEU B  2  134 ? 9.225    -17.865 34.476   1.00 74.43  ? 135  LEU A CD1   1 
ATOM   2452  C  CD2   . LEU B  2  134 ? 8.889    -18.140 32.024   1.00 73.79  ? 135  LEU A CD2   1 
ATOM   2453  N  N     . LEU B  2  135 ? 3.750    -18.409 33.235   1.00 72.66  ? 136  LEU A N     1 
ATOM   2454  C  CA    . LEU B  2  135 ? 2.667    -19.347 33.623   1.00 79.44  ? 136  LEU A CA    1 
ATOM   2455  C  C     . LEU B  2  135 ? 1.439    -19.180 32.735   1.00 78.71  ? 136  LEU A C     1 
ATOM   2456  O  O     . LEU B  2  135 ? 0.543    -20.042 32.859   1.00 83.47  ? 136  LEU A O     1 
ATOM   2457  C  CB    . LEU B  2  135 ? 2.311    -19.107 35.094   1.00 78.53  ? 136  LEU A CB    1 
ATOM   2458  C  CG    . LEU B  2  135 ? 3.401    -19.506 36.082   1.00 79.62  ? 136  LEU A CG    1 
ATOM   2459  C  CD1   . LEU B  2  135 ? 3.201    -18.753 37.380   1.00 81.55  ? 136  LEU A CD1   1 
ATOM   2460  C  CD2   . LEU B  2  135 ? 3.397    -21.021 36.306   1.00 76.42  ? 136  LEU A CD2   1 
ATOM   2461  N  N     . ARG B  2  136 ? 1.389    -18.144 31.882   1.00 72.05  ? 137  ARG A N     1 
ATOM   2462  C  CA    . ARG B  2  136 ? 0.169    -17.811 31.089   1.00 69.60  ? 137  ARG A CA    1 
ATOM   2463  C  C     . ARG B  2  136 ? -0.272   -19.045 30.296   1.00 65.49  ? 137  ARG A C     1 
ATOM   2464  O  O     . ARG B  2  136 ? 0.565    -19.597 29.543   1.00 64.43  ? 137  ARG A O     1 
ATOM   2465  C  CB    . ARG B  2  136 ? 0.419    -16.638 30.140   1.00 73.08  ? 137  ARG A CB    1 
ATOM   2466  C  CG    . ARG B  2  136 ? -0.849   -15.844 29.860   1.00 73.60  ? 137  ARG A CG    1 
ATOM   2467  C  CD    . ARG B  2  136 ? -0.493   -14.536 29.164   1.00 83.73  ? 137  ARG A CD    1 
ATOM   2468  N  NE    . ARG B  2  136 ? -0.680   -14.691 27.718   1.00 101.00 ? 137  ARG A NE    1 
ATOM   2469  C  CZ    . ARG B  2  136 ? -0.097   -13.944 26.791   1.00 112.00 ? 137  ARG A CZ    1 
ATOM   2470  N  NH1   . ARG B  2  136 ? 0.684    -12.937 27.154   1.00 114.92 ? 137  ARG A NH1   1 
ATOM   2471  N  NH2   . ARG B  2  136 ? -0.343   -14.158 25.513   1.00 116.76 ? 137  ARG A NH2   1 
ATOM   2472  N  N     . ASP B  2  137 ? -1.528   -19.458 30.474   1.00 62.61  ? 138  ASP A N     1 
ATOM   2473  C  CA    . ASP B  2  137 ? -2.184   -20.536 29.684   1.00 61.32  ? 138  ASP A CA    1 
ATOM   2474  C  C     . ASP B  2  137 ? -1.712   -21.917 30.152   1.00 58.54  ? 138  ASP A C     1 
ATOM   2475  O  O     . ASP B  2  137 ? -1.861   -22.871 29.368   1.00 53.63  ? 138  ASP A O     1 
ATOM   2476  C  CB    . ASP B  2  137 ? -1.909   -20.405 28.181   1.00 64.24  ? 138  ASP A CB    1 
ATOM   2477  C  CG    . ASP B  2  137 ? -2.137   -19.024 27.567   1.00 71.24  ? 138  ASP A CG    1 
ATOM   2478  O  OD1   . ASP B  2  137 ? -3.255   -18.441 27.802   1.00 66.76  ? 138  ASP A OD1   1 
ATOM   2479  O  OD2   . ASP B  2  137 ? -1.207   -18.546 26.844   1.00 72.29  ? 138  ASP A OD2   1 
ATOM   2480  N  N     . ILE B  2  138 ? -1.171   -22.035 31.369   1.00 63.01  ? 139  ILE A N     1 
ATOM   2481  C  CA    . ILE B  2  138 ? -0.712   -23.345 31.923   1.00 70.38  ? 139  ILE A CA    1 
ATOM   2482  C  C     . ILE B  2  138 ? -1.935   -24.251 32.104   1.00 85.71  ? 139  ILE A C     1 
ATOM   2483  O  O     . ILE B  2  138 ? -1.762   -25.501 32.030   1.00 106.79 ? 139  ILE A O     1 
ATOM   2484  C  CB    . ILE B  2  138 ? 0.098    -23.210 33.229   1.00 63.79  ? 139  ILE A CB    1 
ATOM   2485  C  CG1   . ILE B  2  138 ? 0.779    -24.540 33.597   1.00 58.54  ? 139  ILE A CG1   1 
ATOM   2486  C  CG2   . ILE B  2  138 ? -0.771   -22.697 34.348   1.00 64.77  ? 139  ILE A CG2   1 
ATOM   2487  C  CD1   . ILE B  2  138 ? 1.699    -24.483 34.762   1.00 55.41  ? 139  ILE A CD1   1 
ATOM   2488  N  N     . ASN B  2  139 ? -3.116   -23.644 32.296   1.00 89.11  ? 140  ASN A N     1 
ATOM   2489  C  CA    . ASN B  2  139 ? -4.375   -24.378 32.593   1.00 91.30  ? 140  ASN A CA    1 
ATOM   2490  C  C     . ASN B  2  139 ? -5.200   -24.622 31.320   1.00 85.95  ? 140  ASN A C     1 
ATOM   2491  O  O     . ASN B  2  139 ? -6.307   -25.132 31.454   1.00 75.56  ? 140  ASN A O     1 
ATOM   2492  C  CB    . ASN B  2  139 ? -5.184   -23.654 33.671   1.00 88.53  ? 140  ASN A CB    1 
ATOM   2493  C  CG    . ASN B  2  139 ? -4.658   -23.957 35.055   1.00 81.19  ? 140  ASN A CG    1 
ATOM   2494  O  OD1   . ASN B  2  139 ? -4.122   -25.039 35.294   1.00 68.08  ? 140  ASN A OD1   1 
ATOM   2495  N  ND2   . ASN B  2  139 ? -4.806   -23.006 35.961   1.00 83.14  ? 140  ASN A ND2   1 
ATOM   2496  N  N     . LYS B  2  140 ? -4.639   -24.350 30.136   1.00 83.26  ? 141  LYS A N     1 
ATOM   2497  C  CA    . LYS B  2  140 ? -5.310   -24.546 28.836   1.00 81.71  ? 141  LYS A CA    1 
ATOM   2498  C  C     . LYS B  2  140 ? -4.620   -25.666 28.040   1.00 78.03  ? 141  LYS A C     1 
ATOM   2499  O  O     . LYS B  2  140 ? -4.574   -25.570 26.807   1.00 61.77  ? 141  LYS A O     1 
ATOM   2500  C  CB    . LYS B  2  140 ? -5.343   -23.205 28.104   1.00 79.57  ? 141  LYS A CB    1 
ATOM   2501  C  CG    . LYS B  2  140 ? -6.278   -22.180 28.731   1.00 76.07  ? 141  LYS A CG    1 
ATOM   2502  C  CD    . LYS B  2  140 ? -5.943   -20.737 28.415   1.00 80.32  ? 141  LYS A CD    1 
ATOM   2503  C  CE    . LYS B  2  140 ? -6.945   -19.855 29.129   1.00 80.68  ? 141  LYS A CE    1 
ATOM   2504  N  NZ    . LYS B  2  140 ? -6.754   -18.419 28.854   1.00 81.65  ? 141  LYS A NZ    1 
ATOM   2505  N  N     . ASP B  2  141 ? -4.164   -26.721 28.720   1.00 75.65  ? 142  ASP A N     1 
ATOM   2506  C  CA    . ASP B  2  141 ? -3.572   -27.934 28.091   1.00 77.83  ? 142  ASP A CA    1 
ATOM   2507  C  C     . ASP B  2  141 ? -2.521   -27.533 27.043   1.00 77.69  ? 142  ASP A C     1 
ATOM   2508  O  O     . ASP B  2  141 ? -2.557   -28.053 25.908   1.00 81.41  ? 142  ASP A O     1 
ATOM   2509  C  CB    . ASP B  2  141 ? -4.641   -28.818 27.451   1.00 74.55  ? 142  ASP A CB    1 
ATOM   2510  C  CG    . ASP B  2  141 ? -4.098   -30.158 27.001   1.00 73.88  ? 142  ASP A CG    1 
ATOM   2511  O  OD1   . ASP B  2  141 ? -3.189   -30.671 27.679   1.00 87.33  ? 142  ASP A OD1   1 
ATOM   2512  O  OD2   . ASP B  2  141 ? -4.553   -30.673 25.956   1.00 66.56  ? 142  ASP A OD2   1 
ATOM   2513  N  N     . THR B  2  142 ? -1.605   -26.648 27.440   1.00 74.96  ? 143  THR A N     1 
ATOM   2514  C  CA    . THR B  2  142 ? -0.503   -26.109 26.605   1.00 79.33  ? 143  THR A CA    1 
ATOM   2515  C  C     . THR B  2  142 ? 0.776    -26.908 26.840   1.00 78.86  ? 143  THR A C     1 
ATOM   2516  O  O     . THR B  2  142 ? 1.630    -26.946 25.958   1.00 79.28  ? 143  THR A O     1 
ATOM   2517  C  CB    . THR B  2  142 ? -0.276   -24.624 26.891   1.00 84.10  ? 143  THR A CB    1 
ATOM   2518  O  OG1   . THR B  2  142 ? -0.114   -24.480 28.296   1.00 93.89  ? 143  THR A OG1   1 
ATOM   2519  C  CG2   . THR B  2  142 ? -1.419   -23.756 26.414   1.00 86.92  ? 143  THR A CG2   1 
ATOM   2520  N  N     . ILE B  2  143 ? 0.905    -27.503 28.022   1.00 80.29  ? 144  ILE A N     1 
ATOM   2521  C  CA    . ILE B  2  143 ? 2.095    -28.282 28.480   1.00 79.71  ? 144  ILE A CA    1 
ATOM   2522  C  C     . ILE B  2  143 ? 1.584    -29.561 29.150   1.00 77.23  ? 144  ILE A C     1 
ATOM   2523  O  O     . ILE B  2  143 ? 0.437    -29.529 29.694   1.00 81.70  ? 144  ILE A O     1 
ATOM   2524  C  CB    . ILE B  2  143 ? 2.944    -27.419 29.427   1.00 81.07  ? 144  ILE A CB    1 
ATOM   2525  C  CG1   . ILE B  2  143 ? 2.204    -27.001 30.702   1.00 79.77  ? 144  ILE A CG1   1 
ATOM   2526  C  CG2   . ILE B  2  143 ? 3.511    -26.207 28.688   1.00 83.80  ? 144  ILE A CG2   1 
ATOM   2527  C  CD1   . ILE B  2  143 ? 2.270    -28.017 31.814   1.00 82.65  ? 144  ILE A CD1   1 
ATOM   2528  N  N     . ASP B  2  144 ? 2.376    -30.633 29.117   1.00 69.52  ? 145  ASP A N     1 
ATOM   2529  C  CA    . ASP B  2  144 ? 1.989    -31.942 29.711   1.00 73.72  ? 145  ASP A CA    1 
ATOM   2530  C  C     . ASP B  2  144 ? 2.217    -31.900 31.218   1.00 74.33  ? 145  ASP A C     1 
ATOM   2531  O  O     . ASP B  2  144 ? 3.318    -31.510 31.612   1.00 77.29  ? 145  ASP A O     1 
ATOM   2532  C  CB    . ASP B  2  144 ? 2.772    -33.104 29.088   1.00 75.27  ? 145  ASP A CB    1 
ATOM   2533  C  CG    . ASP B  2  144 ? 2.622    -33.206 27.590   1.00 76.49  ? 145  ASP A CG    1 
ATOM   2534  O  OD1   . ASP B  2  144 ? 1.700    -32.555 27.071   1.00 80.93  ? 145  ASP A OD1   1 
ATOM   2535  O  OD2   . ASP B  2  144 ? 3.428    -33.929 26.962   1.00 86.22  ? 145  ASP A OD2   1 
ATOM   2536  N  N     . PHE B  2  145 ? 1.216    -32.310 32.003   1.00 74.30  ? 146  PHE A N     1 
ATOM   2537  C  CA    . PHE B  2  145 ? 1.378    -32.589 33.453   1.00 74.94  ? 146  PHE A CA    1 
ATOM   2538  C  C     . PHE B  2  145 ? 1.871    -34.022 33.639   1.00 67.62  ? 146  PHE A C     1 
ATOM   2539  O  O     . PHE B  2  145 ? 1.729    -34.846 32.724   1.00 74.64  ? 146  PHE A O     1 
ATOM   2540  C  CB    . PHE B  2  145 ? 0.092    -32.311 34.229   1.00 79.66  ? 146  PHE A CB    1 
ATOM   2541  C  CG    . PHE B  2  145 ? -0.229   -30.842 34.335   1.00 88.63  ? 146  PHE A CG    1 
ATOM   2542  C  CD1   . PHE B  2  145 ? -0.867   -30.177 33.296   1.00 89.22  ? 146  PHE A CD1   1 
ATOM   2543  C  CD2   . PHE B  2  145 ? 0.152    -30.109 35.448   1.00 80.59  ? 146  PHE A CD2   1 
ATOM   2544  C  CE1   . PHE B  2  145 ? -1.161   -28.826 33.396   1.00 76.01  ? 146  PHE A CE1   1 
ATOM   2545  C  CE2   . PHE B  2  145 ? -0.138   -28.761 35.531   1.00 81.86  ? 146  PHE A CE2   1 
ATOM   2546  C  CZ    . PHE B  2  145 ? -0.799   -28.117 34.518   1.00 77.91  ? 146  PHE A CZ    1 
ATOM   2547  N  N     . ILE B  2  146 ? 2.496    -34.273 34.788   1.00 67.24  ? 147  ILE A N     1 
ATOM   2548  C  CA    . ILE B  2  146 ? 3.020    -35.606 35.208   1.00 66.40  ? 147  ILE A CA    1 
ATOM   2549  C  C     . ILE B  2  146 ? 2.716    -35.770 36.695   1.00 63.86  ? 147  ILE A C     1 
ATOM   2550  O  O     . ILE B  2  146 ? 2.457    -34.746 37.376   1.00 55.20  ? 147  ILE A O     1 
ATOM   2551  C  CB    . ILE B  2  146 ? 4.524    -35.751 34.897   1.00 65.63  ? 147  ILE A CB    1 
ATOM   2552  C  CG1   . ILE B  2  146 ? 5.378    -34.762 35.694   1.00 63.30  ? 147  ILE A CG1   1 
ATOM   2553  C  CG2   . ILE B  2  146 ? 4.781    -35.635 33.402   1.00 62.95  ? 147  ILE A CG2   1 
ATOM   2554  C  CD1   . ILE B  2  146 ? 6.846    -35.099 35.751   1.00 60.62  ? 147  ILE A CD1   1 
ATOM   2555  N  N     . ASP B  2  147 ? 2.744    -37.010 37.167   1.00 73.92  ? 148  ASP A N     1 
ATOM   2556  C  CA    . ASP B  2  147 ? 2.546    -37.345 38.601   1.00 82.10  ? 148  ASP A CA    1 
ATOM   2557  C  C     . ASP B  2  147 ? 3.737    -36.782 39.375   1.00 86.23  ? 148  ASP A C     1 
ATOM   2558  O  O     . ASP B  2  147 ? 4.877    -36.821 38.843   1.00 82.33  ? 148  ASP A O     1 
ATOM   2559  C  CB    . ASP B  2  147 ? 2.428    -38.858 38.831   1.00 75.85  ? 148  ASP A CB    1 
ATOM   2560  C  CG    . ASP B  2  147 ? 1.160    -39.492 38.275   1.00 69.05  ? 148  ASP A CG    1 
ATOM   2561  O  OD1   . ASP B  2  147 ? 0.237    -38.703 37.872   1.00 59.20  ? 148  ASP A OD1   1 
ATOM   2562  O  OD2   . ASP B  2  147 ? 1.155    -40.720 38.097   1.00 60.54  ? 148  ASP A OD2   1 
ATOM   2563  N  N     . ASN B  2  148 ? 3.491    -36.252 40.576   1.00 84.18  ? 149  ASN A N     1 
ATOM   2564  C  CA    . ASN B  2  148 ? 4.566    -35.842 41.512   1.00 84.37  ? 149  ASN A CA    1 
ATOM   2565  C  C     . ASN B  2  148 ? 5.236    -37.113 42.054   1.00 84.90  ? 149  ASN A C     1 
ATOM   2566  O  O     . ASN B  2  148 ? 4.818    -38.231 41.677   1.00 79.85  ? 149  ASN A O     1 
ATOM   2567  C  CB    . ASN B  2  148 ? 4.021    -35.008 42.664   1.00 86.71  ? 149  ASN A CB    1 
ATOM   2568  C  CG    . ASN B  2  148 ? 3.172    -35.847 43.587   1.00 88.63  ? 149  ASN A CG    1 
ATOM   2569  O  OD1   . ASN B  2  148 ? 2.524    -36.784 43.123   1.00 93.39  ? 149  ASN A OD1   1 
ATOM   2570  N  ND2   . ASN B  2  148 ? 3.187    -35.537 44.873   1.00 81.71  ? 149  ASN A ND2   1 
ATOM   2571  N  N     . TYR B  2  149 ? 6.215    -36.936 42.938   1.00 80.61  ? 150  TYR A N     1 
ATOM   2572  C  CA    . TYR B  2  149 ? 7.102    -38.004 43.470   1.00 75.09  ? 150  TYR A CA    1 
ATOM   2573  C  C     . TYR B  2  149 ? 6.315    -39.114 44.175   1.00 63.80  ? 150  TYR A C     1 
ATOM   2574  O  O     . TYR B  2  149 ? 6.789    -40.251 44.118   1.00 53.85  ? 150  TYR A O     1 
ATOM   2575  C  CB    . TYR B  2  149 ? 8.134    -37.416 44.431   1.00 87.48  ? 150  TYR A CB    1 
ATOM   2576  C  CG    . TYR B  2  149 ? 7.574    -36.835 45.707   1.00 92.49  ? 150  TYR A CG    1 
ATOM   2577  C  CD1   . TYR B  2  149 ? 6.999    -35.572 45.731   1.00 87.17  ? 150  TYR A CD1   1 
ATOM   2578  C  CD2   . TYR B  2  149 ? 7.661    -37.534 46.900   1.00 93.10  ? 150  TYR A CD2   1 
ATOM   2579  C  CE1   . TYR B  2  149 ? 6.515    -35.026 46.907   1.00 86.47  ? 150  TYR A CE1   1 
ATOM   2580  C  CE2   . TYR B  2  149 ? 7.180    -37.003 48.085   1.00 92.13  ? 150  TYR A CE2   1 
ATOM   2581  C  CZ    . TYR B  2  149 ? 6.607    -35.745 48.090   1.00 90.70  ? 150  TYR A CZ    1 
ATOM   2582  O  OH    . TYR B  2  149 ? 6.131    -35.242 49.270   1.00 75.31  ? 150  TYR A OH    1 
ATOM   2583  N  N     . ASP B  2  150 ? 5.200    -38.809 44.844   1.00 64.27  ? 151  ASP A N     1 
ATOM   2584  C  CA    . ASP B  2  150 ? 4.438    -39.821 45.629   1.00 69.70  ? 151  ASP A CA    1 
ATOM   2585  C  C     . ASP B  2  150 ? 3.133    -40.190 44.907   1.00 75.47  ? 151  ASP A C     1 
ATOM   2586  O  O     . ASP B  2  150 ? 2.407    -41.050 45.438   1.00 76.17  ? 151  ASP A O     1 
ATOM   2587  C  CB    . ASP B  2  150 ? 4.180    -39.349 47.066   1.00 68.21  ? 151  ASP A CB    1 
ATOM   2588  C  CG    . ASP B  2  150 ? 3.265    -38.142 47.182   1.00 70.34  ? 151  ASP A CG    1 
ATOM   2589  O  OD1   . ASP B  2  150 ? 2.454    -37.923 46.263   1.00 71.40  ? 151  ASP A OD1   1 
ATOM   2590  O  OD2   . ASP B  2  150 ? 3.373    -37.430 48.188   1.00 74.57  ? 151  ASP A OD2   1 
ATOM   2591  N  N     . GLY B  2  151 ? 2.827    -39.565 43.766   1.00 79.38  ? 152  GLY A N     1 
ATOM   2592  C  CA    . GLY B  2  151 ? 1.627    -39.876 42.963   1.00 74.54  ? 152  GLY A CA    1 
ATOM   2593  C  C     . GLY B  2  151 ? 0.336    -39.309 43.545   1.00 71.25  ? 152  GLY A C     1 
ATOM   2594  O  O     . GLY B  2  151 ? -0.730   -39.653 43.011   1.00 69.75  ? 152  GLY A O     1 
ATOM   2595  N  N     . ASN B  2  152 ? 0.405    -38.447 44.565   1.00 72.66  ? 153  ASN A N     1 
ATOM   2596  C  CA    . ASN B  2  152 ? -0.776   -37.775 45.178   1.00 83.46  ? 153  ASN A CA    1 
ATOM   2597  C  C     . ASN B  2  152 ? -1.085   -36.436 44.486   1.00 94.30  ? 153  ASN A C     1 
ATOM   2598  O  O     . ASN B  2  152 ? -2.092   -35.823 44.885   1.00 98.44  ? 153  ASN A O     1 
ATOM   2599  C  CB    . ASN B  2  152 ? -0.590   -37.543 46.680   1.00 81.21  ? 153  ASN A CB    1 
ATOM   2600  C  CG    . ASN B  2  152 ? -0.513   -38.840 47.462   1.00 80.57  ? 153  ASN A CG    1 
ATOM   2601  O  OD1   . ASN B  2  152 ? -1.106   -39.843 47.080   1.00 94.67  ? 153  ASN A OD1   1 
ATOM   2602  N  ND2   . ASN B  2  152 ? 0.217    -38.844 48.562   1.00 71.02  ? 153  ASN A ND2   1 
ATOM   2603  N  N     . GLU B  2  153 ? -0.257   -35.974 43.536   1.00 102.73 ? 154  GLU A N     1 
ATOM   2604  C  CA    . GLU B  2  153 ? -0.382   -34.612 42.932   1.00 99.97  ? 154  GLU A CA    1 
ATOM   2605  C  C     . GLU B  2  153 ? 0.063    -34.616 41.463   1.00 90.65  ? 154  GLU A C     1 
ATOM   2606  O  O     . GLU B  2  153 ? 0.829    -35.524 41.067   1.00 74.42  ? 154  GLU A O     1 
ATOM   2607  C  CB    . GLU B  2  153 ? 0.458    -33.573 43.692   1.00 105.23 ? 154  GLU A CB    1 
ATOM   2608  C  CG    . GLU B  2  153 ? 0.118    -33.420 45.172   1.00 103.85 ? 154  GLU A CG    1 
ATOM   2609  C  CD    . GLU B  2  153 ? -1.170   -32.664 45.488   1.00 106.55 ? 154  GLU A CD    1 
ATOM   2610  O  OE1   . GLU B  2  153 ? -1.852   -32.214 44.538   1.00 109.61 ? 154  GLU A OE1   1 
ATOM   2611  O  OE2   . GLU B  2  153 ? -1.498   -32.532 46.687   1.00 100.41 ? 154  GLU A OE2   1 
ATOM   2612  N  N     . ARG B  2  154 ? -0.414   -33.637 40.691   1.00 85.03  ? 155  ARG A N     1 
ATOM   2613  C  CA    . ARG B  2  154 ? 0.027    -33.380 39.299   1.00 80.81  ? 155  ARG A CA    1 
ATOM   2614  C  C     . ARG B  2  154 ? 0.904    -32.128 39.290   1.00 77.91  ? 155  ARG A C     1 
ATOM   2615  O  O     . ARG B  2  154 ? 0.517    -31.116 39.931   1.00 82.29  ? 155  ARG A O     1 
ATOM   2616  C  CB    . ARG B  2  154 ? -1.174   -33.203 38.364   1.00 84.62  ? 155  ARG A CB    1 
ATOM   2617  C  CG    . ARG B  2  154 ? -2.136   -34.385 38.340   1.00 93.46  ? 155  ARG A CG    1 
ATOM   2618  C  CD    . ARG B  2  154 ? -1.601   -35.586 37.566   1.00 95.80  ? 155  ARG A CD    1 
ATOM   2619  N  NE    . ARG B  2  154 ? -1.711   -35.407 36.119   1.00 88.39  ? 155  ARG A NE    1 
ATOM   2620  C  CZ    . ARG B  2  154 ? -1.172   -36.205 35.214   1.00 88.33  ? 155  ARG A CZ    1 
ATOM   2621  N  NH1   . ARG B  2  154 ? -0.484   -37.271 35.570   1.00 99.11  ? 155  ARG A NH1   1 
ATOM   2622  N  NH2   . ARG B  2  154 ? -1.328   -35.937 33.931   1.00 88.37  ? 155  ARG A NH2   1 
ATOM   2623  N  N     . GLU B  2  155 ? 2.045    -32.188 38.608   1.00 79.36  ? 156  GLU A N     1 
ATOM   2624  C  CA    . GLU B  2  155 ? 2.971    -31.038 38.443   1.00 74.26  ? 156  GLU A CA    1 
ATOM   2625  C  C     . GLU B  2  155 ? 3.299    -30.891 36.962   1.00 77.40  ? 156  GLU A C     1 
ATOM   2626  O  O     . GLU B  2  155 ? 3.257    -31.869 36.214   1.00 86.88  ? 156  GLU A O     1 
ATOM   2627  C  CB    . GLU B  2  155 ? 4.232    -31.217 39.293   1.00 64.58  ? 156  GLU A CB    1 
ATOM   2628  C  CG    . GLU B  2  155 ? 5.100    -32.396 38.914   1.00 62.00  ? 156  GLU A CG    1 
ATOM   2629  C  CD    . GLU B  2  155 ? 6.411    -32.499 39.672   1.00 58.70  ? 156  GLU A CD    1 
ATOM   2630  O  OE1   . GLU B  2  155 ? 6.841    -33.640 39.956   1.00 61.18  ? 156  GLU A OE1   1 
ATOM   2631  O  OE2   . GLU B  2  155 ? 7.011    -31.443 39.955   1.00 46.44  ? 156  GLU A OE2   1 
ATOM   2632  N  N     . PRO B  2  156 ? 3.592    -29.654 36.497   1.00 72.22  ? 157  PRO A N     1 
ATOM   2633  C  CA    . PRO B  2  156 ? 3.910    -29.407 35.101   1.00 66.37  ? 157  PRO A CA    1 
ATOM   2634  C  C     . PRO B  2  156 ? 5.340    -29.843 34.759   1.00 64.82  ? 157  PRO A C     1 
ATOM   2635  O  O     . PRO B  2  156 ? 6.223    -29.457 35.471   1.00 60.24  ? 157  PRO A O     1 
ATOM   2636  C  CB    . PRO B  2  156 ? 3.776    -27.886 34.963   1.00 68.69  ? 157  PRO A CB    1 
ATOM   2637  C  CG    . PRO B  2  156 ? 4.128    -27.370 36.316   1.00 70.88  ? 157  PRO A CG    1 
ATOM   2638  C  CD    . PRO B  2  156 ? 3.636    -28.423 37.297   1.00 68.72  ? 157  PRO A CD    1 
ATOM   2639  N  N     . SER B  2  157 ? 5.499    -30.625 33.689   1.00 69.50  ? 158  SER A N     1 
ATOM   2640  C  CA    . SER B  2  157 ? 6.798    -31.053 33.099   1.00 73.83  ? 158  SER A CA    1 
ATOM   2641  C  C     . SER B  2  157 ? 7.600    -29.833 32.644   1.00 81.70  ? 158  SER A C     1 
ATOM   2642  O  O     . SER B  2  157 ? 8.841    -29.902 32.697   1.00 94.70  ? 158  SER A O     1 
ATOM   2643  C  CB    . SER B  2  157 ? 6.586    -31.990 31.944   1.00 70.93  ? 158  SER A CB    1 
ATOM   2644  O  OG    . SER B  2  157 ? 6.142    -31.267 30.800   1.00 73.27  ? 158  SER A OG    1 
ATOM   2645  N  N     . VAL B  2  158 ? 6.922    -28.775 32.184   1.00 82.09  ? 159  VAL A N     1 
ATOM   2646  C  CA    . VAL B  2  158 ? 7.562    -27.527 31.659   1.00 78.47  ? 159  VAL A CA    1 
ATOM   2647  C  C     . VAL B  2  158 ? 6.540    -26.392 31.754   1.00 71.24  ? 159  VAL A C     1 
ATOM   2648  O  O     . VAL B  2  158 ? 5.362    -26.710 31.763   1.00 64.46  ? 159  VAL A O     1 
ATOM   2649  C  CB    . VAL B  2  158 ? 8.059    -27.732 30.216   1.00 87.55  ? 159  VAL A CB    1 
ATOM   2650  C  CG1   . VAL B  2  158 ? 6.910    -27.973 29.268   1.00 89.36  ? 159  VAL A CG1   1 
ATOM   2651  C  CG2   . VAL B  2  158 ? 8.914    -26.581 29.719   1.00 90.48  ? 159  VAL A CG2   1 
ATOM   2652  N  N     . LEU B  2  159 ? 6.973    -25.135 31.845   1.00 69.02  ? 160  LEU A N     1 
ATOM   2653  C  CA    . LEU B  2  159 ? 6.035    -23.975 31.859   1.00 66.41  ? 160  LEU A CA    1 
ATOM   2654  C  C     . LEU B  2  159 ? 5.857    -23.471 30.433   1.00 63.47  ? 160  LEU A C     1 
ATOM   2655  O  O     . LEU B  2  159 ? 6.711    -23.694 29.580   1.00 69.79  ? 160  LEU A O     1 
ATOM   2656  C  CB    . LEU B  2  159 ? 6.549    -22.856 32.770   1.00 65.49  ? 160  LEU A CB    1 
ATOM   2657  C  CG    . LEU B  2  159 ? 6.786    -23.263 34.232   1.00 65.34  ? 160  LEU A CG    1 
ATOM   2658  C  CD1   . LEU B  2  159 ? 6.960    -22.033 35.103   1.00 65.86  ? 160  LEU A CD1   1 
ATOM   2659  C  CD2   . LEU B  2  159 ? 5.659    -24.136 34.796   1.00 60.95  ? 160  LEU A CD2   1 
ATOM   2660  N  N     . PRO B  2  160 ? 4.698    -22.854 30.121   1.00 61.85  ? 161  PRO A N     1 
ATOM   2661  C  CA    . PRO B  2  160 ? 4.467    -22.231 28.818   1.00 58.12  ? 161  PRO A CA    1 
ATOM   2662  C  C     . PRO B  2  160 ? 5.599    -21.288 28.386   1.00 57.01  ? 161  PRO A C     1 
ATOM   2663  O  O     . PRO B  2  160 ? 5.966    -21.300 27.239   1.00 55.71  ? 161  PRO A O     1 
ATOM   2664  C  CB    . PRO B  2  160 ? 3.167    -21.449 29.036   1.00 59.20  ? 161  PRO A CB    1 
ATOM   2665  C  CG    . PRO B  2  160 ? 2.429    -22.271 30.065   1.00 62.56  ? 161  PRO A CG    1 
ATOM   2666  C  CD    . PRO B  2  160 ? 3.511    -22.801 30.986   1.00 63.89  ? 161  PRO A CD    1 
ATOM   2667  N  N     . ALA B  2  161 ? 6.131    -20.503 29.320   1.00 61.83  ? 162  ALA A N     1 
ATOM   2668  C  CA    . ALA B  2  161 ? 7.302    -19.630 29.088   1.00 68.87  ? 162  ALA A CA    1 
ATOM   2669  C  C     . ALA B  2  161 ? 7.032    -18.708 27.892   1.00 71.16  ? 162  ALA A C     1 
ATOM   2670  O  O     . ALA B  2  161 ? 7.645    -18.924 26.826   1.00 74.90  ? 162  ALA A O     1 
ATOM   2671  C  CB    . ALA B  2  161 ? 8.535    -20.486 28.873   1.00 67.95  ? 162  ALA A CB    1 
ATOM   2672  N  N     . ARG B  2  162 ? 6.161    -17.716 28.060   1.00 67.98  ? 163  ARG A N     1 
ATOM   2673  C  CA    . ARG B  2  162 ? 5.713    -16.851 26.937   1.00 65.58  ? 163  ARG A CA    1 
ATOM   2674  C  C     . ARG B  2  162 ? 6.780    -15.789 26.634   1.00 59.90  ? 163  ARG A C     1 
ATOM   2675  O  O     . ARG B  2  162 ? 6.598    -15.071 25.627   1.00 52.35  ? 163  ARG A O     1 
ATOM   2676  C  CB    . ARG B  2  162 ? 4.326    -16.266 27.214   1.00 68.73  ? 163  ARG A CB    1 
ATOM   2677  C  CG    . ARG B  2  162 ? 3.240    -17.314 27.470   1.00 70.96  ? 163  ARG A CG    1 
ATOM   2678  C  CD    . ARG B  2  162 ? 3.187    -18.404 26.411   1.00 71.12  ? 163  ARG A CD    1 
ATOM   2679  N  NE    . ARG B  2  162 ? 3.267    -17.850 25.066   1.00 64.49  ? 163  ARG A NE    1 
ATOM   2680  C  CZ    . ARG B  2  162 ? 2.237    -17.339 24.401   1.00 62.02  ? 163  ARG A CZ    1 
ATOM   2681  N  NH1   . ARG B  2  162 ? 1.020    -17.285 24.952   1.00 63.88  ? 163  ARG A NH1   1 
ATOM   2682  N  NH2   . ARG B  2  162 ? 2.442    -16.853 23.190   1.00 58.95  ? 163  ARG A NH2   1 
ATOM   2683  N  N     . PHE B  2  163 ? 7.865    -15.724 27.418   1.00 56.87  ? 164  PHE A N     1 
ATOM   2684  C  CA    . PHE B  2  163 ? 9.126    -15.011 27.059   1.00 56.82  ? 164  PHE A CA    1 
ATOM   2685  C  C     . PHE B  2  163 ? 10.307   -15.978 27.185   1.00 53.88  ? 164  PHE A C     1 
ATOM   2686  O  O     . PHE B  2  163 ? 10.234   -16.930 27.965   1.00 50.71  ? 164  PHE A O     1 
ATOM   2687  C  CB    . PHE B  2  163 ? 9.280    -13.725 27.883   1.00 65.40  ? 164  PHE A CB    1 
ATOM   2688  C  CG    . PHE B  2  163 ? 9.719    -13.912 29.313   1.00 70.84  ? 164  PHE A CG    1 
ATOM   2689  C  CD1   . PHE B  2  163 ? 8.803    -14.221 30.302   1.00 66.72  ? 164  PHE A CD1   1 
ATOM   2690  C  CD2   . PHE B  2  163 ? 11.051   -13.772 29.673   1.00 75.84  ? 164  PHE A CD2   1 
ATOM   2691  C  CE1   . PHE B  2  163 ? 9.215    -14.401 31.613   1.00 67.28  ? 164  PHE A CE1   1 
ATOM   2692  C  CE2   . PHE B  2  163 ? 11.466   -13.975 30.978   1.00 72.29  ? 164  PHE A CE2   1 
ATOM   2693  C  CZ    . PHE B  2  163 ? 10.548   -14.268 31.950   1.00 68.80  ? 164  PHE A CZ    1 
ATOM   2694  N  N     . PRO B  2  164 ? 11.405   -15.786 26.407   1.00 56.25  ? 165  PRO A N     1 
ATOM   2695  C  CA    . PRO B  2  164 ? 12.535   -16.726 26.354   1.00 59.98  ? 165  PRO A CA    1 
ATOM   2696  C  C     . PRO B  2  164 ? 13.477   -16.647 27.569   1.00 60.37  ? 165  PRO A C     1 
ATOM   2697  O  O     . PRO B  2  164 ? 14.503   -15.972 27.506   1.00 56.63  ? 165  PRO A O     1 
ATOM   2698  C  CB    . PRO B  2  164 ? 13.272   -16.327 25.061   1.00 59.17  ? 165  PRO A CB    1 
ATOM   2699  C  CG    . PRO B  2  164 ? 13.011   -14.837 24.939   1.00 59.25  ? 165  PRO A CG    1 
ATOM   2700  C  CD    . PRO B  2  164 ? 11.602   -14.658 25.486   1.00 58.01  ? 165  PRO A CD    1 
ATOM   2701  N  N     . ASN B  2  165 ? 13.133   -17.397 28.616   1.00 64.56  ? 166  ASN A N     1 
ATOM   2702  C  CA    . ASN B  2  165 ? 13.631   -17.204 30.000   1.00 73.26  ? 166  ASN A CA    1 
ATOM   2703  C  C     . ASN B  2  165 ? 15.045   -17.788 30.166   1.00 75.00  ? 166  ASN A C     1 
ATOM   2704  O  O     . ASN B  2  165 ? 15.806   -17.227 30.991   1.00 69.33  ? 166  ASN A O     1 
ATOM   2705  C  CB    . ASN B  2  165 ? 12.666   -17.822 31.014   1.00 77.80  ? 166  ASN A CB    1 
ATOM   2706  C  CG    . ASN B  2  165 ? 13.142   -17.622 32.433   1.00 80.87  ? 166  ASN A CG    1 
ATOM   2707  O  OD1   . ASN B  2  165 ? 13.256   -16.472 32.856   1.00 86.34  ? 166  ASN A OD1   1 
ATOM   2708  N  ND2   . ASN B  2  165 ? 13.444   -18.708 33.139   1.00 78.19  ? 166  ASN A ND2   1 
ATOM   2709  N  N     . LEU B  2  166 ? 15.381   -18.868 29.442   1.00 82.08  ? 167  LEU A N     1 
ATOM   2710  C  CA    . LEU B  2  166 ? 16.712   -19.535 29.557   1.00 85.17  ? 167  LEU A CA    1 
ATOM   2711  C  C     . LEU B  2  166 ? 17.807   -18.497 29.319   1.00 80.65  ? 167  LEU A C     1 
ATOM   2712  O  O     . LEU B  2  166 ? 18.708   -18.398 30.163   1.00 79.99  ? 167  LEU A O     1 
ATOM   2713  C  CB    . LEU B  2  166 ? 16.884   -20.687 28.561   1.00 82.99  ? 167  LEU A CB    1 
ATOM   2714  C  CG    . LEU B  2  166 ? 18.259   -21.366 28.616   1.00 78.10  ? 167  LEU A CG    1 
ATOM   2715  C  CD1   . LEU B  2  166 ? 18.472   -22.104 29.927   1.00 75.62  ? 167  LEU A CD1   1 
ATOM   2716  C  CD2   . LEU B  2  166 ? 18.464   -22.320 27.455   1.00 75.77  ? 167  LEU A CD2   1 
ATOM   2717  N  N     . LEU B  2  167 ? 17.731   -17.779 28.197   1.00 73.61  ? 168  LEU A N     1 
ATOM   2718  C  CA    . LEU B  2  167 ? 18.755   -16.778 27.802   1.00 72.70  ? 168  LEU A CA    1 
ATOM   2719  C  C     . LEU B  2  167 ? 18.539   -15.473 28.577   1.00 66.85  ? 168  LEU A C     1 
ATOM   2720  O  O     . LEU B  2  167 ? 19.543   -14.808 28.914   1.00 54.93  ? 168  LEU A O     1 
ATOM   2721  C  CB    . LEU B  2  167 ? 18.681   -16.565 26.287   1.00 78.02  ? 168  LEU A CB    1 
ATOM   2722  C  CG    . LEU B  2  167 ? 19.197   -17.723 25.434   1.00 82.01  ? 168  LEU A CG    1 
ATOM   2723  C  CD1   . LEU B  2  167 ? 18.897   -17.503 23.964   1.00 82.62  ? 168  LEU A CD1   1 
ATOM   2724  C  CD2   . LEU B  2  167 ? 20.692   -17.914 25.627   1.00 86.01  ? 168  LEU A CD2   1 
ATOM   2725  N  N     . ALA B  2  168 ? 17.283   -15.108 28.854   1.00 64.28  ? 169  ALA A N     1 
ATOM   2726  C  CA    . ALA B  2  168 ? 16.946   -13.819 29.498   1.00 61.91  ? 169  ALA A CA    1 
ATOM   2727  C  C     . ALA B  2  168 ? 17.592   -13.768 30.881   1.00 60.79  ? 169  ALA A C     1 
ATOM   2728  O  O     . ALA B  2  168 ? 18.341   -12.812 31.163   1.00 59.69  ? 169  ALA A O     1 
ATOM   2729  C  CB    . ALA B  2  168 ? 15.454   -13.640 29.585   1.00 61.05  ? 169  ALA A CB    1 
ATOM   2730  N  N     . ASN B  2  169 ? 17.308   -14.767 31.713   1.00 58.95  ? 170  ASN A N     1 
ATOM   2731  C  CA    . ASN B  2  169 ? 17.771   -14.796 33.121   1.00 55.79  ? 170  ASN A CA    1 
ATOM   2732  C  C     . ASN B  2  169 ? 19.079   -15.574 33.206   1.00 58.41  ? 170  ASN A C     1 
ATOM   2733  O  O     . ASN B  2  169 ? 19.850   -15.292 34.126   1.00 71.87  ? 170  ASN A O     1 
ATOM   2734  C  CB    . ASN B  2  169 ? 16.702   -15.346 34.052   1.00 48.60  ? 170  ASN A CB    1 
ATOM   2735  C  CG    . ASN B  2  169 ? 15.772   -14.251 34.525   1.00 45.96  ? 170  ASN A CG    1 
ATOM   2736  O  OD1   . ASN B  2  169 ? 16.229   -13.214 35.001   1.00 51.41  ? 170  ASN A OD1   1 
ATOM   2737  N  ND2   . ASN B  2  169 ? 14.475   -14.470 34.403   1.00 43.73  ? 170  ASN A ND2   1 
ATOM   2738  N  N     . GLY B  2  170 ? 19.337   -16.481 32.265   1.00 54.03  ? 171  GLY A N     1 
ATOM   2739  C  CA    . GLY B  2  170 ? 20.565   -17.298 32.275   1.00 57.61  ? 171  GLY A CA    1 
ATOM   2740  C  C     . GLY B  2  170 ? 20.385   -18.474 33.210   1.00 64.09  ? 171  GLY A C     1 
ATOM   2741  O  O     . GLY B  2  170 ? 19.220   -18.747 33.578   1.00 69.68  ? 171  GLY A O     1 
ATOM   2742  N  N     . ALA B  2  171 ? 21.476   -19.164 33.546   1.00 64.32  ? 172  ALA A N     1 
ATOM   2743  C  CA    . ALA B  2  171 ? 21.481   -20.407 34.346   1.00 62.74  ? 172  ALA A CA    1 
ATOM   2744  C  C     . ALA B  2  171 ? 22.919   -20.867 34.597   1.00 69.89  ? 172  ALA A C     1 
ATOM   2745  O  O     . ALA B  2  171 ? 23.720   -20.869 33.647   1.00 61.55  ? 172  ALA A O     1 
ATOM   2746  C  CB    . ALA B  2  171 ? 20.708   -21.455 33.610   1.00 60.27  ? 172  ALA A CB    1 
ATOM   2747  N  N     . SER B  2  172 ? 23.228   -21.234 35.840   1.00 86.94  ? 173  SER A N     1 
ATOM   2748  C  CA    . SER B  2  172 ? 24.495   -21.910 36.216   1.00 99.20  ? 173  SER A CA    1 
ATOM   2749  C  C     . SER B  2  172 ? 24.149   -23.155 37.045   1.00 91.60  ? 173  SER A C     1 
ATOM   2750  O  O     . SER B  2  172 ? 23.243   -23.078 37.878   1.00 78.74  ? 173  SER A O     1 
ATOM   2751  C  CB    . SER B  2  172 ? 25.456   -20.958 36.912   1.00 104.81 ? 173  SER A CB    1 
ATOM   2752  O  OG    . SER B  2  172 ? 25.241   -20.899 38.315   1.00 105.79 ? 173  SER A OG    1 
ATOM   2753  N  N     . GLY B  2  173 ? 24.806   -24.279 36.773   1.00 89.86  ? 174  GLY A N     1 
ATOM   2754  C  CA    . GLY B  2  173 ? 24.486   -25.567 37.403   1.00 87.08  ? 174  GLY A CA    1 
ATOM   2755  C  C     . GLY B  2  173 ? 25.642   -26.535 37.293   1.00 84.19  ? 174  GLY A C     1 
ATOM   2756  O  O     . GLY B  2  173 ? 26.097   -26.797 36.162   1.00 71.72  ? 174  GLY A O     1 
ATOM   2757  N  N     . ILE B  2  174 ? 26.128   -27.023 38.434   1.00 84.45  ? 175  ILE A N     1 
ATOM   2758  C  CA    . ILE B  2  174 ? 27.137   -28.113 38.502   1.00 81.71  ? 175  ILE A CA    1 
ATOM   2759  C  C     . ILE B  2  174 ? 26.368   -29.433 38.528   1.00 86.77  ? 175  ILE A C     1 
ATOM   2760  O  O     . ILE B  2  174 ? 25.625   -29.649 39.488   1.00 100.59 ? 175  ILE A O     1 
ATOM   2761  C  CB    . ILE B  2  174 ? 28.053   -27.914 39.716   1.00 78.75  ? 175  ILE A CB    1 
ATOM   2762  C  CG1   . ILE B  2  174 ? 28.712   -26.534 39.673   1.00 80.05  ? 175  ILE A CG1   1 
ATOM   2763  C  CG2   . ILE B  2  174 ? 29.089   -29.015 39.790   1.00 78.09  ? 175  ILE A CG2   1 
ATOM   2764  C  CD1   . ILE B  2  174 ? 29.282   -26.067 40.985   1.00 78.15  ? 175  ILE A CD1   1 
ATOM   2765  N  N     . ALA B  2  175 ? 26.498   -30.246 37.474   1.00 83.92  ? 176  ALA A N     1 
ATOM   2766  C  CA    . ALA B  2  175 ? 25.832   -31.560 37.349   1.00 79.24  ? 176  ALA A CA    1 
ATOM   2767  C  C     . ALA B  2  175 ? 26.855   -32.650 37.686   1.00 69.50  ? 176  ALA A C     1 
ATOM   2768  O  O     . ALA B  2  175 ? 27.689   -32.402 38.579   1.00 56.74  ? 176  ALA A O     1 
ATOM   2769  C  CB    . ALA B  2  175 ? 25.242   -31.704 35.965   1.00 82.89  ? 176  ALA A CB    1 
ATOM   2770  N  N     . VAL B  2  176 ? 26.767   -33.812 37.028   1.00 63.64  ? 177  VAL A N     1 
ATOM   2771  C  CA    . VAL B  2  176 ? 27.810   -34.883 37.057   1.00 60.57  ? 177  VAL A CA    1 
ATOM   2772  C  C     . VAL B  2  176 ? 28.211   -35.156 35.607   1.00 52.37  ? 177  VAL A C     1 
ATOM   2773  O  O     . VAL B  2  176 ? 27.294   -35.331 34.768   1.00 48.68  ? 177  VAL A O     1 
ATOM   2774  C  CB    . VAL B  2  176 ? 27.316   -36.169 37.755   1.00 67.84  ? 177  VAL A CB    1 
ATOM   2775  C  CG1   . VAL B  2  176 ? 28.364   -37.261 37.715   1.00 65.30  ? 177  VAL A CG1   1 
ATOM   2776  C  CG2   . VAL B  2  176 ? 26.842   -35.939 39.179   1.00 67.56  ? 177  VAL A CG2   1 
ATOM   2777  N  N     . GLY B  2  177 ? 29.521   -35.154 35.327   1.00 47.59  ? 178  GLY A N     1 
ATOM   2778  C  CA    . GLY B  2  177 ? 30.096   -35.309 33.979   1.00 53.79  ? 178  GLY A CA    1 
ATOM   2779  C  C     . GLY B  2  177 ? 30.059   -34.018 33.165   1.00 60.36  ? 178  GLY A C     1 
ATOM   2780  O  O     . GLY B  2  177 ? 30.764   -33.942 32.134   1.00 58.37  ? 178  GLY A O     1 
ATOM   2781  N  N     . MET B  2  178 ? 29.288   -33.019 33.603   1.00 70.14  ? 179  MET A N     1 
ATOM   2782  C  CA    . MET B  2  178 ? 29.090   -31.733 32.889   1.00 74.81  ? 179  MET A CA    1 
ATOM   2783  C  C     . MET B  2  178 ? 28.554   -30.675 33.861   1.00 73.64  ? 179  MET A C     1 
ATOM   2784  O  O     . MET B  2  178 ? 28.021   -31.043 34.928   1.00 69.41  ? 179  MET A O     1 
ATOM   2785  C  CB    . MET B  2  178 ? 28.102   -31.917 31.740   1.00 83.03  ? 179  MET A CB    1 
ATOM   2786  C  CG    . MET B  2  178 ? 26.706   -32.264 32.195   1.00 90.39  ? 179  MET A CG    1 
ATOM   2787  S  SD    . MET B  2  178 ? 25.674   -32.945 30.850   1.00 96.93  ? 179  MET A SD    1 
ATOM   2788  C  CE    . MET B  2  178 ? 26.684   -34.336 30.355   1.00 98.23  ? 179  MET A CE    1 
ATOM   2789  N  N     . ALA B  2  179 ? 28.715   -29.405 33.498   1.00 78.25  ? 180  ALA A N     1 
ATOM   2790  C  CA    . ALA B  2  179 ? 28.075   -28.244 34.155   1.00 79.15  ? 180  ALA A CA    1 
ATOM   2791  C  C     . ALA B  2  179 ? 27.384   -27.405 33.080   1.00 74.09  ? 180  ALA A C     1 
ATOM   2792  O  O     . ALA B  2  179 ? 27.530   -27.732 31.893   1.00 70.61  ? 180  ALA A O     1 
ATOM   2793  C  CB    . ALA B  2  179 ? 29.095   -27.432 34.912   1.00 84.70  ? 180  ALA A CB    1 
ATOM   2794  N  N     . THR B  2  180 ? 26.643   -26.380 33.495   1.00 71.46  ? 181  THR A N     1 
ATOM   2795  C  CA    . THR B  2  180 ? 26.084   -25.337 32.603   1.00 73.95  ? 181  THR A CA    1 
ATOM   2796  C  C     . THR B  2  180 ? 26.471   -23.966 33.157   1.00 77.30  ? 181  THR A C     1 
ATOM   2797  O  O     . THR B  2  180 ? 26.557   -23.814 34.398   1.00 75.14  ? 181  THR A O     1 
ATOM   2798  C  CB    . THR B  2  180 ? 24.565   -25.448 32.433   1.00 68.94  ? 181  THR A CB    1 
ATOM   2799  O  OG1   . THR B  2  180 ? 24.249   -24.601 31.318   1.00 61.57  ? 181  THR A OG1   1 
ATOM   2800  C  CG2   . THR B  2  180 ? 23.782   -25.039 33.658   1.00 65.56  ? 181  THR A CG2   1 
ATOM   2801  N  N     . ASN B  2  181 ? 26.711   -23.019 32.254   1.00 81.70  ? 182  ASN A N     1 
ATOM   2802  C  CA    . ASN B  2  181 ? 26.935   -21.596 32.598   1.00 84.74  ? 182  ASN A CA    1 
ATOM   2803  C  C     . ASN B  2  181 ? 26.441   -20.762 31.417   1.00 83.17  ? 182  ASN A C     1 
ATOM   2804  O  O     . ASN B  2  181 ? 27.135   -20.729 30.378   1.00 92.43  ? 182  ASN A O     1 
ATOM   2805  C  CB    . ASN B  2  181 ? 28.400   -21.359 32.954   1.00 90.07  ? 182  ASN A CB    1 
ATOM   2806  C  CG    . ASN B  2  181 ? 28.602   -20.148 33.830   1.00 89.48  ? 182  ASN A CG    1 
ATOM   2807  O  OD1   . ASN B  2  181 ? 27.992   -20.028 34.890   1.00 83.07  ? 182  ASN A OD1   1 
ATOM   2808  N  ND2   . ASN B  2  181 ? 29.479   -19.260 33.404   1.00 92.10  ? 182  ASN A ND2   1 
ATOM   2809  N  N     . ILE B  2  182 ? 25.245   -20.185 31.544   1.00 75.25  ? 183  ILE A N     1 
ATOM   2810  C  CA    . ILE B  2  182 ? 24.601   -19.376 30.475   1.00 65.61  ? 183  ILE A CA    1 
ATOM   2811  C  C     . ILE B  2  182 ? 24.376   -17.982 31.045   1.00 66.15  ? 183  ILE A C     1 
ATOM   2812  O  O     . ILE B  2  182 ? 23.730   -17.826 32.079   1.00 68.90  ? 183  ILE A O     1 
ATOM   2813  C  CB    . ILE B  2  182 ? 23.293   -20.024 29.999   1.00 64.65  ? 183  ILE A CB    1 
ATOM   2814  C  CG1   . ILE B  2  182 ? 23.539   -21.429 29.443   1.00 69.45  ? 183  ILE A CG1   1 
ATOM   2815  C  CG2   . ILE B  2  182 ? 22.588   -19.129 28.992   1.00 65.57  ? 183  ILE A CG2   1 
ATOM   2816  C  CD1   . ILE B  2  182 ? 22.273   -22.244 29.240   1.00 76.87  ? 183  ILE A CD1   1 
ATOM   2817  N  N     . PRO B  2  183 ? 24.920   -16.927 30.403   1.00 59.56  ? 184  PRO A N     1 
ATOM   2818  C  CA    . PRO B  2  183 ? 24.804   -15.576 30.937   1.00 54.96  ? 184  PRO A CA    1 
ATOM   2819  C  C     . PRO B  2  183 ? 23.424   -15.022 30.631   1.00 50.50  ? 184  PRO A C     1 
ATOM   2820  O  O     . PRO B  2  183 ? 22.791   -15.453 29.668   1.00 43.63  ? 184  PRO A O     1 
ATOM   2821  C  CB    . PRO B  2  183 ? 25.892   -14.816 30.174   1.00 58.41  ? 184  PRO A CB    1 
ATOM   2822  C  CG    . PRO B  2  183 ? 25.919   -15.505 28.822   1.00 54.90  ? 184  PRO A CG    1 
ATOM   2823  C  CD    . PRO B  2  183 ? 25.633   -16.963 29.117   1.00 58.17  ? 184  PRO A CD    1 
ATOM   2824  N  N     . PRO B  2  184 ? 22.923   -14.072 31.443   1.00 50.65  ? 185  PRO A N     1 
ATOM   2825  C  CA    . PRO B  2  184 ? 21.657   -13.393 31.163   1.00 50.43  ? 185  PRO A CA    1 
ATOM   2826  C  C     . PRO B  2  184 ? 21.780   -12.462 29.945   1.00 50.90  ? 185  PRO A C     1 
ATOM   2827  O  O     . PRO B  2  184 ? 22.901   -12.100 29.574   1.00 52.09  ? 185  PRO A O     1 
ATOM   2828  C  CB    . PRO B  2  184 ? 21.361   -12.585 32.433   1.00 48.59  ? 185  PRO A CB    1 
ATOM   2829  C  CG    . PRO B  2  184 ? 22.727   -12.374 33.052   1.00 51.22  ? 185  PRO A CG    1 
ATOM   2830  C  CD    . PRO B  2  184 ? 23.533   -13.611 32.691   1.00 51.20  ? 185  PRO A CD    1 
ATOM   2831  N  N     . HIS B  2  185 ? 20.632   -12.112 29.362   1.00 48.34  ? 186  HIS A N     1 
ATOM   2832  C  CA    . HIS B  2  185 ? 20.530   -11.332 28.103   1.00 48.07  ? 186  HIS A CA    1 
ATOM   2833  C  C     . HIS B  2  185 ? 19.490   -10.218 28.240   1.00 44.91  ? 186  HIS A C     1 
ATOM   2834  O  O     . HIS B  2  185 ? 18.692   -10.238 29.201   1.00 40.63  ? 186  HIS A O     1 
ATOM   2835  C  CB    . HIS B  2  185 ? 20.222   -12.285 26.947   1.00 49.76  ? 186  HIS A CB    1 
ATOM   2836  C  CG    . HIS B  2  185 ? 21.403   -13.109 26.580   1.00 50.66  ? 186  HIS A CG    1 
ATOM   2837  N  ND1   . HIS B  2  185 ? 21.723   -14.262 27.266   1.00 53.10  ? 186  HIS A ND1   1 
ATOM   2838  C  CD2   . HIS B  2  185 ? 22.376   -12.919 25.656   1.00 53.40  ? 186  HIS A CD2   1 
ATOM   2839  C  CE1   . HIS B  2  185 ? 22.825   -14.774 26.756   1.00 57.93  ? 186  HIS A CE1   1 
ATOM   2840  N  NE2   . HIS B  2  185 ? 23.251   -13.960 25.772   1.00 60.68  ? 186  HIS A NE2   1 
ATOM   2841  N  N     . ASN B  2  186 ? 19.513   -9.258  27.320   1.00 45.85  ? 187  ASN A N     1 
ATOM   2842  C  CA    . ASN B  2  186 ? 18.486   -8.192  27.271   1.00 48.90  ? 187  ASN A CA    1 
ATOM   2843  C  C     . ASN B  2  186 ? 17.255   -8.773  26.574   1.00 46.81  ? 187  ASN A C     1 
ATOM   2844  O  O     . ASN B  2  186 ? 17.416   -9.351  25.482   1.00 43.10  ? 187  ASN A O     1 
ATOM   2845  C  CB    . ASN B  2  186 ? 18.987   -6.929  26.581   1.00 60.49  ? 187  ASN A CB    1 
ATOM   2846  C  CG    . ASN B  2  186 ? 18.007   -5.785  26.738   1.00 63.59  ? 187  ASN A CG    1 
ATOM   2847  O  OD1   . ASN B  2  186 ? 17.099   -5.619  25.914   1.00 64.03  ? 187  ASN A OD1   1 
ATOM   2848  N  ND2   . ASN B  2  186 ? 18.145   -5.049  27.827   1.00 55.16  ? 187  ASN A ND2   1 
ATOM   2849  N  N     . LEU B  2  187 ? 16.081   -8.643  27.195   1.00 51.66  ? 188  LEU A N     1 
ATOM   2850  C  CA    . LEU B  2  187 ? 14.833   -9.291  26.728   1.00 55.48  ? 188  LEU A CA    1 
ATOM   2851  C  C     . LEU B  2  187 ? 14.451   -8.716  25.360   1.00 55.00  ? 188  LEU A C     1 
ATOM   2852  O  O     . LEU B  2  187 ? 14.055   -9.498  24.475   1.00 53.93  ? 188  LEU A O     1 
ATOM   2853  C  CB    . LEU B  2  187 ? 13.720   -9.065  27.752   1.00 60.24  ? 188  LEU A CB    1 
ATOM   2854  C  CG    . LEU B  2  187 ? 12.371   -9.684  27.383   1.00 67.91  ? 188  LEU A CG    1 
ATOM   2855  C  CD1   . LEU B  2  187 ? 12.515   -11.180 27.179   1.00 69.24  ? 188  LEU A CD1   1 
ATOM   2856  C  CD2   . LEU B  2  187 ? 11.323   -9.377  28.451   1.00 75.71  ? 188  LEU A CD2   1 
ATOM   2857  N  N     . THR B  2  188 ? 14.557   -7.393  25.208   1.00 57.83  ? 189  THR A N     1 
ATOM   2858  C  CA    . THR B  2  188 ? 14.265   -6.667  23.945   1.00 63.60  ? 189  THR A CA    1 
ATOM   2859  C  C     . THR B  2  188 ? 15.122   -7.283  22.837   1.00 71.51  ? 189  THR A C     1 
ATOM   2860  O  O     . THR B  2  188 ? 14.553   -7.707  21.818   1.00 78.08  ? 189  THR A O     1 
ATOM   2861  C  CB    . THR B  2  188 ? 14.504   -5.158  24.089   1.00 60.68  ? 189  THR A CB    1 
ATOM   2862  O  OG1   . THR B  2  188 ? 13.803   -4.665  25.254   1.00 62.15  ? 189  THR A OG1   1 
ATOM   2863  C  CG2   . THR B  2  188 ? 14.091   -4.398  22.842   1.00 54.81  ? 189  THR A CG2   1 
ATOM   2864  N  N     . GLU B  2  189 ? 16.435   -7.358  23.045   1.00 77.68  ? 190  GLU A N     1 
ATOM   2865  C  CA    . GLU B  2  189 ? 17.394   -7.914  22.048   1.00 78.07  ? 190  GLU A CA    1 
ATOM   2866  C  C     . GLU B  2  189 ? 16.976   -9.355  21.715   1.00 71.73  ? 190  GLU A C     1 
ATOM   2867  O  O     . GLU B  2  189 ? 16.900   -9.679  20.521   1.00 68.54  ? 190  GLU A O     1 
ATOM   2868  C  CB    . GLU B  2  189 ? 18.833   -7.844  22.578   1.00 86.45  ? 190  GLU A CB    1 
ATOM   2869  C  CG    . GLU B  2  189 ? 19.333   -6.425  22.829   1.00 90.61  ? 190  GLU A CG    1 
ATOM   2870  C  CD    . GLU B  2  189 ? 20.829   -6.307  23.134   1.00 93.54  ? 190  GLU A CD    1 
ATOM   2871  O  OE1   . GLU B  2  189 ? 21.530   -7.353  23.156   1.00 103.02 ? 190  GLU A OE1   1 
ATOM   2872  O  OE2   . GLU B  2  189 ? 21.298   -5.163  23.356   1.00 93.12  ? 190  GLU A OE2   1 
ATOM   2873  N  N     . LEU B  2  190 ? 16.694   -10.174 22.735   1.00 65.95  ? 191  LEU A N     1 
ATOM   2874  C  CA    . LEU B  2  190 ? 16.326   -11.607 22.571   1.00 61.73  ? 191  LEU A CA    1 
ATOM   2875  C  C     . LEU B  2  190 ? 15.113   -11.715 21.653   1.00 59.94  ? 191  LEU A C     1 
ATOM   2876  O  O     . LEU B  2  190 ? 15.166   -12.512 20.689   1.00 63.97  ? 191  LEU A O     1 
ATOM   2877  C  CB    . LEU B  2  190 ? 16.003   -12.247 23.931   1.00 63.82  ? 191  LEU A CB    1 
ATOM   2878  C  CG    . LEU B  2  190 ? 17.201   -12.689 24.764   1.00 66.90  ? 191  LEU A CG    1 
ATOM   2879  C  CD1   . LEU B  2  190 ? 16.714   -13.388 26.027   1.00 65.65  ? 191  LEU A CD1   1 
ATOM   2880  C  CD2   . LEU B  2  190 ? 18.145   -13.586 23.959   1.00 65.73  ? 191  LEU A CD2   1 
ATOM   2881  N  N     . ILE B  2  191 ? 14.056   -10.960 21.955   1.00 53.69  ? 192  ILE A N     1 
ATOM   2882  C  CA    . ILE B  2  191 ? 12.743   -11.102 21.265   1.00 50.06  ? 192  ILE A CA    1 
ATOM   2883  C  C     . ILE B  2  191 ? 12.916   -10.641 19.810   1.00 52.61  ? 192  ILE A C     1 
ATOM   2884  O  O     . ILE B  2  191 ? 12.412   -11.337 18.915   1.00 65.45  ? 192  ILE A O     1 
ATOM   2885  C  CB    . ILE B  2  191 ? 11.628   -10.381 22.043   1.00 45.72  ? 192  ILE A CB    1 
ATOM   2886  C  CG1   . ILE B  2  191 ? 11.298   -11.154 23.318   1.00 41.64  ? 192  ILE A CG1   1 
ATOM   2887  C  CG2   . ILE B  2  191 ? 10.399   -10.184 21.168   1.00 48.84  ? 192  ILE A CG2   1 
ATOM   2888  C  CD1   . ILE B  2  191 ? 10.184   -10.566 24.154   1.00 45.70  ? 192  ILE A CD1   1 
ATOM   2889  N  N     . ASN B  2  192 ? 13.672   -9.573  19.568   1.00 49.90  ? 193  ASN A N     1 
ATOM   2890  C  CA    . ASN B  2  192 ? 14.052   -9.138  18.197   1.00 54.02  ? 193  ASN A CA    1 
ATOM   2891  C  C     . ASN B  2  192 ? 14.808   -10.278 17.493   1.00 53.18  ? 193  ASN A C     1 
ATOM   2892  O  O     . ASN B  2  192 ? 14.545   -10.521 16.299   1.00 50.81  ? 193  ASN A O     1 
ATOM   2893  C  CB    . ASN B  2  192 ? 14.864   -7.842  18.216   1.00 62.55  ? 193  ASN A CB    1 
ATOM   2894  C  CG    . ASN B  2  192 ? 14.076   -6.685  18.801   1.00 66.28  ? 193  ASN A CG    1 
ATOM   2895  O  OD1   . ASN B  2  192 ? 12.841   -6.659  18.738   1.00 65.32  ? 193  ASN A OD1   1 
ATOM   2896  N  ND2   . ASN B  2  192 ? 14.779   -5.735  19.396   1.00 70.71  ? 193  ASN A ND2   1 
ATOM   2897  N  N     . GLY B  2  193 ? 15.706   -10.963 18.205   1.00 52.33  ? 194  GLY A N     1 
ATOM   2898  C  CA    . GLY B  2  193 ? 16.407   -12.156 17.695   1.00 58.94  ? 194  GLY A CA    1 
ATOM   2899  C  C     . GLY B  2  193 ? 15.421   -13.233 17.254   1.00 70.87  ? 194  GLY A C     1 
ATOM   2900  O  O     . GLY B  2  193 ? 15.563   -13.746 16.122   1.00 78.50  ? 194  GLY A O     1 
ATOM   2901  N  N     . VAL B  2  194 ? 14.443   -13.558 18.103   1.00 76.14  ? 195  VAL A N     1 
ATOM   2902  C  CA    . VAL B  2  194 ? 13.452   -14.642 17.845   1.00 80.64  ? 195  VAL A CA    1 
ATOM   2903  C  C     . VAL B  2  194 ? 12.598   -14.246 16.634   1.00 82.43  ? 195  VAL A C     1 
ATOM   2904  O  O     . VAL B  2  194 ? 12.336   -15.133 15.800   1.00 94.30  ? 195  VAL A O     1 
ATOM   2905  C  CB    . VAL B  2  194 ? 12.561   -14.933 19.071   1.00 82.98  ? 195  VAL A CB    1 
ATOM   2906  C  CG1   . VAL B  2  194 ? 11.477   -15.952 18.734   1.00 87.28  ? 195  VAL A CG1   1 
ATOM   2907  C  CG2   . VAL B  2  194 ? 13.346   -15.392 20.278   1.00 77.83  ? 195  VAL A CG2   1 
ATOM   2908  N  N     . LEU B  2  195 ? 12.169   -12.979 16.558   1.00 70.06  ? 196  LEU A N     1 
ATOM   2909  C  CA    . LEU B  2  195 ? 11.350   -12.444 15.438   1.00 69.40  ? 196  LEU A CA    1 
ATOM   2910  C  C     . LEU B  2  195 ? 12.138   -12.605 14.131   1.00 73.12  ? 196  LEU A C     1 
ATOM   2911  O  O     . LEU B  2  195 ? 11.558   -13.117 13.147   1.00 77.49  ? 196  LEU A O     1 
ATOM   2912  C  CB    . LEU B  2  195 ? 11.005   -10.972 15.699   1.00 69.39  ? 196  LEU A CB    1 
ATOM   2913  C  CG    . LEU B  2  195 ? 10.051   -10.685 16.849   1.00 74.63  ? 196  LEU A CG    1 
ATOM   2914  C  CD1   . LEU B  2  195 ? 9.931    -9.191  17.096   1.00 69.88  ? 196  LEU A CD1   1 
ATOM   2915  C  CD2   . LEU B  2  195 ? 8.695    -11.290 16.578   1.00 79.81  ? 196  LEU A CD2   1 
ATOM   2916  N  N     . SER B  2  196 ? 13.417   -12.214 14.136   1.00 76.82  ? 197  SER A N     1 
ATOM   2917  C  CA    . SER B  2  196 ? 14.343   -12.350 12.984   1.00 78.96  ? 197  SER A CA    1 
ATOM   2918  C  C     . SER B  2  196 ? 14.387   -13.814 12.537   1.00 75.10  ? 197  SER A C     1 
ATOM   2919  O  O     . SER B  2  196 ? 14.128   -14.070 11.344   1.00 72.93  ? 197  SER A O     1 
ATOM   2920  C  CB    . SER B  2  196 ? 15.714   -11.841 13.326   1.00 81.44  ? 197  SER A CB    1 
ATOM   2921  O  OG    . SER B  2  196 ? 15.686   -10.437 13.521   1.00 90.27  ? 197  SER A OG    1 
ATOM   2922  N  N     . LEU B  2  197 ? 14.677   -14.723 13.473   1.00 73.91  ? 198  LEU A N     1 
ATOM   2923  C  CA    . LEU B  2  197 ? 14.712   -16.189 13.239   1.00 78.28  ? 198  LEU A CA    1 
ATOM   2924  C  C     . LEU B  2  197 ? 13.364   -16.684 12.690   1.00 79.57  ? 198  LEU A C     1 
ATOM   2925  O  O     . LEU B  2  197 ? 13.385   -17.532 11.774   1.00 83.61  ? 198  LEU A O     1 
ATOM   2926  C  CB    . LEU B  2  197 ? 15.040   -16.911 14.548   1.00 76.50  ? 198  LEU A CB    1 
ATOM   2927  C  CG    . LEU B  2  197 ? 14.963   -18.435 14.464   1.00 74.36  ? 198  LEU A CG    1 
ATOM   2928  C  CD1   . LEU B  2  197 ? 16.144   -18.981 13.680   1.00 65.80  ? 198  LEU A CD1   1 
ATOM   2929  C  CD2   . LEU B  2  197 ? 14.841   -19.054 15.851   1.00 80.81  ? 198  LEU A CD2   1 
ATOM   2930  N  N     . SER B  2  198 ? 12.238   -16.201 13.232   1.00 73.62  ? 199  SER A N     1 
ATOM   2931  C  CA    . SER B  2  198 ? 10.874   -16.677 12.877   1.00 76.74  ? 199  SER A CA    1 
ATOM   2932  C  C     . SER B  2  198 ? 10.520   -16.275 11.442   1.00 75.89  ? 199  SER A C     1 
ATOM   2933  O  O     . SER B  2  198 ? 9.559    -16.851 10.898   1.00 72.07  ? 199  SER A O     1 
ATOM   2934  C  CB    . SER B  2  198 ? 9.822    -16.160 13.832   1.00 79.25  ? 199  SER A CB    1 
ATOM   2935  O  OG    . SER B  2  198 ? 9.415    -14.851 13.484   1.00 83.89  ? 199  SER A OG    1 
ATOM   2936  N  N     . LYS B  2  199 ? 11.236   -15.297 10.873   1.00 78.63  ? 200  LYS A N     1 
ATOM   2937  C  CA    . LYS B  2  199 ? 11.055   -14.829 9.470    1.00 82.12  ? 200  LYS A CA    1 
ATOM   2938  C  C     . LYS B  2  199 ? 12.076   -15.507 8.546    1.00 84.13  ? 200  LYS A C     1 
ATOM   2939  O  O     . LYS B  2  199 ? 11.809   -15.543 7.338    1.00 85.59  ? 200  LYS A O     1 
ATOM   2940  C  CB    . LYS B  2  199 ? 11.160   -13.300 9.387    1.00 83.47  ? 200  LYS A CB    1 
ATOM   2941  C  CG    . LYS B  2  199 ? 10.027   -12.556 10.087   1.00 84.02  ? 200  LYS A CG    1 
ATOM   2942  C  CD    . LYS B  2  199 ? 10.273   -11.091 10.380   1.00 81.12  ? 200  LYS A CD    1 
ATOM   2943  C  CE    . LYS B  2  199 ? 9.197    -10.511 11.276   1.00 79.00  ? 200  LYS A CE    1 
ATOM   2944  N  NZ    . LYS B  2  199 ? 8.578    -9.255  10.775   1.00 79.20  ? 200  LYS A NZ    1 
ATOM   2945  N  N     . ASN B  2  200 ? 13.189   -16.023 9.081    1.00 90.70  ? 201  ASN A N     1 
ATOM   2946  C  CA    . ASN B  2  200 ? 14.317   -16.567 8.275    1.00 93.27  ? 201  ASN A CA    1 
ATOM   2947  C  C     . ASN B  2  200 ? 14.931   -17.753 9.011    1.00 102.01 ? 201  ASN A C     1 
ATOM   2948  O  O     . ASN B  2  200 ? 15.902   -17.609 9.753    1.00 124.22 ? 201  ASN A O     1 
ATOM   2949  C  CB    . ASN B  2  200 ? 15.361   -15.490 7.967    1.00 95.14  ? 201  ASN A CB    1 
ATOM   2950  C  CG    . ASN B  2  200 ? 16.596   -16.027 7.279    1.00 101.62 ? 201  ASN A CG    1 
ATOM   2951  O  OD1   . ASN B  2  200 ? 16.588   -17.140 6.753    1.00 115.42 ? 201  ASN A OD1   1 
ATOM   2952  N  ND2   . ASN B  2  200 ? 17.666   -15.248 7.279    1.00 101.54 ? 201  ASN A ND2   1 
ATOM   2953  N  N     . PRO B  2  201 ? 14.391   -18.975 8.812    1.00 102.84 ? 202  PRO A N     1 
ATOM   2954  C  CA    . PRO B  2  201 ? 14.921   -20.170 9.471    1.00 102.51 ? 202  PRO A CA    1 
ATOM   2955  C  C     . PRO B  2  201 ? 16.420   -20.408 9.237    1.00 107.84 ? 202  PRO A C     1 
ATOM   2956  O  O     . PRO B  2  201 ? 17.018   -21.064 10.058   1.00 107.24 ? 202  PRO A O     1 
ATOM   2957  C  CB    . PRO B  2  201 ? 14.122   -21.314 8.831    1.00 103.99 ? 202  PRO A CB    1 
ATOM   2958  C  CG    . PRO B  2  201 ? 12.828   -20.658 8.406    1.00 105.89 ? 202  PRO A CG    1 
ATOM   2959  C  CD    . PRO B  2  201 ? 13.226   -19.263 7.964    1.00 104.09 ? 202  PRO A CD    1 
ATOM   2960  N  N     . ASP B  2  202 ? 16.969   -19.880 8.136    1.00 114.79 ? 203  ASP A N     1 
ATOM   2961  C  CA    . ASP B  2  202 ? 18.361   -20.134 7.671    1.00 126.98 ? 203  ASP A CA    1 
ATOM   2962  C  C     . ASP B  2  202 ? 19.302   -19.017 8.147    1.00 129.26 ? 203  ASP A C     1 
ATOM   2963  O  O     . ASP B  2  202 ? 20.470   -19.014 7.697    1.00 135.33 ? 203  ASP A O     1 
ATOM   2964  C  CB    . ASP B  2  202 ? 18.404   -20.282 6.148    1.00 130.13 ? 203  ASP A CB    1 
ATOM   2965  C  CG    . ASP B  2  202 ? 17.607   -21.460 5.617    1.00 126.60 ? 203  ASP A CG    1 
ATOM   2966  O  OD1   . ASP B  2  202 ? 17.362   -22.407 6.394    1.00 118.89 ? 203  ASP A OD1   1 
ATOM   2967  O  OD2   . ASP B  2  202 ? 17.246   -21.422 4.422    1.00 137.90 ? 203  ASP A OD2   1 
ATOM   2968  N  N     . ILE B  2  203 ? 18.838   -18.147 9.053    1.00 123.47 ? 204  ILE A N     1 
ATOM   2969  C  CA    . ILE B  2  203 ? 19.599   -16.969 9.574    1.00 117.79 ? 204  ILE A CA    1 
ATOM   2970  C  C     . ILE B  2  203 ? 20.931   -17.435 10.182   1.00 112.08 ? 204  ILE A C     1 
ATOM   2971  O  O     . ILE B  2  203 ? 20.946   -18.504 10.835   1.00 108.21 ? 204  ILE A O     1 
ATOM   2972  C  CB    . ILE B  2  203 ? 18.746   -16.176 10.589   1.00 112.36 ? 204  ILE A CB    1 
ATOM   2973  C  CG1   . ILE B  2  203 ? 19.319   -14.776 10.840   1.00 105.41 ? 204  ILE A CG1   1 
ATOM   2974  C  CG2   . ILE B  2  203 ? 18.559   -16.961 11.886   1.00 116.62 ? 204  ILE A CG2   1 
ATOM   2975  C  CD1   . ILE B  2  203 ? 18.342   -13.841 11.502   1.00 107.63 ? 204  ILE A CD1   1 
ATOM   2976  N  N     . SER B  2  204 ? 22.001   -16.655 9.977    1.00 105.63 ? 205  SER A N     1 
ATOM   2977  C  CA    . SER B  2  204 ? 23.362   -16.888 10.532   1.00 100.48 ? 205  SER A CA    1 
ATOM   2978  C  C     . SER B  2  204 ? 23.431   -16.355 11.964   1.00 95.54  ? 205  SER A C     1 
ATOM   2979  O  O     . SER B  2  204 ? 22.677   -15.414 12.289   1.00 79.32  ? 205  SER A O     1 
ATOM   2980  C  CB    . SER B  2  204 ? 24.417   -16.227 9.690    1.00 100.04 ? 205  SER A CB    1 
ATOM   2981  O  OG    . SER B  2  204 ? 24.372   -14.815 9.840    1.00 103.43 ? 205  SER A OG    1 
ATOM   2982  N  N     . ILE B  2  205 ? 24.337   -16.910 12.771   1.00 91.20  ? 206  ILE A N     1 
ATOM   2983  C  CA    . ILE B  2  205 ? 24.661   -16.392 14.136   1.00 90.23  ? 206  ILE A CA    1 
ATOM   2984  C  C     . ILE B  2  205 ? 25.046   -14.914 13.994   1.00 89.70  ? 206  ILE A C     1 
ATOM   2985  O  O     . ILE B  2  205 ? 24.577   -14.101 14.810   1.00 87.06  ? 206  ILE A O     1 
ATOM   2986  C  CB    . ILE B  2  205 ? 25.779   -17.220 14.788   1.00 92.30  ? 206  ILE A CB    1 
ATOM   2987  C  CG1   . ILE B  2  205 ? 25.416   -18.707 14.880   1.00 108.85 ? 206  ILE A CG1   1 
ATOM   2988  C  CG2   . ILE B  2  205 ? 26.167   -16.650 16.138   1.00 84.19  ? 206  ILE A CG2   1 
ATOM   2989  C  CD1   . ILE B  2  205 ? 24.358   -19.045 15.933   1.00 116.41 ? 206  ILE A CD1   1 
ATOM   2990  N  N     . ALA B  2  206 ? 25.856   -14.587 12.984   1.00 87.94  ? 207  ALA A N     1 
ATOM   2991  C  CA    . ALA B  2  206 ? 26.344   -13.219 12.689   1.00 90.98  ? 207  ALA A CA    1 
ATOM   2992  C  C     . ALA B  2  206 ? 25.165   -12.237 12.558   1.00 85.84  ? 207  ALA A C     1 
ATOM   2993  O  O     . ALA B  2  206 ? 25.240   -11.120 13.123   1.00 79.70  ? 207  ALA A O     1 
ATOM   2994  C  CB    . ALA B  2  206 ? 27.177   -13.243 11.430   1.00 99.72  ? 207  ALA A CB    1 
ATOM   2995  N  N     A GLU B  2  207 ? 24.118   -12.633 11.828   0.50 81.81  ? 208  GLU A N     1 
ATOM   2996  N  N     B GLU B  2  207 ? 24.118   -12.634 11.828   0.50 83.71  ? 208  GLU A N     1 
ATOM   2997  C  CA    A GLU B  2  207 ? 22.911   -11.797 11.580   0.50 79.70  ? 208  GLU A CA    1 
ATOM   2998  C  CA    B GLU B  2  207 ? 22.911   -11.798 11.581   0.50 82.70  ? 208  GLU A CA    1 
ATOM   2999  C  C     A GLU B  2  207 ? 22.109   -11.685 12.882   0.50 80.39  ? 208  GLU A C     1 
ATOM   3000  C  C     B GLU B  2  207 ? 22.109   -11.685 12.883   0.50 82.11  ? 208  GLU A C     1 
ATOM   3001  O  O     A GLU B  2  207 ? 21.610   -10.580 13.177   0.50 80.57  ? 208  GLU A O     1 
ATOM   3002  O  O     B GLU B  2  207 ? 21.610   -10.580 13.177   0.50 82.08  ? 208  GLU A O     1 
ATOM   3003  C  CB    A GLU B  2  207 ? 22.047   -12.394 10.464   0.50 78.11  ? 208  GLU A CB    1 
ATOM   3004  C  CB    B GLU B  2  207 ? 22.053   -12.392 10.459   0.50 83.44  ? 208  GLU A CB    1 
ATOM   3005  C  CG    A GLU B  2  207 ? 22.688   -12.379 9.090    0.50 72.16  ? 208  GLU A CG    1 
ATOM   3006  C  CG    B GLU B  2  207 ? 21.161   -11.362 9.795    0.50 79.00  ? 208  GLU A CG    1 
ATOM   3007  C  CD    A GLU B  2  207 ? 22.099   -13.385 8.113    0.50 66.65  ? 208  GLU A CD    1 
ATOM   3008  C  CD    B GLU B  2  207 ? 20.202   -10.737 10.788   0.50 74.96  ? 208  GLU A CD    1 
ATOM   3009  O  OE1   A GLU B  2  207 ? 21.122   -14.076 8.463    0.50 59.50  ? 208  GLU A OE1   1 
ATOM   3010  O  OE1   B GLU B  2  207 ? 20.328   -11.029 11.993   0.50 75.72  ? 208  GLU A OE1   1 
ATOM   3011  O  OE2   A GLU B  2  207 ? 22.631   -13.472 6.991    0.50 66.24  ? 208  GLU A OE2   1 
ATOM   3012  O  OE2   B GLU B  2  207 ? 19.345   -9.955  10.360   0.50 74.08  ? 208  GLU A OE2   1 
ATOM   3013  N  N     . LEU B  2  208 ? 21.985   -12.791 13.626   1.00 79.85  ? 209  LEU A N     1 
ATOM   3014  C  CA    . LEU B  2  208 ? 21.309   -12.815 14.950   1.00 72.90  ? 209  LEU A CA    1 
ATOM   3015  C  C     . LEU B  2  208 ? 22.006   -11.825 15.889   1.00 71.24  ? 209  LEU A C     1 
ATOM   3016  O  O     . LEU B  2  208 ? 21.302   -11.200 16.694   1.00 65.25  ? 209  LEU A O     1 
ATOM   3017  C  CB    . LEU B  2  208 ? 21.336   -14.238 15.522   1.00 72.11  ? 209  LEU A CB    1 
ATOM   3018  C  CG    . LEU B  2  208 ? 20.234   -15.169 15.022   1.00 68.32  ? 209  LEU A CG    1 
ATOM   3019  C  CD1   . LEU B  2  208 ? 20.445   -16.589 15.519   1.00 66.00  ? 209  LEU A CD1   1 
ATOM   3020  C  CD2   . LEU B  2  208 ? 18.871   -14.672 15.454   1.00 62.25  ? 209  LEU A CD2   1 
ATOM   3021  N  N     . MET B  2  209 ? 23.326   -11.652 15.765   1.00 70.96  ? 210  MET A N     1 
ATOM   3022  C  CA    . MET B  2  209 ? 24.119   -10.803 16.690   1.00 68.91  ? 210  MET A CA    1 
ATOM   3023  C  C     . MET B  2  209 ? 23.924   -9.309  16.388   1.00 78.76  ? 210  MET A C     1 
ATOM   3024  O  O     . MET B  2  209 ? 24.338   -8.495  17.230   1.00 91.72  ? 210  MET A O     1 
ATOM   3025  C  CB    . MET B  2  209 ? 25.601   -11.173 16.645   1.00 64.43  ? 210  MET A CB    1 
ATOM   3026  C  CG    . MET B  2  209 ? 25.900   -12.435 17.420   1.00 72.18  ? 210  MET A CG    1 
ATOM   3027  S  SD    . MET B  2  209 ? 27.672   -12.749 17.639   1.00 83.61  ? 210  MET A SD    1 
ATOM   3028  C  CE    . MET B  2  209 ? 28.221   -11.213 18.392   1.00 87.37  ? 210  MET A CE    1 
ATOM   3029  N  N     . GLU B  2  210 ? 23.288   -8.952  15.269   1.00 89.29  ? 211  GLU A N     1 
ATOM   3030  C  CA    . GLU B  2  210 ? 22.811   -7.562  15.015   1.00 96.42  ? 211  GLU A CA    1 
ATOM   3031  C  C     . GLU B  2  210 ? 21.624   -7.244  15.934   1.00 91.87  ? 211  GLU A C     1 
ATOM   3032  O  O     . GLU B  2  210 ? 21.396   -6.061  16.182   1.00 88.65  ? 211  GLU A O     1 
ATOM   3033  C  CB    . GLU B  2  210 ? 22.396   -7.359  13.557   1.00 106.80 ? 211  GLU A CB    1 
ATOM   3034  C  CG    . GLU B  2  210 ? 23.520   -7.583  12.559   1.00 110.75 ? 211  GLU A CG    1 
ATOM   3035  C  CD    . GLU B  2  210 ? 23.045   -7.681  11.119   1.00 105.38 ? 211  GLU A CD    1 
ATOM   3036  O  OE1   . GLU B  2  210 ? 23.681   -8.402  10.320   1.00 93.62  ? 211  GLU A OE1   1 
ATOM   3037  O  OE2   . GLU B  2  210 ? 22.065   -6.980  10.788   1.00 102.70 ? 211  GLU A OE2   1 
ATOM   3038  N  N     . ASP B  2  211 ? 20.881   -8.252  16.395   1.00 96.33  ? 212  ASP A N     1 
ATOM   3039  C  CA    . ASP B  2  211 ? 19.794   -8.080  17.399   1.00 102.54 ? 212  ASP A CA    1 
ATOM   3040  C  C     . ASP B  2  211 ? 20.368   -8.291  18.805   1.00 91.48  ? 212  ASP A C     1 
ATOM   3041  O  O     . ASP B  2  211 ? 20.122   -7.446  19.679   1.00 84.96  ? 212  ASP A O     1 
ATOM   3042  C  CB    . ASP B  2  211 ? 18.640   -9.061  17.177   1.00 122.00 ? 212  ASP A CB    1 
ATOM   3043  C  CG    . ASP B  2  211 ? 17.897   -8.866  15.868   1.00 129.55 ? 212  ASP A CG    1 
ATOM   3044  O  OD1   . ASP B  2  211 ? 17.428   -7.736  15.629   1.00 119.07 ? 212  ASP A OD1   1 
ATOM   3045  O  OD2   . ASP B  2  211 ? 17.793   -9.852  15.097   1.00 145.69 ? 212  ASP A OD2   1 
ATOM   3046  N  N     . ILE B  2  212 ? 21.088   -9.398  18.999   1.00 85.20  ? 213  ILE A N     1 
ATOM   3047  C  CA    . ILE B  2  212 ? 21.625   -9.849  20.318   1.00 87.26  ? 213  ILE A CA    1 
ATOM   3048  C  C     . ILE B  2  212 ? 23.111   -9.471  20.384   1.00 81.88  ? 213  ILE A C     1 
ATOM   3049  O  O     . ILE B  2  212 ? 23.953   -10.322 20.038   1.00 77.35  ? 213  ILE A O     1 
ATOM   3050  C  CB    . ILE B  2  212 ? 21.385   -11.364 20.508   1.00 88.11  ? 213  ILE A CB    1 
ATOM   3051  C  CG1   . ILE B  2  212 ? 19.893   -11.704 20.439   1.00 90.30  ? 213  ILE A CG1   1 
ATOM   3052  C  CG2   . ILE B  2  212 ? 22.004   -11.876 21.793   1.00 80.41  ? 213  ILE A CG2   1 
ATOM   3053  C  CD1   . ILE B  2  212 ? 19.600   -13.187 20.406   1.00 90.07  ? 213  ILE A CD1   1 
ATOM   3054  N  N     . GLU B  2  213 ? 23.415   -8.245  20.822   1.00 71.65  ? 214  GLU A N     1 
ATOM   3055  C  CA    . GLU B  2  213 ? 24.796   -7.677  20.884   1.00 67.36  ? 214  GLU A CA    1 
ATOM   3056  C  C     . GLU B  2  213 ? 25.727   -8.604  21.674   1.00 54.78  ? 214  GLU A C     1 
ATOM   3057  O  O     . GLU B  2  213 ? 26.893   -8.794  21.279   1.00 47.10  ? 214  GLU A O     1 
ATOM   3058  C  CB    . GLU B  2  213 ? 24.803   -6.303  21.552   1.00 85.22  ? 214  GLU A CB    1 
ATOM   3059  C  CG    . GLU B  2  213 ? 24.335   -5.146  20.681   1.00 105.25 ? 214  GLU A CG    1 
ATOM   3060  C  CD    . GLU B  2  213 ? 24.379   -3.799  21.389   1.00 115.76 ? 214  GLU A CD    1 
ATOM   3061  O  OE1   . GLU B  2  213 ? 25.481   -3.375  21.792   1.00 130.60 ? 214  GLU A OE1   1 
ATOM   3062  O  OE2   . GLU B  2  213 ? 23.308   -3.182  21.578   1.00 115.48 ? 214  GLU A OE2   1 
ATOM   3063  N  N     . GLY B  2  214 ? 25.218   -9.151  22.781   1.00 50.18  ? 215  GLY A N     1 
ATOM   3064  C  CA    . GLY B  2  214 ? 25.959   -9.980  23.746   1.00 47.03  ? 215  GLY A CA    1 
ATOM   3065  C  C     . GLY B  2  214 ? 25.173   -10.134 25.044   1.00 47.99  ? 215  GLY A C     1 
ATOM   3066  O  O     . GLY B  2  214 ? 24.010   -9.741  25.132   1.00 53.98  ? 215  GLY A O     1 
ATOM   3067  N  N     . PRO B  2  215 ? 25.768   -10.733 26.094   1.00 49.36  ? 216  PRO A N     1 
ATOM   3068  C  CA    . PRO B  2  215 ? 25.122   -10.800 27.399   1.00 47.76  ? 216  PRO A CA    1 
ATOM   3069  C  C     . PRO B  2  215 ? 24.789   -9.399  27.906   1.00 47.45  ? 216  PRO A C     1 
ATOM   3070  O  O     . PRO B  2  215 ? 25.448   -8.448  27.506   1.00 39.11  ? 216  PRO A O     1 
ATOM   3071  C  CB    . PRO B  2  215 ? 26.159   -11.443 28.312   1.00 49.28  ? 216  PRO A CB    1 
ATOM   3072  C  CG    . PRO B  2  215 ? 27.100   -12.176 27.377   1.00 54.55  ? 216  PRO A CG    1 
ATOM   3073  C  CD    . PRO B  2  215 ? 27.080   -11.394 26.074   1.00 53.98  ? 216  PRO A CD    1 
ATOM   3074  N  N     . ASP B  2  216 ? 23.770   -9.329  28.767   1.00 52.20  ? 217  ASP A N     1 
ATOM   3075  C  CA    . ASP B  2  216 ? 23.371   -8.115  29.518   1.00 53.51  ? 217  ASP A CA    1 
ATOM   3076  C  C     . ASP B  2  216 ? 23.171   -8.528  30.974   1.00 55.72  ? 217  ASP A C     1 
ATOM   3077  O  O     . ASP B  2  216 ? 22.091   -9.084  31.297   1.00 56.93  ? 217  ASP A O     1 
ATOM   3078  C  CB    . ASP B  2  216 ? 22.099   -7.512  28.929   1.00 59.21  ? 217  ASP A CB    1 
ATOM   3079  C  CG    . ASP B  2  216 ? 21.700   -6.204  29.594   1.00 62.15  ? 217  ASP A CG    1 
ATOM   3080  O  OD1   . ASP B  2  216 ? 22.590   -5.600  30.233   1.00 63.61  ? 217  ASP A OD1   1 
ATOM   3081  O  OD2   . ASP B  2  216 ? 20.513   -5.804  29.464   1.00 69.00  ? 217  ASP A OD2   1 
ATOM   3082  N  N     . PHE B  2  217 ? 24.188   -8.305  31.813   1.00 57.64  ? 218  PHE A N     1 
ATOM   3083  C  CA    . PHE B  2  217 ? 24.174   -8.702  33.246   1.00 59.19  ? 218  PHE A CA    1 
ATOM   3084  C  C     . PHE B  2  217 ? 23.291   -7.733  34.029   1.00 54.29  ? 218  PHE A C     1 
ATOM   3085  O  O     . PHE B  2  217 ? 23.222   -6.545  33.713   1.00 45.50  ? 218  PHE A O     1 
ATOM   3086  C  CB    . PHE B  2  217 ? 25.598   -8.755  33.795   1.00 65.13  ? 218  PHE A CB    1 
ATOM   3087  C  CG    . PHE B  2  217 ? 26.509   -9.690  33.045   1.00 71.07  ? 218  PHE A CG    1 
ATOM   3088  C  CD1   . PHE B  2  217 ? 26.364   -11.066 33.156   1.00 73.87  ? 218  PHE A CD1   1 
ATOM   3089  C  CD2   . PHE B  2  217 ? 27.503   -9.198  32.217   1.00 72.37  ? 218  PHE A CD2   1 
ATOM   3090  C  CE1   . PHE B  2  217 ? 27.197   -11.932 32.462   1.00 68.69  ? 218  PHE A CE1   1 
ATOM   3091  C  CE2   . PHE B  2  217 ? 28.345   -10.066 31.537   1.00 71.36  ? 218  PHE A CE2   1 
ATOM   3092  C  CZ    . PHE B  2  217 ? 28.184   -11.431 31.655   1.00 68.36  ? 218  PHE A CZ    1 
ATOM   3093  N  N     . PRO B  2  218 ? 22.599   -8.197  35.090   1.00 53.67  ? 219  PRO A N     1 
ATOM   3094  C  CA    . PRO B  2  218 ? 21.807   -7.299  35.931   1.00 53.51  ? 219  PRO A CA    1 
ATOM   3095  C  C     . PRO B  2  218 ? 22.682   -6.229  36.603   1.00 48.37  ? 219  PRO A C     1 
ATOM   3096  O  O     . PRO B  2  218 ? 22.208   -5.138  36.796   1.00 48.10  ? 219  PRO A O     1 
ATOM   3097  C  CB    . PRO B  2  218 ? 21.167   -8.206  37.000   1.00 49.78  ? 219  PRO A CB    1 
ATOM   3098  C  CG    . PRO B  2  218 ? 22.082   -9.419  37.007   1.00 50.55  ? 219  PRO A CG    1 
ATOM   3099  C  CD    . PRO B  2  218 ? 22.564   -9.577  35.571   1.00 51.43  ? 219  PRO A CD    1 
ATOM   3100  N  N     . THR B  2  219 ? 23.928   -6.580  36.918   1.00 46.56  ? 220  THR A N     1 
ATOM   3101  C  CA    . THR B  2  219 ? 24.904   -5.730  37.640   1.00 51.22  ? 220  THR A CA    1 
ATOM   3102  C  C     . THR B  2  219 ? 25.558   -4.707  36.705   1.00 51.91  ? 220  THR A C     1 
ATOM   3103  O  O     . THR B  2  219 ? 26.397   -3.908  37.203   1.00 59.17  ? 220  THR A O     1 
ATOM   3104  C  CB    . THR B  2  219 ? 25.966   -6.613  38.303   1.00 54.37  ? 220  THR A CB    1 
ATOM   3105  O  OG1   . THR B  2  219 ? 26.521   -7.451  37.293   1.00 49.78  ? 220  THR A OG1   1 
ATOM   3106  C  CG2   . THR B  2  219 ? 25.403   -7.463  39.419   1.00 55.13  ? 220  THR A CG2   1 
ATOM   3107  N  N     . ALA B  2  220 ? 25.235   -4.753  35.409   1.00 51.37  ? 221  ALA A N     1 
ATOM   3108  C  CA    . ALA B  2  220 ? 25.783   -3.853  34.361   1.00 48.11  ? 221  ALA A CA    1 
ATOM   3109  C  C     . ALA B  2  220 ? 27.281   -4.146  34.163   1.00 47.63  ? 221  ALA A C     1 
ATOM   3110  O  O     . ALA B  2  220 ? 27.629   -5.337  33.919   1.00 53.61  ? 221  ALA A O     1 
ATOM   3111  C  CB    . ALA B  2  220 ? 25.529   -2.402  34.730   1.00 45.50  ? 221  ALA A CB    1 
ATOM   3112  N  N     . GLY B  2  221 ? 28.144   -3.135  34.272   1.00 45.56  ? 222  GLY A N     1 
ATOM   3113  C  CA    . GLY B  2  221 ? 29.599   -3.270  34.041   1.00 49.25  ? 222  GLY A CA    1 
ATOM   3114  C  C     . GLY B  2  221 ? 29.920   -3.268  32.561   1.00 54.25  ? 222  GLY A C     1 
ATOM   3115  O  O     . GLY B  2  221 ? 29.076   -2.751  31.774   1.00 52.25  ? 222  GLY A O     1 
ATOM   3116  N  N     . LEU B  2  222 ? 31.086   -3.815  32.199   1.00 56.86  ? 223  LEU A N     1 
ATOM   3117  C  CA    . LEU B  2  222 ? 31.648   -3.764  30.825   1.00 57.18  ? 223  LEU A CA    1 
ATOM   3118  C  C     . LEU B  2  222 ? 32.044   -5.165  30.382   1.00 56.99  ? 223  LEU A C     1 
ATOM   3119  O  O     . LEU B  2  222 ? 32.534   -5.939  31.232   1.00 51.69  ? 223  LEU A O     1 
ATOM   3120  C  CB    . LEU B  2  222 ? 32.903   -2.881  30.808   1.00 60.54  ? 223  LEU A CB    1 
ATOM   3121  C  CG    . LEU B  2  222 ? 32.683   -1.377  30.775   1.00 66.90  ? 223  LEU A CG    1 
ATOM   3122  C  CD1   . LEU B  2  222 ? 32.417   -0.847  32.177   1.00 64.10  ? 223  LEU A CD1   1 
ATOM   3123  C  CD2   . LEU B  2  222 ? 33.897   -0.701  30.123   1.00 71.18  ? 223  LEU A CD2   1 
ATOM   3124  N  N     . ILE B  2  223 ? 31.905   -5.430  29.083   1.00 65.27  ? 224  ILE A N     1 
ATOM   3125  C  CA    . ILE B  2  223 ? 32.489   -6.629  28.419   1.00 68.46  ? 224  ILE A CA    1 
ATOM   3126  C  C     . ILE B  2  223 ? 33.560   -6.140  27.448   1.00 68.51  ? 224  ILE A C     1 
ATOM   3127  O  O     . ILE B  2  223 ? 33.255   -5.233  26.647   1.00 66.19  ? 224  ILE A O     1 
ATOM   3128  C  CB    . ILE B  2  223 ? 31.387   -7.458  27.730   1.00 74.46  ? 224  ILE A CB    1 
ATOM   3129  C  CG1   . ILE B  2  223 ? 30.478   -8.136  28.766   1.00 77.55  ? 224  ILE A CG1   1 
ATOM   3130  C  CG2   . ILE B  2  223 ? 31.993   -8.458  26.766   1.00 74.95  ? 224  ILE A CG2   1 
ATOM   3131  C  CD1   . ILE B  2  223 ? 29.219   -8.712  28.203   1.00 77.45  ? 224  ILE A CD1   1 
ATOM   3132  N  N     . LEU B  2  224 ? 34.759   -6.706  27.544   1.00 66.60  ? 225  LEU A N     1 
ATOM   3133  C  CA    . LEU B  2  224 ? 35.925   -6.373  26.682   1.00 61.73  ? 225  LEU A CA    1 
ATOM   3134  C  C     . LEU B  2  224 ? 35.822   -7.234  25.419   1.00 60.09  ? 225  LEU A C     1 
ATOM   3135  O  O     . LEU B  2  224 ? 36.134   -8.451  25.488   1.00 55.18  ? 225  LEU A O     1 
ATOM   3136  C  CB    . LEU B  2  224 ? 37.232   -6.685  27.424   1.00 56.38  ? 225  LEU A CB    1 
ATOM   3137  C  CG    . LEU B  2  224 ? 37.483   -5.983  28.749   1.00 53.22  ? 225  LEU A CG    1 
ATOM   3138  C  CD1   . LEU B  2  224 ? 38.722   -6.545  29.453   1.00 54.86  ? 225  LEU A CD1   1 
ATOM   3139  C  CD2   . LEU B  2  224 ? 37.603   -4.494  28.554   1.00 50.73  ? 225  LEU A CD2   1 
ATOM   3140  N  N     . GLY B  2  225 ? 35.347   -6.648  24.321   1.00 61.06  ? 226  GLY A N     1 
ATOM   3141  C  CA    . GLY B  2  225 ? 35.483   -7.236  22.977   1.00 63.78  ? 226  GLY A CA    1 
ATOM   3142  C  C     . GLY B  2  225 ? 34.336   -8.161  22.627   1.00 65.43  ? 226  GLY A C     1 
ATOM   3143  O  O     . GLY B  2  225 ? 33.551   -8.525  23.527   1.00 66.55  ? 226  GLY A O     1 
ATOM   3144  N  N     . LYS B  2  226 ? 34.243   -8.513  21.347   1.00 65.24  ? 227  LYS A N     1 
ATOM   3145  C  CA    . LYS B  2  226 ? 33.147   -9.347  20.793   1.00 63.87  ? 227  LYS A CA    1 
ATOM   3146  C  C     . LYS B  2  226 ? 33.679   -10.761 20.491   1.00 64.97  ? 227  LYS A C     1 
ATOM   3147  O  O     . LYS B  2  226 ? 32.865   -11.616 20.139   1.00 61.34  ? 227  LYS A O     1 
ATOM   3148  C  CB    . LYS B  2  226 ? 32.539   -8.620  19.590   1.00 62.06  ? 227  LYS A CB    1 
ATOM   3149  C  CG    . LYS B  2  226 ? 31.898   -7.274  19.921   1.00 66.56  ? 227  LYS A CG    1 
ATOM   3150  C  CD    . LYS B  2  226 ? 31.322   -6.499  18.764   1.00 72.07  ? 227  LYS A CD    1 
ATOM   3151  C  CE    . LYS B  2  226 ? 29.987   -7.027  18.263   1.00 75.27  ? 227  LYS A CE    1 
ATOM   3152  N  NZ    . LYS B  2  226 ? 28.864   -6.796  19.207   1.00 73.31  ? 227  LYS A NZ    1 
ATOM   3153  N  N     . SER B  2  227 ? 34.973   -11.021 20.668   1.00 74.57  ? 228  SER A N     1 
ATOM   3154  C  CA    . SER B  2  227 ? 35.654   -12.305 20.334   1.00 86.09  ? 228  SER A CA    1 
ATOM   3155  C  C     . SER B  2  227 ? 35.061   -13.436 21.173   1.00 96.12  ? 228  SER A C     1 
ATOM   3156  O  O     . SER B  2  227 ? 34.603   -14.437 20.587   1.00 103.26 ? 228  SER A O     1 
ATOM   3157  C  CB    . SER B  2  227 ? 37.149   -12.285 20.579   1.00 94.17  ? 228  SER A CB    1 
ATOM   3158  O  OG    . SER B  2  227 ? 37.786   -11.071 20.228   1.00 106.81 ? 228  SER A OG    1 
ATOM   3159  N  N     . GLY B  2  228 ? 35.114   -13.301 22.502   1.00 103.99 ? 229  GLY A N     1 
ATOM   3160  C  CA    . GLY B  2  228 ? 34.572   -14.295 23.442   1.00 98.57  ? 229  GLY A CA    1 
ATOM   3161  C  C     . GLY B  2  228 ? 33.094   -14.526 23.195   1.00 99.81  ? 229  GLY A C     1 
ATOM   3162  O  O     . GLY B  2  228 ? 32.686   -15.701 23.091   1.00 100.75 ? 229  GLY A O     1 
ATOM   3163  N  N     . ILE B  2  229 ? 32.325   -13.438 23.090   1.00 97.98  ? 230  ILE A N     1 
ATOM   3164  C  CA    . ILE B  2  229 ? 30.850   -13.478 22.891   1.00 101.90 ? 230  ILE A CA    1 
ATOM   3165  C  C     . ILE B  2  229 ? 30.551   -14.305 21.637   1.00 98.20  ? 230  ILE A C     1 
ATOM   3166  O  O     . ILE B  2  229 ? 29.690   -15.216 21.710   1.00 98.25  ? 230  ILE A O     1 
ATOM   3167  C  CB    . ILE B  2  229 ? 30.279   -12.048 22.809   1.00 106.45 ? 230  ILE A CB    1 
ATOM   3168  C  CG1   . ILE B  2  229 ? 30.473   -11.302 24.133   1.00 106.88 ? 230  ILE A CG1   1 
ATOM   3169  C  CG2   . ILE B  2  229 ? 28.813   -12.058 22.372   1.00 106.21 ? 230  ILE A CG2   1 
ATOM   3170  C  CD1   . ILE B  2  229 ? 30.055   -9.837  24.066   1.00 109.77 ? 230  ILE A CD1   1 
ATOM   3171  N  N     . ARG B  2  230 ? 31.243   -13.992 20.537   1.00 96.79  ? 231  ARG A N     1 
ATOM   3172  C  CA    . ARG B  2  230 ? 31.049   -14.615 19.201   1.00 94.16  ? 231  ARG A CA    1 
ATOM   3173  C  C     . ARG B  2  230 ? 31.303   -16.118 19.312   1.00 81.50  ? 231  ARG A C     1 
ATOM   3174  O  O     . ARG B  2  230 ? 30.444   -16.894 18.873   1.00 74.77  ? 231  ARG A O     1 
ATOM   3175  C  CB    . ARG B  2  230 ? 31.984   -13.972 18.171   1.00 102.44 ? 231  ARG A CB    1 
ATOM   3176  C  CG    . ARG B  2  230 ? 31.865   -14.522 16.759   1.00 100.81 ? 231  ARG A CG    1 
ATOM   3177  C  CD    . ARG B  2  230 ? 30.518   -14.159 16.153   1.00 99.80  ? 231  ARG A CD    1 
ATOM   3178  N  NE    . ARG B  2  230 ? 30.291   -14.644 14.787   1.00 100.85 ? 231  ARG A NE    1 
ATOM   3179  C  CZ    . ARG B  2  230 ? 30.551   -13.964 13.669   1.00 97.11  ? 231  ARG A CZ    1 
ATOM   3180  N  NH1   . ARG B  2  230 ? 31.101   -12.760 13.726   1.00 101.86 ? 231  ARG A NH1   1 
ATOM   3181  N  NH2   . ARG B  2  230 ? 30.271   -14.507 12.501   1.00 93.08  ? 231  ARG A NH2   1 
ATOM   3182  N  N     A ARG B  2  231 ? 32.440   -16.499 19.899   0.50 80.76  ? 232  ARG A N     1 
ATOM   3183  N  N     B ARG B  2  231 ? 32.440   -16.499 19.899   0.50 77.99  ? 232  ARG A N     1 
ATOM   3184  C  CA    A ARG B  2  231 ? 32.876   -17.911 20.064   0.50 83.95  ? 232  ARG A CA    1 
ATOM   3185  C  CA    B ARG B  2  231 ? 32.876   -17.911 20.064   0.50 79.41  ? 232  ARG A CA    1 
ATOM   3186  C  C     A ARG B  2  231 ? 31.814   -18.678 20.867   0.50 83.03  ? 232  ARG A C     1 
ATOM   3187  C  C     B ARG B  2  231 ? 31.814   -18.678 20.867   0.50 80.39  ? 232  ARG A C     1 
ATOM   3188  O  O     A ARG B  2  231 ? 31.499   -19.827 20.498   0.50 90.91  ? 232  ARG A O     1 
ATOM   3189  O  O     B ARG B  2  231 ? 31.499   -19.827 20.498   0.50 88.26  ? 232  ARG A O     1 
ATOM   3190  C  CB    A ARG B  2  231 ? 34.255   -17.944 20.735   0.50 84.36  ? 232  ARG A CB    1 
ATOM   3191  C  CB    B ARG B  2  231 ? 34.255   -17.945 20.737   0.50 76.47  ? 232  ARG A CB    1 
ATOM   3192  C  CG    A ARG B  2  231 ? 34.931   -19.309 20.706   0.50 82.99  ? 232  ARG A CG    1 
ATOM   3193  C  CG    B ARG B  2  231 ? 34.937   -19.308 20.712   0.50 72.38  ? 232  ARG A CG    1 
ATOM   3194  C  CD    A ARG B  2  231 ? 36.445   -19.275 20.810   0.50 83.56  ? 232  ARG A CD    1 
ATOM   3195  C  CD    B ARG B  2  231 ? 36.339   -19.309 21.305   0.50 70.39  ? 232  ARG A CD    1 
ATOM   3196  N  NE    A ARG B  2  231 ? 36.963   -18.274 21.734   0.50 81.55  ? 232  ARG A NE    1 
ATOM   3197  N  NE    B ARG B  2  231 ? 36.849   -20.650 21.581   0.50 65.32  ? 232  ARG A NE    1 
ATOM   3198  C  CZ    A ARG B  2  231 ? 37.448   -17.096 21.362   0.50 77.39  ? 232  ARG A CZ    1 
ATOM   3199  C  CZ    B ARG B  2  231 ? 38.137   -20.961 21.700   0.50 61.90  ? 232  ARG A CZ    1 
ATOM   3200  N  NH1   A ARG B  2  231 ? 37.911   -16.255 22.270   0.50 77.47  ? 232  ARG A NH1   1 
ATOM   3201  N  NH1   B ARG B  2  231 ? 38.492   -22.207 21.958   0.50 59.86  ? 232  ARG A NH1   1 
ATOM   3202  N  NH2   A ARG B  2  231 ? 37.470   -16.765 20.083   0.50 74.78  ? 232  ARG A NH2   1 
ATOM   3203  N  NH2   B ARG B  2  231 ? 39.067   -20.035 21.548   0.50 61.99  ? 232  ARG A NH2   1 
ATOM   3204  N  N     . ALA B  2  232 ? 31.270   -18.044 21.913   1.00 77.85  ? 233  ALA A N     1 
ATOM   3205  C  CA    . ALA B  2  232 ? 30.265   -18.634 22.820   1.00 75.32  ? 233  ALA A CA    1 
ATOM   3206  C  C     . ALA B  2  232 ? 28.943   -18.845 22.078   1.00 81.00  ? 233  ALA A C     1 
ATOM   3207  O  O     . ALA B  2  232 ? 28.315   -19.895 22.293   1.00 92.64  ? 233  ALA A O     1 
ATOM   3208  C  CB    . ALA B  2  232 ? 30.098   -17.732 24.014   1.00 72.52  ? 233  ALA A CB    1 
ATOM   3209  N  N     . TYR B  2  233 ? 28.533   -17.886 21.241   1.00 83.38  ? 234  TYR A N     1 
ATOM   3210  C  CA    . TYR B  2  233 ? 27.260   -17.942 20.473   1.00 85.83  ? 234  TYR A CA    1 
ATOM   3211  C  C     . TYR B  2  233 ? 27.413   -18.886 19.275   1.00 85.03  ? 234  TYR A C     1 
ATOM   3212  O  O     . TYR B  2  233 ? 26.391   -19.399 18.795   1.00 86.26  ? 234  TYR A O     1 
ATOM   3213  C  CB    . TYR B  2  233 ? 26.841   -16.542 20.014   1.00 92.82  ? 234  TYR A CB    1 
ATOM   3214  C  CG    . TYR B  2  233 ? 26.348   -15.607 21.086   1.00 93.14  ? 234  TYR A CG    1 
ATOM   3215  C  CD1   . TYR B  2  233 ? 26.038   -16.057 22.358   1.00 89.82  ? 234  TYR A CD1   1 
ATOM   3216  C  CD2   . TYR B  2  233 ? 26.151   -14.260 20.806   1.00 99.32  ? 234  TYR A CD2   1 
ATOM   3217  C  CE1   . TYR B  2  233 ? 25.562   -15.191 23.335   1.00 91.99  ? 234  TYR A CE1   1 
ATOM   3218  C  CE2   . TYR B  2  233 ? 25.672   -13.383 21.773   1.00 103.82 ? 234  TYR A CE2   1 
ATOM   3219  C  CZ    . TYR B  2  233 ? 25.378   -13.850 23.044   1.00 96.79  ? 234  TYR A CZ    1 
ATOM   3220  O  OH    . TYR B  2  233 ? 24.904   -13.006 24.004   1.00 82.18  ? 234  TYR A OH    1 
ATOM   3221  N  N     . GLU B  2  234 ? 28.641   -19.071 18.780   1.00 87.13  ? 235  GLU A N     1 
ATOM   3222  C  CA    . GLU B  2  234 ? 28.939   -19.946 17.616   1.00 89.76  ? 235  GLU A CA    1 
ATOM   3223  C  C     . GLU B  2  234 ? 28.872   -21.406 18.066   1.00 78.14  ? 235  GLU A C     1 
ATOM   3224  O  O     . GLU B  2  234 ? 28.234   -22.194 17.366   1.00 78.64  ? 235  GLU A O     1 
ATOM   3225  C  CB    . GLU B  2  234 ? 30.332   -19.663 17.042   1.00 100.15 ? 235  GLU A CB    1 
ATOM   3226  C  CG    . GLU B  2  234 ? 30.448   -18.380 16.239   1.00 101.54 ? 235  GLU A CG    1 
ATOM   3227  C  CD    . GLU B  2  234 ? 29.736   -18.385 14.905   1.00 98.96  ? 235  GLU A CD    1 
ATOM   3228  O  OE1   . GLU B  2  234 ? 29.342   -19.478 14.431   1.00 98.94  ? 235  GLU A OE1   1 
ATOM   3229  O  OE2   . GLU B  2  234 ? 29.547   -17.279 14.344   1.00 99.22  ? 235  GLU A OE2   1 
ATOM   3230  N  N     . THR B  2  235 ? 29.510   -21.725 19.196   1.00 73.19  ? 236  THR A N     1 
ATOM   3231  C  CA    . THR B  2  235 ? 29.920   -23.101 19.584   1.00 76.56  ? 236  THR A CA    1 
ATOM   3232  C  C     . THR B  2  235 ? 29.287   -23.536 20.911   1.00 87.04  ? 236  THR A C     1 
ATOM   3233  O  O     . THR B  2  235 ? 29.309   -24.754 21.189   1.00 97.51  ? 236  THR A O     1 
ATOM   3234  C  CB    . THR B  2  235 ? 31.442   -23.194 19.732   1.00 71.52  ? 236  THR A CB    1 
ATOM   3235  O  OG1   . THR B  2  235 ? 31.800   -22.568 20.966   1.00 77.89  ? 236  THR A OG1   1 
ATOM   3236  C  CG2   . THR B  2  235 ? 32.192   -22.548 18.588   1.00 65.09  ? 236  THR A CG2   1 
ATOM   3237  N  N     . GLY B  2  236 ? 28.803   -22.591 21.724   1.00 96.71  ? 237  GLY A N     1 
ATOM   3238  C  CA    . GLY B  2  236 ? 28.237   -22.889 23.053   1.00 99.20  ? 237  GLY A CA    1 
ATOM   3239  C  C     . GLY B  2  236 ? 29.286   -22.788 24.144   1.00 106.04 ? 237  GLY A C     1 
ATOM   3240  O  O     . GLY B  2  236 ? 28.910   -22.874 25.335   1.00 108.60 ? 237  GLY A O     1 
ATOM   3241  N  N     . ARG B  2  237 ? 30.553   -22.614 23.755   1.00 104.09 ? 238  ARG A N     1 
ATOM   3242  C  CA    . ARG B  2  237 ? 31.681   -22.443 24.698   1.00 104.14 ? 238  ARG A CA    1 
ATOM   3243  C  C     . ARG B  2  237 ? 32.509   -21.231 24.271   1.00 102.59 ? 238  ARG A C     1 
ATOM   3244  O  O     . ARG B  2  237 ? 32.781   -21.069 23.065   1.00 104.33 ? 238  ARG A O     1 
ATOM   3245  C  CB    . ARG B  2  237 ? 32.495   -23.727 24.770   1.00 97.53  ? 238  ARG A CB    1 
ATOM   3246  C  CG    . ARG B  2  237 ? 31.757   -24.847 25.495   1.00 102.73 ? 238  ARG A CG    1 
ATOM   3247  C  CD    . ARG B  2  237 ? 32.549   -26.116 25.721   1.00 104.91 ? 238  ARG A CD    1 
ATOM   3248  N  NE    . ARG B  2  237 ? 33.952   -25.959 26.106   1.00 107.82 ? 238  ARG A NE    1 
ATOM   3249  C  CZ    . ARG B  2  237 ? 34.400   -25.655 27.324   1.00 108.28 ? 238  ARG A CZ    1 
ATOM   3250  N  NH1   . ARG B  2  237 ? 33.565   -25.426 28.321   1.00 109.00 ? 238  ARG A NH1   1 
ATOM   3251  N  NH2   . ARG B  2  237 ? 35.701   -25.532 27.522   1.00 108.80 ? 238  ARG A NH2   1 
ATOM   3252  N  N     . GLY B  2  238 ? 32.861   -20.395 25.245   1.00 107.74 ? 239  GLY A N     1 
ATOM   3253  C  CA    . GLY B  2  238 ? 33.674   -19.181 25.052   1.00 106.99 ? 239  GLY A CA    1 
ATOM   3254  C  C     . GLY B  2  238 ? 33.920   -18.516 26.384   1.00 103.98 ? 239  GLY A C     1 
ATOM   3255  O  O     . GLY B  2  238 ? 33.078   -18.662 27.293   1.00 108.48 ? 239  GLY A O     1 
ATOM   3256  N  N     . SER B  2  239 ? 35.050   -17.836 26.523   1.00 96.48  ? 240  SER A N     1 
ATOM   3257  C  CA    . SER B  2  239 ? 35.330   -16.999 27.712   1.00 94.17  ? 240  SER A CA    1 
ATOM   3258  C  C     . SER B  2  239 ? 34.992   -15.548 27.366   1.00 98.40  ? 240  SER A C     1 
ATOM   3259  O  O     . SER B  2  239 ? 35.415   -15.082 26.304   1.00 103.75 ? 240  SER A O     1 
ATOM   3260  C  CB    . SER B  2  239 ? 36.736   -17.161 28.172   1.00 87.30  ? 240  SER A CB    1 
ATOM   3261  O  OG    . SER B  2  239 ? 36.966   -16.310 29.268   1.00 97.29  ? 240  SER A OG    1 
ATOM   3262  N  N     . ILE B  2  240 ? 34.227   -14.892 28.233   1.00 96.05  ? 241  ILE A N     1 
ATOM   3263  C  CA    . ILE B  2  240 ? 33.788   -13.474 28.107   1.00 90.09  ? 241  ILE A CA    1 
ATOM   3264  C  C     . ILE B  2  240 ? 34.432   -12.707 29.261   1.00 90.21  ? 241  ILE A C     1 
ATOM   3265  O  O     . ILE B  2  240 ? 34.222   -13.117 30.413   1.00 104.63 ? 241  ILE A O     1 
ATOM   3266  C  CB    . ILE B  2  240 ? 32.253   -13.394 28.120   1.00 88.70  ? 241  ILE A CB    1 
ATOM   3267  C  CG1   . ILE B  2  240 ? 31.675   -14.077 26.880   1.00 93.19  ? 241  ILE A CG1   1 
ATOM   3268  C  CG2   . ILE B  2  240 ? 31.775   -11.949 28.281   1.00 81.97  ? 241  ILE A CG2   1 
ATOM   3269  C  CD1   . ILE B  2  240 ? 30.151   -14.133 26.839   1.00 93.14  ? 241  ILE A CD1   1 
ATOM   3270  N  N     . GLN B  2  241 ? 35.229   -11.676 28.956   1.00 82.45  ? 242  GLN A N     1 
ATOM   3271  C  CA    . GLN B  2  241 ? 35.946   -10.877 29.983   1.00 77.56  ? 242  GLN A CA    1 
ATOM   3272  C  C     . GLN B  2  241 ? 35.011   -9.767  30.469   1.00 77.97  ? 242  GLN A C     1 
ATOM   3273  O  O     . GLN B  2  241 ? 34.699   -8.866  29.663   1.00 74.84  ? 242  GLN A O     1 
ATOM   3274  C  CB    . GLN B  2  241 ? 37.245   -10.299 29.426   1.00 75.63  ? 242  GLN A CB    1 
ATOM   3275  C  CG    . GLN B  2  241 ? 38.331   -11.346 29.187   1.00 82.60  ? 242  GLN A CG    1 
ATOM   3276  C  CD    . GLN B  2  241 ? 38.625   -12.177 30.414   1.00 85.39  ? 242  GLN A CD    1 
ATOM   3277  O  OE1   . GLN B  2  241 ? 38.743   -11.656 31.516   1.00 99.49  ? 242  GLN A OE1   1 
ATOM   3278  N  NE2   . GLN B  2  241 ? 38.738   -13.475 30.238   1.00 74.42  ? 242  GLN A NE2   1 
ATOM   3279  N  N     . MET B  2  242 ? 34.582   -9.836  31.735   1.00 72.18  ? 243  MET A N     1 
ATOM   3280  C  CA    . MET B  2  242 ? 33.739   -8.798  32.386   1.00 62.46  ? 243  MET A CA    1 
ATOM   3281  C  C     . MET B  2  242 ? 34.653   -7.842  33.149   1.00 58.47  ? 243  MET A C     1 
ATOM   3282  O  O     . MET B  2  242 ? 35.654   -8.310  33.701   1.00 60.48  ? 243  MET A O     1 
ATOM   3283  C  CB    . MET B  2  242 ? 32.757   -9.413  33.382   1.00 63.14  ? 243  MET A CB    1 
ATOM   3284  C  CG    . MET B  2  242 ? 31.837   -10.444 32.770   1.00 65.14  ? 243  MET A CG    1 
ATOM   3285  S  SD    . MET B  2  242 ? 30.757   -11.156 34.043   1.00 68.07  ? 243  MET A SD    1 
ATOM   3286  C  CE    . MET B  2  242 ? 31.968   -12.020 35.039   1.00 68.78  ? 243  MET A CE    1 
ATOM   3287  N  N     . ARG B  2  243 ? 34.305   -6.560  33.214   1.00 55.54  ? 244  ARG A N     1 
ATOM   3288  C  CA    . ARG B  2  243 ? 35.152   -5.564  33.917   1.00 58.85  ? 244  ARG A CA    1 
ATOM   3289  C  C     . ARG B  2  243 ? 34.270   -4.565  34.663   1.00 57.76  ? 244  ARG A C     1 
ATOM   3290  O  O     . ARG B  2  243 ? 33.293   -4.084  34.057   1.00 53.86  ? 244  ARG A O     1 
ATOM   3291  C  CB    . ARG B  2  243 ? 36.063   -4.857  32.915   1.00 60.62  ? 244  ARG A CB    1 
ATOM   3292  C  CG    . ARG B  2  243 ? 37.313   -4.274  33.564   1.00 65.63  ? 244  ARG A CG    1 
ATOM   3293  C  CD    . ARG B  2  243 ? 38.203   -3.603  32.530   1.00 71.55  ? 244  ARG A CD    1 
ATOM   3294  N  NE    . ARG B  2  243 ? 39.449   -4.294  32.294   1.00 72.67  ? 244  ARG A NE    1 
ATOM   3295  C  CZ    . ARG B  2  243 ? 40.387   -3.865  31.459   1.00 80.70  ? 244  ARG A CZ    1 
ATOM   3296  N  NH1   . ARG B  2  243 ? 40.238   -2.712  30.824   1.00 90.38  ? 244  ARG A NH1   1 
ATOM   3297  N  NH2   . ARG B  2  243 ? 41.500   -4.559  31.297   1.00 76.75  ? 244  ARG A NH2   1 
ATOM   3298  N  N     . SER B  2  244 ? 34.617   -4.286  35.927   1.00 59.83  ? 245  SER A N     1 
ATOM   3299  C  CA    . SER B  2  244 ? 34.045   -3.189  36.757   1.00 56.97  ? 245  SER A CA    1 
ATOM   3300  C  C     . SER B  2  244 ? 34.062   -1.880  35.971   1.00 56.06  ? 245  SER A C     1 
ATOM   3301  O  O     . SER B  2  244 ? 35.066   -1.622  35.252   1.00 57.15  ? 245  SER A O     1 
ATOM   3302  C  CB    . SER B  2  244 ? 34.821   -2.991  38.024   1.00 55.16  ? 245  SER A CB    1 
ATOM   3303  O  OG    . SER B  2  244 ? 34.721   -4.123  38.877   1.00 56.53  ? 245  SER A OG    1 
ATOM   3304  N  N     . ARG B  2  245 ? 33.019   -1.058  36.136   1.00 53.98  ? 246  ARG A N     1 
ATOM   3305  C  CA    . ARG B  2  245 ? 33.014   0.341   35.629   1.00 47.54  ? 246  ARG A CA    1 
ATOM   3306  C  C     . ARG B  2  245 ? 33.742   1.194   36.667   1.00 40.94  ? 246  ARG A C     1 
ATOM   3307  O  O     . ARG B  2  245 ? 33.178   1.397   37.763   1.00 40.27  ? 246  ARG A O     1 
ATOM   3308  C  CB    . ARG B  2  245 ? 31.593   0.854   35.364   1.00 46.72  ? 246  ARG A CB    1 
ATOM   3309  C  CG    . ARG B  2  245 ? 31.572   2.234   34.720   1.00 50.08  ? 246  ARG A CG    1 
ATOM   3310  C  CD    . ARG B  2  245 ? 30.186   2.653   34.266   1.00 52.32  ? 246  ARG A CD    1 
ATOM   3311  N  NE    . ARG B  2  245 ? 29.761   1.877   33.119   1.00 56.44  ? 246  ARG A NE    1 
ATOM   3312  C  CZ    . ARG B  2  245 ? 30.244   2.018   31.891   1.00 53.99  ? 246  ARG A CZ    1 
ATOM   3313  N  NH1   . ARG B  2  245 ? 31.182   2.911   31.639   1.00 55.97  ? 246  ARG A NH1   1 
ATOM   3314  N  NH2   . ARG B  2  245 ? 29.800   1.258   30.914   1.00 50.49  ? 246  ARG A NH2   1 
ATOM   3315  N  N     . ALA B  2  246 ? 34.965   1.600   36.343   1.00 34.31  ? 247  ALA A N     1 
ATOM   3316  C  CA    . ALA B  2  246 ? 35.871   2.349   37.243   1.00 36.02  ? 247  ALA A CA    1 
ATOM   3317  C  C     . ALA B  2  246 ? 36.383   3.566   36.497   1.00 36.31  ? 247  ALA A C     1 
ATOM   3318  O  O     . ALA B  2  246 ? 36.623   3.461   35.267   1.00 40.82  ? 247  ALA A O     1 
ATOM   3319  C  CB    . ALA B  2  246 ? 37.032   1.515   37.737   1.00 37.29  ? 247  ALA A CB    1 
ATOM   3320  N  N     . VAL B  2  247 ? 36.507   4.692   37.210   1.00 34.42  ? 248  VAL A N     1 
ATOM   3321  C  CA    . VAL B  2  247 ? 37.113   5.940   36.676   1.00 35.82  ? 248  VAL A CA    1 
ATOM   3322  C  C     . VAL B  2  247 ? 38.179   6.410   37.663   1.00 37.32  ? 248  VAL A C     1 
ATOM   3323  O  O     . VAL B  2  247 ? 38.130   5.999   38.847   1.00 41.44  ? 248  VAL A O     1 
ATOM   3324  C  CB    . VAL B  2  247 ? 36.044   7.016   36.429   1.00 35.38  ? 248  VAL A CB    1 
ATOM   3325  C  CG1   . VAL B  2  247 ? 34.902   6.486   35.578   1.00 34.32  ? 248  VAL A CG1   1 
ATOM   3326  C  CG2   . VAL B  2  247 ? 35.489   7.583   37.724   1.00 38.66  ? 248  VAL A CG2   1 
ATOM   3327  N  N     . ILE B  2  248 ? 39.086   7.256   37.177   1.00 36.41  ? 249  ILE A N     1 
ATOM   3328  C  CA    . ILE B  2  248 ? 40.085   7.997   37.991   1.00 37.85  ? 249  ILE A CA    1 
ATOM   3329  C  C     . ILE B  2  248 ? 39.626   9.456   38.078   1.00 35.82  ? 249  ILE A C     1 
ATOM   3330  O  O     . ILE B  2  248 ? 39.289   10.028  37.020   1.00 34.84  ? 249  ILE A O     1 
ATOM   3331  C  CB    . ILE B  2  248 ? 41.475   7.843   37.354   1.00 43.62  ? 249  ILE A CB    1 
ATOM   3332  C  CG1   . ILE B  2  248 ? 41.852   6.361   37.216   1.00 47.22  ? 249  ILE A CG1   1 
ATOM   3333  C  CG2   . ILE B  2  248 ? 42.523   8.652   38.119   1.00 43.91  ? 249  ILE A CG2   1 
ATOM   3334  C  CD1   . ILE B  2  248 ? 42.790   6.073   36.055   1.00 48.51  ? 249  ILE A CD1   1 
ATOM   3335  N  N     . GLU B  2  249 ? 39.578   10.024  39.288   1.00 33.85  ? 250  GLU A N     1 
ATOM   3336  C  CA    . GLU B  2  249 ? 39.071   11.401  39.510   1.00 31.59  ? 250  GLU A CA    1 
ATOM   3337  C  C     . GLU B  2  249 ? 39.897   12.088  40.597   1.00 29.59  ? 250  GLU A C     1 
ATOM   3338  O  O     . GLU B  2  249 ? 40.404   11.378  41.464   1.00 26.98  ? 250  GLU A O     1 
ATOM   3339  C  CB    . GLU B  2  249 ? 37.563   11.357  39.785   1.00 33.86  ? 250  GLU A CB    1 
ATOM   3340  C  CG    . GLU B  2  249 ? 37.151   10.860  41.149   1.00 36.63  ? 250  GLU A CG    1 
ATOM   3341  C  CD    . GLU B  2  249 ? 35.634   10.898  41.394   1.00 41.78  ? 250  GLU A CD    1 
ATOM   3342  O  OE1   . GLU B  2  249 ? 34.875   10.686  40.403   1.00 37.54  ? 250  GLU A OE1   1 
ATOM   3343  O  OE2   . GLU B  2  249 ? 35.203   11.104  42.580   1.00 44.65  ? 250  GLU A OE2   1 
ATOM   3344  N  N     . GLU B  2  250 ? 40.067   13.417  40.480   1.00 32.14  ? 251  GLU A N     1 
ATOM   3345  C  CA    . GLU B  2  250 ? 40.641   14.364  41.489   1.00 30.37  ? 251  GLU A CA    1 
ATOM   3346  C  C     . GLU B  2  250 ? 39.868   14.224  42.809   1.00 32.13  ? 251  GLU A C     1 
ATOM   3347  O  O     . GLU B  2  250 ? 38.600   14.129  42.730   1.00 32.19  ? 251  GLU A O     1 
ATOM   3348  C  CB    . GLU B  2  250 ? 40.554   15.818  40.996   1.00 26.50  ? 251  GLU A CB    1 
ATOM   3349  N  N     . ARG B  2  251 ? 40.570   14.191  43.949   1.00 33.87  ? 252  ARG A N     1 
ATOM   3350  C  CA    . ARG B  2  251 ? 39.877   14.094  45.273   1.00 36.57  ? 252  ARG A CA    1 
ATOM   3351  C  C     . ARG B  2  251 ? 40.022   15.319  46.186   1.00 31.36  ? 252  ARG A C     1 
ATOM   3352  O  O     . ARG B  2  251 ? 40.900   16.158  45.983   1.00 26.55  ? 252  ARG A O     1 
ATOM   3353  C  CB    . ARG B  2  251 ? 40.269   12.799  45.986   1.00 43.26  ? 252  ARG A CB    1 
ATOM   3354  C  CG    . ARG B  2  251 ? 41.336   12.861  47.065   1.00 48.21  ? 252  ARG A CG    1 
ATOM   3355  C  CD    . ARG B  2  251 ? 41.523   11.428  47.573   1.00 47.84  ? 252  ARG A CD    1 
ATOM   3356  N  NE    . ARG B  2  251 ? 42.785   10.832  47.169   1.00 44.89  ? 252  ARG A NE    1 
ATOM   3357  C  CZ    . ARG B  2  251 ? 43.818   10.642  47.974   1.00 44.69  ? 252  ARG A CZ    1 
ATOM   3358  N  NH1   . ARG B  2  251 ? 43.796   11.012  49.238   1.00 48.69  ? 252  ARG A NH1   1 
ATOM   3359  N  NH2   . ARG B  2  251 ? 44.919   10.081  47.513   1.00 45.90  ? 252  ARG A NH2   1 
ATOM   3360  N  N     . GLY B  2  254 ? 45.326   17.794  45.459   1.00 52.87  ? 255  GLY A N     1 
ATOM   3361  C  CA    . GLY B  2  254 ? 45.766   17.484  44.077   1.00 57.59  ? 255  GLY A CA    1 
ATOM   3362  C  C     . GLY B  2  254 ? 46.088   15.999  43.885   1.00 60.21  ? 255  GLY A C     1 
ATOM   3363  O  O     . GLY B  2  254 ? 46.762   15.618  42.936   1.00 66.28  ? 255  GLY A O     1 
ATOM   3364  N  N     . ARG B  2  255 ? 45.612   15.157  44.802   1.00 57.35  ? 256  ARG A N     1 
ATOM   3365  C  CA    . ARG B  2  255 ? 45.721   13.683  44.804   1.00 54.51  ? 256  ARG A CA    1 
ATOM   3366  C  C     . ARG B  2  255 ? 44.491   13.129  44.067   1.00 51.92  ? 256  ARG A C     1 
ATOM   3367  O  O     . ARG B  2  255 ? 43.387   13.721  44.176   1.00 42.67  ? 256  ARG A O     1 
ATOM   3368  C  CB    . ARG B  2  255 ? 45.763   13.208  46.262   1.00 62.35  ? 256  ARG A CB    1 
ATOM   3369  C  CG    . ARG B  2  255 ? 47.160   12.943  46.819   1.00 69.04  ? 256  ARG A CG    1 
ATOM   3370  C  CD    . ARG B  2  255 ? 47.373   13.245  48.325   1.00 69.54  ? 256  ARG A CD    1 
ATOM   3371  N  NE    . ARG B  2  255 ? 47.159   12.135  49.277   1.00 70.67  ? 256  ARG A NE    1 
ATOM   3372  C  CZ    . ARG B  2  255 ? 48.103   11.299  49.750   1.00 63.72  ? 256  ARG A CZ    1 
ATOM   3373  N  NH1   . ARG B  2  255 ? 47.777   10.321  50.575   1.00 58.37  ? 256  ARG A NH1   1 
ATOM   3374  N  NH2   . ARG B  2  255 ? 49.355   11.417  49.364   1.00 65.07  ? 256  ARG A NH2   1 
ATOM   3375  N  N     . GLN B  2  256 ? 44.644   11.960  43.443   1.00 54.22  ? 257  GLN A N     1 
ATOM   3376  C  CA    . GLN B  2  256 ? 43.570   11.260  42.696   1.00 54.38  ? 257  GLN A CA    1 
ATOM   3377  C  C     . GLN B  2  256 ? 42.989   10.090  43.505   1.00 56.09  ? 257  GLN A C     1 
ATOM   3378  O  O     . GLN B  2  256 ? 43.448   9.841   44.628   1.00 57.28  ? 257  GLN A O     1 
ATOM   3379  C  CB    . GLN B  2  256 ? 44.130   10.729  41.388   1.00 51.70  ? 257  GLN A CB    1 
ATOM   3380  C  CG    . GLN B  2  256 ? 44.558   11.830  40.436   1.00 51.55  ? 257  GLN A CG    1 
ATOM   3381  C  CD    . GLN B  2  256 ? 45.286   11.277  39.236   1.00 48.61  ? 257  GLN A CD    1 
ATOM   3382  O  OE1   . GLN B  2  256 ? 46.108   10.370  39.345   1.00 49.86  ? 257  GLN A OE1   1 
ATOM   3383  N  NE2   . GLN B  2  256 ? 44.952   11.789  38.066   1.00 44.71  ? 257  GLN A NE2   1 
ATOM   3384  N  N     . ARG B  2  257 ? 41.965   9.441   42.952   1.00 49.09  ? 258  ARG A N     1 
ATOM   3385  C  CA    . ARG B  2  257 ? 41.359   8.191   43.479   1.00 43.35  ? 258  ARG A CA    1 
ATOM   3386  C  C     . ARG B  2  257 ? 40.653   7.438   42.347   1.00 44.15  ? 258  ARG A C     1 
ATOM   3387  O  O     . ARG B  2  257 ? 40.238   8.071   41.360   1.00 45.58  ? 258  ARG A O     1 
ATOM   3388  C  CB    . ARG B  2  257 ? 40.354   8.503   44.579   1.00 40.86  ? 258  ARG A CB    1 
ATOM   3389  C  CG    . ARG B  2  257 ? 39.070   9.138   44.076   1.00 42.37  ? 258  ARG A CG    1 
ATOM   3390  C  CD    . ARG B  2  257 ? 38.238   9.596   45.240   1.00 45.32  ? 258  ARG A CD    1 
ATOM   3391  N  NE    . ARG B  2  257 ? 37.178   10.525  44.866   1.00 40.69  ? 258  ARG A NE    1 
ATOM   3392  C  CZ    . ARG B  2  257 ? 36.492   11.246  45.731   1.00 37.89  ? 258  ARG A CZ    1 
ATOM   3393  N  NH1   . ARG B  2  257 ? 36.683   11.092  47.031   1.00 39.23  ? 258  ARG A NH1   1 
ATOM   3394  N  NH2   . ARG B  2  257 ? 35.566   12.078  45.304   1.00 37.70  ? 258  ARG A NH2   1 
ATOM   3395  N  N     . ILE B  2  258 ? 40.538   6.124   42.513   1.00 41.96  ? 259  ILE A N     1 
ATOM   3396  C  CA    . ILE B  2  258 ? 39.800   5.195   41.620   1.00 39.10  ? 259  ILE A CA    1 
ATOM   3397  C  C     . ILE B  2  258 ? 38.415   4.993   42.228   1.00 42.17  ? 259  ILE A C     1 
ATOM   3398  O  O     . ILE B  2  258 ? 38.357   4.637   43.415   1.00 44.35  ? 259  ILE A O     1 
ATOM   3399  C  CB    . ILE B  2  258 ? 40.584   3.875   41.495   1.00 37.62  ? 259  ILE A CB    1 
ATOM   3400  C  CG1   . ILE B  2  258 ? 41.943   4.110   40.834   1.00 39.65  ? 259  ILE A CG1   1 
ATOM   3401  C  CG2   . ILE B  2  258 ? 39.786   2.815   40.774   1.00 37.83  ? 259  ILE A CG2   1 
ATOM   3402  C  CD1   . ILE B  2  258 ? 42.909   2.968   40.989   1.00 40.25  ? 259  ILE A CD1   1 
ATOM   3403  N  N     . VAL B  2  259 ? 37.353   5.242   41.459   1.00 46.93  ? 260  VAL A N     1 
ATOM   3404  C  CA    . VAL B  2  259 ? 35.952   5.045   41.925   1.00 50.26  ? 260  VAL A CA    1 
ATOM   3405  C  C     . VAL B  2  259 ? 35.323   3.954   41.074   1.00 48.49  ? 260  VAL A C     1 
ATOM   3406  O  O     . VAL B  2  259 ? 35.319   4.112   39.844   1.00 56.43  ? 260  VAL A O     1 
ATOM   3407  C  CB    . VAL B  2  259 ? 35.127   6.344   41.866   1.00 52.99  ? 260  VAL A CB    1 
ATOM   3408  C  CG1   . VAL B  2  259 ? 33.714   6.151   42.398   1.00 52.05  ? 260  VAL A CG1   1 
ATOM   3409  C  CG2   . VAL B  2  259 ? 35.791   7.436   42.656   1.00 55.90  ? 260  VAL A CG2   1 
ATOM   3410  N  N     . VAL B  2  260 ? 34.823   2.907   41.725   1.00 44.94  ? 261  VAL A N     1 
ATOM   3411  C  CA    . VAL B  2  260 ? 34.154   1.737   41.087   1.00 44.64  ? 261  VAL A CA    1 
ATOM   3412  C  C     . VAL B  2  260 ? 32.666   1.835   41.398   1.00 45.23  ? 261  VAL A C     1 
ATOM   3413  O  O     . VAL B  2  260 ? 32.327   1.852   42.599   1.00 46.74  ? 261  VAL A O     1 
ATOM   3414  C  CB    . VAL B  2  260 ? 34.750   0.421   41.610   1.00 46.94  ? 261  VAL A CB    1 
ATOM   3415  C  CG1   . VAL B  2  260 ? 34.041   -0.771  41.041   1.00 52.62  ? 261  VAL A CG1   1 
ATOM   3416  C  CG2   . VAL B  2  260 ? 36.241   0.332   41.354   1.00 48.78  ? 261  VAL A CG2   1 
ATOM   3417  N  N     . THR B  2  261 ? 31.819   1.879   40.367   1.00 47.12  ? 262  THR A N     1 
ATOM   3418  C  CA    . THR B  2  261 ? 30.348   2.089   40.491   1.00 48.23  ? 262  THR A CA    1 
ATOM   3419  C  C     . THR B  2  261 ? 29.557   0.861   40.024   1.00 46.57  ? 262  THR A C     1 
ATOM   3420  O  O     . THR B  2  261 ? 28.375   0.785   40.375   1.00 41.78  ? 262  THR A O     1 
ATOM   3421  C  CB    . THR B  2  261 ? 29.934   3.345   39.719   1.00 50.12  ? 262  THR A CB    1 
ATOM   3422  O  OG1   . THR B  2  261 ? 30.296   3.147   38.363   1.00 50.20  ? 262  THR A OG1   1 
ATOM   3423  C  CG2   . THR B  2  261 ? 30.597   4.601   40.237   1.00 51.57  ? 262  THR A CG2   1 
ATOM   3424  N  N     . GLU B  2  262 ? 30.162   -0.030  39.232   1.00 52.10  ? 263  GLU A N     1 
ATOM   3425  C  CA    . GLU B  2  262 ? 29.534   -1.294  38.751   1.00 52.90  ? 263  GLU A CA    1 
ATOM   3426  C  C     . GLU B  2  262 ? 30.571   -2.413  38.884   1.00 47.67  ? 263  GLU A C     1 
ATOM   3427  O  O     . GLU B  2  262 ? 31.742   -2.160  38.493   1.00 39.55  ? 263  GLU A O     1 
ATOM   3428  C  CB    . GLU B  2  262 ? 29.085   -1.157  37.291   1.00 60.42  ? 263  GLU A CB    1 
ATOM   3429  C  CG    . GLU B  2  262 ? 28.099   -0.012  37.028   1.00 68.46  ? 263  GLU A CG    1 
ATOM   3430  C  CD    . GLU B  2  262 ? 27.712   0.266   35.573   1.00 67.48  ? 263  GLU A CD    1 
ATOM   3431  O  OE1   . GLU B  2  262 ? 26.874   1.155   35.350   1.00 69.71  ? 263  GLU A OE1   1 
ATOM   3432  O  OE2   . GLU B  2  262 ? 28.240   -0.386  34.655   1.00 59.95  ? 263  GLU A OE2   1 
ATOM   3433  N  N     . ILE B  2  263 ? 30.202   -3.589  39.403   1.00 46.08  ? 264  ILE A N     1 
ATOM   3434  C  CA    . ILE B  2  263 ? 31.144   -4.750  39.503   1.00 47.21  ? 264  ILE A CA    1 
ATOM   3435  C  C     . ILE B  2  263 ? 30.704   -5.882  38.573   1.00 42.94  ? 264  ILE A C     1 
ATOM   3436  O  O     . ILE B  2  263 ? 29.572   -5.916  38.091   1.00 38.98  ? 264  ILE A O     1 
ATOM   3437  C  CB    . ILE B  2  263 ? 31.283   -5.232  40.961   1.00 49.59  ? 264  ILE A CB    1 
ATOM   3438  C  CG1   . ILE B  2  263 ? 29.983   -5.826  41.497   1.00 50.57  ? 264  ILE A CG1   1 
ATOM   3439  C  CG2   . ILE B  2  263 ? 31.797   -4.105  41.834   1.00 49.88  ? 264  ILE A CG2   1 
ATOM   3440  C  CD1   . ILE B  2  263 ? 30.090   -6.289  42.925   1.00 52.38  ? 264  ILE A CD1   1 
ATOM   3441  N  N     . PRO B  2  264 ? 31.597   -6.853  38.284   1.00 39.41  ? 265  PRO A N     1 
ATOM   3442  C  CA    . PRO B  2  264 ? 31.255   -7.959  37.407   1.00 44.20  ? 265  PRO A CA    1 
ATOM   3443  C  C     . PRO B  2  264 ? 30.188   -8.851  38.060   1.00 53.31  ? 265  PRO A C     1 
ATOM   3444  O  O     . PRO B  2  264 ? 30.049   -8.856  39.282   1.00 52.70  ? 265  PRO A O     1 
ATOM   3445  C  CB    . PRO B  2  264 ? 32.573   -8.721  37.204   1.00 43.17  ? 265  PRO A CB    1 
ATOM   3446  C  CG    . PRO B  2  264 ? 33.632   -7.758  37.680   1.00 41.32  ? 265  PRO A CG    1 
ATOM   3447  C  CD    . PRO B  2  264 ? 32.970   -6.977  38.789   1.00 40.59  ? 265  PRO A CD    1 
ATOM   3448  N  N     . PHE B  2  265 ? 29.470   -9.573  37.194   1.00 57.95  ? 266  PHE A N     1 
ATOM   3449  C  CA    . PHE B  2  265 ? 28.332   -10.459 37.538   1.00 49.89  ? 266  PHE A CA    1 
ATOM   3450  C  C     . PHE B  2  265 ? 28.805   -11.565 38.478   1.00 51.03  ? 266  PHE A C     1 
ATOM   3451  O  O     . PHE B  2  265 ? 29.886   -12.133 38.243   1.00 43.89  ? 266  PHE A O     1 
ATOM   3452  C  CB    . PHE B  2  265 ? 27.754   -11.071 36.265   1.00 44.57  ? 266  PHE A CB    1 
ATOM   3453  C  CG    . PHE B  2  265 ? 26.508   -11.888 36.477   1.00 41.60  ? 266  PHE A CG    1 
ATOM   3454  C  CD1   . PHE B  2  265 ? 25.458   -11.386 37.236   1.00 41.98  ? 266  PHE A CD1   1 
ATOM   3455  C  CD2   . PHE B  2  265 ? 26.387   -13.148 35.901   1.00 40.46  ? 266  PHE A CD2   1 
ATOM   3456  C  CE1   . PHE B  2  265 ? 24.312   -12.139 37.425   1.00 44.31  ? 266  PHE A CE1   1 
ATOM   3457  C  CE2   . PHE B  2  265 ? 25.238   -13.897 36.088   1.00 40.21  ? 266  PHE A CE2   1 
ATOM   3458  C  CZ    . PHE B  2  265 ? 24.196   -13.391 36.840   1.00 41.05  ? 266  PHE A CZ    1 
ATOM   3459  N  N     . GLN B  2  266 ? 28.003   -11.842 39.513   1.00 56.01  ? 267  GLN A N     1 
ATOM   3460  C  CA    . GLN B  2  266 ? 28.204   -12.958 40.480   1.00 54.24  ? 267  GLN A CA    1 
ATOM   3461  C  C     . GLN B  2  266 ? 29.490   -12.748 41.287   1.00 54.08  ? 267  GLN A C     1 
ATOM   3462  O  O     . GLN B  2  266 ? 29.878   -13.692 41.990   1.00 50.62  ? 267  GLN A O     1 
ATOM   3463  C  CB    . GLN B  2  266 ? 28.232   -14.306 39.753   1.00 56.33  ? 267  GLN A CB    1 
ATOM   3464  C  CG    . GLN B  2  266 ? 26.873   -14.725 39.227   1.00 58.90  ? 267  GLN A CG    1 
ATOM   3465  C  CD    . GLN B  2  266 ? 26.931   -16.029 38.467   1.00 60.91  ? 267  GLN A CD    1 
ATOM   3466  O  OE1   . GLN B  2  266 ? 27.473   -16.108 37.359   1.00 57.25  ? 267  GLN A OE1   1 
ATOM   3467  N  NE2   . GLN B  2  266 ? 26.341   -17.050 39.061   1.00 59.70  ? 267  GLN A NE2   1 
ATOM   3468  N  N     . VAL B  2  267 ? 30.106   -11.556 41.229   1.00 58.52  ? 268  VAL A N     1 
ATOM   3469  C  CA    . VAL B  2  267 ? 31.261   -11.204 42.107   1.00 61.71  ? 268  VAL A CA    1 
ATOM   3470  C  C     . VAL B  2  267 ? 30.708   -10.615 43.408   1.00 57.04  ? 268  VAL A C     1 
ATOM   3471  O  O     . VAL B  2  267 ? 29.871   -9.704  43.355   1.00 53.11  ? 268  VAL A O     1 
ATOM   3472  C  CB    . VAL B  2  267 ? 32.248   -10.233 41.437   1.00 68.56  ? 268  VAL A CB    1 
ATOM   3473  C  CG1   . VAL B  2  267 ? 33.257   -9.709  42.436   1.00 70.52  ? 268  VAL A CG1   1 
ATOM   3474  C  CG2   . VAL B  2  267 ? 32.956   -10.859 40.242   1.00 65.56  ? 268  VAL A CG2   1 
ATOM   3475  N  N     . ASN B  2  268 ? 31.217   -11.099 44.538   1.00 56.22  ? 269  ASN A N     1 
ATOM   3476  C  CA    . ASN B  2  268 ? 30.806   -10.693 45.907   1.00 60.76  ? 269  ASN A CA    1 
ATOM   3477  C  C     . ASN B  2  268 ? 31.509   -9.373  46.265   1.00 71.15  ? 269  ASN A C     1 
ATOM   3478  O  O     . ASN B  2  268 ? 32.752   -9.385  46.363   1.00 74.09  ? 269  ASN A O     1 
ATOM   3479  C  CB    . ASN B  2  268 ? 31.135   -11.824 46.892   1.00 59.09  ? 269  ASN A CB    1 
ATOM   3480  C  CG    . ASN B  2  268 ? 30.693   -11.499 48.298   1.00 61.94  ? 269  ASN A CG    1 
ATOM   3481  O  OD1   . ASN B  2  268 ? 31.033   -10.448 48.836   1.00 70.49  ? 269  ASN A OD1   1 
ATOM   3482  N  ND2   . ASN B  2  268 ? 29.926   -12.385 48.894   1.00 63.88  ? 269  ASN A ND2   1 
ATOM   3483  N  N     . LYS B  2  269 ? 30.761   -8.281  46.464   1.00 75.98  ? 270  LYS A N     1 
ATOM   3484  C  CA    . LYS B  2  269 ? 31.357   -6.933  46.699   1.00 72.78  ? 270  LYS A CA    1 
ATOM   3485  C  C     . LYS B  2  269 ? 32.263   -7.005  47.933   1.00 75.44  ? 270  LYS A C     1 
ATOM   3486  O  O     . LYS B  2  269 ? 33.450   -6.614  47.824   1.00 76.54  ? 270  LYS A O     1 
ATOM   3487  C  CB    . LYS B  2  269 ? 30.285   -5.849  46.840   1.00 66.68  ? 270  LYS A CB    1 
ATOM   3488  C  CG    . LYS B  2  269 ? 30.804   -4.447  47.155   1.00 67.35  ? 270  LYS A CG    1 
ATOM   3489  C  CD    . LYS B  2  269 ? 29.785   -3.335  46.871   1.00 68.90  ? 270  LYS A CD    1 
ATOM   3490  N  N     . ALA B  2  270 ? 31.740   -7.511  49.052   1.00 69.27  ? 271  ALA A N     1 
ATOM   3491  C  CA    . ALA B  2  270 ? 32.458   -7.532  50.346   1.00 73.95  ? 271  ALA A CA    1 
ATOM   3492  C  C     . ALA B  2  270 ? 33.777   -8.291  50.185   1.00 70.24  ? 271  ALA A C     1 
ATOM   3493  O  O     . ALA B  2  270 ? 34.810   -7.787  50.636   1.00 75.78  ? 271  ALA A O     1 
ATOM   3494  C  CB    . ALA B  2  270 ? 31.599   -8.136  51.423   1.00 78.17  ? 271  ALA A CB    1 
ATOM   3495  N  N     A ARG B  2  271 ? 33.727   -9.459  49.546   0.50 68.91  ? 272  ARG A N     1 
ATOM   3496  N  N     B ARG B  2  271 ? 33.728   -9.460  49.546   0.50 67.53  ? 272  ARG A N     1 
ATOM   3497  C  CA    A ARG B  2  271 ? 34.886   -10.362 49.313   0.50 67.77  ? 272  ARG A CA    1 
ATOM   3498  C  CA    B ARG B  2  271 ? 34.888   -10.364 49.313   0.50 65.57  ? 272  ARG A CA    1 
ATOM   3499  C  C     A ARG B  2  271 ? 35.896   -9.672  48.391   0.50 65.48  ? 272  ARG A C     1 
ATOM   3500  C  C     B ARG B  2  271 ? 35.896   -9.672  48.391   0.50 64.26  ? 272  ARG A C     1 
ATOM   3501  O  O     A ARG B  2  271 ? 37.094   -9.715  48.708   0.50 61.65  ? 272  ARG A O     1 
ATOM   3502  O  O     B ARG B  2  271 ? 37.094   -9.715  48.708   0.50 60.63  ? 272  ARG A O     1 
ATOM   3503  C  CB    A ARG B  2  271 ? 34.397   -11.684 48.720   0.50 68.27  ? 272  ARG A CB    1 
ATOM   3504  C  CB    B ARG B  2  271 ? 34.393   -11.685 48.715   0.50 64.31  ? 272  ARG A CB    1 
ATOM   3505  C  CG    A ARG B  2  271 ? 35.469   -12.771 48.763   0.50 70.05  ? 272  ARG A CG    1 
ATOM   3506  C  CG    B ARG B  2  271 ? 35.429   -12.808 48.668   0.50 64.44  ? 272  ARG A CG    1 
ATOM   3507  C  CD    A ARG B  2  271 ? 35.018   -14.157 48.348   0.50 71.21  ? 272  ARG A CD    1 
ATOM   3508  C  CD    B ARG B  2  271 ? 35.098   -13.875 47.627   0.50 63.56  ? 272  ARG A CD    1 
ATOM   3509  N  NE    A ARG B  2  271 ? 33.928   -14.610 49.197   0.50 68.71  ? 272  ARG A NE    1 
ATOM   3510  N  NE    B ARG B  2  271 ? 35.965   -15.048 47.661   0.50 58.93  ? 272  ARG A NE    1 
ATOM   3511  C  CZ    A ARG B  2  271 ? 32.761   -15.055 48.754   0.50 63.33  ? 272  ARG A CZ    1 
ATOM   3512  C  CZ    B ARG B  2  271 ? 35.885   -16.012 48.574   0.50 58.28  ? 272  ARG A CZ    1 
ATOM   3513  N  NH1   A ARG B  2  271 ? 32.527   -15.163 47.457   0.50 60.28  ? 272  ARG A NH1   1 
ATOM   3514  N  NH1   B ARG B  2  271 ? 34.989   -15.939 49.545   0.50 59.43  ? 272  ARG A NH1   1 
ATOM   3515  N  NH2   A ARG B  2  271 ? 31.843   -15.424 49.629   0.50 61.97  ? 272  ARG A NH2   1 
ATOM   3516  N  NH2   B ARG B  2  271 ? 36.716   -17.036 48.528   0.50 58.07  ? 272  ARG A NH2   1 
ATOM   3517  N  N     . MET B  2  272 ? 35.429   -9.033  47.312   1.00 64.29  ? 273  MET A N     1 
ATOM   3518  C  CA    . MET B  2  272 ? 36.293   -8.336  46.324   1.00 64.10  ? 273  MET A CA    1 
ATOM   3519  C  C     . MET B  2  272 ? 37.094   -7.230  47.014   1.00 60.11  ? 273  MET A C     1 
ATOM   3520  O  O     . MET B  2  272 ? 38.289   -7.099  46.704   1.00 57.40  ? 273  MET A O     1 
ATOM   3521  C  CB    . MET B  2  272 ? 35.467   -7.708  45.203   1.00 66.97  ? 273  MET A CB    1 
ATOM   3522  C  CG    . MET B  2  272 ? 36.320   -7.180  44.069   1.00 70.04  ? 273  MET A CG    1 
ATOM   3523  S  SD    . MET B  2  272 ? 35.432   -5.989  43.045   1.00 73.53  ? 273  MET A SD    1 
ATOM   3524  C  CE    . MET B  2  272 ? 35.204   -4.636  44.196   1.00 74.64  ? 273  MET A CE    1 
ATOM   3525  N  N     . ILE B  2  273 ? 36.465   -6.454  47.901   1.00 59.28  ? 274  ILE A N     1 
ATOM   3526  C  CA    . ILE B  2  273 ? 37.142   -5.379  48.685   1.00 64.58  ? 274  ILE A CA    1 
ATOM   3527  C  C     . ILE B  2  273 ? 38.214   -6.009  49.587   1.00 66.31  ? 274  ILE A C     1 
ATOM   3528  O  O     . ILE B  2  273 ? 39.341   -5.474  49.647   1.00 57.79  ? 274  ILE A O     1 
ATOM   3529  C  CB    . ILE B  2  273 ? 36.107   -4.556  49.476   1.00 69.41  ? 274  ILE A CB    1 
ATOM   3530  C  CG1   . ILE B  2  273 ? 35.372   -3.586  48.549   1.00 71.07  ? 274  ILE A CG1   1 
ATOM   3531  C  CG2   . ILE B  2  273 ? 36.751   -3.835  50.650   1.00 71.59  ? 274  ILE A CG2   1 
ATOM   3532  C  CD1   . ILE B  2  273 ? 34.035   -3.119  49.058   1.00 72.30  ? 274  ILE A CD1   1 
ATOM   3533  N  N     . GLU B  2  274 ? 37.871   -7.109  50.259   1.00 72.41  ? 275  GLU A N     1 
ATOM   3534  C  CA    . GLU B  2  274 ? 38.778   -7.836  51.185   1.00 67.09  ? 275  GLU A CA    1 
ATOM   3535  C  C     . GLU B  2  274 ? 40.016   -8.311  50.399   1.00 57.78  ? 275  GLU A C     1 
ATOM   3536  O  O     . GLU B  2  274 ? 41.129   -8.141  50.917   1.00 46.97  ? 275  GLU A O     1 
ATOM   3537  C  CB    . GLU B  2  274 ? 37.979   -8.929  51.900   1.00 69.06  ? 275  GLU A CB    1 
ATOM   3538  C  CG    . GLU B  2  274 ? 38.807   -9.821  52.801   1.00 77.60  ? 275  GLU A CG    1 
ATOM   3539  C  CD    . GLU B  2  274 ? 39.733   -9.098  53.763   1.00 84.16  ? 275  GLU A CD    1 
ATOM   3540  O  OE1   . GLU B  2  274 ? 39.388   -7.973  54.194   1.00 87.82  ? 275  GLU A OE1   1 
ATOM   3541  O  OE2   . GLU B  2  274 ? 40.813   -9.658  54.069   1.00 98.32  ? 275  GLU A OE2   1 
ATOM   3542  N  N     . LYS B  2  275 ? 39.857   -8.823  49.176   1.00 56.55  ? 276  LYS A N     1 
ATOM   3543  C  CA    . LYS B  2  275 ? 41.005   -9.223  48.305   1.00 64.74  ? 276  LYS A CA    1 
ATOM   3544  C  C     . LYS B  2  275 ? 41.929   -8.015  48.075   1.00 62.01  ? 276  LYS A C     1 
ATOM   3545  O  O     . LYS B  2  275 ? 43.167   -8.200  48.115   1.00 56.66  ? 276  LYS A O     1 
ATOM   3546  C  CB    . LYS B  2  275 ? 40.538   -9.850  46.980   1.00 67.62  ? 276  LYS A CB    1 
ATOM   3547  C  CG    . LYS B  2  275 ? 40.501   -11.380 46.975   1.00 73.76  ? 276  LYS A CG    1 
ATOM   3548  C  CD    . LYS B  2  275 ? 39.359   -12.020 46.209   1.00 70.99  ? 276  LYS A CD    1 
ATOM   3549  N  N     . ILE B  2  276 ? 41.367   -6.822  47.850   1.00 63.50  ? 277  ILE A N     1 
ATOM   3550  C  CA    . ILE B  2  276 ? 42.155   -5.585  47.558   1.00 67.36  ? 277  ILE A CA    1 
ATOM   3551  C  C     . ILE B  2  276 ? 42.887   -5.177  48.842   1.00 75.30  ? 277  ILE A C     1 
ATOM   3552  O  O     . ILE B  2  276 ? 44.103   -4.889  48.760   1.00 75.24  ? 277  ILE A O     1 
ATOM   3553  C  CB    . ILE B  2  276 ? 41.263   -4.455  47.002   1.00 63.76  ? 277  ILE A CB    1 
ATOM   3554  C  CG1   . ILE B  2  276 ? 40.670   -4.811  45.640   1.00 57.23  ? 277  ILE A CG1   1 
ATOM   3555  C  CG2   . ILE B  2  276 ? 42.013   -3.131  46.942   1.00 61.88  ? 277  ILE A CG2   1 
ATOM   3556  C  CD1   . ILE B  2  276 ? 39.508   -3.945  45.222   1.00 54.51  ? 277  ILE A CD1   1 
ATOM   3557  N  N     . ALA B  2  277 ? 42.187   -5.156  49.981   1.00 76.56  ? 278  ALA A N     1 
ATOM   3558  C  CA    . ALA B  2  277 ? 42.764   -4.811  51.303   1.00 73.53  ? 278  ALA A CA    1 
ATOM   3559  C  C     . ALA B  2  277 ? 43.905   -5.779  51.612   1.00 66.50  ? 278  ALA A C     1 
ATOM   3560  O  O     . ALA B  2  277 ? 44.941   -5.334  52.136   1.00 59.46  ? 278  ALA A O     1 
ATOM   3561  C  CB    . ALA B  2  277 ? 41.700   -4.846  52.379   1.00 75.70  ? 278  ALA A CB    1 
ATOM   3562  N  N     . GLU B  2  278 ? 43.714   -7.054  51.265   1.00 65.37  ? 279  GLU A N     1 
ATOM   3563  C  CA    . GLU B  2  278 ? 44.674   -8.157  51.526   1.00 72.49  ? 279  GLU A CA    1 
ATOM   3564  C  C     . GLU B  2  278 ? 45.919   -7.970  50.653   1.00 67.07  ? 279  GLU A C     1 
ATOM   3565  O  O     . GLU B  2  278 ? 47.006   -8.229  51.163   1.00 64.79  ? 279  GLU A O     1 
ATOM   3566  C  CB    . GLU B  2  278 ? 43.981   -9.493  51.290   1.00 79.45  ? 279  GLU A CB    1 
ATOM   3567  C  CG    . GLU B  2  278 ? 44.861   -10.713 51.476   1.00 83.31  ? 279  GLU A CG    1 
ATOM   3568  C  CD    . GLU B  2  278 ? 44.330   -11.956 50.769   1.00 84.43  ? 279  GLU A CD    1 
ATOM   3569  O  OE1   . GLU B  2  278 ? 43.141   -11.972 50.352   1.00 81.41  ? 279  GLU A OE1   1 
ATOM   3570  O  OE2   . GLU B  2  278 ? 45.101   -12.943 50.629   1.00 82.46  ? 279  GLU A OE2   1 
ATOM   3571  N  N     . LEU B  2  279 ? 45.772   -7.548  49.394   1.00 68.67  ? 280  LEU A N     1 
ATOM   3572  C  CA    . LEU B  2  279 ? 46.930   -7.245  48.512   1.00 78.92  ? 280  LEU A CA    1 
ATOM   3573  C  C     . LEU B  2  279 ? 47.744   -6.090  49.109   1.00 79.46  ? 280  LEU A C     1 
ATOM   3574  O  O     . LEU B  2  279 ? 48.988   -6.150  49.047   1.00 77.00  ? 280  LEU A O     1 
ATOM   3575  C  CB    . LEU B  2  279 ? 46.443   -6.878  47.104   1.00 89.39  ? 280  LEU A CB    1 
ATOM   3576  C  CG    . LEU B  2  279 ? 46.037   -8.024  46.183   1.00 94.05  ? 280  LEU A CG    1 
ATOM   3577  C  CD1   . LEU B  2  279 ? 45.890   -7.505  44.765   1.00 93.10  ? 280  LEU A CD1   1 
ATOM   3578  C  CD2   . LEU B  2  279 ? 47.047   -9.158  46.219   1.00 100.84 ? 280  LEU A CD2   1 
ATOM   3579  N  N     . VAL B  2  280 ? 47.066   -5.072  49.650   1.00 76.59  ? 281  VAL A N     1 
ATOM   3580  C  CA    . VAL B  2  280 ? 47.705   -3.873  50.271   1.00 77.56  ? 281  VAL A CA    1 
ATOM   3581  C  C     . VAL B  2  280 ? 48.377   -4.301  51.587   1.00 81.46  ? 281  VAL A C     1 
ATOM   3582  O  O     . VAL B  2  280 ? 49.588   -4.018  51.727   1.00 82.63  ? 281  VAL A O     1 
ATOM   3583  C  CB    . VAL B  2  280 ? 46.692   -2.725  50.453   1.00 76.81  ? 281  VAL A CB    1 
ATOM   3584  C  CG1   . VAL B  2  280 ? 47.249   -1.574  51.285   1.00 71.96  ? 281  VAL A CG1   1 
ATOM   3585  C  CG2   . VAL B  2  280 ? 46.214   -2.213  49.107   1.00 76.29  ? 281  VAL A CG2   1 
ATOM   3586  N  N     . ARG B  2  281 ? 47.647   -4.986  52.487   1.00 81.59  ? 282  ARG A N     1 
ATOM   3587  C  CA    . ARG B  2  281 ? 48.178   -5.540  53.770   1.00 76.81  ? 282  ARG A CA    1 
ATOM   3588  C  C     . ARG B  2  281 ? 49.479   -6.300  53.481   1.00 79.52  ? 282  ARG A C     1 
ATOM   3589  O  O     . ARG B  2  281 ? 50.455   -6.066  54.203   1.00 97.03  ? 282  ARG A O     1 
ATOM   3590  C  CB    . ARG B  2  281 ? 47.161   -6.452  54.475   1.00 67.86  ? 282  ARG A CB    1 
ATOM   3591  N  N     . ASP B  2  282 ? 49.504   -7.130  52.427   1.00 73.59  ? 283  ASP A N     1 
ATOM   3592  C  CA    . ASP B  2  282 ? 50.618   -8.064  52.095   1.00 66.11  ? 283  ASP A CA    1 
ATOM   3593  C  C     . ASP B  2  282 ? 51.596   -7.404  51.115   1.00 68.47  ? 283  ASP A C     1 
ATOM   3594  O  O     . ASP B  2  282 ? 52.363   -8.144  50.474   1.00 74.88  ? 283  ASP A O     1 
ATOM   3595  C  CB    . ASP B  2  282 ? 50.082   -9.388  51.535   1.00 63.22  ? 283  ASP A CB    1 
ATOM   3596  C  CG    . ASP B  2  282 ? 49.220   -10.203 52.499   1.00 64.66  ? 283  ASP A CG    1 
ATOM   3597  O  OD1   . ASP B  2  282 ? 49.194   -9.878  53.693   1.00 68.54  ? 283  ASP A OD1   1 
ATOM   3598  O  OD2   . ASP B  2  282 ? 48.575   -11.170 52.055   1.00 65.03  ? 283  ASP A OD2   1 
ATOM   3599  N  N     . LYS B  2  283 ? 51.578   -6.069  51.010   1.00 74.70  ? 284  LYS A N     1 
ATOM   3600  C  CA    . LYS B  2  283 ? 52.450   -5.240  50.121   1.00 74.64  ? 284  LYS A CA    1 
ATOM   3601  C  C     . LYS B  2  283 ? 52.642   -5.901  48.737   1.00 78.19  ? 284  LYS A C     1 
ATOM   3602  O  O     . LYS B  2  283 ? 53.768   -5.806  48.202   1.00 66.77  ? 284  LYS A O     1 
ATOM   3603  C  CB    . LYS B  2  283 ? 53.795   -4.969  50.819   1.00 66.80  ? 284  LYS A CB    1 
ATOM   3604  N  N     . LYS B  2  284 ? 51.592   -6.503  48.141   1.00 84.59  ? 285  LYS A N     1 
ATOM   3605  C  CA    . LYS B  2  284 ? 51.652   -7.198  46.816   1.00 86.53  ? 285  LYS A CA    1 
ATOM   3606  C  C     . LYS B  2  284 ? 51.182   -6.254  45.692   1.00 84.80  ? 285  LYS A C     1 
ATOM   3607  O  O     . LYS B  2  284 ? 51.271   -6.668  44.505   1.00 76.54  ? 285  LYS A O     1 
ATOM   3608  C  CB    . LYS B  2  284 ? 50.845   -8.505  46.834   1.00 85.37  ? 285  LYS A CB    1 
ATOM   3609  N  N     . ILE B  2  285 ? 50.698   -5.050  46.038   1.00 88.85  ? 286  ILE A N     1 
ATOM   3610  C  CA    . ILE B  2  285 ? 50.322   -3.956  45.080   1.00 96.41  ? 286  ILE A CA    1 
ATOM   3611  C  C     . ILE B  2  285 ? 50.698   -2.611  45.715   1.00 95.82  ? 286  ILE A C     1 
ATOM   3612  O  O     . ILE B  2  285 ? 50.397   -2.417  46.903   1.00 112.75 ? 286  ILE A O     1 
ATOM   3613  C  CB    . ILE B  2  285 ? 48.825   -4.022  44.691   1.00 100.84 ? 286  ILE A CB    1 
ATOM   3614  C  CG1   . ILE B  2  285 ? 48.531   -3.238  43.409   1.00 97.70  ? 286  ILE A CG1   1 
ATOM   3615  C  CG2   . ILE B  2  285 ? 47.938   -3.572  45.842   1.00 99.61  ? 286  ILE A CG2   1 
ATOM   3616  C  CD1   . ILE B  2  285 ? 47.089   -3.308  42.959   1.00 93.37  ? 286  ILE A CD1   1 
ATOM   3617  N  N     . ASP B  2  286 ? 51.332   -1.718  44.952   1.00 87.37  ? 287  ASP A N     1 
ATOM   3618  C  CA    . ASP B  2  286 ? 51.983   -0.485  45.470   1.00 81.44  ? 287  ASP A CA    1 
ATOM   3619  C  C     . ASP B  2  286 ? 51.166   0.743   45.040   1.00 73.49  ? 287  ASP A C     1 
ATOM   3620  O  O     . ASP B  2  286 ? 50.796   0.810   43.858   1.00 66.63  ? 287  ASP A O     1 
ATOM   3621  C  CB    . ASP B  2  286 ? 53.440   -0.452  44.991   1.00 80.83  ? 287  ASP A CB    1 
ATOM   3622  C  CG    . ASP B  2  286 ? 54.163   0.878   45.145   1.00 82.17  ? 287  ASP A CG    1 
ATOM   3623  O  OD1   . ASP B  2  286 ? 54.742   1.100   46.220   1.00 81.30  ? 287  ASP A OD1   1 
ATOM   3624  O  OD2   . ASP B  2  286 ? 54.167   1.659   44.172   1.00 75.55  ? 287  ASP A OD2   1 
ATOM   3625  N  N     . GLY B  2  287 ? 50.871   1.653   45.976   1.00 68.72  ? 288  GLY A N     1 
ATOM   3626  C  CA    . GLY B  2  287 ? 50.313   2.990   45.683   1.00 70.57  ? 288  GLY A CA    1 
ATOM   3627  C  C     . GLY B  2  287 ? 48.954   3.281   46.318   1.00 66.32  ? 288  GLY A C     1 
ATOM   3628  O  O     . GLY B  2  287 ? 48.478   4.429   46.179   1.00 67.50  ? 288  GLY A O     1 
ATOM   3629  N  N     . ILE B  2  288 ? 48.334   2.310   46.993   1.00 63.87  ? 289  ILE A N     1 
ATOM   3630  C  CA    . ILE B  2  288 ? 46.951   2.469   47.536   1.00 67.93  ? 289  ILE A CA    1 
ATOM   3631  C  C     . ILE B  2  288 ? 47.023   2.904   49.006   1.00 62.15  ? 289  ILE A C     1 
ATOM   3632  O  O     . ILE B  2  288 ? 47.517   2.117   49.830   1.00 64.56  ? 289  ILE A O     1 
ATOM   3633  C  CB    . ILE B  2  288 ? 46.134   1.176   47.345   1.00 72.78  ? 289  ILE A CB    1 
ATOM   3634  C  CG1   . ILE B  2  288 ? 45.886   0.899   45.860   1.00 74.17  ? 289  ILE A CG1   1 
ATOM   3635  C  CG2   . ILE B  2  288 ? 44.814   1.255   48.106   1.00 72.35  ? 289  ILE A CG2   1 
ATOM   3636  C  CD1   . ILE B  2  288 ? 45.277   -0.464  45.575   1.00 74.13  ? 289  ILE A CD1   1 
ATOM   3637  N  N     . THR B  2  289 ? 46.497   4.093   49.309   1.00 59.32  ? 290  THR A N     1 
ATOM   3638  C  CA    . THR B  2  289 ? 46.608   4.778   50.623   1.00 67.60  ? 290  THR A CA    1 
ATOM   3639  C  C     . THR B  2  289 ? 45.339   4.587   51.459   1.00 69.80  ? 290  THR A C     1 
ATOM   3640  O  O     . THR B  2  289 ? 45.417   4.812   52.671   1.00 63.15  ? 290  THR A O     1 
ATOM   3641  C  CB    . THR B  2  289 ? 46.888   6.277   50.442   1.00 73.03  ? 290  THR A CB    1 
ATOM   3642  O  OG1   . THR B  2  289 ? 45.721   6.929   49.932   1.00 76.89  ? 290  THR A OG1   1 
ATOM   3643  C  CG2   . THR B  2  289 ? 48.071   6.539   49.533   1.00 69.23  ? 290  THR A CG2   1 
ATOM   3644  N  N     . ASP B  2  290 ? 44.209   4.243   50.840   1.00 76.52  ? 291  ASP A N     1 
ATOM   3645  C  CA    . ASP B  2  290 ? 42.941   3.949   51.561   1.00 76.57  ? 291  ASP A CA    1 
ATOM   3646  C  C     . ASP B  2  290 ? 42.009   3.168   50.625   1.00 73.68  ? 291  ASP A C     1 
ATOM   3647  O  O     . ASP B  2  290 ? 42.219   3.200   49.384   1.00 68.59  ? 291  ASP A O     1 
ATOM   3648  C  CB    . ASP B  2  290 ? 42.270   5.227   52.091   1.00 79.17  ? 291  ASP A CB    1 
ATOM   3649  C  CG    . ASP B  2  290 ? 41.164   4.961   53.110   1.00 83.92  ? 291  ASP A CG    1 
ATOM   3650  O  OD1   . ASP B  2  290 ? 41.188   3.871   53.719   1.00 85.32  ? 291  ASP A OD1   1 
ATOM   3651  O  OD2   . ASP B  2  290 ? 40.283   5.835   53.289   1.00 82.31  ? 291  ASP A OD2   1 
ATOM   3652  N  N     . LEU B  2  291 ? 41.014   2.503   51.214   1.00 62.21  ? 292  LEU A N     1 
ATOM   3653  C  CA    . LEU B  2  291 ? 40.003   1.681   50.515   1.00 55.80  ? 292  LEU A CA    1 
ATOM   3654  C  C     . LEU B  2  291 ? 38.707   1.744   51.325   1.00 49.85  ? 292  LEU A C     1 
ATOM   3655  O  O     . LEU B  2  291 ? 38.719   1.256   52.465   1.00 64.77  ? 292  LEU A O     1 
ATOM   3656  C  CB    . LEU B  2  291 ? 40.570   0.257   50.450   1.00 59.82  ? 292  LEU A CB    1 
ATOM   3657  C  CG    . LEU B  2  291 ? 39.662   -0.817  49.868   1.00 63.88  ? 292  LEU A CG    1 
ATOM   3658  C  CD1   . LEU B  2  291 ? 39.406   -0.578  48.402   1.00 67.77  ? 292  LEU A CD1   1 
ATOM   3659  C  CD2   . LEU B  2  291 ? 40.280   -2.161  50.089   1.00 59.96  ? 292  LEU A CD2   1 
ATOM   3660  N  N     . ARG B  2  292 ? 37.660   2.377   50.796   1.00 42.56  ? 293  ARG A N     1 
ATOM   3661  C  CA    . ARG B  2  292 ? 36.344   2.526   51.472   1.00 43.78  ? 293  ARG A CA    1 
ATOM   3662  C  C     . ARG B  2  292 ? 35.238   2.015   50.550   1.00 42.83  ? 293  ARG A C     1 
ATOM   3663  O  O     . ARG B  2  292 ? 35.393   2.145   49.320   1.00 44.38  ? 293  ARG A O     1 
ATOM   3664  C  CB    . ARG B  2  292 ? 36.048   3.999   51.801   1.00 46.27  ? 293  ARG A CB    1 
ATOM   3665  C  CG    . ARG B  2  292 ? 37.042   4.673   52.740   1.00 46.20  ? 293  ARG A CG    1 
ATOM   3666  C  CD    . ARG B  2  292 ? 36.618   6.090   53.053   1.00 48.83  ? 293  ARG A CD    1 
ATOM   3667  N  NE    . ARG B  2  292 ? 36.471   6.925   51.861   1.00 48.22  ? 293  ARG A NE    1 
ATOM   3668  C  CZ    . ARG B  2  292 ? 37.482   7.432   51.156   1.00 48.11  ? 293  ARG A CZ    1 
ATOM   3669  N  NH1   . ARG B  2  292 ? 38.742   7.174   51.473   1.00 45.79  ? 293  ARG A NH1   1 
ATOM   3670  N  NH2   . ARG B  2  292 ? 37.224   8.202   50.113   1.00 48.90  ? 293  ARG A NH2   1 
ATOM   3671  N  N     . ASP B  2  293 ? 34.165   1.475   51.120   1.00 39.17  ? 294  ASP A N     1 
ATOM   3672  C  CA    . ASP B  2  293 ? 32.920   1.107   50.403   1.00 37.74  ? 294  ASP A CA    1 
ATOM   3673  C  C     . ASP B  2  293 ? 31.862   2.149   50.770   1.00 35.47  ? 294  ASP A C     1 
ATOM   3674  O  O     . ASP B  2  293 ? 31.184   1.980   51.804   1.00 34.75  ? 294  ASP A O     1 
ATOM   3675  C  CB    . ASP B  2  293 ? 32.496   -0.325  50.750   1.00 40.37  ? 294  ASP A CB    1 
ATOM   3676  C  CG    . ASP B  2  293 ? 31.282   -0.839  49.985   1.00 43.80  ? 294  ASP A CG    1 
ATOM   3677  O  OD1   . ASP B  2  293 ? 30.827   -0.143  49.053   1.00 46.37  ? 294  ASP A OD1   1 
ATOM   3678  O  OD2   . ASP B  2  293 ? 30.800   -1.934  50.337   1.00 47.66  ? 294  ASP A OD2   1 
ATOM   3679  N  N     . GLU B  2  294 ? 31.740   3.190   49.955   1.00 37.05  ? 295  GLU A N     1 
ATOM   3680  C  CA    . GLU B  2  294 ? 30.760   4.297   50.142   1.00 43.56  ? 295  GLU A CA    1 
ATOM   3681  C  C     . GLU B  2  294 ? 29.426   3.927   49.485   1.00 40.98  ? 295  GLU A C     1 
ATOM   3682  O  O     . GLU B  2  294 ? 28.618   4.840   49.263   1.00 48.08  ? 295  GLU A O     1 
ATOM   3683  C  CB    . GLU B  2  294 ? 31.320   5.612   49.579   1.00 49.68  ? 295  GLU A CB    1 
ATOM   3684  C  CG    . GLU B  2  294 ? 32.503   6.128   50.371   1.00 56.57  ? 295  GLU A CG    1 
ATOM   3685  C  CD    . GLU B  2  294 ? 33.148   7.406   49.857   1.00 61.21  ? 295  GLU A CD    1 
ATOM   3686  O  OE1   . GLU B  2  294 ? 32.670   7.967   48.836   1.00 57.22  ? 295  GLU A OE1   1 
ATOM   3687  O  OE2   . GLU B  2  294 ? 34.166   7.815   50.472   1.00 66.33  ? 295  GLU A OE2   1 
ATOM   3688  N  N     . THR B  2  295 ? 29.188   2.649   49.204   1.00 36.88  ? 296  THR A N     1 
ATOM   3689  C  CA    . THR B  2  295 ? 27.885   2.186   48.673   1.00 40.76  ? 296  THR A CA    1 
ATOM   3690  C  C     . THR B  2  295 ? 26.793   2.594   49.662   1.00 43.94  ? 296  THR A C     1 
ATOM   3691  O  O     . THR B  2  295 ? 27.044   2.571   50.872   1.00 49.57  ? 296  THR A O     1 
ATOM   3692  C  CB    . THR B  2  295 ? 27.843   0.680   48.403   1.00 40.90  ? 296  THR A CB    1 
ATOM   3693  O  OG1   . THR B  2  295 ? 28.883   0.391   47.472   1.00 41.26  ? 296  THR A OG1   1 
ATOM   3694  C  CG2   . THR B  2  295 ? 26.499   0.231   47.865   1.00 38.23  ? 296  THR A CG2   1 
ATOM   3695  N  N     . SER B  2  296 ? 25.646   3.007   49.126   1.00 47.87  ? 297  SER A N     1 
ATOM   3696  C  CA    . SER B  2  296 ? 24.369   3.198   49.848   1.00 57.44  ? 297  SER A CA    1 
ATOM   3697  C  C     . SER B  2  296 ? 23.233   2.970   48.853   1.00 59.79  ? 297  SER A C     1 
ATOM   3698  O  O     . SER B  2  296 ? 23.486   3.077   47.645   1.00 55.37  ? 297  SER A O     1 
ATOM   3699  C  CB    . SER B  2  296 ? 24.309   4.565   50.454   1.00 64.69  ? 297  SER A CB    1 
ATOM   3700  O  OG    . SER B  2  296 ? 23.695   5.471   49.585   1.00 68.78  ? 297  SER A OG    1 
ATOM   3701  N  N     . LEU B  2  297 ? 22.025   2.692   49.328   1.00 62.48  ? 298  LEU A N     1 
ATOM   3702  C  CA    . LEU B  2  297 ? 20.863   2.449   48.431   1.00 65.00  ? 298  LEU A CA    1 
ATOM   3703  C  C     . LEU B  2  297 ? 20.534   3.759   47.689   1.00 61.89  ? 298  LEU A C     1 
ATOM   3704  O  O     . LEU B  2  297 ? 20.110   3.688   46.521   1.00 68.03  ? 298  LEU A O     1 
ATOM   3705  C  CB    . LEU B  2  297 ? 19.686   1.900   49.238   1.00 70.97  ? 298  LEU A CB    1 
ATOM   3706  C  CG    . LEU B  2  297 ? 19.923   0.549   49.923   1.00 69.06  ? 298  LEU A CG    1 
ATOM   3707  C  CD1   . LEU B  2  297 ? 18.635   0.080   50.561   1.00 66.01  ? 298  LEU A CD1   1 
ATOM   3708  C  CD2   . LEU B  2  297 ? 20.472   -0.514  48.968   1.00 65.96  ? 298  LEU A CD2   1 
ATOM   3709  N  N     . ARG B  2  298 ? 20.787   4.908   48.319   1.00 59.35  ? 299  ARG A N     1 
ATOM   3710  C  CA    . ARG B  2  298 ? 20.553   6.258   47.726   1.00 59.34  ? 299  ARG A CA    1 
ATOM   3711  C  C     . ARG B  2  298 ? 21.617   6.548   46.651   1.00 56.45  ? 299  ARG A C     1 
ATOM   3712  O  O     . ARG B  2  298 ? 21.225   6.899   45.545   1.00 52.12  ? 299  ARG A O     1 
ATOM   3713  C  CB    . ARG B  2  298 ? 20.526   7.314   48.840   1.00 59.56  ? 299  ARG A CB    1 
ATOM   3714  N  N     . THR B  2  299 ? 22.904   6.386   46.962   1.00 56.65  ? 300  THR A N     1 
ATOM   3715  C  CA    . THR B  2  299 ? 24.068   6.691   46.074   1.00 57.81  ? 300  THR A CA    1 
ATOM   3716  C  C     . THR B  2  299 ? 24.274   5.618   44.987   1.00 58.18  ? 300  THR A C     1 
ATOM   3717  O  O     . THR B  2  299 ? 24.897   5.947   43.975   1.00 56.67  ? 300  THR A O     1 
ATOM   3718  C  CB    . THR B  2  299 ? 25.413   6.717   46.832   1.00 62.77  ? 300  THR A CB    1 
ATOM   3719  O  OG1   . THR B  2  299 ? 25.389   7.339   48.125   1.00 58.55  ? 300  THR A OG1   1 
ATOM   3720  C  CG2   . THR B  2  299 ? 26.526   7.355   46.032   1.00 66.44  ? 300  THR A CG2   1 
ATOM   3721  N  N     . GLY B  2  300 ? 23.840   4.373   45.216   1.00 54.64  ? 301  GLY A N     1 
ATOM   3722  C  CA    . GLY B  2  300 ? 24.216   3.201   44.412   1.00 52.46  ? 301  GLY A CA    1 
ATOM   3723  C  C     . GLY B  2  300 ? 25.606   2.695   44.792   1.00 48.95  ? 301  GLY A C     1 
ATOM   3724  O  O     . GLY B  2  300 ? 26.135   3.094   45.872   1.00 56.66  ? 301  GLY A O     1 
ATOM   3725  N  N     . VAL B  2  301 ? 26.163   1.781   43.987   1.00 38.80  ? 302  VAL A N     1 
ATOM   3726  C  CA    . VAL B  2  301 ? 27.473   1.127   44.272   1.00 36.45  ? 302  VAL A CA    1 
ATOM   3727  C  C     . VAL B  2  301 ? 28.577   2.162   44.125   1.00 36.94  ? 302  VAL A C     1 
ATOM   3728  O  O     . VAL B  2  301 ? 28.614   2.828   43.092   1.00 35.27  ? 302  VAL A O     1 
ATOM   3729  C  CB    . VAL B  2  301 ? 27.734   -0.080  43.354   1.00 36.26  ? 302  VAL A CB    1 
ATOM   3730  C  CG1   . VAL B  2  301 ? 29.188   -0.550  43.430   1.00 36.35  ? 302  VAL A CG1   1 
ATOM   3731  C  CG2   . VAL B  2  301 ? 26.778   -1.220  43.643   1.00 37.96  ? 302  VAL A CG2   1 
ATOM   3732  N  N     . ARG B  2  302 ? 29.463   2.260   45.112   1.00 39.36  ? 303  ARG A N     1 
ATOM   3733  C  CA    . ARG B  2  302 ? 30.562   3.252   45.124   1.00 42.89  ? 303  ARG A CA    1 
ATOM   3734  C  C     . ARG B  2  302 ? 31.690   2.749   46.018   1.00 47.83  ? 303  ARG A C     1 
ATOM   3735  O  O     . ARG B  2  302 ? 31.596   2.925   47.244   1.00 57.03  ? 303  ARG A O     1 
ATOM   3736  C  CB    . ARG B  2  302 ? 30.032   4.601   45.609   1.00 43.99  ? 303  ARG A CB    1 
ATOM   3737  C  CG    . ARG B  2  302 ? 31.021   5.733   45.397   1.00 44.59  ? 303  ARG A CG    1 
ATOM   3738  C  CD    . ARG B  2  302 ? 30.497   7.002   46.032   1.00 47.39  ? 303  ARG A CD    1 
ATOM   3739  N  NE    . ARG B  2  302 ? 31.617   7.919   46.087   1.00 47.83  ? 303  ARG A NE    1 
ATOM   3740  C  CZ    . ARG B  2  302 ? 32.132   8.511   45.023   1.00 45.25  ? 303  ARG A CZ    1 
ATOM   3741  N  NH1   . ARG B  2  302 ? 31.604   8.330   43.823   1.00 41.40  ? 303  ARG A NH1   1 
ATOM   3742  N  NH2   . ARG B  2  302 ? 33.166   9.306   45.173   1.00 46.64  ? 303  ARG A NH2   1 
ATOM   3743  N  N     . VAL B  2  303 ? 32.698   2.124   45.421   1.00 51.34  ? 304  VAL A N     1 
ATOM   3744  C  CA    . VAL B  2  303 ? 33.925   1.639   46.109   1.00 55.02  ? 304  VAL A CA    1 
ATOM   3745  C  C     . VAL B  2  303 ? 35.048   2.605   45.747   1.00 54.11  ? 304  VAL A C     1 
ATOM   3746  O  O     . VAL B  2  303 ? 35.313   2.767   44.544   1.00 56.16  ? 304  VAL A O     1 
ATOM   3747  C  CB    . VAL B  2  303 ? 34.250   0.195   45.693   1.00 60.50  ? 304  VAL A CB    1 
ATOM   3748  C  CG1   . VAL B  2  303 ? 35.468   -0.355  46.419   1.00 66.19  ? 304  VAL A CG1   1 
ATOM   3749  C  CG2   . VAL B  2  303 ? 33.047   -0.720  45.873   1.00 59.74  ? 304  VAL A CG2   1 
ATOM   3750  N  N     . VAL B  2  304 ? 35.637   3.251   46.750   1.00 49.05  ? 305  VAL A N     1 
ATOM   3751  C  CA    . VAL B  2  304 ? 36.681   4.301   46.572   1.00 50.49  ? 305  VAL A CA    1 
ATOM   3752  C  C     . VAL B  2  304 ? 38.047   3.733   46.965   1.00 48.44  ? 305  VAL A C     1 
ATOM   3753  O  O     . VAL B  2  304 ? 38.147   3.149   48.045   1.00 55.10  ? 305  VAL A O     1 
ATOM   3754  C  CB    . VAL B  2  304 ? 36.331   5.565   47.380   1.00 56.14  ? 305  VAL A CB    1 
ATOM   3755  C  CG1   . VAL B  2  304 ? 37.350   6.662   47.138   1.00 60.66  ? 305  VAL A CG1   1 
ATOM   3756  C  CG2   . VAL B  2  304 ? 34.927   6.072   47.057   1.00 54.20  ? 305  VAL A CG2   1 
ATOM   3757  N  N     . ILE B  2  305 ? 39.050   3.915   46.113   1.00 44.36  ? 306  ILE A N     1 
ATOM   3758  C  CA    . ILE B  2  305 ? 40.465   3.498   46.328   1.00 43.21  ? 306  ILE A CA    1 
ATOM   3759  C  C     . ILE B  2  305 ? 41.342   4.746   46.180   1.00 48.02  ? 306  ILE A C     1 
ATOM   3760  O  O     . ILE B  2  305 ? 41.514   5.224   45.038   1.00 45.81  ? 306  ILE A O     1 
ATOM   3761  C  CB    . ILE B  2  305 ? 40.851   2.411   45.302   1.00 39.34  ? 306  ILE A CB    1 
ATOM   3762  C  CG1   . ILE B  2  305 ? 39.816   1.292   45.249   1.00 37.41  ? 306  ILE A CG1   1 
ATOM   3763  C  CG2   . ILE B  2  305 ? 42.256   1.874   45.554   1.00 38.66  ? 306  ILE A CG2   1 
ATOM   3764  C  CD1   . ILE B  2  305 ? 39.991   0.381   44.058   1.00 38.90  ? 306  ILE A CD1   1 
ATOM   3765  N  N     . ASP B  2  306 ? 41.846   5.278   47.296   1.00 53.19  ? 307  ASP A N     1 
ATOM   3766  C  CA    . ASP B  2  306 ? 42.701   6.497   47.317   1.00 57.68  ? 307  ASP A CA    1 
ATOM   3767  C  C     . ASP B  2  306 ? 44.118   6.102   46.877   1.00 59.81  ? 307  ASP A C     1 
ATOM   3768  O  O     . ASP B  2  306 ? 44.626   5.076   47.346   1.00 63.43  ? 307  ASP A O     1 
ATOM   3769  C  CB    . ASP B  2  306 ? 42.638   7.182   48.689   1.00 57.17  ? 307  ASP A CB    1 
ATOM   3770  C  CG    . ASP B  2  306 ? 41.301   7.836   48.995   1.00 65.44  ? 307  ASP A CG    1 
ATOM   3771  O  OD1   . ASP B  2  306 ? 40.408   7.843   48.103   1.00 67.20  ? 307  ASP A OD1   1 
ATOM   3772  O  OD2   . ASP B  2  306 ? 41.154   8.346   50.122   1.00 80.54  ? 307  ASP A OD2   1 
ATOM   3773  N  N     . VAL B  2  307 ? 44.725   6.911   46.003   1.00 58.37  ? 308  VAL A N     1 
ATOM   3774  C  CA    . VAL B  2  307 ? 46.073   6.682   45.396   1.00 54.15  ? 308  VAL A CA    1 
ATOM   3775  C  C     . VAL B  2  307 ? 47.059   7.725   45.945   1.00 48.99  ? 308  VAL A C     1 
ATOM   3776  O  O     . VAL B  2  307 ? 46.699   8.919   45.944   1.00 44.46  ? 308  VAL A O     1 
ATOM   3777  C  CB    . VAL B  2  307 ? 45.953   6.756   43.863   1.00 57.03  ? 308  VAL A CB    1 
ATOM   3778  C  CG1   . VAL B  2  307 ? 47.299   6.763   43.178   1.00 57.77  ? 308  VAL A CG1   1 
ATOM   3779  C  CG2   . VAL B  2  307 ? 45.068   5.655   43.310   1.00 56.88  ? 308  VAL A CG2   1 
ATOM   3780  N  N     . ARG B  2  308 ? 48.263   7.296   46.360   1.00 48.66  ? 309  ARG A N     1 
ATOM   3781  C  CA    . ARG B  2  308 ? 49.351   8.163   46.896   1.00 49.09  ? 309  ARG A CA    1 
ATOM   3782  C  C     . ARG B  2  308 ? 49.668   9.298   45.906   1.00 46.07  ? 309  ARG A C     1 
ATOM   3783  O  O     . ARG B  2  308 ? 49.607   9.028   44.670   1.00 47.39  ? 309  ARG A O     1 
ATOM   3784  C  CB    . ARG B  2  308 ? 50.619   7.341   47.178   1.00 53.51  ? 309  ARG A CB    1 
ATOM   3785  C  CG    . ARG B  2  308 ? 51.824   8.272   47.317   1.00 60.46  ? 309  ARG A CG    1 
ATOM   3786  C  CD    . ARG B  2  308 ? 53.052   7.786   48.091   1.00 63.21  ? 309  ARG A CD    1 
ATOM   3787  N  NE    . ARG B  2  308 ? 53.058   6.333   48.199   1.00 65.70  ? 309  ARG A NE    1 
ATOM   3788  C  CZ    . ARG B  2  308 ? 53.213   5.479   47.185   1.00 69.01  ? 309  ARG A CZ    1 
ATOM   3789  N  NH1   . ARG B  2  308 ? 53.388   5.918   45.948   1.00 63.71  ? 309  ARG A NH1   1 
ATOM   3790  N  NH2   . ARG B  2  308 ? 53.198   4.177   47.421   1.00 72.14  ? 309  ARG A NH2   1 
ATOM   3791  N  N     . LYS B  2  309 ? 50.007   10.503  46.408   1.00 43.64  ? 310  LYS A N     1 
ATOM   3792  C  CA    . LYS B  2  309 ? 50.245   11.694  45.541   1.00 42.47  ? 310  LYS A CA    1 
ATOM   3793  C  C     . LYS B  2  309 ? 51.437   11.370  44.616   1.00 47.90  ? 310  LYS A C     1 
ATOM   3794  O  O     . LYS B  2  309 ? 52.489   10.809  45.063   1.00 43.07  ? 310  LYS A O     1 
ATOM   3795  C  CB    . LYS B  2  309 ? 50.482   13.015  46.268   1.00 37.91  ? 310  LYS A CB    1 
ATOM   3796  N  N     . ASP B  2  310 ? 51.233   11.584  43.325   1.00 55.05  ? 311  ASP A N     1 
ATOM   3797  C  CA    . ASP B  2  310 ? 52.264   11.338  42.277   1.00 57.13  ? 311  ASP A CA    1 
ATOM   3798  C  C     . ASP B  2  310 ? 52.621   9.840   42.239   1.00 66.43  ? 311  ASP A C     1 
ATOM   3799  O  O     . ASP B  2  310 ? 53.760   9.504   41.853   1.00 79.55  ? 311  ASP A O     1 
ATOM   3800  C  CB    . ASP B  2  310 ? 53.489   12.198  42.537   1.00 58.81  ? 311  ASP A CB    1 
ATOM   3801  C  CG    . ASP B  2  310 ? 53.316   13.671  42.881   1.00 61.95  ? 311  ASP A CG    1 
ATOM   3802  O  OD1   . ASP B  2  310 ? 52.182   14.266  42.971   1.00 63.46  ? 311  ASP A OD1   1 
ATOM   3803  O  OD2   . ASP B  2  310 ? 54.366   14.235  43.040   1.00 57.88  ? 311  ASP A OD2   1 
ATOM   3804  N  N     . ALA B  2  311 ? 51.688   8.960   42.631   1.00 65.90  ? 312  ALA A N     1 
ATOM   3805  C  CA    . ALA B  2  311 ? 51.575   7.579   42.085   1.00 64.81  ? 312  ALA A CA    1 
ATOM   3806  C  C     . ALA B  2  311 ? 50.655   7.616   40.869   1.00 63.29  ? 312  ALA A C     1 
ATOM   3807  O  O     . ALA B  2  311 ? 49.667   8.390   40.902   1.00 61.89  ? 312  ALA A O     1 
ATOM   3808  C  CB    . ALA B  2  311 ? 51.038   6.621   43.111   1.00 65.40  ? 312  ALA A CB    1 
ATOM   3809  N  N     . ASN B  2  312 ? 50.958   6.816   39.840   1.00 59.47  ? 313  ASN A N     1 
ATOM   3810  C  CA    . ASN B  2  312 ? 50.152   6.741   38.594   1.00 58.31  ? 313  ASN A CA    1 
ATOM   3811  C  C     . ASN B  2  312 ? 48.904   5.892   38.863   1.00 52.84  ? 313  ASN A C     1 
ATOM   3812  O  O     . ASN B  2  312 ? 49.067   4.688   39.142   1.00 58.80  ? 313  ASN A O     1 
ATOM   3813  C  CB    . ASN B  2  312 ? 50.961   6.159   37.438   1.00 57.72  ? 313  ASN A CB    1 
ATOM   3814  C  CG    . ASN B  2  312 ? 50.201   6.209   36.133   1.00 58.24  ? 313  ASN A CG    1 
ATOM   3815  O  OD1   . ASN B  2  312 ? 48.999   5.918   36.087   1.00 56.02  ? 313  ASN A OD1   1 
ATOM   3816  N  ND2   . ASN B  2  312 ? 50.933   6.441   35.065   1.00 60.84  ? 313  ASN A ND2   1 
ATOM   3817  N  N     . ALA B  2  313 ? 47.706   6.479   38.758   1.00 45.80  ? 314  ALA A N     1 
ATOM   3818  C  CA    . ALA B  2  313 ? 46.431   5.815   39.104   1.00 42.56  ? 314  ALA A CA    1 
ATOM   3819  C  C     . ALA B  2  313 ? 46.044   4.795   38.028   1.00 40.42  ? 314  ALA A C     1 
ATOM   3820  O  O     . ALA B  2  313 ? 45.435   3.781   38.401   1.00 46.86  ? 314  ALA A O     1 
ATOM   3821  C  CB    . ALA B  2  313 ? 45.340   6.828   39.321   1.00 41.37  ? 314  ALA A CB    1 
ATOM   3822  N  N     . SER B  2  314 ? 46.370   5.039   36.752   1.00 38.31  ? 315  SER A N     1 
ATOM   3823  C  CA    . SER B  2  314 ? 46.011   4.146   35.617   1.00 37.51  ? 315  SER A CA    1 
ATOM   3824  C  C     . SER B  2  314 ? 46.751   2.811   35.765   1.00 42.14  ? 315  SER A C     1 
ATOM   3825  O  O     . SER B  2  314 ? 46.162   1.749   35.433   1.00 44.15  ? 315  SER A O     1 
ATOM   3826  C  CB    . SER B  2  314 ? 46.316   4.779   34.288   1.00 34.27  ? 315  SER A CB    1 
ATOM   3827  O  OG    . SER B  2  314 ? 45.493   5.900   34.060   1.00 34.41  ? 315  SER A OG    1 
ATOM   3828  N  N     . VAL B  2  315 ? 48.002   2.870   36.227   1.00 44.33  ? 316  VAL A N     1 
ATOM   3829  C  CA    . VAL B  2  315 ? 48.866   1.674   36.455   1.00 41.37  ? 316  VAL A CA    1 
ATOM   3830  C  C     . VAL B  2  315 ? 48.267   0.874   37.619   1.00 36.31  ? 316  VAL A C     1 
ATOM   3831  O  O     . VAL B  2  315 ? 48.135   -0.359  37.473   1.00 36.33  ? 316  VAL A O     1 
ATOM   3832  C  CB    . VAL B  2  315 ? 50.330   2.087   36.711   1.00 39.90  ? 316  VAL A CB    1 
ATOM   3833  C  CG1   . VAL B  2  315 ? 51.137   1.016   37.407   1.00 42.59  ? 316  VAL A CG1   1 
ATOM   3834  C  CG2   . VAL B  2  315 ? 51.004   2.520   35.426   1.00 38.10  ? 316  VAL A CG2   1 
ATOM   3835  N  N     . ILE B  2  316 ? 47.882   1.543   38.704   1.00 30.50  ? 317  ILE A N     1 
ATOM   3836  C  CA    . ILE B  2  316 ? 47.259   0.880   39.881   1.00 31.24  ? 317  ILE A CA    1 
ATOM   3837  C  C     . ILE B  2  316 ? 45.956   0.210   39.427   1.00 33.03  ? 317  ILE A C     1 
ATOM   3838  O  O     . ILE B  2  316 ? 45.715   -0.941  39.837   1.00 36.39  ? 317  ILE A O     1 
ATOM   3839  C  CB    . ILE B  2  316 ? 47.067   1.879   41.038   1.00 29.89  ? 317  ILE A CB    1 
ATOM   3840  C  CG1   . ILE B  2  316 ? 48.436   2.342   41.551   1.00 30.96  ? 317  ILE A CG1   1 
ATOM   3841  C  CG2   . ILE B  2  316 ? 46.222   1.295   42.152   1.00 27.42  ? 317  ILE A CG2   1 
ATOM   3842  C  CD1   . ILE B  2  316 ? 48.397   3.485   42.543   1.00 31.30  ? 317  ILE A CD1   1 
ATOM   3843  N  N     . LEU B  2  317 ? 45.163   0.867   38.580   1.00 35.16  ? 318  LEU A N     1 
ATOM   3844  C  CA    . LEU B  2  317 ? 43.880   0.289   38.102   1.00 37.10  ? 318  LEU A CA    1 
ATOM   3845  C  C     . LEU B  2  317 ? 44.172   -0.961  37.263   1.00 38.13  ? 318  LEU A C     1 
ATOM   3846  O  O     . LEU B  2  317 ? 43.471   -1.968  37.470   1.00 40.38  ? 318  LEU A O     1 
ATOM   3847  C  CB    . LEU B  2  317 ? 43.078   1.324   37.305   1.00 38.93  ? 318  LEU A CB    1 
ATOM   3848  C  CG    . LEU B  2  317 ? 41.697   0.851   36.842   1.00 42.76  ? 318  LEU A CG    1 
ATOM   3849  C  CD1   . LEU B  2  317 ? 40.831   0.400   38.004   1.00 41.84  ? 318  LEU A CD1   1 
ATOM   3850  C  CD2   . LEU B  2  317 ? 40.973   1.938   36.062   1.00 43.80  ? 318  LEU A CD2   1 
ATOM   3851  N  N     . ASN B  2  318 ? 45.152   -0.920  36.352   1.00 34.37  ? 319  ASN A N     1 
ATOM   3852  C  CA    . ASN B  2  318 ? 45.476   -2.094  35.498   1.00 36.35  ? 319  ASN A CA    1 
ATOM   3853  C  C     . ASN B  2  318 ? 45.953   -3.242  36.380   1.00 36.49  ? 319  ASN A C     1 
ATOM   3854  O  O     . ASN B  2  318 ? 45.595   -4.386  36.086   1.00 35.35  ? 319  ASN A O     1 
ATOM   3855  C  CB    . ASN B  2  318 ? 46.518   -1.799  34.418   1.00 38.79  ? 319  ASN A CB    1 
ATOM   3856  C  CG    . ASN B  2  318 ? 45.901   -1.206  33.167   1.00 38.06  ? 319  ASN A CG    1 
ATOM   3857  O  OD1   . ASN B  2  318 ? 44.836   -0.594  33.228   1.00 34.69  ? 319  ASN A OD1   1 
ATOM   3858  N  ND2   . ASN B  2  318 ? 46.546   -1.417  32.029   1.00 37.29  ? 319  ASN A ND2   1 
ATOM   3859  N  N     . ASN B  2  319 ? 46.736   -2.948  37.416   1.00 40.75  ? 320  ASN A N     1 
ATOM   3860  C  CA    . ASN B  2  319 ? 47.227   -3.980  38.372   1.00 45.80  ? 320  ASN A CA    1 
ATOM   3861  C  C     . ASN B  2  319 ? 46.022   -4.592  39.084   1.00 47.28  ? 320  ASN A C     1 
ATOM   3862  O  O     . ASN B  2  319 ? 45.981   -5.824  39.183   1.00 50.21  ? 320  ASN A O     1 
ATOM   3863  C  CB    . ASN B  2  319 ? 48.257   -3.430  39.362   1.00 48.78  ? 320  ASN A CB    1 
ATOM   3864  C  CG    . ASN B  2  319 ? 49.607   -3.190  38.704   1.00 53.00  ? 320  ASN A CG    1 
ATOM   3865  O  OD1   . ASN B  2  319 ? 49.892   -3.692  37.618   1.00 51.91  ? 320  ASN A OD1   1 
ATOM   3866  N  ND2   . ASN B  2  319 ? 50.448   -2.397  39.340   1.00 54.14  ? 320  ASN A ND2   1 
ATOM   3867  N  N     . LEU B  2  320 ? 45.084   -3.769  39.549   1.00 50.20  ? 321  LEU A N     1 
ATOM   3868  C  CA    . LEU B  2  320 ? 43.880   -4.245  40.279   1.00 50.95  ? 321  LEU A CA    1 
ATOM   3869  C  C     . LEU B  2  320 ? 43.092   -5.204  39.391   1.00 53.95  ? 321  LEU A C     1 
ATOM   3870  O  O     . LEU B  2  320 ? 42.583   -6.199  39.926   1.00 50.79  ? 321  LEU A O     1 
ATOM   3871  C  CB    . LEU B  2  320 ? 43.004   -3.059  40.691   1.00 50.09  ? 321  LEU A CB    1 
ATOM   3872  C  CG    . LEU B  2  320 ? 43.443   -2.334  41.953   1.00 55.42  ? 321  LEU A CG    1 
ATOM   3873  C  CD1   . LEU B  2  320 ? 42.641   -1.048  42.109   1.00 59.38  ? 321  LEU A CD1   1 
ATOM   3874  C  CD2   . LEU B  2  320 ? 43.294   -3.235  43.171   1.00 60.09  ? 321  LEU A CD2   1 
ATOM   3875  N  N     . TYR B  2  321 ? 42.980   -4.917  38.092   1.00 60.76  ? 322  TYR A N     1 
ATOM   3876  C  CA    . TYR B  2  321 ? 42.242   -5.788  37.145   1.00 70.47  ? 322  TYR A CA    1 
ATOM   3877  C  C     . TYR B  2  321 ? 42.944   -7.152  37.088   1.00 76.89  ? 322  TYR A C     1 
ATOM   3878  O  O     . TYR B  2  321 ? 42.261   -8.182  37.179   1.00 75.78  ? 322  TYR A O     1 
ATOM   3879  C  CB    . TYR B  2  321 ? 42.122   -5.161  35.750   1.00 70.57  ? 322  TYR A CB    1 
ATOM   3880  C  CG    . TYR B  2  321 ? 41.185   -3.980  35.611   1.00 67.19  ? 322  TYR A CG    1 
ATOM   3881  C  CD1   . TYR B  2  321 ? 40.011   -3.867  36.346   1.00 66.24  ? 322  TYR A CD1   1 
ATOM   3882  C  CD2   . TYR B  2  321 ? 41.454   -2.987  34.688   1.00 60.46  ? 322  TYR A CD2   1 
ATOM   3883  C  CE1   . TYR B  2  321 ? 39.149   -2.794  36.185   1.00 61.91  ? 322  TYR A CE1   1 
ATOM   3884  C  CE2   . TYR B  2  321 ? 40.610   -1.902  34.524   1.00 57.26  ? 322  TYR A CE2   1 
ATOM   3885  C  CZ    . TYR B  2  321 ? 39.453   -1.802  35.269   1.00 58.30  ? 322  TYR A CZ    1 
ATOM   3886  O  OH    . TYR B  2  321 ? 38.641   -0.728  35.068   1.00 56.74  ? 322  TYR A OH    1 
ATOM   3887  N  N     . LYS B  2  322 ? 44.276   -7.153  36.962   1.00 79.69  ? 323  LYS A N     1 
ATOM   3888  C  CA    . LYS B  2  322 ? 45.093   -8.391  36.828   1.00 79.29  ? 323  LYS A CA    1 
ATOM   3889  C  C     . LYS B  2  322 ? 45.008   -9.210  38.124   1.00 83.91  ? 323  LYS A C     1 
ATOM   3890  O  O     . LYS B  2  322 ? 45.005   -10.443 38.030   1.00 91.87  ? 323  LYS A O     1 
ATOM   3891  C  CB    . LYS B  2  322 ? 46.555   -8.070  36.508   1.00 73.30  ? 323  LYS A CB    1 
ATOM   3892  N  N     . GLN B  2  323 ? 44.920   -8.556  39.280   1.00 82.74  ? 324  GLN A N     1 
ATOM   3893  C  CA    . GLN B  2  323 ? 45.198   -9.205  40.587   1.00 82.00  ? 324  GLN A CA    1 
ATOM   3894  C  C     . GLN B  2  323 ? 43.926   -9.397  41.423   1.00 76.44  ? 324  GLN A C     1 
ATOM   3895  O  O     . GLN B  2  323 ? 44.047   -10.045 42.471   1.00 74.83  ? 324  GLN A O     1 
ATOM   3896  C  CB    . GLN B  2  323 ? 46.212   -8.378  41.377   1.00 93.92  ? 324  GLN A CB    1 
ATOM   3897  C  CG    . GLN B  2  323 ? 47.564   -8.237  40.698   1.00 105.77 ? 324  GLN A CG    1 
ATOM   3898  C  CD    . GLN B  2  323 ? 48.514   -7.400  41.535   1.00 123.85 ? 324  GLN A CD    1 
ATOM   3899  O  OE1   . GLN B  2  323 ? 48.653   -7.577  42.745   1.00 141.32 ? 324  GLN A OE1   1 
ATOM   3900  N  NE2   . GLN B  2  323 ? 49.179   -6.451  40.898   1.00 123.72 ? 324  GLN A NE2   1 
ATOM   3901  N  N     . THR B  2  324 ? 42.760   -8.873  41.018   1.00 66.31  ? 325  THR A N     1 
ATOM   3902  C  CA    . THR B  2  324 ? 41.499   -9.009  41.810   1.00 59.07  ? 325  THR A CA    1 
ATOM   3903  C  C     . THR B  2  324 ? 40.321   -9.377  40.910   1.00 57.00  ? 325  THR A C     1 
ATOM   3904  O  O     . THR B  2  324 ? 40.426   -9.337  39.685   1.00 59.21  ? 325  THR A O     1 
ATOM   3905  C  CB    . THR B  2  324 ? 41.189   -7.744  42.613   1.00 53.52  ? 325  THR A CB    1 
ATOM   3906  O  OG1   . THR B  2  324 ? 40.884   -6.691  41.701   1.00 61.78  ? 325  THR A OG1   1 
ATOM   3907  C  CG2   . THR B  2  324 ? 42.323   -7.340  43.520   1.00 55.21  ? 325  THR A CG2   1 
ATOM   3908  N  N     . PRO B  2  325 ? 39.167   -9.754  41.502   1.00 56.20  ? 326  PRO A N     1 
ATOM   3909  C  CA    . PRO B  2  325 ? 37.938   -9.972  40.741   1.00 59.86  ? 326  PRO A CA    1 
ATOM   3910  C  C     . PRO B  2  325 ? 37.312   -8.700  40.137   1.00 58.13  ? 326  PRO A C     1 
ATOM   3911  O  O     . PRO B  2  325 ? 36.247   -8.812  39.569   1.00 59.95  ? 326  PRO A O     1 
ATOM   3912  C  CB    . PRO B  2  325 ? 36.936   -10.547 41.763   1.00 61.84  ? 326  PRO A CB    1 
ATOM   3913  C  CG    . PRO B  2  325 ? 37.743   -10.877 43.003   1.00 57.32  ? 326  PRO A CG    1 
ATOM   3914  C  CD    . PRO B  2  325 ? 38.987   -10.021 42.938   1.00 57.00  ? 326  PRO A CD    1 
ATOM   3915  N  N     . LEU B  2  326 ? 37.950   -7.540  40.299   1.00 51.80  ? 327  LEU A N     1 
ATOM   3916  C  CA    . LEU B  2  326 ? 37.538   -6.267  39.643   1.00 52.45  ? 327  LEU A CA    1 
ATOM   3917  C  C     . LEU B  2  326 ? 37.398   -6.480  38.126   1.00 52.10  ? 327  LEU A C     1 
ATOM   3918  O  O     . LEU B  2  326 ? 36.600   -5.754  37.489   1.00 48.61  ? 327  LEU A O     1 
ATOM   3919  C  CB    . LEU B  2  326 ? 38.582   -5.191  39.956   1.00 55.95  ? 327  LEU A CB    1 
ATOM   3920  C  CG    . LEU B  2  326 ? 38.031   -3.772  40.040   1.00 61.21  ? 327  LEU A CG    1 
ATOM   3921  C  CD1   . LEU B  2  326 ? 37.293   -3.579  41.354   1.00 64.51  ? 327  LEU A CD1   1 
ATOM   3922  C  CD2   . LEU B  2  326 ? 39.166   -2.763  39.894   1.00 66.04  ? 327  LEU A CD2   1 
ATOM   3923  N  N     . GLN B  2  327 ? 38.191   -7.408  37.570   1.00 51.37  ? 328  GLN A N     1 
ATOM   3924  C  CA    . GLN B  2  327 ? 37.971   -8.027  36.233   1.00 47.63  ? 328  GLN A CA    1 
ATOM   3925  C  C     . GLN B  2  327 ? 37.829   -9.523  36.488   1.00 51.82  ? 328  GLN A C     1 
ATOM   3926  O  O     . GLN B  2  327 ? 38.667   -10.082 37.220   1.00 58.26  ? 328  GLN A O     1 
ATOM   3927  C  CB    . GLN B  2  327 ? 39.106   -7.730  35.243   1.00 44.75  ? 328  GLN A CB    1 
ATOM   3928  C  CG    . GLN B  2  327 ? 39.046   -8.510  33.944   1.00 44.16  ? 328  GLN A CG    1 
ATOM   3929  C  CD    . GLN B  2  327 ? 39.985   -8.026  32.857   1.00 44.83  ? 328  GLN A CD    1 
ATOM   3930  O  OE1   . GLN B  2  327 ? 40.601   -6.990  32.954   1.00 45.23  ? 328  GLN A OE1   1 
ATOM   3931  N  NE2   . GLN B  2  327 ? 40.147   -8.783  31.788   1.00 41.33  ? 328  GLN A NE2   1 
ATOM   3932  N  N     . THR B  2  328 ? 36.765   -10.128 35.951   1.00 54.10  ? 329  THR A N     1 
ATOM   3933  C  CA    . THR B  2  328 ? 36.466   -11.581 36.066   1.00 55.03  ? 329  THR A CA    1 
ATOM   3934  C  C     . THR B  2  328 ? 36.097   -12.087 34.676   1.00 54.39  ? 329  THR A C     1 
ATOM   3935  O  O     . THR B  2  328 ? 35.522   -11.306 33.915   1.00 52.01  ? 329  THR A O     1 
ATOM   3936  C  CB    . THR B  2  328 ? 35.366   -11.838 37.099   1.00 57.50  ? 329  THR A CB    1 
ATOM   3937  O  OG1   . THR B  2  328 ? 35.795   -11.402 38.383   1.00 58.83  ? 329  THR A OG1   1 
ATOM   3938  C  CG2   . THR B  2  328 ? 34.998   -13.292 37.216   1.00 59.60  ? 329  THR A CG2   1 
ATOM   3939  N  N     . SER B  2  329 ? 36.413   -13.348 34.387   1.00 59.41  ? 330  SER A N     1 
ATOM   3940  C  CA    . SER B  2  329 ? 35.943   -14.050 33.164   1.00 65.18  ? 330  SER A CA    1 
ATOM   3941  C  C     . SER B  2  329 ? 34.593   -14.707 33.460   1.00 61.08  ? 330  SER A C     1 
ATOM   3942  O  O     . SER B  2  329 ? 34.434   -15.211 34.588   1.00 61.63  ? 330  SER A O     1 
ATOM   3943  C  CB    . SER B  2  329 ? 36.957   -15.052 32.717   1.00 71.81  ? 330  SER A CB    1 
ATOM   3944  O  OG    . SER B  2  329 ? 36.391   -15.962 31.792   1.00 81.91  ? 330  SER A OG    1 
ATOM   3945  N  N     . PHE B  2  330 ? 33.653   -14.687 32.507   1.00 56.90  ? 331  PHE A N     1 
ATOM   3946  C  CA    . PHE B  2  330 ? 32.418   -15.511 32.551   1.00 62.80  ? 331  PHE A CA    1 
ATOM   3947  C  C     . PHE B  2  330 ? 32.590   -16.665 31.562   1.00 68.69  ? 331  PHE A C     1 
ATOM   3948  O  O     . PHE B  2  330 ? 32.567   -16.416 30.347   1.00 61.30  ? 331  PHE A O     1 
ATOM   3949  C  CB    . PHE B  2  330 ? 31.156   -14.713 32.218   1.00 61.83  ? 331  PHE A CB    1 
ATOM   3950  C  CG    . PHE B  2  330 ? 29.873   -15.473 32.455   1.00 61.90  ? 331  PHE A CG    1 
ATOM   3951  C  CD1   . PHE B  2  330 ? 29.433   -16.429 31.545   1.00 60.66  ? 331  PHE A CD1   1 
ATOM   3952  C  CD2   . PHE B  2  330 ? 29.099   -15.235 33.593   1.00 64.55  ? 331  PHE A CD2   1 
ATOM   3953  C  CE1   . PHE B  2  330 ? 28.251   -17.116 31.761   1.00 62.93  ? 331  PHE A CE1   1 
ATOM   3954  C  CE2   . PHE B  2  330 ? 27.916   -15.929 33.797   1.00 69.13  ? 331  PHE A CE2   1 
ATOM   3955  C  CZ    . PHE B  2  330 ? 27.498   -16.875 32.886   1.00 67.03  ? 331  PHE A CZ    1 
ATOM   3956  N  N     . GLY B  2  331 ? 32.757   -17.892 32.071   1.00 77.31  ? 332  GLY A N     1 
ATOM   3957  C  CA    . GLY B  2  331 ? 33.036   -19.085 31.259   1.00 78.03  ? 332  GLY A CA    1 
ATOM   3958  C  C     . GLY B  2  331 ? 31.753   -19.678 30.706   1.00 78.20  ? 332  GLY A C     1 
ATOM   3959  O  O     . GLY B  2  331 ? 31.173   -20.560 31.379   1.00 63.80  ? 332  GLY A O     1 
ATOM   3960  N  N     . VAL B  2  332 ? 31.343   -19.248 29.505   1.00 83.14  ? 333  VAL A N     1 
ATOM   3961  C  CA    . VAL B  2  332 ? 30.095   -19.719 28.845   1.00 83.13  ? 333  VAL A CA    1 
ATOM   3962  C  C     . VAL B  2  332 ? 30.236   -21.211 28.515   1.00 84.51  ? 333  VAL A C     1 
ATOM   3963  O  O     . VAL B  2  332 ? 31.237   -21.614 27.877   1.00 84.50  ? 333  VAL A O     1 
ATOM   3964  C  CB    . VAL B  2  332 ? 29.742   -18.908 27.587   1.00 72.90  ? 333  VAL A CB    1 
ATOM   3965  C  CG1   . VAL B  2  332 ? 28.478   -19.437 26.929   1.00 63.24  ? 333  VAL A CG1   1 
ATOM   3966  C  CG2   . VAL B  2  332 ? 29.578   -17.427 27.892   1.00 76.67  ? 333  VAL A CG2   1 
ATOM   3967  N  N     . ASN B  2  333 ? 29.232   -21.990 28.923   1.00 81.46  ? 334  ASN A N     1 
ATOM   3968  C  CA    . ASN B  2  333 ? 29.149   -23.453 28.710   1.00 80.79  ? 334  ASN A CA    1 
ATOM   3969  C  C     . ASN B  2  333 ? 27.663   -23.772 28.558   1.00 73.23  ? 334  ASN A C     1 
ATOM   3970  O  O     . ASN B  2  333 ? 27.022   -24.126 29.577   1.00 77.08  ? 334  ASN A O     1 
ATOM   3971  C  CB    . ASN B  2  333 ? 29.836   -24.198 29.859   1.00 92.36  ? 334  ASN A CB    1 
ATOM   3972  C  CG    . ASN B  2  333 ? 29.918   -25.692 29.655   1.00 98.19  ? 334  ASN A CG    1 
ATOM   3973  O  OD1   . ASN B  2  333 ? 29.952   -26.186 28.532   1.00 108.51 ? 334  ASN A OD1   1 
ATOM   3974  N  ND2   . ASN B  2  333 ? 29.939   -26.426 30.757   1.00 104.42 ? 334  ASN A ND2   1 
ATOM   3975  N  N     . MET B  2  334 ? 27.121   -23.578 27.350   1.00 60.36  ? 335  MET A N     1 
ATOM   3976  C  CA    . MET B  2  334 ? 25.654   -23.521 27.126   1.00 58.50  ? 335  MET A CA    1 
ATOM   3977  C  C     . MET B  2  334 ? 25.101   -24.937 26.971   1.00 57.06  ? 335  MET A C     1 
ATOM   3978  O  O     . MET B  2  334 ? 24.823   -25.352 25.836   1.00 50.75  ? 335  MET A O     1 
ATOM   3979  C  CB    . MET B  2  334 ? 25.310   -22.674 25.903   1.00 58.82  ? 335  MET A CB    1 
ATOM   3980  C  CG    . MET B  2  334 ? 25.661   -21.217 26.076   1.00 64.16  ? 335  MET A CG    1 
ATOM   3981  S  SD    . MET B  2  334 ? 24.422   -20.103 25.299   1.00 64.30  ? 335  MET A SD    1 
ATOM   3982  C  CE    . MET B  2  334 ? 24.695   -20.557 23.599   1.00 65.32  ? 335  MET A CE    1 
ATOM   3983  N  N     . ILE B  2  335 ? 24.958   -25.630 28.101   1.00 65.06  ? 336  ILE A N     1 
ATOM   3984  C  CA    . ILE B  2  335 ? 24.372   -26.996 28.194   1.00 71.13  ? 336  ILE A CA    1 
ATOM   3985  C  C     . ILE B  2  335 ? 23.009   -26.890 28.877   1.00 66.19  ? 336  ILE A C     1 
ATOM   3986  O  O     . ILE B  2  335 ? 22.950   -26.405 30.018   1.00 63.64  ? 336  ILE A O     1 
ATOM   3987  C  CB    . ILE B  2  335 ? 25.318   -27.965 28.927   1.00 79.96  ? 336  ILE A CB    1 
ATOM   3988  C  CG1   . ILE B  2  335 ? 26.569   -28.256 28.095   1.00 86.54  ? 336  ILE A CG1   1 
ATOM   3989  C  CG2   . ILE B  2  335 ? 24.593   -29.241 29.310   1.00 80.01  ? 336  ILE A CG2   1 
ATOM   3990  C  CD1   . ILE B  2  335 ? 27.639   -29.032 28.830   1.00 89.34  ? 336  ILE A CD1   1 
ATOM   3991  N  N     . ALA B  2  336 ? 21.970   -27.336 28.182   1.00 66.41  ? 337  ALA A N     1 
ATOM   3992  C  CA    . ALA B  2  336 ? 20.576   -27.443 28.674   1.00 71.15  ? 337  ALA A CA    1 
ATOM   3993  C  C     . ALA B  2  336 ? 19.982   -28.764 28.181   1.00 70.67  ? 337  ALA A C     1 
ATOM   3994  O  O     . ALA B  2  336 ? 20.594   -29.392 27.290   1.00 68.52  ? 337  ALA A O     1 
ATOM   3995  C  CB    . ALA B  2  336 ? 19.754   -26.264 28.193   1.00 76.51  ? 337  ALA A CB    1 
ATOM   3996  N  N     . LEU B  2  337 ? 18.820   -29.127 28.724   1.00 70.54  ? 338  LEU A N     1 
ATOM   3997  C  CA    . LEU B  2  337 ? 18.053   -30.341 28.360   1.00 70.71  ? 338  LEU A CA    1 
ATOM   3998  C  C     . LEU B  2  337 ? 17.202   -30.053 27.121   1.00 75.89  ? 338  LEU A C     1 
ATOM   3999  O  O     . LEU B  2  337 ? 16.381   -29.130 27.167   1.00 68.03  ? 338  LEU A O     1 
ATOM   4000  C  CB    . LEU B  2  337 ? 17.187   -30.753 29.553   1.00 69.38  ? 338  LEU A CB    1 
ATOM   4001  C  CG    . LEU B  2  337 ? 17.968   -31.158 30.799   1.00 78.00  ? 338  LEU A CG    1 
ATOM   4002  C  CD1   . LEU B  2  337 ? 17.043   -31.304 32.006   1.00 80.40  ? 338  LEU A CD1   1 
ATOM   4003  C  CD2   . LEU B  2  337 ? 18.747   -32.445 30.535   1.00 81.44  ? 338  LEU A CD2   1 
ATOM   4004  N  N     . VAL B  2  338 ? 17.413   -30.838 26.063   1.00 82.80  ? 339  VAL A N     1 
ATOM   4005  C  CA    . VAL B  2  338 ? 16.642   -30.821 24.785   1.00 79.10  ? 339  VAL A CA    1 
ATOM   4006  C  C     . VAL B  2  338 ? 16.054   -32.224 24.593   1.00 74.09  ? 339  VAL A C     1 
ATOM   4007  O  O     . VAL B  2  338 ? 16.851   -33.180 24.522   1.00 68.04  ? 339  VAL A O     1 
ATOM   4008  C  CB    . VAL B  2  338 ? 17.547   -30.415 23.604   1.00 83.48  ? 339  VAL A CB    1 
ATOM   4009  C  CG1   . VAL B  2  338 ? 16.775   -30.347 22.293   1.00 85.63  ? 339  VAL A CG1   1 
ATOM   4010  C  CG2   . VAL B  2  338 ? 18.276   -29.105 23.870   1.00 82.97  ? 339  VAL A CG2   1 
ATOM   4011  N  N     . ASN B  2  339 ? 14.721   -32.337 24.529   1.00 71.91  ? 340  ASN A N     1 
ATOM   4012  C  CA    . ASN B  2  339 ? 13.980   -33.634 24.522   1.00 65.90  ? 340  ASN A CA    1 
ATOM   4013  C  C     . ASN B  2  339 ? 14.556   -34.510 25.639   1.00 62.30  ? 340  ASN A C     1 
ATOM   4014  O  O     . ASN B  2  339 ? 14.900   -35.673 25.363   1.00 70.37  ? 340  ASN A O     1 
ATOM   4015  C  CB    . ASN B  2  339 ? 14.003   -34.315 23.145   1.00 62.55  ? 340  ASN A CB    1 
ATOM   4016  C  CG    . ASN B  2  339 ? 13.515   -33.405 22.029   1.00 58.80  ? 340  ASN A CG    1 
ATOM   4017  O  OD1   . ASN B  2  339 ? 12.758   -32.467 22.261   1.00 59.13  ? 340  ASN A OD1   1 
ATOM   4018  N  ND2   . ASN B  2  339 ? 13.940   -33.648 20.804   1.00 49.96  ? 340  ASN A ND2   1 
ATOM   4019  N  N     . GLY B  2  340 ? 14.708   -33.934 26.837   1.00 59.68  ? 341  GLY A N     1 
ATOM   4020  C  CA    . GLY B  2  340 ? 15.092   -34.630 28.082   1.00 59.71  ? 341  GLY A CA    1 
ATOM   4021  C  C     . GLY B  2  340 ? 16.561   -35.039 28.147   1.00 62.19  ? 341  GLY A C     1 
ATOM   4022  O  O     . GLY B  2  340 ? 16.915   -35.743 29.114   1.00 63.74  ? 341  GLY A O     1 
ATOM   4023  N  N     . ARG B  2  341 ? 17.404   -34.620 27.198   1.00 61.67  ? 342  ARG A N     1 
ATOM   4024  C  CA    . ARG B  2  341 ? 18.849   -34.997 27.167   1.00 67.21  ? 342  ARG A CA    1 
ATOM   4025  C  C     . ARG B  2  341 ? 19.722   -33.747 27.177   1.00 60.63  ? 342  ARG A C     1 
ATOM   4026  O  O     . ARG B  2  341 ? 19.394   -32.762 26.522   1.00 56.24  ? 342  ARG A O     1 
ATOM   4027  C  CB    . ARG B  2  341 ? 19.179   -35.822 25.922   1.00 71.56  ? 342  ARG A CB    1 
ATOM   4028  C  CG    . ARG B  2  341 ? 18.328   -37.073 25.762   1.00 70.02  ? 342  ARG A CG    1 
ATOM   4029  C  CD    . ARG B  2  341 ? 18.867   -37.955 24.654   1.00 69.71  ? 342  ARG A CD    1 
ATOM   4030  N  NE    . ARG B  2  341 ? 17.841   -38.935 24.300   1.00 73.21  ? 342  ARG A NE    1 
ATOM   4031  C  CZ    . ARG B  2  341 ? 16.686   -38.646 23.704   1.00 75.03  ? 342  ARG A CZ    1 
ATOM   4032  N  NH1   . ARG B  2  341 ? 16.393   -37.407 23.332   1.00 75.32  ? 342  ARG A NH1   1 
ATOM   4033  N  NH2   . ARG B  2  341 ? 15.824   -39.619 23.460   1.00 79.08  ? 342  ARG A NH2   1 
ATOM   4034  N  N     . PRO B  2  342 ? 20.882   -33.757 27.874   1.00 59.06  ? 343  PRO A N     1 
ATOM   4035  C  CA    . PRO B  2  342 ? 21.760   -32.594 27.901   1.00 64.70  ? 343  PRO A CA    1 
ATOM   4036  C  C     . PRO B  2  342 ? 22.430   -32.438 26.533   1.00 68.84  ? 343  PRO A C     1 
ATOM   4037  O  O     . PRO B  2  342 ? 22.960   -33.403 26.051   1.00 72.72  ? 343  PRO A O     1 
ATOM   4038  C  CB    . PRO B  2  342 ? 22.792   -32.918 28.977   1.00 64.67  ? 343  PRO A CB    1 
ATOM   4039  C  CG    . PRO B  2  342 ? 22.857   -34.432 28.970   1.00 66.36  ? 343  PRO A CG    1 
ATOM   4040  C  CD    . PRO B  2  342 ? 21.443   -34.892 28.622   1.00 60.34  ? 343  PRO A CD    1 
ATOM   4041  N  N     . LYS B  2  343 ? 22.362   -31.239 25.952   1.00 71.59  ? 344  LYS A N     1 
ATOM   4042  C  CA    . LYS B  2  343 ? 23.017   -30.897 24.666   1.00 74.56  ? 344  LYS A CA    1 
ATOM   4043  C  C     . LYS B  2  343 ? 23.798   -29.589 24.848   1.00 82.01  ? 344  LYS A C     1 
ATOM   4044  O  O     . LYS B  2  343 ? 23.243   -28.656 25.468   1.00 101.77 ? 344  LYS A O     1 
ATOM   4045  C  CB    . LYS B  2  343 ? 21.950   -30.808 23.567   1.00 69.95  ? 344  LYS A CB    1 
ATOM   4046  C  CG    . LYS B  2  343 ? 21.282   -32.115 23.167   1.00 67.70  ? 344  LYS A CG    1 
ATOM   4047  N  N     . LEU B  2  344 ? 25.045   -29.532 24.365   1.00 82.12  ? 345  LEU A N     1 
ATOM   4048  C  CA    . LEU B  2  344 ? 25.783   -28.251 24.166   1.00 78.00  ? 345  LEU A CA    1 
ATOM   4049  C  C     . LEU B  2  344 ? 25.150   -27.563 22.956   1.00 68.01  ? 345  LEU A C     1 
ATOM   4050  O  O     . LEU B  2  344 ? 25.137   -28.168 21.878   1.00 63.35  ? 345  LEU A O     1 
ATOM   4051  C  CB    . LEU B  2  344 ? 27.280   -28.494 23.937   1.00 78.51  ? 345  LEU A CB    1 
ATOM   4052  C  CG    . LEU B  2  344 ? 28.141   -27.231 23.817   1.00 76.32  ? 345  LEU A CG    1 
ATOM   4053  C  CD1   . LEU B  2  344 ? 28.242   -26.505 25.147   1.00 82.27  ? 345  LEU A CD1   1 
ATOM   4054  C  CD2   . LEU B  2  344 ? 29.547   -27.549 23.340   1.00 72.98  ? 345  LEU A CD2   1 
ATOM   4055  N  N     . ILE B  2  345 ? 24.604   -26.369 23.143   1.00 58.25  ? 346  ILE A N     1 
ATOM   4056  C  CA    . ILE B  2  345 ? 23.800   -25.674 22.101   1.00 55.00  ? 346  ILE A CA    1 
ATOM   4057  C  C     . ILE B  2  345 ? 24.439   -24.316 21.822   1.00 55.47  ? 346  ILE A C     1 
ATOM   4058  O  O     . ILE B  2  345 ? 25.031   -23.741 22.740   1.00 51.41  ? 346  ILE A O     1 
ATOM   4059  C  CB    . ILE B  2  345 ? 22.325   -25.569 22.532   1.00 53.40  ? 346  ILE A CB    1 
ATOM   4060  C  CG1   . ILE B  2  345 ? 22.161   -24.789 23.839   1.00 54.35  ? 346  ILE A CG1   1 
ATOM   4061  C  CG2   . ILE B  2  345 ? 21.714   -26.948 22.623   1.00 53.26  ? 346  ILE A CG2   1 
ATOM   4062  C  CD1   . ILE B  2  345 ? 20.717   -24.602 24.261   1.00 56.03  ? 346  ILE A CD1   1 
ATOM   4063  N  N     . ASN B  2  346 ? 24.353   -23.868 20.571   1.00 64.66  ? 347  ASN A N     1 
ATOM   4064  C  CA    . ASN B  2  346 ? 24.764   -22.509 20.152   1.00 69.31  ? 347  ASN A CA    1 
ATOM   4065  C  C     . ASN B  2  346 ? 23.567   -21.581 20.374   1.00 65.32  ? 347  ASN A C     1 
ATOM   4066  O  O     . ASN B  2  346 ? 22.473   -22.082 20.711   1.00 55.39  ? 347  ASN A O     1 
ATOM   4067  C  CB    . ASN B  2  346 ? 25.295   -22.491 18.717   1.00 78.14  ? 347  ASN A CB    1 
ATOM   4068  C  CG    . ASN B  2  346 ? 24.272   -22.942 17.696   1.00 87.90  ? 347  ASN A CG    1 
ATOM   4069  O  OD1   . ASN B  2  346 ? 23.187   -22.373 17.602   1.00 90.44  ? 347  ASN A OD1   1 
ATOM   4070  N  ND2   . ASN B  2  346 ? 24.606   -23.972 16.932   1.00 95.01  ? 347  ASN A ND2   1 
ATOM   4071  N  N     . LEU B  2  347 ? 23.768   -20.275 20.187   1.00 68.39  ? 348  LEU A N     1 
ATOM   4072  C  CA    . LEU B  2  347 ? 22.698   -19.265 20.355   1.00 76.44  ? 348  LEU A CA    1 
ATOM   4073  C  C     . LEU B  2  347 ? 21.488   -19.662 19.498   1.00 78.13  ? 348  LEU A C     1 
ATOM   4074  O  O     . LEU B  2  347 ? 20.363   -19.595 20.003   1.00 71.93  ? 348  LEU A O     1 
ATOM   4075  C  CB    . LEU B  2  347 ? 23.252   -17.889 19.980   1.00 81.20  ? 348  LEU A CB    1 
ATOM   4076  C  CG    . LEU B  2  347 ? 22.219   -16.756 19.931   1.00 85.25  ? 348  LEU A CG    1 
ATOM   4077  C  CD1   . LEU B  2  347 ? 21.501   -16.603 21.261   1.00 88.65  ? 348  LEU A CD1   1 
ATOM   4078  C  CD2   . LEU B  2  347 ? 22.891   -15.445 19.541   1.00 89.01  ? 348  LEU A CD2   1 
ATOM   4079  N  N     . LYS B  2  348 ? 21.702   -20.063 18.245   1.00 87.67  ? 349  LYS A N     1 
ATOM   4080  C  CA    . LYS B  2  348 ? 20.578   -20.316 17.303   1.00 90.65  ? 349  LYS A CA    1 
ATOM   4081  C  C     . LYS B  2  348 ? 19.766   -21.543 17.756   1.00 93.22  ? 349  LYS A C     1 
ATOM   4082  O  O     . LYS B  2  348 ? 18.530   -21.457 17.716   1.00 95.14  ? 349  LYS A O     1 
ATOM   4083  C  CB    . LYS B  2  348 ? 21.066   -20.455 15.861   1.00 87.16  ? 349  LYS A CB    1 
ATOM   4084  C  CG    . LYS B  2  348 ? 19.954   -20.839 14.891   1.00 85.93  ? 349  LYS A CG    1 
ATOM   4085  C  CD    . LYS B  2  348 ? 20.208   -20.375 13.471   1.00 85.36  ? 349  LYS A CD    1 
ATOM   4086  C  CE    . LYS B  2  348 ? 19.329   -21.110 12.485   1.00 91.27  ? 349  LYS A CE    1 
ATOM   4087  N  NZ    . LYS B  2  348 ? 19.715   -20.844 11.089   1.00 90.37  ? 349  LYS A NZ    1 
ATOM   4088  N  N     . GLU B  2  349 ? 20.398   -22.641 18.179   1.00 94.05  ? 350  GLU A N     1 
ATOM   4089  C  CA    . GLU B  2  349 ? 19.660   -23.848 18.647   1.00 96.68  ? 350  GLU A CA    1 
ATOM   4090  C  C     . GLU B  2  349 ? 18.725   -23.451 19.796   1.00 104.30 ? 350  GLU A C     1 
ATOM   4091  O  O     . GLU B  2  349 ? 17.544   -23.847 19.765   1.00 110.24 ? 350  GLU A O     1 
ATOM   4092  C  CB    . GLU B  2  349 ? 20.601   -24.947 19.129   1.00 89.97  ? 350  GLU A CB    1 
ATOM   4093  C  CG    . GLU B  2  349 ? 21.413   -25.584 18.018   1.00 89.45  ? 350  GLU A CG    1 
ATOM   4094  C  CD    . GLU B  2  349 ? 22.362   -26.660 18.514   1.00 87.51  ? 350  GLU A CD    1 
ATOM   4095  O  OE1   . GLU B  2  349 ? 21.857   -27.719 18.939   1.00 91.85  ? 350  GLU A OE1   1 
ATOM   4096  O  OE2   . GLU B  2  349 ? 23.598   -26.420 18.518   1.00 66.64  ? 350  GLU A OE2   1 
ATOM   4097  N  N     . ALA B  2  350 ? 19.248   -22.693 20.764   1.00 101.28 ? 351  ALA A N     1 
ATOM   4098  C  CA    . ALA B  2  350 ? 18.508   -22.228 21.960   1.00 84.89  ? 351  ALA A CA    1 
ATOM   4099  C  C     . ALA B  2  350 ? 17.253   -21.445 21.535   1.00 81.64  ? 351  ALA A C     1 
ATOM   4100  O  O     . ALA B  2  350 ? 16.177   -21.683 22.130   1.00 74.83  ? 351  ALA A O     1 
ATOM   4101  C  CB    . ALA B  2  350 ? 19.409   -21.406 22.845   1.00 77.83  ? 351  ALA A CB    1 
ATOM   4102  N  N     . LEU B  2  351 ? 17.385   -20.549 20.550   1.00 87.95  ? 352  LEU A N     1 
ATOM   4103  C  CA    . LEU B  2  351 ? 16.278   -19.686 20.053   1.00 96.33  ? 352  LEU A CA    1 
ATOM   4104  C  C     . LEU B  2  351 ? 15.289   -20.535 19.241   1.00 101.53 ? 352  LEU A C     1 
ATOM   4105  O  O     . LEU B  2  351 ? 14.066   -20.296 19.343   1.00 116.71 ? 352  LEU A O     1 
ATOM   4106  C  CB    . LEU B  2  351 ? 16.836   -18.556 19.189   1.00 100.23 ? 352  LEU A CB    1 
ATOM   4107  C  CG    . LEU B  2  351 ? 17.589   -17.440 19.908   1.00 102.46 ? 352  LEU A CG    1 
ATOM   4108  C  CD1   . LEU B  2  351 ? 18.090   -16.396 18.912   1.00 106.53 ? 352  LEU A CD1   1 
ATOM   4109  C  CD2   . LEU B  2  351 ? 16.730   -16.779 20.968   1.00 92.55  ? 352  LEU A CD2   1 
ATOM   4110  N  N     . VAL B  2  352 ? 15.806   -21.463 18.430   1.00 101.63 ? 353  VAL A N     1 
ATOM   4111  C  CA    . VAL B  2  352 ? 14.980   -22.375 17.590   1.00 99.11  ? 353  VAL A CA    1 
ATOM   4112  C  C     . VAL B  2  352 ? 14.120   -23.251 18.510   1.00 88.21  ? 353  VAL A C     1 
ATOM   4113  O  O     . VAL B  2  352 ? 12.895   -23.312 18.284   1.00 72.51  ? 353  VAL A O     1 
ATOM   4114  C  CB    . VAL B  2  352 ? 15.849   -23.221 16.638   1.00 101.59 ? 353  VAL A CB    1 
ATOM   4115  C  CG1   . VAL B  2  352 ? 15.088   -24.425 16.096   1.00 103.02 ? 353  VAL A CG1   1 
ATOM   4116  C  CG2   . VAL B  2  352 ? 16.423   -22.394 15.500   1.00 100.93 ? 353  VAL A CG2   1 
ATOM   4117  N  N     . HIS B  2  353 ? 14.729   -23.899 19.509   1.00 88.20  ? 354  HIS A N     1 
ATOM   4118  C  CA    . HIS B  2  353 ? 13.993   -24.775 20.460   1.00 92.85  ? 354  HIS A CA    1 
ATOM   4119  C  C     . HIS B  2  353 ? 12.914   -23.954 21.174   1.00 103.00 ? 354  HIS A C     1 
ATOM   4120  O  O     . HIS B  2  353 ? 11.814   -24.503 21.401   1.00 98.64  ? 354  HIS A O     1 
ATOM   4121  C  CB    . HIS B  2  353 ? 14.945   -25.495 21.417   1.00 92.01  ? 354  HIS A CB    1 
ATOM   4122  C  CG    . HIS B  2  353 ? 15.737   -26.556 20.730   1.00 93.44  ? 354  HIS A CG    1 
ATOM   4123  N  ND1   . HIS B  2  353 ? 15.161   -27.408 19.801   1.00 85.10  ? 354  HIS A ND1   1 
ATOM   4124  C  CD2   . HIS B  2  353 ? 17.049   -26.884 20.802   1.00 100.75 ? 354  HIS A CD2   1 
ATOM   4125  C  CE1   . HIS B  2  353 ? 16.082   -28.227 19.342   1.00 94.10  ? 354  HIS A CE1   1 
ATOM   4126  N  NE2   . HIS B  2  353 ? 17.249   -27.921 19.933   1.00 104.28 ? 354  HIS A NE2   1 
ATOM   4127  N  N     . TYR B  2  354 ? 13.200   -22.683 21.481   1.00 111.60 ? 355  TYR A N     1 
ATOM   4128  C  CA    . TYR B  2  354 ? 12.250   -21.788 22.189   1.00 107.02 ? 355  TYR A CA    1 
ATOM   4129  C  C     . TYR B  2  354 ? 11.066   -21.458 21.270   1.00 95.55  ? 355  TYR A C     1 
ATOM   4130  O  O     . TYR B  2  354 ? 9.912    -21.607 21.702   1.00 88.63  ? 355  TYR A O     1 
ATOM   4131  C  CB    . TYR B  2  354 ? 12.882   -20.477 22.659   1.00 106.58 ? 355  TYR A CB    1 
ATOM   4132  C  CG    . TYR B  2  354 ? 11.846   -19.550 23.248   1.00 105.62 ? 355  TYR A CG    1 
ATOM   4133  C  CD1   . TYR B  2  354 ? 11.229   -19.864 24.447   1.00 101.30 ? 355  TYR A CD1   1 
ATOM   4134  C  CD2   . TYR B  2  354 ? 11.417   -18.412 22.579   1.00 101.27 ? 355  TYR A CD2   1 
ATOM   4135  C  CE1   . TYR B  2  354 ? 10.247   -19.056 24.994   1.00 94.15  ? 355  TYR A CE1   1 
ATOM   4136  C  CE2   . TYR B  2  354 ? 10.442   -17.586 23.115   1.00 99.52  ? 355  TYR A CE2   1 
ATOM   4137  C  CZ    . TYR B  2  354 ? 9.851    -17.912 24.325   1.00 97.39  ? 355  TYR A CZ    1 
ATOM   4138  O  OH    . TYR B  2  354 ? 8.879    -17.123 24.868   1.00 94.47  ? 355  TYR A OH    1 
ATOM   4139  N  N     . LEU B  2  355 ? 11.357   -20.985 20.060   1.00 92.05  ? 356  LEU A N     1 
ATOM   4140  C  CA    . LEU B  2  355 ? 10.312   -20.617 19.077   1.00 92.06  ? 356  LEU A CA    1 
ATOM   4141  C  C     . LEU B  2  355 ? 9.406    -21.830 18.813   1.00 92.21  ? 356  LEU A C     1 
ATOM   4142  O  O     . LEU B  2  355 ? 8.167    -21.648 18.713   1.00 81.70  ? 356  LEU A O     1 
ATOM   4143  C  CB    . LEU B  2  355 ? 10.963   -20.123 17.783   1.00 85.33  ? 356  LEU A CB    1 
ATOM   4144  C  CG    . LEU B  2  355 ? 9.997    -19.737 16.675   1.00 86.80  ? 356  LEU A CG    1 
ATOM   4145  C  CD1   . LEU B  2  355 ? 9.057    -18.640 17.151   1.00 85.61  ? 356  LEU A CD1   1 
ATOM   4146  C  CD2   . LEU B  2  355 ? 10.796   -19.279 15.449   1.00 94.78  ? 356  LEU A CD2   1 
ATOM   4147  N  N     A GLU B  2  356 ? 10.006   -23.026 18.715   0.50 92.24  ? 357  GLU A N     1 
ATOM   4148  N  N     B GLU B  2  356 ? 10.005   -23.026 18.715   0.50 89.58  ? 357  GLU A N     1 
ATOM   4149  C  CA    A GLU B  2  356 ? 9.261    -24.284 18.443   0.50 89.68  ? 357  GLU A CA    1 
ATOM   4150  C  CA    B GLU B  2  356 ? 9.259    -24.287 18.446   0.50 85.53  ? 357  GLU A CA    1 
ATOM   4151  C  C     A GLU B  2  356 ? 8.322    -24.566 19.632   0.50 88.53  ? 357  GLU A C     1 
ATOM   4152  C  C     B GLU B  2  356 ? 8.321    -24.567 19.633   0.50 86.07  ? 357  GLU A C     1 
ATOM   4153  O  O     A GLU B  2  356 ? 7.162    -24.997 19.396   0.50 96.30  ? 357  GLU A O     1 
ATOM   4154  O  O     B GLU B  2  356 ? 7.162    -24.997 19.396   0.50 93.90  ? 357  GLU A O     1 
ATOM   4155  C  CB    A GLU B  2  356 ? 10.235   -25.433 18.151   0.50 86.42  ? 357  GLU A CB    1 
ATOM   4156  C  CB    B GLU B  2  356 ? 10.245   -25.422 18.144   0.50 79.46  ? 357  GLU A CB    1 
ATOM   4157  C  CG    A GLU B  2  356 ? 9.822    -26.335 16.998   0.50 84.27  ? 357  GLU A CG    1 
ATOM   4158  C  CG    B GLU B  2  356 ? 9.706    -26.833 18.194   0.50 75.73  ? 357  GLU A CG    1 
ATOM   4159  C  CD    A GLU B  2  356 ? 9.837    -25.680 15.623   0.50 84.83  ? 357  GLU A CD    1 
ATOM   4160  C  CD    B GLU B  2  356 ? 10.842   -27.846 18.201   0.50 73.66  ? 357  GLU A CD    1 
ATOM   4161  O  OE1   A GLU B  2  356 ? 9.465    -24.488 15.518   0.50 90.02  ? 357  GLU A OE1   1 
ATOM   4162  O  OE1   B GLU B  2  356 ? 12.015   -27.419 18.117   0.50 65.87  ? 357  GLU A OE1   1 
ATOM   4163  O  OE2   A GLU B  2  356 ? 10.142   -26.360 14.630   0.50 78.73  ? 357  GLU A OE2   1 
ATOM   4164  O  OE2   B GLU B  2  356 ? 10.561   -29.052 18.305   0.50 75.89  ? 357  GLU A OE2   1 
ATOM   4165  N  N     . HIS B  2  357 ? 8.795    -24.308 20.854   1.00 83.63  ? 358  HIS A N     1 
ATOM   4166  C  CA    . HIS B  2  357 ? 7.998    -24.474 22.097   1.00 85.74  ? 358  HIS A CA    1 
ATOM   4167  C  C     . HIS B  2  357 ? 6.784    -23.535 22.054   1.00 85.93  ? 358  HIS A C     1 
ATOM   4168  O  O     . HIS B  2  357 ? 5.702    -23.966 22.464   1.00 91.50  ? 358  HIS A O     1 
ATOM   4169  C  CB    . HIS B  2  357 ? 8.866    -24.248 23.340   1.00 86.37  ? 358  HIS A CB    1 
ATOM   4170  C  CG    . HIS B  2  357 ? 8.126    -24.310 24.630   1.00 84.56  ? 358  HIS A CG    1 
ATOM   4171  N  ND1   . HIS B  2  357 ? 7.467    -25.453 25.045   1.00 87.74  ? 358  HIS A ND1   1 
ATOM   4172  C  CD2   . HIS B  2  357 ? 7.965    -23.391 25.609   1.00 84.96  ? 358  HIS A CD2   1 
ATOM   4173  C  CE1   . HIS B  2  357 ? 6.914    -25.232 26.221   1.00 99.35  ? 358  HIS A CE1   1 
ATOM   4174  N  NE2   . HIS B  2  357 ? 7.205    -23.972 26.590   1.00 99.98  ? 358  HIS A NE2   1 
ATOM   4175  N  N     . GLN B  2  358 ? 6.964    -22.313 21.554   1.00 84.23  ? 359  GLN A N     1 
ATOM   4176  C  CA    . GLN B  2  358 ? 5.883    -21.296 21.498   1.00 85.44  ? 359  GLN A CA    1 
ATOM   4177  C  C     . GLN B  2  358 ? 4.820    -21.733 20.479   1.00 90.79  ? 359  GLN A C     1 
ATOM   4178  O  O     . GLN B  2  358 ? 3.589    -21.679 20.811   1.00 83.72  ? 359  GLN A O     1 
ATOM   4179  C  CB    . GLN B  2  358 ? 6.461    -19.920 21.178   1.00 83.86  ? 359  GLN A CB    1 
ATOM   4180  C  CG    . GLN B  2  358 ? 7.406    -19.406 22.261   1.00 81.06  ? 359  GLN A CG    1 
ATOM   4181  C  CD    . GLN B  2  358 ? 6.665    -19.207 23.560   1.00 83.78  ? 359  GLN A CD    1 
ATOM   4182  O  OE1   . GLN B  2  358 ? 5.899    -18.256 23.716   1.00 75.89  ? 359  GLN A OE1   1 
ATOM   4183  N  NE2   . GLN B  2  358 ? 6.872    -20.124 24.495   1.00 87.43  ? 359  GLN A NE2   1 
ATOM   4184  N  N     . LYS B  2  359 ? 5.269    -22.161 19.289   1.00 101.46 ? 360  LYS A N     1 
ATOM   4185  C  CA    . LYS B  2  359 ? 4.346    -22.650 18.235   1.00 104.87 ? 360  LYS A CA    1 
ATOM   4186  C  C     . LYS B  2  359 ? 3.465    -23.756 18.850   1.00 98.41  ? 360  LYS A C     1 
ATOM   4187  O  O     . LYS B  2  359 ? 2.222    -23.694 18.662   1.00 103.94 ? 360  LYS A O     1 
ATOM   4188  C  CB    . LYS B  2  359 ? 5.124    -23.113 17.000   1.00 97.86  ? 360  LYS A CB    1 
ATOM   4189  C  CG    . LYS B  2  359 ? 5.683    -21.995 16.126   1.00 100.59 ? 360  LYS A CG    1 
ATOM   4190  C  CD    . LYS B  2  359 ? 6.847    -22.354 15.236   1.00 99.29  ? 360  LYS A CD    1 
ATOM   4191  C  CE    . LYS B  2  359 ? 6.465    -23.055 13.956   1.00 90.22  ? 360  LYS A CE    1 
ATOM   4192  N  NZ    . LYS B  2  359 ? 7.606    -23.847 13.464   1.00 93.17  ? 360  LYS A NZ    1 
ATOM   4193  N  N     . THR B  2  360 ? 4.077    -24.681 19.602   1.00 82.16  ? 361  THR A N     1 
ATOM   4194  C  CA    . THR B  2  360 ? 3.384    -25.822 20.261   1.00 75.30  ? 361  THR A CA    1 
ATOM   4195  C  C     . THR B  2  360 ? 2.354    -25.297 21.267   1.00 79.38  ? 361  THR A C     1 
ATOM   4196  O  O     . THR B  2  360 ? 1.197    -25.731 21.204   1.00 81.67  ? 361  THR A O     1 
ATOM   4197  C  CB    . THR B  2  360 ? 4.367    -26.753 20.980   1.00 67.37  ? 361  THR A CB    1 
ATOM   4198  O  OG1   . THR B  2  360 ? 5.237    -27.279 19.986   1.00 57.72  ? 361  THR A OG1   1 
ATOM   4199  C  CG2   . THR B  2  360 ? 3.701    -27.880 21.730   1.00 67.96  ? 361  THR A CG2   1 
ATOM   4200  N  N     . VAL B  2  361 ? 2.784    -24.407 22.165   1.00 82.28  ? 362  VAL A N     1 
ATOM   4201  C  CA    . VAL B  2  361 ? 1.934    -23.845 23.258   1.00 78.06  ? 362  VAL A CA    1 
ATOM   4202  C  C     . VAL B  2  361 ? 0.713    -23.142 22.644   1.00 73.42  ? 362  VAL A C     1 
ATOM   4203  O  O     . VAL B  2  361 ? -0.415   -23.385 23.129   1.00 58.46  ? 362  VAL A O     1 
ATOM   4204  C  CB    . VAL B  2  361 ? 2.725    -22.908 24.185   1.00 80.32  ? 362  VAL A CB    1 
ATOM   4205  C  CG1   . VAL B  2  361 ? 1.804    -22.007 25.005   1.00 77.58  ? 362  VAL A CG1   1 
ATOM   4206  C  CG2   . VAL B  2  361 ? 3.676    -23.693 25.085   1.00 91.96  ? 362  VAL A CG2   1 
ATOM   4207  N  N     . VAL B  2  362 ? 0.918    -22.305 21.623   1.00 76.10  ? 363  VAL A N     1 
ATOM   4208  C  CA    . VAL B  2  362 ? -0.210   -21.519 21.042   1.00 81.23  ? 363  VAL A CA    1 
ATOM   4209  C  C     . VAL B  2  362 ? -1.155   -22.463 20.267   1.00 84.25  ? 363  VAL A C     1 
ATOM   4210  O  O     . VAL B  2  362 ? -2.404   -22.303 20.389   1.00 89.33  ? 363  VAL A O     1 
ATOM   4211  C  CB    . VAL B  2  362 ? 0.276    -20.340 20.190   1.00 80.97  ? 363  VAL A CB    1 
ATOM   4212  C  CG1   . VAL B  2  362 ? -0.877   -19.698 19.425   1.00 79.02  ? 363  VAL A CG1   1 
ATOM   4213  C  CG2   . VAL B  2  362 ? 0.973    -19.304 21.053   1.00 78.21  ? 363  VAL A CG2   1 
ATOM   4214  N  N     . ARG B  2  363 ? -0.589   -23.423 19.519   1.00 84.18  ? 364  ARG A N     1 
ATOM   4215  C  CA    . ARG B  2  363 ? -1.420   -24.425 18.800   1.00 88.24  ? 364  ARG A CA    1 
ATOM   4216  C  C     . ARG B  2  363 ? -2.309   -25.167 19.823   1.00 89.75  ? 364  ARG A C     1 
ATOM   4217  O  O     . ARG B  2  363 ? -3.548   -25.192 19.670   1.00 93.59  ? 364  ARG A O     1 
ATOM   4218  C  CB    . ARG B  2  363 ? -0.553   -25.396 17.992   1.00 85.18  ? 364  ARG A CB    1 
ATOM   4219  C  CG    . ARG B  2  363 ? -1.367   -26.436 17.228   1.00 79.19  ? 364  ARG A CG    1 
ATOM   4220  C  CD    . ARG B  2  363 ? -0.723   -27.162 16.075   1.00 78.71  ? 364  ARG A CD    1 
ATOM   4221  N  NE    . ARG B  2  363 ? 0.400    -26.455 15.449   1.00 77.14  ? 364  ARG A NE    1 
ATOM   4222  C  CZ    . ARG B  2  363 ? 1.673    -26.495 15.858   1.00 70.74  ? 364  ARG A CZ    1 
ATOM   4223  N  NH1   . ARG B  2  363 ? 2.027    -27.188 16.931   1.00 69.06  ? 364  ARG A NH1   1 
ATOM   4224  N  NH2   . ARG B  2  363 ? 2.590    -25.811 15.196   1.00 70.90  ? 364  ARG A NH2   1 
ATOM   4225  N  N     . ARG B  2  364 ? -1.690   -25.741 20.852   1.00 80.69  ? 365  ARG A N     1 
ATOM   4226  C  CA    . ARG B  2  364 ? -2.395   -26.537 21.890   1.00 75.63  ? 365  ARG A CA    1 
ATOM   4227  C  C     . ARG B  2  364 ? -3.431   -25.677 22.615   1.00 74.53  ? 365  ARG A C     1 
ATOM   4228  O  O     . ARG B  2  364 ? -4.542   -26.192 22.861   1.00 60.13  ? 365  ARG A O     1 
ATOM   4229  C  CB    . ARG B  2  364 ? -1.389   -27.131 22.863   1.00 74.97  ? 365  ARG A CB    1 
ATOM   4230  C  CG    . ARG B  2  364 ? -0.568   -28.253 22.254   1.00 80.05  ? 365  ARG A CG    1 
ATOM   4231  C  CD    . ARG B  2  364 ? 0.404    -28.893 23.181   1.00 77.74  ? 365  ARG A CD    1 
ATOM   4232  N  NE    . ARG B  2  364 ? -0.248   -29.285 24.421   1.00 74.47  ? 365  ARG A NE    1 
ATOM   4233  C  CZ    . ARG B  2  364 ? 0.253    -30.149 25.273   1.00 77.55  ? 365  ARG A CZ    1 
ATOM   4234  N  NH1   . ARG B  2  364 ? 1.427    -30.723 25.049   1.00 74.99  ? 365  ARG A NH1   1 
ATOM   4235  N  NH2   . ARG B  2  364 ? -0.428   -30.424 26.364   1.00 84.63  ? 365  ARG A NH2   1 
ATOM   4236  N  N     . ARG B  2  365 ? -3.094   -24.427 22.939   1.00 82.28  ? 366  ARG A N     1 
ATOM   4237  C  CA    . ARG B  2  365 ? -4.052   -23.503 23.601   1.00 82.60  ? 366  ARG A CA    1 
ATOM   4238  C  C     . ARG B  2  365 ? -5.299   -23.403 22.710   1.00 81.19  ? 366  ARG A C     1 
ATOM   4239  O  O     . ARG B  2  365 ? -6.425   -23.525 23.238   1.00 85.89  ? 366  ARG A O     1 
ATOM   4240  C  CB    . ARG B  2  365 ? -3.462   -22.111 23.848   1.00 83.65  ? 366  ARG A CB    1 
ATOM   4241  C  CG    . ARG B  2  365 ? -4.398   -21.184 24.620   1.00 81.87  ? 366  ARG A CG    1 
ATOM   4242  C  CD    . ARG B  2  365 ? -3.819   -19.786 24.707   1.00 79.95  ? 366  ARG A CD    1 
ATOM   4243  N  NE    . ARG B  2  365 ? -3.946   -19.086 23.451   1.00 87.47  ? 366  ARG A NE    1 
ATOM   4244  C  CZ    . ARG B  2  365 ? -3.212   -18.027 23.076   1.00 90.14  ? 366  ARG A CZ    1 
ATOM   4245  N  NH1   . ARG B  2  365 ? -2.194   -17.623 23.802   1.00 82.27  ? 366  ARG A NH1   1 
ATOM   4246  N  NH2   . ARG B  2  365 ? -3.445   -17.410 21.934   1.00 96.94  ? 366  ARG A NH2   1 
ATOM   4247  N  N     . THR B  2  366 ? -5.069   -23.193 21.406   1.00 84.01  ? 367  THR A N     1 
ATOM   4248  C  CA    . THR B  2  366 ? -6.139   -22.985 20.403   1.00 91.88  ? 367  THR A CA    1 
ATOM   4249  C  C     . THR B  2  366 ? -7.000   -24.259 20.292   1.00 94.61  ? 367  THR A C     1 
ATOM   4250  O  O     . THR B  2  366 ? -8.256   -24.149 20.300   1.00 79.53  ? 367  THR A O     1 
ATOM   4251  C  CB    . THR B  2  366 ? -5.549   -22.556 19.062   1.00 91.71  ? 367  THR A CB    1 
ATOM   4252  O  OG1   . THR B  2  366 ? -4.878   -21.309 19.284   1.00 81.30  ? 367  THR A OG1   1 
ATOM   4253  C  CG2   . THR B  2  366 ? -6.612   -22.432 17.988   1.00 94.93  ? 367  THR A CG2   1 
ATOM   4254  N  N     . GLN B  2  367 ? -6.338   -25.417 20.198   1.00 98.34  ? 368  GLN A N     1 
ATOM   4255  C  CA    . GLN B  2  367 ? -7.009   -26.743 20.165   1.00 105.51 ? 368  GLN A CA    1 
ATOM   4256  C  C     . GLN B  2  367 ? -7.895   -26.898 21.414   1.00 109.67 ? 368  GLN A C     1 
ATOM   4257  O  O     . GLN B  2  367 ? -9.040   -27.377 21.286   1.00 100.27 ? 368  GLN A O     1 
ATOM   4258  C  CB    . GLN B  2  367 ? -5.972   -27.865 20.066   1.00 101.25 ? 368  GLN A CB    1 
ATOM   4259  C  CG    . GLN B  2  367 ? -5.364   -27.992 18.687   1.00 91.32  ? 368  GLN A CG    1 
ATOM   4260  C  CD    . GLN B  2  367 ? -4.162   -28.885 18.609   1.00 82.88  ? 368  GLN A CD    1 
ATOM   4261  O  OE1   . GLN B  2  367 ? -3.579   -29.238 19.613   1.00 68.33  ? 368  GLN A OE1   1 
ATOM   4262  N  NE2   . GLN B  2  367 ? -3.791   -29.265 17.401   1.00 87.78  ? 368  GLN A NE2   1 
ATOM   4263  N  N     . TYR B  2  368 ? -7.378   -26.511 22.580   1.00 119.66 ? 369  TYR A N     1 
ATOM   4264  C  CA    . TYR B  2  368 ? -8.083   -26.610 23.882   1.00 123.87 ? 369  TYR A CA    1 
ATOM   4265  C  C     . TYR B  2  368 ? -9.285   -25.659 23.889   1.00 122.91 ? 369  TYR A C     1 
ATOM   4266  O  O     . TYR B  2  368 ? -10.373  -26.086 24.314   1.00 127.94 ? 369  TYR A O     1 
ATOM   4267  C  CB    . TYR B  2  368 ? -7.153   -26.288 25.048   1.00 115.47 ? 369  TYR A CB    1 
ATOM   4268  C  CG    . TYR B  2  368 ? -7.863   -26.097 26.369   1.00 105.88 ? 369  TYR A CG    1 
ATOM   4269  C  CD1   . TYR B  2  368 ? -8.356   -24.856 26.743   1.00 92.73  ? 369  TYR A CD1   1 
ATOM   4270  C  CD2   . TYR B  2  368 ? -8.058   -27.156 27.241   1.00 102.51 ? 369  TYR A CD2   1 
ATOM   4271  C  CE1   . TYR B  2  368 ? -9.014   -24.670 27.948   1.00 84.15  ? 369  TYR A CE1   1 
ATOM   4272  C  CE2   . TYR B  2  368 ? -8.694   -26.985 28.457   1.00 95.67  ? 369  TYR A CE2   1 
ATOM   4273  C  CZ    . TYR B  2  368 ? -9.197   -25.742 28.796   1.00 86.21  ? 369  TYR A CZ    1 
ATOM   4274  O  OH    . TYR B  2  368 ? -9.847   -25.582 29.985   1.00 84.10  ? 369  TYR A OH    1 
ATOM   4275  N  N     . ASN B  2  369 ? -9.083   -24.402 23.475   1.00 107.59 ? 370  ASN A N     1 
ATOM   4276  C  CA    . ASN B  2  369 ? -10.157  -23.378 23.476   1.00 100.89 ? 370  ASN A CA    1 
ATOM   4277  C  C     . ASN B  2  369 ? -11.304  -23.865 22.575   1.00 95.69  ? 370  ASN A C     1 
ATOM   4278  O  O     . ASN B  2  369 ? -12.487  -23.691 22.973   1.00 93.62  ? 370  ASN A O     1 
ATOM   4279  C  CB    . ASN B  2  369 ? -9.643   -22.007 23.056   1.00 104.52 ? 370  ASN A CB    1 
ATOM   4280  C  CG    . ASN B  2  369 ? -8.755   -21.369 24.104   1.00 108.02 ? 370  ASN A CG    1 
ATOM   4281  O  OD1   . ASN B  2  369 ? -9.025   -21.486 25.299   1.00 112.96 ? 370  ASN A OD1   1 
ATOM   4282  N  ND2   . ASN B  2  369 ? -7.680   -20.710 23.685   1.00 107.78 ? 370  ASN A ND2   1 
ATOM   4283  N  N     . LEU B  2  370 ? -10.950  -24.454 21.421   1.00 96.61  ? 371  LEU A N     1 
ATOM   4284  C  CA    . LEU B  2  370 ? -11.914  -25.022 20.445   1.00 93.12  ? 371  LEU A CA    1 
ATOM   4285  C  C     . LEU B  2  370 ? -12.702  -26.179 21.086   1.00 92.68  ? 371  LEU A C     1 
ATOM   4286  O  O     . LEU B  2  370 ? -13.942  -26.183 20.988   1.00 95.74  ? 371  LEU A O     1 
ATOM   4287  C  CB    . LEU B  2  370 ? -11.148  -25.512 19.214   1.00 84.10  ? 371  LEU A CB    1 
ATOM   4288  C  CG    . LEU B  2  370 ? -12.007  -26.058 18.080   1.00 72.38  ? 371  LEU A CG    1 
ATOM   4289  C  CD1   . LEU B  2  370 ? -12.777  -24.930 17.458   1.00 69.22  ? 371  LEU A CD1   1 
ATOM   4290  C  CD2   . LEU B  2  370 ? -11.146  -26.738 17.031   1.00 72.43  ? 371  LEU A CD2   1 
ATOM   4291  N  N     . ARG B  2  371 ? -11.986  -27.135 21.687   1.00 83.17  ? 372  ARG A N     1 
ATOM   4292  C  CA    . ARG B  2  371 ? -12.579  -28.273 22.432   1.00 78.41  ? 372  ARG A CA    1 
ATOM   4293  C  C     . ARG B  2  371 ? -13.623  -27.746 23.426   1.00 79.58  ? 372  ARG A C     1 
ATOM   4294  O  O     . ARG B  2  371 ? -14.771  -28.200 23.365   1.00 84.68  ? 372  ARG A O     1 
ATOM   4295  C  CB    . ARG B  2  371 ? -11.482  -29.052 23.157   1.00 80.50  ? 372  ARG A CB    1 
ATOM   4296  C  CG    . ARG B  2  371 ? -11.892  -30.449 23.599   1.00 91.86  ? 372  ARG A CG    1 
ATOM   4297  C  CD    . ARG B  2  371 ? -10.622  -31.326 23.615   1.00 94.84  ? 372  ARG A CD    1 
ATOM   4298  N  NE    . ARG B  2  371 ? -9.583   -30.863 24.546   1.00 94.98  ? 372  ARG A NE    1 
ATOM   4299  C  CZ    . ARG B  2  371 ? -8.391   -30.330 24.219   1.00 91.47  ? 372  ARG A CZ    1 
ATOM   4300  N  NH1   . ARG B  2  371 ? -8.078   -30.100 22.956   1.00 82.43  ? 372  ARG A NH1   1 
ATOM   4301  N  NH2   . ARG B  2  371 ? -7.588   -29.984 25.188   1.00 96.58  ? 372  ARG A NH2   1 
ATOM   4302  N  N     . LYS B  2  372 ? -13.235  -26.810 24.298   1.00 80.99  ? 373  LYS A N     1 
ATOM   4303  C  CA    . LYS B  2  372 ? -14.100  -26.280 25.394   1.00 78.20  ? 373  LYS A CA    1 
ATOM   4304  C  C     . LYS B  2  372 ? -15.309  -25.551 24.790   1.00 70.97  ? 373  LYS A C     1 
ATOM   4305  O  O     . LYS B  2  372 ? -16.443  -25.764 25.282   1.00 63.64  ? 373  LYS A O     1 
ATOM   4306  C  CB    . LYS B  2  372 ? -13.310  -25.393 26.356   1.00 83.42  ? 373  LYS A CB    1 
ATOM   4307  C  CG    . LYS B  2  372 ? -12.379  -26.160 27.293   1.00 100.56 ? 373  LYS A CG    1 
ATOM   4308  C  CD    . LYS B  2  372 ? -13.019  -27.270 28.168   1.00 101.74 ? 373  LYS A CD    1 
ATOM   4309  C  CE    . LYS B  2  372 ? -12.083  -28.423 28.486   1.00 93.94  ? 373  LYS A CE    1 
ATOM   4310  N  NZ    . LYS B  2  372 ? -11.757  -29.252 27.290   1.00 95.03  ? 373  LYS A NZ    1 
ATOM   4311  N  N     . ALA B  2  373 ? -15.080  -24.740 23.753   1.00 73.21  ? 374  ALA A N     1 
ATOM   4312  C  CA    . ALA B  2  373 ? -16.130  -23.944 23.081   1.00 86.43  ? 374  ALA A CA    1 
ATOM   4313  C  C     . ALA B  2  373 ? -17.182  -24.876 22.452   1.00 100.27 ? 374  ALA A C     1 
ATOM   4314  O  O     . ALA B  2  373 ? -18.388  -24.568 22.559   1.00 106.29 ? 374  ALA A O     1 
ATOM   4315  C  CB    . ALA B  2  373 ? -15.507  -23.036 22.057   1.00 94.48  ? 374  ALA A CB    1 
ATOM   4316  N  N     . LYS B  2  374 ? -16.726  -25.943 21.785   1.00 104.44 ? 375  LYS A N     1 
ATOM   4317  C  CA    . LYS B  2  374 ? -17.601  -26.945 21.109   1.00 91.04  ? 375  LYS A CA    1 
ATOM   4318  C  C     . LYS B  2  374 ? -18.439  -27.678 22.170   1.00 87.07  ? 375  LYS A C     1 
ATOM   4319  O  O     . LYS B  2  374 ? -19.663  -27.707 22.024   1.00 80.11  ? 375  LYS A O     1 
ATOM   4320  C  CB    . LYS B  2  374 ? -16.775  -27.905 20.248   1.00 82.42  ? 375  LYS A CB    1 
ATOM   4321  C  CG    . LYS B  2  374 ? -16.379  -27.351 18.897   1.00 81.38  ? 375  LYS A CG    1 
ATOM   4322  C  CD    . LYS B  2  374 ? -15.393  -28.245 18.218   1.00 90.58  ? 375  LYS A CD    1 
ATOM   4323  C  CE    . LYS B  2  374 ? -15.467  -28.124 16.715   1.00 95.34  ? 375  LYS A CE    1 
ATOM   4324  N  NZ    . LYS B  2  374 ? -14.245  -28.650 16.070   1.00 94.96  ? 375  LYS A NZ    1 
ATOM   4325  N  N     . ASP B  2  375 ? -17.809  -28.208 23.216   1.00 86.06  ? 376  ASP A N     1 
ATOM   4326  C  CA    . ASP B  2  375 ? -18.497  -28.835 24.378   1.00 92.79  ? 376  ASP A CA    1 
ATOM   4327  C  C     . ASP B  2  375 ? -19.611  -27.905 24.883   1.00 90.57  ? 376  ASP A C     1 
ATOM   4328  O  O     . ASP B  2  375 ? -20.730  -28.418 25.183   1.00 88.82  ? 376  ASP A O     1 
ATOM   4329  C  CB    . ASP B  2  375 ? -17.520  -29.137 25.514   1.00 103.31 ? 376  ASP A CB    1 
ATOM   4330  C  CG    . ASP B  2  375 ? -16.656  -30.364 25.295   1.00 116.14 ? 376  ASP A CG    1 
ATOM   4331  O  OD1   . ASP B  2  375 ? -16.846  -31.036 24.257   1.00 135.74 ? 376  ASP A OD1   1 
ATOM   4332  O  OD2   . ASP B  2  375 ? -15.806  -30.646 26.171   1.00 112.42 ? 376  ASP A OD2   1 
ATOM   4333  N  N     . ARG B  2  376 ? -19.315  -26.601 24.992   1.00 91.12  ? 377  ARG A N     1 
ATOM   4334  C  CA    . ARG B  2  376 ? -20.240  -25.576 25.548   1.00 85.64  ? 377  ARG A CA    1 
ATOM   4335  C  C     . ARG B  2  376 ? -21.375  -25.309 24.544   1.00 92.63  ? 377  ARG A C     1 
ATOM   4336  O  O     . ARG B  2  376 ? -22.548  -25.154 24.971   1.00 100.75 ? 377  ARG A O     1 
ATOM   4337  C  CB    . ARG B  2  376 ? -19.506  -24.268 25.845   1.00 84.76  ? 377  ARG A CB    1 
ATOM   4338  C  CG    . ARG B  2  376 ? -20.415  -23.135 26.320   1.00 81.88  ? 377  ARG A CG    1 
ATOM   4339  C  CD    . ARG B  2  376 ? -21.224  -23.520 27.533   1.00 77.51  ? 377  ARG A CD    1 
ATOM   4340  N  NE    . ARG B  2  376 ? -22.124  -22.470 27.994   1.00 72.11  ? 377  ARG A NE    1 
ATOM   4341  C  CZ    . ARG B  2  376 ? -23.032  -22.647 28.955   1.00 64.97  ? 377  ARG A CZ    1 
ATOM   4342  N  NH1   . ARG B  2  376 ? -23.177  -23.829 29.535   1.00 68.23  ? 377  ARG A NH1   1 
ATOM   4343  N  NH2   . ARG B  2  376 ? -23.807  -21.652 29.328   1.00 57.57  ? 377  ARG A NH2   1 
ATOM   4344  N  N     . ALA B  2  377 ? -21.021  -25.207 23.261   1.00 93.79  ? 378  ALA A N     1 
ATOM   4345  C  CA    . ALA B  2  377 ? -21.977  -24.984 22.154   1.00 97.72  ? 378  ALA A CA    1 
ATOM   4346  C  C     . ALA B  2  377 ? -22.993  -26.137 22.134   1.00 97.48  ? 378  ALA A C     1 
ATOM   4347  O  O     . ALA B  2  377 ? -24.198  -25.865 22.032   1.00 94.43  ? 378  ALA A O     1 
ATOM   4348  C  CB    . ALA B  2  377 ? -21.223  -24.851 20.850   1.00 101.27 ? 378  ALA A CB    1 
ATOM   4349  N  N     . HIS B  2  378 ? -22.510  -27.372 22.267   1.00 93.43  ? 379  HIS A N     1 
ATOM   4350  C  CA    . HIS B  2  378 ? -23.326  -28.614 22.367   1.00 91.94  ? 379  HIS A CA    1 
ATOM   4351  C  C     . HIS B  2  378 ? -24.318  -28.483 23.530   1.00 86.09  ? 379  HIS A C     1 
ATOM   4352  O  O     . HIS B  2  378 ? -25.504  -28.797 23.321   1.00 87.71  ? 379  HIS A O     1 
ATOM   4353  C  CB    . HIS B  2  378 ? -22.420  -29.844 22.507   1.00 94.88  ? 379  HIS A CB    1 
ATOM   4354  C  CG    . HIS B  2  378 ? -23.151  -31.136 22.649   1.00 99.51  ? 379  HIS A CG    1 
ATOM   4355  N  ND1   . HIS B  2  378 ? -23.700  -31.793 21.568   1.00 96.23  ? 379  HIS A ND1   1 
ATOM   4356  C  CD2   . HIS B  2  378 ? -23.414  -31.911 23.729   1.00 104.99 ? 379  HIS A CD2   1 
ATOM   4357  C  CE1   . HIS B  2  378 ? -24.268  -32.916 21.973   1.00 92.70  ? 379  HIS A CE1   1 
ATOM   4358  N  NE2   . HIS B  2  378 ? -24.107  -33.012 23.293   1.00 101.82 ? 379  HIS A NE2   1 
ATOM   4359  N  N     . ILE B  2  379 ? -23.870  -28.031 24.704   1.00 80.82  ? 380  ILE A N     1 
ATOM   4360  C  CA    . ILE B  2  379 ? -24.770  -27.886 25.883   1.00 82.88  ? 380  ILE A CA    1 
ATOM   4361  C  C     . ILE B  2  379 ? -25.845  -26.835 25.564   1.00 76.99  ? 380  ILE A C     1 
ATOM   4362  O  O     . ILE B  2  379 ? -27.043  -27.103 25.852   1.00 75.01  ? 380  ILE A O     1 
ATOM   4363  C  CB    . ILE B  2  379 ? -23.991  -27.565 27.173   1.00 83.49  ? 380  ILE A CB    1 
ATOM   4364  C  CG1   . ILE B  2  379 ? -23.098  -28.744 27.580   1.00 90.75  ? 380  ILE A CG1   1 
ATOM   4365  C  CG2   . ILE B  2  379 ? -24.950  -27.158 28.297   1.00 78.45  ? 380  ILE A CG2   1 
ATOM   4366  C  CD1   . ILE B  2  379 ? -23.887  -30.010 27.935   1.00 89.79  ? 380  ILE A CD1   1 
ATOM   4367  N  N     . LEU B  2  380 ? -25.436  -25.699 24.985   1.00 72.42  ? 381  LEU A N     1 
ATOM   4368  C  CA    . LEU B  2  380 ? -26.352  -24.569 24.675   1.00 86.06  ? 381  LEU A CA    1 
ATOM   4369  C  C     . LEU B  2  380 ? -27.424  -25.035 23.674   1.00 94.71  ? 381  LEU A C     1 
ATOM   4370  O  O     . LEU B  2  380 ? -28.586  -24.581 23.801   1.00 110.56 ? 381  LEU A O     1 
ATOM   4371  C  CB    . LEU B  2  380 ? -25.567  -23.377 24.129   1.00 81.59  ? 381  LEU A CB    1 
ATOM   4372  C  CG    . LEU B  2  380 ? -24.807  -22.547 25.165   1.00 71.54  ? 381  LEU A CG    1 
ATOM   4373  C  CD1   . LEU B  2  380 ? -24.214  -21.295 24.559   1.00 71.86  ? 381  LEU A CD1   1 
ATOM   4374  C  CD2   . LEU B  2  380 ? -25.694  -22.124 26.327   1.00 67.16  ? 381  LEU A CD2   1 
ATOM   4375  N  N     . GLU B  2  381 ? -27.046  -25.901 22.724   1.00 91.30  ? 382  GLU A N     1 
ATOM   4376  C  CA    . GLU B  2  381 ? -27.979  -26.496 21.728   1.00 95.46  ? 382  GLU A CA    1 
ATOM   4377  C  C     . GLU B  2  381 ? -29.077  -27.265 22.468   1.00 100.30 ? 382  GLU A C     1 
ATOM   4378  O  O     . GLU B  2  381 ? -30.248  -27.085 22.110   1.00 100.50 ? 382  GLU A O     1 
ATOM   4379  C  CB    . GLU B  2  381 ? -27.219  -27.382 20.738   1.00 100.52 ? 382  GLU A CB    1 
ATOM   4380  C  CG    . GLU B  2  381 ? -26.413  -26.573 19.733   1.00 105.82 ? 382  GLU A CG    1 
ATOM   4381  C  CD    . GLU B  2  381 ? -25.350  -27.355 18.975   1.00 109.86 ? 382  GLU A CD    1 
ATOM   4382  O  OE1   . GLU B  2  381 ? -25.265  -28.591 19.173   1.00 110.47 ? 382  GLU A OE1   1 
ATOM   4383  O  OE2   . GLU B  2  381 ? -24.589  -26.725 18.205   1.00 115.64 ? 382  GLU A OE2   1 
ATOM   4384  N  N     . GLY B  2  382 ? -28.699  -28.061 23.479   1.00 103.36 ? 383  GLY A N     1 
ATOM   4385  C  CA    . GLY B  2  382 ? -29.625  -28.799 24.369   1.00 91.90  ? 383  GLY A CA    1 
ATOM   4386  C  C     . GLY B  2  382 ? -30.555  -27.871 25.128   1.00 82.25  ? 383  GLY A C     1 
ATOM   4387  O  O     . GLY B  2  382 ? -31.778  -28.143 25.138   1.00 64.44  ? 383  GLY A O     1 
ATOM   4388  N  N     . LEU B  2  383 ? -30.017  -26.810 25.739   1.00 87.39  ? 384  LEU A N     1 
ATOM   4389  C  CA    . LEU B  2  383 ? -30.827  -25.840 26.524   1.00 115.35 ? 384  LEU A CA    1 
ATOM   4390  C  C     . LEU B  2  383 ? -31.841  -25.135 25.605   1.00 118.90 ? 384  LEU A C     1 
ATOM   4391  O  O     . LEU B  2  383 ? -32.986  -24.900 26.051   1.00 104.52 ? 384  LEU A O     1 
ATOM   4392  C  CB    . LEU B  2  383 ? -29.907  -24.825 27.205   1.00 127.14 ? 384  LEU A CB    1 
ATOM   4393  C  CG    . LEU B  2  383 ? -28.987  -25.372 28.291   1.00 132.74 ? 384  LEU A CG    1 
ATOM   4394  C  CD1   . LEU B  2  383 ? -28.198  -24.243 28.924   1.00 131.90 ? 384  LEU A CD1   1 
ATOM   4395  C  CD2   . LEU B  2  383 ? -29.776  -26.134 29.345   1.00 135.65 ? 384  LEU A CD2   1 
ATOM   4396  N  N     . ARG B  2  384 ? -31.425  -24.808 24.375   1.00 132.57 ? 385  ARG A N     1 
ATOM   4397  C  CA    . ARG B  2  384 ? -32.285  -24.128 23.369   1.00 132.48 ? 385  ARG A CA    1 
ATOM   4398  C  C     . ARG B  2  384 ? -33.495  -25.023 23.058   1.00 119.08 ? 385  ARG A C     1 
ATOM   4399  O  O     . ARG B  2  384 ? -34.631  -24.546 23.199   1.00 110.69 ? 385  ARG A O     1 
ATOM   4400  C  CB    . ARG B  2  384 ? -31.471  -23.766 22.127   1.00 139.13 ? 385  ARG A CB    1 
ATOM   4401  C  CG    . ARG B  2  384 ? -30.678  -22.475 22.302   1.00 148.01 ? 385  ARG A CG    1 
ATOM   4402  C  CD    . ARG B  2  384 ? -29.474  -22.339 21.377   1.00 143.89 ? 385  ARG A CD    1 
ATOM   4403  N  NE    . ARG B  2  384 ? -29.823  -21.762 20.085   1.00 135.70 ? 385  ARG A NE    1 
ATOM   4404  C  CZ    . ARG B  2  384 ? -29.829  -22.415 18.928   1.00 126.92 ? 385  ARG A CZ    1 
ATOM   4405  N  NH1   . ARG B  2  384 ? -29.497  -23.693 18.858   1.00 119.30 ? 385  ARG A NH1   1 
ATOM   4406  N  NH2   . ARG B  2  384 ? -30.158  -21.777 17.822   1.00 133.89 ? 385  ARG A NH2   1 
ATOM   4407  N  N     . ILE B  2  385 ? -33.249  -26.275 22.675   1.00 108.05 ? 386  ILE A N     1 
ATOM   4408  C  CA    . ILE B  2  385 ? -34.286  -27.327 22.460   1.00 112.04 ? 386  ILE A CA    1 
ATOM   4409  C  C     . ILE B  2  385 ? -35.201  -27.392 23.691   1.00 112.45 ? 386  ILE A C     1 
ATOM   4410  O  O     . ILE B  2  385 ? -36.432  -27.430 23.511   1.00 117.23 ? 386  ILE A O     1 
ATOM   4411  C  CB    . ILE B  2  385 ? -33.609  -28.679 22.161   1.00 115.06 ? 386  ILE A CB    1 
ATOM   4412  C  CG1   . ILE B  2  385 ? -33.022  -28.708 20.750   1.00 116.34 ? 386  ILE A CG1   1 
ATOM   4413  C  CG2   . ILE B  2  385 ? -34.557  -29.848 22.380   1.00 120.36 ? 386  ILE A CG2   1 
ATOM   4414  C  CD1   . ILE B  2  385 ? -31.934  -29.741 20.567   1.00 117.04 ? 386  ILE A CD1   1 
ATOM   4415  N  N     . ALA B  2  386 ? -34.644  -27.405 24.903   1.00 113.62 ? 387  ALA A N     1 
ATOM   4416  C  CA    . ALA B  2  386 ? -35.445  -27.572 26.140   1.00 122.77 ? 387  ALA A CA    1 
ATOM   4417  C  C     . ALA B  2  386 ? -36.350  -26.347 26.357   1.00 131.04 ? 387  ALA A C     1 
ATOM   4418  O  O     . ALA B  2  386 ? -37.525  -26.544 26.734   1.00 143.83 ? 387  ALA A O     1 
ATOM   4419  C  CB    . ALA B  2  386 ? -34.543  -27.803 27.321   1.00 116.44 ? 387  ALA A CB    1 
ATOM   4420  N  N     . LEU B  2  387 ? -35.822  -25.132 26.155   1.00 126.75 ? 388  LEU A N     1 
ATOM   4421  C  CA    . LEU B  2  387 ? -36.590  -23.870 26.352   1.00 111.84 ? 388  LEU A CA    1 
ATOM   4422  C  C     . LEU B  2  387 ? -37.677  -23.763 25.273   1.00 111.47 ? 388  LEU A C     1 
ATOM   4423  O  O     . LEU B  2  387 ? -38.786  -23.297 25.604   1.00 112.65 ? 388  LEU A O     1 
ATOM   4424  C  CB    . LEU B  2  387 ? -35.641  -22.668 26.317   1.00 102.22 ? 388  LEU A CB    1 
ATOM   4425  C  CG    . LEU B  2  387 ? -34.676  -22.572 27.498   1.00 86.56  ? 388  LEU A CG    1 
ATOM   4426  C  CD1   . LEU B  2  387 ? -33.849  -21.310 27.413   1.00 79.60  ? 388  LEU A CD1   1 
ATOM   4427  C  CD2   . LEU B  2  387 ? -35.411  -22.637 28.830   1.00 81.23  ? 388  LEU A CD2   1 
ATOM   4428  N  N     . ASP B  2  388 ? -37.379  -24.212 24.051   1.00 102.27 ? 389  ASP A N     1 
ATOM   4429  C  CA    . ASP B  2  388 ? -38.293  -24.133 22.879   1.00 106.11 ? 389  ASP A CA    1 
ATOM   4430  C  C     . ASP B  2  388 ? -39.462  -25.118 23.029   1.00 101.85 ? 389  ASP A C     1 
ATOM   4431  O  O     . ASP B  2  388 ? -40.501  -24.837 22.425   1.00 99.94  ? 389  ASP A O     1 
ATOM   4432  C  CB    . ASP B  2  388 ? -37.545  -24.351 21.558   1.00 110.59 ? 389  ASP A CB    1 
ATOM   4433  C  CG    . ASP B  2  388 ? -36.616  -23.204 21.193   1.00 118.60 ? 389  ASP A CG    1 
ATOM   4434  O  OD1   . ASP B  2  388 ? -36.775  -22.111 21.776   1.00 121.39 ? 389  ASP A OD1   1 
ATOM   4435  O  OD2   . ASP B  2  388 ? -35.735  -23.412 20.331   1.00 122.26 ? 389  ASP A OD2   1 
ATOM   4436  N  N     . HIS B  2  389 ? -39.313  -26.221 23.775   1.00 95.79  ? 390  HIS A N     1 
ATOM   4437  C  CA    . HIS B  2  389 ? -40.404  -27.207 24.021   1.00 88.11  ? 390  HIS A CA    1 
ATOM   4438  C  C     . HIS B  2  389 ? -40.593  -27.421 25.530   1.00 88.44  ? 390  HIS A C     1 
ATOM   4439  O  O     . HIS B  2  389 ? -40.815  -28.576 25.948   1.00 70.77  ? 390  HIS A O     1 
ATOM   4440  C  CB    . HIS B  2  389 ? -40.148  -28.519 23.268   1.00 86.49  ? 390  HIS A CB    1 
ATOM   4441  C  CG    . HIS B  2  389 ? -39.582  -28.354 21.899   1.00 87.87  ? 390  HIS A CG    1 
ATOM   4442  N  ND1   . HIS B  2  389 ? -38.483  -29.073 21.500   1.00 90.27  ? 390  HIS A ND1   1 
ATOM   4443  C  CD2   . HIS B  2  389 ? -39.918  -27.572 20.846   1.00 91.88  ? 390  HIS A CD2   1 
ATOM   4444  C  CE1   . HIS B  2  389 ? -38.162  -28.758 20.261   1.00 87.21  ? 390  HIS A CE1   1 
ATOM   4445  N  NE2   . HIS B  2  389 ? -39.021  -27.823 19.843   1.00 89.34  ? 390  HIS A NE2   1 
ATOM   4446  N  N     . ILE B  2  390 ? -40.524  -26.349 26.322   1.00 96.63  ? 391  ILE A N     1 
ATOM   4447  C  CA    . ILE B  2  390 ? -40.406  -26.452 27.806   1.00 104.48 ? 391  ILE A CA    1 
ATOM   4448  C  C     . ILE B  2  390 ? -41.623  -27.189 28.394   1.00 103.82 ? 391  ILE A C     1 
ATOM   4449  O  O     . ILE B  2  390 ? -41.409  -27.972 29.339   1.00 101.51 ? 391  ILE A O     1 
ATOM   4450  C  CB    . ILE B  2  390 ? -40.163  -25.079 28.472   1.00 103.28 ? 391  ILE A CB    1 
ATOM   4451  C  CG1   . ILE B  2  390 ? -39.897  -25.219 29.976   1.00 99.85  ? 391  ILE A CG1   1 
ATOM   4452  C  CG2   . ILE B  2  390 ? -41.307  -24.110 28.206   1.00 99.78  ? 391  ILE A CG2   1 
ATOM   4453  C  CD1   . ILE B  2  390 ? -38.702  -26.095 30.315   1.00 96.53  ? 391  ILE A CD1   1 
ATOM   4454  N  N     . ASP B  2  391 ? -42.831  -26.988 27.858   1.00 105.19 ? 392  ASP A N     1 
ATOM   4455  C  CA    . ASP B  2  391 ? -44.075  -27.603 28.401   1.00 106.69 ? 392  ASP A CA    1 
ATOM   4456  C  C     . ASP B  2  391 ? -43.953  -29.133 28.316   1.00 107.03 ? 392  ASP A C     1 
ATOM   4457  O  O     . ASP B  2  391 ? -44.267  -29.825 29.320   1.00 101.43 ? 392  ASP A O     1 
ATOM   4458  C  CB    . ASP B  2  391 ? -45.327  -27.068 27.699   1.00 100.40 ? 392  ASP A CB    1 
ATOM   4459  N  N     . GLU B  2  392 ? -43.459  -29.650 27.185   1.00 99.12  ? 393  GLU A N     1 
ATOM   4460  C  CA    . GLU B  2  392 ? -43.284  -31.109 26.955   1.00 88.51  ? 393  GLU A CA    1 
ATOM   4461  C  C     . GLU B  2  392 ? -42.178  -31.643 27.874   1.00 85.23  ? 393  GLU A C     1 
ATOM   4462  O  O     . GLU B  2  392 ? -42.372  -32.727 28.462   1.00 80.61  ? 393  GLU A O     1 
ATOM   4463  C  CB    . GLU B  2  392 ? -42.943  -31.394 25.495   1.00 85.38  ? 393  GLU A CB    1 
ATOM   4464  C  CG    . GLU B  2  392 ? -43.971  -30.854 24.512   1.00 88.47  ? 393  GLU A CG    1 
ATOM   4465  C  CD    . GLU B  2  392 ? -43.601  -31.069 23.057   1.00 92.39  ? 393  GLU A CD    1 
ATOM   4466  O  OE1   . GLU B  2  392 ? -43.508  -32.249 22.656   1.00 79.53  ? 393  GLU A OE1   1 
ATOM   4467  O  OE2   . GLU B  2  392 ? -43.381  -30.055 22.333   1.00 101.53 ? 393  GLU A OE2   1 
ATOM   4468  N  N     . ILE B  2  393 ? -41.064  -30.907 27.993   1.00 79.69  ? 394  ILE A N     1 
ATOM   4469  C  CA    . ILE B  2  393 ? -39.879  -31.285 28.824   1.00 70.14  ? 394  ILE A CA    1 
ATOM   4470  C  C     . ILE B  2  393 ? -40.346  -31.526 30.266   1.00 65.93  ? 394  ILE A C     1 
ATOM   4471  O  O     . ILE B  2  393 ? -39.967  -32.560 30.839   1.00 48.87  ? 394  ILE A O     1 
ATOM   4472  C  CB    . ILE B  2  393 ? -38.779  -30.202 28.756   1.00 66.56  ? 394  ILE A CB    1 
ATOM   4473  C  CG1   . ILE B  2  393 ? -38.199  -30.040 27.345   1.00 68.91  ? 394  ILE A CG1   1 
ATOM   4474  C  CG2   . ILE B  2  393 ? -37.678  -30.469 29.779   1.00 70.23  ? 394  ILE A CG2   1 
ATOM   4475  C  CD1   . ILE B  2  393 ? -37.156  -31.053 26.957   1.00 68.68  ? 394  ILE A CD1   1 
ATOM   4476  N  N     . ILE B  2  394 ? -41.139  -30.602 30.819   1.00 75.92  ? 395  ILE A N     1 
ATOM   4477  C  CA    . ILE B  2  394 ? -41.624  -30.653 32.232   1.00 86.92  ? 395  ILE A CA    1 
ATOM   4478  C  C     . ILE B  2  394 ? -42.416  -31.948 32.427   1.00 92.16  ? 395  ILE A C     1 
ATOM   4479  O  O     . ILE B  2  394 ? -42.099  -32.688 33.383   1.00 90.12  ? 395  ILE A O     1 
ATOM   4480  C  CB    . ILE B  2  394 ? -42.476  -29.419 32.601   1.00 84.99  ? 395  ILE A CB    1 
ATOM   4481  C  CG1   . ILE B  2  394 ? -41.705  -28.105 32.445   1.00 81.40  ? 395  ILE A CG1   1 
ATOM   4482  C  CG2   . ILE B  2  394 ? -43.052  -29.566 34.004   1.00 83.25  ? 395  ILE A CG2   1 
ATOM   4483  C  CD1   . ILE B  2  394 ? -40.564  -27.940 33.418   1.00 78.56  ? 395  ILE A CD1   1 
ATOM   4484  N  N     . SER B  2  395 ? -43.405  -32.199 31.557   1.00 97.46  ? 396  SER A N     1 
ATOM   4485  C  CA    . SER B  2  395 ? -44.296  -33.392 31.619   1.00 98.04  ? 396  SER A CA    1 
ATOM   4486  C  C     . SER B  2  395 ? -43.447  -34.670 31.589   1.00 89.05  ? 396  SER A C     1 
ATOM   4487  O  O     . SER B  2  395 ? -43.666  -35.523 32.474   1.00 77.64  ? 396  SER A O     1 
ATOM   4488  C  CB    . SER B  2  395 ? -45.336  -33.387 30.523   1.00 99.22  ? 396  SER A CB    1 
ATOM   4489  O  OG    . SER B  2  395 ? -44.765  -33.053 29.271   1.00 98.22  ? 396  SER A OG    1 
ATOM   4490  N  N     . THR B  2  396 ? -42.507  -34.770 30.638   1.00 78.56  ? 397  THR A N     1 
ATOM   4491  C  CA    . THR B  2  396 ? -41.532  -35.893 30.514   1.00 69.83  ? 397  THR A CA    1 
ATOM   4492  C  C     . THR B  2  396 ? -40.835  -36.147 31.855   1.00 64.62  ? 397  THR A C     1 
ATOM   4493  O  O     . THR B  2  396 ? -40.695  -37.326 32.220   1.00 52.25  ? 397  THR A O     1 
ATOM   4494  C  CB    . THR B  2  396 ? -40.439  -35.612 29.472   1.00 72.82  ? 397  THR A CB    1 
ATOM   4495  O  OG1   . THR B  2  396 ? -41.052  -35.231 28.240   1.00 70.86  ? 397  THR A OG1   1 
ATOM   4496  C  CG2   . THR B  2  396 ? -39.536  -36.803 29.238   1.00 70.91  ? 397  THR A CG2   1 
ATOM   4497  N  N     . ILE B  2  397 ? -40.379  -35.085 32.527   1.00 65.59  ? 398  ILE A N     1 
ATOM   4498  C  CA    . ILE B  2  397 ? -39.589  -35.168 33.796   1.00 64.28  ? 398  ILE A CA    1 
ATOM   4499  C  C     . ILE B  2  397 ? -40.533  -35.533 34.944   1.00 59.66  ? 398  ILE A C     1 
ATOM   4500  O  O     . ILE B  2  397 ? -40.098  -36.276 35.854   1.00 51.18  ? 398  ILE A O     1 
ATOM   4501  C  CB    . ILE B  2  397 ? -38.817  -33.863 34.084   1.00 64.63  ? 398  ILE A CB    1 
ATOM   4502  C  CG1   . ILE B  2  397 ? -37.739  -33.594 33.030   1.00 69.72  ? 398  ILE A CG1   1 
ATOM   4503  C  CG2   . ILE B  2  397 ? -38.203  -33.897 35.476   1.00 63.24  ? 398  ILE A CG2   1 
ATOM   4504  C  CD1   . ILE B  2  397 ? -37.232  -32.172 33.006   1.00 70.37  ? 398  ILE A CD1   1 
ATOM   4505  N  N     . ARG B  2  398 ? -41.767  -35.025 34.905   1.00 59.90  ? 399  ARG A N     1 
ATOM   4506  C  CA    . ARG B  2  398 ? -42.769  -35.193 35.999   1.00 62.23  ? 399  ARG A CA    1 
ATOM   4507  C  C     . ARG B  2  398 ? -43.267  -36.642 36.023   1.00 72.35  ? 399  ARG A C     1 
ATOM   4508  O  O     . ARG B  2  398 ? -43.356  -37.216 37.127   1.00 68.43  ? 399  ARG A O     1 
ATOM   4509  C  CB    . ARG B  2  398 ? -43.907  -34.192 35.852   1.00 56.49  ? 399  ARG A CB    1 
ATOM   4510  C  CG    . ARG B  2  398 ? -43.504  -32.815 36.374   1.00 53.67  ? 399  ARG A CG    1 
ATOM   4511  C  CD    . ARG B  2  398 ? -44.646  -31.854 36.390   1.00 47.55  ? 399  ARG A CD    1 
ATOM   4512  N  NE    . ARG B  2  398 ? -45.580  -32.194 37.450   1.00 43.74  ? 399  ARG A NE    1 
ATOM   4513  C  CZ    . ARG B  2  398 ? -46.849  -31.801 37.496   1.00 38.70  ? 399  ARG A CZ    1 
ATOM   4514  N  NH1   . ARG B  2  398 ? -47.345  -31.029 36.535   1.00 33.52  ? 399  ARG A NH1   1 
ATOM   4515  N  NH2   . ARG B  2  398 ? -47.592  -32.186 38.521   1.00 36.61  ? 399  ARG A NH2   1 
ATOM   4516  N  N     . GLU B  2  399 ? -43.548  -37.212 34.847   1.00 83.40  ? 400  GLU A N     1 
ATOM   4517  C  CA    . GLU B  2  399 ? -44.012  -38.621 34.698   1.00 77.13  ? 400  GLU A CA    1 
ATOM   4518  C  C     . GLU B  2  399 ? -42.839  -39.581 34.970   1.00 66.91  ? 400  GLU A C     1 
ATOM   4519  O  O     . GLU B  2  399 ? -43.120  -40.773 35.173   1.00 66.61  ? 400  GLU A O     1 
ATOM   4520  C  CB    . GLU B  2  399 ? -44.677  -38.821 33.326   1.00 80.59  ? 400  GLU A CB    1 
ATOM   4521  C  CG    . GLU B  2  399 ? -43.701  -39.055 32.179   1.00 91.81  ? 400  GLU A CG    1 
ATOM   4522  C  CD    . GLU B  2  399 ? -44.258  -38.907 30.772   1.00 99.43  ? 400  GLU A CD    1 
ATOM   4523  O  OE1   . GLU B  2  399 ? -43.525  -39.264 29.811   1.00 92.75  ? 400  GLU A OE1   1 
ATOM   4524  O  OE2   . GLU B  2  399 ? -45.402  -38.418 30.635   1.00 104.87 ? 400  GLU A OE2   1 
ATOM   4525  N  N     . SER B  2  400 ? -41.592  -39.095 35.005   1.00 63.68  ? 401  SER A N     1 
ATOM   4526  C  CA    . SER B  2  400 ? -40.381  -39.902 35.325   1.00 67.00  ? 401  SER A CA    1 
ATOM   4527  C  C     . SER B  2  400 ? -40.278  -40.112 36.841   1.00 69.06  ? 401  SER A C     1 
ATOM   4528  O  O     . SER B  2  400 ? -40.410  -39.128 37.585   1.00 71.86  ? 401  SER A O     1 
ATOM   4529  C  CB    . SER B  2  400 ? -39.115  -39.272 34.779   1.00 64.21  ? 401  SER A CB    1 
ATOM   4530  O  OG    . SER B  2  400 ? -39.176  -39.140 33.368   1.00 55.58  ? 401  SER A OG    1 
ATOM   4531  N  N     . ASP B  2  401 ? -40.018  -41.346 37.265   1.00 76.56  ? 402  ASP A N     1 
ATOM   4532  C  CA    . ASP B  2  401 ? -40.029  -41.769 38.691   1.00 83.63  ? 402  ASP A CA    1 
ATOM   4533  C  C     . ASP B  2  401 ? -38.686  -41.379 39.312   1.00 81.54  ? 402  ASP A C     1 
ATOM   4534  O  O     . ASP B  2  401 ? -38.696  -40.818 40.419   1.00 78.92  ? 402  ASP A O     1 
ATOM   4535  C  CB    . ASP B  2  401 ? -40.301  -43.273 38.840   1.00 87.64  ? 402  ASP A CB    1 
ATOM   4536  C  CG    . ASP B  2  401 ? -41.291  -43.820 37.822   1.00 88.52  ? 402  ASP A CG    1 
ATOM   4537  O  OD1   . ASP B  2  401 ? -42.349  -43.188 37.656   1.00 87.25  ? 402  ASP A OD1   1 
ATOM   4538  O  OD2   . ASP B  2  401 ? -40.980  -44.854 37.183   1.00 85.86  ? 402  ASP A OD2   1 
ATOM   4539  N  N     . THR B  2  402 ? -37.587  -41.659 38.603   1.00 80.44  ? 403  THR A N     1 
ATOM   4540  C  CA    . THR B  2  402 ? -36.189  -41.383 39.028   1.00 78.07  ? 403  THR A CA    1 
ATOM   4541  C  C     . THR B  2  402 ? -35.509  -40.442 38.021   1.00 74.79  ? 403  THR A C     1 
ATOM   4542  O  O     . THR B  2  402 ? -36.071  -40.217 36.929   1.00 56.87  ? 403  THR A O     1 
ATOM   4543  C  CB    . THR B  2  402 ? -35.394  -42.686 39.190   1.00 80.29  ? 403  THR A CB    1 
ATOM   4544  O  OG1   . THR B  2  402 ? -35.225  -43.301 37.911   1.00 81.96  ? 403  THR A OG1   1 
ATOM   4545  C  CG2   . THR B  2  402 ? -36.061  -43.655 40.141   1.00 80.71  ? 403  THR A CG2   1 
ATOM   4546  N  N     . ASP B  2  403 ? -34.335  -39.915 38.388   1.00 75.50  ? 404  ASP A N     1 
ATOM   4547  C  CA    . ASP B  2  403 ? -33.479  -39.079 37.508   1.00 76.26  ? 404  ASP A CA    1 
ATOM   4548  C  C     . ASP B  2  403 ? -33.030  -39.929 36.314   1.00 75.31  ? 404  ASP A C     1 
ATOM   4549  O  O     . ASP B  2  403 ? -33.007  -39.380 35.193   1.00 73.29  ? 404  ASP A O     1 
ATOM   4550  C  CB    . ASP B  2  403 ? -32.289  -38.484 38.270   1.00 68.51  ? 404  ASP A CB    1 
ATOM   4551  N  N     . LYS B  2  404 ? -32.705  -41.212 36.547   1.00 73.56  ? 405  LYS A N     1 
ATOM   4552  C  CA    . LYS B  2  404 ? -32.195  -42.162 35.515   1.00 69.51  ? 405  LYS A CA    1 
ATOM   4553  C  C     . LYS B  2  404 ? -33.241  -42.306 34.406   1.00 67.81  ? 405  LYS A C     1 
ATOM   4554  O  O     . LYS B  2  404 ? -32.847  -42.264 33.227   1.00 61.11  ? 405  LYS A O     1 
ATOM   4555  C  CB    . LYS B  2  404 ? -31.862  -43.535 36.119   1.00 61.33  ? 405  LYS A CB    1 
ATOM   4556  N  N     . VAL B  2  405 ? -34.517  -42.475 34.781   1.00 69.89  ? 406  VAL A N     1 
ATOM   4557  C  CA    . VAL B  2  405 ? -35.664  -42.650 33.838   1.00 68.20  ? 406  VAL A CA    1 
ATOM   4558  C  C     . VAL B  2  405 ? -35.842  -41.351 33.041   1.00 71.45  ? 406  VAL A C     1 
ATOM   4559  O  O     . VAL B  2  405 ? -35.987  -41.445 31.809   1.00 58.80  ? 406  VAL A O     1 
ATOM   4560  C  CB    . VAL B  2  405 ? -36.959  -43.048 34.578   1.00 70.14  ? 406  VAL A CB    1 
ATOM   4561  C  CG1   . VAL B  2  405 ? -38.194  -42.952 33.690   1.00 68.41  ? 406  VAL A CG1   1 
ATOM   4562  C  CG2   . VAL B  2  405 ? -36.856  -44.434 35.192   1.00 68.26  ? 406  VAL A CG2   1 
ATOM   4563  N  N     . ALA B  2  406 ? -35.835  -40.195 33.722   1.00 71.11  ? 407  ALA A N     1 
ATOM   4564  C  CA    . ALA B  2  406 ? -35.974  -38.848 33.115   1.00 68.77  ? 407  ALA A CA    1 
ATOM   4565  C  C     . ALA B  2  406 ? -34.887  -38.634 32.054   1.00 67.13  ? 407  ALA A C     1 
ATOM   4566  O  O     . ALA B  2  406 ? -35.210  -38.153 30.959   1.00 67.20  ? 407  ALA A O     1 
ATOM   4567  C  CB    . ALA B  2  406 ? -35.923  -37.783 34.180   1.00 69.09  ? 407  ALA A CB    1 
ATOM   4568  N  N     A MET B  2  407 ? -33.640  -38.991 32.376   0.50 67.20  ? 408  MET A N     1 
ATOM   4569  N  N     B MET B  2  407 ? -33.641  -38.991 32.375   0.50 67.00  ? 408  MET A N     1 
ATOM   4570  C  CA    A MET B  2  407 ? -32.477  -38.905 31.450   0.50 68.00  ? 408  MET A CA    1 
ATOM   4571  C  CA    B MET B  2  407 ? -32.479  -38.908 31.448   0.50 67.52  ? 408  MET A CA    1 
ATOM   4572  C  C     A MET B  2  407 ? -32.759  -39.700 30.171   0.50 70.72  ? 408  MET A C     1 
ATOM   4573  C  C     B MET B  2  407 ? -32.760  -39.705 30.169   0.50 67.30  ? 408  MET A C     1 
ATOM   4574  O  O     A MET B  2  407 ? -32.496  -39.158 29.079   0.50 73.47  ? 408  MET A O     1 
ATOM   4575  O  O     B MET B  2  407 ? -32.496  -39.159 29.079   0.50 69.92  ? 408  MET A O     1 
ATOM   4576  C  CB    A MET B  2  407 ? -31.221  -39.479 32.107   0.50 68.43  ? 408  MET A CB    1 
ATOM   4577  C  CB    B MET B  2  407 ? -31.223  -39.481 32.103   0.50 70.47  ? 408  MET A CB    1 
ATOM   4578  C  CG    A MET B  2  407 ? -30.602  -38.554 33.131   0.50 68.41  ? 408  MET A CG    1 
ATOM   4579  C  CG    B MET B  2  407 ? -30.606  -38.567 33.130   0.50 72.54  ? 408  MET A CG    1 
ATOM   4580  S  SD    A MET B  2  407 ? -29.544  -37.272 32.361   0.50 66.39  ? 408  MET A SD    1 
ATOM   4581  S  SD    B MET B  2  407 ? -28.805  -38.793 33.172   0.50 74.50  ? 408  MET A SD    1 
ATOM   4582  C  CE    A MET B  2  407 ? -28.348  -38.309 31.512   0.50 66.90  ? 408  MET A CE    1 
ATOM   4583  C  CE    B MET B  2  407 ? -28.347  -38.310 31.509   0.50 74.06  ? 408  MET A CE    1 
ATOM   4584  N  N     A GLU B  2  408 ? -33.246  -40.939 30.310   0.50 70.44  ? 409  GLU A N     1 
ATOM   4585  N  N     B GLU B  2  408 ? -33.248  -40.947 30.309   0.50 63.36  ? 409  GLU A N     1 
ATOM   4586  C  CA    A GLU B  2  408 ? -33.507  -41.865 29.176   0.50 70.72  ? 409  GLU A CA    1 
ATOM   4587  C  CA    B GLU B  2  408 ? -33.514  -41.893 29.182   0.50 61.32  ? 409  GLU A CA    1 
ATOM   4588  C  C     A GLU B  2  408 ? -34.651  -41.302 28.327   0.50 68.97  ? 409  GLU A C     1 
ATOM   4589  C  C     B GLU B  2  408 ? -34.650  -41.303 28.329   0.50 63.48  ? 409  GLU A C     1 
ATOM   4590  O  O     A GLU B  2  408 ? -34.490  -41.228 27.091   0.50 67.26  ? 409  GLU A O     1 
ATOM   4591  O  O     B GLU B  2  408 ? -34.489  -41.228 27.092   0.50 62.25  ? 409  GLU A O     1 
ATOM   4592  C  CB    A GLU B  2  408 ? -33.826  -43.273 29.685   0.50 73.14  ? 409  GLU A CB    1 
ATOM   4593  C  CB    B GLU B  2  408 ? -33.881  -43.313 29.670   0.50 58.05  ? 409  GLU A CB    1 
ATOM   4594  C  CG    A GLU B  2  408 ? -33.710  -44.328 28.609   0.50 73.13  ? 409  GLU A CG    1 
ATOM   4595  C  CG    B GLU B  2  408 ? -32.973  -43.992 30.681   0.50 53.65  ? 409  GLU A CG    1 
ATOM   4596  C  CD    A GLU B  2  408 ? -34.220  -45.703 28.998   0.50 71.81  ? 409  GLU A CD    1 
ATOM   4597  C  CD    B GLU B  2  408 ? -31.772  -44.821 30.270   0.50 47.42  ? 409  GLU A CD    1 
ATOM   4598  O  OE1   A GLU B  2  408 ? -35.290  -45.771 29.624   0.50 63.65  ? 409  GLU A OE1   1 
ATOM   4599  O  OE1   B GLU B  2  408 ? -31.406  -44.819 29.083   0.50 45.69  ? 409  GLU A OE1   1 
ATOM   4600  O  OE2   A GLU B  2  408 ? -33.548  -46.700 28.659   0.50 75.36  ? 409  GLU A OE2   1 
ATOM   4601  O  OE2   B GLU B  2  408 ? -31.198  -45.457 31.170   0.50 39.85  ? 409  GLU A OE2   1 
ATOM   4602  N  N     . SER B  2  409 ? -35.742  -40.881 28.977   1.00 65.71  ? 410  SER A N     1 
ATOM   4603  C  CA    . SER B  2  409 ? -36.963  -40.325 28.334   1.00 65.88  ? 410  SER A CA    1 
ATOM   4604  C  C     . SER B  2  409 ? -36.620  -39.060 27.538   1.00 67.16  ? 410  SER A C     1 
ATOM   4605  O  O     . SER B  2  409 ? -37.133  -38.927 26.408   1.00 53.79  ? 410  SER A O     1 
ATOM   4606  C  CB    . SER B  2  409 ? -38.032  -40.049 29.353   1.00 62.14  ? 410  SER A CB    1 
ATOM   4607  O  OG    . SER B  2  409 ? -38.226  -41.176 30.193   1.00 56.07  ? 410  SER A OG    1 
ATOM   4608  N  N     . LEU B  2  410 ? -35.797  -38.166 28.101   1.00 73.75  ? 411  LEU A N     1 
ATOM   4609  C  CA    . LEU B  2  410 ? -35.404  -36.886 27.445   1.00 78.58  ? 411  LEU A CA    1 
ATOM   4610  C  C     . LEU B  2  410 ? -34.552  -37.195 26.210   1.00 87.51  ? 411  LEU A C     1 
ATOM   4611  O  O     . LEU B  2  410 ? -34.776  -36.564 25.159   1.00 89.98  ? 411  LEU A O     1 
ATOM   4612  C  CB    . LEU B  2  410 ? -34.639  -35.999 28.434   1.00 74.53  ? 411  LEU A CB    1 
ATOM   4613  C  CG    . LEU B  2  410 ? -35.491  -35.347 29.522   1.00 76.26  ? 411  LEU A CG    1 
ATOM   4614  C  CD1   . LEU B  2  410 ? -34.615  -34.652 30.546   1.00 74.71  ? 411  LEU A CD1   1 
ATOM   4615  C  CD2   . LEU B  2  410 ? -36.495  -34.367 28.924   1.00 83.71  ? 411  LEU A CD2   1 
ATOM   4616  N  N     . GLN B  2  411 ? -33.611  -38.130 26.342   1.00 86.72  ? 412  GLN A N     1 
ATOM   4617  C  CA    . GLN B  2  411 ? -32.684  -38.533 25.254   1.00 83.25  ? 412  GLN A CA    1 
ATOM   4618  C  C     . GLN B  2  411 ? -33.483  -39.127 24.087   1.00 85.02  ? 412  GLN A C     1 
ATOM   4619  O  O     . GLN B  2  411 ? -33.217  -38.746 22.921   1.00 91.71  ? 412  GLN A O     1 
ATOM   4620  C  CB    . GLN B  2  411 ? -31.677  -39.533 25.808   1.00 74.61  ? 412  GLN A CB    1 
ATOM   4621  C  CG    . GLN B  2  411 ? -30.461  -38.867 26.431   1.00 70.36  ? 412  GLN A CG    1 
ATOM   4622  C  CD    . GLN B  2  411 ? -29.494  -39.898 26.945   1.00 71.99  ? 412  GLN A CD    1 
ATOM   4623  O  OE1   . GLN B  2  411 ? -28.665  -40.456 26.215   1.00 65.69  ? 412  GLN A OE1   1 
ATOM   4624  N  NE2   . GLN B  2  411 ? -29.637  -40.181 28.223   1.00 77.16  ? 412  GLN A NE2   1 
ATOM   4625  N  N     . GLN B  2  412 ? -34.423  -40.026 24.396   1.00 71.12  ? 413  GLN A N     1 
ATOM   4626  C  CA    . GLN B  2  412 ? -35.245  -40.764 23.399   1.00 68.56  ? 413  GLN A CA    1 
ATOM   4627  C  C     . GLN B  2  412 ? -36.216  -39.786 22.722   1.00 64.85  ? 413  GLN A C     1 
ATOM   4628  O  O     . GLN B  2  412 ? -36.240  -39.747 21.471   1.00 62.85  ? 413  GLN A O     1 
ATOM   4629  C  CB    . GLN B  2  412 ? -35.970  -41.930 24.074   1.00 71.58  ? 413  GLN A CB    1 
ATOM   4630  C  CG    . GLN B  2  412 ? -35.139  -43.196 24.201   1.00 73.48  ? 413  GLN A CG    1 
ATOM   4631  C  CD    . GLN B  2  412 ? -35.711  -44.156 25.223   1.00 72.78  ? 413  GLN A CD    1 
ATOM   4632  O  OE1   . GLN B  2  412 ? -36.869  -44.074 25.634   1.00 70.78  ? 413  GLN A OE1   1 
ATOM   4633  N  NE2   . GLN B  2  412 ? -34.894  -45.095 25.660   1.00 65.47  ? 413  GLN A NE2   1 
ATOM   4634  N  N     . ARG B  2  413 ? -36.958  -39.004 23.516   1.00 59.59  ? 414  ARG A N     1 
ATOM   4635  C  CA    . ARG B  2  413 ? -38.080  -38.149 23.038   1.00 54.29  ? 414  ARG A CA    1 
ATOM   4636  C  C     . ARG B  2  413 ? -37.546  -36.964 22.214   1.00 53.50  ? 414  ARG A C     1 
ATOM   4637  O  O     . ARG B  2  413 ? -38.248  -36.575 21.266   1.00 51.53  ? 414  ARG A O     1 
ATOM   4638  C  CB    . ARG B  2  413 ? -38.938  -37.678 24.217   1.00 47.40  ? 414  ARG A CB    1 
ATOM   4639  N  N     . PHE B  2  414 ? -36.373  -36.404 22.539   1.00 56.42  ? 415  PHE A N     1 
ATOM   4640  C  CA    . PHE B  2  414 ? -35.895  -35.106 21.983   1.00 63.38  ? 415  PHE A CA    1 
ATOM   4641  C  C     . PHE B  2  414 ? -34.542  -35.247 21.276   1.00 63.18  ? 415  PHE A C     1 
ATOM   4642  O  O     . PHE B  2  414 ? -33.974  -34.207 20.875   1.00 68.20  ? 415  PHE A O     1 
ATOM   4643  C  CB    . PHE B  2  414 ? -35.808  -34.048 23.090   1.00 67.73  ? 415  PHE A CB    1 
ATOM   4644  C  CG    . PHE B  2  414 ? -37.128  -33.728 23.744   1.00 66.66  ? 415  PHE A CG    1 
ATOM   4645  C  CD1   . PHE B  2  414 ? -37.946  -32.731 23.236   1.00 61.90  ? 415  PHE A CD1   1 
ATOM   4646  C  CD2   . PHE B  2  414 ? -37.556  -34.433 24.862   1.00 69.31  ? 415  PHE A CD2   1 
ATOM   4647  C  CE1   . PHE B  2  414 ? -39.157  -32.438 23.845   1.00 61.81  ? 415  PHE A CE1   1 
ATOM   4648  C  CE2   . PHE B  2  414 ? -38.770  -34.138 25.465   1.00 66.73  ? 415  PHE A CE2   1 
ATOM   4649  C  CZ    . PHE B  2  414 ? -39.568  -33.141 24.956   1.00 61.87  ? 415  PHE A CZ    1 
ATOM   4650  N  N     . LYS B  2  415 ? -34.053  -36.476 21.109   1.00 64.75  ? 416  LYS A N     1 
ATOM   4651  C  CA    . LYS B  2  415 ? -32.807  -36.779 20.356   1.00 68.22  ? 416  LYS A CA    1 
ATOM   4652  C  C     . LYS B  2  415 ? -31.643  -35.999 20.987   1.00 67.46  ? 416  LYS A C     1 
ATOM   4653  O  O     . LYS B  2  415 ? -30.860  -35.396 20.228   1.00 64.69  ? 416  LYS A O     1 
ATOM   4654  C  CB    . LYS B  2  415 ? -33.016  -36.455 18.869   1.00 64.72  ? 416  LYS A CB    1 
ATOM   4655  N  N     . LEU B  2  416 ? -31.552  -36.015 22.329   1.00 65.98  ? 417  LEU A N     1 
ATOM   4656  C  CA    . LEU B  2  416 ? -30.508  -35.324 23.143   1.00 67.66  ? 417  LEU A CA    1 
ATOM   4657  C  C     . LEU B  2  416 ? -29.395  -36.312 23.517   1.00 67.90  ? 417  LEU A C     1 
ATOM   4658  O  O     . LEU B  2  416 ? -29.703  -37.517 23.691   1.00 63.32  ? 417  LEU A O     1 
ATOM   4659  C  CB    . LEU B  2  416 ? -31.143  -34.756 24.415   1.00 70.00  ? 417  LEU A CB    1 
ATOM   4660  C  CG    . LEU B  2  416 ? -32.186  -33.648 24.218   1.00 76.68  ? 417  LEU A CG    1 
ATOM   4661  C  CD1   . LEU B  2  416 ? -32.974  -33.416 25.500   1.00 76.90  ? 417  LEU A CD1   1 
ATOM   4662  C  CD2   . LEU B  2  416 ? -31.526  -32.345 23.760   1.00 77.87  ? 417  LEU A CD2   1 
ATOM   4663  N  N     . SER B  2  417 ? -28.162  -35.813 23.663   1.00 70.22  ? 418  SER A N     1 
ATOM   4664  C  CA    . SER B  2  417 ? -27.012  -36.550 24.255   1.00 67.56  ? 418  SER A CA    1 
ATOM   4665  C  C     . SER B  2  417 ? -27.229  -36.696 25.769   1.00 79.87  ? 418  SER A C     1 
ATOM   4666  O  O     . SER B  2  417 ? -28.097  -35.989 26.330   1.00 81.21  ? 418  SER A O     1 
ATOM   4667  C  CB    . SER B  2  417 ? -25.702  -35.850 23.968   1.00 61.03  ? 418  SER A CB    1 
ATOM   4668  O  OG    . SER B  2  417 ? -25.598  -34.642 24.714   1.00 63.48  ? 418  SER A OG    1 
ATOM   4669  N  N     . GLU B  2  418 ? -26.450  -37.567 26.408   1.00 83.91  ? 419  GLU A N     1 
ATOM   4670  C  CA    . GLU B  2  418 ? -26.439  -37.745 27.886   1.00 81.70  ? 419  GLU A CA    1 
ATOM   4671  C  C     . GLU B  2  418 ? -25.990  -36.423 28.530   1.00 82.27  ? 419  GLU A C     1 
ATOM   4672  O  O     . GLU B  2  418 ? -26.614  -36.011 29.523   1.00 75.28  ? 419  GLU A O     1 
ATOM   4673  C  CB    . GLU B  2  418 ? -25.512  -38.893 28.269   1.00 78.89  ? 419  GLU A CB    1 
ATOM   4674  C  CG    . GLU B  2  418 ? -25.788  -39.426 29.659   1.00 80.17  ? 419  GLU A CG    1 
ATOM   4675  C  CD    . GLU B  2  418 ? -24.846  -40.550 30.046   1.00 84.86  ? 419  GLU A CD    1 
ATOM   4676  O  OE1   . GLU B  2  418 ? -25.305  -41.576 30.629   1.00 81.52  ? 419  GLU A OE1   1 
ATOM   4677  O  OE2   . GLU B  2  418 ? -23.634  -40.409 29.780   1.00 88.03  ? 419  GLU A OE2   1 
ATOM   4678  N  N     . LYS B  2  419 ? -24.958  -35.783 27.965   1.00 80.69  ? 420  LYS A N     1 
ATOM   4679  C  CA    . LYS B  2  419 ? -24.398  -34.490 28.449   1.00 76.16  ? 420  LYS A CA    1 
ATOM   4680  C  C     . LYS B  2  419 ? -25.485  -33.403 28.382   1.00 79.74  ? 420  LYS A C     1 
ATOM   4681  O  O     . LYS B  2  419 ? -25.571  -32.602 29.349   1.00 83.59  ? 420  LYS A O     1 
ATOM   4682  C  CB    . LYS B  2  419 ? -23.127  -34.105 27.674   1.00 70.46  ? 420  LYS A CB    1 
ATOM   4683  C  CG    . LYS B  2  419 ? -21.817  -34.701 28.200   1.00 63.67  ? 420  LYS A CG    1 
ATOM   4684  C  CD    . LYS B  2  419 ? -20.615  -34.588 27.259   1.00 57.05  ? 420  LYS A CD    1 
ATOM   4685  C  CE    . LYS B  2  419 ? -19.301  -34.933 27.921   1.00 52.72  ? 420  LYS A CE    1 
ATOM   4686  N  N     . GLN B  2  420 ? -26.303  -33.367 27.319   1.00 76.74  ? 421  GLN A N     1 
ATOM   4687  C  CA    . GLN B  2  420 ? -27.367  -32.335 27.142   1.00 77.65  ? 421  GLN A CA    1 
ATOM   4688  C  C     . GLN B  2  420 ? -28.522  -32.606 28.116   1.00 77.34  ? 421  GLN A C     1 
ATOM   4689  O  O     . GLN B  2  420 ? -29.079  -31.642 28.657   1.00 68.86  ? 421  GLN A O     1 
ATOM   4690  C  CB    . GLN B  2  420 ? -27.886  -32.293 25.704   1.00 75.91  ? 421  GLN A CB    1 
ATOM   4691  C  CG    . GLN B  2  420 ? -26.939  -31.615 24.715   1.00 80.01  ? 421  GLN A CG    1 
ATOM   4692  C  CD    . GLN B  2  420 ? -27.322  -31.890 23.281   1.00 80.33  ? 421  GLN A CD    1 
ATOM   4693  O  OE1   . GLN B  2  420 ? -27.846  -32.964 22.960   1.00 80.06  ? 421  GLN A OE1   1 
ATOM   4694  N  NE2   . GLN B  2  420 ? -27.065  -30.919 22.408   1.00 76.13  ? 421  GLN A NE2   1 
ATOM   4695  N  N     . ALA B  2  421 ? -28.887  -33.871 28.320   1.00 84.11  ? 422  ALA A N     1 
ATOM   4696  C  CA    . ALA B  2  421 ? -30.010  -34.264 29.203   1.00 78.47  ? 422  ALA A CA    1 
ATOM   4697  C  C     . ALA B  2  421 ? -29.639  -33.927 30.645   1.00 70.26  ? 422  ALA A C     1 
ATOM   4698  O  O     . ALA B  2  421 ? -30.519  -33.474 31.387   1.00 63.84  ? 422  ALA A O     1 
ATOM   4699  C  CB    . ALA B  2  421 ? -30.328  -35.734 29.051   1.00 78.31  ? 422  ALA A CB    1 
ATOM   4700  N  N     . GLN B  2  422 ? -28.377  -34.160 31.011   1.00 69.43  ? 423  GLN A N     1 
ATOM   4701  C  CA    . GLN B  2  422 ? -27.849  -33.866 32.365   1.00 78.74  ? 423  GLN A CA    1 
ATOM   4702  C  C     . GLN B  2  422 ? -27.975  -32.356 32.602   1.00 79.37  ? 423  GLN A C     1 
ATOM   4703  O  O     . GLN B  2  422 ? -28.514  -31.963 33.665   1.00 82.06  ? 423  GLN A O     1 
ATOM   4704  C  CB    . GLN B  2  422 ? -26.412  -34.390 32.495   1.00 81.69  ? 423  GLN A CB    1 
ATOM   4705  C  CG    . GLN B  2  422 ? -25.833  -34.472 33.907   1.00 86.01  ? 423  GLN A CG    1 
ATOM   4706  C  CD    . GLN B  2  422 ? -26.794  -35.003 34.946   1.00 91.89  ? 423  GLN A CD    1 
ATOM   4707  O  OE1   . GLN B  2  422 ? -27.173  -34.300 35.870   1.00 102.94 ? 423  GLN A OE1   1 
ATOM   4708  N  NE2   . GLN B  2  422 ? -27.300  -36.196 34.729   1.00 87.45  ? 423  GLN A NE2   1 
ATOM   4709  N  N     . ALA B  2  423 ? -27.561  -31.559 31.607   1.00 69.95  ? 424  ALA A N     1 
ATOM   4710  C  CA    . ALA B  2  423 ? -27.574  -30.076 31.633   1.00 64.91  ? 424  ALA A CA    1 
ATOM   4711  C  C     . ALA B  2  423 ? -29.005  -29.558 31.841   1.00 59.54  ? 424  ALA A C     1 
ATOM   4712  O  O     . ALA B  2  423 ? -29.164  -28.575 32.589   1.00 63.53  ? 424  ALA A O     1 
ATOM   4713  C  CB    . ALA B  2  423 ? -26.966  -29.526 30.357   1.00 68.95  ? 424  ALA A CB    1 
ATOM   4714  N  N     . ILE B  2  424 ? -29.994  -30.193 31.205   1.00 62.08  ? 425  ILE A N     1 
ATOM   4715  C  CA    . ILE B  2  424 ? -31.427  -29.776 31.262   1.00 63.46  ? 425  ILE A CA    1 
ATOM   4716  C  C     . ILE B  2  424 ? -32.004  -30.129 32.636   1.00 64.14  ? 425  ILE A C     1 
ATOM   4717  O  O     . ILE B  2  424 ? -32.785  -29.327 33.166   1.00 61.10  ? 425  ILE A O     1 
ATOM   4718  C  CB    . ILE B  2  424 ? -32.247  -30.400 30.114   1.00 65.11  ? 425  ILE A CB    1 
ATOM   4719  C  CG1   . ILE B  2  424 ? -31.850  -29.789 28.771   1.00 67.07  ? 425  ILE A CG1   1 
ATOM   4720  C  CG2   . ILE B  2  424 ? -33.753  -30.275 30.374   1.00 67.92  ? 425  ILE A CG2   1 
ATOM   4721  C  CD1   . ILE B  2  424 ? -32.188  -30.650 27.576   1.00 73.34  ? 425  ILE A CD1   1 
ATOM   4722  N  N     . LEU B  2  425 ? -31.636  -31.277 33.194   1.00 73.75  ? 426  LEU A N     1 
ATOM   4723  C  CA    . LEU B  2  425 ? -32.093  -31.687 34.548   1.00 82.68  ? 426  LEU A CA    1 
ATOM   4724  C  C     . LEU B  2  425 ? -31.464  -30.761 35.596   1.00 84.52  ? 426  LEU A C     1 
ATOM   4725  O  O     . LEU B  2  425 ? -32.082  -30.575 36.652   1.00 77.77  ? 426  LEU A O     1 
ATOM   4726  C  CB    . LEU B  2  425 ? -31.724  -33.154 34.781   1.00 88.91  ? 426  LEU A CB    1 
ATOM   4727  C  CG    . LEU B  2  425 ? -32.672  -34.163 34.129   1.00 82.63  ? 426  LEU A CG    1 
ATOM   4728  C  CD1   . LEU B  2  425 ? -32.134  -35.575 34.294   1.00 88.72  ? 426  LEU A CD1   1 
ATOM   4729  C  CD2   . LEU B  2  425 ? -34.091  -34.066 34.686   1.00 78.18  ? 426  LEU A CD2   1 
ATOM   4730  N  N     . ASP B  2  426 ? -30.290  -30.197 35.302   1.00 87.05  ? 427  ASP A N     1 
ATOM   4731  C  CA    . ASP B  2  426 ? -29.542  -29.303 36.228   1.00 80.06  ? 427  ASP A CA    1 
ATOM   4732  C  C     . ASP B  2  426 ? -29.984  -27.847 36.058   1.00 69.64  ? 427  ASP A C     1 
ATOM   4733  O  O     . ASP B  2  426 ? -29.640  -27.035 36.922   1.00 61.00  ? 427  ASP A O     1 
ATOM   4734  C  CB    . ASP B  2  426 ? -28.035  -29.444 36.021   1.00 86.94  ? 427  ASP A CB    1 
ATOM   4735  C  CG    . ASP B  2  426 ? -27.475  -30.682 36.695   1.00 92.60  ? 427  ASP A CG    1 
ATOM   4736  O  OD1   . ASP B  2  426 ? -28.067  -31.108 37.709   1.00 97.42  ? 427  ASP A OD1   1 
ATOM   4737  O  OD2   . ASP B  2  426 ? -26.462  -31.215 36.200   1.00 94.73  ? 427  ASP A OD2   1 
ATOM   4738  N  N     . MET B  2  427 ? -30.712  -27.530 34.988   1.00 67.67  ? 428  MET A N     1 
ATOM   4739  C  CA    . MET B  2  427 ? -31.243  -26.167 34.714   1.00 68.67  ? 428  MET A CA    1 
ATOM   4740  C  C     . MET B  2  427 ? -32.182  -25.762 35.869   1.00 69.81  ? 428  MET A C     1 
ATOM   4741  O  O     . MET B  2  427 ? -32.964  -26.612 36.318   1.00 60.70  ? 428  MET A O     1 
ATOM   4742  C  CB    . MET B  2  427 ? -32.000  -26.151 33.389   1.00 71.30  ? 428  MET A CB    1 
ATOM   4743  C  CG    . MET B  2  427 ? -32.527  -24.800 32.986   1.00 83.94  ? 428  MET A CG    1 
ATOM   4744  S  SD    . MET B  2  427 ? -32.776  -24.562 31.214   1.00 98.57  ? 428  MET A SD    1 
ATOM   4745  C  CE    . MET B  2  427 ? -33.317  -26.184 30.669   1.00 105.50 ? 428  MET A CE    1 
ATOM   4746  N  N     . ARG B  2  428 ? -32.078  -24.522 36.352   1.00 68.67  ? 429  ARG A N     1 
ATOM   4747  C  CA    . ARG B  2  428 ? -32.950  -23.963 37.423   1.00 65.62  ? 429  ARG A CA    1 
ATOM   4748  C  C     . ARG B  2  428 ? -34.190  -23.332 36.780   1.00 68.81  ? 429  ARG A C     1 
ATOM   4749  O  O     . ARG B  2  428 ? -34.092  -22.911 35.620   1.00 79.73  ? 429  ARG A O     1 
ATOM   4750  C  CB    . ARG B  2  428 ? -32.224  -22.901 38.254   1.00 60.90  ? 429  ARG A CB    1 
ATOM   4751  C  CG    . ARG B  2  428 ? -30.904  -23.371 38.835   1.00 59.27  ? 429  ARG A CG    1 
ATOM   4752  C  CD    . ARG B  2  428 ? -30.092  -22.218 39.387   1.00 59.75  ? 429  ARG A CD    1 
ATOM   4753  N  NE    . ARG B  2  428 ? -28.922  -22.715 40.102   1.00 60.68  ? 429  ARG A NE    1 
ATOM   4754  C  CZ    . ARG B  2  428 ? -28.947  -23.288 41.308   1.00 56.78  ? 429  ARG A CZ    1 
ATOM   4755  N  NH1   . ARG B  2  428 ? -30.088  -23.455 41.957   1.00 50.84  ? 429  ARG A NH1   1 
ATOM   4756  N  NH2   . ARG B  2  428 ? -27.823  -23.712 41.849   1.00 59.04  ? 429  ARG A NH2   1 
ATOM   4757  N  N     . LEU B  2  429 ? -35.297  -23.249 37.530   1.00 65.60  ? 430  LEU A N     1 
ATOM   4758  C  CA    . LEU B  2  429 ? -36.577  -22.673 37.050   1.00 73.30  ? 430  LEU A CA    1 
ATOM   4759  C  C     . LEU B  2  429 ? -36.403  -21.208 36.623   1.00 78.26  ? 430  LEU A C     1 
ATOM   4760  O  O     . LEU B  2  429 ? -37.133  -20.807 35.690   1.00 80.78  ? 430  LEU A O     1 
ATOM   4761  C  CB    . LEU B  2  429 ? -37.645  -22.832 38.136   1.00 72.88  ? 430  LEU A CB    1 
ATOM   4762  C  CG    . LEU B  2  429 ? -38.187  -24.258 38.299   1.00 71.02  ? 430  LEU A CG    1 
ATOM   4763  C  CD1   . LEU B  2  429 ? -39.342  -24.304 39.296   1.00 69.82  ? 430  LEU A CD1   1 
ATOM   4764  C  CD2   . LEU B  2  429 ? -38.616  -24.831 36.957   1.00 69.67  ? 430  LEU A CD2   1 
ATOM   4765  N  N     . ARG B  2  430 ? -35.471  -20.458 37.240   1.00 73.21  ? 431  ARG A N     1 
ATOM   4766  C  CA    . ARG B  2  430 ? -35.299  -18.997 36.973   1.00 70.62  ? 431  ARG A CA    1 
ATOM   4767  C  C     . ARG B  2  430 ? -34.811  -18.790 35.533   1.00 72.00  ? 431  ARG A C     1 
ATOM   4768  O  O     . ARG B  2  430 ? -34.844  -17.610 35.039   1.00 81.48  ? 431  ARG A O     1 
ATOM   4769  C  CB    . ARG B  2  430 ? -34.369  -18.339 37.996   1.00 73.11  ? 431  ARG A CB    1 
ATOM   4770  C  CG    . ARG B  2  430 ? -32.878  -18.474 37.730   1.00 77.46  ? 431  ARG A CG    1 
ATOM   4771  C  CD    . ARG B  2  430 ? -32.026  -17.571 38.618   1.00 82.02  ? 431  ARG A CD    1 
ATOM   4772  N  NE    . ARG B  2  430 ? -32.381  -17.690 40.035   1.00 89.52  ? 431  ARG A NE    1 
ATOM   4773  C  CZ    . ARG B  2  430 ? -33.115  -16.821 40.740   1.00 85.89  ? 431  ARG A CZ    1 
ATOM   4774  N  NH1   . ARG B  2  430 ? -33.594  -15.723 40.188   1.00 89.13  ? 431  ARG A NH1   1 
ATOM   4775  N  NH2   . ARG B  2  430 ? -33.352  -17.038 42.019   1.00 78.55  ? 431  ARG A NH2   1 
ATOM   4776  N  N     . ARG B  2  431 ? -34.399  -19.880 34.869   1.00 64.57  ? 432  ARG A N     1 
ATOM   4777  C  CA    . ARG B  2  431 ? -33.892  -19.854 33.472   1.00 64.26  ? 432  ARG A CA    1 
ATOM   4778  C  C     . ARG B  2  431 ? -35.058  -19.915 32.461   1.00 61.80  ? 432  ARG A C     1 
ATOM   4779  O  O     . ARG B  2  431 ? -34.780  -19.843 31.256   1.00 59.56  ? 432  ARG A O     1 
ATOM   4780  C  CB    . ARG B  2  431 ? -32.881  -20.989 33.308   1.00 61.63  ? 432  ARG A CB    1 
ATOM   4781  C  CG    . ARG B  2  431 ? -31.594  -20.571 32.630   1.00 62.82  ? 432  ARG A CG    1 
ATOM   4782  C  CD    . ARG B  2  431 ? -30.448  -21.452 33.055   1.00 64.20  ? 432  ARG A CD    1 
ATOM   4783  N  NE    . ARG B  2  431 ? -29.484  -21.477 31.965   1.00 68.58  ? 432  ARG A NE    1 
ATOM   4784  C  CZ    . ARG B  2  431 ? -28.238  -21.899 32.031   1.00 78.18  ? 432  ARG A CZ    1 
ATOM   4785  N  NH1   . ARG B  2  431 ? -27.733  -22.363 33.164   1.00 79.16  ? 432  ARG A NH1   1 
ATOM   4786  N  NH2   . ARG B  2  431 ? -27.497  -21.858 30.934   1.00 90.19  ? 432  ARG A NH2   1 
ATOM   4787  N  N     . LEU B  2  432 ? -36.318  -20.009 32.922   1.00 62.45  ? 433  LEU A N     1 
ATOM   4788  C  CA    . LEU B  2  432 ? -37.514  -20.052 32.042   1.00 66.46  ? 433  LEU A CA    1 
ATOM   4789  C  C     . LEU B  2  432 ? -38.127  -18.654 31.839   1.00 69.02  ? 433  LEU A C     1 
ATOM   4790  O  O     . LEU B  2  432 ? -39.174  -18.578 31.175   1.00 78.43  ? 433  LEU A O     1 
ATOM   4791  C  CB    . LEU B  2  432 ? -38.538  -21.008 32.654   1.00 70.43  ? 433  LEU A CB    1 
ATOM   4792  C  CG    . LEU B  2  432 ? -38.204  -22.487 32.494   1.00 72.33  ? 433  LEU A CG    1 
ATOM   4793  C  CD1   . LEU B  2  432 ? -36.859  -22.866 33.085   1.00 76.99  ? 433  LEU A CD1   1 
ATOM   4794  C  CD2   . LEU B  2  432 ? -39.314  -23.323 33.112   1.00 73.98  ? 433  LEU A CD2   1 
ATOM   4795  N  N     . THR B  2  433 ? -37.534  -17.596 32.394   1.00 67.19  ? 434  THR A N     1 
ATOM   4796  C  CA    . THR B  2  433 ? -38.012  -16.197 32.200   1.00 69.78  ? 434  THR A CA    1 
ATOM   4797  C  C     . THR B  2  433 ? -37.679  -15.765 30.760   1.00 80.20  ? 434  THR A C     1 
ATOM   4798  O  O     . THR B  2  433 ? -36.906  -16.485 30.078   1.00 72.63  ? 434  THR A O     1 
ATOM   4799  C  CB    . THR B  2  433 ? -37.447  -15.231 33.249   1.00 69.43  ? 434  THR A CB    1 
ATOM   4800  O  OG1   . THR B  2  433 ? -36.037  -15.130 33.052   1.00 79.70  ? 434  THR A OG1   1 
ATOM   4801  C  CG2   . THR B  2  433 ? -37.742  -15.643 34.674   1.00 68.13  ? 434  THR A CG2   1 
ATOM   4802  N  N     . GLY B  2  434 ? -38.262  -14.646 30.318   1.00 85.92  ? 435  GLY A N     1 
ATOM   4803  C  CA    . GLY B  2  434 ? -38.193  -14.153 28.927   1.00 84.80  ? 435  GLY A CA    1 
ATOM   4804  C  C     . GLY B  2  434 ? -36.782  -13.730 28.526   1.00 89.94  ? 435  GLY A C     1 
ATOM   4805  O  O     . GLY B  2  434 ? -36.316  -14.111 27.449   1.00 112.74 ? 435  GLY A O     1 
ATOM   4806  N  N     . LEU B  2  435 ? -36.120  -12.943 29.365   1.00 82.39  ? 436  LEU A N     1 
ATOM   4807  C  CA    . LEU B  2  435 ? -34.768  -12.376 29.078   1.00 79.27  ? 436  LEU A CA    1 
ATOM   4808  C  C     . LEU B  2  435 ? -33.744  -13.507 29.024   1.00 86.86  ? 436  LEU A C     1 
ATOM   4809  O  O     . LEU B  2  435 ? -32.757  -13.347 28.256   1.00 90.25  ? 436  LEU A O     1 
ATOM   4810  C  CB    . LEU B  2  435 ? -34.412  -11.321 30.122   1.00 73.34  ? 436  LEU A CB    1 
ATOM   4811  C  CG    . LEU B  2  435 ? -35.283  -10.070 29.961   1.00 65.68  ? 436  LEU A CG    1 
ATOM   4812  C  CD1   . LEU B  2  435 ? -35.071  -9.048  31.062   1.00 62.97  ? 436  LEU A CD1   1 
ATOM   4813  C  CD2   . LEU B  2  435 ? -35.100  -9.441  28.584   1.00 60.52  ? 436  LEU A CD2   1 
ATOM   4814  N  N     . GLU B  2  436 ? -33.967  -14.612 29.757   1.00 91.25  ? 437  GLU A N     1 
ATOM   4815  C  CA    . GLU B  2  436 ? -33.004  -15.749 29.873   1.00 90.25  ? 437  GLU A CA    1 
ATOM   4816  C  C     . GLU B  2  436 ? -32.903  -16.524 28.548   1.00 86.78  ? 437  GLU A C     1 
ATOM   4817  O  O     . GLU B  2  436 ? -31.796  -16.994 28.256   1.00 81.92  ? 437  GLU A O     1 
ATOM   4818  C  CB    . GLU B  2  436 ? -33.387  -16.685 31.028   1.00 91.96  ? 437  GLU A CB    1 
ATOM   4819  C  CG    . GLU B  2  436 ? -32.582  -16.449 32.306   1.00 89.10  ? 437  GLU A CG    1 
ATOM   4820  C  CD    . GLU B  2  436 ? -31.068  -16.611 32.206   1.00 85.25  ? 437  GLU A CD    1 
ATOM   4821  O  OE1   . GLU B  2  436 ? -30.592  -17.425 31.385   1.00 79.58  ? 437  GLU A OE1   1 
ATOM   4822  O  OE2   . GLU B  2  436 ? -30.370  -15.969 32.972   1.00 77.57  ? 437  GLU A OE2   1 
ATOM   4823  N  N     . ARG B  2  437 ? -33.988  -16.674 27.781   1.00 96.01  ? 438  ARG A N     1 
ATOM   4824  C  CA    . ARG B  2  437 ? -33.944  -17.359 26.452   1.00 111.35 ? 438  ARG A CA    1 
ATOM   4825  C  C     . ARG B  2  437 ? -33.067  -16.555 25.486   1.00 120.26 ? 438  ARG A C     1 
ATOM   4826  O  O     . ARG B  2  437 ? -32.314  -17.195 24.712   1.00 145.36 ? 438  ARG A O     1 
ATOM   4827  C  CB    . ARG B  2  437 ? -35.365  -17.591 25.929   1.00 109.84 ? 438  ARG A CB    1 
ATOM   4828  C  CG    . ARG B  2  437 ? -35.559  -18.014 24.478   1.00 104.42 ? 438  ARG A CG    1 
ATOM   4829  C  CD    . ARG B  2  437 ? -34.793  -19.202 23.952   1.00 98.06  ? 438  ARG A CD    1 
ATOM   4830  N  NE    . ARG B  2  437 ? -34.613  -19.145 22.500   1.00 98.05  ? 438  ARG A NE    1 
ATOM   4831  C  CZ    . ARG B  2  437 ? -33.955  -18.179 21.848   1.00 107.87 ? 438  ARG A CZ    1 
ATOM   4832  N  NH1   . ARG B  2  437 ? -33.430  -17.151 22.496   1.00 106.30 ? 438  ARG A NH1   1 
ATOM   4833  N  NH2   . ARG B  2  437 ? -33.847  -18.233 20.535   1.00 116.97 ? 438  ARG A NH2   1 
ATOM   4834  N  N     . ASP B  2  438 ? -33.153  -15.225 25.534   1.00 109.06 ? 439  ASP A N     1 
ATOM   4835  C  CA    . ASP B  2  438 ? -32.404  -14.321 24.616   1.00 106.50 ? 439  ASP A CA    1 
ATOM   4836  C  C     . ASP B  2  438 ? -30.912  -14.373 24.989   1.00 101.31 ? 439  ASP A C     1 
ATOM   4837  O  O     . ASP B  2  438 ? -30.065  -14.455 24.065   1.00 88.21  ? 439  ASP A O     1 
ATOM   4838  C  CB    . ASP B  2  438 ? -32.941  -12.889 24.685   1.00 113.21 ? 439  ASP A CB    1 
ATOM   4839  C  CG    . ASP B  2  438 ? -34.316  -12.705 24.068   1.00 116.91 ? 439  ASP A CG    1 
ATOM   4840  O  OD1   . ASP B  2  438 ? -34.673  -13.500 23.181   1.00 110.78 ? 439  ASP A OD1   1 
ATOM   4841  O  OD2   . ASP B  2  438 ? -35.016  -11.753 24.470   1.00 127.17 ? 439  ASP A OD2   1 
ATOM   4842  N  N     . LYS B  2  439 ? -30.624  -14.326 26.299   1.00 104.27 ? 440  LYS A N     1 
ATOM   4843  C  CA    . LYS B  2  439 ? -29.266  -14.394 26.888   1.00 114.43 ? 440  LYS A CA    1 
ATOM   4844  C  C     . LYS B  2  439 ? -28.548  -15.676 26.418   1.00 122.54 ? 440  LYS A C     1 
ATOM   4845  O  O     . LYS B  2  439 ? -27.318  -15.614 26.148   1.00 122.08 ? 440  LYS A O     1 
ATOM   4846  C  CB    . LYS B  2  439 ? -29.377  -14.331 28.417   1.00 111.44 ? 440  LYS A CB    1 
ATOM   4847  C  CG    . LYS B  2  439 ? -28.140  -13.890 29.211   1.00 103.72 ? 440  LYS A CG    1 
ATOM   4848  C  CD    . LYS B  2  439 ? -28.432  -12.873 30.362   1.00 98.21  ? 440  LYS A CD    1 
ATOM   4849  C  CE    . LYS B  2  439 ? -27.816  -13.200 31.708   1.00 89.28  ? 440  LYS A CE    1 
ATOM   4850  N  NZ    . LYS B  2  439 ? -28.857  -13.370 32.744   1.00 78.31  ? 440  LYS A NZ    1 
ATOM   4851  N  N     . ILE B  2  440 ? -29.276  -16.795 26.323   1.00 125.34 ? 441  ILE A N     1 
ATOM   4852  C  CA    . ILE B  2  440 ? -28.700  -18.114 25.930   1.00 122.17 ? 441  ILE A CA    1 
ATOM   4853  C  C     . ILE B  2  440 ? -28.339  -18.064 24.447   1.00 130.53 ? 441  ILE A C     1 
ATOM   4854  O  O     . ILE B  2  440 ? -27.258  -18.593 24.077   1.00 142.90 ? 441  ILE A O     1 
ATOM   4855  C  CB    . ILE B  2  440 ? -29.642  -19.289 26.262   1.00 122.33 ? 441  ILE A CB    1 
ATOM   4856  C  CG1   . ILE B  2  440 ? -29.586  -19.594 27.765   1.00 124.76 ? 441  ILE A CG1   1 
ATOM   4857  C  CG2   . ILE B  2  440 ? -29.296  -20.523 25.426   1.00 123.12 ? 441  ILE A CG2   1 
ATOM   4858  C  CD1   . ILE B  2  440 ? -30.464  -20.718 28.219   1.00 120.76 ? 441  ILE A CD1   1 
ATOM   4859  N  N     . GLU B  2  441 ? -29.195  -17.456 23.627   1.00 142.95 ? 442  GLU A N     1 
ATOM   4860  C  CA    . GLU B  2  441 ? -28.968  -17.449 22.162   1.00 164.70 ? 442  GLU A CA    1 
ATOM   4861  C  C     . GLU B  2  441 ? -27.864  -16.442 21.827   1.00 162.77 ? 442  GLU A C     1 
ATOM   4862  O  O     . GLU B  2  441 ? -27.095  -16.702 20.885   1.00 179.70 ? 442  GLU A O     1 
ATOM   4863  C  CB    . GLU B  2  441 ? -30.242  -17.210 21.360   1.00 179.09 ? 442  GLU A CB    1 
ATOM   4864  C  CG    . GLU B  2  441 ? -30.027  -17.886 19.999   1.00 186.06 ? 442  GLU A CG    1 
ATOM   4865  C  CD    . GLU B  2  441 ? -31.104  -17.790 18.950   1.00 189.12 ? 442  GLU A CD    1 
ATOM   4866  O  OE1   . GLU B  2  441 ? -31.511  -16.648 18.714   1.00 190.84 ? 442  GLU A OE1   1 
ATOM   4867  O  OE2   . GLU B  2  441 ? -31.488  -18.856 18.338   1.00 181.34 ? 442  GLU A OE2   1 
ATOM   4868  N  N     . ALA B  2  442 ? -27.769  -15.344 22.582   1.00 143.95 ? 443  ALA A N     1 
ATOM   4869  C  CA    . ALA B  2  442 ? -26.662  -14.363 22.496   1.00 122.20 ? 443  ALA A CA    1 
ATOM   4870  C  C     . ALA B  2  442 ? -25.318  -15.088 22.691   1.00 98.75  ? 443  ALA A C     1 
ATOM   4871  O  O     . ALA B  2  442 ? -24.445  -14.955 21.782   1.00 78.17  ? 443  ALA A O     1 
ATOM   4872  C  CB    . ALA B  2  442 ? -26.862  -13.266 23.503   1.00 117.73 ? 443  ALA A CB    1 
ATOM   4873  N  N     . GLU B  2  443 ? -25.166  -15.824 23.799   1.00 87.85  ? 444  GLU A N     1 
ATOM   4874  C  CA    . GLU B  2  443 ? -23.922  -16.574 24.141   1.00 86.53  ? 444  GLU A CA    1 
ATOM   4875  C  C     . GLU B  2  443 ? -23.619  -17.602 23.036   1.00 92.31  ? 444  GLU A C     1 
ATOM   4876  O  O     . GLU B  2  443 ? -22.423  -17.815 22.715   1.00 95.00  ? 444  GLU A O     1 
ATOM   4877  C  CB    . GLU B  2  443 ? -24.024  -17.307 25.480   1.00 80.19  ? 444  GLU A CB    1 
ATOM   4878  C  CG    . GLU B  2  443 ? -22.762  -18.104 25.838   1.00 74.73  ? 444  GLU A CG    1 
ATOM   4879  C  CD    . GLU B  2  443 ? -22.811  -18.878 27.133   1.00 71.88  ? 444  GLU A CD    1 
ATOM   4880  O  OE1   . GLU B  2  443 ? -21.823  -19.588 27.470   1.00 63.90  ? 444  GLU A OE1   1 
ATOM   4881  O  OE2   . GLU B  2  443 ? -23.871  -18.809 27.762   1.00 78.17  ? 444  GLU A OE2   1 
ATOM   4882  N  N     . TYR B  2  444 ? -24.667  -18.233 22.496   1.00 100.28 ? 445  TYR A N     1 
ATOM   4883  C  CA    . TYR B  2  444 ? -24.526  -19.331 21.507   1.00 97.19  ? 445  TYR A CA    1 
ATOM   4884  C  C     . TYR B  2  444 ? -23.977  -18.793 20.175   1.00 100.10 ? 445  TYR A C     1 
ATOM   4885  O  O     . TYR B  2  444 ? -23.161  -19.476 19.546   1.00 88.67  ? 445  TYR A O     1 
ATOM   4886  C  CB    . TYR B  2  444 ? -25.856  -20.046 21.288   1.00 95.57  ? 445  TYR A CB    1 
ATOM   4887  C  CG    . TYR B  2  444 ? -25.744  -21.148 20.273   1.00 100.00 ? 445  TYR A CG    1 
ATOM   4888  C  CD1   . TYR B  2  444 ? -25.019  -22.292 20.552   1.00 101.91 ? 445  TYR A CD1   1 
ATOM   4889  C  CD2   . TYR B  2  444 ? -26.295  -21.020 19.014   1.00 98.03  ? 445  TYR A CD2   1 
ATOM   4890  C  CE1   . TYR B  2  444 ? -24.893  -23.316 19.626   1.00 100.05 ? 445  TYR A CE1   1 
ATOM   4891  C  CE2   . TYR B  2  444 ? -26.168  -22.028 18.071   1.00 95.30  ? 445  TYR A CE2   1 
ATOM   4892  C  CZ    . TYR B  2  444 ? -25.464  -23.179 18.380   1.00 93.23  ? 445  TYR A CZ    1 
ATOM   4893  O  OH    . TYR B  2  444 ? -25.325  -24.174 17.463   1.00 80.13  ? 445  TYR A OH    1 
ATOM   4894  N  N     . ASN B  2  445 ? -24.423  -17.603 19.765   1.00 108.88 ? 446  ASN A N     1 
ATOM   4895  C  CA    . ASN B  2  445 ? -24.024  -16.968 18.480   1.00 106.82 ? 446  ASN A CA    1 
ATOM   4896  C  C     . ASN B  2  445 ? -22.567  -16.500 18.569   1.00 103.35 ? 446  ASN A C     1 
ATOM   4897  O  O     . ASN B  2  445 ? -21.829  -16.753 17.609   1.00 98.53  ? 446  ASN A O     1 
ATOM   4898  C  CB    . ASN B  2  445 ? -25.008  -15.867 18.080   1.00 115.37 ? 446  ASN A CB    1 
ATOM   4899  C  CG    . ASN B  2  445 ? -26.314  -16.458 17.580   1.00 119.09 ? 446  ASN A CG    1 
ATOM   4900  O  OD1   . ASN B  2  445 ? -26.315  -17.301 16.686   1.00 123.84 ? 446  ASN A OD1   1 
ATOM   4901  N  ND2   . ASN B  2  445 ? -27.434  -16.050 18.156   1.00 120.58 ? 446  ASN A ND2   1 
ATOM   4902  N  N     . GLU B  2  446 ? -22.175  -15.851 19.671   1.00 96.45  ? 447  GLU A N     1 
ATOM   4903  C  CA    . GLU B  2  446 ? -20.775  -15.402 19.928   1.00 90.57  ? 447  GLU A CA    1 
ATOM   4904  C  C     . GLU B  2  446 ? -19.840  -16.630 19.907   1.00 93.38  ? 447  GLU A C     1 
ATOM   4905  O  O     . GLU B  2  446 ? -18.723  -16.538 19.323   1.00 98.51  ? 447  GLU A O     1 
ATOM   4906  C  CB    . GLU B  2  446 ? -20.674  -14.638 21.247   1.00 75.10  ? 447  GLU A CB    1 
ATOM   4907  N  N     . LEU B  2  447 ? -20.300  -17.743 20.496   1.00 89.42  ? 448  LEU A N     1 
ATOM   4908  C  CA    . LEU B  2  447 ? -19.530  -19.010 20.576   1.00 94.63  ? 448  LEU A CA    1 
ATOM   4909  C  C     . LEU B  2  447 ? -19.227  -19.533 19.161   1.00 94.55  ? 448  LEU A C     1 
ATOM   4910  O  O     . LEU B  2  447 ? -18.101  -20.002 18.916   1.00 87.40  ? 448  LEU A O     1 
ATOM   4911  C  CB    . LEU B  2  447 ? -20.326  -20.037 21.382   1.00 99.74  ? 448  LEU A CB    1 
ATOM   4912  C  CG    . LEU B  2  447 ? -19.737  -20.442 22.731   1.00 94.78  ? 448  LEU A CG    1 
ATOM   4913  C  CD1   . LEU B  2  447 ? -20.611  -21.515 23.374   1.00 102.32 ? 448  LEU A CD1   1 
ATOM   4914  C  CD2   . LEU B  2  447 ? -18.302  -20.942 22.589   1.00 88.14  ? 448  LEU A CD2   1 
ATOM   4915  N  N     . LEU B  2  448 ? -20.205  -19.456 18.261   1.00 95.97  ? 449  LEU A N     1 
ATOM   4916  C  CA    . LEU B  2  448 ? -20.052  -19.948 16.864   1.00 97.36  ? 449  LEU A CA    1 
ATOM   4917  C  C     . LEU B  2  448 ? -19.018  -19.094 16.119   1.00 104.69 ? 449  LEU A C     1 
ATOM   4918  O  O     . LEU B  2  448 ? -18.217  -19.679 15.391   1.00 99.64  ? 449  LEU A O     1 
ATOM   4919  C  CB    . LEU B  2  448 ? -21.420  -19.952 16.168   1.00 95.11  ? 449  LEU A CB    1 
ATOM   4920  C  CG    . LEU B  2  448 ? -22.404  -20.996 16.700   1.00 99.37  ? 449  LEU A CG    1 
ATOM   4921  C  CD1   . LEU B  2  448 ? -23.767  -20.768 16.086   1.00 102.26 ? 449  LEU A CD1   1 
ATOM   4922  C  CD2   . LEU B  2  448 ? -21.926  -22.426 16.459   1.00 95.58  ? 449  LEU A CD2   1 
ATOM   4923  N  N     . ASN B  2  449 ? -19.005  -17.773 16.315   1.00 114.84 ? 450  ASN A N     1 
ATOM   4924  C  CA    . ASN B  2  449 ? -17.964  -16.875 15.729   1.00 109.20 ? 450  ASN A CA    1 
ATOM   4925  C  C     . ASN B  2  449 ? -16.596  -17.274 16.285   1.00 107.26 ? 450  ASN A C     1 
ATOM   4926  O  O     . ASN B  2  449 ? -15.663  -17.418 15.464   1.00 113.43 ? 450  ASN A O     1 
ATOM   4927  C  CB    . ASN B  2  449 ? -18.175  -15.387 16.015   1.00 111.54 ? 450  ASN A CB    1 
ATOM   4928  C  CG    . ASN B  2  449 ? -19.506  -14.870 15.515   1.00 115.65 ? 450  ASN A CG    1 
ATOM   4929  O  OD1   . ASN B  2  449 ? -20.261  -15.624 14.906   1.00 120.52 ? 450  ASN A OD1   1 
ATOM   4930  N  ND2   . ASN B  2  449 ? -19.798  -13.606 15.775   1.00 115.27 ? 450  ASN A ND2   1 
ATOM   4931  N  N     . TYR B  2  450 ? -16.490  -17.446 17.612   1.00 102.24 ? 451  TYR A N     1 
ATOM   4932  C  CA    . TYR B  2  450 ? -15.227  -17.844 18.292   1.00 110.48 ? 451  TYR A CA    1 
ATOM   4933  C  C     . TYR B  2  450 ? -14.718  -19.183 17.716   1.00 115.33 ? 451  TYR A C     1 
ATOM   4934  O  O     . TYR B  2  450 ? -13.509  -19.292 17.399   1.00 100.12 ? 451  TYR A O     1 
ATOM   4935  C  CB    . TYR B  2  450 ? -15.413  -17.907 19.810   1.00 109.82 ? 451  TYR A CB    1 
ATOM   4936  C  CG    . TYR B  2  450 ? -14.160  -18.197 20.618   1.00 108.13 ? 451  TYR A CG    1 
ATOM   4937  C  CD1   . TYR B  2  450 ? -12.948  -17.581 20.341   1.00 103.81 ? 451  TYR A CD1   1 
ATOM   4938  C  CD2   . TYR B  2  450 ? -14.202  -19.069 21.700   1.00 107.29 ? 451  TYR A CD2   1 
ATOM   4939  C  CE1   . TYR B  2  450 ? -11.813  -17.837 21.094   1.00 104.62 ? 451  TYR A CE1   1 
ATOM   4940  C  CE2   . TYR B  2  450 ? -13.079  -19.332 22.466   1.00 103.17 ? 451  TYR A CE2   1 
ATOM   4941  C  CZ    . TYR B  2  450 ? -11.875  -18.716 22.164   1.00 105.28 ? 451  TYR A CZ    1 
ATOM   4942  O  OH    . TYR B  2  450 ? -10.766  -18.992 22.923   1.00 94.22  ? 451  TYR A OH    1 
ATOM   4943  N  N     . ILE B  2  451 ? -15.607  -20.172 17.579   1.00 115.93 ? 452  ILE A N     1 
ATOM   4944  C  CA    . ILE B  2  451 ? -15.224  -21.523 17.072   1.00 108.96 ? 452  ILE A CA    1 
ATOM   4945  C  C     . ILE B  2  451 ? -14.614  -21.356 15.667   1.00 109.47 ? 452  ILE A C     1 
ATOM   4946  O  O     . ILE B  2  451 ? -13.592  -22.006 15.381   1.00 109.70 ? 452  ILE A O     1 
ATOM   4947  C  CB    . ILE B  2  451 ? -16.414  -22.502 17.109   1.00 109.67 ? 452  ILE A CB    1 
ATOM   4948  C  CG1   . ILE B  2  451 ? -16.821  -22.826 18.545   1.00 98.50  ? 452  ILE A CG1   1 
ATOM   4949  C  CG2   . ILE B  2  451 ? -16.118  -23.768 16.319   1.00 114.01 ? 452  ILE A CG2   1 
ATOM   4950  C  CD1   . ILE B  2  451 ? -18.178  -23.486 18.695   1.00 89.19  ? 452  ILE A CD1   1 
ATOM   4951  N  N     . SER B  2  452 ? -15.197  -20.479 14.844   1.00 110.52 ? 453  SER A N     1 
ATOM   4952  C  CA    . SER B  2  452 ? -14.763  -20.200 13.446   1.00 107.06 ? 453  SER A CA    1 
ATOM   4953  C  C     . SER B  2  452 ? -13.388  -19.512 13.441   1.00 104.68 ? 453  SER A C     1 
ATOM   4954  O  O     . SER B  2  452 ? -12.536  -19.899 12.600   1.00 101.07 ? 453  SER A O     1 
ATOM   4955  C  CB    . SER B  2  452 ? -15.810  -19.399 12.705   1.00 109.66 ? 453  SER A CB    1 
ATOM   4956  O  OG    . SER B  2  452 ? -15.247  -18.630 11.650   1.00 105.42 ? 453  SER A OG    1 
ATOM   4957  N  N     A GLU B  2  453 ? -13.174  -18.539 14.343   0.50 101.60 ? 454  GLU A N     1 
ATOM   4958  N  N     B GLU B  2  453 ? -13.174  -18.539 14.343   0.50 104.58 ? 454  GLU A N     1 
ATOM   4959  C  CA    A GLU B  2  453 ? -11.882  -17.814 14.509   0.50 101.16 ? 454  GLU A CA    1 
ATOM   4960  C  CA    B GLU B  2  453 ? -11.881  -17.817 14.509   0.50 105.91 ? 454  GLU A CA    1 
ATOM   4961  C  C     A GLU B  2  453 ? -10.787  -18.825 14.876   0.50 101.93 ? 454  GLU A C     1 
ATOM   4962  C  C     B GLU B  2  453 ? -10.786  -18.826 14.876   0.50 104.64 ? 454  GLU A C     1 
ATOM   4963  O  O     A GLU B  2  453 ? -9.674   -18.728 14.310   0.50 106.26 ? 454  GLU A O     1 
ATOM   4964  O  O     B GLU B  2  453 ? -9.674   -18.728 14.310   0.50 108.76 ? 454  GLU A O     1 
ATOM   4965  C  CB    A GLU B  2  453 ? -11.988  -16.718 15.577   0.50 100.42 ? 454  GLU A CB    1 
ATOM   4966  C  CB    B GLU B  2  453 ? -11.990  -16.716 15.566   0.50 108.87 ? 454  GLU A CB    1 
ATOM   4967  C  CG    A GLU B  2  453 ? -12.891  -15.556 15.188   0.50 101.37 ? 454  GLU A CG    1 
ATOM   4968  C  CG    B GLU B  2  453 ? -12.883  -15.580 15.109   0.50 113.17 ? 454  GLU A CG    1 
ATOM   4969  C  CD    A GLU B  2  453 ? -13.377  -14.697 16.348   0.50 99.39  ? 454  GLU A CD    1 
ATOM   4970  C  CD    B GLU B  2  453 ? -13.105  -15.566 13.604   0.50 114.58 ? 454  GLU A CD    1 
ATOM   4971  O  OE1   A GLU B  2  453 ? -12.878  -14.894 17.468   0.50 94.79  ? 454  GLU A OE1   1 
ATOM   4972  O  OE1   B GLU B  2  453 ? -12.426  -16.348 12.908   0.50 115.53 ? 454  GLU A OE1   1 
ATOM   4973  O  OE2   A GLU B  2  453 ? -14.253  -13.830 16.131   0.50 97.72  ? 454  GLU A OE2   1 
ATOM   4974  O  OE2   B GLU B  2  453 ? -13.954  -14.780 13.128   0.50 114.97 ? 454  GLU A OE2   1 
ATOM   4975  N  N     . LEU B  2  454 ? -11.096  -19.761 15.777   1.00 97.43  ? 455  LEU A N     1 
ATOM   4976  C  CA    . LEU B  2  454 ? -10.128  -20.783 16.263   1.00 87.55  ? 455  LEU A CA    1 
ATOM   4977  C  C     . LEU B  2  454 ? -9.756   -21.739 15.120   1.00 77.19  ? 455  LEU A C     1 
ATOM   4978  O  O     . LEU B  2  454 ? -8.571   -22.108 15.012   1.00 64.20  ? 455  LEU A O     1 
ATOM   4979  C  CB    . LEU B  2  454 ? -10.744  -21.532 17.451   1.00 91.59  ? 455  LEU A CB    1 
ATOM   4980  C  CG    . LEU B  2  454 ? -10.976  -20.682 18.705   1.00 90.81  ? 455  LEU A CG    1 
ATOM   4981  C  CD1   . LEU B  2  454 ? -11.775  -21.468 19.736   1.00 91.40  ? 455  LEU A CD1   1 
ATOM   4982  C  CD2   . LEU B  2  454 ? -9.653   -20.195 19.288   1.00 88.21  ? 455  LEU A CD2   1 
ATOM   4983  N  N     . GLU B  2  455 ? -10.729  -22.114 14.291   1.00 86.26  ? 456  GLU A N     1 
ATOM   4984  C  CA    . GLU B  2  455 ? -10.529  -23.100 13.191   1.00 87.48  ? 456  GLU A CA    1 
ATOM   4985  C  C     . GLU B  2  455 ? -9.646   -22.475 12.102   1.00 91.23  ? 456  GLU A C     1 
ATOM   4986  O  O     . GLU B  2  455 ? -8.829   -23.219 11.516   1.00 96.78  ? 456  GLU A O     1 
ATOM   4987  C  CB    . GLU B  2  455 ? -11.869  -23.586 12.648   1.00 78.99  ? 456  GLU A CB    1 
ATOM   4988  C  CG    . GLU B  2  455 ? -12.474  -24.695 13.484   1.00 77.33  ? 456  GLU A CG    1 
ATOM   4989  C  CD    . GLU B  2  455 ? -13.979  -24.847 13.349   1.00 82.55  ? 456  GLU A CD    1 
ATOM   4990  O  OE1   . GLU B  2  455 ? -14.523  -25.857 13.831   1.00 80.80  ? 456  GLU A OE1   1 
ATOM   4991  O  OE2   . GLU B  2  455 ? -14.609  -23.956 12.749   1.00 92.84  ? 456  GLU A OE2   1 
ATOM   4992  N  N     . THR B  2  456 ? -9.792   -21.165 11.863   1.00 93.13  ? 457  THR A N     1 
ATOM   4993  C  CA    . THR B  2  456 ? -8.943   -20.376 10.926   1.00 97.01  ? 457  THR A CA    1 
ATOM   4994  C  C     . THR B  2  456 ? -7.471   -20.513 11.346   1.00 99.07  ? 457  THR A C     1 
ATOM   4995  O  O     . THR B  2  456 ? -6.605   -20.698 10.452   1.00 94.92  ? 457  THR A O     1 
ATOM   4996  C  CB    . THR B  2  456 ? -9.369   -18.901 10.864   1.00 91.18  ? 457  THR A CB    1 
ATOM   4997  O  OG1   . THR B  2  456 ? -10.787  -18.831 10.702   1.00 80.86  ? 457  THR A OG1   1 
ATOM   4998  C  CG2   . THR B  2  456 ? -8.699   -18.135 9.742    1.00 88.95  ? 457  THR A CG2   1 
ATOM   4999  N  N     . ILE B  2  457 ? -7.202   -20.440 12.653   1.00 89.57  ? 458  ILE A N     1 
ATOM   5000  C  CA    . ILE B  2  457 ? -5.827   -20.496 13.232   1.00 82.38  ? 458  ILE A CA    1 
ATOM   5001  C  C     . ILE B  2  457 ? -5.259   -21.904 13.042   1.00 80.93  ? 458  ILE A C     1 
ATOM   5002  O  O     . ILE B  2  457 ? -4.072   -22.021 12.683   1.00 94.81  ? 458  ILE A O     1 
ATOM   5003  C  CB    . ILE B  2  457 ? -5.840   -20.085 14.716   1.00 76.26  ? 458  ILE A CB    1 
ATOM   5004  C  CG1   . ILE B  2  457 ? -6.269   -18.631 14.901   1.00 71.12  ? 458  ILE A CG1   1 
ATOM   5005  C  CG2   . ILE B  2  457 ? -4.494   -20.354 15.366   1.00 72.25  ? 458  ILE A CG2   1 
ATOM   5006  C  CD1   . ILE B  2  457 ? -6.679   -18.298 16.314   1.00 71.20  ? 458  ILE A CD1   1 
ATOM   5007  N  N     . LEU B  2  458 ? -6.053   -22.933 13.296   1.00 74.62  ? 459  LEU A N     1 
ATOM   5008  C  CA    . LEU B  2  458 ? -5.579   -24.338 13.203   1.00 80.35  ? 459  LEU A CA    1 
ATOM   5009  C  C     . LEU B  2  458 ? -5.399   -24.731 11.735   1.00 84.09  ? 459  LEU A C     1 
ATOM   5010  O  O     . LEU B  2  458 ? -4.530   -25.575 11.472   1.00 79.48  ? 459  LEU A O     1 
ATOM   5011  C  CB    . LEU B  2  458 ? -6.562   -25.255 13.936   1.00 78.23  ? 459  LEU A CB    1 
ATOM   5012  C  CG    . LEU B  2  458 ? -6.585   -25.077 15.450   1.00 73.38  ? 459  LEU A CG    1 
ATOM   5013  C  CD1   . LEU B  2  458 ? -7.769   -25.792 16.075   1.00 70.15  ? 459  LEU A CD1   1 
ATOM   5014  C  CD2   . LEU B  2  458 ? -5.289   -25.576 16.042   1.00 74.31  ? 459  LEU A CD2   1 
ATOM   5015  N  N     . ALA B  2  459 ? -6.157   -24.115 10.819   1.00 101.69 ? 460  ALA A N     1 
ATOM   5016  C  CA    . ALA B  2  459 ? -6.136   -24.416 9.366    1.00 116.98 ? 460  ALA A CA    1 
ATOM   5017  C  C     . ALA B  2  459 ? -4.844   -23.884 8.725    1.00 122.86 ? 460  ALA A C     1 
ATOM   5018  O  O     . ALA B  2  459 ? -4.259   -24.610 7.903    1.00 130.57 ? 460  ALA A O     1 
ATOM   5019  C  CB    . ALA B  2  459 ? -7.356   -23.842 8.695    1.00 117.99 ? 460  ALA A CB    1 
ATOM   5020  N  N     . ASP B  2  460 ? -4.413   -22.669 9.089    1.00 122.84 ? 461  ASP A N     1 
ATOM   5021  C  CA    . ASP B  2  460 ? -3.299   -21.947 8.419    1.00 123.58 ? 461  ASP A CA    1 
ATOM   5022  C  C     . ASP B  2  460 ? -2.187   -21.634 9.434    1.00 114.22 ? 461  ASP A C     1 
ATOM   5023  O  O     . ASP B  2  460 ? -2.349   -20.656 10.238   1.00 122.94 ? 461  ASP A O     1 
ATOM   5024  C  CB    . ASP B  2  460 ? -3.839   -20.699 7.714    1.00 128.74 ? 461  ASP A CB    1 
ATOM   5025  C  CG    . ASP B  2  460 ? -2.822   -20.016 6.793    1.00 137.20 ? 461  ASP A CG    1 
ATOM   5026  O  OD1   . ASP B  2  460 ? -1.668   -20.485 6.721    1.00 150.48 ? 461  ASP A OD1   1 
ATOM   5027  O  OD2   . ASP B  2  460 ? -3.248   -19.138 5.998    1.00 144.32 ? 461  ASP A OD2   1 
ATOM   5028  N  N     . GLU B  2  461 ? -1.086   -22.404 9.396    1.00 108.80 ? 462  GLU A N     1 
ATOM   5029  C  CA    . GLU B  2  461 ? 0.092    -22.247 10.295   1.00 100.37 ? 462  GLU A CA    1 
ATOM   5030  C  C     . GLU B  2  461 ? 0.632    -20.806 10.209   1.00 98.65  ? 462  GLU A C     1 
ATOM   5031  O  O     . GLU B  2  461 ? 1.205    -20.354 11.228   1.00 102.53 ? 462  GLU A O     1 
ATOM   5032  C  CB    . GLU B  2  461 ? 1.220    -23.205 9.940    1.00 98.75  ? 462  GLU A CB    1 
ATOM   5033  C  CG    . GLU B  2  461 ? 1.130    -24.499 10.716   1.00 97.17  ? 462  GLU A CG    1 
ATOM   5034  C  CD    . GLU B  2  461 ? 2.102    -25.561 10.261   1.00 98.62  ? 462  GLU A CD    1 
ATOM   5035  O  OE1   . GLU B  2  461 ? 2.579    -26.303 11.135   1.00 97.39  ? 462  GLU A OE1   1 
ATOM   5036  O  OE2   . GLU B  2  461 ? 2.376    -25.691 9.041    1.00 95.06  ? 462  GLU A OE2   1 
ATOM   5037  N  N     . GLU B  2  462 ? 0.483    -20.135 9.074    1.00 93.58  ? 463  GLU A N     1 
ATOM   5038  C  CA    . GLU B  2  462 ? 1.065    -18.778 8.950    1.00 96.52  ? 463  GLU A CA    1 
ATOM   5039  C  C     . GLU B  2  462 ? 0.227    -17.780 9.742    1.00 99.71  ? 463  GLU A C     1 
ATOM   5040  O  O     . GLU B  2  462 ? 0.877    -16.862 10.376   1.00 89.79  ? 463  GLU A O     1 
ATOM   5041  C  CB    . GLU B  2  462 ? 1.393    -18.323 7.539    1.00 100.60 ? 463  GLU A CB    1 
ATOM   5042  C  CG    . GLU B  2  462 ? 2.611    -17.409 7.577    1.00 102.49 ? 463  GLU A CG    1 
ATOM   5043  C  CD    . GLU B  2  462 ? 3.929    -18.135 7.847    1.00 106.12 ? 463  GLU A CD    1 
ATOM   5044  O  OE1   . GLU B  2  462 ? 4.011    -19.369 8.183    1.00 105.36 ? 463  GLU A OE1   1 
ATOM   5045  O  OE2   . GLU B  2  462 ? 4.920    -17.447 7.682    1.00 109.05 ? 463  GLU A OE2   1 
ATOM   5046  N  N     . VAL B  2  463 ? -1.086   -17.988 9.836    1.00 111.71 ? 464  VAL A N     1 
ATOM   5047  C  CA    . VAL B  2  463 ? -2.009   -17.041 10.556   1.00 118.03 ? 464  VAL A CA    1 
ATOM   5048  C  C     . VAL B  2  463 ? -1.605   -16.966 12.047   1.00 118.00 ? 464  VAL A C     1 
ATOM   5049  O  O     . VAL B  2  463 ? -1.500   -15.817 12.612   1.00 105.37 ? 464  VAL A O     1 
ATOM   5050  C  CB    . VAL B  2  463 ? -3.508   -17.422 10.468   1.00 120.16 ? 464  VAL A CB    1 
ATOM   5051  C  CG1   . VAL B  2  463 ? -4.405   -16.175 10.479   1.00 110.23 ? 464  VAL A CG1   1 
ATOM   5052  C  CG2   . VAL B  2  463 ? -3.908   -18.346 9.332    1.00 122.60 ? 464  VAL A CG2   1 
ATOM   5053  N  N     . LEU B  2  464 ? -1.312   -18.155 12.627   1.00 115.22 ? 465  LEU A N     1 
ATOM   5054  C  CA    . LEU B  2  464 ? -0.676   -18.320 13.949   1.00 108.23 ? 465  LEU A CA    1 
ATOM   5055  C  C     . LEU B  2  464 ? 0.519    -17.370 14.096   1.00 104.68 ? 465  LEU A C     1 
ATOM   5056  O  O     . LEU B  2  464 ? 0.468    -16.593 15.067   1.00 106.02 ? 465  LEU A O     1 
ATOM   5057  C  CB    . LEU B  2  464 ? -0.210   -19.771 14.139   1.00 104.03 ? 465  LEU A CB    1 
ATOM   5058  C  CG    . LEU B  2  464 ? -0.914   -20.649 15.161   1.00 107.38 ? 465  LEU A CG    1 
ATOM   5059  C  CD1   . LEU B  2  464 ? -1.951   -21.457 14.436   1.00 103.88 ? 465  LEU A CD1   1 
ATOM   5060  C  CD2   . LEU B  2  464 ? 0.074    -21.571 15.859   1.00 107.93 ? 465  LEU A CD2   1 
ATOM   5061  N  N     . LEU B  2  465 ? 1.465    -17.405 13.155   1.00 94.12  ? 466  LEU A N     1 
ATOM   5062  C  CA    . LEU B  2  465 ? 2.736    -16.639 13.279   1.00 95.22  ? 466  LEU A CA    1 
ATOM   5063  C  C     . LEU B  2  465 ? 2.437    -15.146 13.408   1.00 96.33  ? 466  LEU A C     1 
ATOM   5064  O  O     . LEU B  2  465 ? 3.109    -14.472 14.266   1.00 93.37  ? 466  LEU A O     1 
ATOM   5065  C  CB    . LEU B  2  465 ? 3.645    -16.834 12.066   1.00 93.33  ? 466  LEU A CB    1 
ATOM   5066  C  CG    . LEU B  2  465 ? 5.091    -16.440 12.359   1.00 94.73  ? 466  LEU A CG    1 
ATOM   5067  C  CD1   . LEU B  2  465 ? 5.674    -17.513 13.269   1.00 93.32  ? 466  LEU A CD1   1 
ATOM   5068  C  CD2   . LEU B  2  465 ? 5.956    -16.286 11.103   1.00 95.41  ? 466  LEU A CD2   1 
ATOM   5069  N  N     . GLN B  2  466 ? 1.451    -14.675 12.603   1.00 99.19  ? 467  GLN A N     1 
ATOM   5070  C  CA    . GLN B  2  466 ? 1.115    -13.217 12.590   1.00 104.45 ? 467  GLN A CA    1 
ATOM   5071  C  C     . GLN B  2  466 ? 0.548    -12.853 13.980   1.00 116.45 ? 467  GLN A C     1 
ATOM   5072  O  O     . GLN B  2  466 ? 0.976    -11.786 14.505   1.00 134.83 ? 467  GLN A O     1 
ATOM   5073  C  CB    . GLN B  2  466 ? 0.113    -12.863 11.491   1.00 99.41  ? 467  GLN A CB    1 
ATOM   5074  C  CG    . GLN B  2  466 ? -0.578   -11.499 11.680   1.00 95.26  ? 467  GLN A CG    1 
ATOM   5075  C  CD    . GLN B  2  466 ? 0.447    -10.445 12.040   1.00 96.24  ? 467  GLN A CD    1 
ATOM   5076  O  OE1   . GLN B  2  466 ? 1.248    -10.172 11.203   1.00 98.81  ? 467  GLN A OE1   1 
ATOM   5077  N  NE2   . GLN B  2  466 ? 0.561    -9.991  13.283   1.00 98.16  ? 467  GLN A NE2   1 
ATOM   5078  N  N     . LEU B  2  467 ? -0.305   -13.730 14.537   1.00 111.30 ? 468  LEU A N     1 
ATOM   5079  C  CA    . LEU B  2  467 ? -0.900   -13.478 15.858   1.00 91.94  ? 468  LEU A CA    1 
ATOM   5080  C  C     . LEU B  2  467 ? 0.207    -13.421 16.930   1.00 83.70  ? 468  LEU A C     1 
ATOM   5081  O  O     . LEU B  2  467 ? 0.223    -12.496 17.750   1.00 85.40  ? 468  LEU A O     1 
ATOM   5082  C  CB    . LEU B  2  467 ? -1.957   -14.533 16.193   1.00 89.50  ? 468  LEU A CB    1 
ATOM   5083  C  CG    . LEU B  2  467 ? -2.721   -14.301 17.508   1.00 85.59  ? 468  LEU A CG    1 
ATOM   5084  C  CD1   . LEU B  2  467 ? -2.749   -12.819 17.898   1.00 87.58  ? 468  LEU A CD1   1 
ATOM   5085  C  CD2   . LEU B  2  467 ? -4.148   -14.840 17.467   1.00 84.47  ? 468  LEU A CD2   1 
ATOM   5086  N  N     . VAL B  2  468 ? 1.118    -14.397 16.882   1.00 78.00  ? 469  VAL A N     1 
ATOM   5087  C  CA    . VAL B  2  468 ? 2.283    -14.510 17.803   1.00 72.60  ? 469  VAL A CA    1 
ATOM   5088  C  C     . VAL B  2  468 ? 3.067    -13.213 17.770   1.00 79.21  ? 469  VAL A C     1 
ATOM   5089  O  O     . VAL B  2  468 ? 3.420    -12.803 18.859   1.00 70.88  ? 469  VAL A O     1 
ATOM   5090  C  CB    . VAL B  2  468 ? 3.194    -15.702 17.458   1.00 63.00  ? 469  VAL A CB    1 
ATOM   5091  C  CG1   . VAL B  2  468 ? 4.545    -15.616 18.157   1.00 56.70  ? 469  VAL A CG1   1 
ATOM   5092  C  CG2   . VAL B  2  468 ? 2.522    -17.013 17.855   1.00 65.76  ? 469  VAL A CG2   1 
ATOM   5093  N  N     . ARG B  2  469 ? 3.362    -12.656 16.599   1.00 83.10  ? 470  ARG A N     1 
ATOM   5094  C  CA    . ARG B  2  469 ? 4.106    -11.376 16.446   1.00 78.43  ? 470  ARG A CA    1 
ATOM   5095  C  C     . ARG B  2  469 ? 3.495    -10.275 17.327   1.00 71.85  ? 470  ARG A C     1 
ATOM   5096  O  O     . ARG B  2  469 ? 4.251    -9.594  18.039   1.00 77.97  ? 470  ARG A O     1 
ATOM   5097  C  CB    . ARG B  2  469 ? 4.171    -10.892 15.008   1.00 86.49  ? 470  ARG A CB    1 
ATOM   5098  C  CG    . ARG B  2  469 ? 4.977    -11.820 14.097   1.00 94.01  ? 470  ARG A CG    1 
ATOM   5099  C  CD    . ARG B  2  469 ? 5.453    -11.398 12.764   1.00 100.57 ? 470  ARG A CD    1 
ATOM   5100  N  NE    . ARG B  2  469 ? 5.054    -12.341 11.697   1.00 104.97 ? 470  ARG A NE    1 
ATOM   5101  C  CZ    . ARG B  2  469 ? 4.380    -11.987 10.616   1.00 105.99 ? 470  ARG A CZ    1 
ATOM   5102  N  NH1   . ARG B  2  469 ? 4.129    -10.715 10.341   1.00 108.67 ? 470  ARG A NH1   1 
ATOM   5103  N  NH2   . ARG B  2  469 ? 4.017    -12.907 9.740    1.00 104.18 ? 470  ARG A NH2   1 
ATOM   5104  N  N     . ASP B  2  470 ? 2.168    -10.132 17.253   1.00 70.85  ? 471  ASP A N     1 
ATOM   5105  C  CA    . ASP B  2  470 ? 1.423    -9.038  17.944   1.00 79.83  ? 471  ASP A CA    1 
ATOM   5106  C  C     . ASP B  2  470 ? 1.495    -9.255  19.463   1.00 82.61  ? 471  ASP A C     1 
ATOM   5107  O  O     . ASP B  2  470 ? 1.725    -8.257  20.177   1.00 84.14  ? 471  ASP A O     1 
ATOM   5108  C  CB    . ASP B  2  470 ? -0.014   -8.926  17.424   1.00 84.67  ? 471  ASP A CB    1 
ATOM   5109  C  CG    . ASP B  2  470 ? -0.139   -8.339  16.019   1.00 88.56  ? 471  ASP A CG    1 
ATOM   5110  O  OD1   . ASP B  2  470 ? 0.838    -7.753  15.506   1.00 78.24  ? 471  ASP A OD1   1 
ATOM   5111  O  OD2   . ASP B  2  470 ? -1.205   -8.532  15.390   1.00 98.01  ? 471  ASP A OD2   1 
ATOM   5112  N  N     . GLU B  2  471 ? 1.350    -10.480 19.950   1.00 88.49  ? 472  GLU A N     1 
ATOM   5113  C  CA    . GLU B  2  471 ? 1.364    -10.788 21.418   1.00 86.41  ? 472  GLU A CA    1 
ATOM   5114  C  C     . GLU B  2  471 ? 2.792    -10.642 21.981   1.00 85.11  ? 472  GLU A C     1 
ATOM   5115  O  O     . GLU B  2  471 ? 2.935    -10.164 23.123   1.00 92.47  ? 472  GLU A O     1 
ATOM   5116  C  CB    . GLU B  2  471 ? 0.759    -12.168 21.689   1.00 82.71  ? 472  GLU A CB    1 
ATOM   5117  C  CG    . GLU B  2  471 ? -0.746   -12.164 21.473   1.00 84.26  ? 472  GLU A CG    1 
ATOM   5118  C  CD    . GLU B  2  471 ? -1.477   -13.474 21.733   1.00 86.12  ? 472  GLU A CD    1 
ATOM   5119  O  OE1   . GLU B  2  471 ? -0.836   -14.422 22.244   1.00 75.71  ? 472  GLU A OE1   1 
ATOM   5120  O  OE2   . GLU B  2  471 ? -2.694   -13.551 21.413   1.00 77.62  ? 472  GLU A OE2   1 
ATOM   5121  N  N     . LEU B  2  472 ? 3.810    -11.025 21.211   1.00 76.34  ? 473  LEU A N     1 
ATOM   5122  C  CA    . LEU B  2  472 ? 5.239    -10.807 21.575   1.00 65.62  ? 473  LEU A CA    1 
ATOM   5123  C  C     . LEU B  2  472 ? 5.506    -9.311  21.675   1.00 58.67  ? 473  LEU A C     1 
ATOM   5124  O  O     . LEU B  2  472 ? 6.188    -8.909  22.610   1.00 60.02  ? 473  LEU A O     1 
ATOM   5125  C  CB    . LEU B  2  472 ? 6.172    -11.453 20.550   1.00 66.06  ? 473  LEU A CB    1 
ATOM   5126  C  CG    . LEU B  2  472 ? 6.512    -12.926 20.838   1.00 62.86  ? 473  LEU A CG    1 
ATOM   5127  C  CD1   . LEU B  2  472 ? 7.198    -13.545 19.633   1.00 63.02  ? 473  LEU A CD1   1 
ATOM   5128  C  CD2   . LEU B  2  472 ? 7.346    -13.130 22.114   1.00 58.72  ? 473  LEU A CD2   1 
ATOM   5129  N  N     . THR B  2  473 ? 4.989    -8.525  20.737   1.00 57.96  ? 474  THR A N     1 
ATOM   5130  C  CA    . THR B  2  473 ? 5.169    -7.044  20.674   1.00 63.45  ? 474  THR A CA    1 
ATOM   5131  C  C     . THR B  2  473 ? 4.546    -6.401  21.921   1.00 69.44  ? 474  THR A C     1 
ATOM   5132  O  O     . THR B  2  473 ? 5.164    -5.480  22.463   1.00 79.30  ? 474  THR A O     1 
ATOM   5133  C  CB    . THR B  2  473 ? 4.608    -6.461  19.367   1.00 57.39  ? 474  THR A CB    1 
ATOM   5134  O  OG1   . THR B  2  473 ? 5.439    -6.936  18.309   1.00 54.07  ? 474  THR A OG1   1 
ATOM   5135  C  CG2   . THR B  2  473 ? 4.543    -4.953  19.342   1.00 55.51  ? 474  THR A CG2   1 
ATOM   5136  N  N     A GLU B  2  474 ? 3.370    -6.875  22.349   0.50 69.18  ? 475  GLU A N     1 
ATOM   5137  N  N     B GLU B  2  474 ? 3.370    -6.875  22.348   0.50 72.41  ? 475  GLU A N     1 
ATOM   5138  C  CA    A GLU B  2  474 ? 2.664    -6.397  23.569   0.50 72.14  ? 475  GLU A CA    1 
ATOM   5139  C  CA    B GLU B  2  474 ? 2.664    -6.398  23.570   0.50 77.63  ? 475  GLU A CA    1 
ATOM   5140  C  C     A GLU B  2  474 ? 3.568    -6.644  24.789   0.50 79.73  ? 475  GLU A C     1 
ATOM   5141  C  C     B GLU B  2  474 ? 3.568    -6.644  24.789   0.50 83.13  ? 475  GLU A C     1 
ATOM   5142  O  O     A GLU B  2  474 ? 3.679    -5.736  25.645   0.50 93.44  ? 475  GLU A O     1 
ATOM   5143  O  O     B GLU B  2  474 ? 3.679    -5.736  25.645   0.50 96.80  ? 475  GLU A O     1 
ATOM   5144  C  CB    A GLU B  2  474 ? 1.302    -7.083  23.709   0.50 67.33  ? 475  GLU A CB    1 
ATOM   5145  C  CB    B GLU B  2  474 ? 1.303    -7.086  23.711   0.50 76.63  ? 475  GLU A CB    1 
ATOM   5146  C  CG    A GLU B  2  474 ? 0.443    -6.504  24.826   0.50 64.29  ? 475  GLU A CG    1 
ATOM   5147  C  CG    B GLU B  2  474 ? 0.128    -6.130  23.595   0.50 77.15  ? 475  GLU A CG    1 
ATOM   5148  C  CD    A GLU B  2  474 ? 0.902    -6.935  26.209   0.50 61.68  ? 475  GLU A CD    1 
ATOM   5149  C  CD    B GLU B  2  474 ? -1.183   -6.774  23.179   0.50 77.98  ? 475  GLU A CD    1 
ATOM   5150  O  OE1   A GLU B  2  474 ? 0.968    -8.147  26.432   0.50 61.26  ? 475  GLU A OE1   1 
ATOM   5151  O  OE1   B GLU B  2  474 ? -1.876   -6.192  22.324   0.50 79.60  ? 475  GLU A OE1   1 
ATOM   5152  O  OE2   A GLU B  2  474 ? 1.246    -6.068  27.025   0.50 57.93  ? 475  GLU A OE2   1 
ATOM   5153  O  OE2   B GLU B  2  474 ? -1.507   -7.852  23.710   0.50 76.56  ? 475  GLU A OE2   1 
ATOM   5154  N  N     . ILE B  2  475 ? 4.196    -7.822  24.851   1.00 79.02  ? 476  ILE A N     1 
ATOM   5155  C  CA    . ILE B  2  475 ? 5.116    -8.214  25.959   1.00 77.32  ? 476  ILE A CA    1 
ATOM   5156  C  C     . ILE B  2  475 ? 6.366    -7.326  25.903   1.00 75.03  ? 476  ILE A C     1 
ATOM   5157  O  O     . ILE B  2  475 ? 6.814    -6.858  26.953   1.00 79.82  ? 476  ILE A O     1 
ATOM   5158  C  CB    . ILE B  2  475 ? 5.440    -9.722  25.897   1.00 73.58  ? 476  ILE A CB    1 
ATOM   5159  C  CG1   . ILE B  2  475 ? 4.305    -10.543 26.524   1.00 75.72  ? 476  ILE A CG1   1 
ATOM   5160  C  CG2   . ILE B  2  475 ? 6.786    -10.041 26.544   1.00 66.14  ? 476  ILE A CG2   1 
ATOM   5161  C  CD1   . ILE B  2  475 ? 4.286    -11.972 26.070   1.00 76.84  ? 476  ILE A CD1   1 
ATOM   5162  N  N     . ARG B  2  476 ? 6.899    -7.086  24.713   1.00 72.25  ? 477  ARG A N     1 
ATOM   5163  C  CA    . ARG B  2  476 ? 8.109    -6.252  24.525   1.00 74.90  ? 477  ARG A CA    1 
ATOM   5164  C  C     . ARG B  2  476 ? 7.824    -4.829  25.007   1.00 71.69  ? 477  ARG A C     1 
ATOM   5165  O  O     . ARG B  2  476 ? 8.729    -4.225  25.609   1.00 73.59  ? 477  ARG A O     1 
ATOM   5166  C  CB    . ARG B  2  476 ? 8.540    -6.210  23.063   1.00 81.92  ? 477  ARG A CB    1 
ATOM   5167  C  CG    . ARG B  2  476 ? 9.883    -5.534  22.844   1.00 86.17  ? 477  ARG A CG    1 
ATOM   5168  C  CD    . ARG B  2  476 ? 10.053   -5.115  21.403   1.00 86.90  ? 477  ARG A CD    1 
ATOM   5169  N  NE    . ARG B  2  476 ? 8.987    -4.208  21.010   1.00 82.43  ? 477  ARG A NE    1 
ATOM   5170  C  CZ    . ARG B  2  476 ? 8.612    -3.999  19.758   1.00 87.25  ? 477  ARG A CZ    1 
ATOM   5171  N  NH1   . ARG B  2  476 ? 9.208    -4.639  18.762   1.00 85.80  ? 477  ARG A NH1   1 
ATOM   5172  N  NH2   . ARG B  2  476 ? 7.631    -3.150  19.510   1.00 94.06  ? 477  ARG A NH2   1 
ATOM   5173  N  N     . ASP B  2  477 ? 6.617    -4.324  24.755   1.00 68.30  ? 478  ASP A N     1 
ATOM   5174  C  CA    . ASP B  2  477 ? 6.243    -2.924  25.073   1.00 71.18  ? 478  ASP A CA    1 
ATOM   5175  C  C     . ASP B  2  477 ? 6.020    -2.803  26.581   1.00 69.74  ? 478  ASP A C     1 
ATOM   5176  O  O     . ASP B  2  477 ? 6.344    -1.743  27.120   1.00 85.10  ? 478  ASP A O     1 
ATOM   5177  C  CB    . ASP B  2  477 ? 5.071    -2.455  24.197   1.00 75.54  ? 478  ASP A CB    1 
ATOM   5178  C  CG    . ASP B  2  477 ? 5.460    -2.264  22.736   1.00 83.49  ? 478  ASP A CG    1 
ATOM   5179  O  OD1   . ASP B  2  477 ? 6.691    -2.225  22.454   1.00 93.55  ? 478  ASP A OD1   1 
ATOM   5180  O  OD2   . ASP B  2  477 ? 4.541    -2.166  21.883   1.00 77.06  ? 478  ASP A OD2   1 
ATOM   5181  N  N     . ARG B  2  478 ? 5.559    -3.861  27.249   1.00 69.79  ? 479  ARG A N     1 
ATOM   5182  C  CA    . ARG B  2  478 ? 5.262    -3.841  28.711   1.00 76.32  ? 479  ARG A CA    1 
ATOM   5183  C  C     . ARG B  2  478 ? 6.525    -4.154  29.540   1.00 64.79  ? 479  ARG A C     1 
ATOM   5184  O  O     . ARG B  2  478 ? 6.611    -3.618  30.647   1.00 59.22  ? 479  ARG A O     1 
ATOM   5185  C  CB    . ARG B  2  478 ? 4.112    -4.802  29.042   1.00 86.22  ? 479  ARG A CB    1 
ATOM   5186  C  CG    . ARG B  2  478 ? 3.584    -4.656  30.467   1.00 91.70  ? 479  ARG A CG    1 
ATOM   5187  C  CD    . ARG B  2  478 ? 2.106    -4.968  30.616   1.00 94.32  ? 479  ARG A CD    1 
ATOM   5188  N  NE    . ARG B  2  478 ? 1.745    -6.154  29.841   1.00 103.69 ? 479  ARG A NE    1 
ATOM   5189  C  CZ    . ARG B  2  478 ? 1.699    -7.409  30.302   1.00 97.96  ? 479  ARG A CZ    1 
ATOM   5190  N  NH1   . ARG B  2  478 ? 1.963    -7.675  31.564   1.00 91.55  ? 479  ARG A NH1   1 
ATOM   5191  N  NH2   . ARG B  2  478 ? 1.359    -8.405  29.503   1.00 95.29  ? 479  ARG A NH2   1 
ATOM   5192  N  N     . PHE B  2  479 ? 7.446    -4.981  29.047   1.00 61.19  ? 480  PHE A N     1 
ATOM   5193  C  CA    . PHE B  2  479 ? 8.564    -5.568  29.842   1.00 60.03  ? 480  PHE A CA    1 
ATOM   5194  C  C     . PHE B  2  479 ? 9.943    -5.284  29.261   1.00 53.56  ? 480  PHE A C     1 
ATOM   5195  O  O     . PHE B  2  479 ? 10.904   -5.391  30.042   1.00 51.66  ? 480  PHE A O     1 
ATOM   5196  C  CB    . PHE B  2  479 ? 8.396    -7.091  29.982   1.00 64.98  ? 480  PHE A CB    1 
ATOM   5197  C  CG    . PHE B  2  479 ? 7.273    -7.519  30.885   1.00 67.56  ? 480  PHE A CG    1 
ATOM   5198  C  CD1   . PHE B  2  479 ? 7.293    -7.259  32.243   1.00 67.14  ? 480  PHE A CD1   1 
ATOM   5199  C  CD2   . PHE B  2  479 ? 6.148    -8.137  30.356   1.00 73.64  ? 480  PHE A CD2   1 
ATOM   5200  C  CE1   . PHE B  2  479 ? 6.224    -7.606  33.047   1.00 77.82  ? 480  PHE A CE1   1 
ATOM   5201  C  CE2   . PHE B  2  479 ? 5.097    -8.532  31.166   1.00 80.51  ? 480  PHE A CE2   1 
ATOM   5202  C  CZ    . PHE B  2  479 ? 5.147    -8.260  32.507   1.00 79.76  ? 480  PHE A CZ    1 
ATOM   5203  N  N     . GLY B  2  480 ? 10.048   -4.985  27.967   1.00 56.16  ? 481  GLY A N     1 
ATOM   5204  C  CA    . GLY B  2  480 ? 11.350   -4.633  27.329   1.00 59.05  ? 481  GLY A CA    1 
ATOM   5205  C  C     . GLY B  2  480 ? 12.113   -3.598  28.160   1.00 58.41  ? 481  GLY A C     1 
ATOM   5206  O  O     . GLY B  2  480 ? 11.355   -2.733  28.747   1.00 61.03  ? 481  GLY A O     1 
ATOM   5207  N  N     . ASP B  2  481 ? 13.443   -3.609  28.247   1.00 55.19  ? 482  ASP A N     1 
ATOM   5208  C  CA    . ASP B  2  481 ? 14.152   -2.560  29.020   1.00 49.42  ? 482  ASP A CA    1 
ATOM   5209  C  C     . ASP B  2  481 ? 15.531   -2.307  28.401   1.00 44.75  ? 482  ASP A C     1 
ATOM   5210  O  O     . ASP B  2  481 ? 15.955   -3.117  27.566   1.00 40.17  ? 482  ASP A O     1 
ATOM   5211  C  CB    . ASP B  2  481 ? 14.211   -2.918  30.517   1.00 51.74  ? 482  ASP A CB    1 
ATOM   5212  C  CG    . ASP B  2  481 ? 15.156   -4.042  30.901   1.00 52.97  ? 482  ASP A CG    1 
ATOM   5213  O  OD1   . ASP B  2  481 ? 15.454   -4.900  30.032   1.00 52.98  ? 482  ASP A OD1   1 
ATOM   5214  O  OD2   . ASP B  2  481 ? 15.601   -4.038  32.085   1.00 51.97  ? 482  ASP A OD2   1 
ATOM   5215  N  N     . ASP B  2  482 ? 16.178   -1.223  28.808   1.00 42.45  ? 483  ASP A N     1 
ATOM   5216  C  CA    . ASP B  2  482 ? 17.479   -0.795  28.233   1.00 46.66  ? 483  ASP A CA    1 
ATOM   5217  C  C     . ASP B  2  482 ? 18.571   -1.781  28.640   1.00 50.49  ? 483  ASP A C     1 
ATOM   5218  O  O     . ASP B  2  482 ? 18.495   -2.347  29.732   1.00 51.71  ? 483  ASP A O     1 
ATOM   5219  C  CB    . ASP B  2  482 ? 17.866   0.628   28.629   1.00 48.62  ? 483  ASP A CB    1 
ATOM   5220  C  CG    . ASP B  2  482 ? 16.967   1.685   27.976   1.00 51.18  ? 483  ASP A CG    1 
ATOM   5221  O  OD1   . ASP B  2  482 ? 16.556   1.504   26.803   1.00 48.81  ? 483  ASP A OD1   1 
ATOM   5222  O  OD2   . ASP B  2  482 ? 16.651   2.684   28.652   1.00 58.57  ? 483  ASP A OD2   1 
ATOM   5223  N  N     . ARG B  2  483 ? 19.550   -1.962  27.756   1.00 57.68  ? 484  ARG A N     1 
ATOM   5224  C  CA    . ARG B  2  483 ? 20.834   -2.646  28.034   1.00 56.85  ? 484  ARG A CA    1 
ATOM   5225  C  C     . ARG B  2  483 ? 21.479   -1.976  29.256   1.00 52.02  ? 484  ARG A C     1 
ATOM   5226  O  O     . ARG B  2  483 ? 21.257   -0.774  29.444   1.00 49.49  ? 484  ARG A O     1 
ATOM   5227  C  CB    . ARG B  2  483 ? 21.711   -2.584  26.781   1.00 59.84  ? 484  ARG A CB    1 
ATOM   5228  C  CG    . ARG B  2  483 ? 23.138   -3.094  26.958   1.00 66.72  ? 484  ARG A CG    1 
ATOM   5229  C  CD    . ARG B  2  483 ? 23.756   -3.387  25.602   1.00 71.77  ? 484  ARG A CD    1 
ATOM   5230  N  NE    . ARG B  2  483 ? 23.449   -4.733  25.137   1.00 72.49  ? 484  ARG A NE    1 
ATOM   5231  C  CZ    . ARG B  2  483 ? 23.957   -5.851  25.637   1.00 82.38  ? 484  ARG A CZ    1 
ATOM   5232  N  NH1   . ARG B  2  483 ? 24.784   -5.827  26.667   1.00 83.71  ? 484  ARG A NH1   1 
ATOM   5233  N  NH2   . ARG B  2  483 ? 23.607   -7.014  25.122   1.00 91.45  ? 484  ARG A NH2   1 
ATOM   5234  N  N     . ARG B  2  484 ? 22.196   -2.742  30.077   1.00 45.83  ? 485  ARG A N     1 
ATOM   5235  C  CA    . ARG B  2  484 ? 22.971   -2.228  31.236   1.00 43.39  ? 485  ARG A CA    1 
ATOM   5236  C  C     . ARG B  2  484 ? 24.466   -2.446  30.996   1.00 42.17  ? 485  ARG A C     1 
ATOM   5237  O  O     . ARG B  2  484 ? 25.271   -1.561  31.341   1.00 46.79  ? 485  ARG A O     1 
ATOM   5238  C  CB    . ARG B  2  484 ? 22.578   -2.940  32.534   1.00 43.16  ? 485  ARG A CB    1 
ATOM   5239  C  CG    . ARG B  2  484 ? 21.070   -3.072  32.725   1.00 44.65  ? 485  ARG A CG    1 
ATOM   5240  C  CD    . ARG B  2  484 ? 20.741   -3.564  34.115   1.00 45.44  ? 485  ARG A CD    1 
ATOM   5241  N  NE    . ARG B  2  484 ? 19.316   -3.441  34.366   1.00 46.55  ? 485  ARG A NE    1 
ATOM   5242  C  CZ    . ARG B  2  484 ? 18.634   -4.143  35.259   1.00 43.63  ? 485  ARG A CZ    1 
ATOM   5243  N  NH1   . ARG B  2  484 ? 19.241   -5.048  36.006   1.00 40.62  ? 485  ARG A NH1   1 
ATOM   5244  N  NH2   . ARG B  2  484 ? 17.334   -3.938  35.388   1.00 43.75  ? 485  ARG A NH2   1 
ATOM   5245  N  N     . THR B  2  485 ? 24.846   -3.602  30.464   1.00 40.78  ? 486  THR A N     1 
ATOM   5246  C  CA    . THR B  2  485 ? 26.273   -3.960  30.282   1.00 40.17  ? 486  THR A CA    1 
ATOM   5247  C  C     . THR B  2  485 ? 26.770   -3.347  28.969   1.00 40.98  ? 486  THR A C     1 
ATOM   5248  O  O     . THR B  2  485 ? 26.231   -3.716  27.914   1.00 44.83  ? 486  THR A O     1 
ATOM   5249  C  CB    . THR B  2  485 ? 26.447   -5.480  30.362   1.00 39.01  ? 486  THR A CB    1 
ATOM   5250  O  OG1   . THR B  2  485 ? 25.850   -5.916  31.586   1.00 35.38  ? 486  THR A OG1   1 
ATOM   5251  C  CG2   . THR B  2  485 ? 27.907   -5.891  30.273   1.00 39.38  ? 486  THR A CG2   1 
ATOM   5252  N  N     . GLU B  2  486 ? 27.742   -2.431  29.042   1.00 41.20  ? 487  GLU A N     1 
ATOM   5253  C  CA    . GLU B  2  486 ? 28.399   -1.836  27.844   1.00 45.18  ? 487  GLU A CA    1 
ATOM   5254  C  C     . GLU B  2  486 ? 29.382   -2.870  27.279   1.00 51.83  ? 487  GLU A C     1 
ATOM   5255  O  O     . GLU B  2  486 ? 30.204   -3.399  28.050   1.00 53.67  ? 487  GLU A O     1 
ATOM   5256  C  CB    . GLU B  2  486 ? 29.136   -0.536  28.160   1.00 44.29  ? 487  GLU A CB    1 
ATOM   5257  C  CG    . GLU B  2  486 ? 29.770   0.113   26.934   1.00 44.70  ? 487  GLU A CG    1 
ATOM   5258  C  CD    . GLU B  2  486 ? 30.644   1.357   27.145   1.00 44.27  ? 487  GLU A CD    1 
ATOM   5259  O  OE1   . GLU B  2  486 ? 30.636   1.925   28.242   1.00 40.54  ? 487  GLU A OE1   1 
ATOM   5260  O  OE2   . GLU B  2  486 ? 31.320   1.792   26.208   1.00 38.65  ? 487  GLU A OE2   1 
ATOM   5261  N  N     . ILE B  2  487 ? 29.296   -3.142  25.972   1.00 55.89  ? 488  ILE A N     1 
ATOM   5262  C  CA    . ILE B  2  487 ? 30.243   -4.017  25.229   1.00 58.42  ? 488  ILE A CA    1 
ATOM   5263  C  C     . ILE B  2  487 ? 31.209   -3.106  24.469   1.00 65.84  ? 488  ILE A C     1 
ATOM   5264  O  O     . ILE B  2  487 ? 30.767   -2.540  23.460   1.00 59.52  ? 488  ILE A O     1 
ATOM   5265  C  CB    . ILE B  2  487 ? 29.481   -4.981  24.302   1.00 57.15  ? 488  ILE A CB    1 
ATOM   5266  C  CG1   . ILE B  2  487 ? 28.553   -5.890  25.113   1.00 58.72  ? 488  ILE A CG1   1 
ATOM   5267  C  CG2   . ILE B  2  487 ? 30.442   -5.794  23.444   1.00 59.07  ? 488  ILE A CG2   1 
ATOM   5268  C  CD1   . ILE B  2  487 ? 27.563   -6.669  24.281   1.00 64.11  ? 488  ILE A CD1   1 
ATOM   5269  N  N     . GLN B  2  488 ? 32.471   -3.000  24.929   1.00 80.24  ? 489  GLN A N     1 
ATOM   5270  C  CA    . GLN B  2  488 ? 33.528   -2.156  24.310   1.00 90.60  ? 489  GLN A CA    1 
ATOM   5271  C  C     . GLN B  2  488 ? 34.276   -2.905  23.188   1.00 107.21 ? 489  GLN A C     1 
ATOM   5272  O  O     . GLN B  2  488 ? 34.960   -3.892  23.520   1.00 127.28 ? 489  GLN A O     1 
ATOM   5273  C  CB    . GLN B  2  488 ? 34.541   -1.724  25.367   1.00 85.68  ? 489  GLN A CB    1 
ATOM   5274  C  CG    . GLN B  2  488 ? 34.124   -0.442  26.040   1.00 78.34  ? 489  GLN A CG    1 
ATOM   5275  C  CD    . GLN B  2  488 ? 35.188   0.073   26.962   1.00 78.62  ? 489  GLN A CD    1 
ATOM   5276  O  OE1   . GLN B  2  488 ? 36.320   -0.406  26.962   1.00 70.95  ? 489  GLN A OE1   1 
ATOM   5277  N  NE2   . GLN B  2  488 ? 34.833   1.117   27.687   1.00 85.43  ? 489  GLN A NE2   1 
ATOM   5278  N  N     . LEU B  2  489 ? 34.218   -2.368  21.962   1.00 111.57 ? 490  LEU A N     1 
ATOM   5279  C  CA    . LEU B  2  489 ? 34.904   -2.911  20.757   1.00 105.88 ? 490  LEU A CA    1 
ATOM   5280  C  C     . LEU B  2  489 ? 36.413   -2.683  20.916   1.00 101.42 ? 490  LEU A C     1 
ATOM   5281  O  O     . LEU B  2  489 ? 36.816   -1.704  21.590   1.00 92.29  ? 490  LEU A O     1 
ATOM   5282  C  CB    . LEU B  2  489 ? 34.332   -2.245  19.498   1.00 99.99  ? 490  LEU A CB    1 
ATOM   5283  N  N     . GLY B  2  490 ? 37.206   -3.592  20.353   1.00 102.64 ? 491  GLY A N     1 
ATOM   5284  C  CA    . GLY B  2  490 ? 38.680   -3.509  20.325   1.00 101.56 ? 491  GLY A CA    1 
ATOM   5285  C  C     . GLY B  2  490 ? 39.300   -3.905  21.654   1.00 102.68 ? 491  GLY A C     1 
ATOM   5286  O  O     . GLY B  2  490 ? 40.235   -4.726  21.709   1.00 98.87  ? 491  GLY A O     1 
ATOM   5287  O  OXT   . GLY B  2  490 ? 38.895   -3.415  22.712   1.00 105.31 ? 491  GLY A OXT   1 
ATOM   5288  N  N     . LYS C  3  1   ? 31.026   -9.482  64.014   1.00 75.88  ? 417  LYS D N     1 
ATOM   5289  C  CA    . LYS C  3  1   ? 29.546   -9.308  63.796   1.00 80.57  ? 417  LYS D CA    1 
ATOM   5290  C  C     . LYS C  3  1   ? 29.173   -7.818  63.659   1.00 83.71  ? 417  LYS D C     1 
ATOM   5291  O  O     . LYS C  3  1   ? 28.088   -7.537  63.147   1.00 94.28  ? 417  LYS D O     1 
ATOM   5292  C  CB    . LYS C  3  1   ? 28.733   -9.931  64.934   1.00 73.99  ? 417  LYS D CB    1 
ATOM   5293  N  N     . LEU C  3  2   ? 30.064   -6.902  64.057   1.00 77.92  ? 418  LEU D N     1 
ATOM   5294  C  CA    . LEU C  3  2   ? 29.866   -5.419  64.008   1.00 70.59  ? 418  LEU D CA    1 
ATOM   5295  C  C     . LEU C  3  2   ? 30.117   -4.921  62.577   1.00 76.73  ? 418  LEU D C     1 
ATOM   5296  O  O     . LEU C  3  2   ? 31.172   -5.260  62.013   1.00 76.67  ? 418  LEU D O     1 
ATOM   5297  C  CB    . LEU C  3  2   ? 30.845   -4.763  64.986   1.00 62.79  ? 418  LEU D CB    1 
ATOM   5298  C  CG    . LEU C  3  2   ? 30.574   -3.310  65.364   1.00 62.20  ? 418  LEU D CG    1 
ATOM   5299  C  CD1   . LEU C  3  2   ? 31.867   -2.649  65.815   1.00 61.80  ? 418  LEU D CD1   1 
ATOM   5300  C  CD2   . LEU C  3  2   ? 29.898   -2.481  64.295   1.00 64.73  ? 418  LEU D CD2   1 
ATOM   5301  N  N     . ALA C  3  3   ? 29.176   -4.182  61.991   1.00 76.84  ? 419  ALA D N     1 
ATOM   5302  C  CA    . ALA C  3  3   ? 29.364   -3.435  60.722   1.00 74.02  ? 419  ALA D CA    1 
ATOM   5303  C  C     . ALA C  3  3   ? 29.539   -1.953  61.065   1.00 79.02  ? 419  ALA D C     1 
ATOM   5304  O  O     . ALA C  3  3   ? 28.518   -1.244  61.177   1.00 74.45  ? 419  ALA D O     1 
ATOM   5305  C  CB    . ALA C  3  3   ? 28.194   -3.639  59.788   1.00 73.33  ? 419  ALA D CB    1 
ATOM   5306  N  N     . ASP C  3  4   ? 30.789   -1.519  61.259   1.00 86.58  ? 420  ASP D N     1 
ATOM   5307  C  CA    . ASP C  3  4   ? 31.125   -0.175  61.798   1.00 95.79  ? 420  ASP D CA    1 
ATOM   5308  C  C     . ASP C  3  4   ? 30.920   0.872   60.697   1.00 100.08 ? 420  ASP D C     1 
ATOM   5309  O  O     . ASP C  3  4   ? 30.904   0.484   59.506   1.00 99.00  ? 420  ASP D O     1 
ATOM   5310  C  CB    . ASP C  3  4   ? 32.547   -0.141  62.376   1.00 94.17  ? 420  ASP D CB    1 
ATOM   5311  C  CG    . ASP C  3  4   ? 32.708   0.851   63.521   1.00 100.83 ? 420  ASP D CG    1 
ATOM   5312  O  OD1   . ASP C  3  4   ? 31.942   1.842   63.566   1.00 112.81 ? 420  ASP D OD1   1 
ATOM   5313  O  OD2   . ASP C  3  4   ? 33.594   0.628   64.351   1.00 95.92  ? 420  ASP D OD2   1 
ATOM   5314  N  N     . CYS C  3  5   ? 30.749   2.143   61.091   1.00 102.87 ? 421  CYS D N     1 
ATOM   5315  C  CA    . CYS C  3  5   ? 30.634   3.323   60.194   1.00 106.84 ? 421  CYS D CA    1 
ATOM   5316  C  C     . CYS C  3  5   ? 32.037   3.861   59.887   1.00 107.58 ? 421  CYS D C     1 
ATOM   5317  O  O     . CYS C  3  5   ? 32.962   3.550   60.668   1.00 92.55  ? 421  CYS D O     1 
ATOM   5318  C  CB    . CYS C  3  5   ? 29.756   4.411   60.806   1.00 112.17 ? 421  CYS D CB    1 
ATOM   5319  S  SG    . CYS C  3  5   ? 30.301   4.977   62.437   1.00 108.40 ? 421  CYS D SG    1 
ATOM   5320  N  N     . SER C  3  6   ? 32.175   4.641   58.800   1.00 116.60 ? 422  SER D N     1 
ATOM   5321  C  CA    . SER C  3  6   ? 33.451   5.204   58.276   1.00 118.46 ? 422  SER D CA    1 
ATOM   5322  C  C     . SER C  3  6   ? 34.010   6.275   59.221   1.00 105.89 ? 422  SER D C     1 
ATOM   5323  O  O     . SER C  3  6   ? 35.217   6.207   59.533   1.00 105.87 ? 422  SER D O     1 
ATOM   5324  C  CB    . SER C  3  6   ? 33.272   5.752   56.887   1.00 122.67 ? 422  SER D CB    1 
ATOM   5325  O  OG    . SER C  3  6   ? 33.151   4.686   55.969   1.00 128.87 ? 422  SER D OG    1 
ATOM   5326  N  N     . SER C  3  7   ? 33.171   7.229   59.640   1.00 94.63  ? 423  SER D N     1 
ATOM   5327  C  CA    . SER C  3  7   ? 33.534   8.329   60.575   1.00 96.86  ? 423  SER D CA    1 
ATOM   5328  C  C     . SER C  3  7   ? 34.107   7.744   61.871   1.00 106.38 ? 423  SER D C     1 
ATOM   5329  O  O     . SER C  3  7   ? 33.523   6.775   62.383   1.00 110.22 ? 423  SER D O     1 
ATOM   5330  C  CB    . SER C  3  7   ? 32.354   9.223   60.862   1.00 96.16  ? 423  SER D CB    1 
ATOM   5331  O  OG    . SER C  3  7   ? 32.645   10.121  61.927   1.00 88.12  ? 423  SER D OG    1 
ATOM   5332  N  N     . LYS C  3  8   ? 35.200   8.321   62.376   1.00 116.43 ? 424  LYS D N     1 
ATOM   5333  C  CA    . LYS C  3  8   ? 35.799   7.982   63.698   1.00 109.99 ? 424  LYS D CA    1 
ATOM   5334  C  C     . LYS C  3  8   ? 35.584   9.167   64.659   1.00 106.68 ? 424  LYS D C     1 
ATOM   5335  O  O     . LYS C  3  8   ? 36.357   9.274   65.625   1.00 100.66 ? 424  LYS D O     1 
ATOM   5336  C  CB    . LYS C  3  8   ? 37.271   7.581   63.522   1.00 98.73  ? 424  LYS D CB    1 
ATOM   5337  N  N     . SER C  3  9   ? 34.559   10.003  64.418   1.00 98.62  ? 425  SER D N     1 
ATOM   5338  C  CA    . SER C  3  9   ? 34.136   11.138  65.289   1.00 84.59  ? 425  SER D CA    1 
ATOM   5339  C  C     . SER C  3  9   ? 32.905   10.746  66.113   1.00 79.73  ? 425  SER D C     1 
ATOM   5340  O  O     . SER C  3  9   ? 31.774   10.991  65.690   1.00 73.75  ? 425  SER D O     1 
ATOM   5341  C  CB    . SER C  3  9   ? 33.862   12.388  64.488   1.00 71.41  ? 425  SER D CB    1 
ATOM   5342  O  OG    . SER C  3  9   ? 33.547   13.464  65.354   1.00 62.68  ? 425  SER D OG    1 
ATOM   5343  N  N     . PRO C  3  10  ? 33.083   10.164  67.328   1.00 72.35  ? 426  PRO D N     1 
ATOM   5344  C  CA    . PRO C  3  10  ? 31.959   9.714   68.151   1.00 73.36  ? 426  PRO D CA    1 
ATOM   5345  C  C     . PRO C  3  10  ? 30.742   10.647  68.290   1.00 70.04  ? 426  PRO D C     1 
ATOM   5346  O  O     . PRO C  3  10  ? 29.630   10.152  68.397   1.00 80.81  ? 426  PRO D O     1 
ATOM   5347  C  CB    . PRO C  3  10  ? 32.615   9.525   69.532   1.00 71.93  ? 426  PRO D CB    1 
ATOM   5348  C  CG    . PRO C  3  10  ? 34.041   9.123   69.217   1.00 71.18  ? 426  PRO D CG    1 
ATOM   5349  C  CD    . PRO C  3  10  ? 34.387   9.882   67.956   1.00 67.71  ? 426  PRO D CD    1 
ATOM   5350  N  N     A GLU C  3  11  ? 30.968   11.969  68.280   0.50 65.90  ? 427  GLU D N     1 
ATOM   5351  N  N     B GLU C  3  11  ? 30.965   11.965  68.277   0.50 69.27  ? 427  GLU D N     1 
ATOM   5352  C  CA    A GLU C  3  11  ? 29.916   12.993  68.527   0.50 66.70  ? 427  GLU D CA    1 
ATOM   5353  C  CA    B GLU C  3  11  ? 29.912   12.988  68.525   0.50 72.29  ? 427  GLU D CA    1 
ATOM   5354  C  C     A GLU C  3  11  ? 28.809   12.884  67.463   0.50 71.87  ? 427  GLU D C     1 
ATOM   5355  C  C     B GLU C  3  11  ? 28.809   12.887  67.460   0.50 75.34  ? 427  GLU D C     1 
ATOM   5356  O  O     A GLU C  3  11  ? 27.669   13.278  67.777   0.50 73.36  ? 427  GLU D O     1 
ATOM   5357  O  O     B GLU C  3  11  ? 27.670   13.279  67.776   0.50 76.76  ? 427  GLU D O     1 
ATOM   5358  C  CB    A GLU C  3  11  ? 30.508   14.414  68.506   0.50 64.72  ? 427  GLU D CB    1 
ATOM   5359  C  CB    B GLU C  3  11  ? 30.565   14.373  68.585   0.50 74.60  ? 427  GLU D CB    1 
ATOM   5360  C  CG    A GLU C  3  11  ? 31.201   14.882  69.771   0.50 60.05  ? 427  GLU D CG    1 
ATOM   5361  C  CG    B GLU C  3  11  ? 31.663   14.429  69.646   0.50 73.05  ? 427  GLU D CG    1 
ATOM   5362  C  CD    A GLU C  3  11  ? 30.812   16.300  70.173   0.50 53.00  ? 427  GLU D CD    1 
ATOM   5363  C  CD    B GLU C  3  11  ? 33.013   13.811  69.278   0.50 68.32  ? 427  GLU D CD    1 
ATOM   5364  O  OE1   A GLU C  3  11  ? 31.723   17.134  70.378   0.50 47.56  ? 427  GLU D OE1   1 
ATOM   5365  O  OE1   B GLU C  3  11  ? 33.381   13.830  68.089   0.50 64.63  ? 427  GLU D OE1   1 
ATOM   5366  O  OE2   A GLU C  3  11  ? 29.594   16.570  70.286   0.50 45.96  ? 427  GLU D OE2   1 
ATOM   5367  O  OE2   B GLU C  3  11  ? 33.712   13.322  70.187   0.50 63.97  ? 427  GLU D OE2   1 
ATOM   5368  N  N     . GLU C  3  12  ? 29.130   12.391  66.255   1.00 79.74  ? 428  GLU D N     1 
ATOM   5369  C  CA    . GLU C  3  12  ? 28.190   12.318  65.094   1.00 88.60  ? 428  GLU D CA    1 
ATOM   5370  C  C     . GLU C  3  12  ? 27.923   10.864  64.669   1.00 86.85  ? 428  GLU D C     1 
ATOM   5371  O  O     . GLU C  3  12  ? 27.186   10.662  63.679   1.00 94.60  ? 428  GLU D O     1 
ATOM   5372  C  CB    . GLU C  3  12  ? 28.740   13.116  63.902   1.00 93.60  ? 428  GLU D CB    1 
ATOM   5373  C  CG    . GLU C  3  12  ? 30.001   12.529  63.269   1.00 92.28  ? 428  GLU D CG    1 
ATOM   5374  C  CD    . GLU C  3  12  ? 30.312   13.006  61.852   1.00 95.09  ? 428  GLU D CD    1 
ATOM   5375  O  OE1   . GLU C  3  12  ? 29.505   13.774  61.282   1.00 87.68  ? 428  GLU D OE1   1 
ATOM   5376  O  OE2   . GLU C  3  12  ? 31.362   12.592  61.311   1.00 102.75 ? 428  GLU D OE2   1 
ATOM   5377  N  N     . CYS C  3  13  ? 28.503   9.890   65.374   1.00 79.47  ? 429  CYS D N     1 
ATOM   5378  C  CA    . CYS C  3  13  ? 28.326   8.437   65.105   1.00 81.94  ? 429  CYS D CA    1 
ATOM   5379  C  C     . CYS C  3  13  ? 27.201   7.881   65.983   1.00 73.20  ? 429  CYS D C     1 
ATOM   5380  O  O     . CYS C  3  13  ? 26.975   8.430   67.083   1.00 75.16  ? 429  CYS D O     1 
ATOM   5381  C  CB    . CYS C  3  13  ? 29.617   7.668   65.350   1.00 89.07  ? 429  CYS D CB    1 
ATOM   5382  S  SG    . CYS C  3  13  ? 30.874   7.978   64.087   1.00 102.03 ? 429  CYS D SG    1 
ATOM   5383  N  N     . GLU C  3  14  ? 26.527   6.835   65.497   1.00 64.66  ? 430  GLU D N     1 
ATOM   5384  C  CA    . GLU C  3  14  ? 25.460   6.097   66.222   1.00 63.65  ? 430  GLU D CA    1 
ATOM   5385  C  C     . GLU C  3  14  ? 25.564   4.604   65.880   1.00 69.05  ? 430  GLU D C     1 
ATOM   5386  O  O     . GLU C  3  14  ? 25.881   4.285   64.714   1.00 69.77  ? 430  GLU D O     1 
ATOM   5387  C  CB    . GLU C  3  14  ? 24.078   6.678   65.907   1.00 64.41  ? 430  GLU D CB    1 
ATOM   5388  C  CG    . GLU C  3  14  ? 23.894   7.207   64.495   1.00 63.71  ? 430  GLU D CG    1 
ATOM   5389  C  CD    . GLU C  3  14  ? 22.676   8.111   64.313   1.00 61.64  ? 430  GLU D CD    1 
ATOM   5390  O  OE1   . GLU C  3  14  ? 22.451   8.997   65.168   1.00 51.19  ? 430  GLU D OE1   1 
ATOM   5391  O  OE2   . GLU C  3  14  ? 21.941   7.919   63.323   1.00 63.12  ? 430  GLU D OE2   1 
ATOM   5392  N  N     . ILE C  3  15  ? 25.328   3.733   66.871   1.00 71.86  ? 431  ILE D N     1 
ATOM   5393  C  CA    . ILE C  3  15  ? 25.332   2.241   66.736   1.00 69.95  ? 431  ILE D CA    1 
ATOM   5394  C  C     . ILE C  3  15  ? 23.910   1.718   66.979   1.00 66.05  ? 431  ILE D C     1 
ATOM   5395  O  O     . ILE C  3  15  ? 23.272   2.147   67.966   1.00 82.69  ? 431  ILE D O     1 
ATOM   5396  C  CB    . ILE C  3  15  ? 26.371   1.569   67.669   1.00 71.43  ? 431  ILE D CB    1 
ATOM   5397  C  CG1   . ILE C  3  15  ? 26.467   0.064   67.398   1.00 69.14  ? 431  ILE D CG1   1 
ATOM   5398  C  CG2   . ILE C  3  15  ? 26.082   1.852   69.144   1.00 73.61  ? 431  ILE D CG2   1 
ATOM   5399  C  CD1   . ILE C  3  15  ? 27.718   -0.586  67.961   1.00 70.81  ? 431  ILE D CD1   1 
ATOM   5400  N  N     . PHE C  3  16  ? 23.433   0.840   66.092   1.00 54.02  ? 432  PHE D N     1 
ATOM   5401  C  CA    . PHE C  3  16  ? 22.097   0.197   66.156   1.00 49.92  ? 432  PHE D CA    1 
ATOM   5402  C  C     . PHE C  3  16  ? 22.273   -1.261  66.602   1.00 51.60  ? 432  PHE D C     1 
ATOM   5403  O  O     . PHE C  3  16  ? 22.999   -2.023  65.927   1.00 51.24  ? 432  PHE D O     1 
ATOM   5404  C  CB    . PHE C  3  16  ? 21.383   0.326   64.809   1.00 45.03  ? 432  PHE D CB    1 
ATOM   5405  C  CG    . PHE C  3  16  ? 20.960   1.730   64.463   1.00 39.85  ? 432  PHE D CG    1 
ATOM   5406  C  CD1   . PHE C  3  16  ? 21.870   2.638   63.942   1.00 42.27  ? 432  PHE D CD1   1 
ATOM   5407  C  CD2   . PHE C  3  16  ? 19.654   2.144   64.649   1.00 36.01  ? 432  PHE D CD2   1 
ATOM   5408  C  CE1   . PHE C  3  16  ? 21.485   3.940   63.630   1.00 40.44  ? 432  PHE D CE1   1 
ATOM   5409  C  CE2   . PHE C  3  16  ? 19.272   3.444   64.335   1.00 37.51  ? 432  PHE D CE2   1 
ATOM   5410  C  CZ    . PHE C  3  16  ? 20.187   4.346   63.828   1.00 37.57  ? 432  PHE D CZ    1 
ATOM   5411  N  N     . LEU C  3  17  ? 21.638   -1.622  67.720   1.00 58.48  ? 433  LEU D N     1 
ATOM   5412  C  CA    . LEU C  3  17  ? 21.579   -3.002  68.275   1.00 60.17  ? 433  LEU D CA    1 
ATOM   5413  C  C     . LEU C  3  17  ? 20.284   -3.673  67.794   1.00 67.10  ? 433  LEU D C     1 
ATOM   5414  O  O     . LEU C  3  17  ? 19.201   -3.140  68.088   1.00 70.11  ? 433  LEU D O     1 
ATOM   5415  C  CB    . LEU C  3  17  ? 21.628   -2.928  69.804   1.00 57.32  ? 433  LEU D CB    1 
ATOM   5416  C  CG    . LEU C  3  17  ? 22.773   -2.116  70.397   1.00 56.35  ? 433  LEU D CG    1 
ATOM   5417  C  CD1   . LEU C  3  17  ? 22.546   -1.908  71.894   1.00 54.64  ? 433  LEU D CD1   1 
ATOM   5418  C  CD2   . LEU C  3  17  ? 24.111   -2.787  70.114   1.00 53.80  ? 433  LEU D CD2   1 
ATOM   5419  N  N     . VAL C  3  18  ? 20.404   -4.798  67.077   1.00 70.50  ? 434  VAL D N     1 
ATOM   5420  C  CA    . VAL C  3  18  ? 19.281   -5.494  66.372   1.00 66.50  ? 434  VAL D CA    1 
ATOM   5421  C  C     . VAL C  3  18  ? 19.290   -6.975  66.773   1.00 65.10  ? 434  VAL D C     1 
ATOM   5422  O  O     . VAL C  3  18  ? 20.356   -7.434  67.235   1.00 58.01  ? 434  VAL D O     1 
ATOM   5423  C  CB    . VAL C  3  18  ? 19.359   -5.268  64.849   1.00 62.91  ? 434  VAL D CB    1 
ATOM   5424  C  CG1   . VAL C  3  18  ? 19.071   -3.813  64.473   1.00 58.16  ? 434  VAL D CG1   1 
ATOM   5425  C  CG2   . VAL C  3  18  ? 20.711   -5.664  64.286   1.00 65.15  ? 434  VAL D CG2   1 
ATOM   5426  N  N     . GLU C  3  19  ? 18.154   -7.678  66.631   1.00 71.18  ? 435  GLU D N     1 
ATOM   5427  C  CA    . GLU C  3  19  ? 17.875   -8.993  67.300   1.00 76.87  ? 435  GLU D CA    1 
ATOM   5428  C  C     . GLU C  3  19  ? 18.678   -10.128 66.653   1.00 78.95  ? 435  GLU D C     1 
ATOM   5429  O  O     . GLU C  3  19  ? 19.038   -11.065 67.395   1.00 71.24  ? 435  GLU D O     1 
ATOM   5430  C  CB    . GLU C  3  19  ? 16.397   -9.386  67.254   1.00 84.06  ? 435  GLU D CB    1 
ATOM   5431  C  CG    . GLU C  3  19  ? 15.550   -8.706  68.310   1.00 92.66  ? 435  GLU D CG    1 
ATOM   5432  C  CD    . GLU C  3  19  ? 14.094   -9.164  68.401   1.00 91.12  ? 435  GLU D CD    1 
ATOM   5433  O  OE1   . GLU C  3  19  ? 13.725   -10.181 67.777   1.00 81.43  ? 435  GLU D OE1   1 
ATOM   5434  O  OE2   . GLU C  3  19  ? 13.280   -8.431  69.020   1.00 77.15  ? 435  GLU D OE2   1 
ATOM   5435  N  N     . GLY C  3  20  ? 18.916   -10.076 65.333   1.00 76.04  ? 436  GLY D N     1 
ATOM   5436  C  CA    . GLY C  3  20  ? 19.688   -11.110 64.621   1.00 71.32  ? 436  GLY D CA    1 
ATOM   5437  C  C     . GLY C  3  20  ? 20.197   -10.629 63.276   1.00 73.47  ? 436  GLY D C     1 
ATOM   5438  O  O     . GLY C  3  20  ? 19.985   -9.455  62.948   1.00 70.75  ? 436  GLY D O     1 
ATOM   5439  N  N     . ASP C  3  21  ? 20.832   -11.520 62.516   1.00 79.77  ? 437  ASP D N     1 
ATOM   5440  C  CA    . ASP C  3  21  ? 21.351   -11.276 61.137   1.00 79.48  ? 437  ASP D CA    1 
ATOM   5441  C  C     . ASP C  3  21  ? 20.168   -11.004 60.183   1.00 74.75  ? 437  ASP D C     1 
ATOM   5442  O  O     . ASP C  3  21  ? 20.347   -10.299 59.201   1.00 70.04  ? 437  ASP D O     1 
ATOM   5443  C  CB    . ASP C  3  21  ? 22.233   -12.425 60.655   1.00 88.05  ? 437  ASP D CB    1 
ATOM   5444  C  CG    . ASP C  3  21  ? 23.389   -12.759 61.588   1.00 96.88  ? 437  ASP D CG    1 
ATOM   5445  O  OD1   . ASP C  3  21  ? 23.719   -11.922 62.435   1.00 85.80  ? 437  ASP D OD1   1 
ATOM   5446  O  OD2   . ASP C  3  21  ? 23.951   -13.872 61.466   1.00 126.61 ? 437  ASP D OD2   1 
ATOM   5447  N  N     . SER C  3  22  ? 18.982   -11.520 60.480   1.00 79.21  ? 438  SER D N     1 
ATOM   5448  C  CA    . SER C  3  22  ? 17.704   -11.191 59.790   1.00 84.30  ? 438  SER D CA    1 
ATOM   5449  C  C     . SER C  3  22  ? 17.554   -9.674  59.699   1.00 88.07  ? 438  SER D C     1 
ATOM   5450  O  O     . SER C  3  22  ? 17.523   -9.151  58.574   1.00 95.75  ? 438  SER D O     1 
ATOM   5451  C  CB    . SER C  3  22  ? 16.527   -11.801 60.499   1.00 92.82  ? 438  SER D CB    1 
ATOM   5452  O  OG    . SER C  3  22  ? 16.864   -13.113 60.910   1.00 80.64  ? 438  SER D OG    1 
ATOM   5453  N  N     . ALA C  3  23  ? 17.469   -9.006  60.846   1.00 93.14  ? 439  ALA D N     1 
ATOM   5454  C  CA    . ALA C  3  23  ? 17.342   -7.532  60.965   1.00 106.06 ? 439  ALA D CA    1 
ATOM   5455  C  C     . ALA C  3  23  ? 18.675   -6.880  60.584   1.00 123.75 ? 439  ALA D C     1 
ATOM   5456  O  O     . ALA C  3  23  ? 18.653   -5.852  59.892   1.00 139.67 ? 439  ALA D O     1 
ATOM   5457  C  CB    . ALA C  3  23  ? 16.922   -7.142  62.360   1.00 108.07 ? 439  ALA D CB    1 
ATOM   5458  N  N     . GLY C  3  24  ? 19.793   -7.474  61.013   1.00 130.15 ? 440  GLY D N     1 
ATOM   5459  C  CA    . GLY C  3  24  ? 21.160   -7.025  60.673   1.00 124.95 ? 440  GLY D CA    1 
ATOM   5460  C  C     . GLY C  3  24  ? 21.307   -6.648  59.201   1.00 113.73 ? 440  GLY D C     1 
ATOM   5461  O  O     . GLY C  3  24  ? 21.762   -5.533  58.923   1.00 113.22 ? 440  GLY D O     1 
ATOM   5462  N  N     . GLY C  3  25  ? 20.947   -7.544  58.285   1.00 93.83  ? 441  GLY D N     1 
ATOM   5463  C  CA    . GLY C  3  25  ? 21.124   -7.372  56.831   1.00 84.30  ? 441  GLY D CA    1 
ATOM   5464  C  C     . GLY C  3  25  ? 20.247   -6.262  56.280   1.00 80.27  ? 441  GLY D C     1 
ATOM   5465  O  O     . GLY C  3  25  ? 20.781   -5.425  55.513   1.00 76.49  ? 441  GLY D O     1 
ATOM   5466  N  N     . SER C  3  26  ? 18.961   -6.254  56.640   1.00 72.25  ? 442  SER D N     1 
ATOM   5467  C  CA    . SER C  3  26  ? 17.963   -5.233  56.224   1.00 69.32  ? 442  SER D CA    1 
ATOM   5468  C  C     . SER C  3  26  ? 18.465   -3.840  56.633   1.00 69.33  ? 442  SER D C     1 
ATOM   5469  O  O     . SER C  3  26  ? 18.368   -2.885  55.819   1.00 61.04  ? 442  SER D O     1 
ATOM   5470  C  CB    . SER C  3  26  ? 16.607   -5.523  56.839   1.00 69.22  ? 442  SER D CB    1 
ATOM   5471  O  OG    . SER C  3  26  ? 16.103   -6.769  56.430   1.00 72.54  ? 442  SER D OG    1 
ATOM   5472  N  N     . THR C  3  27  ? 19.002   -3.761  57.856   1.00 71.68  ? 443  THR D N     1 
ATOM   5473  C  CA    . THR C  3  27  ? 19.542   -2.541  58.504   1.00 67.06  ? 443  THR D CA    1 
ATOM   5474  C  C     . THR C  3  27  ? 20.814   -2.081  57.780   1.00 60.62  ? 443  THR D C     1 
ATOM   5475  O  O     . THR C  3  27  ? 20.894   -0.882  57.460   1.00 54.36  ? 443  THR D O     1 
ATOM   5476  C  CB    . THR C  3  27  ? 19.781   -2.813  59.995   1.00 70.80  ? 443  THR D CB    1 
ATOM   5477  O  OG1   . THR C  3  27  ? 18.580   -3.362  60.540   1.00 77.36  ? 443  THR D OG1   1 
ATOM   5478  C  CG2   . THR C  3  27  ? 20.150   -1.573  60.775   1.00 72.88  ? 443  THR D CG2   1 
ATOM   5479  N  N     . LYS C  3  28  ? 21.768   -2.991  57.539   1.00 57.60  ? 444  LYS D N     1 
ATOM   5480  C  CA    . LYS C  3  28  ? 23.070   -2.692  56.883   1.00 59.66  ? 444  LYS D CA    1 
ATOM   5481  C  C     . LYS C  3  28  ? 22.826   -2.106  55.490   1.00 60.56  ? 444  LYS D C     1 
ATOM   5482  O  O     . LYS C  3  28  ? 23.630   -1.256  55.084   1.00 62.21  ? 444  LYS D O     1 
ATOM   5483  C  CB    . LYS C  3  28  ? 23.977   -3.924  56.813   1.00 57.27  ? 444  LYS D CB    1 
ATOM   5484  C  CG    . LYS C  3  28  ? 24.775   -4.185  58.086   1.00 58.17  ? 444  LYS D CG    1 
ATOM   5485  C  CD    . LYS C  3  28  ? 25.237   -5.622  58.273   1.00 58.14  ? 444  LYS D CD    1 
ATOM   5486  N  N     . SER C  3  29  ? 21.768   -2.527  54.796   1.00 61.25  ? 445  SER D N     1 
ATOM   5487  C  CA    . SER C  3  29  ? 21.374   -1.988  53.467   1.00 61.47  ? 445  SER D CA    1 
ATOM   5488  C  C     . SER C  3  29  ? 20.795   -0.579  53.622   1.00 60.63  ? 445  SER D C     1 
ATOM   5489  O  O     . SER C  3  29  ? 21.196   0.315   52.841   1.00 56.69  ? 445  SER D O     1 
ATOM   5490  C  CB    . SER C  3  29  ? 20.402   -2.912  52.767   1.00 60.75  ? 445  SER D CB    1 
ATOM   5491  O  OG    . SER C  3  29  ? 21.088   -4.012  52.193   1.00 53.67  ? 445  SER D OG    1 
ATOM   5492  N  N     . GLY C  3  30  ? 19.896   -0.399  54.596   1.00 67.85  ? 446  GLY D N     1 
ATOM   5493  C  CA    . GLY C  3  30  ? 19.134   0.847   54.823   1.00 80.46  ? 446  GLY D CA    1 
ATOM   5494  C  C     . GLY C  3  30  ? 20.020   1.997   55.287   1.00 86.88  ? 446  GLY D C     1 
ATOM   5495  O  O     . GLY C  3  30  ? 19.749   3.156   54.885   1.00 94.70  ? 446  GLY D O     1 
ATOM   5496  N  N     . ARG C  3  31  ? 21.053   1.686   56.078   1.00 82.60  ? 447  ARG D N     1 
ATOM   5497  C  CA    . ARG C  3  31  ? 21.806   2.658   56.917   1.00 77.89  ? 447  ARG D CA    1 
ATOM   5498  C  C     . ARG C  3  31  ? 22.614   3.642   56.058   1.00 81.90  ? 447  ARG D C     1 
ATOM   5499  O  O     . ARG C  3  31  ? 22.908   3.316   54.886   1.00 70.66  ? 447  ARG D O     1 
ATOM   5500  C  CB    . ARG C  3  31  ? 22.753   1.932   57.881   1.00 67.79  ? 447  ARG D CB    1 
ATOM   5501  C  CG    . ARG C  3  31  ? 23.786   1.042   57.207   1.00 58.03  ? 447  ARG D CG    1 
ATOM   5502  C  CD    . ARG C  3  31  ? 25.080   0.983   57.987   1.00 60.71  ? 447  ARG D CD    1 
ATOM   5503  N  NE    . ARG C  3  31  ? 26.064   0.085   57.402   1.00 65.06  ? 447  ARG D NE    1 
ATOM   5504  C  CZ    . ARG C  3  31  ? 27.266   -0.149  57.921   1.00 69.71  ? 447  ARG D CZ    1 
ATOM   5505  N  NH1   . ARG C  3  31  ? 28.102   -0.975  57.317   1.00 70.20  ? 447  ARG D NH1   1 
ATOM   5506  N  NH2   . ARG C  3  31  ? 27.640   0.444   59.042   1.00 73.29  ? 447  ARG D NH2   1 
ATOM   5507  N  N     . ASP C  3  32  ? 22.955   4.794   56.650   1.00 89.15  ? 448  ASP D N     1 
ATOM   5508  C  CA    . ASP C  3  32  ? 24.028   5.716   56.188   1.00 89.51  ? 448  ASP D CA    1 
ATOM   5509  C  C     . ASP C  3  32  ? 25.348   5.210   56.789   1.00 86.37  ? 448  ASP D C     1 
ATOM   5510  O  O     . ASP C  3  32  ? 25.640   5.557   57.952   1.00 79.17  ? 448  ASP D O     1 
ATOM   5511  C  CB    . ASP C  3  32  ? 23.702   7.168   56.572   1.00 88.53  ? 448  ASP D CB    1 
ATOM   5512  C  CG    . ASP C  3  32  ? 24.804   8.189   56.318   1.00 92.52  ? 448  ASP D CG    1 
ATOM   5513  O  OD1   . ASP C  3  32  ? 25.705   7.914   55.486   1.00 89.94  ? 448  ASP D OD1   1 
ATOM   5514  O  OD2   . ASP C  3  32  ? 24.752   9.258   56.959   1.00 99.60  ? 448  ASP D OD2   1 
ATOM   5515  N  N     . SER C  3  33  ? 26.113   4.412   56.035   1.00 82.48  ? 449  SER D N     1 
ATOM   5516  C  CA    . SER C  3  33  ? 27.327   3.705   56.527   1.00 76.91  ? 449  SER D CA    1 
ATOM   5517  C  C     . SER C  3  33  ? 28.442   4.705   56.869   1.00 77.67  ? 449  SER D C     1 
ATOM   5518  O  O     . SER C  3  33  ? 29.480   4.258   57.373   1.00 88.51  ? 449  SER D O     1 
ATOM   5519  C  CB    . SER C  3  33  ? 27.794   2.642   55.558   1.00 76.94  ? 449  SER D CB    1 
ATOM   5520  O  OG    . SER C  3  33  ? 28.046   3.190   54.268   1.00 76.70  ? 449  SER D OG    1 
ATOM   5521  N  N     . ARG C  3  34  ? 28.239   6.005   56.632   1.00 72.73  ? 450  ARG D N     1 
ATOM   5522  C  CA    . ARG C  3  34  ? 29.190   7.077   57.038   1.00 68.93  ? 450  ARG D CA    1 
ATOM   5523  C  C     . ARG C  3  34  ? 29.134   7.280   58.563   1.00 58.88  ? 450  ARG D C     1 
ATOM   5524  O  O     . ARG C  3  34  ? 30.215   7.464   59.159   1.00 48.45  ? 450  ARG D O     1 
ATOM   5525  C  CB    . ARG C  3  34  ? 28.918   8.379   56.274   1.00 75.11  ? 450  ARG D CB    1 
ATOM   5526  C  CG    . ARG C  3  34  ? 30.157   9.259   56.151   1.00 76.02  ? 450  ARG D CG    1 
ATOM   5527  C  CD    . ARG C  3  34  ? 29.871   10.680  55.693   1.00 77.18  ? 450  ARG D CD    1 
ATOM   5528  N  NE    . ARG C  3  34  ? 29.093   11.471  56.644   1.00 79.72  ? 450  ARG D NE    1 
ATOM   5529  C  CZ    . ARG C  3  34  ? 29.548   11.983  57.796   1.00 76.59  ? 450  ARG D CZ    1 
ATOM   5530  N  NH1   . ARG C  3  34  ? 28.727   12.697  58.551   1.00 73.66  ? 450  ARG D NH1   1 
ATOM   5531  N  NH2   . ARG C  3  34  ? 30.795   11.775  58.200   1.00 70.65  ? 450  ARG D NH2   1 
ATOM   5532  N  N     . THR C  3  35  ? 27.940   7.233   59.177   1.00 58.91  ? 451  THR D N     1 
ATOM   5533  C  CA    . THR C  3  35  ? 27.705   7.606   60.606   1.00 60.89  ? 451  THR D CA    1 
ATOM   5534  C  C     . THR C  3  35  ? 26.927   6.542   61.401   1.00 64.75  ? 451  THR D C     1 
ATOM   5535  O  O     . THR C  3  35  ? 26.793   6.728   62.627   1.00 61.90  ? 451  THR D O     1 
ATOM   5536  C  CB    . THR C  3  35  ? 26.945   8.936   60.703   1.00 59.54  ? 451  THR D CB    1 
ATOM   5537  O  OG1   . THR C  3  35  ? 25.793   8.885   59.857   1.00 55.04  ? 451  THR D OG1   1 
ATOM   5538  C  CG2   . THR C  3  35  ? 27.808   10.121  60.322   1.00 65.32  ? 451  THR D CG2   1 
ATOM   5539  N  N     . GLN C  3  36  ? 26.422   5.481   60.763   1.00 70.91  ? 452  GLN D N     1 
ATOM   5540  C  CA    . GLN C  3  36  ? 25.522   4.491   61.419   1.00 69.35  ? 452  GLN D CA    1 
ATOM   5541  C  C     . GLN C  3  36  ? 26.192   3.114   61.415   1.00 65.48  ? 452  GLN D C     1 
ATOM   5542  O  O     . GLN C  3  36  ? 26.365   2.544   60.327   1.00 53.78  ? 452  GLN D O     1 
ATOM   5543  C  CB    . GLN C  3  36  ? 24.165   4.470   60.718   1.00 72.33  ? 452  GLN D CB    1 
ATOM   5544  C  CG    . GLN C  3  36  ? 23.401   5.774   60.877   1.00 80.86  ? 452  GLN D CG    1 
ATOM   5545  C  CD    . GLN C  3  36  ? 22.013   5.695   60.284   1.00 87.71  ? 452  GLN D CD    1 
ATOM   5546  O  OE1   . GLN C  3  36  ? 21.805   5.106   59.224   1.00 98.62  ? 452  GLN D OE1   1 
ATOM   5547  N  NE2   . GLN C  3  36  ? 21.047   6.285   60.969   1.00 90.81  ? 452  GLN D NE2   1 
ATOM   5548  N  N     . ALA C  3  37  ? 26.579   2.619   62.595   1.00 67.43  ? 453  ALA D N     1 
ATOM   5549  C  CA    . ALA C  3  37  ? 27.140   1.262   62.792   1.00 74.07  ? 453  ALA D CA    1 
ATOM   5550  C  C     . ALA C  3  37  ? 25.996   0.314   63.159   1.00 83.19  ? 453  ALA D C     1 
ATOM   5551  O  O     . ALA C  3  37  ? 24.936   0.816   63.593   1.00 88.92  ? 453  ALA D O     1 
ATOM   5552  C  CB    . ALA C  3  37  ? 28.210   1.287   63.854   1.00 69.75  ? 453  ALA D CB    1 
ATOM   5553  N  N     . ILE C  3  38  ? 26.195   -0.996  62.985   1.00 83.61  ? 454  ILE D N     1 
ATOM   5554  C  CA    . ILE C  3  38  ? 25.183   -2.038  63.332   1.00 87.82  ? 454  ILE D CA    1 
ATOM   5555  C  C     . ILE C  3  38  ? 25.871   -3.199  64.053   1.00 83.71  ? 454  ILE D C     1 
ATOM   5556  O  O     . ILE C  3  38  ? 26.846   -3.752  63.503   1.00 75.78  ? 454  ILE D O     1 
ATOM   5557  C  CB    . ILE C  3  38  ? 24.429   -2.495  62.074   1.00 90.32  ? 454  ILE D CB    1 
ATOM   5558  C  CG1   . ILE C  3  38  ? 23.538   -1.369  61.549   1.00 93.25  ? 454  ILE D CG1   1 
ATOM   5559  C  CG2   . ILE C  3  38  ? 23.626   -3.759  62.337   1.00 89.03  ? 454  ILE D CG2   1 
ATOM   5560  C  CD1   . ILE C  3  38  ? 23.462   -1.303  60.053   1.00 96.79  ? 454  ILE D CD1   1 
ATOM   5561  N  N     . LEU C  3  39  ? 25.366   -3.541  65.239   1.00 86.36  ? 455  LEU D N     1 
ATOM   5562  C  CA    . LEU C  3  39  ? 25.773   -4.739  66.015   1.00 93.07  ? 455  LEU D CA    1 
ATOM   5563  C  C     . LEU C  3  39  ? 24.567   -5.660  66.132   1.00 89.65  ? 455  LEU D C     1 
ATOM   5564  O  O     . LEU C  3  39  ? 23.696   -5.422  66.962   1.00 92.22  ? 455  LEU D O     1 
ATOM   5565  C  CB    . LEU C  3  39  ? 26.282   -4.334  67.398   1.00 100.90 ? 455  LEU D CB    1 
ATOM   5566  C  CG    . LEU C  3  39  ? 26.779   -5.485  68.271   1.00 103.79 ? 455  LEU D CG    1 
ATOM   5567  C  CD1   . LEU C  3  39  ? 27.830   -6.319  67.544   1.00 105.43 ? 455  LEU D CD1   1 
ATOM   5568  C  CD2   . LEU C  3  39  ? 27.329   -4.964  69.587   1.00 105.64 ? 455  LEU D CD2   1 
ATOM   5569  N  N     . PRO C  3  40  ? 24.477   -6.722  65.293   1.00 84.25  ? 456  PRO D N     1 
ATOM   5570  C  CA    . PRO C  3  40  ? 23.411   -7.701  65.418   1.00 79.87  ? 456  PRO D CA    1 
ATOM   5571  C  C     . PRO C  3  40  ? 23.781   -8.623  66.583   1.00 78.07  ? 456  PRO D C     1 
ATOM   5572  O  O     . PRO C  3  40  ? 24.882   -9.129  66.588   1.00 85.86  ? 456  PRO D O     1 
ATOM   5573  C  CB    . PRO C  3  40  ? 23.387   -8.417  64.060   1.00 79.71  ? 456  PRO D CB    1 
ATOM   5574  C  CG    . PRO C  3  40  ? 24.672   -8.034  63.334   1.00 78.29  ? 456  PRO D CG    1 
ATOM   5575  C  CD    . PRO C  3  40  ? 25.426   -7.083  64.229   1.00 79.98  ? 456  PRO D CD    1 
ATOM   5576  N  N     . LEU C  3  41  ? 22.867   -8.764  67.545   1.00 76.76  ? 457  LEU D N     1 
ATOM   5577  C  CA    . LEU C  3  41  ? 22.965   -9.700  68.697   1.00 72.84  ? 457  LEU D CA    1 
ATOM   5578  C  C     . LEU C  3  41  ? 22.466   -11.082 68.265   1.00 76.80  ? 457  LEU D C     1 
ATOM   5579  O  O     . LEU C  3  41  ? 22.069   -11.236 67.088   1.00 87.58  ? 457  LEU D O     1 
ATOM   5580  C  CB    . LEU C  3  41  ? 22.134   -9.143  69.859   1.00 68.94  ? 457  LEU D CB    1 
ATOM   5581  C  CG    . LEU C  3  41  ? 22.513   -7.734  70.313   1.00 66.27  ? 457  LEU D CG    1 
ATOM   5582  C  CD1   . LEU C  3  41  ? 21.520   -7.229  71.345   1.00 64.93  ? 457  LEU D CD1   1 
ATOM   5583  C  CD2   . LEU C  3  41  ? 23.937   -7.688  70.868   1.00 58.46  ? 457  LEU D CD2   1 
ATOM   5584  N  N     . ARG C  3  42  ? 22.496   -12.051 69.180   1.00 77.41  ? 458  ARG D N     1 
ATOM   5585  C  CA    . ARG C  3  42  ? 22.141   -13.464 68.896   1.00 74.47  ? 458  ARG D CA    1 
ATOM   5586  C  C     . ARG C  3  42  ? 20.999   -13.868 69.830   1.00 68.07  ? 458  ARG D C     1 
ATOM   5587  O  O     . ARG C  3  42  ? 21.206   -14.735 70.695   1.00 61.48  ? 458  ARG D O     1 
ATOM   5588  C  CB    . ARG C  3  42  ? 23.400   -14.328 69.003   1.00 69.40  ? 458  ARG D CB    1 
ATOM   5589  C  CG    . ARG C  3  42  ? 24.443   -14.003 67.947   1.00 67.62  ? 458  ARG D CG    1 
ATOM   5590  C  CD    . ARG C  3  42  ? 25.516   -15.067 67.910   1.00 70.26  ? 458  ARG D CD    1 
ATOM   5591  N  NE    . ARG C  3  42  ? 26.472   -14.807 66.847   1.00 74.98  ? 458  ARG D NE    1 
ATOM   5592  C  CZ    . ARG C  3  42  ? 27.226   -15.734 66.245   1.00 71.99  ? 458  ARG D CZ    1 
ATOM   5593  N  NH1   . ARG C  3  42  ? 27.142   -17.007 66.602   1.00 73.55  ? 458  ARG D NH1   1 
ATOM   5594  N  NH2   . ARG C  3  42  ? 28.052   -15.378 65.279   1.00 66.00  ? 458  ARG D NH2   1 
ATOM   5595  N  N     . GLY C  3  43  ? 19.840   -13.233 69.651   1.00 72.19  ? 459  GLY D N     1 
ATOM   5596  C  CA    . GLY C  3  43  ? 18.596   -13.540 70.385   1.00 74.86  ? 459  GLY D CA    1 
ATOM   5597  C  C     . GLY C  3  43  ? 18.656   -13.036 71.812   1.00 76.12  ? 459  GLY D C     1 
ATOM   5598  O  O     . GLY C  3  43  ? 19.373   -12.049 72.051   1.00 80.32  ? 459  GLY D O     1 
ATOM   5599  N  N     . LYS C  3  44  ? 17.919   -13.686 72.714   1.00 77.02  ? 460  LYS D N     1 
ATOM   5600  C  CA    . LYS C  3  44  ? 17.873   -13.333 74.159   1.00 79.79  ? 460  LYS D CA    1 
ATOM   5601  C  C     . LYS C  3  44  ? 19.320   -13.206 74.657   1.00 75.52  ? 460  LYS D C     1 
ATOM   5602  O  O     . LYS C  3  44  ? 20.138   -14.097 74.356   1.00 52.19  ? 460  LYS D O     1 
ATOM   5603  C  CB    . LYS C  3  44  ? 17.062   -14.356 74.962   1.00 82.02  ? 460  LYS D CB    1 
ATOM   5604  C  CG    . LYS C  3  44  ? 15.602   -14.513 74.554   1.00 77.80  ? 460  LYS D CG    1 
ATOM   5605  C  CD    . LYS C  3  44  ? 14.732   -13.328 74.923   1.00 75.61  ? 460  LYS D CD    1 
ATOM   5606  C  CE    . LYS C  3  44  ? 13.374   -13.352 74.254   1.00 76.41  ? 460  LYS D CE    1 
ATOM   5607  N  NZ    . LYS C  3  44  ? 12.421   -14.255 74.942   1.00 80.26  ? 460  LYS D NZ    1 
ATOM   5608  N  N     . ILE C  3  45  ? 19.626   -12.101 75.323   1.00 83.42  ? 461  ILE D N     1 
ATOM   5609  C  CA    . ILE C  3  45  ? 20.976   -11.835 75.899   1.00 87.30  ? 461  ILE D CA    1 
ATOM   5610  C  C     . ILE C  3  45  ? 20.894   -12.229 77.383   1.00 83.50  ? 461  ILE D C     1 
ATOM   5611  O  O     . ILE C  3  45  ? 19.759   -12.330 77.912   1.00 78.63  ? 461  ILE D O     1 
ATOM   5612  C  CB    . ILE C  3  45  ? 21.451   -10.370 75.698   1.00 86.67  ? 461  ILE D CB    1 
ATOM   5613  C  CG1   . ILE C  3  45  ? 20.871   -9.451  76.778   1.00 85.31  ? 461  ILE D CG1   1 
ATOM   5614  C  CG2   . ILE C  3  45  ? 21.256   -9.804  74.291   1.00 85.50  ? 461  ILE D CG2   1 
ATOM   5615  C  CD1   . ILE C  3  45  ? 21.795   -8.323  77.192   1.00 84.97  ? 461  ILE D CD1   1 
ATOM   5616  N  N     . LEU C  3  46  ? 22.045   -12.438 78.023   1.00 75.55  ? 462  LEU D N     1 
ATOM   5617  C  CA    . LEU C  3  46  ? 22.162   -12.843 79.447   1.00 74.15  ? 462  LEU D CA    1 
ATOM   5618  C  C     . LEU C  3  46  ? 21.467   -11.800 80.339   1.00 78.81  ? 462  LEU D C     1 
ATOM   5619  O  O     . LEU C  3  46  ? 21.695   -10.585 80.146   1.00 66.37  ? 462  LEU D O     1 
ATOM   5620  C  CB    . LEU C  3  46  ? 23.653   -12.971 79.760   1.00 73.08  ? 462  LEU D CB    1 
ATOM   5621  C  CG    . LEU C  3  46  ? 24.013   -13.685 81.057   1.00 76.65  ? 462  LEU D CG    1 
ATOM   5622  C  CD1   . LEU C  3  46  ? 23.551   -15.139 81.049   1.00 73.84  ? 462  LEU D CD1   1 
ATOM   5623  C  CD2   . LEU C  3  46  ? 25.523   -13.598 81.305   1.00 82.76  ? 462  LEU D CD2   1 
ATOM   5624  N  N     . ASN C  3  47  ? 20.621   -12.252 81.273   1.00 82.72  ? 463  ASN D N     1 
ATOM   5625  C  CA    . ASN C  3  47  ? 20.035   -11.393 82.336   1.00 73.74  ? 463  ASN D CA    1 
ATOM   5626  C  C     . ASN C  3  47  ? 21.112   -11.191 83.406   1.00 72.01  ? 463  ASN D C     1 
ATOM   5627  O  O     . ASN C  3  47  ? 21.265   -12.099 84.252   1.00 84.57  ? 463  ASN D O     1 
ATOM   5628  C  CB    . ASN C  3  47  ? 18.766   -11.998 82.943   1.00 72.27  ? 463  ASN D CB    1 
ATOM   5629  C  CG    . ASN C  3  47  ? 18.152   -11.112 84.006   1.00 75.47  ? 463  ASN D CG    1 
ATOM   5630  O  OD1   . ASN C  3  47  ? 18.795   -10.189 84.491   1.00 76.97  ? 463  ASN D OD1   1 
ATOM   5631  N  ND2   . ASN C  3  47  ? 16.906   -11.376 84.371   1.00 80.18  ? 463  ASN D ND2   1 
ATOM   5632  N  N     . VAL C  3  48  ? 21.821   -10.052 83.357   1.00 68.48  ? 464  VAL D N     1 
ATOM   5633  C  CA    . VAL C  3  48  ? 23.002   -9.735  84.226   1.00 60.12  ? 464  VAL D CA    1 
ATOM   5634  C  C     . VAL C  3  48  ? 22.572   -9.583  85.691   1.00 54.84  ? 464  VAL D C     1 
ATOM   5635  O  O     . VAL C  3  48  ? 23.438   -9.752  86.562   1.00 44.62  ? 464  VAL D O     1 
ATOM   5636  C  CB    . VAL C  3  48  ? 23.770   -8.483  83.740   1.00 58.48  ? 464  VAL D CB    1 
ATOM   5637  C  CG1   . VAL C  3  48  ? 24.428   -8.717  82.392   1.00 57.01  ? 464  VAL D CG1   1 
ATOM   5638  C  CG2   . VAL C  3  48  ? 22.904   -7.223  83.705   1.00 55.93  ? 464  VAL D CG2   1 
ATOM   5639  N  N     . GLU C  3  49  ? 21.295   -9.269  85.946   1.00 61.92  ? 465  GLU D N     1 
ATOM   5640  C  CA    . GLU C  3  49  ? 20.697   -9.127  87.305   1.00 70.36  ? 465  GLU D CA    1 
ATOM   5641  C  C     . GLU C  3  49  ? 20.668   -10.490 88.013   1.00 70.80  ? 465  GLU D C     1 
ATOM   5642  O  O     . GLU C  3  49  ? 20.802   -10.491 89.249   1.00 68.05  ? 465  GLU D O     1 
ATOM   5643  C  CB    . GLU C  3  49  ? 19.285   -8.543  87.202   1.00 78.57  ? 465  GLU D CB    1 
ATOM   5644  C  CG    . GLU C  3  49  ? 18.725   -8.041  88.520   1.00 86.87  ? 465  GLU D CG    1 
ATOM   5645  C  CD    . GLU C  3  49  ? 19.308   -6.728  89.023   1.00 96.10  ? 465  GLU D CD    1 
ATOM   5646  O  OE1   . GLU C  3  49  ? 20.290   -6.253  88.427   1.00 108.39 ? 465  GLU D OE1   1 
ATOM   5647  O  OE2   . GLU C  3  49  ? 18.814   -6.211  90.048   1.00 99.95  ? 465  GLU D OE2   1 
ATOM   5648  N  N     . LYS C  3  50  ? 20.492   -11.590 87.266   1.00 70.56  ? 466  LYS D N     1 
ATOM   5649  C  CA    . LYS C  3  50  ? 20.409   -12.981 87.794   1.00 64.73  ? 466  LYS D CA    1 
ATOM   5650  C  C     . LYS C  3  50  ? 21.765   -13.685 87.688   1.00 66.83  ? 466  LYS D C     1 
ATOM   5651  O  O     . LYS C  3  50  ? 22.047   -14.528 88.544   1.00 66.49  ? 466  LYS D O     1 
ATOM   5652  C  CB    . LYS C  3  50  ? 19.372   -13.810 87.028   1.00 63.68  ? 466  LYS D CB    1 
ATOM   5653  C  CG    . LYS C  3  50  ? 17.919   -13.494 87.341   1.00 65.98  ? 466  LYS D CG    1 
ATOM   5654  C  CD    . LYS C  3  50  ? 16.905   -14.253 86.511   1.00 66.54  ? 466  LYS D CD    1 
ATOM   5655  C  CE    . LYS C  3  50  ? 15.499   -13.716 86.702   1.00 71.28  ? 466  LYS D CE    1 
ATOM   5656  N  NZ    . LYS C  3  50  ? 14.482   -14.539 85.993   1.00 68.82  ? 466  LYS D NZ    1 
ATOM   5657  N  N     . ALA C  3  51  ? 22.552   -13.394 86.649   1.00 79.22  ? 467  ALA D N     1 
ATOM   5658  C  CA    . ALA C  3  51  ? 23.801   -14.121 86.314   1.00 78.16  ? 467  ALA D CA    1 
ATOM   5659  C  C     . ALA C  3  51  ? 24.930   -13.665 87.243   1.00 76.29  ? 467  ALA D C     1 
ATOM   5660  O  O     . ALA C  3  51  ? 24.890   -12.495 87.678   1.00 70.37  ? 467  ALA D O     1 
ATOM   5661  C  CB    . ALA C  3  51  ? 24.168   -13.895 84.874   1.00 75.21  ? 467  ALA D CB    1 
ATOM   5662  N  N     . ARG C  3  52  ? 25.882   -14.567 87.516   1.00 74.23  ? 468  ARG D N     1 
ATOM   5663  C  CA    . ARG C  3  52  ? 27.139   -14.307 88.274   1.00 73.84  ? 468  ARG D CA    1 
ATOM   5664  C  C     . ARG C  3  52  ? 28.144   -13.585 87.361   1.00 72.96  ? 468  ARG D C     1 
ATOM   5665  O  O     . ARG C  3  52  ? 28.097   -13.825 86.139   1.00 85.01  ? 468  ARG D O     1 
ATOM   5666  C  CB    . ARG C  3  52  ? 27.714   -15.620 88.823   1.00 68.73  ? 468  ARG D CB    1 
ATOM   5667  N  N     . LEU C  3  53  ? 29.024   -12.755 87.939   1.00 71.42  ? 469  LEU D N     1 
ATOM   5668  C  CA    . LEU C  3  53  ? 29.947   -11.843 87.208   1.00 74.17  ? 469  LEU D CA    1 
ATOM   5669  C  C     . LEU C  3  53  ? 30.883   -12.648 86.293   1.00 75.87  ? 469  LEU D C     1 
ATOM   5670  O  O     . LEU C  3  53  ? 31.145   -12.172 85.178   1.00 82.69  ? 469  LEU D O     1 
ATOM   5671  C  CB    . LEU C  3  53  ? 30.748   -11.001 88.207   1.00 75.28  ? 469  LEU D CB    1 
ATOM   5672  C  CG    . LEU C  3  53  ? 31.749   -10.028 87.582   1.00 79.43  ? 469  LEU D CG    1 
ATOM   5673  C  CD1   . LEU C  3  53  ? 31.036   -8.948  86.773   1.00 81.71  ? 469  LEU D CD1   1 
ATOM   5674  C  CD2   . LEU C  3  53  ? 32.653   -9.424  88.647   1.00 80.26  ? 469  LEU D CD2   1 
ATOM   5675  N  N     . ASP C  3  54  ? 31.377   -13.808 86.746   1.00 77.12  ? 470  ASP D N     1 
ATOM   5676  C  CA    . ASP C  3  54  ? 32.244   -14.712 85.943   1.00 79.29  ? 470  ASP D CA    1 
ATOM   5677  C  C     . ASP C  3  54  ? 31.593   -14.982 84.577   1.00 71.93  ? 470  ASP D C     1 
ATOM   5678  O  O     . ASP C  3  54  ? 32.286   -14.802 83.551   1.00 54.61  ? 470  ASP D O     1 
ATOM   5679  C  CB    . ASP C  3  54  ? 32.492   -16.037 86.686   1.00 86.89  ? 470  ASP D CB    1 
ATOM   5680  C  CG    . ASP C  3  54  ? 33.520   -16.958 86.043   1.00 90.21  ? 470  ASP D CG    1 
ATOM   5681  O  OD1   . ASP C  3  54  ? 34.494   -16.429 85.443   1.00 89.82  ? 470  ASP D OD1   1 
ATOM   5682  O  OD2   . ASP C  3  54  ? 33.325   -18.197 86.109   1.00 92.34  ? 470  ASP D OD2   1 
ATOM   5683  N  N     . ARG C  3  55  ? 30.324   -15.413 84.578   1.00 70.47  ? 471  ARG D N     1 
ATOM   5684  C  CA    . ARG C  3  55  ? 29.524   -15.791 83.376   1.00 63.58  ? 471  ARG D CA    1 
ATOM   5685  C  C     . ARG C  3  55  ? 29.339   -14.561 82.476   1.00 67.47  ? 471  ARG D C     1 
ATOM   5686  O  O     . ARG C  3  55  ? 29.512   -14.702 81.246   1.00 78.05  ? 471  ARG D O     1 
ATOM   5687  C  CB    . ARG C  3  55  ? 28.171   -16.377 83.794   1.00 50.50  ? 471  ARG D CB    1 
ATOM   5688  N  N     . ILE C  3  56  ? 29.027   -13.405 83.077   1.00 66.34  ? 472  ILE D N     1 
ATOM   5689  C  CA    . ILE C  3  56  ? 28.740   -12.119 82.370   1.00 63.77  ? 472  ILE D CA    1 
ATOM   5690  C  C     . ILE C  3  56  ? 29.959   -11.728 81.527   1.00 63.60  ? 472  ILE D C     1 
ATOM   5691  O  O     . ILE C  3  56  ? 29.780   -11.453 80.332   1.00 55.50  ? 472  ILE D O     1 
ATOM   5692  C  CB    . ILE C  3  56  ? 28.344   -11.013 83.374   1.00 66.66  ? 472  ILE D CB    1 
ATOM   5693  C  CG1   . ILE C  3  56  ? 27.023   -11.329 84.073   1.00 62.32  ? 472  ILE D CG1   1 
ATOM   5694  C  CG2   . ILE C  3  56  ? 28.303   -9.650  82.694   1.00 74.74  ? 472  ILE D CG2   1 
ATOM   5695  C  CD1   . ILE C  3  56  ? 26.679   -10.365 85.180   1.00 64.01  ? 472  ILE D CD1   1 
ATOM   5696  N  N     . LEU C  3  57  ? 31.154   -11.726 82.118   1.00 72.09  ? 473  LEU D N     1 
ATOM   5697  C  CA    . LEU C  3  57  ? 32.402   -11.260 81.453   1.00 78.65  ? 473  LEU D CA    1 
ATOM   5698  C  C     . LEU C  3  57  ? 32.845   -12.274 80.389   1.00 80.49  ? 473  LEU D C     1 
ATOM   5699  O  O     . LEU C  3  57  ? 33.541   -11.850 79.460   1.00 81.92  ? 473  LEU D O     1 
ATOM   5700  C  CB    . LEU C  3  57  ? 33.497   -11.043 82.503   1.00 86.14  ? 473  LEU D CB    1 
ATOM   5701  C  CG    . LEU C  3  57  ? 33.168   -10.043 83.612   1.00 87.59  ? 473  LEU D CG    1 
ATOM   5702  C  CD1   . LEU C  3  57  ? 34.312   -9.956  84.616   1.00 85.81  ? 473  LEU D CD1   1 
ATOM   5703  C  CD2   . LEU C  3  57  ? 32.848   -8.674  83.045   1.00 88.98  ? 473  LEU D CD2   1 
ATOM   5704  N  N     . ASN C  3  58  ? 32.452   -13.550 80.520   1.00 87.54  ? 474  ASN D N     1 
ATOM   5705  C  CA    . ASN C  3  58  ? 32.794   -14.642 79.563   1.00 84.90  ? 474  ASN D CA    1 
ATOM   5706  C  C     . ASN C  3  58  ? 31.761   -14.721 78.431   1.00 80.99  ? 474  ASN D C     1 
ATOM   5707  O  O     . ASN C  3  58  ? 32.099   -15.323 77.393   1.00 89.65  ? 474  ASN D O     1 
ATOM   5708  C  CB    . ASN C  3  58  ? 32.961   -15.988 80.273   1.00 84.59  ? 474  ASN D CB    1 
ATOM   5709  C  CG    . ASN C  3  58  ? 34.265   -16.047 81.036   1.00 84.06  ? 474  ASN D CG    1 
ATOM   5710  O  OD1   . ASN C  3  58  ? 35.218   -15.351 80.695   1.00 80.38  ? 474  ASN D OD1   1 
ATOM   5711  N  ND2   . ASN C  3  58  ? 34.323   -16.867 82.068   1.00 85.09  ? 474  ASN D ND2   1 
ATOM   5712  N  N     . ASN C  3  59  ? 30.563   -14.143 78.608   1.00 71.15  ? 475  ASN D N     1 
ATOM   5713  C  CA    . ASN C  3  59  ? 29.470   -14.104 77.591   1.00 69.48  ? 475  ASN D CA    1 
ATOM   5714  C  C     . ASN C  3  59  ? 29.985   -13.380 76.340   1.00 69.49  ? 475  ASN D C     1 
ATOM   5715  O  O     . ASN C  3  59  ? 30.559   -12.281 76.492   1.00 79.35  ? 475  ASN D O     1 
ATOM   5716  C  CB    . ASN C  3  59  ? 28.206   -13.425 78.134   1.00 69.07  ? 475  ASN D CB    1 
ATOM   5717  C  CG    . ASN C  3  59  ? 27.008   -13.533 77.212   1.00 64.99  ? 475  ASN D CG    1 
ATOM   5718  O  OD1   . ASN C  3  59  ? 26.975   -12.927 76.143   1.00 59.47  ? 475  ASN D OD1   1 
ATOM   5719  N  ND2   . ASN C  3  59  ? 25.997   -14.278 77.634   1.00 60.35  ? 475  ASN D ND2   1 
ATOM   5720  N  N     . ASN C  3  60  ? 29.767   -13.972 75.160   1.00 65.37  ? 476  ASN D N     1 
ATOM   5721  C  CA    . ASN C  3  60  ? 30.306   -13.498 73.857   1.00 64.97  ? 476  ASN D CA    1 
ATOM   5722  C  C     . ASN C  3  60  ? 29.528   -12.242 73.397   1.00 69.68  ? 476  ASN D C     1 
ATOM   5723  O  O     . ASN C  3  60  ? 30.175   -11.308 72.898   1.00 66.45  ? 476  ASN D O     1 
ATOM   5724  C  CB    . ASN C  3  60  ? 30.349   -14.650 72.842   1.00 56.42  ? 476  ASN D CB    1 
ATOM   5725  N  N     . GLU C  3  61  ? 28.203   -12.186 73.588   1.00 79.56  ? 477  GLU D N     1 
ATOM   5726  C  CA    . GLU C  3  61  ? 27.350   -11.015 73.212   1.00 84.42  ? 477  GLU D CA    1 
ATOM   5727  C  C     . GLU C  3  61  ? 27.650   -9.811  74.115   1.00 89.49  ? 477  GLU D C     1 
ATOM   5728  O  O     . GLU C  3  61  ? 27.693   -8.676  73.584   1.00 99.14  ? 477  GLU D O     1 
ATOM   5729  C  CB    . GLU C  3  61  ? 25.857   -11.371 73.258   1.00 90.58  ? 477  GLU D CB    1 
ATOM   5730  C  CG    . GLU C  3  61  ? 25.295   -11.787 71.910   1.00 94.02  ? 477  GLU D CG    1 
ATOM   5731  C  CD    . GLU C  3  61  ? 26.185   -12.732 71.125   1.00 102.53 ? 477  GLU D CD    1 
ATOM   5732  O  OE1   . GLU C  3  61  ? 26.566   -13.783 71.682   1.00 109.57 ? 477  GLU D OE1   1 
ATOM   5733  O  OE2   . GLU C  3  61  ? 26.505   -12.413 69.960   1.00 111.13 ? 477  GLU D OE2   1 
ATOM   5734  N  N     . ILE C  3  62  ? 27.833   -10.032 75.421   1.00 87.58  ? 478  ILE D N     1 
ATOM   5735  C  CA    . ILE C  3  62  ? 28.220   -8.962  76.392   1.00 90.06  ? 478  ILE D CA    1 
ATOM   5736  C  C     . ILE C  3  62  ? 29.602   -8.420  75.994   1.00 89.94  ? 478  ILE D C     1 
ATOM   5737  O  O     . ILE C  3  62  ? 29.771   -7.190  75.983   1.00 91.46  ? 478  ILE D O     1 
ATOM   5738  C  CB    . ILE C  3  62  ? 28.202   -9.476  77.842   1.00 90.44  ? 478  ILE D CB    1 
ATOM   5739  C  CG1   . ILE C  3  62  ? 26.797   -9.897  78.289   1.00 85.56  ? 478  ILE D CG1   1 
ATOM   5740  C  CG2   . ILE C  3  62  ? 28.799   -8.432  78.783   1.00 97.03  ? 478  ILE D CG2   1 
ATOM   5741  C  CD1   . ILE C  3  62  ? 25.830   -8.738  78.470   1.00 81.11  ? 478  ILE D CD1   1 
ATOM   5742  N  N     . ARG C  3  63  ? 30.544   -9.306  75.672   1.00 89.13  ? 479  ARG D N     1 
ATOM   5743  C  CA    . ARG C  3  63  ? 31.927   -8.937  75.264   1.00 86.50  ? 479  ARG D CA    1 
ATOM   5744  C  C     . ARG C  3  63  ? 31.882   -8.051  74.004   1.00 88.25  ? 479  ARG D C     1 
ATOM   5745  O  O     . ARG C  3  63  ? 32.546   -6.994  74.004   1.00 101.95 ? 479  ARG D O     1 
ATOM   5746  C  CB    . ARG C  3  63  ? 32.776   -10.210 75.117   1.00 83.53  ? 479  ARG D CB    1 
ATOM   5747  C  CG    . ARG C  3  63  ? 34.261   -10.013 74.843   1.00 87.71  ? 479  ARG D CG    1 
ATOM   5748  C  CD    . ARG C  3  63  ? 34.988   -9.065  75.786   1.00 101.88 ? 479  ARG D CD    1 
ATOM   5749  N  NE    . ARG C  3  63  ? 34.736   -9.352  77.189   1.00 109.35 ? 479  ARG D NE    1 
ATOM   5750  C  CZ    . ARG C  3  63  ? 34.867   -8.480  78.190   1.00 110.03 ? 479  ARG D CZ    1 
ATOM   5751  N  NH1   . ARG C  3  63  ? 35.248   -7.236  77.953   1.00 105.14 ? 479  ARG D NH1   1 
ATOM   5752  N  NH2   . ARG C  3  63  ? 34.581   -8.853  79.427   1.00 109.85 ? 479  ARG D NH2   1 
ATOM   5753  N  N     A GLN C  3  64  ? 31.124   -8.444  72.976   0.50 87.70  ? 480  GLN D N     1 
ATOM   5754  N  N     B GLN C  3  64  ? 31.124   -8.445  72.975   0.50 86.24  ? 480  GLN D N     1 
ATOM   5755  C  CA    A GLN C  3  64  ? 31.069   -7.711  71.681   0.50 88.29  ? 480  GLN D CA    1 
ATOM   5756  C  CA    B GLN C  3  64  ? 31.069   -7.718  71.675   0.50 85.92  ? 480  GLN D CA    1 
ATOM   5757  C  C     A GLN C  3  64  ? 30.552   -6.285  71.916   0.50 95.36  ? 480  GLN D C     1 
ATOM   5758  C  C     B GLN C  3  64  ? 30.553   -6.287  71.916   0.50 93.88  ? 480  GLN D C     1 
ATOM   5759  O  O     A GLN C  3  64  ? 31.065   -5.363  71.253   0.50 104.24 ? 480  GLN D O     1 
ATOM   5760  O  O     B GLN C  3  64  ? 31.065   -5.363  71.253   0.50 102.76 ? 480  GLN D O     1 
ATOM   5761  C  CB    A GLN C  3  64  ? 30.206   -8.442  70.650   0.50 84.77  ? 480  GLN D CB    1 
ATOM   5762  C  CB    B GLN C  3  64  ? 30.174   -8.419  70.642   0.50 80.81  ? 480  GLN D CB    1 
ATOM   5763  C  CG    A GLN C  3  64  ? 30.846   -9.728  70.137   0.50 81.22  ? 480  GLN D CG    1 
ATOM   5764  C  CG    B GLN C  3  64  ? 30.609   -9.777  70.111   0.50 76.37  ? 480  GLN D CG    1 
ATOM   5765  C  CD    A GLN C  3  64  ? 30.879   -9.784  68.628   0.50 80.10  ? 480  GLN D CD    1 
ATOM   5766  C  CD    B GLN C  3  64  ? 31.929   -9.829  69.398   0.50 72.72  ? 480  GLN D CD    1 
ATOM   5767  O  OE1   A GLN C  3  64  ? 29.967   -9.314  67.950   0.50 76.43  ? 480  GLN D OE1   1 
ATOM   5768  O  OE1   B GLN C  3  64  ? 32.288   -8.920  68.652   0.50 71.55  ? 480  GLN D OE1   1 
ATOM   5769  N  NE2   A GLN C  3  64  ? 31.943   -10.355 68.088   0.50 78.18  ? 480  GLN D NE2   1 
ATOM   5770  N  NE2   B GLN C  3  64  ? 32.632   -10.936 69.566   0.50 68.58  ? 480  GLN D NE2   1 
ATOM   5771  N  N     . MET C  3  65  ? 29.586   -6.111  72.824   1.00 94.21  ? 481  MET D N     1 
ATOM   5772  C  CA    . MET C  3  65  ? 28.966   -4.788  73.107   1.00 92.98  ? 481  MET D CA    1 
ATOM   5773  C  C     . MET C  3  65  ? 29.983   -3.887  73.816   1.00 89.40  ? 481  MET D C     1 
ATOM   5774  O  O     . MET C  3  65  ? 30.120   -2.708  73.410   1.00 104.63 ? 481  MET D O     1 
ATOM   5775  C  CB    . MET C  3  65  ? 27.701   -4.920  73.964   1.00 92.47  ? 481  MET D CB    1 
ATOM   5776  C  CG    . MET C  3  65  ? 26.452   -5.230  73.152   1.00 95.75  ? 481  MET D CG    1 
ATOM   5777  S  SD    . MET C  3  65  ? 24.920   -5.051  74.076   1.00 106.38 ? 481  MET D SD    1 
ATOM   5778  C  CE    . MET C  3  65  ? 25.181   -6.217  75.414   1.00 101.50 ? 481  MET D CE    1 
ATOM   5779  N  N     . ILE C  3  66  ? 30.677   -4.427  74.819   1.00 77.77  ? 482  ILE D N     1 
ATOM   5780  C  CA    . ILE C  3  66  ? 31.765   -3.722  75.559   1.00 80.67  ? 482  ILE D CA    1 
ATOM   5781  C  C     . ILE C  3  66  ? 32.834   -3.276  74.548   1.00 78.07  ? 482  ILE D C     1 
ATOM   5782  O  O     . ILE C  3  66  ? 33.238   -2.097  74.601   1.00 85.46  ? 482  ILE D O     1 
ATOM   5783  C  CB    . ILE C  3  66  ? 32.326   -4.621  76.682   1.00 81.45  ? 482  ILE D CB    1 
ATOM   5784  C  CG1   . ILE C  3  66  ? 31.297   -4.803  77.805   1.00 83.39  ? 482  ILE D CG1   1 
ATOM   5785  C  CG2   . ILE C  3  66  ? 33.647   -4.082  77.216   1.00 82.42  ? 482  ILE D CG2   1 
ATOM   5786  C  CD1   . ILE C  3  66  ? 31.606   -5.953  78.737   1.00 83.42  ? 482  ILE D CD1   1 
ATOM   5787  N  N     . THR C  3  67  ? 33.265   -4.171  73.654   1.00 74.35  ? 483  THR D N     1 
ATOM   5788  C  CA    . THR C  3  67  ? 34.334   -3.903  72.651   1.00 78.10  ? 483  THR D CA    1 
ATOM   5789  C  C     . THR C  3  67  ? 33.880   -2.777  71.712   1.00 86.44  ? 483  THR D C     1 
ATOM   5790  O  O     . THR C  3  67  ? 34.703   -1.886  71.420   1.00 82.81  ? 483  THR D O     1 
ATOM   5791  C  CB    . THR C  3  67  ? 34.701   -5.165  71.857   1.00 76.59  ? 483  THR D CB    1 
ATOM   5792  O  OG1   . THR C  3  67  ? 35.047   -6.189  72.786   1.00 76.17  ? 483  THR D OG1   1 
ATOM   5793  C  CG2   . THR C  3  67  ? 35.849   -4.957  70.893   1.00 76.84  ? 483  THR D CG2   1 
ATOM   5794  N  N     . ALA C  3  68  ? 32.624   -2.831  71.259   1.00 89.61  ? 484  ALA D N     1 
ATOM   5795  C  CA    . ALA C  3  68  ? 32.034   -1.902  70.266   1.00 85.25  ? 484  ALA D CA    1 
ATOM   5796  C  C     . ALA C  3  68  ? 32.001   -0.480  70.838   1.00 84.04  ? 484  ALA D C     1 
ATOM   5797  O  O     . ALA C  3  68  ? 32.384   0.456   70.101   1.00 87.59  ? 484  ALA D O     1 
ATOM   5798  C  CB    . ALA C  3  68  ? 30.649   -2.367  69.878   1.00 83.75  ? 484  ALA D CB    1 
ATOM   5799  N  N     . PHE C  3  69  ? 31.566   -0.335  72.096   1.00 81.41  ? 485  PHE D N     1 
ATOM   5800  C  CA    . PHE C  3  69  ? 31.419   0.970   72.794   1.00 81.54  ? 485  PHE D CA    1 
ATOM   5801  C  C     . PHE C  3  69  ? 32.803   1.506   73.198   1.00 80.14  ? 485  PHE D C     1 
ATOM   5802  O  O     . PHE C  3  69  ? 33.008   2.745   73.157   1.00 66.97  ? 485  PHE D O     1 
ATOM   5803  C  CB    . PHE C  3  69  ? 30.490   0.837   74.006   1.00 81.69  ? 485  PHE D CB    1 
ATOM   5804  C  CG    . PHE C  3  69  ? 29.108   0.280   73.742   1.00 76.18  ? 485  PHE D CG    1 
ATOM   5805  C  CD1   . PHE C  3  69  ? 28.467   0.444   72.521   1.00 76.82  ? 485  PHE D CD1   1 
ATOM   5806  C  CD2   . PHE C  3  69  ? 28.422   -0.379  74.748   1.00 67.60  ? 485  PHE D CD2   1 
ATOM   5807  C  CE1   . PHE C  3  69  ? 27.189   -0.055  72.313   1.00 70.63  ? 485  PHE D CE1   1 
ATOM   5808  C  CE2   . PHE C  3  69  ? 27.149   -0.878  74.540   1.00 66.56  ? 485  PHE D CE2   1 
ATOM   5809  C  CZ    . PHE C  3  69  ? 26.529   -0.707  73.325   1.00 66.81  ? 485  PHE D CZ    1 
ATOM   5810  N  N     . GLY C  3  70  ? 33.715   0.599   73.582   1.00 83.67  ? 486  GLY D N     1 
ATOM   5811  C  CA    . GLY C  3  70  ? 35.106   0.894   73.986   1.00 87.47  ? 486  GLY D CA    1 
ATOM   5812  C  C     . GLY C  3  70  ? 35.202   1.734   75.258   1.00 93.06  ? 486  GLY D C     1 
ATOM   5813  O  O     . GLY C  3  70  ? 36.200   2.474   75.391   1.00 92.03  ? 486  GLY D O     1 
ATOM   5814  N  N     . THR C  3  71  ? 34.225   1.625   76.168   1.00 94.50  ? 487  THR D N     1 
ATOM   5815  C  CA    . THR C  3  71  ? 34.162   2.417   77.429   1.00 92.15  ? 487  THR D CA    1 
ATOM   5816  C  C     . THR C  3  71  ? 34.636   1.582   78.626   1.00 97.04  ? 487  THR D C     1 
ATOM   5817  O  O     . THR C  3  71  ? 34.976   2.201   79.653   1.00 119.51 ? 487  THR D O     1 
ATOM   5818  C  CB    . THR C  3  71  ? 32.749   2.940   77.722   1.00 90.31  ? 487  THR D CB    1 
ATOM   5819  O  OG1   . THR C  3  71  ? 31.889   1.825   77.930   1.00 88.05  ? 487  THR D OG1   1 
ATOM   5820  C  CG2   . THR C  3  71  ? 32.192   3.802   76.612   1.00 95.65  ? 487  THR D CG2   1 
ATOM   5821  N  N     . GLY C  3  72  ? 34.650   0.247   78.513   1.00 93.42  ? 488  GLY D N     1 
ATOM   5822  C  CA    . GLY C  3  72  ? 34.839   -0.664  79.664   1.00 89.88  ? 488  GLY D CA    1 
ATOM   5823  C  C     . GLY C  3  72  ? 33.637   -0.614  80.595   1.00 91.71  ? 488  GLY D C     1 
ATOM   5824  O  O     . GLY C  3  72  ? 32.645   0.059   80.240   1.00 99.55  ? 488  GLY D O     1 
ATOM   5825  N  N     . ILE C  3  73  ? 33.702   -1.274  81.755   1.00 90.89  ? 489  ILE D N     1 
ATOM   5826  C  CA    . ILE C  3  73  ? 32.499   -1.511  82.615   1.00 98.50  ? 489  ILE D CA    1 
ATOM   5827  C  C     . ILE C  3  73  ? 32.796   -1.175  84.084   1.00 96.74  ? 489  ILE D C     1 
ATOM   5828  O  O     . ILE C  3  73  ? 33.975   -1.245  84.493   1.00 92.18  ? 489  ILE D O     1 
ATOM   5829  C  CB    . ILE C  3  73  ? 31.999   -2.966  82.448   1.00 96.85  ? 489  ILE D CB    1 
ATOM   5830  C  CG1   . ILE C  3  73  ? 33.145   -3.981  82.526   1.00 96.89  ? 489  ILE D CG1   1 
ATOM   5831  C  CG2   . ILE C  3  73  ? 31.210   -3.119  81.160   1.00 88.72  ? 489  ILE D CG2   1 
ATOM   5832  C  CD1   . ILE C  3  73  ? 32.732   -5.320  83.065   1.00 97.93  ? 489  ILE D CD1   1 
ATOM   5833  N  N     . GLY C  3  74  ? 31.740   -0.831  84.835   1.00 92.25  ? 490  GLY D N     1 
ATOM   5834  C  CA    . GLY C  3  74  ? 31.758   -0.611  86.295   1.00 93.99  ? 490  GLY D CA    1 
ATOM   5835  C  C     . GLY C  3  74  ? 32.601   0.599   86.674   1.00 102.35 ? 490  GLY D C     1 
ATOM   5836  O  O     . GLY C  3  74  ? 32.282   1.719   86.202   1.00 103.19 ? 490  GLY D O     1 
ATOM   5837  N  N     . GLY C  3  75  ? 33.637   0.374   87.493   1.00 108.33 ? 491  GLY D N     1 
ATOM   5838  C  CA    . GLY C  3  75  ? 34.601   1.393   87.951   1.00 109.86 ? 491  GLY D CA    1 
ATOM   5839  C  C     . GLY C  3  75  ? 35.452   1.922   86.808   1.00 113.99 ? 491  GLY D C     1 
ATOM   5840  O  O     . GLY C  3  75  ? 35.619   3.160   86.744   1.00 121.75 ? 491  GLY D O     1 
ATOM   5841  N  N     . ASP C  3  76  ? 35.946   1.038   85.925   1.00 107.13 ? 492  ASP D N     1 
ATOM   5842  C  CA    . ASP C  3  76  ? 36.826   1.393   84.774   1.00 100.08 ? 492  ASP D CA    1 
ATOM   5843  C  C     . ASP C  3  76  ? 36.029   2.049   83.635   1.00 96.23  ? 492  ASP D C     1 
ATOM   5844  O  O     . ASP C  3  76  ? 36.674   2.414   82.621   1.00 94.78  ? 492  ASP D O     1 
ATOM   5845  C  CB    . ASP C  3  76  ? 37.564   0.176   84.207   1.00 93.75  ? 492  ASP D CB    1 
ATOM   5846  C  CG    . ASP C  3  76  ? 38.431   -0.533  85.224   1.00 92.88  ? 492  ASP D CG    1 
ATOM   5847  O  OD1   . ASP C  3  76  ? 38.167   -0.393  86.432   1.00 88.44  ? 492  ASP D OD1   1 
ATOM   5848  O  OD2   . ASP C  3  76  ? 39.385   -1.222  84.790   1.00 86.01  ? 492  ASP D OD2   1 
ATOM   5849  N  N     . PHE C  3  77  ? 34.701   2.184   83.765   1.00 88.77  ? 493  PHE D N     1 
ATOM   5850  C  CA    . PHE C  3  77  ? 33.855   2.851   82.740   1.00 83.74  ? 493  PHE D CA    1 
ATOM   5851  C  C     . PHE C  3  77  ? 34.354   4.290   82.556   1.00 75.78  ? 493  PHE D C     1 
ATOM   5852  O  O     . PHE C  3  77  ? 34.508   5.000   83.564   1.00 71.77  ? 493  PHE D O     1 
ATOM   5853  C  CB    . PHE C  3  77  ? 32.362   2.814   83.089   1.00 87.26  ? 493  PHE D CB    1 
ATOM   5854  C  CG    . PHE C  3  77  ? 31.516   3.563   82.088   1.00 89.33  ? 493  PHE D CG    1 
ATOM   5855  C  CD1   . PHE C  3  77  ? 31.272   4.920   82.246   1.00 94.98  ? 493  PHE D CD1   1 
ATOM   5856  C  CD2   . PHE C  3  77  ? 31.022   2.933   80.956   1.00 91.22  ? 493  PHE D CD2   1 
ATOM   5857  C  CE1   . PHE C  3  77  ? 30.530   5.622   81.310   1.00 102.94 ? 493  PHE D CE1   1 
ATOM   5858  C  CE2   . PHE C  3  77  ? 30.277   3.636   80.020   1.00 102.53 ? 493  PHE D CE2   1 
ATOM   5859  C  CZ    . PHE C  3  77  ? 30.026   4.978   80.206   1.00 106.14 ? 493  PHE D CZ    1 
ATOM   5860  N  N     . ASP C  3  78  ? 34.597   4.685   81.303   1.00 74.10  ? 494  ASP D N     1 
ATOM   5861  C  CA    . ASP C  3  78  ? 35.119   6.018   80.896   1.00 72.40  ? 494  ASP D CA    1 
ATOM   5862  C  C     . ASP C  3  78  ? 34.242   6.574   79.765   1.00 70.82  ? 494  ASP D C     1 
ATOM   5863  O  O     . ASP C  3  78  ? 34.400   6.101   78.612   1.00 61.83  ? 494  ASP D O     1 
ATOM   5864  C  CB    . ASP C  3  78  ? 36.588   5.898   80.476   1.00 74.21  ? 494  ASP D CB    1 
ATOM   5865  C  CG    . ASP C  3  78  ? 37.208   7.186   79.965   1.00 76.11  ? 494  ASP D CG    1 
ATOM   5866  O  OD1   . ASP C  3  78  ? 36.518   8.229   79.999   1.00 88.11  ? 494  ASP D OD1   1 
ATOM   5867  O  OD2   . ASP C  3  78  ? 38.378   7.137   79.536   1.00 68.67  ? 494  ASP D OD2   1 
ATOM   5868  N  N     . LEU C  3  79  ? 33.382   7.555   80.071   1.00 80.41  ? 495  LEU D N     1 
ATOM   5869  C  CA    . LEU C  3  79  ? 32.377   8.120   79.122   1.00 87.78  ? 495  LEU D CA    1 
ATOM   5870  C  C     . LEU C  3  79  ? 33.074   8.774   77.918   1.00 89.09  ? 495  LEU D C     1 
ATOM   5871  O  O     . LEU C  3  79  ? 32.459   8.801   76.837   1.00 83.56  ? 495  LEU D O     1 
ATOM   5872  C  CB    . LEU C  3  79  ? 31.481   9.128   79.852   1.00 87.02  ? 495  LEU D CB    1 
ATOM   5873  C  CG    . LEU C  3  79  ? 30.442   9.838   78.978   1.00 86.21  ? 495  LEU D CG    1 
ATOM   5874  C  CD1   . LEU C  3  79  ? 29.313   8.896   78.595   1.00 82.34  ? 495  LEU D CD1   1 
ATOM   5875  C  CD2   . LEU C  3  79  ? 29.909   11.090  79.651   1.00 90.92  ? 495  LEU D CD2   1 
ATOM   5876  N  N     . ALA C  3  80  ? 34.298   9.285   78.089   1.00 95.86  ? 496  ALA D N     1 
ATOM   5877  C  CA    . ALA C  3  80  ? 35.050   10.036  77.054   1.00 96.35  ? 496  ALA D CA    1 
ATOM   5878  C  C     . ALA C  3  80  ? 35.645   9.083   76.003   1.00 90.04  ? 496  ALA D C     1 
ATOM   5879  O  O     . ALA C  3  80  ? 35.908   9.558   74.879   1.00 93.59  ? 496  ALA D O     1 
ATOM   5880  C  CB    . ALA C  3  80  ? 36.122   10.874  77.707   1.00 97.47  ? 496  ALA D CB    1 
ATOM   5881  N  N     . LYS C  3  81  ? 35.851   7.802   76.345   1.00 78.78  ? 497  LYS D N     1 
ATOM   5882  C  CA    . LYS C  3  81  ? 36.406   6.760   75.431   1.00 78.20  ? 497  LYS D CA    1 
ATOM   5883  C  C     . LYS C  3  81  ? 35.269   6.135   74.597   1.00 81.18  ? 497  LYS D C     1 
ATOM   5884  O  O     . LYS C  3  81  ? 35.564   5.234   73.776   1.00 83.56  ? 497  LYS D O     1 
ATOM   5885  C  CB    . LYS C  3  81  ? 37.200   5.710   76.223   1.00 72.29  ? 497  LYS D CB    1 
ATOM   5886  C  CG    . LYS C  3  81  ? 38.718   5.900   76.219   1.00 62.61  ? 497  LYS D CG    1 
ATOM   5887  N  N     . ALA C  3  82  ? 34.023   6.598   74.776   1.00 79.45  ? 498  ALA D N     1 
ATOM   5888  C  CA    . ALA C  3  82  ? 32.827   6.145   74.020   1.00 80.69  ? 498  ALA D CA    1 
ATOM   5889  C  C     . ALA C  3  82  ? 33.040   6.397   72.522   1.00 80.12  ? 498  ALA D C     1 
ATOM   5890  O  O     . ALA C  3  82  ? 33.465   7.517   72.155   1.00 80.25  ? 498  ALA D O     1 
ATOM   5891  C  CB    . ALA C  3  82  ? 31.580   6.840   74.515   1.00 78.22  ? 498  ALA D CB    1 
ATOM   5892  N  N     . ARG C  3  83  ? 32.734   5.391   71.697   1.00 74.96  ? 499  ARG D N     1 
ATOM   5893  C  CA    . ARG C  3  83  ? 32.990   5.386   70.232   1.00 68.60  ? 499  ARG D CA    1 
ATOM   5894  C  C     . ARG C  3  83  ? 31.725   5.810   69.466   1.00 69.37  ? 499  ARG D C     1 
ATOM   5895  O  O     . ARG C  3  83  ? 31.833   6.052   68.248   1.00 54.84  ? 499  ARG D O     1 
ATOM   5896  C  CB    . ARG C  3  83  ? 33.516   4.001   69.852   1.00 66.04  ? 499  ARG D CB    1 
ATOM   5897  C  CG    . ARG C  3  83  ? 34.867   3.671   70.484   1.00 67.96  ? 499  ARG D CG    1 
ATOM   5898  C  CD    . ARG C  3  83  ? 35.610   2.621   69.656   1.00 68.65  ? 499  ARG D CD    1 
ATOM   5899  N  NE    . ARG C  3  83  ? 34.646   1.882   68.843   1.00 74.10  ? 499  ARG D NE    1 
ATOM   5900  C  CZ    . ARG C  3  83  ? 34.845   1.362   67.633   1.00 75.95  ? 499  ARG D CZ    1 
ATOM   5901  N  NH1   . ARG C  3  83  ? 33.847   0.744   67.014   1.00 76.56  ? 499  ARG D NH1   1 
ATOM   5902  N  NH2   . ARG C  3  83  ? 35.997   1.533   67.003   1.00 78.01  ? 499  ARG D NH2   1 
ATOM   5903  N  N     . TYR C  3  84  ? 30.578   5.912   70.156   1.00 77.95  ? 500  TYR D N     1 
ATOM   5904  C  CA    . TYR C  3  84  ? 29.268   6.399   69.633   1.00 82.00  ? 500  TYR D CA    1 
ATOM   5905  C  C     . TYR C  3  84  ? 28.618   7.253   70.731   1.00 85.88  ? 500  TYR D C     1 
ATOM   5906  O  O     . TYR C  3  84  ? 28.801   6.913   71.918   1.00 87.39  ? 500  TYR D O     1 
ATOM   5907  C  CB    . TYR C  3  84  ? 28.371   5.227   69.207   1.00 89.28  ? 500  TYR D CB    1 
ATOM   5908  C  CG    . TYR C  3  84  ? 29.070   4.146   68.409   1.00 89.30  ? 500  TYR D CG    1 
ATOM   5909  C  CD1   . TYR C  3  84  ? 29.127   4.201   67.022   1.00 81.05  ? 500  TYR D CD1   1 
ATOM   5910  C  CD2   . TYR C  3  84  ? 29.708   3.081   69.039   1.00 79.41  ? 500  TYR D CD2   1 
ATOM   5911  C  CE1   . TYR C  3  84  ? 29.798   3.233   66.287   1.00 74.97  ? 500  TYR D CE1   1 
ATOM   5912  C  CE2   . TYR C  3  84  ? 30.386   2.112   68.318   1.00 70.84  ? 500  TYR D CE2   1 
ATOM   5913  C  CZ    . TYR C  3  84  ? 30.433   2.186   66.935   1.00 73.49  ? 500  TYR D CZ    1 
ATOM   5914  O  OH    . TYR C  3  84  ? 31.103   1.236   66.214   1.00 72.18  ? 500  TYR D OH    1 
ATOM   5915  N  N     . HIS C  3  85  ? 27.931   8.344   70.364   1.00 88.86  ? 501  HIS D N     1 
ATOM   5916  C  CA    . HIS C  3  85  ? 27.201   9.242   71.308   1.00 93.22  ? 501  HIS D CA    1 
ATOM   5917  C  C     . HIS C  3  85  ? 25.694   8.952   71.225   1.00 93.27  ? 501  HIS D C     1 
ATOM   5918  O  O     . HIS C  3  85  ? 24.910   9.648   71.914   1.00 98.15  ? 501  HIS D O     1 
ATOM   5919  C  CB    . HIS C  3  85  ? 27.551   10.720  71.042   1.00 96.41  ? 501  HIS D CB    1 
ATOM   5920  C  CG    . HIS C  3  85  ? 28.861   11.166  71.611   1.00 97.83  ? 501  HIS D CG    1 
ATOM   5921  N  ND1   . HIS C  3  85  ? 29.061   12.460  72.063   1.00 92.20  ? 501  HIS D ND1   1 
ATOM   5922  C  CD2   . HIS C  3  85  ? 30.030   10.507  71.797   1.00 94.61  ? 501  HIS D CD2   1 
ATOM   5923  C  CE1   . HIS C  3  85  ? 30.301   12.579  72.498   1.00 100.36 ? 501  HIS D CE1   1 
ATOM   5924  N  NE2   . HIS C  3  85  ? 30.919   11.390  72.348   1.00 95.68  ? 501  HIS D NE2   1 
ATOM   5925  N  N     . LYS C  3  86  ? 25.319   7.963   70.403   1.00 93.55  ? 502  LYS D N     1 
ATOM   5926  C  CA    . LYS C  3  86  ? 23.949   7.392   70.299   1.00 91.64  ? 502  LYS D CA    1 
ATOM   5927  C  C     . LYS C  3  86  ? 24.066   5.864   70.182   1.00 99.47  ? 502  LYS D C     1 
ATOM   5928  O  O     . LYS C  3  86  ? 24.485   5.377   69.117   1.00 98.20  ? 502  LYS D O     1 
ATOM   5929  C  CB    . LYS C  3  86  ? 23.208   7.977   69.094   1.00 84.81  ? 502  LYS D CB    1 
ATOM   5930  C  CG    . LYS C  3  86  ? 22.799   9.441   69.205   1.00 80.90  ? 502  LYS D CG    1 
ATOM   5931  N  N     . ILE C  3  87  ? 23.732   5.144   71.255   1.00 105.19 ? 503  ILE D N     1 
ATOM   5932  C  CA    . ILE C  3  87  ? 23.506   3.669   71.254   1.00 97.08  ? 503  ILE D CA    1 
ATOM   5933  C  C     . ILE C  3  87  ? 21.992   3.457   71.128   1.00 78.96  ? 503  ILE D C     1 
ATOM   5934  O  O     . ILE C  3  87  ? 21.274   3.759   72.099   1.00 63.86  ? 503  ILE D O     1 
ATOM   5935  C  CB    . ILE C  3  87  ? 24.098   3.026   72.526   1.00 113.90 ? 503  ILE D CB    1 
ATOM   5936  C  CG1   . ILE C  3  87  ? 25.618   3.196   72.600   1.00 119.50 ? 503  ILE D CG1   1 
ATOM   5937  C  CG2   . ILE C  3  87  ? 23.711   1.559   72.637   1.00 122.73 ? 503  ILE D CG2   1 
ATOM   5938  C  CD1   . ILE C  3  87  ? 26.053   4.473   73.291   1.00 126.50 ? 503  ILE D CD1   1 
ATOM   5939  N  N     . VAL C  3  88  ? 21.531   2.993   69.963   1.00 69.54  ? 504  VAL D N     1 
ATOM   5940  C  CA    . VAL C  3  88  ? 20.083   2.821   69.630   1.00 72.09  ? 504  VAL D CA    1 
ATOM   5941  C  C     . VAL C  3  88  ? 19.702   1.340   69.770   1.00 85.96  ? 504  VAL D C     1 
ATOM   5942  O  O     . VAL C  3  88  ? 20.248   0.507   69.018   1.00 87.03  ? 504  VAL D O     1 
ATOM   5943  C  CB    . VAL C  3  88  ? 19.760   3.339   68.217   1.00 67.66  ? 504  VAL D CB    1 
ATOM   5944  C  CG1   . VAL C  3  88  ? 18.263   3.470   68.001   1.00 63.78  ? 504  VAL D CG1   1 
ATOM   5945  C  CG2   . VAL C  3  88  ? 20.456   4.663   67.931   1.00 67.52  ? 504  VAL D CG2   1 
ATOM   5946  N  N     . ILE C  3  89  ? 18.800   1.036   70.710   1.00 98.12  ? 505  ILE D N     1 
ATOM   5947  C  CA    . ILE C  3  89  ? 18.152   -0.298  70.879   1.00 89.69  ? 505  ILE D CA    1 
ATOM   5948  C  C     . ILE C  3  89  ? 17.006   -0.359  69.864   1.00 87.45  ? 505  ILE D C     1 
ATOM   5949  O  O     . ILE C  3  89  ? 16.036   0.403   70.022   1.00 83.21  ? 505  ILE D O     1 
ATOM   5950  C  CB    . ILE C  3  89  ? 17.667   -0.497  72.328   1.00 92.87  ? 505  ILE D CB    1 
ATOM   5951  C  CG1   . ILE C  3  89  ? 18.837   -0.511  73.317   1.00 92.69  ? 505  ILE D CG1   1 
ATOM   5952  C  CG2   . ILE C  3  89  ? 16.819   -1.751  72.461   1.00 96.62  ? 505  ILE D CG2   1 
ATOM   5953  C  CD1   . ILE C  3  89  ? 18.418   -0.364  74.766   1.00 89.35  ? 505  ILE D CD1   1 
ATOM   5954  N  N     . MET C  3  90  ? 17.135   -1.209  68.843   1.00 93.73  ? 506  MET D N     1 
ATOM   5955  C  CA    . MET C  3  90  ? 16.146   -1.355  67.748   1.00 106.05 ? 506  MET D CA    1 
ATOM   5956  C  C     . MET C  3  90  ? 15.662   -2.810  67.718   1.00 106.61 ? 506  MET D C     1 
ATOM   5957  O  O     . MET C  3  90  ? 16.079   -3.575  66.828   1.00 115.22 ? 506  MET D O     1 
ATOM   5958  C  CB    . MET C  3  90  ? 16.763   -0.960  66.409   1.00 110.99 ? 506  MET D CB    1 
ATOM   5959  C  CG    . MET C  3  90  ? 15.702   -0.709  65.327   1.00 103.65 ? 506  MET D CG    1 
ATOM   5960  S  SD    . MET C  3  90  ? 16.345   0.299   63.968   1.00 92.01  ? 506  MET D SD    1 
ATOM   5961  C  CE    . MET C  3  90  ? 17.369   -0.929  63.157   1.00 89.29  ? 506  MET D CE    1 
ATOM   5962  N  N     . THR C  3  91  ? 14.828   -3.173  68.689   1.00 110.96 ? 507  THR D N     1 
ATOM   5963  C  CA    . THR C  3  91  ? 14.187   -4.505  68.807   1.00 116.24 ? 507  THR D CA    1 
ATOM   5964  C  C     . THR C  3  91  ? 12.856   -4.477  68.052   1.00 113.56 ? 507  THR D C     1 
ATOM   5965  O  O     . THR C  3  91  ? 12.315   -3.358  67.825   1.00 124.03 ? 507  THR D O     1 
ATOM   5966  C  CB    . THR C  3  91  ? 13.975   -4.897  70.271   1.00 129.08 ? 507  THR D CB    1 
ATOM   5967  O  OG1   . THR C  3  91  ? 13.163   -3.889  70.875   1.00 132.75 ? 507  THR D OG1   1 
ATOM   5968  C  CG2   . THR C  3  91  ? 15.287   -5.085  71.006   1.00 132.32 ? 507  THR D CG2   1 
ATOM   5969  N  N     . ASP C  3  92  ? 12.366   -5.658  67.680   1.00 107.87 ? 508  ASP D N     1 
ATOM   5970  C  CA    . ASP C  3  92  ? 11.144   -5.864  66.860   1.00 103.07 ? 508  ASP D CA    1 
ATOM   5971  C  C     . ASP C  3  92  ? 9.954    -5.302  67.646   1.00 94.08  ? 508  ASP D C     1 
ATOM   5972  O  O     . ASP C  3  92  ? 10.109   -5.065  68.899   1.00 73.51  ? 508  ASP D O     1 
ATOM   5973  C  CB    . ASP C  3  92  ? 10.943   -7.347  66.515   1.00 111.82 ? 508  ASP D CB    1 
ATOM   5974  C  CG    . ASP C  3  92  ? 12.057   -7.915  65.636   1.00 117.54 ? 508  ASP D CG    1 
ATOM   5975  O  OD1   . ASP C  3  92  ? 12.703   -7.106  64.880   1.00 127.08 ? 508  ASP D OD1   1 
ATOM   5976  O  OD2   . ASP C  3  92  ? 12.194   -9.158  65.604   1.00 109.62 ? 508  ASP D OD2   1 
ATOM   5977  N  N     . ALA C  3  93  ? 8.827    -5.093  66.960   1.00 100.55 ? 509  ALA D N     1 
ATOM   5978  C  CA    . ALA C  3  93  ? 7.616    -4.407  67.473   1.00 114.09 ? 509  ALA D CA    1 
ATOM   5979  C  C     . ALA C  3  93  ? 6.709    -5.381  68.252   1.00 121.64 ? 509  ALA D C     1 
ATOM   5980  O  O     . ALA C  3  93  ? 5.526    -5.073  68.411   1.00 137.15 ? 509  ALA D O     1 
ATOM   5981  C  CB    . ALA C  3  93  ? 6.878    -3.777  66.302   1.00 112.91 ? 509  ALA D CB    1 
ATOM   5982  N  N     . ASP C  3  94  ? 7.264    -6.503  68.723   1.00 118.83 ? 510  ASP D N     1 
ATOM   5983  C  CA    . ASP C  3  94  ? 6.525    -7.657  69.306   1.00 105.14 ? 510  ASP D CA    1 
ATOM   5984  C  C     . ASP C  3  94  ? 6.852    -7.749  70.809   1.00 104.90 ? 510  ASP D C     1 
ATOM   5985  O  O     . ASP C  3  94  ? 7.445    -6.802  71.378   1.00 116.01 ? 510  ASP D O     1 
ATOM   5986  C  CB    . ASP C  3  94  ? 6.815    -8.940  68.509   1.00 95.40  ? 510  ASP D CB    1 
ATOM   5987  C  CG    . ASP C  3  94  ? 8.284    -9.321  68.347   1.00 85.97  ? 510  ASP D CG    1 
ATOM   5988  O  OD1   . ASP C  3  94  ? 9.070    -9.028  69.248   1.00 73.22  ? 510  ASP D OD1   1 
ATOM   5989  O  OD2   . ASP C  3  94  ? 8.631    -9.943  67.329   1.00 84.20  ? 510  ASP D OD2   1 
ATOM   5990  N  N     . VAL C  3  95  ? 6.454    -8.849  71.449   1.00 85.80  ? 511  VAL D N     1 
ATOM   5991  C  CA    . VAL C  3  95  ? 6.596    -9.048  72.920   1.00 73.86  ? 511  VAL D CA    1 
ATOM   5992  C  C     . VAL C  3  95  ? 8.029    -9.505  73.231   1.00 69.20  ? 511  VAL D C     1 
ATOM   5993  O  O     . VAL C  3  95  ? 8.550    -9.114  74.284   1.00 65.29  ? 511  VAL D O     1 
ATOM   5994  C  CB    . VAL C  3  95  ? 5.533    -10.031 73.439   1.00 70.62  ? 511  VAL D CB    1 
ATOM   5995  C  CG1   . VAL C  3  95  ? 4.129    -9.595  73.023   1.00 63.74  ? 511  VAL D CG1   1 
ATOM   5996  C  CG2   . VAL C  3  95  ? 5.821    -11.468 73.008   1.00 71.54  ? 511  VAL D CG2   1 
ATOM   5997  N  N     . ASP C  3  96  ? 8.647    -10.312 72.369   1.00 71.13  ? 512  ASP D N     1 
ATOM   5998  C  CA    . ASP C  3  96  ? 10.035   -10.822 72.571   1.00 79.34  ? 512  ASP D CA    1 
ATOM   5999  C  C     . ASP C  3  96  ? 11.034   -9.694  72.286   1.00 81.64  ? 512  ASP D C     1 
ATOM   6000  O  O     . ASP C  3  96  ? 12.166   -9.752  72.796   1.00 83.26  ? 512  ASP D O     1 
ATOM   6001  C  CB    . ASP C  3  96  ? 10.316   -12.065 71.722   1.00 81.67  ? 512  ASP D CB    1 
ATOM   6002  C  CG    . ASP C  3  96  ? 9.643    -13.306 72.269   1.00 75.53  ? 512  ASP D CG    1 
ATOM   6003  O  OD1   . ASP C  3  96  ? 10.114   -13.782 73.308   1.00 58.52  ? 512  ASP D OD1   1 
ATOM   6004  O  OD2   . ASP C  3  96  ? 8.657    -13.781 71.661   1.00 77.49  ? 512  ASP D OD2   1 
ATOM   6005  N  N     . GLY C  3  97  ? 10.622   -8.709  71.483   1.00 74.78  ? 513  GLY D N     1 
ATOM   6006  C  CA    . GLY C  3  97  ? 11.316   -7.418  71.319   1.00 59.31  ? 513  GLY D CA    1 
ATOM   6007  C  C     . GLY C  3  97  ? 11.383   -6.687  72.647   1.00 48.59  ? 513  GLY D C     1 
ATOM   6008  O  O     . GLY C  3  97  ? 12.490   -6.313  73.067   1.00 45.21  ? 513  GLY D O     1 
ATOM   6009  N  N     . ALA C  3  98  ? 10.236   -6.529  73.308   1.00 47.08  ? 514  ALA D N     1 
ATOM   6010  C  CA    . ALA C  3  98  ? 10.117   -5.857  74.626   1.00 51.41  ? 514  ALA D CA    1 
ATOM   6011  C  C     . ALA C  3  98  ? 11.027   -6.551  75.649   1.00 54.47  ? 514  ALA D C     1 
ATOM   6012  O  O     . ALA C  3  98  ? 11.690   -5.849  76.421   1.00 62.26  ? 514  ALA D O     1 
ATOM   6013  C  CB    . ALA C  3  98  ? 8.677    -5.821  75.072   1.00 51.29  ? 514  ALA D CB    1 
ATOM   6014  N  N     . HIS C  3  99  ? 11.094   -7.882  75.643   1.00 59.67  ? 515  HIS D N     1 
ATOM   6015  C  CA    . HIS C  3  99  ? 11.958   -8.662  76.573   1.00 55.94  ? 515  HIS D CA    1 
ATOM   6016  C  C     . HIS C  3  99  ? 13.438   -8.342  76.316   1.00 53.06  ? 515  HIS D C     1 
ATOM   6017  O  O     . HIS C  3  99  ? 14.128   -8.057  77.299   1.00 44.69  ? 515  HIS D O     1 
ATOM   6018  C  CB    . HIS C  3  99  ? 11.679   -10.167 76.496   1.00 54.42  ? 515  HIS D CB    1 
ATOM   6019  C  CG    . HIS C  3  99  ? 12.302   -10.931 77.617   1.00 55.29  ? 515  HIS D CG    1 
ATOM   6020  N  ND1   . HIS C  3  99  ? 12.873   -12.173 77.441   1.00 52.63  ? 515  HIS D ND1   1 
ATOM   6021  C  CD2   . HIS C  3  99  ? 12.471   -10.620 78.921   1.00 57.15  ? 515  HIS D CD2   1 
ATOM   6022  C  CE1   . HIS C  3  99  ? 13.348   -12.602 78.591   1.00 54.31  ? 515  HIS D CE1   1 
ATOM   6023  N  NE2   . HIS C  3  99  ? 13.120   -11.667 79.519   1.00 57.32  ? 515  HIS D NE2   1 
ATOM   6024  N  N     . ILE C  3  100 ? 13.903   -8.386  75.060   1.00 55.18  ? 516  ILE D N     1 
ATOM   6025  C  CA    . ILE C  3  100 ? 15.335   -8.121  74.713   1.00 60.69  ? 516  ILE D CA    1 
ATOM   6026  C  C     . ILE C  3  100 ? 15.653   -6.663  75.055   1.00 57.92  ? 516  ILE D C     1 
ATOM   6027  O  O     . ILE C  3  100 ? 16.803   -6.386  75.440   1.00 63.15  ? 516  ILE D O     1 
ATOM   6028  C  CB    . ILE C  3  100 ? 15.673   -8.458  73.247   1.00 70.30  ? 516  ILE D CB    1 
ATOM   6029  C  CG1   . ILE C  3  100 ? 15.414   -9.934  72.932   1.00 85.38  ? 516  ILE D CG1   1 
ATOM   6030  C  CG2   . ILE C  3  100 ? 17.116   -8.078  72.942   1.00 72.87  ? 516  ILE D CG2   1 
ATOM   6031  C  CD1   . ILE C  3  100 ? 15.562   -10.317 71.474   1.00 92.92  ? 516  ILE D CD1   1 
ATOM   6032  N  N     . ARG C  3  101 ? 14.663   -5.775  74.943   1.00 55.95  ? 517  ARG D N     1 
ATOM   6033  C  CA    . ARG C  3  101 ? 14.788   -4.353  75.354   1.00 57.54  ? 517  ARG D CA    1 
ATOM   6034  C  C     . ARG C  3  101 ? 15.025   -4.268  76.871   1.00 62.07  ? 517  ARG D C     1 
ATOM   6035  O  O     . ARG C  3  101 ? 15.998   -3.599  77.255   1.00 84.58  ? 517  ARG D O     1 
ATOM   6036  C  CB    . ARG C  3  101 ? 13.565   -3.547  74.910   1.00 56.04  ? 517  ARG D CB    1 
ATOM   6037  C  CG    . ARG C  3  101 ? 13.722   -2.049  75.112   1.00 56.35  ? 517  ARG D CG    1 
ATOM   6038  C  CD    . ARG C  3  101 ? 12.822   -1.257  74.191   1.00 59.12  ? 517  ARG D CD    1 
ATOM   6039  N  NE    . ARG C  3  101 ? 11.428   -1.579  74.466   1.00 62.14  ? 517  ARG D NE    1 
ATOM   6040  C  CZ    . ARG C  3  101 ? 10.622   -2.255  73.660   1.00 63.16  ? 517  ARG D CZ    1 
ATOM   6041  N  NH1   . ARG C  3  101 ? 11.058   -2.687  72.491   1.00 63.45  ? 517  ARG D NH1   1 
ATOM   6042  N  NH2   . ARG C  3  101 ? 9.380    -2.509  74.020   1.00 65.87  ? 517  ARG D NH2   1 
ATOM   6043  N  N     . THR C  3  102 ? 14.211   -4.933  77.703   1.00 57.22  ? 518  THR D N     1 
ATOM   6044  C  CA    . THR C  3  102 ? 14.386   -4.952  79.187   1.00 56.31  ? 518  THR D CA    1 
ATOM   6045  C  C     . THR C  3  102 ? 15.740   -5.579  79.563   1.00 67.01  ? 518  THR D C     1 
ATOM   6046  O  O     . THR C  3  102 ? 16.306   -5.166  80.592   1.00 65.76  ? 518  THR D O     1 
ATOM   6047  C  CB    . THR C  3  102 ? 13.285   -5.699  79.958   1.00 51.99  ? 518  THR D CB    1 
ATOM   6048  O  OG1   . THR C  3  102 ? 13.368   -7.102  79.712   1.00 46.25  ? 518  THR D OG1   1 
ATOM   6049  C  CG2   . THR C  3  102 ? 11.883   -5.217  79.657   1.00 52.17  ? 518  THR D CG2   1 
ATOM   6050  N  N     . LEU C  3  103 ? 16.233   -6.548  78.780   1.00 77.68  ? 519  LEU D N     1 
ATOM   6051  C  CA    . LEU C  3  103 ? 17.465   -7.307  79.121   1.00 88.55  ? 519  LEU D CA    1 
ATOM   6052  C  C     . LEU C  3  103 ? 18.688   -6.420  78.866   1.00 99.87  ? 519  LEU D C     1 
ATOM   6053  O  O     . LEU C  3  103 ? 19.646   -6.485  79.674   1.00 115.19 ? 519  LEU D O     1 
ATOM   6054  C  CB    . LEU C  3  103 ? 17.527   -8.599  78.299   1.00 83.49  ? 519  LEU D CB    1 
ATOM   6055  C  CG    . LEU C  3  103 ? 16.621   -9.731  78.780   1.00 84.78  ? 519  LEU D CG    1 
ATOM   6056  C  CD1   . LEU C  3  103 ? 16.455   -10.787 77.696   1.00 85.88  ? 519  LEU D CD1   1 
ATOM   6057  C  CD2   . LEU C  3  103 ? 17.163   -10.355 80.065   1.00 84.60  ? 519  LEU D CD2   1 
ATOM   6058  N  N     . LEU C  3  104 ? 18.654   -5.645  77.775   1.00 95.74  ? 520  LEU D N     1 
ATOM   6059  C  CA    . LEU C  3  104 ? 19.738   -4.710  77.370   1.00 94.76  ? 520  LEU D CA    1 
ATOM   6060  C  C     . LEU C  3  104 ? 19.783   -3.538  78.355   1.00 94.87  ? 520  LEU D C     1 
ATOM   6061  O  O     . LEU C  3  104 ? 20.897   -3.189  78.809   1.00 102.72 ? 520  LEU D O     1 
ATOM   6062  C  CB    . LEU C  3  104 ? 19.484   -4.212  75.942   1.00 97.99  ? 520  LEU D CB    1 
ATOM   6063  C  CG    . LEU C  3  104 ? 19.896   -5.160  74.817   1.00 98.37  ? 520  LEU D CG    1 
ATOM   6064  C  CD1   . LEU C  3  104 ? 19.351   -4.677  73.480   1.00 104.86 ? 520  LEU D CD1   1 
ATOM   6065  C  CD2   . LEU C  3  104 ? 21.405   -5.284  74.752   1.00 92.07  ? 520  LEU D CD2   1 
ATOM   6066  N  N     . LEU C  3  105 ? 18.619   -2.951  78.656   1.00 92.83  ? 521  LEU D N     1 
ATOM   6067  C  CA    . LEU C  3  105 ? 18.471   -1.825  79.618   1.00 94.76  ? 521  LEU D CA    1 
ATOM   6068  C  C     . LEU C  3  105 ? 19.016   -2.246  80.990   1.00 109.43 ? 521  LEU D C     1 
ATOM   6069  O  O     . LEU C  3  105 ? 19.654   -1.399  81.656   1.00 134.56 ? 521  LEU D O     1 
ATOM   6070  C  CB    . LEU C  3  105 ? 17.002   -1.401  79.696   1.00 85.80  ? 521  LEU D CB    1 
ATOM   6071  C  CG    . LEU C  3  105 ? 16.521   -0.532  78.532   1.00 78.94  ? 521  LEU D CG    1 
ATOM   6072  C  CD1   . LEU C  3  105 ? 15.070   -0.109  78.719   1.00 75.40  ? 521  LEU D CD1   1 
ATOM   6073  C  CD2   . LEU C  3  105 ? 17.406   0.695   78.356   1.00 76.83  ? 521  LEU D CD2   1 
ATOM   6074  N  N     . THR C  3  106 ? 18.796   -3.501  81.389   1.00 103.07 ? 522  THR D N     1 
ATOM   6075  C  CA    . THR C  3  106 ? 19.299   -4.061  82.668   1.00 105.67 ? 522  THR D CA    1 
ATOM   6076  C  C     . THR C  3  106 ? 20.828   -4.087  82.625   1.00 104.11 ? 522  THR D C     1 
ATOM   6077  O  O     . THR C  3  106 ? 21.437   -3.716  83.641   1.00 116.45 ? 522  THR D O     1 
ATOM   6078  C  CB    . THR C  3  106 ? 18.665   -5.423  82.969   1.00 112.47 ? 522  THR D CB    1 
ATOM   6079  O  OG1   . THR C  3  106 ? 17.254   -5.196  83.040   1.00 117.30 ? 522  THR D OG1   1 
ATOM   6080  C  CG2   . THR C  3  106 ? 19.169   -6.047  84.255   1.00 114.86 ? 522  THR D CG2   1 
ATOM   6081  N  N     . PHE C  3  107 ? 21.418   -4.476  81.493   1.00 98.78  ? 523  PHE D N     1 
ATOM   6082  C  CA    . PHE C  3  107 ? 22.893   -4.519  81.301   1.00 96.64  ? 523  PHE D CA    1 
ATOM   6083  C  C     . PHE C  3  107 ? 23.453   -3.097  81.372   1.00 95.83  ? 523  PHE D C     1 
ATOM   6084  O  O     . PHE C  3  107 ? 24.418   -2.885  82.130   1.00 94.91  ? 523  PHE D O     1 
ATOM   6085  C  CB    . PHE C  3  107 ? 23.283   -5.189  79.980   1.00 91.71  ? 523  PHE D CB    1 
ATOM   6086  C  CG    . PHE C  3  107 ? 24.728   -5.003  79.591   1.00 85.22  ? 523  PHE D CG    1 
ATOM   6087  C  CD1   . PHE C  3  107 ? 25.745   -5.542  80.362   1.00 89.43  ? 523  PHE D CD1   1 
ATOM   6088  C  CD2   . PHE C  3  107 ? 25.072   -4.277  78.464   1.00 77.04  ? 523  PHE D CD2   1 
ATOM   6089  C  CE1   . PHE C  3  107 ? 27.077   -5.374  80.008   1.00 88.66  ? 523  PHE D CE1   1 
ATOM   6090  C  CE2   . PHE C  3  107 ? 26.404   -4.116  78.105   1.00 78.59  ? 523  PHE D CE2   1 
ATOM   6091  C  CZ    . PHE C  3  107 ? 27.406   -4.671  78.871   1.00 84.41  ? 523  PHE D CZ    1 
ATOM   6092  N  N     . PHE C  3  108 ? 22.873   -2.162  80.613   1.00 96.06  ? 524  PHE D N     1 
ATOM   6093  C  CA    . PHE C  3  108 ? 23.321   -0.745  80.564   1.00 91.79  ? 524  PHE D CA    1 
ATOM   6094  C  C     . PHE C  3  108 ? 23.238   -0.127  81.964   1.00 88.77  ? 524  PHE D C     1 
ATOM   6095  O  O     . PHE C  3  108 ? 24.197   0.551   82.355   1.00 87.07  ? 524  PHE D O     1 
ATOM   6096  C  CB    . PHE C  3  108 ? 22.523   0.066   79.540   1.00 92.58  ? 524  PHE D CB    1 
ATOM   6097  C  CG    . PHE C  3  108 ? 22.790   -0.298  78.101   1.00 96.99  ? 524  PHE D CG    1 
ATOM   6098  C  CD1   . PHE C  3  108 ? 24.049   -0.698  77.689   1.00 88.14  ? 524  PHE D CD1   1 
ATOM   6099  C  CD2   . PHE C  3  108 ? 21.784   -0.225  77.150   1.00 100.55 ? 524  PHE D CD2   1 
ATOM   6100  C  CE1   . PHE C  3  108 ? 24.294   -1.022  76.365   1.00 85.02  ? 524  PHE D CE1   1 
ATOM   6101  C  CE2   . PHE C  3  108 ? 22.029   -0.556  75.826   1.00 93.98  ? 524  PHE D CE2   1 
ATOM   6102  C  CZ    . PHE C  3  108 ? 23.282   -0.962  75.436   1.00 88.58  ? 524  PHE D CZ    1 
ATOM   6103  N  N     . TYR C  3  109 ? 22.151   -0.363  82.702   1.00 91.92  ? 525  TYR D N     1 
ATOM   6104  C  CA    . TYR C  3  109 ? 21.906   0.288   84.014   1.00 99.57  ? 525  TYR D CA    1 
ATOM   6105  C  C     . TYR C  3  109 ? 22.866   -0.260  85.079   1.00 98.81  ? 525  TYR D C     1 
ATOM   6106  O  O     . TYR C  3  109 ? 23.210   0.510   85.995   1.00 104.17 ? 525  TYR D O     1 
ATOM   6107  C  CB    . TYR C  3  109 ? 20.461   0.134   84.485   1.00 99.54  ? 525  TYR D CB    1 
ATOM   6108  C  CG    . TYR C  3  109 ? 20.190   0.845   85.789   1.00 101.12 ? 525  TYR D CG    1 
ATOM   6109  C  CD1   . TYR C  3  109 ? 19.958   2.212   85.826   1.00 103.03 ? 525  TYR D CD1   1 
ATOM   6110  C  CD2   . TYR C  3  109 ? 20.221   0.164   86.994   1.00 99.00  ? 525  TYR D CD2   1 
ATOM   6111  C  CE1   . TYR C  3  109 ? 19.739   2.878   87.023   1.00 103.37 ? 525  TYR D CE1   1 
ATOM   6112  C  CE2   . TYR C  3  109 ? 19.992   0.810   88.199   1.00 97.12  ? 525  TYR D CE2   1 
ATOM   6113  C  CZ    . TYR C  3  109 ? 19.747   2.171   88.215   1.00 98.01  ? 525  TYR D CZ    1 
ATOM   6114  O  OH    . TYR C  3  109 ? 19.531   2.822   89.403   1.00 99.33  ? 525  TYR D OH    1 
ATOM   6115  N  N     . ARG C  3  110 ? 23.266   -1.532  84.990   1.00 88.54  ? 526  ARG D N     1 
ATOM   6116  C  CA    . ARG C  3  110 ? 24.082   -2.187  86.046   1.00 94.13  ? 526  ARG D CA    1 
ATOM   6117  C  C     . ARG C  3  110 ? 25.575   -2.014  85.742   1.00 92.08  ? 526  ARG D C     1 
ATOM   6118  O  O     . ARG C  3  110 ? 26.347   -2.012  86.706   1.00 110.42 ? 526  ARG D O     1 
ATOM   6119  C  CB    . ARG C  3  110 ? 23.729   -3.673  86.215   1.00 93.71  ? 526  ARG D CB    1 
ATOM   6120  C  CG    . ARG C  3  110 ? 22.431   -3.944  86.974   1.00 89.19  ? 526  ARG D CG    1 
ATOM   6121  C  CD    . ARG C  3  110 ? 22.395   -3.415  88.412   1.00 88.13  ? 526  ARG D CD    1 
ATOM   6122  N  NE    . ARG C  3  110 ? 21.077   -3.574  89.023   1.00 96.09  ? 526  ARG D NE    1 
ATOM   6123  C  CZ    . ARG C  3  110 ? 20.596   -2.857  90.048   1.00 98.87  ? 526  ARG D CZ    1 
ATOM   6124  N  NH1   . ARG C  3  110 ? 21.328   -1.914  90.613   1.00 105.44 ? 526  ARG D NH1   1 
ATOM   6125  N  NH2   . ARG C  3  110 ? 19.373   -3.077  90.505   1.00 98.24  ? 526  ARG D NH2   1 
ATOM   6126  N  N     . PHE C  3  111 ? 25.974   -1.885  84.475   1.00 82.92  ? 527  PHE D N     1 
ATOM   6127  C  CA    . PHE C  3  111 ? 27.405   -1.964  84.057   1.00 76.94  ? 527  PHE D CA    1 
ATOM   6128  C  C     . PHE C  3  111 ? 27.889   -0.687  83.362   1.00 83.21  ? 527  PHE D C     1 
ATOM   6129  O  O     . PHE C  3  111 ? 29.120   -0.513  83.281   1.00 93.84  ? 527  PHE D O     1 
ATOM   6130  C  CB    . PHE C  3  111 ? 27.626   -3.180  83.157   1.00 66.99  ? 527  PHE D CB    1 
ATOM   6131  C  CG    . PHE C  3  111 ? 27.718   -4.469  83.926   1.00 58.82  ? 527  PHE D CG    1 
ATOM   6132  C  CD1   . PHE C  3  111 ? 26.615   -4.964  84.606   1.00 57.87  ? 527  PHE D CD1   1 
ATOM   6133  C  CD2   . PHE C  3  111 ? 28.910   -5.174  83.986   1.00 52.25  ? 527  PHE D CD2   1 
ATOM   6134  C  CE1   . PHE C  3  111 ? 26.703   -6.138  85.334   1.00 56.87  ? 527  PHE D CE1   1 
ATOM   6135  C  CE2   . PHE C  3  111 ? 28.996   -6.353  84.712   1.00 50.70  ? 527  PHE D CE2   1 
ATOM   6136  C  CZ    . PHE C  3  111 ? 27.890   -6.834  85.379   1.00 53.87  ? 527  PHE D CZ    1 
ATOM   6137  N  N     . MET C  3  112 ? 26.979   0.150   82.855   1.00 81.78  ? 528  MET D N     1 
ATOM   6138  C  CA    . MET C  3  112 ? 27.322   1.382   82.095   1.00 80.19  ? 528  MET D CA    1 
ATOM   6139  C  C     . MET C  3  112 ? 26.301   2.477   82.419   1.00 83.35  ? 528  MET D C     1 
ATOM   6140  O  O     . MET C  3  112 ? 25.792   3.116   81.470   1.00 73.35  ? 528  MET D O     1 
ATOM   6141  C  CB    . MET C  3  112 ? 27.311   1.111   80.588   1.00 75.35  ? 528  MET D CB    1 
ATOM   6142  C  CG    . MET C  3  112 ? 28.293   0.055   80.156   1.00 68.81  ? 528  MET D CG    1 
ATOM   6143  S  SD    . MET C  3  112 ? 28.192   -0.259  78.382   1.00 60.70  ? 528  MET D SD    1 
ATOM   6144  C  CE    . MET C  3  112 ? 29.600   -1.341  78.165   1.00 60.52  ? 528  MET D CE    1 
ATOM   6145  N  N     . ARG C  3  113 ? 26.013   2.691   83.705   1.00 85.28  ? 529  ARG D N     1 
ATOM   6146  C  CA    . ARG C  3  113 ? 24.966   3.647   84.148   1.00 95.06  ? 529  ARG D CA    1 
ATOM   6147  C  C     . ARG C  3  113 ? 25.258   5.049   83.608   1.00 100.06 ? 529  ARG D C     1 
ATOM   6148  O  O     . ARG C  3  113 ? 24.334   5.725   83.157   1.00 95.35  ? 529  ARG D O     1 
ATOM   6149  C  CB    . ARG C  3  113 ? 24.833   3.646   85.671   1.00 106.02 ? 529  ARG D CB    1 
ATOM   6150  C  CG    . ARG C  3  113 ? 23.626   4.435   86.155   1.00 118.97 ? 529  ARG D CG    1 
ATOM   6151  C  CD    . ARG C  3  113 ? 23.462   4.364   87.645   1.00 126.69 ? 529  ARG D CD    1 
ATOM   6152  N  NE    . ARG C  3  113 ? 23.286   3.051   88.234   1.00 133.40 ? 529  ARG D NE    1 
ATOM   6153  C  CZ    . ARG C  3  113 ? 22.933   2.855   89.498   1.00 136.10 ? 529  ARG D CZ    1 
ATOM   6154  N  NH1   . ARG C  3  113 ? 22.718   3.889   90.299   1.00 150.70 ? 529  ARG D NH1   1 
ATOM   6155  N  NH2   . ARG C  3  113 ? 22.789   1.628   89.956   1.00 127.49 ? 529  ARG D NH2   1 
ATOM   6156  N  N     . PRO C  3  114 ? 26.522   5.544   83.634   1.00 108.20 ? 530  PRO D N     1 
ATOM   6157  C  CA    . PRO C  3  114 ? 26.827   6.901   83.164   1.00 108.36 ? 530  PRO D CA    1 
ATOM   6158  C  C     . PRO C  3  114 ? 26.504   7.168   81.681   1.00 110.91 ? 530  PRO D C     1 
ATOM   6159  O  O     . PRO C  3  114 ? 26.281   8.325   81.336   1.00 96.34  ? 530  PRO D O     1 
ATOM   6160  C  CB    . PRO C  3  114 ? 28.343   7.036   83.395   1.00 113.49 ? 530  PRO D CB    1 
ATOM   6161  C  CG    . PRO C  3  114 ? 28.667   5.996   84.443   1.00 109.68 ? 530  PRO D CG    1 
ATOM   6162  C  CD    . PRO C  3  114 ? 27.720   4.855   84.146   1.00 111.81 ? 530  PRO D CD    1 
ATOM   6163  N  N     . LEU C  3  115 ? 26.501   6.116   80.854   1.00 110.32 ? 531  LEU D N     1 
ATOM   6164  C  CA    . LEU C  3  115 ? 26.043   6.140   79.436   1.00 97.43  ? 531  LEU D CA    1 
ATOM   6165  C  C     . LEU C  3  115 ? 24.578   6.587   79.368   1.00 93.97  ? 531  LEU D C     1 
ATOM   6166  O  O     . LEU C  3  115 ? 24.248   7.391   78.477   1.00 83.26  ? 531  LEU D O     1 
ATOM   6167  C  CB    . LEU C  3  115 ? 26.212   4.744   78.824   1.00 87.80  ? 531  LEU D CB    1 
ATOM   6168  C  CG    . LEU C  3  115 ? 27.456   4.552   77.953   1.00 87.62  ? 531  LEU D CG    1 
ATOM   6169  C  CD1   . LEU C  3  115 ? 27.611   3.116   77.512   1.00 85.30  ? 531  LEU D CD1   1 
ATOM   6170  C  CD2   . LEU C  3  115 ? 27.436   5.450   76.732   1.00 89.43  ? 531  LEU D CD2   1 
ATOM   6171  N  N     . ILE C  3  116 ? 23.730   6.072   80.266   1.00 93.36  ? 532  ILE D N     1 
ATOM   6172  C  CA    . ILE C  3  116 ? 22.281   6.428   80.350   1.00 88.13  ? 532  ILE D CA    1 
ATOM   6173  C  C     . ILE C  3  116 ? 22.154   7.868   80.852   1.00 83.24  ? 532  ILE D C     1 
ATOM   6174  O  O     . ILE C  3  116 ? 21.319   8.608   80.290   1.00 75.92  ? 532  ILE D O     1 
ATOM   6175  C  CB    . ILE C  3  116 ? 21.511   5.449   81.261   1.00 81.19  ? 532  ILE D CB    1 
ATOM   6176  C  CG1   . ILE C  3  116 ? 21.486   4.033   80.682   1.00 71.79  ? 532  ILE D CG1   1 
ATOM   6177  C  CG2   . ILE C  3  116 ? 20.106   5.968   81.548   1.00 90.96  ? 532  ILE D CG2   1 
ATOM   6178  C  CD1   . ILE C  3  116 ? 21.134   2.977   81.704   1.00 72.26  ? 532  ILE D CD1   1 
ATOM   6179  N  N     . GLU C  3  117 ? 22.919   8.213   81.897   1.00 83.79  ? 533  GLU D N     1 
ATOM   6180  C  CA    . GLU C  3  117 ? 22.972   9.566   82.521   1.00 79.59  ? 533  GLU D CA    1 
ATOM   6181  C  C     . GLU C  3  117 ? 23.318   10.595  81.441   1.00 72.76  ? 533  GLU D C     1 
ATOM   6182  O  O     . GLU C  3  117 ? 22.569   11.576  81.318   1.00 79.18  ? 533  GLU D O     1 
ATOM   6183  C  CB    . GLU C  3  117 ? 23.975   9.598   83.676   1.00 78.03  ? 533  GLU D CB    1 
ATOM   6184  C  CG    . GLU C  3  117 ? 23.366   9.151   84.996   1.00 80.10  ? 533  GLU D CG    1 
ATOM   6185  C  CD    . GLU C  3  117 ? 24.314   8.439   85.946   1.00 85.99  ? 533  GLU D CD    1 
ATOM   6186  O  OE1   . GLU C  3  117 ? 23.826   7.940   86.991   1.00 81.36  ? 533  GLU D OE1   1 
ATOM   6187  O  OE2   . GLU C  3  117 ? 25.533   8.372   85.637   1.00 95.10  ? 533  GLU D OE2   1 
ATOM   6188  N  N     . ALA C  3  118 ? 24.373   10.344  80.656   1.00 63.36  ? 534  ALA D N     1 
ATOM   6189  C  CA    . ALA C  3  118 ? 24.856   11.220  79.557   1.00 61.67  ? 534  ALA D CA    1 
ATOM   6190  C  C     . ALA C  3  118 ? 23.818   11.347  78.426   1.00 61.38  ? 534  ALA D C     1 
ATOM   6191  O  O     . ALA C  3  118 ? 24.029   12.195  77.543   1.00 58.92  ? 534  ALA D O     1 
ATOM   6192  C  CB    . ALA C  3  118 ? 26.166   10.693  79.024   1.00 61.60  ? 534  ALA D CB    1 
ATOM   6193  N  N     . GLY C  3  119 ? 22.765   10.518  78.424   1.00 68.38  ? 535  GLY D N     1 
ATOM   6194  C  CA    . GLY C  3  119 ? 21.678   10.533  77.425   1.00 74.52  ? 535  GLY D CA    1 
ATOM   6195  C  C     . GLY C  3  119 ? 22.095   9.921   76.095   1.00 81.46  ? 535  GLY D C     1 
ATOM   6196  O  O     . GLY C  3  119 ? 21.559   10.356  75.057   1.00 91.15  ? 535  GLY D O     1 
ATOM   6197  N  N     . TYR C  3  120 ? 23.012   8.945   76.122   1.00 79.16  ? 536  TYR D N     1 
ATOM   6198  C  CA    . TYR C  3  120 ? 23.591   8.282   74.921   1.00 83.46  ? 536  TYR D CA    1 
ATOM   6199  C  C     . TYR C  3  120 ? 22.747   7.063   74.526   1.00 89.94  ? 536  TYR D C     1 
ATOM   6200  O  O     . TYR C  3  120 ? 22.923   6.553   73.403   1.00 89.14  ? 536  TYR D O     1 
ATOM   6201  C  CB    . TYR C  3  120 ? 25.031   7.828   75.174   1.00 83.96  ? 536  TYR D CB    1 
ATOM   6202  C  CG    . TYR C  3  120 ? 26.089   8.900   75.168   1.00 88.66  ? 536  TYR D CG    1 
ATOM   6203  C  CD1   . TYR C  3  120 ? 25.775   10.249  75.266   1.00 95.98  ? 536  TYR D CD1   1 
ATOM   6204  C  CD2   . TYR C  3  120 ? 27.430   8.550   75.106   1.00 93.53  ? 536  TYR D CD2   1 
ATOM   6205  C  CE1   . TYR C  3  120 ? 26.765   11.221  75.273   1.00 105.81 ? 536  TYR D CE1   1 
ATOM   6206  C  CE2   . TYR C  3  120 ? 28.430   9.507   75.124   1.00 104.35 ? 536  TYR D CE2   1 
ATOM   6207  C  CZ    . TYR C  3  120 ? 28.097   10.847  75.197   1.00 109.40 ? 536  TYR D CZ    1 
ATOM   6208  O  OH    . TYR C  3  120 ? 29.084   11.787  75.208   1.00 116.22 ? 536  TYR D OH    1 
ATOM   6209  N  N     . VAL C  3  121 ? 21.881   6.584   75.422   1.00 95.04  ? 537  VAL D N     1 
ATOM   6210  C  CA    . VAL C  3  121 ? 21.022   5.394   75.159   1.00 90.60  ? 537  VAL D CA    1 
ATOM   6211  C  C     . VAL C  3  121 ? 19.672   5.898   74.637   1.00 90.42  ? 537  VAL D C     1 
ATOM   6212  O  O     . VAL C  3  121 ? 19.049   6.756   75.311   1.00 89.02  ? 537  VAL D O     1 
ATOM   6213  C  CB    . VAL C  3  121 ? 20.882   4.497   76.403   1.00 85.77  ? 537  VAL D CB    1 
ATOM   6214  C  CG1   . VAL C  3  121 ? 19.899   3.361   76.174   1.00 84.13  ? 537  VAL D CG1   1 
ATOM   6215  C  CG2   . VAL C  3  121 ? 22.231   3.949   76.841   1.00 82.90  ? 537  VAL D CG2   1 
ATOM   6216  N  N     . TYR C  3  122 ? 19.276   5.386   73.465   1.00 89.88  ? 538  TYR D N     1 
ATOM   6217  C  CA    . TYR C  3  122 ? 17.996   5.671   72.771   1.00 83.59  ? 538  TYR D CA    1 
ATOM   6218  C  C     . TYR C  3  122 ? 17.277   4.360   72.422   1.00 84.55  ? 538  TYR D C     1 
ATOM   6219  O  O     . TYR C  3  122 ? 17.902   3.274   72.430   1.00 76.18  ? 538  TYR D O     1 
ATOM   6220  C  CB    . TYR C  3  122 ? 18.245   6.469   71.491   1.00 86.93  ? 538  TYR D CB    1 
ATOM   6221  C  CG    . TYR C  3  122 ? 18.897   7.811   71.692   1.00 88.73  ? 538  TYR D CG    1 
ATOM   6222  C  CD1   . TYR C  3  122 ? 20.259   7.911   71.909   1.00 84.64  ? 538  TYR D CD1   1 
ATOM   6223  C  CD2   . TYR C  3  122 ? 18.158   8.984   71.649   1.00 93.43  ? 538  TYR D CD2   1 
ATOM   6224  C  CE1   . TYR C  3  122 ? 20.873   9.138   72.087   1.00 87.70  ? 538  TYR D CE1   1 
ATOM   6225  C  CE2   . TYR C  3  122 ? 18.754   10.220  71.827   1.00 93.77  ? 538  TYR D CE2   1 
ATOM   6226  C  CZ    . TYR C  3  122 ? 20.117   10.295  72.042   1.00 92.18  ? 538  TYR D CZ    1 
ATOM   6227  O  OH    . TYR C  3  122 ? 20.730   11.499  72.222   1.00 100.37 ? 538  TYR D OH    1 
ATOM   6228  N  N     . ILE C  3  123 ? 15.990   4.483   72.097   1.00 85.30  ? 539  ILE D N     1 
ATOM   6229  C  CA    . ILE C  3  123 ? 15.064   3.365   71.749   1.00 85.32  ? 539  ILE D CA    1 
ATOM   6230  C  C     . ILE C  3  123 ? 14.349   3.724   70.441   1.00 85.23  ? 539  ILE D C     1 
ATOM   6231  O  O     . ILE C  3  123 ? 13.436   4.566   70.485   1.00 71.77  ? 539  ILE D O     1 
ATOM   6232  C  CB    . ILE C  3  123 ? 14.067   3.130   72.903   1.00 82.54  ? 539  ILE D CB    1 
ATOM   6233  C  CG1   . ILE C  3  123 ? 14.758   2.527   74.125   1.00 82.66  ? 539  ILE D CG1   1 
ATOM   6234  C  CG2   . ILE C  3  123 ? 12.881   2.285   72.464   1.00 84.28  ? 539  ILE D CG2   1 
ATOM   6235  C  CD1   . ILE C  3  123 ? 13.858   2.437   75.339   1.00 85.47  ? 539  ILE D CD1   1 
ATOM   6236  N  N     . ALA C  3  124 ? 14.738   3.097   69.326   1.00 94.23  ? 540  ALA D N     1 
ATOM   6237  C  CA    . ALA C  3  124 ? 14.085   3.245   68.001   1.00 90.93  ? 540  ALA D CA    1 
ATOM   6238  C  C     . ALA C  3  124 ? 12.624   2.824   68.124   1.00 86.38  ? 540  ALA D C     1 
ATOM   6239  O  O     . ALA C  3  124 ? 12.307   2.024   69.050   1.00 86.39  ? 540  ALA D O     1 
ATOM   6240  C  CB    . ALA C  3  124 ? 14.796   2.428   66.950   1.00 91.15  ? 540  ALA D CB    1 
ATOM   6241  N  N     . GLN C  3  125 ? 11.757   3.310   67.224   1.00 84.63  ? 541  GLN D N     1 
ATOM   6242  C  CA    . GLN C  3  125 ? 10.309   2.980   67.240   1.00 89.56  ? 541  GLN D CA    1 
ATOM   6243  C  C     . GLN C  3  125 ? 9.862    2.570   65.851   1.00 90.24  ? 541  GLN D C     1 
ATOM   6244  O  O     . GLN C  3  125 ? 9.214    3.349   65.170   1.00 89.74  ? 541  GLN D O     1 
ATOM   6245  C  CB    . GLN C  3  125 ? 9.554    4.219   67.753   1.00 87.24  ? 541  GLN D CB    1 
ATOM   6246  C  CG    . GLN C  3  125 ? 9.769    4.496   69.226   1.00 87.49  ? 541  GLN D CG    1 
ATOM   6247  C  CD    . GLN C  3  125 ? 10.343   5.832   69.589   1.00 98.02  ? 541  GLN D CD    1 
ATOM   6248  O  OE1   . GLN C  3  125 ? 11.402   5.845   70.175   1.00 97.87  ? 541  GLN D OE1   1 
ATOM   6249  N  NE2   . GLN C  3  125 ? 9.654    6.906   69.250   1.00 116.03 ? 541  GLN D NE2   1 
ATOM   6250  N  N     . PRO C  3  126 ? 10.170   1.338   65.396   1.00 95.67  ? 542  PRO D N     1 
ATOM   6251  C  CA    . PRO C  3  126 ? 9.718    0.879   64.084   1.00 102.57 ? 542  PRO D CA    1 
ATOM   6252  C  C     . PRO C  3  126 ? 8.202    0.820   64.019   1.00 105.71 ? 542  PRO D C     1 
ATOM   6253  O  O     . PRO C  3  126 ? 7.556    0.526   65.020   1.00 121.81 ? 542  PRO D O     1 
ATOM   6254  C  CB    . PRO C  3  126 ? 10.365   -0.499  63.907   1.00 104.24 ? 542  PRO D CB    1 
ATOM   6255  C  CG    . PRO C  3  126 ? 10.631   -0.960  65.350   1.00 106.19 ? 542  PRO D CG    1 
ATOM   6256  C  CD    . PRO C  3  126 ? 10.954   0.309   66.096   1.00 98.18  ? 542  PRO D CD    1 
ATOM   6257  N  N     . PRO C  3  127 ? 7.575    1.122   62.853   1.00 99.79  ? 543  PRO D N     1 
ATOM   6258  C  CA    . PRO C  3  127 ? 6.112    1.139   62.780   1.00 102.05 ? 543  PRO D CA    1 
ATOM   6259  C  C     . PRO C  3  127 ? 5.595    -0.301  62.951   1.00 110.12 ? 543  PRO D C     1 
ATOM   6260  O  O     . PRO C  3  127 ? 6.209    -1.259  62.478   1.00 100.24 ? 543  PRO D O     1 
ATOM   6261  C  CB    . PRO C  3  127 ? 5.781    1.829   61.447   1.00 95.27  ? 543  PRO D CB    1 
ATOM   6262  C  CG    . PRO C  3  127 ? 7.102    1.839   60.651   1.00 94.44  ? 543  PRO D CG    1 
ATOM   6263  C  CD    . PRO C  3  127 ? 8.238    1.485   61.593   1.00 96.44  ? 543  PRO D CD    1 
ATOM   6264  N  N     . THR C  3  128 ? 4.490    -0.447  63.692   1.00 121.49 ? 544  THR D N     1 
ATOM   6265  C  CA    . THR C  3  128 ? 3.931    -1.750  64.158   1.00 129.26 ? 544  THR D CA    1 
ATOM   6266  C  C     . THR C  3  128 ? 3.147    -2.424  63.022   1.00 136.20 ? 544  THR D C     1 
ATOM   6267  O  O     . THR C  3  128 ? 2.499    -1.692  62.268   1.00 140.63 ? 544  THR D O     1 
ATOM   6268  C  CB    . THR C  3  128 ? 3.055    -1.523  65.391   1.00 124.26 ? 544  THR D CB    1 
ATOM   6269  O  OG1   . THR C  3  128 ? 2.321    -0.322  65.145   1.00 125.34 ? 544  THR D OG1   1 
ATOM   6270  C  CG2   . THR C  3  128 ? 3.863    -1.405  66.665   1.00 118.31 ? 544  THR D CG2   1 
ATOM   6271  N  N     . GLY C  3  129 ? 3.166    -3.757  62.939   1.00 136.69 ? 545  GLY D N     1 
ATOM   6272  C  CA    . GLY C  3  129 ? 2.294    -4.518  62.021   1.00 133.00 ? 545  GLY D CA    1 
ATOM   6273  C  C     . GLY C  3  129 ? 3.094    -5.383  61.051   1.00 135.05 ? 545  GLY D C     1 
ATOM   6274  O  O     . GLY C  3  129 ? 2.566    -6.388  60.576   1.00 141.12 ? 545  GLY D O     1 
ATOM   6275  N  N     . TYR C  3  130 ? 4.354    -4.993  60.763   1.00 135.37 ? 580  TYR D N     1 
ATOM   6276  C  CA    . TYR C  3  130 ? 5.367    -5.950  60.305   1.00 130.04 ? 580  TYR D CA    1 
ATOM   6277  C  C     . TYR C  3  130 ? 5.817    -6.818  61.491   1.00 138.14 ? 580  TYR D C     1 
ATOM   6278  O  O     . TYR C  3  130 ? 5.906    -6.292  62.625   1.00 144.54 ? 580  TYR D O     1 
ATOM   6279  C  CB    . TYR C  3  130 ? 6.585    -5.266  59.682   1.00 121.98 ? 580  TYR D CB    1 
ATOM   6280  N  N     . LYS C  3  131 ? 6.115    -8.104  61.225   1.00 145.22 ? 581  LYS D N     1 
ATOM   6281  C  CA    . LYS C  3  131 ? 6.511    -9.159  62.204   1.00 145.20 ? 581  LYS D CA    1 
ATOM   6282  C  C     . LYS C  3  131 ? 7.678    -8.654  63.063   1.00 152.13 ? 581  LYS D C     1 
ATOM   6283  O  O     . LYS C  3  131 ? 7.560    -8.737  64.306   1.00 162.82 ? 581  LYS D O     1 
ATOM   6284  C  CB    . LYS C  3  131 ? 6.909    -10.453 61.479   1.00 133.59 ? 581  LYS D CB    1 
ATOM   6285  N  N     . GLY C  3  132 ? 8.748    -8.205  62.414   1.00 148.03 ? 582  GLY D N     1 
ATOM   6286  C  CA    . GLY C  3  132 ? 9.922    -7.582  63.049   1.00 140.99 ? 582  GLY D CA    1 
ATOM   6287  C  C     . GLY C  3  132 ? 10.639   -6.660  62.097   1.00 138.27 ? 582  GLY D C     1 
ATOM   6288  O  O     . GLY C  3  132 ? 9.929    -6.154  61.222   1.00 131.34 ? 582  GLY D O     1 
ATOM   6289  N  N     . LEU C  3  133 ? 11.947   -6.462  62.246   1.00 138.61 ? 583  LEU D N     1 
ATOM   6290  C  CA    . LEU C  3  133 ? 12.722   -5.651  61.264   1.00 134.08 ? 583  LEU D CA    1 
ATOM   6291  C  C     . LEU C  3  133 ? 13.325   -6.586  60.190   1.00 130.55 ? 583  LEU D C     1 
ATOM   6292  O  O     . LEU C  3  133 ? 13.701   -6.081  59.108   1.00 125.54 ? 583  LEU D O     1 
ATOM   6293  C  CB    . LEU C  3  133 ? 13.794   -4.781  61.950   1.00 132.54 ? 583  LEU D CB    1 
ATOM   6294  C  CG    . LEU C  3  133 ? 13.787   -4.579  63.478   1.00 137.07 ? 583  LEU D CG    1 
ATOM   6295  C  CD1   . LEU C  3  133 ? 15.193   -4.724  64.056   1.00 146.49 ? 583  LEU D CD1   1 
ATOM   6296  C  CD2   . LEU C  3  133 ? 13.170   -3.264  63.899   1.00 130.65 ? 583  LEU D CD2   1 
ATOM   6297  N  N     . GLY C  3  134 ? 13.359   -7.896  60.490   1.00 123.00 ? 584  GLY D N     1 
ATOM   6298  C  CA    . GLY C  3  134 ? 13.764   -8.936  59.513   1.00 119.32 ? 584  GLY D CA    1 
ATOM   6299  C  C     . GLY C  3  134 ? 12.705   -9.119  58.441   1.00 122.70 ? 584  GLY D C     1 
ATOM   6300  O  O     . GLY C  3  134 ? 13.045   -9.765  57.408   1.00 97.00  ? 584  GLY D O     1 
ATOM   6301  N  N     . GLU C  3  135 ? 11.490   -8.567  58.677   1.00 133.28 ? 585  GLU D N     1 
ATOM   6302  C  CA    . GLU C  3  135 ? 10.295   -8.619  57.784   1.00 130.19 ? 585  GLU D CA    1 
ATOM   6303  C  C     . GLU C  3  135 ? 10.133   -7.311  56.989   1.00 114.07 ? 585  GLU D C     1 
ATOM   6304  O  O     . GLU C  3  135 ? 9.363    -7.308  56.037   1.00 117.09 ? 585  GLU D O     1 
ATOM   6305  C  CB    . GLU C  3  135 ? 9.037    -8.889  58.628   1.00 125.17 ? 585  GLU D CB    1 
ATOM   6306  C  CG    . GLU C  3  135 ? 7.754    -9.019  57.821   1.00 112.81 ? 585  GLU D CG    1 
ATOM   6307  C  CD    . GLU C  3  135 ? 7.603    -10.296 57.008   1.00 105.87 ? 585  GLU D CD    1 
ATOM   6308  O  OE1   . GLU C  3  135 ? 7.610    -11.380 57.618   1.00 94.46  ? 585  GLU D OE1   1 
ATOM   6309  O  OE2   . GLU C  3  135 ? 7.537    -10.197 55.756   1.00 101.58 ? 585  GLU D OE2   1 
ATOM   6310  N  N     . MET C  3  136 ? 10.822   -6.229  57.384   1.00 96.98  ? 586  MET D N     1 
ATOM   6311  C  CA    . MET C  3  136 ? 10.779   -4.926  56.662   1.00 92.16  ? 586  MET D CA    1 
ATOM   6312  C  C     . MET C  3  136 ? 11.798   -4.962  55.523   1.00 77.61  ? 586  MET D C     1 
ATOM   6313  O  O     . MET C  3  136 ? 12.794   -5.695  55.643   1.00 70.55  ? 586  MET D O     1 
ATOM   6314  C  CB    . MET C  3  136 ? 11.089   -3.756  57.597   1.00 100.00 ? 586  MET D CB    1 
ATOM   6315  C  CG    . MET C  3  136 ? 9.981    -3.538  58.629   1.00 103.87 ? 586  MET D CG    1 
ATOM   6316  S  SD    . MET C  3  136 ? 10.085   -2.041  59.593   1.00 122.07 ? 586  MET D SD    1 
ATOM   6317  C  CE    . MET C  3  136 ? 9.719    -0.804  58.355   1.00 111.82 ? 586  MET D CE    1 
ATOM   6318  N  N     . ASN C  3  137 ? 11.549   -4.190  54.462   1.00 69.74  ? 587  ASN D N     1 
ATOM   6319  C  CA    . ASN C  3  137 ? 12.538   -3.910  53.374   1.00 71.82  ? 587  ASN D CA    1 
ATOM   6320  C  C     . ASN C  3  137 ? 13.413   -2.740  53.830   1.00 76.12  ? 587  ASN D C     1 
ATOM   6321  O  O     . ASN C  3  137 ? 12.918   -1.943  54.640   1.00 88.38  ? 587  ASN D O     1 
ATOM   6322  C  CB    . ASN C  3  137 ? 11.900   -3.604  52.014   1.00 69.81  ? 587  ASN D CB    1 
ATOM   6323  C  CG    . ASN C  3  137 ? 11.004   -4.702  51.481   1.00 65.91  ? 587  ASN D CG    1 
ATOM   6324  O  OD1   . ASN C  3  137 ? 11.179   -5.868  51.819   1.00 55.83  ? 587  ASN D OD1   1 
ATOM   6325  N  ND2   . ASN C  3  137 ? 10.050   -4.336  50.636   1.00 63.49  ? 587  ASN D ND2   1 
ATOM   6326  N  N     . ALA C  3  138 ? 14.644   -2.642  53.327   1.00 78.39  ? 588  ALA D N     1 
ATOM   6327  C  CA    . ALA C  3  138 ? 15.671   -1.654  53.748   1.00 82.82  ? 588  ALA D CA    1 
ATOM   6328  C  C     . ALA C  3  138 ? 15.212   -0.214  53.432   1.00 89.04  ? 588  ALA D C     1 
ATOM   6329  O  O     . ALA C  3  138 ? 15.442   0.667   54.279   1.00 95.93  ? 588  ALA D O     1 
ATOM   6330  C  CB    . ALA C  3  138 ? 16.993   -1.978  53.093   1.00 84.11  ? 588  ALA D CB    1 
ATOM   6331  N  N     . ASP C  3  139 ? 14.590   0.023   52.270   1.00 89.17  ? 589  ASP D N     1 
ATOM   6332  C  CA    . ASP C  3  139 ? 14.129   1.368   51.824   1.00 86.78  ? 589  ASP D CA    1 
ATOM   6333  C  C     . ASP C  3  139 ? 13.183   1.957   52.880   1.00 91.93  ? 589  ASP D C     1 
ATOM   6334  O  O     . ASP C  3  139 ? 13.340   3.158   53.243   1.00 95.40  ? 589  ASP D O     1 
ATOM   6335  C  CB    . ASP C  3  139 ? 13.450   1.303   50.450   1.00 84.16  ? 589  ASP D CB    1 
ATOM   6336  C  CG    . ASP C  3  139 ? 12.290   0.315   50.355   1.00 86.46  ? 589  ASP D CG    1 
ATOM   6337  O  OD1   . ASP C  3  139 ? 12.260   -0.663  51.148   1.00 75.35  ? 589  ASP D OD1   1 
ATOM   6338  O  OD2   . ASP C  3  139 ? 11.421   0.525   49.487   1.00 89.52  ? 589  ASP D OD2   1 
ATOM   6339  N  N     . GLN C  3  140 ? 12.250   1.134   53.365   1.00 95.62  ? 590  GLN D N     1 
ATOM   6340  C  CA    . GLN C  3  140 ? 11.136   1.536   54.265   1.00 94.92  ? 590  GLN D CA    1 
ATOM   6341  C  C     . GLN C  3  140 ? 11.668   1.640   55.698   1.00 86.45  ? 590  GLN D C     1 
ATOM   6342  O  O     . GLN C  3  140 ? 11.237   2.558   56.422   1.00 79.25  ? 590  GLN D O     1 
ATOM   6343  C  CB    . GLN C  3  140 ? 9.963    0.559   54.111   1.00 100.70 ? 590  GLN D CB    1 
ATOM   6344  C  CG    . GLN C  3  140 ? 10.300   -0.902  54.387   1.00 94.50  ? 590  GLN D CG    1 
ATOM   6345  C  CD    . GLN C  3  140 ? 9.422    -1.864  53.634   1.00 82.52  ? 590  GLN D CD    1 
ATOM   6346  O  OE1   . GLN C  3  140 ? 8.953    -2.853  54.198   1.00 80.28  ? 590  GLN D OE1   1 
ATOM   6347  N  NE2   . GLN C  3  140 ? 9.228    -1.596  52.350   1.00 71.23  ? 590  GLN D NE2   1 
ATOM   6348  N  N     . LEU C  3  141 ? 12.594   0.747   56.072   1.00 84.30  ? 591  LEU D N     1 
ATOM   6349  C  CA    . LEU C  3  141 ? 13.261   0.691   57.406   1.00 80.43  ? 591  LEU D CA    1 
ATOM   6350  C  C     . LEU C  3  141 ? 14.096   1.959   57.614   1.00 83.21  ? 591  LEU D C     1 
ATOM   6351  O  O     . LEU C  3  141 ? 14.136   2.443   58.742   1.00 80.35  ? 591  LEU D O     1 
ATOM   6352  C  CB    . LEU C  3  141 ? 14.142   -0.561  57.444   1.00 79.64  ? 591  LEU D CB    1 
ATOM   6353  C  CG    . LEU C  3  141 ? 14.871   -0.856  58.750   1.00 86.86  ? 591  LEU D CG    1 
ATOM   6354  C  CD1   . LEU C  3  141 ? 13.901   -1.034  59.895   1.00 92.00  ? 591  LEU D CD1   1 
ATOM   6355  C  CD2   . LEU C  3  141 ? 15.735   -2.101  58.625   1.00 88.12  ? 591  LEU D CD2   1 
ATOM   6356  N  N     . TRP C  3  142 ? 14.761   2.457   56.565   1.00 89.96  ? 592  TRP D N     1 
ATOM   6357  C  CA    . TRP C  3  142 ? 15.545   3.722   56.590   1.00 91.48  ? 592  TRP D CA    1 
ATOM   6358  C  C     . TRP C  3  142 ? 14.599   4.900   56.852   1.00 77.89  ? 592  TRP D C     1 
ATOM   6359  O  O     . TRP C  3  142 ? 14.856   5.659   57.811   1.00 75.69  ? 592  TRP D O     1 
ATOM   6360  C  CB    . TRP C  3  142 ? 16.349   3.906   55.292   1.00 101.13 ? 592  TRP D CB    1 
ATOM   6361  C  CG    . TRP C  3  142 ? 16.781   5.317   55.023   1.00 106.16 ? 592  TRP D CG    1 
ATOM   6362  C  CD1   . TRP C  3  142 ? 16.192   6.204   54.168   1.00 107.57 ? 592  TRP D CD1   1 
ATOM   6363  C  CD2   . TRP C  3  142 ? 17.892   6.015   55.614   1.00 113.41 ? 592  TRP D CD2   1 
ATOM   6364  N  NE1   . TRP C  3  142 ? 16.847   7.405   54.199   1.00 110.64 ? 592  TRP D NE1   1 
ATOM   6365  C  CE2   . TRP C  3  142 ? 17.896   7.319   55.071   1.00 113.50 ? 592  TRP D CE2   1 
ATOM   6366  C  CE3   . TRP C  3  142 ? 18.873   5.675   56.554   1.00 121.02 ? 592  TRP D CE3   1 
ATOM   6367  C  CZ2   . TRP C  3  142 ? 18.845   8.276   55.431   1.00 114.01 ? 592  TRP D CZ2   1 
ATOM   6368  C  CZ3   . TRP C  3  142 ? 19.814   6.618   56.910   1.00 128.85 ? 592  TRP D CZ3   1 
ATOM   6369  C  CH2   . TRP C  3  142 ? 19.797   7.902   56.354   1.00 127.56 ? 592  TRP D CH2   1 
ATOM   6370  N  N     . GLU C  3  143 ? 13.538   5.023   56.048   1.00 65.61  ? 593  GLU D N     1 
ATOM   6371  C  CA    . GLU C  3  143 ? 12.692   6.243   55.975   1.00 63.15  ? 593  GLU D CA    1 
ATOM   6372  C  C     . GLU C  3  143 ? 11.910   6.446   57.281   1.00 58.20  ? 593  GLU D C     1 
ATOM   6373  O  O     . GLU C  3  143 ? 11.750   7.614   57.697   1.00 44.78  ? 593  GLU D O     1 
ATOM   6374  C  CB    . GLU C  3  143 ? 11.783   6.190   54.743   1.00 63.37  ? 593  GLU D CB    1 
ATOM   6375  C  CG    . GLU C  3  143 ? 12.439   6.761   53.490   1.00 61.23  ? 593  GLU D CG    1 
ATOM   6376  C  CD    . GLU C  3  143 ? 13.248   8.048   53.671   1.00 61.57  ? 593  GLU D CD    1 
ATOM   6377  O  OE1   . GLU C  3  143 ? 13.014   8.783   54.654   1.00 54.33  ? 593  GLU D OE1   1 
ATOM   6378  O  OE2   . GLU C  3  143 ? 14.137   8.312   52.837   1.00 69.30  ? 593  GLU D OE2   1 
ATOM   6379  N  N     . THR C  3  144 ? 11.466   5.357   57.917   1.00 61.38  ? 594  THR D N     1 
ATOM   6380  C  CA    . THR C  3  144 ? 10.605   5.386   59.131   1.00 62.48  ? 594  THR D CA    1 
ATOM   6381  C  C     . THR C  3  144 ? 11.453   5.458   60.411   1.00 65.01  ? 594  THR D C     1 
ATOM   6382  O  O     . THR C  3  144 ? 11.020   6.154   61.343   1.00 58.79  ? 594  THR D O     1 
ATOM   6383  C  CB    . THR C  3  144 ? 9.665    4.176   59.165   1.00 60.48  ? 594  THR D CB    1 
ATOM   6384  O  OG1   . THR C  3  144 ? 10.440   2.975   59.220   1.00 65.63  ? 594  THR D OG1   1 
ATOM   6385  C  CG2   . THR C  3  144 ? 8.724    4.125   57.983   1.00 59.39  ? 594  THR D CG2   1 
ATOM   6386  N  N     . THR C  3  145 ? 12.605   4.782   60.463   1.00 71.01  ? 595  THR D N     1 
ATOM   6387  C  CA    . THR C  3  145 ? 13.261   4.369   61.736   1.00 81.60  ? 595  THR D CA    1 
ATOM   6388  C  C     . THR C  3  145 ? 14.710   4.863   61.873   1.00 84.25  ? 595  THR D C     1 
ATOM   6389  O  O     . THR C  3  145 ? 15.114   5.061   63.024   1.00 92.80  ? 595  THR D O     1 
ATOM   6390  C  CB    . THR C  3  145 ? 13.222   2.841   61.856   1.00 89.22  ? 595  THR D CB    1 
ATOM   6391  O  OG1   . THR C  3  145 ? 11.914   2.454   61.440   1.00 93.19  ? 595  THR D OG1   1 
ATOM   6392  C  CG2   . THR C  3  145 ? 13.557   2.320   63.241   1.00 93.61  ? 595  THR D CG2   1 
ATOM   6393  N  N     . MET C  3  146 ? 15.469   5.009   60.777   1.00 81.23  ? 596  MET D N     1 
ATOM   6394  C  CA    . MET C  3  146 ? 16.942   5.267   60.802   1.00 82.31  ? 596  MET D CA    1 
ATOM   6395  C  C     . MET C  3  146 ? 17.300   6.650   60.232   1.00 77.77  ? 596  MET D C     1 
ATOM   6396  O  O     . MET C  3  146 ? 18.421   7.109   60.508   1.00 76.57  ? 596  MET D O     1 
ATOM   6397  C  CB    . MET C  3  146 ? 17.711   4.221   59.993   1.00 86.15  ? 596  MET D CB    1 
ATOM   6398  C  CG    . MET C  3  146 ? 17.443   2.795   60.420   1.00 92.65  ? 596  MET D CG    1 
ATOM   6399  S  SD    . MET C  3  146 ? 18.544   1.615   59.601   1.00 99.87  ? 596  MET D SD    1 
ATOM   6400  C  CE    . MET C  3  146 ? 20.103   2.015   60.393   1.00 96.36  ? 596  MET D CE    1 
ATOM   6401  N  N     . ASN C  3  147 ? 16.425   7.264   59.429   1.00 79.03  ? 597  ASN D N     1 
ATOM   6402  C  CA    . ASN C  3  147 ? 16.685   8.568   58.760   1.00 82.68  ? 597  ASN D CA    1 
ATOM   6403  C  C     . ASN C  3  147 ? 16.518   9.685   59.783   1.00 77.25  ? 597  ASN D C     1 
ATOM   6404  O  O     . ASN C  3  147 ? 15.414   9.905   60.273   1.00 67.15  ? 597  ASN D O     1 
ATOM   6405  C  CB    . ASN C  3  147 ? 15.755   8.796   57.561   1.00 92.57  ? 597  ASN D CB    1 
ATOM   6406  C  CG    . ASN C  3  147 ? 16.057   10.071  56.804   1.00 95.19  ? 597  ASN D CG    1 
ATOM   6407  O  OD1   . ASN C  3  147 ? 17.159   10.607  56.894   1.00 96.87  ? 597  ASN D OD1   1 
ATOM   6408  N  ND2   . ASN C  3  147 ? 15.077   10.568  56.064   1.00 93.30  ? 597  ASN D ND2   1 
ATOM   6409  N  N     . PRO C  3  148 ? 17.593   10.439  60.134   1.00 76.93  ? 598  PRO D N     1 
ATOM   6410  C  CA    . PRO C  3  148 ? 17.481   11.515  61.125   1.00 76.46  ? 598  PRO D CA    1 
ATOM   6411  C  C     . PRO C  3  148 ? 16.473   12.610  60.749   1.00 77.64  ? 598  PRO D C     1 
ATOM   6412  O  O     . PRO C  3  148 ? 16.111   13.384  61.613   1.00 77.53  ? 598  PRO D O     1 
ATOM   6413  C  CB    . PRO C  3  148 ? 18.886   12.127  61.211   1.00 76.65  ? 598  PRO D CB    1 
ATOM   6414  C  CG    . PRO C  3  148 ? 19.795   11.085  60.604   1.00 77.36  ? 598  PRO D CG    1 
ATOM   6415  C  CD    . PRO C  3  148 ? 18.961   10.294  59.616   1.00 73.87  ? 598  PRO D CD    1 
ATOM   6416  N  N     . GLU C  3  149 ? 16.032   12.647  59.488   1.00 84.67  ? 599  GLU D N     1 
ATOM   6417  C  CA    . GLU C  3  149 ? 15.057   13.646  58.980   1.00 90.87  ? 599  GLU D CA    1 
ATOM   6418  C  C     . GLU C  3  149 ? 13.633   13.286  59.418   1.00 85.24  ? 599  GLU D C     1 
ATOM   6419  O  O     . GLU C  3  149 ? 12.869   14.219  59.675   1.00 80.67  ? 599  GLU D O     1 
ATOM   6420  C  CB    . GLU C  3  149 ? 15.158   13.754  57.456   1.00 100.52 ? 599  GLU D CB    1 
ATOM   6421  C  CG    . GLU C  3  149 ? 16.533   14.178  56.957   1.00 115.88 ? 599  GLU D CG    1 
ATOM   6422  C  CD    . GLU C  3  149 ? 17.149   15.391  57.650   1.00 125.86 ? 599  GLU D CD    1 
ATOM   6423  O  OE1   . GLU C  3  149 ? 16.415   16.361  57.916   1.00 132.16 ? 599  GLU D OE1   1 
ATOM   6424  O  OE2   . GLU C  3  149 ? 18.365   15.361  57.932   1.00 130.50 ? 599  GLU D OE2   1 
ATOM   6425  N  N     . HIS C  3  150 ? 13.271   11.998  59.481   1.00 84.63  ? 600  HIS D N     1 
ATOM   6426  C  CA    . HIS C  3  150 ? 11.867   11.558  59.736   1.00 76.60  ? 600  HIS D CA    1 
ATOM   6427  C  C     . HIS C  3  150 ? 11.748   10.581  60.915   1.00 76.31  ? 600  HIS D C     1 
ATOM   6428  O  O     . HIS C  3  150 ? 10.596   10.348  61.333   1.00 76.83  ? 600  HIS D O     1 
ATOM   6429  C  CB    . HIS C  3  150 ? 11.255   10.962  58.463   1.00 72.03  ? 600  HIS D CB    1 
ATOM   6430  C  CG    . HIS C  3  150 ? 11.477   11.826  57.274   1.00 73.21  ? 600  HIS D CG    1 
ATOM   6431  N  ND1   . HIS C  3  150 ? 12.401   11.513  56.298   1.00 80.57  ? 600  HIS D ND1   1 
ATOM   6432  C  CD2   . HIS C  3  150 ? 10.941   13.015  56.931   1.00 71.62  ? 600  HIS D CD2   1 
ATOM   6433  C  CE1   . HIS C  3  150 ? 12.401   12.462  55.384   1.00 76.09  ? 600  HIS D CE1   1 
ATOM   6434  N  NE2   . HIS C  3  150 ? 11.516   13.393  55.749   1.00 70.00  ? 600  HIS D NE2   1 
ATOM   6435  N  N     . ARG C  3  151 ? 12.853   10.035  61.448   1.00 69.93  ? 601  ARG D N     1 
ATOM   6436  C  CA    . ARG C  3  151 ? 12.812   9.014   62.531   1.00 64.09  ? 601  ARG D CA    1 
ATOM   6437  C  C     . ARG C  3  151 ? 12.351   9.653   63.839   1.00 64.10  ? 601  ARG D C     1 
ATOM   6438  O  O     . ARG C  3  151 ? 12.457   10.876  63.954   1.00 71.18  ? 601  ARG D O     1 
ATOM   6439  C  CB    . ARG C  3  151 ? 14.174   8.355   62.752   1.00 58.15  ? 601  ARG D CB    1 
ATOM   6440  C  CG    . ARG C  3  151 ? 15.156   9.185   63.563   1.00 52.29  ? 601  ARG D CG    1 
ATOM   6441  C  CD    . ARG C  3  151 ? 16.559   8.632   63.393   1.00 48.24  ? 601  ARG D CD    1 
ATOM   6442  N  NE    . ARG C  3  151 ? 17.548   9.320   64.203   1.00 45.77  ? 601  ARG D NE    1 
ATOM   6443  C  CZ    . ARG C  3  151 ? 18.856   9.146   64.104   1.00 47.00  ? 601  ARG D CZ    1 
ATOM   6444  N  NH1   . ARG C  3  151 ? 19.347   8.286   63.233   1.00 49.12  ? 601  ARG D NH1   1 
ATOM   6445  N  NH2   . ARG C  3  151 ? 19.677   9.823   64.885   1.00 50.96  ? 601  ARG D NH2   1 
ATOM   6446  N  N     . ALA C  3  152 ? 11.906   8.824   64.784   1.00 65.96  ? 602  ALA D N     1 
ATOM   6447  C  CA    . ALA C  3  152 ? 11.419   9.221   66.124   1.00 70.11  ? 602  ALA D CA    1 
ATOM   6448  C  C     . ALA C  3  152 ? 12.086   8.329   67.176   1.00 69.92  ? 602  ALA D C     1 
ATOM   6449  O  O     . ALA C  3  152 ? 11.438   7.342   67.616   1.00 80.29  ? 602  ALA D O     1 
ATOM   6450  C  CB    . ALA C  3  152 ? 9.910    9.116   66.176   1.00 75.89  ? 602  ALA D CB    1 
ATOM   6451  N  N     . LEU C  3  153 ? 13.314   8.669   67.585   1.00 63.73  ? 603  LEU D N     1 
ATOM   6452  C  CA    . LEU C  3  153 ? 14.025   7.982   68.702   1.00 60.14  ? 603  LEU D CA    1 
ATOM   6453  C  C     . LEU C  3  153 ? 13.463   8.479   70.038   1.00 59.71  ? 603  LEU D C     1 
ATOM   6454  O  O     . LEU C  3  153 ? 13.046   9.644   70.102   1.00 57.08  ? 603  LEU D O     1 
ATOM   6455  C  CB    . LEU C  3  153 ? 15.531   8.252   68.621   1.00 54.32  ? 603  LEU D CB    1 
ATOM   6456  C  CG    . LEU C  3  153 ? 16.191   7.902   67.293   1.00 52.28  ? 603  LEU D CG    1 
ATOM   6457  C  CD1   . LEU C  3  153 ? 17.701   7.845   67.427   1.00 49.55  ? 603  LEU D CD1   1 
ATOM   6458  C  CD2   . LEU C  3  153 ? 15.671   6.584   66.769   1.00 51.26  ? 603  LEU D CD2   1 
ATOM   6459  N  N     . LEU C  3  154 ? 13.416   7.602   71.042   1.00 55.35  ? 604  LEU D N     1 
ATOM   6460  C  CA    . LEU C  3  154 ? 13.127   7.951   72.452   1.00 51.15  ? 604  LEU D CA    1 
ATOM   6461  C  C     . LEU C  3  154 ? 14.462   7.932   73.195   1.00 56.29  ? 604  LEU D C     1 
ATOM   6462  O  O     . LEU C  3  154 ? 15.161   6.907   73.127   1.00 54.46  ? 604  LEU D O     1 
ATOM   6463  C  CB    . LEU C  3  154 ? 12.148   6.931   73.039   1.00 46.63  ? 604  LEU D CB    1 
ATOM   6464  C  CG    . LEU C  3  154 ? 10.645   7.224   73.028   1.00 48.36  ? 604  LEU D CG    1 
ATOM   6465  C  CD1   . LEU C  3  154 ? 10.156   8.206   71.960   1.00 47.05  ? 604  LEU D CD1   1 
ATOM   6466  C  CD2   . LEU C  3  154 ? 9.860    5.912   72.999   1.00 52.01  ? 604  LEU D CD2   1 
ATOM   6467  N  N     . GLN C  3  155 ? 14.835   9.051   73.815   1.00 66.06  ? 605  GLN D N     1 
ATOM   6468  C  CA    . GLN C  3  155 ? 16.061   9.143   74.643   1.00 76.65  ? 605  GLN D CA    1 
ATOM   6469  C  C     . GLN C  3  155 ? 15.733   8.599   76.038   1.00 87.13  ? 605  GLN D C     1 
ATOM   6470  O  O     . GLN C  3  155 ? 14.772   9.102   76.652   1.00 85.25  ? 605  GLN D O     1 
ATOM   6471  C  CB    . GLN C  3  155 ? 16.567   10.583  74.701   1.00 71.34  ? 605  GLN D CB    1 
ATOM   6472  C  CG    . GLN C  3  155 ? 17.866   10.718  75.477   1.00 63.95  ? 605  GLN D CG    1 
ATOM   6473  C  CD    . GLN C  3  155 ? 18.372   12.136  75.484   1.00 56.41  ? 605  GLN D CD    1 
ATOM   6474  O  OE1   . GLN C  3  155 ? 17.592   13.072  75.609   1.00 50.19  ? 605  GLN D OE1   1 
ATOM   6475  N  NE2   . GLN C  3  155 ? 19.688   12.281  75.440   1.00 51.75  ? 605  GLN D NE2   1 
ATOM   6476  N  N     . VAL C  3  156 ? 16.489   7.605   76.512   1.00 95.79  ? 606  VAL D N     1 
ATOM   6477  C  CA    . VAL C  3  156 ? 16.268   6.987   77.850   1.00 100.32 ? 606  VAL D CA    1 
ATOM   6478  C  C     . VAL C  3  156 ? 16.805   7.963   78.902   1.00 114.92 ? 606  VAL D C     1 
ATOM   6479  O  O     . VAL C  3  156 ? 18.043   8.235   78.871   1.00 115.85 ? 606  VAL D O     1 
ATOM   6480  C  CB    . VAL C  3  156 ? 16.926   5.599   77.971   1.00 100.66 ? 606  VAL D CB    1 
ATOM   6481  C  CG1   . VAL C  3  156 ? 16.739   4.985   79.348   1.00 99.56  ? 606  VAL D CG1   1 
ATOM   6482  C  CG2   . VAL C  3  156 ? 16.410   4.648   76.908   1.00 98.17  ? 606  VAL D CG2   1 
ATOM   6483  N  N     . LYS C  3  157 ? 15.897   8.480   79.745   1.00 127.08 ? 607  LYS D N     1 
ATOM   6484  C  CA    . LYS C  3  157 ? 16.184   9.426   80.859   1.00 125.60 ? 607  LYS D CA    1 
ATOM   6485  C  C     . LYS C  3  157 ? 16.023   8.678   82.188   1.00 114.79 ? 607  LYS D C     1 
ATOM   6486  O  O     . LYS C  3  157 ? 14.967   8.060   82.397   1.00 107.17 ? 607  LYS D O     1 
ATOM   6487  C  CB    . LYS C  3  157 ? 15.254   10.644  80.800   1.00 124.11 ? 607  LYS D CB    1 
ATOM   6488  N  N     . LEU C  3  158 ? 17.053   8.717   83.038   1.00 107.83 ? 608  LEU D N     1 
ATOM   6489  C  CA    . LEU C  3  158 ? 17.024   8.205   84.433   1.00 107.28 ? 608  LEU D CA    1 
ATOM   6490  C  C     . LEU C  3  158 ? 16.654   9.360   85.375   1.00 110.52 ? 608  LEU D C     1 
ATOM   6491  O  O     . LEU C  3  158 ? 17.501   10.248  85.556   1.00 114.65 ? 608  LEU D O     1 
ATOM   6492  C  CB    . LEU C  3  158 ? 18.406   7.628   84.767   1.00 102.74 ? 608  LEU D CB    1 
ATOM   6493  C  CG    . LEU C  3  158 ? 18.688   7.365   86.247   1.00 107.12 ? 608  LEU D CG    1 
ATOM   6494  C  CD1   . LEU C  3  158 ? 17.592   6.529   86.883   1.00 100.58 ? 608  LEU D CD1   1 
ATOM   6495  C  CD2   . LEU C  3  158 ? 20.033   6.668   86.412   1.00 115.85 ? 608  LEU D CD2   1 
ATOM   6496  N  N     . GLU C  3  159 ? 15.451   9.348   85.964   1.00 114.20 ? 609  GLU D N     1 
ATOM   6497  C  CA    . GLU C  3  159 ? 14.979   10.413  86.899   1.00 104.73 ? 609  GLU D CA    1 
ATOM   6498  C  C     . GLU C  3  159 ? 15.390   10.056  88.335   1.00 102.77 ? 609  GLU D C     1 
ATOM   6499  O  O     . GLU C  3  159 ? 16.228   10.767  88.887   1.00 107.45 ? 609  GLU D O     1 
ATOM   6500  C  CB    . GLU C  3  159 ? 13.465   10.636  86.784   1.00 96.69  ? 609  GLU D CB    1 
ATOM   6501  C  CG    . GLU C  3  159 ? 13.061   11.343  85.506   1.00 98.84  ? 609  GLU D CG    1 
ATOM   6502  C  CD    . GLU C  3  159 ? 11.812   12.218  85.555   1.00 89.73  ? 609  GLU D CD    1 
ATOM   6503  O  OE1   . GLU C  3  159 ? 11.321   12.586  86.654   1.00 80.41  ? 609  GLU D OE1   1 
ATOM   6504  O  OE2   . GLU C  3  159 ? 11.340   12.550  84.470   1.00 81.20  ? 609  GLU D OE2   1 
ATOM   6505  N  N     . ASP C  3  160 ? 14.810   8.998   88.906   1.00 98.85  ? 610  ASP D N     1 
ATOM   6506  C  CA    . ASP C  3  160 ? 15.010   8.579   90.321   1.00 93.02  ? 610  ASP D CA    1 
ATOM   6507  C  C     . ASP C  3  160 ? 15.850   7.293   90.356   1.00 98.24  ? 610  ASP D C     1 
ATOM   6508  O  O     . ASP C  3  160 ? 15.317   6.225   89.982   1.00 114.08 ? 610  ASP D O     1 
ATOM   6509  C  CB    . ASP C  3  160 ? 13.655   8.392   91.017   1.00 83.80  ? 610  ASP D CB    1 
ATOM   6510  C  CG    . ASP C  3  160 ? 13.721   8.197   92.523   1.00 73.51  ? 610  ASP D CG    1 
ATOM   6511  O  OD1   . ASP C  3  160 ? 14.815   7.882   93.035   1.00 61.39  ? 610  ASP D OD1   1 
ATOM   6512  O  OD2   . ASP C  3  160 ? 12.664   8.363   93.167   1.00 68.97  ? 610  ASP D OD2   1 
ATOM   6513  N  N     . ALA C  3  161 ? 17.108   7.384   90.808   1.00 86.79  ? 611  ALA D N     1 
ATOM   6514  C  CA    . ALA C  3  161 ? 18.069   6.252   90.865   1.00 79.56  ? 611  ALA D CA    1 
ATOM   6515  C  C     . ALA C  3  161 ? 17.621   5.214   91.904   1.00 81.29  ? 611  ALA D C     1 
ATOM   6516  O  O     . ALA C  3  161 ? 17.854   4.026   91.658   1.00 90.71  ? 611  ALA D O     1 
ATOM   6517  C  CB    . ALA C  3  161 ? 19.459   6.762   91.161   1.00 71.54  ? 611  ALA D CB    1 
ATOM   6518  N  N     . ILE C  3  162 ? 17.008   5.634   93.016   1.00 87.55  ? 612  ILE D N     1 
ATOM   6519  C  CA    . ILE C  3  162 ? 16.485   4.723   94.084   1.00 91.22  ? 612  ILE D CA    1 
ATOM   6520  C  C     . ILE C  3  162 ? 15.337   3.891   93.483   1.00 84.58  ? 612  ILE D C     1 
ATOM   6521  O  O     . ILE C  3  162 ? 15.351   2.651   93.658   1.00 94.47  ? 612  ILE D O     1 
ATOM   6522  C  CB    . ILE C  3  162 ? 16.020   5.503   95.342   1.00 91.75  ? 612  ILE D CB    1 
ATOM   6523  C  CG1   . ILE C  3  162 ? 17.147   6.275   96.039   1.00 95.70  ? 612  ILE D CG1   1 
ATOM   6524  C  CG2   . ILE C  3  162 ? 15.254   4.597   96.299   1.00 83.02  ? 612  ILE D CG2   1 
ATOM   6525  C  CD1   . ILE C  3  162 ? 18.297   5.436   96.550   1.00 95.11  ? 612  ILE D CD1   1 
ATOM   6526  N  N     . GLU C  3  163 ? 14.385   4.541   92.801   1.00 75.16  ? 613  GLU D N     1 
ATOM   6527  C  CA    . GLU C  3  163 ? 13.187   3.891   92.201   1.00 69.99  ? 613  GLU D CA    1 
ATOM   6528  C  C     . GLU C  3  163 ? 13.630   2.957   91.070   1.00 68.26  ? 613  GLU D C     1 
ATOM   6529  O  O     . GLU C  3  163 ? 13.004   1.893   90.907   1.00 68.17  ? 613  GLU D O     1 
ATOM   6530  C  CB    . GLU C  3  163 ? 12.190   4.929   91.681   1.00 73.99  ? 613  GLU D CB    1 
ATOM   6531  C  CG    . GLU C  3  163 ? 10.791   4.366   91.484   1.00 74.61  ? 613  GLU D CG    1 
ATOM   6532  C  CD    . GLU C  3  163 ? 9.880    5.163   90.561   1.00 77.04  ? 613  GLU D CD    1 
ATOM   6533  O  OE1   . GLU C  3  163 ? 10.367   6.087   89.859   1.00 75.40  ? 613  GLU D OE1   1 
ATOM   6534  O  OE2   . GLU C  3  163 ? 8.674    4.850   90.537   1.00 71.92  ? 613  GLU D OE2   1 
ATOM   6535  N  N     . ALA C  3  164 ? 14.663   3.341   90.317   1.00 69.08  ? 614  ALA D N     1 
ATOM   6536  C  CA    . ALA C  3  164 ? 15.261   2.530   89.228   1.00 70.19  ? 614  ALA D CA    1 
ATOM   6537  C  C     . ALA C  3  164 ? 15.881   1.249   89.811   1.00 70.38  ? 614  ALA D C     1 
ATOM   6538  O  O     . ALA C  3  164 ? 15.579   0.163   89.282   1.00 66.57  ? 614  ALA D O     1 
ATOM   6539  C  CB    . ALA C  3  164 ? 16.267   3.350   88.459   1.00 64.48  ? 614  ALA D CB    1 
ATOM   6540  N  N     . ASP C  3  165 ? 16.683   1.364   90.877   1.00 75.82  ? 615  ASP D N     1 
ATOM   6541  C  CA    . ASP C  3  165 ? 17.342   0.213   91.559   1.00 87.72  ? 615  ASP D CA    1 
ATOM   6542  C  C     . ASP C  3  165 ? 16.292   -0.805  92.008   1.00 94.03  ? 615  ASP D C     1 
ATOM   6543  O  O     . ASP C  3  165 ? 16.579   -2.010  91.917   1.00 96.53  ? 615  ASP D O     1 
ATOM   6544  C  CB    . ASP C  3  165 ? 18.148   0.642   92.790   1.00 95.95  ? 615  ASP D CB    1 
ATOM   6545  C  CG    . ASP C  3  165 ? 19.451   1.355   92.478   1.00 103.54 ? 615  ASP D CG    1 
ATOM   6546  O  OD1   . ASP C  3  165 ? 20.194   0.853   91.601   1.00 101.67 ? 615  ASP D OD1   1 
ATOM   6547  O  OD2   . ASP C  3  165 ? 19.702   2.408   93.115   1.00 105.46 ? 615  ASP D OD2   1 
ATOM   6548  N  N     . GLN C  3  166 ? 15.141   -0.333  92.506   1.00 103.03 ? 616  GLN D N     1 
ATOM   6549  C  CA    . GLN C  3  166 ? 14.052   -1.204  93.031   1.00 113.98 ? 616  GLN D CA    1 
ATOM   6550  C  C     . GLN C  3  166 ? 13.375   -1.905  91.846   1.00 126.48 ? 616  GLN D C     1 
ATOM   6551  O  O     . GLN C  3  166 ? 13.056   -3.108  91.989   1.00 138.96 ? 616  GLN D O     1 
ATOM   6552  C  CB    . GLN C  3  166 ? 13.074   -0.411  93.912   1.00 108.23 ? 616  GLN D CB    1 
ATOM   6553  C  CG    . GLN C  3  166 ? 11.693   -0.128  93.324   1.00 107.52 ? 616  GLN D CG    1 
ATOM   6554  C  CD    . GLN C  3  166 ? 10.674   -1.211  93.591   1.00 108.00 ? 616  GLN D CD    1 
ATOM   6555  O  OE1   . GLN C  3  166 ? 10.869   -2.075  94.438   1.00 130.39 ? 616  GLN D OE1   1 
ATOM   6556  N  NE2   . GLN C  3  166 ? 9.575    -1.167  92.860   1.00 84.18  ? 616  GLN D NE2   1 
ATOM   6557  N  N     . THR C  3  167 ? 13.193   -1.197  90.721   1.00 116.58 ? 617  THR D N     1 
ATOM   6558  C  CA    . THR C  3  167 ? 12.433   -1.686  89.535   1.00 98.06  ? 617  THR D CA    1 
ATOM   6559  C  C     . THR C  3  167 ? 13.234   -2.795  88.835   1.00 94.57  ? 617  THR D C     1 
ATOM   6560  O  O     . THR C  3  167 ? 12.624   -3.823  88.505   1.00 99.10  ? 617  THR D O     1 
ATOM   6561  C  CB    . THR C  3  167 ? 12.040   -0.536  88.599   1.00 87.76  ? 617  THR D CB    1 
ATOM   6562  O  OG1   . THR C  3  167 ? 11.095   0.267   89.296   1.00 83.41  ? 617  THR D OG1   1 
ATOM   6563  C  CG2   . THR C  3  167 ? 11.414   -0.999  87.302   1.00 82.18  ? 617  THR D CG2   1 
ATOM   6564  N  N     . PHE C  3  168 ? 14.541   -2.605  88.630   1.00 82.91  ? 618  PHE D N     1 
ATOM   6565  C  CA    . PHE C  3  168 ? 15.428   -3.622  88.011   1.00 78.96  ? 618  PHE D CA    1 
ATOM   6566  C  C     . PHE C  3  168 ? 15.503   -4.860  88.913   1.00 77.53  ? 618  PHE D C     1 
ATOM   6567  O  O     . PHE C  3  168 ? 15.394   -5.987  88.396   1.00 73.36  ? 618  PHE D O     1 
ATOM   6568  C  CB    . PHE C  3  168 ? 16.806   -3.038  87.702   1.00 76.92  ? 618  PHE D CB    1 
ATOM   6569  C  CG    . PHE C  3  168 ? 16.837   -2.201  86.448   1.00 84.68  ? 618  PHE D CG    1 
ATOM   6570  C  CD1   . PHE C  3  168 ? 16.941   -2.794  85.197   1.00 86.55  ? 618  PHE D CD1   1 
ATOM   6571  C  CD2   . PHE C  3  168 ? 16.741   -0.818  86.515   1.00 86.73  ? 618  PHE D CD2   1 
ATOM   6572  C  CE1   . PHE C  3  168 ? 16.951   -2.022  84.044   1.00 83.08  ? 618  PHE D CE1   1 
ATOM   6573  C  CE2   . PHE C  3  168 ? 16.762   -0.050  85.363   1.00 82.83  ? 618  PHE D CE2   1 
ATOM   6574  C  CZ    . PHE C  3  168 ? 16.869   -0.651  84.130   1.00 80.49  ? 618  PHE D CZ    1 
ATOM   6575  N  N     . GLU C  3  169 ? 15.653   -4.661  90.226   1.00 85.38  ? 619  GLU D N     1 
ATOM   6576  C  CA    . GLU C  3  169 ? 15.764   -5.765  91.215   1.00 83.55  ? 619  GLU D CA    1 
ATOM   6577  C  C     . GLU C  3  169 ? 14.457   -6.563  91.233   1.00 73.83  ? 619  GLU D C     1 
ATOM   6578  O  O     . GLU C  3  169 ? 14.534   -7.794  91.407   1.00 84.68  ? 619  GLU D O     1 
ATOM   6579  C  CB    . GLU C  3  169 ? 16.107   -5.199  92.600   1.00 88.02  ? 619  GLU D CB    1 
ATOM   6580  C  CG    . GLU C  3  169 ? 16.419   -6.227  93.673   1.00 92.04  ? 619  GLU D CG    1 
ATOM   6581  C  CD    . GLU C  3  169 ? 16.051   -5.805  95.094   1.00 93.32  ? 619  GLU D CD    1 
ATOM   6582  O  OE1   . GLU C  3  169 ? 15.532   -4.678  95.299   1.00 88.29  ? 619  GLU D OE1   1 
ATOM   6583  O  OE2   . GLU C  3  169 ? 16.277   -6.614  95.989   1.00 93.84  ? 619  GLU D OE2   1 
ATOM   6584  N  N     . MET C  3  170 ? 13.305   -5.900  91.056   1.00 65.83  ? 620  MET D N     1 
ATOM   6585  C  CA    . MET C  3  170 ? 11.974   -6.555  91.136   1.00 72.82  ? 620  MET D CA    1 
ATOM   6586  C  C     . MET C  3  170 ? 11.685   -7.336  89.848   1.00 70.74  ? 620  MET D C     1 
ATOM   6587  O  O     . MET C  3  170 ? 11.271   -8.494  89.954   1.00 74.11  ? 620  MET D O     1 
ATOM   6588  C  CB    . MET C  3  170 ? 10.869   -5.523  91.349   1.00 83.41  ? 620  MET D CB    1 
ATOM   6589  C  CG    . MET C  3  170 ? 9.487    -6.090  91.237   1.00 92.60  ? 620  MET D CG    1 
ATOM   6590  S  SD    . MET C  3  170 ? 8.243    -4.808  91.493   1.00 110.59 ? 620  MET D SD    1 
ATOM   6591  C  CE    . MET C  3  170 ? 8.340    -3.945  89.924   1.00 114.55 ? 620  MET D CE    1 
ATOM   6592  N  N     . LEU C  3  171 ? 11.858   -6.712  88.680   1.00 62.80  ? 621  LEU D N     1 
ATOM   6593  C  CA    . LEU C  3  171 ? 11.527   -7.311  87.360   1.00 58.13  ? 621  LEU D CA    1 
ATOM   6594  C  C     . LEU C  3  171 ? 12.590   -8.339  86.965   1.00 61.84  ? 621  LEU D C     1 
ATOM   6595  O  O     . LEU C  3  171 ? 12.194   -9.408  86.457   1.00 82.29  ? 621  LEU D O     1 
ATOM   6596  C  CB    . LEU C  3  171 ? 11.445   -6.221  86.288   1.00 58.42  ? 621  LEU D CB    1 
ATOM   6597  C  CG    . LEU C  3  171 ? 10.407   -5.121  86.509   1.00 56.64  ? 621  LEU D CG    1 
ATOM   6598  C  CD1   . LEU C  3  171 ? 10.356   -4.209  85.294   1.00 56.97  ? 621  LEU D CD1   1 
ATOM   6599  C  CD2   . LEU C  3  171 ? 9.029    -5.689  86.807   1.00 56.19  ? 621  LEU D CD2   1 
ATOM   6600  N  N     . MET C  3  172 ? 13.877   -8.036  87.152   1.00 63.35  ? 622  MET D N     1 
ATOM   6601  C  CA    . MET C  3  172 ? 14.990   -8.828  86.558   1.00 69.59  ? 622  MET D CA    1 
ATOM   6602  C  C     . MET C  3  172 ? 15.754   -9.621  87.632   1.00 74.87  ? 622  MET D C     1 
ATOM   6603  O  O     . MET C  3  172 ? 16.675   -10.367 87.248   1.00 69.22  ? 622  MET D O     1 
ATOM   6604  C  CB    . MET C  3  172 ? 15.975   -7.918  85.821   1.00 74.06  ? 622  MET D CB    1 
ATOM   6605  C  CG    . MET C  3  172 ? 15.289   -6.872  84.950   1.00 83.44  ? 622  MET D CG    1 
ATOM   6606  S  SD    . MET C  3  172 ? 14.121   -7.587  83.746   1.00 100.08 ? 622  MET D SD    1 
ATOM   6607  C  CE    . MET C  3  172 ? 15.278   -8.334  82.592   1.00 90.14  ? 622  MET D CE    1 
ATOM   6608  N  N     . GLY C  3  173 ? 15.392   -9.486  88.918   1.00 78.91  ? 623  GLY D N     1 
ATOM   6609  C  CA    . GLY C  3  173 ? 16.076   -10.159 90.042   1.00 73.65  ? 623  GLY D CA    1 
ATOM   6610  C  C     . GLY C  3  173 ? 15.655   -11.610 90.196   1.00 70.91  ? 623  GLY D C     1 
ATOM   6611  O  O     . GLY C  3  173 ? 14.689   -12.023 89.531   1.00 69.34  ? 623  GLY D O     1 
ATOM   6612  N  N     . ASP C  3  174 ? 16.356   -12.374 91.043   1.00 70.71  ? 624  ASP D N     1 
ATOM   6613  C  CA    . ASP C  3  174 ? 16.134   -13.836 91.233   1.00 58.50  ? 624  ASP D CA    1 
ATOM   6614  C  C     . ASP C  3  174 ? 14.888   -14.087 92.101   1.00 52.53  ? 624  ASP D C     1 
ATOM   6615  O  O     . ASP C  3  174 ? 14.418   -15.226 92.088   1.00 46.62  ? 624  ASP D O     1 
ATOM   6616  C  CB    . ASP C  3  174 ? 17.381   -14.523 91.807   1.00 52.84  ? 624  ASP D CB    1 
ATOM   6617  N  N     . VAL C  3  175 ? 14.346   -13.082 92.802   1.00 52.12  ? 625  VAL D N     1 
ATOM   6618  C  CA    . VAL C  3  175 ? 13.145   -13.249 93.680   1.00 55.83  ? 625  VAL D CA    1 
ATOM   6619  C  C     . VAL C  3  175 ? 11.875   -13.219 92.817   1.00 58.40  ? 625  VAL D C     1 
ATOM   6620  O  O     . VAL C  3  175 ? 11.482   -12.125 92.351   1.00 58.78  ? 625  VAL D O     1 
ATOM   6621  C  CB    . VAL C  3  175 ? 13.072   -12.194 94.802   1.00 56.53  ? 625  VAL D CB    1 
ATOM   6622  C  CG1   . VAL C  3  175 ? 11.860   -12.419 95.698   1.00 50.39  ? 625  VAL D CG1   1 
ATOM   6623  C  CG2   . VAL C  3  175 ? 14.350   -12.146 95.628   1.00 60.16  ? 625  VAL D CG2   1 
ATOM   6624  N  N     . VAL C  3  176 ? 11.225   -14.376 92.668   1.00 60.95  ? 626  VAL D N     1 
ATOM   6625  C  CA    . VAL C  3  176 ? 10.062   -14.588 91.754   1.00 60.45  ? 626  VAL D CA    1 
ATOM   6626  C  C     . VAL C  3  176 ? 8.819    -13.913 92.339   1.00 59.46  ? 626  VAL D C     1 
ATOM   6627  O  O     . VAL C  3  176 ? 8.017    -13.405 91.547   1.00 58.41  ? 626  VAL D O     1 
ATOM   6628  C  CB    . VAL C  3  176 ? 9.824    -16.088 91.493   1.00 60.31  ? 626  VAL D CB    1 
ATOM   6629  C  CG1   . VAL C  3  176 ? 8.519    -16.354 90.757   1.00 57.50  ? 626  VAL D CG1   1 
ATOM   6630  C  CG2   . VAL C  3  176 ? 10.990   -16.705 90.745   1.00 60.34  ? 626  VAL D CG2   1 
ATOM   6631  N  N     . GLU C  3  177 ? 8.646    -13.919 93.656   1.00 61.65  ? 627  GLU D N     1 
ATOM   6632  C  CA    . GLU C  3  177 ? 7.378    -13.510 94.312   1.00 75.53  ? 627  GLU D CA    1 
ATOM   6633  C  C     . GLU C  3  177 ? 7.101    -12.017 94.060   1.00 74.54  ? 627  GLU D C     1 
ATOM   6634  O  O     . GLU C  3  177 ? 5.947    -11.676 93.748   1.00 67.15  ? 627  GLU D O     1 
ATOM   6635  C  CB    . GLU C  3  177 ? 7.419    -13.883 95.798   1.00 85.63  ? 627  GLU D CB    1 
ATOM   6636  C  CG    . GLU C  3  177 ? 6.160    -13.511 96.571   1.00 94.29  ? 627  GLU D CG    1 
ATOM   6637  C  CD    . GLU C  3  177 ? 4.826    -13.855 95.923   1.00 99.37  ? 627  GLU D CD    1 
ATOM   6638  O  OE1   . GLU C  3  177 ? 4.769    -14.802 95.100   1.00 89.03  ? 627  GLU D OE1   1 
ATOM   6639  O  OE2   . GLU C  3  177 ? 3.829    -13.157 96.233   1.00 110.99 ? 627  GLU D OE2   1 
ATOM   6640  N  N     . ASN C  3  178 ? 8.113    -11.154 94.167   1.00 78.62  ? 628  ASN D N     1 
ATOM   6641  C  CA    . ASN C  3  178 ? 7.976    -9.685  93.941   1.00 80.37  ? 628  ASN D CA    1 
ATOM   6642  C  C     . ASN C  3  178 ? 7.575    -9.427  92.484   1.00 92.16  ? 628  ASN D C     1 
ATOM   6643  O  O     . ASN C  3  178 ? 6.705    -8.565  92.250   1.00 89.73  ? 628  ASN D O     1 
ATOM   6644  C  CB    . ASN C  3  178 ? 9.264    -8.935  94.300   1.00 75.09  ? 628  ASN D CB    1 
ATOM   6645  C  CG    . ASN C  3  178 ? 9.680    -9.183  95.737   1.00 70.75  ? 628  ASN D CG    1 
ATOM   6646  O  OD1   . ASN C  3  178 ? 8.831    -9.349  96.615   1.00 59.24  ? 628  ASN D OD1   1 
ATOM   6647  N  ND2   . ASN C  3  178 ? 10.981   -9.237  95.983   1.00 72.07  ? 628  ASN D ND2   1 
ATOM   6648  N  N     . ARG C  3  179 ? 8.194    -10.146 91.547   1.00 102.74 ? 629  ARG D N     1 
ATOM   6649  C  CA    . ARG C  3  179 ? 7.908    -10.094 90.085   1.00 91.53  ? 629  ARG D CA    1 
ATOM   6650  C  C     . ARG C  3  179 ? 6.451    -10.509 89.839   1.00 98.49  ? 629  ARG D C     1 
ATOM   6651  O  O     . ARG C  3  179 ? 5.757    -9.798  89.107   1.00 89.20  ? 629  ARG D O     1 
ATOM   6652  C  CB    . ARG C  3  179 ? 8.902    -10.987 89.332   1.00 78.54  ? 629  ARG D CB    1 
ATOM   6653  C  CG    . ARG C  3  179 ? 8.585    -11.164 87.858   1.00 71.59  ? 629  ARG D CG    1 
ATOM   6654  C  CD    . ARG C  3  179 ? 9.758    -11.713 87.056   1.00 62.73  ? 629  ARG D CD    1 
ATOM   6655  N  NE    . ARG C  3  179 ? 10.502   -12.760 87.745   1.00 53.61  ? 629  ARG D NE    1 
ATOM   6656  C  CZ    . ARG C  3  179 ? 11.680   -12.600 88.342   1.00 52.68  ? 629  ARG D CZ    1 
ATOM   6657  N  NH1   . ARG C  3  179 ? 12.269   -11.413 88.358   1.00 60.44  ? 629  ARG D NH1   1 
ATOM   6658  N  NH2   . ARG C  3  179 ? 12.261   -13.623 88.942   1.00 47.64  ? 629  ARG D NH2   1 
ATOM   6659  N  N     . ARG C  3  180 ? 6.011    -11.626 90.426   1.00 102.13 ? 630  ARG D N     1 
ATOM   6660  C  CA    . ARG C  3  180 ? 4.634    -12.167 90.255   1.00 100.52 ? 630  ARG D CA    1 
ATOM   6661  C  C     . ARG C  3  180 ? 3.627    -11.159 90.817   1.00 91.59  ? 630  ARG D C     1 
ATOM   6662  O  O     . ARG C  3  180 ? 2.604    -10.926 90.161   1.00 91.11  ? 630  ARG D O     1 
ATOM   6663  C  CB    . ARG C  3  180 ? 4.488    -13.528 90.944   1.00 108.13 ? 630  ARG D CB    1 
ATOM   6664  C  CG    . ARG C  3  180 ? 3.130    -14.183 90.754   1.00 115.41 ? 630  ARG D CG    1 
ATOM   6665  C  CD    . ARG C  3  180 ? 2.743    -15.050 91.941   1.00 123.29 ? 630  ARG D CD    1 
ATOM   6666  N  NE    . ARG C  3  180 ? 2.503    -14.235 93.121   1.00 131.42 ? 630  ARG D NE    1 
ATOM   6667  C  CZ    . ARG C  3  180 ? 1.430    -13.471 93.320   1.00 143.33 ? 630  ARG D CZ    1 
ATOM   6668  N  NH1   . ARG C  3  180 ? 0.459    -13.412 92.420   1.00 142.32 ? 630  ARG D NH1   1 
ATOM   6669  N  NH2   . ARG C  3  180 ? 1.330    -12.758 94.425   1.00 154.92 ? 630  ARG D NH2   1 
ATOM   6670  N  N     . GLN C  3  181 ? 3.922    -10.596 91.991   1.00 80.80  ? 631  GLN D N     1 
ATOM   6671  C  CA    . GLN C  3  181 ? 3.065    -9.601  92.691   1.00 72.10  ? 631  GLN D CA    1 
ATOM   6672  C  C     . GLN C  3  181 ? 2.850    -8.411  91.757   1.00 71.58  ? 631  GLN D C     1 
ATOM   6673  O  O     . GLN C  3  181 ? 1.697    -8.015  91.565   1.00 72.52  ? 631  GLN D O     1 
ATOM   6674  C  CB    . GLN C  3  181 ? 3.705    -9.137  94.003   1.00 67.41  ? 631  GLN D CB    1 
ATOM   6675  C  CG    . GLN C  3  181 ? 2.784    -8.288  94.863   1.00 65.08  ? 631  GLN D CG    1 
ATOM   6676  C  CD    . GLN C  3  181 ? 1.551    -9.045  95.297   1.00 64.24  ? 631  GLN D CD    1 
ATOM   6677  O  OE1   . GLN C  3  181 ? 1.650    -10.148 95.836   1.00 62.78  ? 631  GLN D OE1   1 
ATOM   6678  N  NE2   . GLN C  3  181 ? 0.382    -8.462  95.052   1.00 60.11  ? 631  GLN D NE2   1 
ATOM   6679  N  N     . PHE C  3  182 ? 3.938    -7.892  91.193   1.00 73.90  ? 632  PHE D N     1 
ATOM   6680  C  CA    . PHE C  3  182 ? 3.958    -6.746  90.244   1.00 78.04  ? 632  PHE D CA    1 
ATOM   6681  C  C     . PHE C  3  182 ? 3.004    -7.018  89.071   1.00 85.39  ? 632  PHE D C     1 
ATOM   6682  O  O     . PHE C  3  182 ? 2.241    -6.098  88.706   1.00 78.63  ? 632  PHE D O     1 
ATOM   6683  C  CB    . PHE C  3  182 ? 5.372    -6.471  89.729   1.00 74.23  ? 632  PHE D CB    1 
ATOM   6684  C  CG    . PHE C  3  182 ? 5.392    -5.610  88.495   1.00 73.46  ? 632  PHE D CG    1 
ATOM   6685  C  CD1   . PHE C  3  182 ? 4.959    -4.299  88.538   1.00 73.59  ? 632  PHE D CD1   1 
ATOM   6686  C  CD2   . PHE C  3  182 ? 5.785    -6.132  87.275   1.00 85.22  ? 632  PHE D CD2   1 
ATOM   6687  C  CE1   . PHE C  3  182 ? 4.945    -3.517  87.396   1.00 77.30  ? 632  PHE D CE1   1 
ATOM   6688  C  CE2   . PHE C  3  182 ? 5.772    -5.349  86.131   1.00 84.97  ? 632  PHE D CE2   1 
ATOM   6689  C  CZ    . PHE C  3  182 ? 5.347    -4.045  86.193   1.00 80.91  ? 632  PHE D CZ    1 
ATOM   6690  N  N     . ILE C  3  183 ? 3.053    -8.234  88.506   1.00 91.12  ? 633  ILE D N     1 
ATOM   6691  C  CA    . ILE C  3  183 ? 2.250    -8.642  87.311   1.00 85.40  ? 633  ILE D CA    1 
ATOM   6692  C  C     . ILE C  3  183 ? 0.765    -8.636  87.701   1.00 88.49  ? 633  ILE D C     1 
ATOM   6693  O  O     . ILE C  3  183 ? -0.019   -7.998  86.983   1.00 83.74  ? 633  ILE D O     1 
ATOM   6694  C  CB    . ILE C  3  183 ? 2.684    -10.011 86.746   1.00 82.30  ? 633  ILE D CB    1 
ATOM   6695  C  CG1   . ILE C  3  183 ? 4.146    -10.045 86.305   1.00 78.96  ? 633  ILE D CG1   1 
ATOM   6696  C  CG2   . ILE C  3  183 ? 1.767    -10.419 85.602   1.00 81.13  ? 633  ILE D CG2   1 
ATOM   6697  C  CD1   . ILE C  3  183 ? 4.703    -11.454 86.171   1.00 77.35  ? 633  ILE D CD1   1 
ATOM   6698  N  N     . GLU C  3  184 ? 0.401    -9.318  88.796   1.00 90.37  ? 634  GLU D N     1 
ATOM   6699  C  CA    . GLU C  3  184 ? -0.998   -9.403  89.301   1.00 85.79  ? 634  GLU D CA    1 
ATOM   6700  C  C     . GLU C  3  184 ? -1.531   -7.983  89.532   1.00 83.96  ? 634  GLU D C     1 
ATOM   6701  O  O     . GLU C  3  184 ? -2.644   -7.690  89.061   1.00 74.29  ? 634  GLU D O     1 
ATOM   6702  C  CB    . GLU C  3  184 ? -1.087   -10.250 90.573   1.00 81.64  ? 634  GLU D CB    1 
ATOM   6703  C  CG    . GLU C  3  184 ? -2.488   -10.305 91.189   1.00 84.49  ? 634  GLU D CG    1 
ATOM   6704  C  CD    . GLU C  3  184 ? -2.544   -10.768 92.640   1.00 82.89  ? 634  GLU D CD    1 
ATOM   6705  O  OE1   . GLU C  3  184 ? -3.145   -10.083 93.554   1.00 81.22  ? 634  GLU D OE1   1 
ATOM   6706  O  OE2   . GLU C  3  184 ? -2.017   -11.852 92.857   1.00 87.57  ? 634  GLU D OE2   1 
ATOM   6707  N  N     . ASP C  3  185 ? -0.749   -7.142  90.218   1.00 88.50  ? 635  ASP D N     1 
ATOM   6708  C  CA    . ASP C  3  185 ? -1.106   -5.745  90.594   1.00 91.51  ? 635  ASP D CA    1 
ATOM   6709  C  C     . ASP C  3  185 ? -1.392   -4.931  89.326   1.00 89.56  ? 635  ASP D C     1 
ATOM   6710  O  O     . ASP C  3  185 ? -2.385   -4.197  89.312   1.00 91.13  ? 635  ASP D O     1 
ATOM   6711  C  CB    . ASP C  3  185 ? 0.006    -5.078  91.413   1.00 86.99  ? 635  ASP D CB    1 
ATOM   6712  C  CG    . ASP C  3  185 ? 0.121    -5.589  92.853   1.00 81.92  ? 635  ASP D CG    1 
ATOM   6713  O  OD1   . ASP C  3  185 ? -0.797   -6.291  93.317   1.00 75.17  ? 635  ASP D OD1   1 
ATOM   6714  O  OD2   . ASP C  3  185 ? 1.134    -5.281  93.510   1.00 81.18  ? 635  ASP D OD2   1 
ATOM   6715  N  N     . ASN C  3  186 ? -0.545   -5.064  88.307   1.00 86.78  ? 636  ASN D N     1 
ATOM   6716  C  CA    . ASN C  3  186 ? -0.548   -4.210  87.089   1.00 88.66  ? 636  ASN D CA    1 
ATOM   6717  C  C     . ASN C  3  186 ? -1.232   -4.918  85.915   1.00 84.17  ? 636  ASN D C     1 
ATOM   6718  O  O     . ASN C  3  186 ? -1.215   -4.357  84.820   1.00 88.31  ? 636  ASN D O     1 
ATOM   6719  C  CB    . ASN C  3  186 ? 0.877    -3.822  86.687   1.00 95.65  ? 636  ASN D CB    1 
ATOM   6720  C  CG    . ASN C  3  186 ? 1.493    -2.816  87.632   1.00 101.64 ? 636  ASN D CG    1 
ATOM   6721  O  OD1   . ASN C  3  186 ? 1.714    -1.668  87.249   1.00 96.46  ? 636  ASN D OD1   1 
ATOM   6722  N  ND2   . ASN C  3  186 ? 1.773    -3.235  88.862   1.00 109.08 ? 636  ASN D ND2   1 
ATOM   6723  N  N     . ALA C  3  187 ? -1.820   -6.102  86.109   1.00 82.36  ? 637  ALA D N     1 
ATOM   6724  C  CA    . ALA C  3  187 ? -2.518   -6.844  85.035   1.00 85.35  ? 637  ALA D CA    1 
ATOM   6725  C  C     . ALA C  3  187 ? -3.699   -5.988  84.576   1.00 77.81  ? 637  ALA D C     1 
ATOM   6726  O  O     . ALA C  3  187 ? -4.462   -5.494  85.447   1.00 81.67  ? 637  ALA D O     1 
ATOM   6727  C  CB    . ALA C  3  187 ? -2.974   -8.211  85.489   1.00 89.28  ? 637  ALA D CB    1 
ATOM   6728  N  N     . VAL C  3  188 ? -3.841   -5.828  83.257   1.00 65.66  ? 638  VAL D N     1 
ATOM   6729  C  CA    . VAL C  3  188 ? -4.954   -5.090  82.595   1.00 65.30  ? 638  VAL D CA    1 
ATOM   6730  C  C     . VAL C  3  188 ? -5.102   -3.745  83.301   1.00 53.55  ? 638  VAL D C     1 
ATOM   6731  O  O     . VAL C  3  188 ? -5.367   -2.849  82.556   1.00 43.53  ? 638  VAL D O     1 
ATOM   6732  C  CB    . VAL C  3  188 ? -6.284   -5.886  82.577   1.00 73.63  ? 638  VAL D CB    1 
ATOM   6733  C  CG1   . VAL C  3  188 ? -7.483   -5.012  82.247   1.00 76.86  ? 638  VAL D CG1   1 
ATOM   6734  C  CG2   . VAL C  3  188 ? -6.217   -7.112  81.665   1.00 71.01  ? 638  VAL D CG2   1 
ATOM   6735  N  N     . ILE D  2  8   ? 9.683    16.596  72.790   1.00 78.45  ? 9    ILE C N     1 
ATOM   6736  C  CA    . ILE D  2  8   ? 10.636   15.627  73.406   1.00 76.46  ? 9    ILE C CA    1 
ATOM   6737  C  C     . ILE D  2  8   ? 10.281   14.215  72.914   1.00 77.86  ? 9    ILE C C     1 
ATOM   6738  O  O     . ILE D  2  8   ? 9.227    13.648  73.312   1.00 78.87  ? 9    ILE C O     1 
ATOM   6739  C  CB    . ILE D  2  8   ? 10.656   15.709  74.953   1.00 68.73  ? 9    ILE C CB    1 
ATOM   6740  N  N     . ASN D  2  9   ? 11.134   13.661  72.062   1.00 73.49  ? 10   ASN C N     1 
ATOM   6741  C  CA    . ASN D  2  9   ? 11.376   12.201  72.059   1.00 70.40  ? 10   ASN C CA    1 
ATOM   6742  C  C     . ASN D  2  9   ? 12.354   11.958  73.218   1.00 73.83  ? 10   ASN C C     1 
ATOM   6743  O  O     . ASN D  2  9   ? 13.590   12.020  73.038   1.00 83.93  ? 10   ASN C O     1 
ATOM   6744  C  CB    . ASN D  2  9   ? 11.729   11.681  70.670   1.00 66.26  ? 10   ASN C CB    1 
ATOM   6745  C  CG    . ASN D  2  9   ? 10.546   11.026  69.966   1.00 62.52  ? 10   ASN C CG    1 
ATOM   6746  O  OD1   . ASN D  2  9   ? 9.392    11.432  70.119   1.00 62.66  ? 10   ASN C OD1   1 
ATOM   6747  N  ND2   . ASN D  2  9   ? 10.809   9.997   69.179   1.00 50.36  ? 10   ASN C ND2   1 
ATOM   6748  N  N     . GLU D  2  10  ? 11.758   11.758  74.391   1.00 70.53  ? 11   GLU C N     1 
ATOM   6749  C  CA    . GLU D  2  10  ? 12.429   11.431  75.680   1.00 74.04  ? 11   GLU C CA    1 
ATOM   6750  C  C     . GLU D  2  10  ? 11.564   10.437  76.468   1.00 74.34  ? 11   GLU C C     1 
ATOM   6751  O  O     . GLU D  2  10  ? 10.335   10.598  76.473   1.00 63.07  ? 11   GLU C O     1 
ATOM   6752  C  CB    . GLU D  2  10  ? 12.592   12.695  76.516   1.00 80.73  ? 11   GLU C CB    1 
ATOM   6753  C  CG    . GLU D  2  10  ? 13.800   12.677  77.434   1.00 80.73  ? 11   GLU C CG    1 
ATOM   6754  C  CD    . GLU D  2  10  ? 14.332   14.050  77.821   1.00 77.36  ? 11   GLU C CD    1 
ATOM   6755  O  OE1   . GLU D  2  10  ? 15.581   14.222  77.813   1.00 69.44  ? 11   GLU C OE1   1 
ATOM   6756  O  OE2   . GLU D  2  10  ? 13.495   14.943  78.106   1.00 70.48  ? 11   GLU C OE2   1 
ATOM   6757  N  N     . ARG D  2  11  ? 12.188   9.428   77.083   1.00 83.43  ? 12   ARG C N     1 
ATOM   6758  C  CA    . ARG D  2  11  ? 11.493   8.244   77.662   1.00 85.49  ? 12   ARG C CA    1 
ATOM   6759  C  C     . ARG D  2  11  ? 12.175   7.845   78.977   1.00 87.00  ? 12   ARG C C     1 
ATOM   6760  O  O     . ARG D  2  11  ? 13.388   7.553   78.973   1.00 78.92  ? 12   ARG C O     1 
ATOM   6761  C  CB    . ARG D  2  11  ? 11.498   7.109   76.642   1.00 86.72  ? 12   ARG C CB    1 
ATOM   6762  C  CG    . ARG D  2  11  ? 10.826   5.819   77.109   1.00 82.35  ? 12   ARG C CG    1 
ATOM   6763  C  CD    . ARG D  2  11  ? 9.352    6.011   77.390   1.00 84.93  ? 12   ARG C CD    1 
ATOM   6764  N  NE    . ARG D  2  11  ? 8.660    4.729   77.306   1.00 94.90  ? 12   ARG C NE    1 
ATOM   6765  C  CZ    . ARG D  2  11  ? 7.568    4.396   77.985   1.00 96.80  ? 12   ARG C CZ    1 
ATOM   6766  N  NH1   . ARG D  2  11  ? 6.974    5.243   78.800   1.00 96.14  ? 12   ARG C NH1   1 
ATOM   6767  N  NH2   . ARG D  2  11  ? 7.049    3.194   77.851   1.00 103.23 ? 12   ARG C NH2   1 
ATOM   6768  N  N     . ASN D  2  12  ? 11.396   7.859   80.063   1.00 89.31  ? 13   ASN C N     1 
ATOM   6769  C  CA    . ASN D  2  12  ? 11.869   7.513   81.428   1.00 91.60  ? 13   ASN C CA    1 
ATOM   6770  C  C     . ASN D  2  12  ? 12.230   6.024   81.437   1.00 97.22  ? 13   ASN C C     1 
ATOM   6771  O  O     . ASN D  2  12  ? 11.389   5.211   80.971   1.00 112.29 ? 13   ASN C O     1 
ATOM   6772  C  CB    . ASN D  2  12  ? 10.817   7.855   82.486   1.00 87.13  ? 13   ASN C CB    1 
ATOM   6773  C  CG    . ASN D  2  12  ? 11.287   7.538   83.887   1.00 89.34  ? 13   ASN C CG    1 
ATOM   6774  O  OD1   . ASN D  2  12  ? 10.836   6.569   84.483   1.00 87.32  ? 13   ASN C OD1   1 
ATOM   6775  N  ND2   . ASN D  2  12  ? 12.254   8.294   84.382   1.00 96.18  ? 13   ASN C ND2   1 
ATOM   6776  N  N     . ILE D  2  13  ? 13.425   5.674   81.927   1.00 94.37  ? 14   ILE C N     1 
ATOM   6777  C  CA    . ILE D  2  13  ? 13.942   4.269   81.925   1.00 93.10  ? 14   ILE C CA    1 
ATOM   6778  C  C     . ILE D  2  13  ? 12.999   3.364   82.729   1.00 88.97  ? 14   ILE C C     1 
ATOM   6779  O  O     . ILE D  2  13  ? 12.761   2.239   82.285   1.00 85.04  ? 14   ILE C O     1 
ATOM   6780  C  CB    . ILE D  2  13  ? 15.393   4.179   82.443   1.00 89.52  ? 14   ILE C CB    1 
ATOM   6781  C  CG1   . ILE D  2  13  ? 15.998   2.804   82.144   1.00 77.83  ? 14   ILE C CG1   1 
ATOM   6782  C  CG2   . ILE D  2  13  ? 15.479   4.526   83.924   1.00 95.46  ? 14   ILE C CG2   1 
ATOM   6783  C  CD1   . ILE D  2  13  ? 17.501   2.765   82.212   1.00 76.48  ? 14   ILE C CD1   1 
ATOM   6784  N  N     . THR D  2  14  ? 12.485   3.842   83.861   1.00 93.43  ? 15   THR C N     1 
ATOM   6785  C  CA    . THR D  2  14  ? 11.575   3.082   84.758   1.00 98.91  ? 15   THR C CA    1 
ATOM   6786  C  C     . THR D  2  14  ? 10.269   2.790   84.007   1.00 93.49  ? 15   THR C C     1 
ATOM   6787  O  O     . THR D  2  14  ? 9.850    1.621   84.027   1.00 102.79 ? 15   THR C O     1 
ATOM   6788  C  CB    . THR D  2  14  ? 11.402   3.812   86.098   1.00 102.28 ? 15   THR C CB    1 
ATOM   6789  O  OG1   . THR D  2  14  ? 12.598   3.575   86.839   1.00 95.82  ? 15   THR C OG1   1 
ATOM   6790  C  CG2   . THR D  2  14  ? 10.195   3.360   86.892   1.00 101.27 ? 15   THR C CG2   1 
ATOM   6791  N  N     . SER D  2  15  ? 9.671    3.789   83.350   1.00 81.13  ? 16   SER C N     1 
ATOM   6792  C  CA    . SER D  2  15  ? 8.410    3.651   82.566   1.00 75.90  ? 16   SER C CA    1 
ATOM   6793  C  C     . SER D  2  15  ? 8.606    2.613   81.456   1.00 72.71  ? 16   SER C C     1 
ATOM   6794  O  O     . SER D  2  15  ? 7.703    1.765   81.262   1.00 68.70  ? 16   SER C O     1 
ATOM   6795  C  CB    . SER D  2  15  ? 7.958    4.968   81.980   1.00 71.79  ? 16   SER C CB    1 
ATOM   6796  O  OG    . SER D  2  15  ? 8.012    5.997   82.952   1.00 73.34  ? 16   SER C OG    1 
ATOM   6797  N  N     . GLU D  2  16  ? 9.740    2.696   80.751   1.00 72.59  ? 17   GLU C N     1 
ATOM   6798  C  CA    . GLU D  2  16  ? 10.075   1.823   79.599   1.00 74.96  ? 17   GLU C CA    1 
ATOM   6799  C  C     . GLU D  2  16  ? 10.180   0.372   80.074   1.00 73.70  ? 17   GLU C C     1 
ATOM   6800  O  O     . GLU D  2  16  ? 9.530    -0.486  79.466   1.00 80.94  ? 17   GLU C O     1 
ATOM   6801  C  CB    . GLU D  2  16  ? 11.371   2.284   78.930   1.00 79.08  ? 17   GLU C CB    1 
ATOM   6802  C  CG    . GLU D  2  16  ? 11.805   1.388   77.780   1.00 80.51  ? 17   GLU C CG    1 
ATOM   6803  C  CD    . GLU D  2  16  ? 10.801   1.294   76.640   1.00 82.08  ? 17   GLU C CD    1 
ATOM   6804  O  OE1   . GLU D  2  16  ? 10.025   2.242   76.453   1.00 84.23  ? 17   GLU C OE1   1 
ATOM   6805  O  OE2   . GLU D  2  16  ? 10.799   0.276   75.936   1.00 85.60  ? 17   GLU C OE2   1 
ATOM   6806  N  N     . MET D  2  17  ? 10.965   0.122   81.123   1.00 68.33  ? 18   MET C N     1 
ATOM   6807  C  CA    . MET D  2  17  ? 11.127   -1.216  81.756   1.00 66.13  ? 18   MET C CA    1 
ATOM   6808  C  C     . MET D  2  17  ? 9.753    -1.767  82.154   1.00 67.69  ? 18   MET C C     1 
ATOM   6809  O  O     . MET D  2  17  ? 9.446    -2.905  81.768   1.00 73.71  ? 18   MET C O     1 
ATOM   6810  C  CB    . MET D  2  17  ? 11.989   -1.128  83.017   1.00 67.02  ? 18   MET C CB    1 
ATOM   6811  C  CG    . MET D  2  17  ? 13.450   -0.896  82.744   1.00 68.65  ? 18   MET C CG    1 
ATOM   6812  S  SD    . MET D  2  17  ? 14.185   -2.168  81.737   1.00 70.41  ? 18   MET C SD    1 
ATOM   6813  C  CE    . MET D  2  17  ? 13.931   -3.586  82.807   1.00 70.61  ? 18   MET C CE    1 
ATOM   6814  N  N     . ARG D  2  18  ? 8.960    -1.004  82.912   1.00 71.14  ? 19   ARG C N     1 
ATOM   6815  C  CA    . ARG D  2  18  ? 7.717    -1.519  83.530   1.00 78.45  ? 19   ARG C CA    1 
ATOM   6816  C  C     . ARG D  2  18  ? 6.724    -1.899  82.427   1.00 83.83  ? 19   ARG C C     1 
ATOM   6817  O  O     . ARG D  2  18  ? 6.117    -2.977  82.533   1.00 82.77  ? 19   ARG C O     1 
ATOM   6818  C  CB    . ARG D  2  18  ? 7.141    -0.503  84.525   1.00 80.24  ? 19   ARG C CB    1 
ATOM   6819  C  CG    . ARG D  2  18  ? 7.966    -0.304  85.782   1.00 83.14  ? 19   ARG C CG    1 
ATOM   6820  C  CD    . ARG D  2  18  ? 7.530    0.921   86.579   1.00 84.09  ? 19   ARG C CD    1 
ATOM   6821  N  NE    . ARG D  2  18  ? 6.091    0.953   86.823   1.00 81.89  ? 19   ARG C NE    1 
ATOM   6822  C  CZ    . ARG D  2  18  ? 5.473    0.358   87.838   1.00 79.89  ? 19   ARG C CZ    1 
ATOM   6823  N  NH1   . ARG D  2  18  ? 6.149    -0.333  88.744   1.00 75.94  ? 19   ARG C NH1   1 
ATOM   6824  N  NH2   . ARG D  2  18  ? 4.159    0.466   87.945   1.00 81.97  ? 19   ARG C NH2   1 
ATOM   6825  N  N     A GLU D  2  19  ? 6.585    -1.064  81.390   0.50 85.45  ? 20   GLU C N     1 
ATOM   6826  N  N     B GLU D  2  19  ? 6.585    -1.065  81.390   0.50 90.83  ? 20   GLU C N     1 
ATOM   6827  C  CA    A GLU D  2  19  ? 5.586    -1.265  80.305   0.50 86.40  ? 20   GLU C CA    1 
ATOM   6828  C  CA    B GLU D  2  19  ? 5.588    -1.268  80.305   0.50 95.45  ? 20   GLU C CA    1 
ATOM   6829  C  C     A GLU D  2  19  ? 6.088    -2.343  79.337   0.50 91.60  ? 20   GLU C C     1 
ATOM   6830  C  C     B GLU D  2  19  ? 6.088    -2.344  79.336   0.50 96.96  ? 20   GLU C C     1 
ATOM   6831  O  O     A GLU D  2  19  ? 5.253    -3.149  78.897   0.50 98.52  ? 20   GLU C O     1 
ATOM   6832  O  O     B GLU D  2  19  ? 5.253    -3.149  78.897   0.50 103.58 ? 20   GLU C O     1 
ATOM   6833  C  CB    A GLU D  2  19  ? 5.300    0.052   79.581   0.50 80.48  ? 20   GLU C CB    1 
ATOM   6834  C  CB    B GLU D  2  19  ? 5.302    0.042   79.578   0.50 96.33  ? 20   GLU C CB    1 
ATOM   6835  C  CG    A GLU D  2  19  ? 4.345    -0.076  78.406   0.50 74.84  ? 20   GLU C CG    1 
ATOM   6836  C  CG    B GLU D  2  19  ? 4.474    0.993   80.399   0.50 95.69  ? 20   GLU C CG    1 
ATOM   6837  C  CD    A GLU D  2  19  ? 4.457    1.048   77.389   0.50 69.88  ? 20   GLU C CD    1 
ATOM   6838  C  CD    B GLU D  2  19  ? 4.309    2.311   79.685   0.50 98.87  ? 20   GLU C CD    1 
ATOM   6839  O  OE1   A GLU D  2  19  ? 4.456    2.253   77.810   0.50 73.56  ? 20   GLU C OE1   1 
ATOM   6840  O  OE1   B GLU D  2  19  ? 4.398    2.309   78.435   0.50 105.58 ? 20   GLU C OE1   1 
ATOM   6841  O  OE2   A GLU D  2  19  ? 4.604    0.727   76.192   0.50 60.01  ? 20   GLU C OE2   1 
ATOM   6842  O  OE2   B GLU D  2  19  ? 4.136    3.330   80.372   0.50 96.92  ? 20   GLU C OE2   1 
ATOM   6843  N  N     . SER D  2  20  ? 7.390    -2.353  79.022   1.00 90.57  ? 21   SER C N     1 
ATOM   6844  C  CA    . SER D  2  20  ? 8.033    -3.345  78.113   1.00 87.28  ? 21   SER C CA    1 
ATOM   6845  C  C     . SER D  2  20  ? 7.940    -4.749  78.718   1.00 79.28  ? 21   SER C C     1 
ATOM   6846  O  O     . SER D  2  20  ? 7.482    -5.676  78.008   1.00 78.79  ? 21   SER C O     1 
ATOM   6847  C  CB    . SER D  2  20  ? 9.470    -2.991  77.811   1.00 88.67  ? 21   SER C CB    1 
ATOM   6848  O  OG    . SER D  2  20  ? 9.552    -2.052  76.748   1.00 83.21  ? 21   SER C OG    1 
ATOM   6849  N  N     . PHE D  2  21  ? 8.374    -4.898  79.973   1.00 70.86  ? 22   PHE C N     1 
ATOM   6850  C  CA    . PHE D  2  21  ? 8.402    -6.201  80.689   1.00 65.87  ? 22   PHE C CA    1 
ATOM   6851  C  C     . PHE D  2  21  ? 6.971    -6.717  80.860   1.00 67.57  ? 22   PHE C C     1 
ATOM   6852  O  O     . PHE D  2  21  ? 6.766    -7.926  80.688   1.00 57.93  ? 22   PHE C O     1 
ATOM   6853  C  CB    . PHE D  2  21  ? 9.094    -6.123  82.052   1.00 58.35  ? 22   PHE C CB    1 
ATOM   6854  C  CG    . PHE D  2  21  ? 9.401    -7.485  82.620   1.00 56.11  ? 22   PHE C CG    1 
ATOM   6855  C  CD1   . PHE D  2  21  ? 10.579   -8.134  82.287   1.00 54.93  ? 22   PHE C CD1   1 
ATOM   6856  C  CD2   . PHE D  2  21  ? 8.494    -8.152  83.435   1.00 56.06  ? 22   PHE C CD2   1 
ATOM   6857  C  CE1   . PHE D  2  21  ? 10.863   -9.403  82.783   1.00 51.36  ? 22   PHE C CE1   1 
ATOM   6858  C  CE2   . PHE D  2  21  ? 8.776    -9.424  83.924   1.00 49.48  ? 22   PHE C CE2   1 
ATOM   6859  C  CZ    . PHE D  2  21  ? 9.956    -10.047 83.595   1.00 47.59  ? 22   PHE C CZ    1 
ATOM   6860  N  N     . LEU D  2  22  ? 6.024    -5.838  81.204   1.00 78.63  ? 23   LEU C N     1 
ATOM   6861  C  CA    . LEU D  2  22  ? 4.601    -6.217  81.426   1.00 88.13  ? 23   LEU C CA    1 
ATOM   6862  C  C     . LEU D  2  22  ? 4.033    -6.773  80.116   1.00 87.38  ? 23   LEU C C     1 
ATOM   6863  O  O     . LEU D  2  22  ? 3.302    -7.784  80.177   1.00 78.51  ? 23   LEU C O     1 
ATOM   6864  C  CB    . LEU D  2  22  ? 3.807    -4.995  81.899   1.00 96.06  ? 23   LEU C CB    1 
ATOM   6865  C  CG    . LEU D  2  22  ? 2.328    -5.231  82.193   1.00 95.02  ? 23   LEU C CG    1 
ATOM   6866  C  CD1   . LEU D  2  22  ? 2.167    -5.954  83.514   1.00 99.26  ? 23   LEU C CD1   1 
ATOM   6867  C  CD2   . LEU D  2  22  ? 1.571    -3.910  82.213   1.00 92.13  ? 23   LEU C CD2   1 
ATOM   6868  N  N     . ASP D  2  23  ? 4.374    -6.143  78.985   1.00 89.64  ? 24   ASP C N     1 
ATOM   6869  C  CA    . ASP D  2  23  ? 3.875    -6.524  77.639   1.00 86.28  ? 24   ASP C CA    1 
ATOM   6870  C  C     . ASP D  2  23  ? 4.315    -7.955  77.340   1.00 90.76  ? 24   ASP C C     1 
ATOM   6871  O  O     . ASP D  2  23  ? 3.465    -8.763  76.921   1.00 98.39  ? 24   ASP C O     1 
ATOM   6872  C  CB    . ASP D  2  23  ? 4.382    -5.570  76.549   1.00 78.30  ? 24   ASP C CB    1 
ATOM   6873  C  CG    . ASP D  2  23  ? 3.992    -6.024  75.156   1.00 80.75  ? 24   ASP C CG    1 
ATOM   6874  O  OD1   . ASP D  2  23  ? 2.882    -6.568  75.032   1.00 86.62  ? 24   ASP C OD1   1 
ATOM   6875  O  OD2   . ASP D  2  23  ? 4.810    -5.870  74.214   1.00 81.73  ? 24   ASP C OD2   1 
ATOM   6876  N  N     . TYR D  2  24  ? 5.604    -8.231  77.543   1.00 84.53  ? 25   TYR C N     1 
ATOM   6877  C  CA    . TYR D  2  24  ? 6.231    -9.571  77.413   1.00 80.40  ? 25   TYR C CA    1 
ATOM   6878  C  C     . TYR D  2  24  ? 5.559    -10.564 78.365   1.00 84.76  ? 25   TYR C C     1 
ATOM   6879  O  O     . TYR D  2  24  ? 5.000    -11.574 77.890   1.00 97.37  ? 25   TYR C O     1 
ATOM   6880  C  CB    . TYR D  2  24  ? 7.726    -9.488  77.714   1.00 74.68  ? 25   TYR C CB    1 
ATOM   6881  C  CG    . TYR D  2  24  ? 8.406    -10.825 77.680   1.00 68.96  ? 25   TYR C CG    1 
ATOM   6882  C  CD1   . TYR D  2  24  ? 8.438    -11.545 76.501   1.00 74.17  ? 25   TYR C CD1   1 
ATOM   6883  C  CD2   . TYR D  2  24  ? 8.971    -11.390 78.808   1.00 64.34  ? 25   TYR C CD2   1 
ATOM   6884  C  CE1   . TYR D  2  24  ? 9.050    -12.784 76.424   1.00 75.86  ? 25   TYR C CE1   1 
ATOM   6885  C  CE2   . TYR D  2  24  ? 9.594    -12.625 78.745   1.00 71.59  ? 25   TYR C CE2   1 
ATOM   6886  C  CZ    . TYR D  2  24  ? 9.628    -13.328 77.553   1.00 73.70  ? 25   TYR C CZ    1 
ATOM   6887  O  OH    . TYR D  2  24  ? 10.222   -14.553 77.469   1.00 71.42  ? 25   TYR C OH    1 
ATOM   6888  N  N     . ALA D  2  25  ? 5.620    -10.285 79.672   1.00 85.33  ? 26   ALA C N     1 
ATOM   6889  C  CA    . ALA D  2  25  ? 5.155    -11.178 80.759   1.00 77.44  ? 26   ALA C CA    1 
ATOM   6890  C  C     . ALA D  2  25  ? 3.699    -11.567 80.511   1.00 67.31  ? 26   ALA C C     1 
ATOM   6891  O  O     . ALA D  2  25  ? 3.393    -12.780 80.570   1.00 59.64  ? 26   ALA C O     1 
ATOM   6892  C  CB    . ALA D  2  25  ? 5.304    -10.506 82.099   1.00 76.21  ? 26   ALA C CB    1 
ATOM   6893  N  N     . MET D  2  26  ? 2.835    -10.581 80.246   1.00 65.56  ? 27   MET C N     1 
ATOM   6894  C  CA    . MET D  2  26  ? 1.378    -10.818 80.082   1.00 69.83  ? 27   MET C CA    1 
ATOM   6895  C  C     . MET D  2  26  ? 1.178    -11.750 78.883   1.00 63.43  ? 27   MET C C     1 
ATOM   6896  O  O     . MET D  2  26  ? 0.339    -12.672 78.979   1.00 63.21  ? 27   MET C O     1 
ATOM   6897  C  CB    . MET D  2  26  ? 0.624    -9.503  79.846   1.00 82.55  ? 27   MET C CB    1 
ATOM   6898  C  CG    . MET D  2  26  ? 0.335    -8.717  81.108   1.00 96.09  ? 27   MET C CG    1 
ATOM   6899  S  SD    . MET D  2  26  ? -0.758   -9.514  82.286   1.00 110.44 ? 27   MET C SD    1 
ATOM   6900  C  CE    . MET D  2  26  ? -2.140   -9.793  81.183   1.00 114.34 ? 27   MET C CE    1 
ATOM   6901  N  N     . SER D  2  27  ? 1.948    -11.520 77.816   1.00 62.87  ? 28   SER C N     1 
ATOM   6902  C  CA    . SER D  2  27  ? 1.846    -12.229 76.517   1.00 63.04  ? 28   SER C CA    1 
ATOM   6903  C  C     . SER D  2  27  ? 2.256    -13.696 76.688   1.00 62.73  ? 28   SER C C     1 
ATOM   6904  O  O     . SER D  2  27  ? 1.542    -14.578 76.156   1.00 64.00  ? 28   SER C O     1 
ATOM   6905  C  CB    . SER D  2  27  ? 2.682    -11.548 75.479   1.00 61.88  ? 28   SER C CB    1 
ATOM   6906  O  OG    . SER D  2  27  ? 2.679    -12.301 74.287   1.00 65.77  ? 28   SER C OG    1 
ATOM   6907  N  N     . VAL D  2  28  ? 3.350    -13.940 77.415   1.00 63.01  ? 29   VAL C N     1 
ATOM   6908  C  CA    . VAL D  2  28  ? 3.868    -15.303 77.734   1.00 60.00  ? 29   VAL C CA    1 
ATOM   6909  C  C     . VAL D  2  28  ? 2.838    -16.059 78.580   1.00 58.82  ? 29   VAL C C     1 
ATOM   6910  O  O     . VAL D  2  28  ? 2.749    -17.287 78.425   1.00 67.07  ? 29   VAL C O     1 
ATOM   6911  C  CB    . VAL D  2  28  ? 5.227    -15.231 78.455   1.00 57.65  ? 29   VAL C CB    1 
ATOM   6912  C  CG1   . VAL D  2  28  ? 5.627    -16.564 79.085   1.00 51.75  ? 29   VAL C CG1   1 
ATOM   6913  C  CG2   . VAL D  2  28  ? 6.320    -14.725 77.533   1.00 58.05  ? 29   VAL C CG2   1 
ATOM   6914  N  N     . ILE D  2  29  ? 2.092    -15.363 79.435   1.00 57.93  ? 30   ILE C N     1 
ATOM   6915  C  CA    . ILE D  2  29  ? 1.140    -15.997 80.393   1.00 67.39  ? 30   ILE C CA    1 
ATOM   6916  C  C     . ILE D  2  29  ? -0.152   -16.399 79.663   1.00 78.23  ? 30   ILE C C     1 
ATOM   6917  O  O     . ILE D  2  29  ? -0.592   -17.554 79.837   1.00 83.85  ? 30   ILE C O     1 
ATOM   6918  C  CB    . ILE D  2  29  ? 0.879    -15.062 81.586   1.00 66.10  ? 30   ILE C CB    1 
ATOM   6919  C  CG1   . ILE D  2  29  ? 2.106    -14.979 82.497   1.00 70.94  ? 30   ILE C CG1   1 
ATOM   6920  C  CG2   . ILE D  2  29  ? -0.351   -15.490 82.360   1.00 61.00  ? 30   ILE C CG2   1 
ATOM   6921  C  CD1   . ILE D  2  29  ? 2.142    -13.728 83.352   1.00 79.37  ? 30   ILE C CD1   1 
ATOM   6922  N  N     . VAL D  2  30  ? -0.754   -15.496 78.885   1.00 89.65  ? 31   VAL C N     1 
ATOM   6923  C  CA    . VAL D  2  30  ? -2.146   -15.670 78.363   1.00 90.69  ? 31   VAL C CA    1 
ATOM   6924  C  C     . VAL D  2  30  ? -2.124   -16.165 76.910   1.00 87.16  ? 31   VAL C C     1 
ATOM   6925  O  O     . VAL D  2  30  ? -3.221   -16.443 76.377   1.00 84.02  ? 31   VAL C O     1 
ATOM   6926  C  CB    . VAL D  2  30  ? -2.955   -14.361 78.486   1.00 83.79  ? 31   VAL C CB    1 
ATOM   6927  C  CG1   . VAL D  2  30  ? -2.945   -13.826 79.912   1.00 82.05  ? 31   VAL C CG1   1 
ATOM   6928  C  CG2   . VAL D  2  30  ? -2.473   -13.292 77.512   1.00 76.92  ? 31   VAL C CG2   1 
ATOM   6929  N  N     . ALA D  2  31  ? -0.949   -16.253 76.279   1.00 79.45  ? 32   ALA C N     1 
ATOM   6930  C  CA    . ALA D  2  31  ? -0.830   -16.556 74.835   1.00 72.52  ? 32   ALA C CA    1 
ATOM   6931  C  C     . ALA D  2  31  ? 0.528    -17.187 74.514   1.00 66.27  ? 32   ALA C C     1 
ATOM   6932  O  O     . ALA D  2  31  ? 1.124    -16.792 73.494   1.00 49.55  ? 32   ALA C O     1 
ATOM   6933  C  CB    . ALA D  2  31  ? -1.051   -15.295 74.040   1.00 71.68  ? 32   ALA C CB    1 
ATOM   6934  N  N     . ARG D  2  32  ? 0.991    -18.144 75.328   1.00 68.93  ? 33   ARG C N     1 
ATOM   6935  C  CA    . ARG D  2  32  ? 2.180    -18.973 74.982   1.00 74.11  ? 33   ARG C CA    1 
ATOM   6936  C  C     . ARG D  2  32  ? 2.268    -20.230 75.856   1.00 76.40  ? 33   ARG C C     1 
ATOM   6937  O  O     . ARG D  2  32  ? 2.095    -21.338 75.300   1.00 82.30  ? 33   ARG C O     1 
ATOM   6938  C  CB    . ARG D  2  32  ? 3.455    -18.144 75.107   1.00 76.34  ? 33   ARG C CB    1 
ATOM   6939  C  CG    . ARG D  2  32  ? 4.690    -18.792 74.508   1.00 83.09  ? 33   ARG C CG    1 
ATOM   6940  C  CD    . ARG D  2  32  ? 5.907    -17.890 74.595   1.00 86.57  ? 33   ARG C CD    1 
ATOM   6941  N  NE    . ARG D  2  32  ? 5.839    -16.851 73.574   1.00 94.43  ? 33   ARG C NE    1 
ATOM   6942  C  CZ    . ARG D  2  32  ? 6.762    -15.939 73.348   1.00 95.62  ? 33   ARG C CZ    1 
ATOM   6943  N  NH1   . ARG D  2  32  ? 7.883    -15.942 74.052   1.00 92.28  ? 33   ARG C NH1   1 
ATOM   6944  N  NH2   . ARG D  2  32  ? 6.559    -15.041 72.394   1.00 95.73  ? 33   ARG C NH2   1 
ATOM   6945  N  N     . ALA D  2  33  ? 2.561    -20.069 77.149   1.00 72.31  ? 34   ALA C N     1 
ATOM   6946  C  CA    . ALA D  2  33  ? 3.174    -21.120 78.000   1.00 76.92  ? 34   ALA C CA    1 
ATOM   6947  C  C     . ALA D  2  33  ? 2.126    -21.839 78.861   1.00 76.05  ? 34   ALA C C     1 
ATOM   6948  O  O     . ALA D  2  33  ? 2.398    -22.992 79.291   1.00 95.56  ? 34   ALA C O     1 
ATOM   6949  C  CB    . ALA D  2  33  ? 4.261    -20.506 78.850   1.00 77.82  ? 34   ALA C CB    1 
ATOM   6950  N  N     . LEU D  2  34  ? 0.986    -21.204 79.136   1.00 66.42  ? 35   LEU C N     1 
ATOM   6951  C  CA    . LEU D  2  34  ? -0.074   -21.780 79.998   1.00 68.29  ? 35   LEU C CA    1 
ATOM   6952  C  C     . LEU D  2  34  ? -1.236   -22.253 79.140   1.00 60.97  ? 35   LEU C C     1 
ATOM   6953  O  O     . LEU D  2  34  ? -1.683   -21.534 78.248   1.00 55.25  ? 35   LEU C O     1 
ATOM   6954  C  CB    . LEU D  2  34  ? -0.552   -20.729 81.007   1.00 71.04  ? 35   LEU C CB    1 
ATOM   6955  C  CG    . LEU D  2  34  ? 0.493    -20.235 81.999   1.00 71.73  ? 35   LEU C CG    1 
ATOM   6956  C  CD1   . LEU D  2  34  ? -0.141   -19.316 83.016   1.00 75.42  ? 35   LEU C CD1   1 
ATOM   6957  C  CD2   . LEU D  2  34  ? 1.206    -21.405 82.693   1.00 74.21  ? 35   LEU C CD2   1 
ATOM   6958  N  N     . PRO D  2  35  ? -1.782   -23.455 79.433   1.00 53.41  ? 36   PRO C N     1 
ATOM   6959  C  CA    . PRO D  2  35  ? -2.932   -23.978 78.702   1.00 48.78  ? 36   PRO C CA    1 
ATOM   6960  C  C     . PRO D  2  35  ? -4.248   -23.395 79.209   1.00 40.00  ? 36   PRO C C     1 
ATOM   6961  O  O     . PRO D  2  35  ? -4.301   -23.058 80.373   1.00 35.35  ? 36   PRO C O     1 
ATOM   6962  C  CB    . PRO D  2  35  ? -2.897   -25.472 79.039   1.00 54.51  ? 36   PRO C CB    1 
ATOM   6963  C  CG    . PRO D  2  35  ? -2.353   -25.490 80.459   1.00 55.27  ? 36   PRO C CG    1 
ATOM   6964  C  CD    . PRO D  2  35  ? -1.343   -24.361 80.506   1.00 52.69  ? 36   PRO C CD    1 
ATOM   6965  N  N     . ASP D  2  36  ? -5.267   -23.328 78.346   1.00 34.88  ? 37   ASP C N     1 
ATOM   6966  C  CA    . ASP D  2  36  ? -6.670   -23.009 78.725   1.00 33.44  ? 37   ASP C CA    1 
ATOM   6967  C  C     . ASP D  2  36  ? -7.231   -24.209 79.493   1.00 33.24  ? 37   ASP C C     1 
ATOM   6968  O  O     . ASP D  2  36  ? -6.958   -25.348 79.094   1.00 37.15  ? 37   ASP C O     1 
ATOM   6969  C  CB    . ASP D  2  36  ? -7.534   -22.665 77.505   1.00 33.14  ? 37   ASP C CB    1 
ATOM   6970  C  CG    . ASP D  2  36  ? -8.866   -22.010 77.854   1.00 33.64  ? 37   ASP C CG    1 
ATOM   6971  O  OD1   . ASP D  2  36  ? -9.734   -22.703 78.447   1.00 35.81  ? 37   ASP C OD1   1 
ATOM   6972  O  OD2   . ASP D  2  36  ? -9.035   -20.817 77.512   1.00 29.02  ? 37   ASP C OD2   1 
ATOM   6973  N  N     . VAL D  2  37  ? -8.005   -23.952 80.545   1.00 34.35  ? 38   VAL C N     1 
ATOM   6974  C  CA    . VAL D  2  37  ? -8.603   -24.986 81.437   1.00 37.17  ? 38   VAL C CA    1 
ATOM   6975  C  C     . VAL D  2  37  ? -9.643   -25.812 80.660   1.00 39.92  ? 38   VAL C C     1 
ATOM   6976  O  O     . VAL D  2  37  ? -9.917   -26.975 81.089   1.00 41.55  ? 38   VAL C O     1 
ATOM   6977  C  CB    . VAL D  2  37  ? -9.230   -24.324 82.679   1.00 37.84  ? 38   VAL C CB    1 
ATOM   6978  C  CG1   . VAL D  2  37  ? -10.500  -23.553 82.323   1.00 40.27  ? 38   VAL C CG1   1 
ATOM   6979  C  CG2   . VAL D  2  37  ? -9.516   -25.334 83.780   1.00 39.19  ? 38   VAL C CG2   1 
ATOM   6980  N  N     . ARG D  2  38  ? -10.206  -25.247 79.585   1.00 41.33  ? 39   ARG C N     1 
ATOM   6981  C  CA    . ARG D  2  38  ? -11.348  -25.849 78.845   1.00 46.71  ? 39   ARG C CA    1 
ATOM   6982  C  C     . ARG D  2  38  ? -10.867  -27.004 77.943   1.00 46.94  ? 39   ARG C C     1 
ATOM   6983  O  O     . ARG D  2  38  ? -11.368  -28.131 78.114   1.00 53.32  ? 39   ARG C O     1 
ATOM   6984  C  CB    . ARG D  2  38  ? -12.100  -24.761 78.065   1.00 49.39  ? 39   ARG C CB    1 
ATOM   6985  C  CG    . ARG D  2  38  ? -12.877  -23.816 78.977   1.00 50.27  ? 39   ARG C CG    1 
ATOM   6986  C  CD    . ARG D  2  38  ? -13.462  -22.623 78.241   1.00 52.73  ? 39   ARG C CD    1 
ATOM   6987  N  NE    . ARG D  2  38  ? -12.395  -21.809 77.681   1.00 54.09  ? 39   ARG C NE    1 
ATOM   6988  C  CZ    . ARG D  2  38  ? -12.564  -20.802 76.836   1.00 49.85  ? 39   ARG C CZ    1 
ATOM   6989  N  NH1   . ARG D  2  38  ? -13.780  -20.456 76.432   1.00 46.35  ? 39   ARG C NH1   1 
ATOM   6990  N  NH2   . ARG D  2  38  ? -11.506  -20.144 76.393   1.00 46.66  ? 39   ARG C NH2   1 
ATOM   6991  N  N     . ASP D  2  39  ? -9.929   -26.748 77.026   1.00 38.33  ? 40   ASP C N     1 
ATOM   6992  C  CA    . ASP D  2  39  ? -9.477   -27.750 76.025   1.00 33.45  ? 40   ASP C CA    1 
ATOM   6993  C  C     . ASP D  2  39  ? -8.059   -28.242 76.350   1.00 32.59  ? 40   ASP C C     1 
ATOM   6994  O  O     . ASP D  2  39  ? -7.553   -29.117 75.607   1.00 29.86  ? 40   ASP C O     1 
ATOM   6995  C  CB    . ASP D  2  39  ? -9.570   -27.184 74.607   1.00 33.04  ? 40   ASP C CB    1 
ATOM   6996  C  CG    . ASP D  2  39  ? -8.627   -26.029 74.344   1.00 32.96  ? 40   ASP C CG    1 
ATOM   6997  O  OD1   . ASP D  2  39  ? -8.027   -25.527 75.334   1.00 31.53  ? 40   ASP C OD1   1 
ATOM   6998  O  OD2   . ASP D  2  39  ? -8.506   -25.630 73.150   1.00 35.38  ? 40   ASP C OD2   1 
ATOM   6999  N  N     . GLY D  2  40  ? -7.430   -27.702 77.402   1.00 29.94  ? 41   GLY C N     1 
ATOM   7000  C  CA    . GLY D  2  40  ? -6.090   -28.126 77.858   1.00 28.07  ? 41   GLY C CA    1 
ATOM   7001  C  C     . GLY D  2  40  ? -4.970   -27.704 76.922   1.00 25.63  ? 41   GLY C C     1 
ATOM   7002  O  O     . GLY D  2  40  ? -3.842   -28.175 77.119   1.00 23.03  ? 41   GLY C O     1 
ATOM   7003  N  N     . LEU D  2  41  ? -5.237   -26.815 75.968   1.00 26.17  ? 42   LEU C N     1 
ATOM   7004  C  CA    . LEU D  2  41  ? -4.276   -26.495 74.879   1.00 27.73  ? 42   LEU C CA    1 
ATOM   7005  C  C     . LEU D  2  41  ? -3.612   -25.123 75.097   1.00 26.92  ? 42   LEU C C     1 
ATOM   7006  O  O     . LEU D  2  41  ? -4.295   -24.165 75.494   1.00 27.79  ? 42   LEU C O     1 
ATOM   7007  C  CB    . LEU D  2  41  ? -5.024   -26.558 73.549   1.00 27.05  ? 42   LEU C CB    1 
ATOM   7008  C  CG    . LEU D  2  41  ? -5.590   -27.932 73.202   1.00 28.30  ? 42   LEU C CG    1 
ATOM   7009  C  CD1   . LEU D  2  41  ? -6.260   -27.927 71.833   1.00 27.30  ? 42   LEU C CD1   1 
ATOM   7010  C  CD2   . LEU D  2  41  ? -4.512   -29.000 73.255   1.00 29.69  ? 42   LEU C CD2   1 
ATOM   7011  N  N     . LYS D  2  42  ? -2.315   -25.038 74.837   1.00 26.85  ? 43   LYS C N     1 
ATOM   7012  C  CA    . LYS D  2  42  ? -1.619   -23.755 74.632   1.00 31.40  ? 43   LYS C CA    1 
ATOM   7013  C  C     . LYS D  2  42  ? -1.949   -23.299 73.209   1.00 41.70  ? 43   LYS C C     1 
ATOM   7014  O  O     . LYS D  2  42  ? -2.286   -24.124 72.357   1.00 44.01  ? 43   LYS C O     1 
ATOM   7015  C  CB    . LYS D  2  42  ? -0.113   -23.933 74.801   1.00 30.35  ? 43   LYS C CB    1 
ATOM   7016  C  CG    . LYS D  2  42  ? 0.346    -24.498 76.134   1.00 29.60  ? 43   LYS C CG    1 
ATOM   7017  C  CD    . LYS D  2  42  ? 1.854    -24.687 76.182   1.00 29.31  ? 43   LYS C CD    1 
ATOM   7018  C  CE    . LYS D  2  42  ? 2.332    -25.659 77.242   1.00 28.17  ? 43   LYS C CE    1 
ATOM   7019  N  NZ    . LYS D  2  42  ? 3.806    -25.716 77.286   1.00 26.93  ? 43   LYS C NZ    1 
ATOM   7020  N  N     . PRO D  2  43  ? -1.874   -21.986 72.900   1.00 49.64  ? 44   PRO C N     1 
ATOM   7021  C  CA    . PRO D  2  43  ? -2.016   -21.488 71.531   1.00 49.25  ? 44   PRO C CA    1 
ATOM   7022  C  C     . PRO D  2  43  ? -1.392   -22.355 70.427   1.00 47.35  ? 44   PRO C C     1 
ATOM   7023  O  O     . PRO D  2  43  ? -2.092   -22.722 69.507   1.00 47.28  ? 44   PRO C O     1 
ATOM   7024  C  CB    . PRO D  2  43  ? -1.271   -20.153 71.598   1.00 49.41  ? 44   PRO C CB    1 
ATOM   7025  C  CG    . PRO D  2  43  ? -1.603   -19.656 72.991   1.00 50.86  ? 44   PRO C CG    1 
ATOM   7026  C  CD    . PRO D  2  43  ? -1.669   -20.898 73.861   1.00 51.17  ? 44   PRO C CD    1 
ATOM   7027  N  N     . VAL D  2  44  ? -0.102   -22.666 70.529   1.00 46.98  ? 45   VAL C N     1 
ATOM   7028  C  CA    . VAL D  2  44  ? 0.623    -23.371 69.433   1.00 49.44  ? 45   VAL C CA    1 
ATOM   7029  C  C     . VAL D  2  44  ? -0.039   -24.731 69.170   1.00 51.53  ? 45   VAL C C     1 
ATOM   7030  O  O     . VAL D  2  44  ? -0.126   -25.103 67.993   1.00 49.35  ? 45   VAL C O     1 
ATOM   7031  C  CB    . VAL D  2  44  ? 2.128    -23.525 69.706   1.00 47.09  ? 45   VAL C CB    1 
ATOM   7032  C  CG1   . VAL D  2  44  ? 2.418    -24.381 70.927   1.00 47.93  ? 45   VAL C CG1   1 
ATOM   7033  C  CG2   . VAL D  2  44  ? 2.831    -24.077 68.476   1.00 45.71  ? 45   VAL C CG2   1 
ATOM   7034  N  N     . HIS D  2  45  ? -0.479   -25.444 70.215   1.00 47.98  ? 46   HIS C N     1 
ATOM   7035  C  CA    . HIS D  2  45  ? -1.133   -26.775 70.086   1.00 48.63  ? 46   HIS C CA    1 
ATOM   7036  C  C     . HIS D  2  45  ? -2.469   -26.611 69.367   1.00 46.86  ? 46   HIS C C     1 
ATOM   7037  O  O     . HIS D  2  45  ? -2.726   -27.363 68.404   1.00 47.05  ? 46   HIS C O     1 
ATOM   7038  C  CB    . HIS D  2  45  ? -1.332   -27.444 71.450   1.00 49.31  ? 46   HIS C CB    1 
ATOM   7039  C  CG    . HIS D  2  45  ? -0.048   -27.711 72.150   1.00 47.73  ? 46   HIS C CG    1 
ATOM   7040  N  ND1   . HIS D  2  45  ? 0.235    -27.188 73.383   1.00 44.49  ? 46   HIS C ND1   1 
ATOM   7041  C  CD2   . HIS D  2  45  ? 1.035    -28.410 71.761   1.00 45.10  ? 46   HIS C CD2   1 
ATOM   7042  C  CE1   . HIS D  2  45  ? 1.441    -27.567 73.739   1.00 48.16  ? 46   HIS C CE1   1 
ATOM   7043  N  NE2   . HIS D  2  45  ? 1.957    -28.302 72.758   1.00 51.18  ? 46   HIS C NE2   1 
ATOM   7044  N  N     . ARG D  2  46  ? -3.270   -25.649 69.828   1.00 45.87  ? 47   ARG C N     1 
ATOM   7045  C  CA    . ARG D  2  46  ? -4.615   -25.353 69.272   1.00 42.89  ? 47   ARG C CA    1 
ATOM   7046  C  C     . ARG D  2  46  ? -4.492   -25.036 67.785   1.00 40.30  ? 47   ARG C C     1 
ATOM   7047  O  O     . ARG D  2  46  ? -5.265   -25.609 67.001   1.00 49.58  ? 47   ARG C O     1 
ATOM   7048  C  CB    . ARG D  2  46  ? -5.279   -24.182 69.993   1.00 39.68  ? 47   ARG C CB    1 
ATOM   7049  C  CG    . ARG D  2  46  ? -6.729   -24.013 69.586   1.00 39.87  ? 47   ARG C CG    1 
ATOM   7050  C  CD    . ARG D  2  46  ? -7.458   -22.998 70.424   1.00 41.93  ? 47   ARG C CD    1 
ATOM   7051  N  NE    . ARG D  2  46  ? -7.457   -23.306 71.851   1.00 39.72  ? 47   ARG C NE    1 
ATOM   7052  C  CZ    . ARG D  2  46  ? -6.622   -22.782 72.740   1.00 42.85  ? 47   ARG C CZ    1 
ATOM   7053  N  NH1   . ARG D  2  46  ? -5.692   -21.928 72.350   1.00 45.72  ? 47   ARG C NH1   1 
ATOM   7054  N  NH2   . ARG D  2  46  ? -6.714   -23.120 74.015   1.00 43.64  ? 47   ARG C NH2   1 
ATOM   7055  N  N     . ARG D  2  47  ? -3.539   -24.179 67.422   1.00 38.51  ? 48   ARG C N     1 
ATOM   7056  C  CA    . ARG D  2  47  ? -3.342   -23.716 66.023   1.00 39.32  ? 48   ARG C CA    1 
ATOM   7057  C  C     . ARG D  2  47  ? -2.943   -24.891 65.127   1.00 40.99  ? 48   ARG C C     1 
ATOM   7058  O  O     . ARG D  2  47  ? -3.436   -24.933 63.975   1.00 34.46  ? 48   ARG C O     1 
ATOM   7059  C  CB    . ARG D  2  47  ? -2.321   -22.581 65.975   1.00 38.16  ? 48   ARG C CB    1 
ATOM   7060  C  CG    . ARG D  2  47  ? -2.916   -21.268 66.450   1.00 36.35  ? 48   ARG C CG    1 
ATOM   7061  C  CD    . ARG D  2  47  ? -1.866   -20.233 66.748   1.00 36.74  ? 48   ARG C CD    1 
ATOM   7062  N  NE    . ARG D  2  47  ? -2.513   -19.031 67.244   1.00 36.62  ? 48   ARG C NE    1 
ATOM   7063  C  CZ    . ARG D  2  47  ? -1.906   -18.048 67.902   1.00 37.47  ? 48   ARG C CZ    1 
ATOM   7064  N  NH1   . ARG D  2  47  ? -0.610   -18.088 68.165   1.00 36.85  ? 48   ARG C NH1   1 
ATOM   7065  N  NH2   . ARG D  2  47  ? -2.616   -17.019 68.310   1.00 39.97  ? 48   ARG C NH2   1 
ATOM   7066  N  N     . ILE D  2  48  ? -2.109   -25.805 65.635   1.00 47.27  ? 49   ILE C N     1 
ATOM   7067  C  CA    . ILE D  2  48  ? -1.694   -27.034 64.897   1.00 51.98  ? 49   ILE C CA    1 
ATOM   7068  C  C     . ILE D  2  48  ? -2.937   -27.903 64.632   1.00 48.16  ? 49   ILE C C     1 
ATOM   7069  O  O     . ILE D  2  48  ? -3.168   -28.261 63.456   1.00 47.35  ? 49   ILE C O     1 
ATOM   7070  C  CB    . ILE D  2  48  ? -0.568   -27.799 65.623   1.00 55.85  ? 49   ILE C CB    1 
ATOM   7071  C  CG1   . ILE D  2  48  ? 0.736    -26.997 65.626   1.00 56.99  ? 49   ILE C CG1   1 
ATOM   7072  C  CG2   . ILE D  2  48  ? -0.363   -29.168 64.996   1.00 57.12  ? 49   ILE C CG2   1 
ATOM   7073  C  CD1   . ILE D  2  48  ? 1.751    -27.440 66.677   1.00 58.22  ? 49   ILE C CD1   1 
ATOM   7074  N  N     . LEU D  2  49  ? -3.710   -28.231 65.669   1.00 45.70  ? 50   LEU C N     1 
ATOM   7075  C  CA    . LEU D  2  49  ? -4.869   -29.159 65.546   1.00 49.66  ? 50   LEU C CA    1 
ATOM   7076  C  C     . LEU D  2  49  ? -5.928   -28.539 64.633   1.00 50.70  ? 50   LEU C C     1 
ATOM   7077  O  O     . LEU D  2  49  ? -6.546   -29.292 63.851   1.00 54.76  ? 50   LEU C O     1 
ATOM   7078  C  CB    . LEU D  2  49  ? -5.451   -29.478 66.930   1.00 47.91  ? 50   LEU C CB    1 
ATOM   7079  C  CG    . LEU D  2  49  ? -4.523   -30.257 67.859   1.00 49.46  ? 50   LEU C CG    1 
ATOM   7080  C  CD1   . LEU D  2  49  ? -5.288   -30.762 69.069   1.00 51.41  ? 50   LEU C CD1   1 
ATOM   7081  C  CD2   . LEU D  2  49  ? -3.878   -31.434 67.143   1.00 47.56  ? 50   LEU C CD2   1 
ATOM   7082  N  N     . TYR D  2  50  ? -6.121   -27.223 64.716   1.00 51.59  ? 51   TYR C N     1 
ATOM   7083  C  CA    . TYR D  2  50  ? -7.116   -26.490 63.894   1.00 50.55  ? 51   TYR C CA    1 
ATOM   7084  C  C     . TYR D  2  50  ? -6.634   -26.460 62.445   1.00 42.88  ? 51   TYR C C     1 
ATOM   7085  O  O     . TYR D  2  50  ? -7.471   -26.590 61.535   1.00 41.35  ? 51   TYR C O     1 
ATOM   7086  C  CB    . TYR D  2  50  ? -7.349   -25.074 64.423   1.00 59.16  ? 51   TYR C CB    1 
ATOM   7087  C  CG    . TYR D  2  50  ? -8.322   -24.290 63.585   1.00 62.39  ? 51   TYR C CG    1 
ATOM   7088  C  CD1   . TYR D  2  50  ? -9.660   -24.647 63.537   1.00 63.97  ? 51   TYR C CD1   1 
ATOM   7089  C  CD2   . TYR D  2  50  ? -7.897   -23.224 62.808   1.00 63.06  ? 51   TYR C CD2   1 
ATOM   7090  C  CE1   . TYR D  2  50  ? -10.560  -23.944 62.753   1.00 69.96  ? 51   TYR C CE1   1 
ATOM   7091  C  CE2   . TYR D  2  50  ? -8.785   -22.503 62.025   1.00 70.00  ? 51   TYR C CE2   1 
ATOM   7092  C  CZ    . TYR D  2  50  ? -10.122  -22.868 61.996   1.00 75.76  ? 51   TYR C CZ    1 
ATOM   7093  O  OH    . TYR D  2  50  ? -11.005  -22.171 61.221   1.00 84.70  ? 51   TYR C OH    1 
ATOM   7094  N  N     . GLY D  2  51  ? -5.325   -26.283 62.254   1.00 40.82  ? 52   GLY C N     1 
ATOM   7095  C  CA    . GLY D  2  51  ? -4.667   -26.326 60.933   1.00 44.41  ? 52   GLY C CA    1 
ATOM   7096  C  C     . GLY D  2  51  ? -4.816   -27.691 60.282   1.00 45.11  ? 52   GLY C C     1 
ATOM   7097  O  O     . GLY D  2  51  ? -5.078   -27.744 59.068   1.00 42.29  ? 52   GLY C O     1 
ATOM   7098  N  N     . LEU D  2  52  ? -4.658   -28.770 61.052   1.00 46.32  ? 53   LEU C N     1 
ATOM   7099  C  CA    . LEU D  2  52  ? -4.843   -30.148 60.538   1.00 49.48  ? 53   LEU C CA    1 
ATOM   7100  C  C     . LEU D  2  52  ? -6.274   -30.270 60.021   1.00 52.37  ? 53   LEU C C     1 
ATOM   7101  O  O     . LEU D  2  52  ? -6.468   -30.883 58.964   1.00 58.17  ? 53   LEU C O     1 
ATOM   7102  C  CB    . LEU D  2  52  ? -4.565   -31.163 61.647   1.00 49.71  ? 53   LEU C CB    1 
ATOM   7103  C  CG    . LEU D  2  52  ? -3.099   -31.302 62.049   1.00 49.30  ? 53   LEU C CG    1 
ATOM   7104  C  CD1   . LEU D  2  52  ? -2.966   -32.212 63.250   1.00 54.58  ? 53   LEU C CD1   1 
ATOM   7105  C  CD2   . LEU D  2  52  ? -2.250   -31.833 60.915   1.00 47.61  ? 53   LEU C CD2   1 
ATOM   7106  N  N     . ASN D  2  53  ? -7.220   -29.678 60.747   1.00 58.18  ? 54   ASN C N     1 
ATOM   7107  C  CA    . ASN D  2  53  ? -8.681   -29.836 60.526   1.00 64.48  ? 54   ASN C CA    1 
ATOM   7108  C  C     . ASN D  2  53  ? -9.107   -29.030 59.300   1.00 66.87  ? 54   ASN C C     1 
ATOM   7109  O  O     . ASN D  2  53  ? -9.942   -29.543 58.531   1.00 61.78  ? 54   ASN C O     1 
ATOM   7110  C  CB    . ASN D  2  53  ? -9.451   -29.427 61.777   1.00 71.95  ? 54   ASN C CB    1 
ATOM   7111  C  CG    . ASN D  2  53  ? -10.922  -29.783 61.724   1.00 76.00  ? 54   ASN C CG    1 
ATOM   7112  O  OD1   . ASN D  2  53  ? -11.286  -30.951 61.568   1.00 87.01  ? 54   ASN C OD1   1 
ATOM   7113  N  ND2   . ASN D  2  53  ? -11.769  -28.774 61.879   1.00 79.30  ? 54   ASN C ND2   1 
ATOM   7114  N  N     . GLU D  2  54  ? -8.539   -27.832 59.128   1.00 73.58  ? 55   GLU C N     1 
ATOM   7115  C  CA    . GLU D  2  54  ? -8.861   -26.909 58.011   1.00 72.64  ? 55   GLU C CA    1 
ATOM   7116  C  C     . GLU D  2  54  ? -8.335   -27.489 56.701   1.00 69.00  ? 55   GLU C C     1 
ATOM   7117  O  O     . GLU D  2  54  ? -8.938   -27.178 55.681   1.00 80.74  ? 55   GLU C O     1 
ATOM   7118  C  CB    . GLU D  2  54  ? -8.279   -25.511 58.233   1.00 82.00  ? 55   GLU C CB    1 
ATOM   7119  C  CG    . GLU D  2  54  ? -9.049   -24.696 59.257   1.00 88.82  ? 55   GLU C CG    1 
ATOM   7120  C  CD    . GLU D  2  54  ? -10.558  -24.792 59.128   1.00 97.72  ? 55   GLU C CD    1 
ATOM   7121  O  OE1   . GLU D  2  54  ? -11.096  -24.171 58.178   1.00 108.67 ? 55   GLU C OE1   1 
ATOM   7122  O  OE2   . GLU D  2  54  ? -11.188  -25.505 59.962   1.00 99.81  ? 55   GLU C OE2   1 
ATOM   7123  N  N     . GLN D  2  55  ? -7.258   -28.279 56.726   1.00 63.45  ? 56   GLN C N     1 
ATOM   7124  C  CA    . GLN D  2  55  ? -6.726   -28.969 55.517   1.00 61.88  ? 56   GLN C CA    1 
ATOM   7125  C  C     . GLN D  2  55  ? -7.211   -30.421 55.504   1.00 51.30  ? 56   GLN C C     1 
ATOM   7126  O  O     . GLN D  2  55  ? -6.560   -31.230 54.863   1.00 48.45  ? 56   GLN C O     1 
ATOM   7127  C  CB    . GLN D  2  55  ? -5.192   -28.955 55.470   1.00 66.59  ? 56   GLN C CB    1 
ATOM   7128  C  CG    . GLN D  2  55  ? -4.552   -27.595 55.733   1.00 68.23  ? 56   GLN C CG    1 
ATOM   7129  C  CD    . GLN D  2  55  ? -5.035   -26.491 54.824   1.00 65.62  ? 56   GLN C CD    1 
ATOM   7130  O  OE1   . GLN D  2  55  ? -4.808   -26.511 53.618   1.00 64.54  ? 56   GLN C OE1   1 
ATOM   7131  N  NE2   . GLN D  2  55  ? -5.710   -25.505 55.398   1.00 53.86  ? 56   GLN C NE2   1 
ATOM   7132  N  N     . GLY D  2  56  ? -8.305   -30.725 56.209   1.00 50.90  ? 57   GLY C N     1 
ATOM   7133  C  CA    . GLY D  2  56  ? -8.876   -32.082 56.367   1.00 54.89  ? 57   GLY C CA    1 
ATOM   7134  C  C     . GLY D  2  56  ? -7.827   -33.193 56.342   1.00 58.84  ? 57   GLY C C     1 
ATOM   7135  O  O     . GLY D  2  56  ? -8.017   -34.200 55.598   1.00 58.49  ? 57   GLY C O     1 
ATOM   7136  N  N     . MET D  2  57  ? -6.749   -33.041 57.127   1.00 61.85  ? 58   MET C N     1 
ATOM   7137  C  CA    . MET D  2  57  ? -5.763   -34.121 57.395   1.00 62.85  ? 58   MET C CA    1 
ATOM   7138  C  C     . MET D  2  57  ? -6.323   -34.994 58.525   1.00 67.65  ? 58   MET C C     1 
ATOM   7139  O  O     . MET D  2  57  ? -5.895   -34.823 59.688   1.00 71.93  ? 58   MET C O     1 
ATOM   7140  C  CB    . MET D  2  57  ? -4.397   -33.543 57.776   1.00 54.75  ? 58   MET C CB    1 
ATOM   7141  C  CG    . MET D  2  57  ? -3.980   -32.500 56.765   1.00 52.11  ? 58   MET C CG    1 
ATOM   7142  S  SD    . MET D  2  57  ? -2.267   -31.937 56.788   1.00 47.94  ? 58   MET C SD    1 
ATOM   7143  C  CE    . MET D  2  57  ? -2.572   -30.219 57.171   1.00 48.87  ? 58   MET C CE    1 
ATOM   7144  N  N     . THR D  2  58  ? -7.282   -35.855 58.183   1.00 69.45  ? 59   THR C N     1 
ATOM   7145  C  CA    . THR D  2  58  ? -8.099   -36.653 59.132   1.00 78.98  ? 59   THR C CA    1 
ATOM   7146  C  C     . THR D  2  58  ? -7.528   -38.063 59.169   1.00 84.19  ? 59   THR C C     1 
ATOM   7147  O  O     . THR D  2  58  ? -6.704   -38.385 58.325   1.00 90.18  ? 59   THR C O     1 
ATOM   7148  C  CB    . THR D  2  58  ? -9.569   -36.586 58.710   1.00 81.23  ? 59   THR C CB    1 
ATOM   7149  O  OG1   . THR D  2  58  ? -9.569   -36.837 57.309   1.00 76.55  ? 59   THR C OG1   1 
ATOM   7150  C  CG2   . THR D  2  58  ? -10.224  -35.254 58.994   1.00 80.98  ? 59   THR C CG2   1 
ATOM   7151  N  N     . PRO D  2  59  ? -7.904   -38.920 60.152   1.00 91.61  ? 60   PRO C N     1 
ATOM   7152  C  CA    . PRO D  2  59  ? -7.323   -40.260 60.281   1.00 98.13  ? 60   PRO C CA    1 
ATOM   7153  C  C     . PRO D  2  59  ? -7.503   -41.162 59.050   1.00 99.97  ? 60   PRO C C     1 
ATOM   7154  O  O     . PRO D  2  59  ? -6.609   -41.963 58.793   1.00 111.67 ? 60   PRO C O     1 
ATOM   7155  C  CB    . PRO D  2  59  ? -8.068   -40.861 61.479   1.00 96.98  ? 60   PRO C CB    1 
ATOM   7156  C  CG    . PRO D  2  59  ? -8.472   -39.655 62.289   1.00 95.56  ? 60   PRO C CG    1 
ATOM   7157  C  CD    . PRO D  2  59  ? -8.859   -38.631 61.238   1.00 93.36  ? 60   PRO C CD    1 
ATOM   7158  N  N     . ASP D  2  60  ? -8.633   -41.005 58.346   1.00 87.66  ? 61   ASP C N     1 
ATOM   7159  C  CA    . ASP D  2  60  ? -9.042   -41.797 57.150   1.00 86.53  ? 61   ASP C CA    1 
ATOM   7160  C  C     . ASP D  2  60  ? -8.172   -41.425 55.940   1.00 79.54  ? 61   ASP C C     1 
ATOM   7161  O  O     . ASP D  2  60  ? -7.803   -42.341 55.196   1.00 79.81  ? 61   ASP C O     1 
ATOM   7162  C  CB    . ASP D  2  60  ? -10.520  -41.578 56.808   1.00 87.59  ? 61   ASP C CB    1 
ATOM   7163  C  CG    . ASP D  2  60  ? -10.908  -40.115 56.648   1.00 87.97  ? 61   ASP C CG    1 
ATOM   7164  O  OD1   . ASP D  2  60  ? -10.548  -39.317 57.546   1.00 93.64  ? 61   ASP C OD1   1 
ATOM   7165  O  OD2   . ASP D  2  60  ? -11.555  -39.779 55.632   1.00 79.06  ? 61   ASP C OD2   1 
ATOM   7166  N  N     . LYS D  2  61  ? -7.879   -40.135 55.749   1.00 72.23  ? 62   LYS C N     1 
ATOM   7167  C  CA    . LYS D  2  61  ? -6.976   -39.618 54.683   1.00 71.66  ? 62   LYS C CA    1 
ATOM   7168  C  C     . LYS D  2  61  ? -5.511   -39.905 55.040   1.00 71.46  ? 62   LYS C C     1 
ATOM   7169  O  O     . LYS D  2  61  ? -5.206   -40.144 56.226   1.00 63.75  ? 62   LYS C O     1 
ATOM   7170  C  CB    . LYS D  2  61  ? -7.184   -38.110 54.465   1.00 66.70  ? 62   LYS C CB    1 
ATOM   7171  C  CG    . LYS D  2  61  ? -8.614   -37.706 54.095   1.00 64.14  ? 62   LYS C CG    1 
ATOM   7172  C  CD    . LYS D  2  61  ? -8.869   -37.920 52.616   1.00 57.27  ? 62   LYS C CD    1 
ATOM   7173  C  CE    . LYS D  2  61  ? -10.323  -38.146 52.260   1.00 58.75  ? 62   LYS C CE    1 
ATOM   7174  N  NZ    . LYS D  2  61  ? -11.174  -37.149 52.934   1.00 62.41  ? 62   LYS C NZ    1 
ATOM   7175  N  N     . SER D  2  62  ? -4.624   -39.866 54.042   1.00 78.25  ? 63   SER C N     1 
ATOM   7176  C  CA    . SER D  2  62  ? -3.207   -40.299 54.167   1.00 82.89  ? 63   SER C CA    1 
ATOM   7177  C  C     . SER D  2  62  ? -2.354   -39.179 54.773   1.00 79.34  ? 63   SER C C     1 
ATOM   7178  O  O     . SER D  2  62  ? -2.694   -38.003 54.580   1.00 75.25  ? 63   SER C O     1 
ATOM   7179  C  CB    . SER D  2  62  ? -2.648   -40.735 52.849   1.00 82.25  ? 63   SER C CB    1 
ATOM   7180  O  OG    . SER D  2  62  ? -2.251   -39.603 52.099   1.00 86.78  ? 63   SER C OG    1 
ATOM   7181  N  N     . TYR D  2  63  ? -1.263   -39.571 55.437   1.00 78.85  ? 64   TYR C N     1 
ATOM   7182  C  CA    . TYR D  2  63  ? -0.281   -38.686 56.115   1.00 67.38  ? 64   TYR C CA    1 
ATOM   7183  C  C     . TYR D  2  63  ? 0.216    -37.628 55.136   1.00 62.47  ? 64   TYR C C     1 
ATOM   7184  O  O     . TYR D  2  63  ? 0.526    -37.963 53.996   1.00 50.45  ? 64   TYR C O     1 
ATOM   7185  C  CB    . TYR D  2  63  ? 0.946    -39.455 56.602   1.00 69.63  ? 64   TYR C CB    1 
ATOM   7186  C  CG    . TYR D  2  63  ? 0.672    -40.504 57.648   1.00 81.22  ? 64   TYR C CG    1 
ATOM   7187  C  CD1   . TYR D  2  63  ? 0.688    -40.176 58.992   1.00 86.48  ? 64   TYR C CD1   1 
ATOM   7188  C  CD2   . TYR D  2  63  ? 0.422    -41.828 57.298   1.00 83.39  ? 64   TYR C CD2   1 
ATOM   7189  C  CE1   . TYR D  2  63  ? 0.457    -41.137 59.962   1.00 91.48  ? 64   TYR C CE1   1 
ATOM   7190  C  CE2   . TYR D  2  63  ? 0.181    -42.793 58.256   1.00 85.64  ? 64   TYR C CE2   1 
ATOM   7191  C  CZ    . TYR D  2  63  ? 0.201    -42.443 59.592   1.00 93.40  ? 64   TYR C CZ    1 
ATOM   7192  O  OH    . TYR D  2  63  ? -0.034   -43.384 60.547   1.00 114.77 ? 64   TYR C OH    1 
ATOM   7193  N  N     . LYS D  2  64  ? 0.294    -36.382 55.600   1.00 69.14  ? 65   LYS C N     1 
ATOM   7194  C  CA    . LYS D  2  64  ? 0.814    -35.214 54.844   1.00 71.39  ? 65   LYS C CA    1 
ATOM   7195  C  C     . LYS D  2  64  ? 2.180    -34.826 55.446   1.00 71.98  ? 65   LYS C C     1 
ATOM   7196  O  O     . LYS D  2  64  ? 2.386    -35.032 56.665   1.00 63.84  ? 65   LYS C O     1 
ATOM   7197  C  CB    . LYS D  2  64  ? -0.248   -34.106 54.895   1.00 63.54  ? 65   LYS C CB    1 
ATOM   7198  N  N     A LYS D  2  65  ? 3.078    -34.280 54.619   0.50 75.18  ? 66   LYS C N     1 
ATOM   7199  N  N     B LYS D  2  65  ? 3.078    -34.275 54.619   0.50 69.66  ? 66   LYS C N     1 
ATOM   7200  C  CA    A LYS D  2  65  ? 4.454    -33.882 55.029   0.50 75.91  ? 66   LYS C CA    1 
ATOM   7201  C  CA    B LYS D  2  65  ? 4.458    -33.891 55.033   0.50 67.34  ? 66   LYS C CA    1 
ATOM   7202  C  C     A LYS D  2  65  ? 4.367    -32.835 56.140   0.50 73.43  ? 66   LYS C C     1 
ATOM   7203  C  C     B LYS D  2  65  ? 4.370    -32.836 56.138   0.50 68.45  ? 66   LYS C C     1 
ATOM   7204  O  O     A LYS D  2  65  ? 3.511    -31.938 56.045   0.50 71.10  ? 66   LYS C O     1 
ATOM   7205  O  O     B LYS D  2  65  ? 3.512    -31.938 56.044   0.50 66.65  ? 66   LYS C O     1 
ATOM   7206  C  CB    A LYS D  2  65  ? 5.247    -33.293 53.861   0.50 78.09  ? 66   LYS C CB    1 
ATOM   7207  C  CB    B LYS D  2  65  ? 5.296    -33.382 53.859   0.50 63.11  ? 66   LYS C CB    1 
ATOM   7208  C  CG    A LYS D  2  65  ? 6.744    -33.357 54.078   0.50 81.88  ? 66   LYS C CG    1 
ATOM   7209  C  CG    B LYS D  2  65  ? 5.228    -34.236 52.594   0.50 62.54  ? 66   LYS C CG    1 
ATOM   7210  C  CD    A LYS D  2  65  ? 7.538    -32.532 53.128   0.50 91.64  ? 66   LYS C CD    1 
ATOM   7211  C  CD    B LYS D  2  65  ? 5.338    -35.740 52.823   0.50 59.91  ? 66   LYS C CD    1 
ATOM   7212  C  CE    A LYS D  2  65  ? 8.811    -33.259 52.750   0.50 101.06 ? 66   LYS C CE    1 
ATOM   7213  C  CE    B LYS D  2  65  ? 4.431    -36.551 51.919   0.50 54.75  ? 66   LYS C CE    1 
ATOM   7214  N  NZ    A LYS D  2  65  ? 8.617    -34.185 51.609   0.50 103.58 ? 66   LYS C NZ    1 
ATOM   7215  N  NZ    B LYS D  2  65  ? 4.447    -37.986 52.274   0.50 51.18  ? 66   LYS C NZ    1 
ATOM   7216  N  N     . SER D  2  66  ? 5.228    -32.955 57.148   1.00 71.90  ? 67   SER C N     1 
ATOM   7217  C  CA    . SER D  2  66  ? 5.254    -32.057 58.329   1.00 71.65  ? 67   SER C CA    1 
ATOM   7218  C  C     . SER D  2  66  ? 5.581    -30.621 57.891   1.00 66.16  ? 67   SER C C     1 
ATOM   7219  O  O     . SER D  2  66  ? 4.910    -29.675 58.354   1.00 56.71  ? 67   SER C O     1 
ATOM   7220  C  CB    . SER D  2  66  ? 6.219    -32.590 59.352   1.00 71.42  ? 67   SER C CB    1 
ATOM   7221  O  OG    . SER D  2  66  ? 5.805    -33.878 59.789   1.00 76.85  ? 67   SER C OG    1 
ATOM   7222  N  N     . ALA D  2  67  ? 6.542    -30.455 56.987   1.00 67.00  ? 68   ALA C N     1 
ATOM   7223  C  CA    . ALA D  2  67  ? 6.936    -29.131 56.453   1.00 70.30  ? 68   ALA C CA    1 
ATOM   7224  C  C     . ALA D  2  67  ? 5.716    -28.420 55.837   1.00 72.78  ? 68   ALA C C     1 
ATOM   7225  O  O     . ALA D  2  67  ? 5.647    -27.182 55.936   1.00 83.42  ? 68   ALA C O     1 
ATOM   7226  C  CB    . ALA D  2  67  ? 8.057    -29.295 55.453   1.00 70.45  ? 68   ALA C CB    1 
ATOM   7227  N  N     . ARG D  2  68  ? 4.788    -29.166 55.221   1.00 68.38  ? 69   ARG C N     1 
ATOM   7228  C  CA    . ARG D  2  68  ? 3.531    -28.627 54.629   1.00 68.76  ? 69   ARG C CA    1 
ATOM   7229  C  C     . ARG D  2  68  ? 2.644    -28.101 55.768   1.00 73.78  ? 69   ARG C C     1 
ATOM   7230  O  O     . ARG D  2  68  ? 2.122    -26.971 55.646   1.00 60.04  ? 69   ARG C O     1 
ATOM   7231  C  CB    . ARG D  2  68  ? 2.856    -29.708 53.771   1.00 62.68  ? 69   ARG C CB    1 
ATOM   7232  C  CG    . ARG D  2  68  ? 1.491    -29.355 53.207   1.00 60.02  ? 69   ARG C CG    1 
ATOM   7233  C  CD    . ARG D  2  68  ? 1.053    -30.414 52.205   1.00 54.98  ? 69   ARG C CD    1 
ATOM   7234  N  N     . ILE D  2  69  ? 2.526    -28.876 56.852   1.00 81.02  ? 70   ILE C N     1 
ATOM   7235  C  CA    . ILE D  2  69  ? 1.641    -28.570 58.017   1.00 81.68  ? 70   ILE C CA    1 
ATOM   7236  C  C     . ILE D  2  69  ? 2.199    -27.351 58.756   1.00 81.74  ? 70   ILE C C     1 
ATOM   7237  O  O     . ILE D  2  69  ? 1.414    -26.426 59.047   1.00 74.86  ? 70   ILE C O     1 
ATOM   7238  C  CB    . ILE D  2  69  ? 1.509    -29.791 58.951   1.00 80.48  ? 70   ILE C CB    1 
ATOM   7239  C  CG1   . ILE D  2  69  ? 0.869    -30.983 58.234   1.00 72.06  ? 70   ILE C CG1   1 
ATOM   7240  C  CG2   . ILE D  2  69  ? 0.757    -29.418 60.220   1.00 87.69  ? 70   ILE C CG2   1 
ATOM   7241  C  CD1   . ILE D  2  69  ? 0.929    -32.281 58.991   1.00 71.38  ? 70   ILE C CD1   1 
ATOM   7242  N  N     . VAL D  2  70  ? 3.502    -27.365 59.053   1.00 85.39  ? 71   VAL C N     1 
ATOM   7243  C  CA    . VAL D  2  70  ? 4.190    -26.296 59.833   1.00 85.01  ? 71   VAL C CA    1 
ATOM   7244  C  C     . VAL D  2  70  ? 4.095    -24.979 59.047   1.00 80.60  ? 71   VAL C C     1 
ATOM   7245  O  O     . VAL D  2  70  ? 3.853    -23.931 59.671   1.00 85.41  ? 71   VAL C O     1 
ATOM   7246  C  CB    . VAL D  2  70  ? 5.654    -26.668 60.142   1.00 86.47  ? 71   VAL C CB    1 
ATOM   7247  C  CG1   . VAL D  2  70  ? 6.402    -25.512 60.783   1.00 92.69  ? 71   VAL C CG1   1 
ATOM   7248  C  CG2   . VAL D  2  70  ? 5.757    -27.911 61.019   1.00 87.67  ? 71   VAL C CG2   1 
ATOM   7249  N  N     . GLY D  2  71  ? 4.302    -25.035 57.729   1.00 76.74  ? 72   GLY C N     1 
ATOM   7250  C  CA    . GLY D  2  71  ? 4.210    -23.868 56.833   1.00 76.42  ? 72   GLY C CA    1 
ATOM   7251  C  C     . GLY D  2  71  ? 2.829    -23.246 56.894   1.00 72.81  ? 72   GLY C C     1 
ATOM   7252  O  O     . GLY D  2  71  ? 2.740    -22.014 57.071   1.00 68.58  ? 72   GLY C O     1 
ATOM   7253  N  N     . ASP D  2  72  ? 1.788    -24.076 56.769   1.00 76.00  ? 73   ASP C N     1 
ATOM   7254  C  CA    . ASP D  2  72  ? 0.362    -23.657 56.783   1.00 87.33  ? 73   ASP C CA    1 
ATOM   7255  C  C     . ASP D  2  72  ? 0.051    -22.996 58.133   1.00 90.15  ? 73   ASP C C     1 
ATOM   7256  O  O     . ASP D  2  72  ? -0.557   -21.892 58.124   1.00 97.58  ? 73   ASP C O     1 
ATOM   7257  C  CB    . ASP D  2  72  ? -0.547   -24.845 56.449   1.00 94.90  ? 73   ASP C CB    1 
ATOM   7258  C  CG    . ASP D  2  72  ? -2.028   -24.638 56.724   1.00 105.05 ? 73   ASP C CG    1 
ATOM   7259  O  OD1   . ASP D  2  72  ? -2.677   -23.872 55.972   1.00 105.35 ? 73   ASP C OD1   1 
ATOM   7260  O  OD2   . ASP D  2  72  ? -2.526   -25.280 57.668   1.00 117.44 ? 73   ASP C OD2   1 
ATOM   7261  N  N     . VAL D  2  73  ? 0.472    -23.613 59.242   1.00 84.56  ? 74   VAL C N     1 
ATOM   7262  C  CA    . VAL D  2  73  ? 0.169    -23.117 60.619   1.00 88.56  ? 74   VAL C CA    1 
ATOM   7263  C  C     . VAL D  2  73  ? 0.895    -21.781 60.844   1.00 78.21  ? 74   VAL C C     1 
ATOM   7264  O  O     . VAL D  2  73  ? 0.262    -20.851 61.361   1.00 69.94  ? 74   VAL C O     1 
ATOM   7265  C  CB    . VAL D  2  73  ? 0.528    -24.171 61.687   1.00 99.36  ? 74   VAL C CB    1 
ATOM   7266  C  CG1   . VAL D  2  73  ? 0.551    -23.590 63.093   1.00 105.38 ? 74   VAL C CG1   1 
ATOM   7267  C  CG2   . VAL D  2  73  ? -0.410   -25.362 61.623   1.00 101.74 ? 74   VAL C CG2   1 
ATOM   7268  N  N     . MET D  2  74  ? 2.166    -21.698 60.447   1.00 77.05  ? 75   MET C N     1 
ATOM   7269  C  CA    . MET D  2  74  ? 3.036    -20.501 60.614   1.00 77.11  ? 75   MET C CA    1 
ATOM   7270  C  C     . MET D  2  74  ? 2.496    -19.340 59.764   1.00 74.79  ? 75   MET C C     1 
ATOM   7271  O  O     . MET D  2  74  ? 2.505    -18.171 60.249   1.00 73.65  ? 75   MET C O     1 
ATOM   7272  C  CB    . MET D  2  74  ? 4.477    -20.822 60.203   1.00 82.75  ? 75   MET C CB    1 
ATOM   7273  C  CG    . MET D  2  74  ? 5.388    -19.604 60.141   1.00 84.00  ? 75   MET C CG    1 
ATOM   7274  S  SD    . MET D  2  74  ? 7.163    -19.981 60.259   1.00 96.32  ? 75   MET C SD    1 
ATOM   7275  C  CE    . MET D  2  74  ? 7.226    -21.688 59.722   1.00 98.14  ? 75   MET C CE    1 
ATOM   7276  N  N     . GLY D  2  75  ? 2.036    -19.646 58.548   1.00 77.67  ? 76   GLY C N     1 
ATOM   7277  C  CA    . GLY D  2  75  ? 1.461    -18.666 57.608   1.00 84.91  ? 76   GLY C CA    1 
ATOM   7278  C  C     . GLY D  2  75  ? 0.193    -18.022 58.148   1.00 86.60  ? 76   GLY C C     1 
ATOM   7279  O  O     . GLY D  2  75  ? 0.100    -16.786 58.095   1.00 83.58  ? 76   GLY C O     1 
ATOM   7280  N  N     . LYS D  2  76  ? -0.731   -18.823 58.692   1.00 83.83  ? 77   LYS C N     1 
ATOM   7281  C  CA    . LYS D  2  76  ? -2.155   -18.437 58.878   1.00 85.92  ? 77   LYS C CA    1 
ATOM   7282  C  C     . LYS D  2  76  ? -2.494   -18.077 60.333   1.00 85.33  ? 77   LYS C C     1 
ATOM   7283  O  O     . LYS D  2  76  ? -3.446   -17.288 60.521   1.00 89.34  ? 77   LYS C O     1 
ATOM   7284  C  CB    . LYS D  2  76  ? -3.058   -19.582 58.423   1.00 87.01  ? 77   LYS C CB    1 
ATOM   7285  C  CG    . LYS D  2  76  ? -2.982   -19.890 56.936   1.00 87.97  ? 77   LYS C CG    1 
ATOM   7286  C  CD    . LYS D  2  76  ? -4.049   -20.851 56.452   1.00 87.86  ? 77   LYS C CD    1 
ATOM   7287  C  CE    . LYS D  2  76  ? -3.979   -21.076 54.954   1.00 81.91  ? 77   LYS C CE    1 
ATOM   7288  N  NZ    . LYS D  2  76  ? -4.567   -22.375 54.550   1.00 76.82  ? 77   LYS C NZ    1 
ATOM   7289  N  N     . TYR D  2  77  ? -1.806   -18.657 61.324   1.00 75.81  ? 78   TYR C N     1 
ATOM   7290  C  CA    . TYR D  2  77  ? -2.255   -18.627 62.742   1.00 69.84  ? 78   TYR C CA    1 
ATOM   7291  C  C     . TYR D  2  77  ? -1.119   -18.257 63.711   1.00 72.46  ? 78   TYR C C     1 
ATOM   7292  O  O     . TYR D  2  77  ? -1.380   -17.446 64.624   1.00 78.72  ? 78   TYR C O     1 
ATOM   7293  C  CB    . TYR D  2  77  ? -2.855   -19.983 63.121   1.00 71.24  ? 78   TYR C CB    1 
ATOM   7294  C  CG    . TYR D  2  77  ? -3.796   -20.586 62.107   1.00 67.39  ? 78   TYR C CG    1 
ATOM   7295  C  CD1   . TYR D  2  77  ? -4.975   -19.946 61.752   1.00 63.98  ? 78   TYR C CD1   1 
ATOM   7296  C  CD2   . TYR D  2  77  ? -3.526   -21.817 61.524   1.00 63.88  ? 78   TYR C CD2   1 
ATOM   7297  C  CE1   . TYR D  2  77  ? -5.855   -20.501 60.837   1.00 62.12  ? 78   TYR C CE1   1 
ATOM   7298  C  CE2   . TYR D  2  77  ? -4.394   -22.385 60.601   1.00 62.05  ? 78   TYR C CE2   1 
ATOM   7299  C  CZ    . TYR D  2  77  ? -5.559   -21.724 60.254   1.00 59.09  ? 78   TYR C CZ    1 
ATOM   7300  O  OH    . TYR D  2  77  ? -6.403   -22.291 59.347   1.00 55.75  ? 78   TYR C OH    1 
ATOM   7301  N  N     . HIS D  2  78  ? 0.069    -18.854 63.553   1.00 70.53  ? 79   HIS C N     1 
ATOM   7302  C  CA    . HIS D  2  78  ? 1.173    -18.854 64.553   1.00 70.88  ? 79   HIS C CA    1 
ATOM   7303  C  C     . HIS D  2  78  ? 2.410    -18.150 63.999   1.00 73.07  ? 79   HIS C C     1 
ATOM   7304  O  O     . HIS D  2  78  ? 3.311    -18.797 63.464   1.00 87.49  ? 79   HIS C O     1 
ATOM   7305  C  CB    . HIS D  2  78  ? 1.492    -20.292 64.979   1.00 68.29  ? 79   HIS C CB    1 
ATOM   7306  C  CG    . HIS D  2  78  ? 2.106    -20.366 66.329   1.00 67.28  ? 79   HIS C CG    1 
ATOM   7307  N  ND1   . HIS D  2  78  ? 1.351    -20.206 67.466   1.00 74.78  ? 79   HIS C ND1   1 
ATOM   7308  C  CD2   . HIS D  2  78  ? 3.377    -20.554 66.736   1.00 66.45  ? 79   HIS C CD2   1 
ATOM   7309  C  CE1   . HIS D  2  78  ? 2.128    -20.297 68.524   1.00 75.97  ? 79   HIS C CE1   1 
ATOM   7310  N  NE2   . HIS D  2  78  ? 3.376    -20.510 68.103   1.00 75.94  ? 79   HIS C NE2   1 
ATOM   7311  N  N     . PRO D  2  79  ? 2.524    -16.811 64.144   1.00 67.23  ? 80   PRO C N     1 
ATOM   7312  C  CA    . PRO D  2  79  ? 3.625    -16.067 63.525   1.00 61.12  ? 80   PRO C CA    1 
ATOM   7313  C  C     . PRO D  2  79  ? 4.910    -16.166 64.363   1.00 52.96  ? 80   PRO C C     1 
ATOM   7314  O  O     . PRO D  2  79  ? 5.313    -15.167 64.926   1.00 46.49  ? 80   PRO C O     1 
ATOM   7315  C  CB    . PRO D  2  79  ? 3.045    -14.641 63.490   1.00 64.10  ? 80   PRO C CB    1 
ATOM   7316  C  CG    . PRO D  2  79  ? 2.244    -14.562 64.780   1.00 65.12  ? 80   PRO C CG    1 
ATOM   7317  C  CD    . PRO D  2  79  ? 1.639    -15.946 64.945   1.00 66.70  ? 80   PRO C CD    1 
ATOM   7318  N  N     . HIS D  2  80  ? 5.497    -17.366 64.438   1.00 51.50  ? 81   HIS C N     1 
ATOM   7319  C  CA    . HIS D  2  80  ? 6.717    -17.676 65.236   1.00 56.85  ? 81   HIS C CA    1 
ATOM   7320  C  C     . HIS D  2  80  ? 7.554    -18.730 64.510   1.00 61.48  ? 81   HIS C C     1 
ATOM   7321  O  O     . HIS D  2  80  ? 7.203    -19.095 63.370   1.00 60.99  ? 81   HIS C O     1 
ATOM   7322  C  CB    . HIS D  2  80  ? 6.365    -18.124 66.658   1.00 56.73  ? 81   HIS C CB    1 
ATOM   7323  C  CG    . HIS D  2  80  ? 5.518    -17.166 67.424   1.00 59.59  ? 81   HIS C CG    1 
ATOM   7324  N  ND1   . HIS D  2  80  ? 6.066    -16.113 68.114   1.00 56.12  ? 81   HIS C ND1   1 
ATOM   7325  C  CD2   . HIS D  2  80  ? 4.177    -17.119 67.632   1.00 61.63  ? 81   HIS C CD2   1 
ATOM   7326  C  CE1   . HIS D  2  80  ? 5.099    -15.442 68.715   1.00 61.67  ? 81   HIS C CE1   1 
ATOM   7327  N  NE2   . HIS D  2  80  ? 3.927    -16.039 68.431   1.00 59.66  ? 81   HIS C NE2   1 
ATOM   7328  N  N     A GLY D  2  81  ? 8.631    -19.192 65.152   0.50 67.79  ? 82   GLY C N     1 
ATOM   7329  N  N     B GLY D  2  81  ? 8.631    -19.193 65.152   0.50 67.79  ? 82   GLY C N     1 
ATOM   7330  C  CA    A GLY D  2  81  ? 9.640    -20.084 64.550   0.50 77.43  ? 82   GLY C CA    1 
ATOM   7331  C  CA    B GLY D  2  81  ? 9.640    -20.084 64.550   0.50 77.43  ? 82   GLY C CA    1 
ATOM   7332  C  C     A GLY D  2  81  ? 9.040    -21.406 64.110   0.50 83.47  ? 82   GLY C C     1 
ATOM   7333  C  C     B GLY D  2  81  ? 9.039    -21.406 64.109   0.50 83.47  ? 82   GLY C C     1 
ATOM   7334  O  O     A GLY D  2  81  ? 8.124    -21.890 64.798   0.50 84.25  ? 82   GLY C O     1 
ATOM   7335  O  O     B GLY D  2  81  ? 8.124    -21.889 64.798   0.50 84.25  ? 82   GLY C O     1 
ATOM   7336  N  N     . ASP D  2  82  ? 9.540    -21.959 63.002   1.00 88.46  ? 83   ASP C N     1 
ATOM   7337  C  CA    . ASP D  2  82  ? 9.186    -23.320 62.515   1.00 97.86  ? 83   ASP C CA    1 
ATOM   7338  C  C     . ASP D  2  82  ? 9.582    -24.363 63.580   1.00 92.81  ? 83   ASP C C     1 
ATOM   7339  O  O     . ASP D  2  82  ? 8.791    -25.298 63.807   1.00 100.73 ? 83   ASP C O     1 
ATOM   7340  C  CB    . ASP D  2  82  ? 9.829    -23.602 61.153   1.00 103.81 ? 83   ASP C CB    1 
ATOM   7341  C  CG    . ASP D  2  82  ? 11.323   -23.343 61.141   1.00 121.91 ? 83   ASP C CG    1 
ATOM   7342  O  OD1   . ASP D  2  82  ? 11.715   -22.219 61.511   1.00 135.40 ? 83   ASP C OD1   1 
ATOM   7343  O  OD2   . ASP D  2  82  ? 12.084   -24.271 60.792   1.00 136.35 ? 83   ASP C OD2   1 
ATOM   7344  N  N     . SER D  2  83  ? 10.736   -24.219 64.241   1.00 69.99  ? 84   SER C N     1 
ATOM   7345  C  CA    . SER D  2  83  ? 11.162   -25.180 65.293   1.00 61.91  ? 84   SER C CA    1 
ATOM   7346  C  C     . SER D  2  83  ? 10.145   -25.198 66.450   1.00 57.12  ? 84   SER C C     1 
ATOM   7347  O  O     . SER D  2  83  ? 9.823    -26.293 66.925   1.00 56.89  ? 84   SER C O     1 
ATOM   7348  C  CB    . SER D  2  83  ? 12.568   -24.916 65.782   1.00 56.38  ? 84   SER C CB    1 
ATOM   7349  O  OG    . SER D  2  83  ? 12.817   -25.527 67.043   1.00 51.99  ? 84   SER C OG    1 
ATOM   7350  N  N     . SER D  2  84  ? 9.649    -24.041 66.897   1.00 56.13  ? 85   SER C N     1 
ATOM   7351  C  CA    . SER D  2  84  ? 8.679    -23.952 68.027   1.00 60.44  ? 85   SER C CA    1 
ATOM   7352  C  C     . SER D  2  84  ? 7.429    -24.769 67.679   1.00 55.48  ? 85   SER C C     1 
ATOM   7353  O  O     . SER D  2  84  ? 6.934    -25.497 68.560   1.00 47.95  ? 85   SER C O     1 
ATOM   7354  C  CB    . SER D  2  84  ? 8.321    -22.523 68.380   1.00 68.55  ? 85   SER C CB    1 
ATOM   7355  O  OG    . SER D  2  84  ? 9.465    -21.828 68.882   1.00 70.25  ? 85   SER C OG    1 
ATOM   7356  N  N     . ILE D  2  85  ? 6.959    -24.645 66.434   1.00 55.26  ? 86   ILE C N     1 
ATOM   7357  C  CA    . ILE D  2  85  ? 5.723    -25.316 65.928   1.00 58.75  ? 86   ILE C CA    1 
ATOM   7358  C  C     . ILE D  2  85  ? 5.999    -26.813 65.769   1.00 56.33  ? 86   ILE C C     1 
ATOM   7359  O  O     . ILE D  2  85  ? 5.221    -27.607 66.307   1.00 49.88  ? 86   ILE C O     1 
ATOM   7360  C  CB    . ILE D  2  85  ? 5.232    -24.680 64.613   1.00 59.71  ? 86   ILE C CB    1 
ATOM   7361  C  CG1   . ILE D  2  85  ? 4.789    -23.227 64.817   1.00 58.64  ? 86   ILE C CG1   1 
ATOM   7362  C  CG2   . ILE D  2  85  ? 4.132    -25.514 63.981   1.00 57.49  ? 86   ILE C CG2   1 
ATOM   7363  C  CD1   . ILE D  2  85  ? 4.717    -22.425 63.524   1.00 58.82  ? 86   ILE C CD1   1 
ATOM   7364  N  N     . TYR D  2  86  ? 7.050    -27.182 65.043   1.00 53.59  ? 87   TYR C N     1 
ATOM   7365  C  CA    . TYR D  2  86  ? 7.331    -28.600 64.718   1.00 57.42  ? 87   TYR C CA    1 
ATOM   7366  C  C     . TYR D  2  86  ? 7.532    -29.418 65.995   1.00 55.11  ? 87   TYR C C     1 
ATOM   7367  O  O     . TYR D  2  86  ? 6.952    -30.514 66.089   1.00 55.39  ? 87   TYR C O     1 
ATOM   7368  C  CB    . TYR D  2  86  ? 8.559    -28.746 63.826   1.00 59.82  ? 87   TYR C CB    1 
ATOM   7369  C  CG    . TYR D  2  86  ? 8.830    -30.176 63.433   1.00 59.99  ? 87   TYR C CG    1 
ATOM   7370  C  CD1   . TYR D  2  86  ? 7.857    -30.930 62.794   1.00 57.18  ? 87   TYR C CD1   1 
ATOM   7371  C  CD2   . TYR D  2  86  ? 10.043   -30.780 63.715   1.00 57.32  ? 87   TYR C CD2   1 
ATOM   7372  C  CE1   . TYR D  2  86  ? 8.094    -32.243 62.424   1.00 58.92  ? 87   TYR C CE1   1 
ATOM   7373  C  CE2   . TYR D  2  86  ? 10.300   -32.086 63.341   1.00 57.28  ? 87   TYR C CE2   1 
ATOM   7374  C  CZ    . TYR D  2  86  ? 9.322    -32.822 62.694   1.00 62.13  ? 87   TYR C CZ    1 
ATOM   7375  O  OH    . TYR D  2  86  ? 9.564    -34.110 62.319   1.00 74.50  ? 87   TYR C OH    1 
ATOM   7376  N  N     . GLU D  2  87  ? 8.340    -28.925 66.933   1.00 56.84  ? 88   GLU C N     1 
ATOM   7377  C  CA    . GLU D  2  87  ? 8.657    -29.657 68.187   1.00 63.96  ? 88   GLU C CA    1 
ATOM   7378  C  C     . GLU D  2  87  ? 7.365    -29.853 68.992   1.00 70.45  ? 88   GLU C C     1 
ATOM   7379  O  O     . GLU D  2  87  ? 7.233    -30.908 69.638   1.00 88.70  ? 88   GLU C O     1 
ATOM   7380  C  CB    . GLU D  2  87  ? 9.699    -28.903 69.022   1.00 64.70  ? 88   GLU C CB    1 
ATOM   7381  C  CG    . GLU D  2  87  ? 11.119   -29.017 68.506   1.00 72.95  ? 88   GLU C CG    1 
ATOM   7382  C  CD    . GLU D  2  87  ? 12.132   -28.098 69.205   1.00 77.12  ? 88   GLU C CD    1 
ATOM   7383  O  OE1   . GLU D  2  87  ? 13.232   -27.868 68.638   1.00 79.65  ? 88   GLU C OE1   1 
ATOM   7384  O  OE2   . GLU D  2  87  ? 11.816   -27.561 70.293   1.00 78.16  ? 88   GLU C OE2   1 
ATOM   7385  N  N     . ALA D  2  88  ? 6.449    -28.875 68.957   1.00 66.55  ? 89   ALA C N     1 
ATOM   7386  C  CA    . ALA D  2  88  ? 5.168    -28.932 69.693   1.00 66.10  ? 89   ALA C CA    1 
ATOM   7387  C  C     . ALA D  2  88  ? 4.280    -30.012 69.067   1.00 65.48  ? 89   ALA C C     1 
ATOM   7388  O  O     . ALA D  2  88  ? 3.546    -30.679 69.810   1.00 65.50  ? 89   ALA C O     1 
ATOM   7389  C  CB    . ALA D  2  88  ? 4.483    -27.589 69.680   1.00 70.61  ? 89   ALA C CB    1 
ATOM   7390  N  N     . MET D  2  89  ? 4.337    -30.151 67.741   1.00 62.41  ? 90   MET C N     1 
ATOM   7391  C  CA    . MET D  2  89  ? 3.564    -31.172 66.994   1.00 62.65  ? 90   MET C CA    1 
ATOM   7392  C  C     . MET D  2  89  ? 4.167    -32.551 67.274   1.00 53.37  ? 90   MET C C     1 
ATOM   7393  O  O     . MET D  2  89  ? 3.394    -33.492 67.535   1.00 45.46  ? 90   MET C O     1 
ATOM   7394  C  CB    . MET D  2  89  ? 3.576    -30.894 65.491   1.00 70.92  ? 90   MET C CB    1 
ATOM   7395  C  CG    . MET D  2  89  ? 2.579    -31.760 64.732   1.00 78.04  ? 90   MET C CG    1 
ATOM   7396  S  SD    . MET D  2  89  ? 2.825    -31.668 62.946   1.00 94.54  ? 90   MET C SD    1 
ATOM   7397  C  CE    . MET D  2  89  ? 4.306    -32.661 62.748   1.00 89.21  ? 90   MET C CE    1 
ATOM   7398  N  N     . VAL D  2  90  ? 5.496    -32.652 67.245   1.00 51.43  ? 91   VAL C N     1 
ATOM   7399  C  CA    . VAL D  2  90  ? 6.239    -33.917 67.511   1.00 54.16  ? 91   VAL C CA    1 
ATOM   7400  C  C     . VAL D  2  90  ? 5.770    -34.505 68.847   1.00 50.94  ? 91   VAL C C     1 
ATOM   7401  O  O     . VAL D  2  90  ? 5.370    -35.679 68.870   1.00 44.67  ? 91   VAL C O     1 
ATOM   7402  C  CB    . VAL D  2  90  ? 7.764    -33.667 67.491   1.00 58.75  ? 91   VAL C CB    1 
ATOM   7403  C  CG1   . VAL D  2  90  ? 8.549    -34.809 68.123   1.00 53.16  ? 91   VAL C CG1   1 
ATOM   7404  C  CG2   . VAL D  2  90  ? 8.274    -33.417 66.080   1.00 65.88  ? 91   VAL C CG2   1 
ATOM   7405  N  N     . ARG D  2  91  ? 5.815    -33.703 69.916   1.00 53.98  ? 92   ARG C N     1 
ATOM   7406  C  CA    . ARG D  2  91  ? 5.483    -34.117 71.313   1.00 55.21  ? 92   ARG C CA    1 
ATOM   7407  C  C     . ARG D  2  91  ? 4.067    -34.702 71.352   1.00 53.66  ? 92   ARG C C     1 
ATOM   7408  O  O     . ARG D  2  91  ? 3.887    -35.737 72.016   1.00 52.59  ? 92   ARG C O     1 
ATOM   7409  C  CB    . ARG D  2  91  ? 5.595    -32.916 72.258   1.00 55.56  ? 92   ARG C CB    1 
ATOM   7410  C  CG    . ARG D  2  91  ? 6.878    -32.926 73.076   1.00 60.58  ? 92   ARG C CG    1 
ATOM   7411  C  CD    . ARG D  2  91  ? 6.989    -31.859 74.152   1.00 67.20  ? 92   ARG C CD    1 
ATOM   7412  N  NE    . ARG D  2  91  ? 5.806    -31.662 75.007   1.00 71.92  ? 92   ARG C NE    1 
ATOM   7413  C  CZ    . ARG D  2  91  ? 5.438    -32.424 76.056   1.00 68.18  ? 92   ARG C CZ    1 
ATOM   7414  N  NH1   . ARG D  2  91  ? 6.076    -33.561 76.308   1.00 70.64  ? 92   ARG C NH1   1 
ATOM   7415  N  NH2   . ARG D  2  91  ? 4.343    -32.111 76.727   1.00 66.29  ? 92   ARG C NH2   1 
ATOM   7416  N  N     . MET D  2  92  ? 3.105    -34.072 70.666   1.00 54.36  ? 93   MET C N     1 
ATOM   7417  C  CA    . MET D  2  92  ? 1.683    -34.509 70.616   1.00 56.18  ? 93   MET C CA    1 
ATOM   7418  C  C     . MET D  2  92  ? 1.571    -35.882 69.939   1.00 59.88  ? 93   MET C C     1 
ATOM   7419  O  O     . MET D  2  92  ? 0.489    -36.506 70.035   1.00 60.63  ? 93   MET C O     1 
ATOM   7420  C  CB    . MET D  2  92  ? 0.826    -33.507 69.829   1.00 56.42  ? 93   MET C CB    1 
ATOM   7421  C  CG    . MET D  2  92  ? 0.584    -32.189 70.526   1.00 53.54  ? 93   MET C CG    1 
ATOM   7422  S  SD    . MET D  2  92  ? -0.742   -31.179 69.728   1.00 44.91  ? 93   MET C SD    1 
ATOM   7423  C  CE    . MET D  2  92  ? 0.156    -30.497 68.348   1.00 42.98  ? 93   MET C CE    1 
ATOM   7424  N  N     . ALA D  2  93  ? 2.626    -36.310 69.237   1.00 59.40  ? 94   ALA C N     1 
ATOM   7425  C  CA    . ALA D  2  93  ? 2.644    -37.547 68.429   1.00 58.08  ? 94   ALA C CA    1 
ATOM   7426  C  C     . ALA D  2  93  ? 3.424    -38.649 69.147   1.00 57.23  ? 94   ALA C C     1 
ATOM   7427  O  O     . ALA D  2  93  ? 3.382    -39.799 68.657   1.00 57.76  ? 94   ALA C O     1 
ATOM   7428  C  CB    . ALA D  2  93  ? 3.234    -37.263 67.071   1.00 57.12  ? 94   ALA C CB    1 
ATOM   7429  N  N     . GLN D  2  94  ? 4.092    -38.331 70.258   1.00 54.67  ? 95   GLN C N     1 
ATOM   7430  C  CA    . GLN D  2  94  ? 4.937    -39.300 71.009   1.00 53.48  ? 95   GLN C CA    1 
ATOM   7431  C  C     . GLN D  2  94  ? 4.074    -40.028 72.040   1.00 49.79  ? 95   GLN C C     1 
ATOM   7432  O  O     . GLN D  2  94  ? 3.516    -39.344 72.941   1.00 52.76  ? 95   GLN C O     1 
ATOM   7433  C  CB    . GLN D  2  94  ? 6.106    -38.587 71.691   1.00 52.33  ? 95   GLN C CB    1 
ATOM   7434  C  CG    . GLN D  2  94  ? 7.117    -38.050 70.699   1.00 51.71  ? 95   GLN C CG    1 
ATOM   7435  C  CD    . GLN D  2  94  ? 8.134    -37.147 71.350   1.00 45.68  ? 95   GLN C CD    1 
ATOM   7436  O  OE1   . GLN D  2  94  ? 7.983    -36.720 72.485   1.00 37.35  ? 95   GLN C OE1   1 
ATOM   7437  N  NE2   . GLN D  2  94  ? 9.198    -36.854 70.620   1.00 43.19  ? 95   GLN C NE2   1 
ATOM   7438  N  N     . ASP D  2  95  ? 3.986    -41.354 71.931   1.00 47.09  ? 96   ASP C N     1 
ATOM   7439  C  CA    . ASP D  2  95  ? 3.103    -42.165 72.809   1.00 50.39  ? 96   ASP C CA    1 
ATOM   7440  C  C     . ASP D  2  95  ? 3.709    -42.238 74.219   1.00 49.45  ? 96   ASP C C     1 
ATOM   7441  O  O     . ASP D  2  95  ? 2.978    -42.686 75.114   1.00 42.32  ? 96   ASP C O     1 
ATOM   7442  C  CB    . ASP D  2  95  ? 2.843    -43.551 72.222   1.00 52.29  ? 96   ASP C CB    1 
ATOM   7443  C  CG    . ASP D  2  95  ? 4.076    -44.432 72.165   1.00 55.17  ? 96   ASP C CG    1 
ATOM   7444  O  OD1   . ASP D  2  95  ? 5.156    -43.968 72.619   1.00 47.38  ? 96   ASP C OD1   1 
ATOM   7445  O  OD2   . ASP D  2  95  ? 3.942    -45.569 71.657   1.00 64.77  ? 96   ASP C OD2   1 
ATOM   7446  N  N     . PHE D  2  96  ? 4.971    -41.810 74.395   1.00 47.23  ? 97   PHE C N     1 
ATOM   7447  C  CA    . PHE D  2  96  ? 5.685    -41.750 75.702   1.00 48.96  ? 97   PHE C CA    1 
ATOM   7448  C  C     . PHE D  2  96  ? 5.607    -40.345 76.310   1.00 49.42  ? 97   PHE C C     1 
ATOM   7449  O  O     . PHE D  2  96  ? 6.053    -40.184 77.455   1.00 50.53  ? 97   PHE C O     1 
ATOM   7450  C  CB    . PHE D  2  96  ? 7.151    -42.188 75.574   1.00 53.58  ? 97   PHE C CB    1 
ATOM   7451  C  CG    . PHE D  2  96  ? 7.954    -41.498 74.498   1.00 61.28  ? 97   PHE C CG    1 
ATOM   7452  C  CD1   . PHE D  2  96  ? 8.555    -40.268 74.730   1.00 67.54  ? 97   PHE C CD1   1 
ATOM   7453  C  CD2   . PHE D  2  96  ? 8.107    -42.080 73.251   1.00 65.86  ? 97   PHE C CD2   1 
ATOM   7454  C  CE1   . PHE D  2  96  ? 9.272    -39.632 73.728   1.00 70.24  ? 97   PHE C CE1   1 
ATOM   7455  C  CE2   . PHE D  2  96  ? 8.806    -41.433 72.243   1.00 66.92  ? 97   PHE C CE2   1 
ATOM   7456  C  CZ    . PHE D  2  96  ? 9.402    -40.215 72.488   1.00 67.14  ? 97   PHE C CZ    1 
ATOM   7457  N  N     . SER D  2  97  ? 5.075    -39.361 75.585   1.00 49.91  ? 98   SER C N     1 
ATOM   7458  C  CA    . SER D  2  97  ? 4.906    -37.962 76.067   1.00 47.48  ? 98   SER C CA    1 
ATOM   7459  C  C     . SER D  2  97  ? 3.430    -37.708 76.358   1.00 48.12  ? 98   SER C C     1 
ATOM   7460  O  O     . SER D  2  97  ? 3.124    -37.267 77.481   1.00 51.45  ? 98   SER C O     1 
ATOM   7461  C  CB    . SER D  2  97  ? 5.449    -36.955 75.089   1.00 45.94  ? 98   SER C CB    1 
ATOM   7462  O  OG    . SER D  2  97  ? 6.863    -37.098 74.968   1.00 45.44  ? 98   SER C OG    1 
ATOM   7463  N  N     . TYR D  2  98  ? 2.567    -38.022 75.388   1.00 49.58  ? 99   TYR C N     1 
ATOM   7464  C  CA    . TYR D  2  98  ? 1.092    -37.840 75.444   1.00 51.83  ? 99   TYR C CA    1 
ATOM   7465  C  C     . TYR D  2  98  ? 0.411    -39.182 75.775   1.00 51.44  ? 99   TYR C C     1 
ATOM   7466  O  O     . TYR D  2  98  ? 0.595    -40.189 75.061   1.00 54.41  ? 99   TYR C O     1 
ATOM   7467  C  CB    . TYR D  2  98  ? 0.603    -37.230 74.131   1.00 53.79  ? 99   TYR C CB    1 
ATOM   7468  C  CG    . TYR D  2  98  ? 0.569    -35.718 74.126   1.00 54.96  ? 99   TYR C CG    1 
ATOM   7469  C  CD1   . TYR D  2  98  ? 1.724    -34.954 74.127   1.00 54.13  ? 99   TYR C CD1   1 
ATOM   7470  C  CD2   . TYR D  2  98  ? -0.638   -35.053 74.068   1.00 56.25  ? 99   TYR C CD2   1 
ATOM   7471  C  CE1   . TYR D  2  98  ? 1.670    -33.566 74.107   1.00 53.10  ? 99   TYR C CE1   1 
ATOM   7472  C  CE2   . TYR D  2  98  ? -0.707   -33.666 74.062   1.00 54.69  ? 99   TYR C CE2   1 
ATOM   7473  C  CZ    . TYR D  2  98  ? 0.449    -32.917 74.097   1.00 51.94  ? 99   TYR C CZ    1 
ATOM   7474  O  OH    . TYR D  2  98  ? 0.367    -31.556 74.089   1.00 47.82  ? 99   TYR C OH    1 
ATOM   7475  N  N     . ARG D  2  99  ? -0.348   -39.194 76.871   1.00 49.49  ? 100  ARG C N     1 
ATOM   7476  C  CA    . ARG D  2  99  ? -1.137   -40.357 77.348   1.00 47.58  ? 100  ARG C CA    1 
ATOM   7477  C  C     . ARG D  2  99  ? -2.184   -40.737 76.294   1.00 50.05  ? 100  ARG C C     1 
ATOM   7478  O  O     . ARG D  2  99  ? -2.419   -41.950 76.076   1.00 57.49  ? 100  ARG C O     1 
ATOM   7479  C  CB    . ARG D  2  99  ? -1.827   -39.985 78.658   1.00 50.15  ? 100  ARG C CB    1 
ATOM   7480  C  CG    . ARG D  2  99  ? -2.549   -41.139 79.331   1.00 48.77  ? 100  ARG C CG    1 
ATOM   7481  C  CD    . ARG D  2  99  ? -1.561   -42.238 79.699   1.00 46.16  ? 100  ARG C CD    1 
ATOM   7482  N  NE    . ARG D  2  99  ? -2.266   -43.369 80.268   1.00 43.80  ? 100  ARG C NE    1 
ATOM   7483  C  CZ    . ARG D  2  99  ? -3.091   -44.164 79.590   1.00 39.47  ? 100  ARG C CZ    1 
ATOM   7484  N  NH1   . ARG D  2  99  ? -3.320   -43.962 78.306   1.00 33.25  ? 100  ARG C NH1   1 
ATOM   7485  N  NH2   . ARG D  2  99  ? -3.691   -45.161 80.211   1.00 45.20  ? 100  ARG C NH2   1 
ATOM   7486  N  N     . TYR D  2  100 ? -2.803   -39.729 75.674   1.00 44.69  ? 101  TYR C N     1 
ATOM   7487  C  CA    . TYR D  2  100 ? -3.702   -39.875 74.503   1.00 44.81  ? 101  TYR C CA    1 
ATOM   7488  C  C     . TYR D  2  100 ? -3.146   -38.992 73.397   1.00 45.26  ? 101  TYR C C     1 
ATOM   7489  O  O     . TYR D  2  100 ? -3.479   -37.811 73.309   1.00 41.05  ? 101  TYR C O     1 
ATOM   7490  C  CB    . TYR D  2  100 ? -5.149   -39.588 74.920   1.00 43.69  ? 101  TYR C CB    1 
ATOM   7491  C  CG    . TYR D  2  100 ? -5.575   -40.458 76.070   1.00 42.34  ? 101  TYR C CG    1 
ATOM   7492  C  CD1   . TYR D  2  100 ? -6.009   -41.749 75.844   1.00 45.48  ? 101  TYR C CD1   1 
ATOM   7493  C  CD2   . TYR D  2  100 ? -5.455   -40.037 77.379   1.00 44.29  ? 101  TYR C CD2   1 
ATOM   7494  C  CE1   . TYR D  2  100 ? -6.370   -42.588 76.886   1.00 47.37  ? 101  TYR C CE1   1 
ATOM   7495  C  CE2   . TYR D  2  100 ? -5.789   -40.866 78.434   1.00 47.54  ? 101  TYR C CE2   1 
ATOM   7496  C  CZ    . TYR D  2  100 ? -6.254   -42.144 78.187   1.00 47.82  ? 101  TYR C CZ    1 
ATOM   7497  O  OH    . TYR D  2  100 ? -6.606   -42.968 79.218   1.00 54.72  ? 101  TYR C OH    1 
ATOM   7498  N  N     . PRO D  2  101 ? -2.235   -39.531 72.551   1.00 48.65  ? 102  PRO C N     1 
ATOM   7499  C  CA    . PRO D  2  101 ? -1.666   -38.777 71.438   1.00 51.65  ? 102  PRO C CA    1 
ATOM   7500  C  C     . PRO D  2  101 ? -2.745   -38.077 70.601   1.00 50.93  ? 102  PRO C C     1 
ATOM   7501  O  O     . PRO D  2  101 ? -3.767   -38.690 70.326   1.00 57.69  ? 102  PRO C O     1 
ATOM   7502  C  CB    . PRO D  2  101 ? -0.963   -39.865 70.619   1.00 50.77  ? 102  PRO C CB    1 
ATOM   7503  C  CG    . PRO D  2  101 ? -0.540   -40.879 71.655   1.00 48.41  ? 102  PRO C CG    1 
ATOM   7504  C  CD    . PRO D  2  101 ? -1.693   -40.898 72.630   1.00 48.27  ? 102  PRO C CD    1 
ATOM   7505  N  N     . LEU D  2  102 ? -2.487   -36.819 70.238   1.00 47.19  ? 103  LEU C N     1 
ATOM   7506  C  CA    . LEU D  2  102 ? -3.409   -35.965 69.448   1.00 46.92  ? 103  LEU C CA    1 
ATOM   7507  C  C     . LEU D  2  102 ? -2.944   -35.897 67.994   1.00 47.92  ? 103  LEU C C     1 
ATOM   7508  O  O     . LEU D  2  102 ? -3.704   -35.389 67.147   1.00 47.98  ? 103  LEU C O     1 
ATOM   7509  C  CB    . LEU D  2  102 ? -3.441   -34.575 70.092   1.00 49.67  ? 103  LEU C CB    1 
ATOM   7510  C  CG    . LEU D  2  102 ? -3.823   -34.560 71.560   1.00 49.15  ? 103  LEU C CG    1 
ATOM   7511  C  CD1   . LEU D  2  102 ? -3.907   -33.128 72.076   1.00 47.64  ? 103  LEU C CD1   1 
ATOM   7512  C  CD2   . LEU D  2  102 ? -5.124   -35.309 71.761   1.00 47.23  ? 103  LEU C CD2   1 
ATOM   7513  N  N     . VAL D  2  103 ? -1.738   -36.387 67.709   1.00 53.05  ? 104  VAL C N     1 
ATOM   7514  C  CA    . VAL D  2  103 ? -1.159   -36.373 66.335   1.00 55.70  ? 104  VAL C CA    1 
ATOM   7515  C  C     . VAL D  2  103 ? -0.647   -37.775 66.016   1.00 50.43  ? 104  VAL C C     1 
ATOM   7516  O  O     . VAL D  2  103 ? 0.012    -38.396 66.865   1.00 53.60  ? 104  VAL C O     1 
ATOM   7517  C  CB    . VAL D  2  103 ? -0.042   -35.325 66.195   1.00 64.14  ? 104  VAL C CB    1 
ATOM   7518  C  CG1   . VAL D  2  103 ? 0.577    -35.378 64.812   1.00 76.09  ? 104  VAL C CG1   1 
ATOM   7519  C  CG2   . VAL D  2  103 ? -0.530   -33.928 66.519   1.00 61.55  ? 104  VAL C CG2   1 
ATOM   7520  N  N     . ASP D  2  104 ? -0.943   -38.228 64.806   1.00 45.46  ? 105  ASP C N     1 
ATOM   7521  C  CA    . ASP D  2  104 ? -0.542   -39.555 64.289   1.00 52.05  ? 105  ASP C CA    1 
ATOM   7522  C  C     . ASP D  2  104 ? 0.638    -39.310 63.355   1.00 57.93  ? 105  ASP C C     1 
ATOM   7523  O  O     . ASP D  2  104 ? 0.414    -38.739 62.281   1.00 62.53  ? 105  ASP C O     1 
ATOM   7524  C  CB    . ASP D  2  104 ? -1.756   -40.257 63.670   1.00 51.94  ? 105  ASP C CB    1 
ATOM   7525  C  CG    . ASP D  2  104 ? -1.439   -41.544 62.941   1.00 49.25  ? 105  ASP C CG    1 
ATOM   7526  O  OD1   . ASP D  2  104 ? -0.285   -42.014 63.033   1.00 43.75  ? 105  ASP C OD1   1 
ATOM   7527  O  OD2   . ASP D  2  104 ? -2.354   -42.051 62.260   1.00 50.24  ? 105  ASP C OD2   1 
ATOM   7528  N  N     . GLY D  2  105 ? 1.842    -39.703 63.791   1.00 67.57  ? 106  GLY C N     1 
ATOM   7529  C  CA    . GLY D  2  105 ? 3.121    -39.454 63.101   1.00 75.41  ? 106  GLY C CA    1 
ATOM   7530  C  C     . GLY D  2  105 ? 3.543    -40.648 62.260   1.00 80.26  ? 106  GLY C C     1 
ATOM   7531  O  O     . GLY D  2  105 ? 3.221    -41.791 62.639   1.00 89.32  ? 106  GLY C O     1 
ATOM   7532  N  N     . GLN D  2  106 ? 4.199    -40.388 61.129   1.00 73.94  ? 107  GLN C N     1 
ATOM   7533  C  CA    . GLN D  2  106 ? 4.845    -41.403 60.267   1.00 67.76  ? 107  GLN C CA    1 
ATOM   7534  C  C     . GLN D  2  106 ? 6.327    -41.040 60.174   1.00 58.89  ? 107  GLN C C     1 
ATOM   7535  O  O     . GLN D  2  106 ? 6.634    -39.979 59.585   1.00 52.10  ? 107  GLN C O     1 
ATOM   7536  C  CB    . GLN D  2  106 ? 4.178    -41.426 58.888   1.00 72.52  ? 107  GLN C CB    1 
ATOM   7537  C  CG    . GLN D  2  106 ? 4.880    -42.335 57.889   1.00 74.29  ? 107  GLN C CG    1 
ATOM   7538  C  CD    . GLN D  2  106 ? 3.911    -43.259 57.192   1.00 68.09  ? 107  GLN C CD    1 
ATOM   7539  O  OE1   . GLN D  2  106 ? 3.405    -44.200 57.799   1.00 54.93  ? 107  GLN C OE1   1 
ATOM   7540  N  NE2   . GLN D  2  106 ? 3.644    -42.981 55.921   1.00 59.18  ? 107  GLN C NE2   1 
ATOM   7541  N  N     . GLY D  2  107 ? 7.200    -41.858 60.766   1.00 63.25  ? 108  GLY C N     1 
ATOM   7542  C  CA    . GLY D  2  107 ? 8.666    -41.707 60.670   1.00 72.08  ? 108  GLY C CA    1 
ATOM   7543  C  C     . GLY D  2  107 ? 9.324    -41.510 62.028   1.00 70.45  ? 108  GLY C C     1 
ATOM   7544  O  O     . GLY D  2  107 ? 8.705    -41.905 63.032   1.00 74.03  ? 108  GLY C O     1 
ATOM   7545  N  N     . ASN D  2  108 ? 10.525   -40.924 62.048   1.00 65.04  ? 109  ASN C N     1 
ATOM   7546  C  CA    . ASN D  2  108 ? 11.329   -40.762 63.284   1.00 65.53  ? 109  ASN C CA    1 
ATOM   7547  C  C     . ASN D  2  108 ? 10.801   -39.552 64.060   1.00 64.16  ? 109  ASN C C     1 
ATOM   7548  O  O     . ASN D  2  108 ? 11.291   -38.446 63.784   1.00 67.92  ? 109  ASN C O     1 
ATOM   7549  C  CB    . ASN D  2  108 ? 12.829   -40.651 62.987   1.00 67.80  ? 109  ASN C CB    1 
ATOM   7550  C  CG    . ASN D  2  108 ? 13.696   -40.531 64.226   1.00 70.99  ? 109  ASN C CG    1 
ATOM   7551  O  OD1   . ASN D  2  108 ? 13.220   -40.654 65.352   1.00 80.03  ? 109  ASN C OD1   1 
ATOM   7552  N  ND2   . ASN D  2  108 ? 14.985   -40.312 64.029   1.00 70.83  ? 109  ASN C ND2   1 
ATOM   7553  N  N     . PHE D  2  109 ? 9.890    -39.776 65.022   1.00 61.88  ? 110  PHE C N     1 
ATOM   7554  C  CA    . PHE D  2  109 ? 9.361    -38.761 65.974   1.00 58.06  ? 110  PHE C CA    1 
ATOM   7555  C  C     . PHE D  2  109 ? 10.044   -38.896 67.341   1.00 53.45  ? 110  PHE C C     1 
ATOM   7556  O  O     . PHE D  2  109 ? 9.457    -38.487 68.370   1.00 48.72  ? 110  PHE C O     1 
ATOM   7557  C  CB    . PHE D  2  109 ? 7.844    -38.885 66.114   1.00 60.84  ? 110  PHE C CB    1 
ATOM   7558  C  CG    . PHE D  2  109 ? 7.079    -38.176 65.033   1.00 58.34  ? 110  PHE C CG    1 
ATOM   7559  C  CD1   . PHE D  2  109 ? 6.857    -38.793 63.816   1.00 60.44  ? 110  PHE C CD1   1 
ATOM   7560  C  CD2   . PHE D  2  109 ? 6.601    -36.891 65.231   1.00 56.06  ? 110  PHE C CD2   1 
ATOM   7561  C  CE1   . PHE D  2  109 ? 6.159    -38.134 62.817   1.00 65.40  ? 110  PHE C CE1   1 
ATOM   7562  C  CE2   . PHE D  2  109 ? 5.922    -36.234 64.227   1.00 57.97  ? 110  PHE C CE2   1 
ATOM   7563  C  CZ    . PHE D  2  109 ? 5.685    -36.859 63.029   1.00 61.49  ? 110  PHE C CZ    1 
ATOM   7564  N  N     . GLY D  2  110 ? 11.277   -39.414 67.337   1.00 56.74  ? 111  GLY C N     1 
ATOM   7565  C  CA    . GLY D  2  110 ? 12.118   -39.562 68.534   1.00 63.17  ? 111  GLY C CA    1 
ATOM   7566  C  C     . GLY D  2  110 ? 11.824   -40.860 69.261   1.00 64.23  ? 111  GLY C C     1 
ATOM   7567  O  O     . GLY D  2  110 ? 10.955   -41.633 68.811   1.00 71.69  ? 111  GLY C O     1 
ATOM   7568  N  N     . SER D  2  111 ? 12.545   -41.067 70.358   1.00 63.49  ? 112  SER C N     1 
ATOM   7569  C  CA    . SER D  2  111 ? 12.461   -42.235 71.267   1.00 67.69  ? 112  SER C CA    1 
ATOM   7570  C  C     . SER D  2  111 ? 12.543   -41.735 72.711   1.00 70.24  ? 112  SER C C     1 
ATOM   7571  O  O     . SER D  2  111 ? 12.742   -40.531 72.931   1.00 60.48  ? 112  SER C O     1 
ATOM   7572  C  CB    . SER D  2  111 ? 13.579   -43.189 70.998   1.00 70.96  ? 112  SER C CB    1 
ATOM   7573  O  OG    . SER D  2  111 ? 14.794   -42.637 71.478   1.00 80.23  ? 112  SER C OG    1 
ATOM   7574  N  N     A MET D  2  112 ? 12.445   -42.662 73.662   0.50 75.52  ? 113  MET C N     1 
ATOM   7575  N  N     B MET D  2  112 ? 12.444   -42.664 73.659   0.50 75.19  ? 113  MET C N     1 
ATOM   7576  C  CA    A MET D  2  112 ? 12.580   -42.401 75.121   0.50 77.02  ? 113  MET C CA    1 
ATOM   7577  C  CA    B MET D  2  112 ? 12.580   -42.437 75.120   0.50 76.46  ? 113  MET C CA    1 
ATOM   7578  C  C     A MET D  2  112 ? 14.037   -42.070 75.470   0.50 79.99  ? 113  MET C C     1 
ATOM   7579  C  C     B MET D  2  112 ? 14.035   -42.074 75.470   0.50 79.69  ? 113  MET C C     1 
ATOM   7580  O  O     A MET D  2  112 ? 14.257   -41.548 76.575   0.50 80.52  ? 113  MET C O     1 
ATOM   7581  O  O     B MET D  2  112 ? 14.256   -41.548 76.575   0.50 80.27  ? 113  MET C O     1 
ATOM   7582  C  CB    A MET D  2  112 ? 12.125   -43.618 75.925   0.50 75.88  ? 113  MET C CB    1 
ATOM   7583  C  CB    B MET D  2  112 ? 12.162   -43.724 75.851   0.50 75.07  ? 113  MET C CB    1 
ATOM   7584  C  CG    A MET D  2  112 ? 10.733   -44.063 75.551   0.50 78.33  ? 113  MET C CG    1 
ATOM   7585  C  CG    B MET D  2  112 ? 11.652   -43.546 77.256   0.50 75.78  ? 113  MET C CG    1 
ATOM   7586  S  SD    A MET D  2  112 ? 10.095   -45.451 76.502   0.50 78.90  ? 113  MET C SD    1 
ATOM   7587  S  SD    B MET D  2  112 ? 10.873   -45.101 77.800   0.50 79.43  ? 113  MET C SD    1 
ATOM   7588  C  CE    A MET D  2  112 ? 10.340   -44.881 78.185   0.50 80.56  ? 113  MET C CE    1 
ATOM   7589  C  CE    B MET D  2  112 ? 9.602    -45.257 76.544   0.50 80.28  ? 113  MET C CE    1 
ATOM   7590  N  N     . ASP D  2  113 ? 14.989   -42.340 74.569   1.00 81.33  ? 114  ASP C N     1 
ATOM   7591  C  CA    . ASP D  2  113 ? 16.434   -42.063 74.786   1.00 80.18  ? 114  ASP C CA    1 
ATOM   7592  C  C     . ASP D  2  113 ? 16.749   -40.584 74.520   1.00 72.11  ? 114  ASP C C     1 
ATOM   7593  O  O     . ASP D  2  113 ? 17.920   -40.184 74.679   1.00 61.79  ? 114  ASP C O     1 
ATOM   7594  C  CB    . ASP D  2  113 ? 17.315   -42.982 73.935   1.00 84.61  ? 114  ASP C CB    1 
ATOM   7595  C  CG    . ASP D  2  113 ? 17.343   -44.430 74.404   1.00 90.84  ? 114  ASP C CG    1 
ATOM   7596  O  OD1   . ASP D  2  113 ? 17.658   -44.662 75.591   1.00 91.32  ? 114  ASP C OD1   1 
ATOM   7597  O  OD2   . ASP D  2  113 ? 17.063   -45.316 73.577   1.00 92.67  ? 114  ASP C OD2   1 
ATOM   7598  N  N     . GLY D  2  114 ? 15.760   -39.791 74.117   1.00 69.91  ? 115  GLY C N     1 
ATOM   7599  C  CA    . GLY D  2  114 ? 15.907   -38.331 73.965   1.00 67.81  ? 115  GLY C CA    1 
ATOM   7600  C  C     . GLY D  2  114 ? 16.590   -37.951 72.670   1.00 63.90  ? 115  GLY C C     1 
ATOM   7601  O  O     . GLY D  2  114 ? 16.911   -36.762 72.534   1.00 55.75  ? 115  GLY C O     1 
ATOM   7602  N  N     . ASP D  2  115 ? 16.805   -38.901 71.737   1.00 61.90  ? 116  ASP C N     1 
ATOM   7603  C  CA    . ASP D  2  115 ? 17.142   -38.545 70.338   1.00 60.39  ? 116  ASP C CA    1 
ATOM   7604  C  C     . ASP D  2  115 ? 15.927   -37.794 69.811   1.00 57.10  ? 116  ASP C C     1 
ATOM   7605  O  O     . ASP D  2  115 ? 14.787   -38.293 70.024   1.00 54.84  ? 116  ASP C O     1 
ATOM   7606  C  CB    . ASP D  2  115 ? 17.399   -39.745 69.424   1.00 73.17  ? 116  ASP C CB    1 
ATOM   7607  C  CG    . ASP D  2  115 ? 16.285   -40.771 69.347   1.00 82.96  ? 116  ASP C CG    1 
ATOM   7608  O  OD1   . ASP D  2  115 ? 15.500   -40.716 68.367   1.00 88.26  ? 116  ASP C OD1   1 
ATOM   7609  O  OD2   . ASP D  2  115 ? 16.248   -41.644 70.226   1.00 91.29  ? 116  ASP C OD2   1 
ATOM   7610  N  N     . GLY D  2  116 ? 16.140   -36.641 69.180   1.00 56.87  ? 117  GLY C N     1 
ATOM   7611  C  CA    . GLY D  2  116 ? 15.024   -35.828 68.657   1.00 55.62  ? 117  GLY C CA    1 
ATOM   7612  C  C     . GLY D  2  116 ? 14.299   -36.522 67.526   1.00 49.10  ? 117  GLY C C     1 
ATOM   7613  O  O     . GLY D  2  116 ? 14.796   -37.559 67.032   1.00 44.18  ? 117  GLY C O     1 
ATOM   7614  N  N     . ALA D  2  117 ? 13.160   -35.964 67.124   1.00 49.95  ? 118  ALA C N     1 
ATOM   7615  C  CA    . ALA D  2  117 ? 12.486   -36.281 65.841   1.00 50.54  ? 118  ALA C CA    1 
ATOM   7616  C  C     . ALA D  2  117 ? 13.432   -35.923 64.692   1.00 52.74  ? 118  ALA C C     1 
ATOM   7617  O  O     . ALA D  2  117 ? 14.203   -34.964 64.837   1.00 48.80  ? 118  ALA C O     1 
ATOM   7618  C  CB    . ALA D  2  117 ? 11.175   -35.528 65.724   1.00 45.13  ? 118  ALA C CB    1 
ATOM   7619  N  N     . ALA D  2  118 ? 13.383   -36.663 63.582   1.00 60.21  ? 119  ALA C N     1 
ATOM   7620  C  CA    . ALA D  2  118 ? 14.003   -36.226 62.313   1.00 62.07  ? 119  ALA C CA    1 
ATOM   7621  C  C     . ALA D  2  118 ? 13.457   -34.831 61.963   1.00 67.36  ? 119  ALA C C     1 
ATOM   7622  O  O     . ALA D  2  118 ? 12.354   -34.472 62.451   1.00 66.10  ? 119  ALA C O     1 
ATOM   7623  C  CB    . ALA D  2  118 ? 13.712   -37.240 61.235   1.00 63.06  ? 119  ALA C CB    1 
ATOM   7624  N  N     . ALA D  2  119 ? 14.193   -34.067 61.154   1.00 73.29  ? 120  ALA C N     1 
ATOM   7625  C  CA    . ALA D  2  119 ? 13.765   -32.745 60.631   1.00 84.79  ? 120  ALA C CA    1 
ATOM   7626  C  C     . ALA D  2  119 ? 12.423   -32.889 59.890   1.00 94.52  ? 120  ALA C C     1 
ATOM   7627  O  O     . ALA D  2  119 ? 12.101   -34.007 59.430   1.00 120.51 ? 120  ALA C O     1 
ATOM   7628  C  CB    . ALA D  2  119 ? 14.837   -32.168 59.743   1.00 81.68  ? 120  ALA C CB    1 
ATOM   7629  N  N     . MET D  2  120 ? 11.666   -31.794 59.773   1.00 85.27  ? 121  MET C N     1 
ATOM   7630  C  CA    . MET D  2  120 ? 10.260   -31.807 59.281   1.00 85.08  ? 121  MET C CA    1 
ATOM   7631  C  C     . MET D  2  120 ? 10.193   -32.231 57.810   1.00 81.70  ? 121  MET C C     1 
ATOM   7632  O  O     . MET D  2  120 ? 9.101    -32.653 57.378   1.00 78.64  ? 121  MET C O     1 
ATOM   7633  C  CB    . MET D  2  120 ? 9.569    -30.449 59.472   1.00 91.15  ? 121  MET C CB    1 
ATOM   7634  C  CG    . MET D  2  120 ? 10.180   -29.286 58.710   1.00 88.79  ? 121  MET C CG    1 
ATOM   7635  S  SD    . MET D  2  120 ? 9.399    -27.744 59.233   1.00 86.97  ? 121  MET C SD    1 
ATOM   7636  C  CE    . MET D  2  120 ? 10.167   -27.534 60.835   1.00 77.86  ? 121  MET C CE    1 
ATOM   7637  N  N     . ARG D  2  121 ? 11.300   -32.134 57.065   1.00 76.39  ? 122  ARG C N     1 
ATOM   7638  C  CA    . ARG D  2  121 ? 11.359   -32.614 55.654   1.00 71.80  ? 122  ARG C CA    1 
ATOM   7639  C  C     . ARG D  2  121 ? 11.115   -34.128 55.625   1.00 71.20  ? 122  ARG C C     1 
ATOM   7640  O  O     . ARG D  2  121 ? 10.519   -34.612 54.654   1.00 75.38  ? 122  ARG C O     1 
ATOM   7641  C  CB    . ARG D  2  121 ? 12.706   -32.268 55.006   1.00 69.60  ? 122  ARG C CB    1 
ATOM   7642  N  N     . TYR D  2  122 ? 11.523   -34.836 56.678   1.00 72.94  ? 123  TYR C N     1 
ATOM   7643  C  CA    . TYR D  2  122 ? 11.593   -36.315 56.734   1.00 78.83  ? 123  TYR C CA    1 
ATOM   7644  C  C     . TYR D  2  122 ? 10.278   -36.931 57.226   1.00 83.31  ? 123  TYR C C     1 
ATOM   7645  O  O     . TYR D  2  122 ? 10.021   -38.093 56.851   1.00 99.03  ? 123  TYR C O     1 
ATOM   7646  C  CB    . TYR D  2  122 ? 12.761   -36.741 57.622   1.00 82.04  ? 123  TYR C CB    1 
ATOM   7647  N  N     . THR D  2  123 ? 9.482    -36.228 58.038   1.00 76.54  ? 124  THR C N     1 
ATOM   7648  C  CA    . THR D  2  123 ? 8.326    -36.849 58.760   1.00 76.00  ? 124  THR C CA    1 
ATOM   7649  C  C     . THR D  2  123 ? 7.010    -36.439 58.093   1.00 78.70  ? 124  THR C C     1 
ATOM   7650  O  O     . THR D  2  123 ? 6.999    -35.428 57.371   1.00 94.79  ? 124  THR C O     1 
ATOM   7651  C  CB    . THR D  2  123 ? 8.345    -36.510 60.257   1.00 67.87  ? 124  THR C CB    1 
ATOM   7652  O  OG1   . THR D  2  123 ? 7.966    -35.145 60.465   1.00 68.89  ? 124  THR C OG1   1 
ATOM   7653  C  CG2   . THR D  2  123 ? 9.714    -36.735 60.860   1.00 61.58  ? 124  THR C CG2   1 
ATOM   7654  N  N     . GLU D  2  124 ? 5.962    -37.225 58.316   1.00 73.20  ? 125  GLU C N     1 
ATOM   7655  C  CA    . GLU D  2  124 ? 4.573    -36.947 57.868   1.00 70.98  ? 125  GLU C CA    1 
ATOM   7656  C  C     . GLU D  2  124 ? 3.662    -37.112 59.089   1.00 75.35  ? 125  GLU C C     1 
ATOM   7657  O  O     . GLU D  2  124 ? 4.090    -37.758 60.046   1.00 83.98  ? 125  GLU C O     1 
ATOM   7658  C  CB    . GLU D  2  124 ? 4.202    -37.892 56.720   1.00 67.76  ? 125  GLU C CB    1 
ATOM   7659  N  N     . ALA D  2  125 ? 2.447    -36.563 59.068   1.00 72.38  ? 126  ALA C N     1 
ATOM   7660  C  CA    . ALA D  2  125 ? 1.563    -36.487 60.254   1.00 64.78  ? 126  ALA C CA    1 
ATOM   7661  C  C     . ALA D  2  125 ? 0.099    -36.330 59.838   1.00 66.85  ? 126  ALA C C     1 
ATOM   7662  O  O     . ALA D  2  125 ? -0.145   -35.857 58.728   1.00 69.48  ? 126  ALA C O     1 
ATOM   7663  C  CB    . ALA D  2  125 ? 2.001    -35.333 61.115   1.00 59.86  ? 126  ALA C CB    1 
ATOM   7664  N  N     . ARG D  2  126 ? -0.823   -36.679 60.739   1.00 71.51  ? 127  ARG C N     1 
ATOM   7665  C  CA    . ARG D  2  126 ? -2.288   -36.420 60.625   1.00 76.83  ? 127  ARG C CA    1 
ATOM   7666  C  C     . ARG D  2  126 ? -2.928   -36.407 62.015   1.00 82.16  ? 127  ARG C C     1 
ATOM   7667  O  O     . ARG D  2  126 ? -2.200   -36.584 62.999   1.00 97.50  ? 127  ARG C O     1 
ATOM   7668  C  CB    . ARG D  2  126 ? -2.944   -37.493 59.754   1.00 80.18  ? 127  ARG C CB    1 
ATOM   7669  C  CG    . ARG D  2  126 ? -2.744   -38.912 60.269   1.00 81.54  ? 127  ARG C CG    1 
ATOM   7670  C  CD    . ARG D  2  126 ? -3.238   -39.891 59.234   1.00 89.22  ? 127  ARG C CD    1 
ATOM   7671  N  NE    . ARG D  2  126 ? -3.001   -41.270 59.608   1.00 91.01  ? 127  ARG C NE    1 
ATOM   7672  C  CZ    . ARG D  2  126 ? -3.167   -42.303 58.796   1.00 86.70  ? 127  ARG C CZ    1 
ATOM   7673  N  NH1   . ARG D  2  126 ? -3.584   -42.115 57.558   1.00 82.92  ? 127  ARG C NH1   1 
ATOM   7674  N  NH2   . ARG D  2  126 ? -2.914   -43.524 59.226   1.00 93.19  ? 127  ARG C NH2   1 
ATOM   7675  N  N     . MET D  2  127 ? -4.248   -36.216 62.087   1.00 80.10  ? 128  MET C N     1 
ATOM   7676  C  CA    . MET D  2  127 ? -5.034   -36.341 63.344   1.00 66.33  ? 128  MET C CA    1 
ATOM   7677  C  C     . MET D  2  127 ? -5.047   -37.801 63.808   1.00 56.31  ? 128  MET C C     1 
ATOM   7678  O  O     . MET D  2  127 ? -4.997   -38.723 62.955   1.00 47.77  ? 128  MET C O     1 
ATOM   7679  C  CB    . MET D  2  127 ? -6.491   -35.914 63.156   1.00 64.91  ? 128  MET C CB    1 
ATOM   7680  C  CG    . MET D  2  127 ? -6.692   -34.435 63.000   1.00 65.86  ? 128  MET C CG    1 
ATOM   7681  S  SD    . MET D  2  127 ? -8.457   -34.091 62.808   1.00 74.93  ? 128  MET C SD    1 
ATOM   7682  C  CE    . MET D  2  127 ? -8.386   -32.899 61.479   1.00 74.98  ? 128  MET C CE    1 
ATOM   7683  N  N     . THR D  2  128 ? -5.142   -37.980 65.126   1.00 50.68  ? 129  THR C N     1 
ATOM   7684  C  CA    . THR D  2  128 ? -5.543   -39.247 65.783   1.00 54.64  ? 129  THR C CA    1 
ATOM   7685  C  C     . THR D  2  128 ? -7.071   -39.268 65.816   1.00 56.80  ? 129  THR C C     1 
ATOM   7686  O  O     . THR D  2  128 ? -7.664   -38.166 65.733   1.00 49.35  ? 129  THR C O     1 
ATOM   7687  C  CB    . THR D  2  128 ? -4.887   -39.358 67.162   1.00 56.95  ? 129  THR C CB    1 
ATOM   7688  O  OG1   . THR D  2  128 ? -5.327   -38.261 67.959   1.00 58.34  ? 129  THR C OG1   1 
ATOM   7689  C  CG2   . THR D  2  128 ? -3.374   -39.327 67.091   1.00 58.21  ? 129  THR C CG2   1 
ATOM   7690  N  N     . LYS D  2  129 ? -7.688   -40.452 65.927   1.00 58.04  ? 130  LYS C N     1 
ATOM   7691  C  CA    . LYS D  2  129 ? -9.174   -40.589 65.995   1.00 54.65  ? 130  LYS C CA    1 
ATOM   7692  C  C     . LYS D  2  129 ? -9.703   -39.753 67.168   1.00 59.63  ? 130  LYS C C     1 
ATOM   7693  O  O     . LYS D  2  129 ? -10.778  -39.150 67.018   1.00 67.34  ? 130  LYS C O     1 
ATOM   7694  C  CB    . LYS D  2  129 ? -9.586   -42.058 66.079   1.00 49.36  ? 130  LYS C CB    1 
ATOM   7695  C  CG    . LYS D  2  129 ? -9.022   -42.863 64.920   1.00 48.17  ? 130  LYS C CG    1 
ATOM   7696  C  CD    . LYS D  2  129 ? -9.551   -44.239 64.766   1.00 45.41  ? 130  LYS C CD    1 
ATOM   7697  C  CE    . LYS D  2  129 ? -8.575   -45.081 63.981   1.00 44.24  ? 130  LYS C CE    1 
ATOM   7698  N  NZ    . LYS D  2  129 ? -8.895   -46.509 64.154   1.00 48.15  ? 130  LYS C NZ    1 
ATOM   7699  N  N     . ILE D  2  130 ? -8.965   -39.675 68.283   1.00 54.72  ? 131  ILE C N     1 
ATOM   7700  C  CA    . ILE D  2  130 ? -9.433   -38.945 69.499   1.00 45.45  ? 131  ILE C CA    1 
ATOM   7701  C  C     . ILE D  2  130 ? -9.370   -37.429 69.256   1.00 42.39  ? 131  ILE C C     1 
ATOM   7702  O  O     . ILE D  2  130 ? -10.128  -36.707 69.919   1.00 43.12  ? 131  ILE C O     1 
ATOM   7703  C  CB    . ILE D  2  130 ? -8.659   -39.375 70.762   1.00 43.01  ? 131  ILE C CB    1 
ATOM   7704  C  CG1   . ILE D  2  130 ? -9.503   -39.163 72.021   1.00 42.15  ? 131  ILE C CG1   1 
ATOM   7705  C  CG2   . ILE D  2  130 ? -7.318   -38.662 70.871   1.00 42.59  ? 131  ILE C CG2   1 
ATOM   7706  C  CD1   . ILE D  2  130 ? -8.863   -39.706 73.282   1.00 41.74  ? 131  ILE C CD1   1 
ATOM   7707  N  N     . THR D  2  131 ? -8.528   -36.942 68.343   1.00 40.30  ? 132  THR C N     1 
ATOM   7708  C  CA    . THR D  2  131 ? -8.413   -35.483 68.059   1.00 41.19  ? 132  THR C CA    1 
ATOM   7709  C  C     . THR D  2  131 ? -9.696   -35.016 67.355   1.00 43.61  ? 132  THR C C     1 
ATOM   7710  O  O     . THR D  2  131 ? -10.030  -33.820 67.476   1.00 44.63  ? 132  THR C O     1 
ATOM   7711  C  CB    . THR D  2  131 ? -7.117   -35.147 67.308   1.00 40.90  ? 132  THR C CB    1 
ATOM   7712  O  OG1   . THR D  2  131 ? -6.056   -35.311 68.249   1.00 38.31  ? 132  THR C OG1   1 
ATOM   7713  C  CG2   . THR D  2  131 ? -7.067   -33.747 66.730   1.00 41.09  ? 132  THR C CG2   1 
ATOM   7714  N  N     . LEU D  2  132 ? -10.413  -35.916 66.679   1.00 46.10  ? 133  LEU C N     1 
ATOM   7715  C  CA    . LEU D  2  132 ? -11.763  -35.615 66.123   1.00 47.56  ? 133  LEU C CA    1 
ATOM   7716  C  C     . LEU D  2  132 ? -12.697  -35.187 67.263   1.00 51.36  ? 133  LEU C C     1 
ATOM   7717  O  O     . LEU D  2  132 ? -13.528  -34.287 67.021   1.00 64.38  ? 133  LEU C O     1 
ATOM   7718  C  CB    . LEU D  2  132 ? -12.327  -36.831 65.381   1.00 46.78  ? 133  LEU C CB    1 
ATOM   7719  C  CG    . LEU D  2  132 ? -11.527  -37.294 64.159   1.00 42.60  ? 133  LEU C CG    1 
ATOM   7720  C  CD1   . LEU D  2  132 ? -12.157  -38.532 63.546   1.00 38.88  ? 133  LEU C CD1   1 
ATOM   7721  C  CD2   . LEU D  2  132 ? -11.406  -36.181 63.126   1.00 41.84  ? 133  LEU C CD2   1 
ATOM   7722  N  N     . GLU D  2  133 ? -12.562  -35.780 68.454   1.00 53.34  ? 134  GLU C N     1 
ATOM   7723  C  CA    . GLU D  2  133 ? -13.411  -35.438 69.627   1.00 53.10  ? 134  GLU C CA    1 
ATOM   7724  C  C     . GLU D  2  133 ? -13.037  -34.041 70.137   1.00 53.66  ? 134  GLU C C     1 
ATOM   7725  O  O     . GLU D  2  133 ? -13.939  -33.339 70.618   1.00 48.75  ? 134  GLU C O     1 
ATOM   7726  C  CB    . GLU D  2  133 ? -13.302  -36.492 70.731   1.00 51.01  ? 134  GLU C CB    1 
ATOM   7727  C  CG    . GLU D  2  133 ? -13.827  -37.857 70.317   1.00 53.16  ? 134  GLU C CG    1 
ATOM   7728  C  CD    . GLU D  2  133 ? -15.110  -37.862 69.500   1.00 56.97  ? 134  GLU C CD    1 
ATOM   7729  O  OE1   . GLU D  2  133 ? -15.108  -38.514 68.419   1.00 59.21  ? 134  GLU C OE1   1 
ATOM   7730  O  OE2   . GLU D  2  133 ? -16.105  -37.215 69.934   1.00 50.64  ? 134  GLU C OE2   1 
ATOM   7731  N  N     . LEU D  2  134 ? -11.771  -33.636 70.038   1.00 59.37  ? 135  LEU C N     1 
ATOM   7732  C  CA    . LEU D  2  134 ? -11.351  -32.252 70.395   1.00 67.19  ? 135  LEU C CA    1 
ATOM   7733  C  C     . LEU D  2  134 ? -12.038  -31.247 69.465   1.00 68.28  ? 135  LEU C C     1 
ATOM   7734  O  O     . LEU D  2  134 ? -12.402  -30.149 69.948   1.00 80.80  ? 135  LEU C O     1 
ATOM   7735  C  CB    . LEU D  2  134 ? -9.831   -32.109 70.301   1.00 70.69  ? 135  LEU C CB    1 
ATOM   7736  C  CG    . LEU D  2  134 ? -9.064   -32.575 71.535   1.00 76.54  ? 135  LEU C CG    1 
ATOM   7737  C  CD1   . LEU D  2  134 ? -7.586   -32.250 71.410   1.00 77.17  ? 135  LEU C CD1   1 
ATOM   7738  C  CD2   . LEU D  2  134 ? -9.632   -31.955 72.805   1.00 76.65  ? 135  LEU C CD2   1 
ATOM   7739  N  N     . LEU D  2  135 ? -12.214  -31.603 68.189   1.00 59.45  ? 136  LEU C N     1 
ATOM   7740  C  CA    . LEU D  2  135 ? -12.669  -30.661 67.137   1.00 56.98  ? 136  LEU C CA    1 
ATOM   7741  C  C     . LEU D  2  135 ? -14.166  -30.829 66.849   1.00 63.73  ? 136  LEU C C     1 
ATOM   7742  O  O     . LEU D  2  135 ? -14.698  -29.962 66.129   1.00 75.92  ? 136  LEU C O     1 
ATOM   7743  C  CB    . LEU D  2  135 ? -11.837  -30.887 65.875   1.00 49.23  ? 136  LEU C CB    1 
ATOM   7744  C  CG    . LEU D  2  135 ? -10.368  -30.507 66.004   1.00 47.62  ? 136  LEU C CG    1 
ATOM   7745  C  CD1   . LEU D  2  135 ? -9.516   -31.267 64.992   1.00 44.49  ? 136  LEU C CD1   1 
ATOM   7746  C  CD2   . LEU D  2  135 ? -10.178  -28.993 65.877   1.00 50.31  ? 136  LEU C CD2   1 
ATOM   7747  N  N     . ARG D  2  136 ? -14.816  -31.876 67.377   1.00 61.85  ? 137  ARG C N     1 
ATOM   7748  C  CA    . ARG D  2  136 ? -16.228  -32.219 67.045   1.00 58.86  ? 137  ARG C CA    1 
ATOM   7749  C  C     . ARG D  2  136 ? -17.114  -30.991 67.286   1.00 54.81  ? 137  ARG C C     1 
ATOM   7750  O  O     . ARG D  2  136 ? -17.086  -30.455 68.402   1.00 49.34  ? 137  ARG C O     1 
ATOM   7751  C  CB    . ARG D  2  136 ? -16.750  -33.413 67.855   1.00 53.79  ? 137  ARG C CB    1 
ATOM   7752  N  N     . ASP D  2  137 ? -17.862  -30.576 66.260   1.00 56.10  ? 138  ASP C N     1 
ATOM   7753  C  CA    . ASP D  2  137 ? -18.901  -29.517 66.340   1.00 61.27  ? 138  ASP C CA    1 
ATOM   7754  C  C     . ASP D  2  137 ? -18.246  -28.129 66.360   1.00 54.95  ? 138  ASP C C     1 
ATOM   7755  O  O     . ASP D  2  137 ? -18.930  -27.174 66.805   1.00 50.76  ? 138  ASP C O     1 
ATOM   7756  C  CB    . ASP D  2  137 ? -19.783  -29.655 67.596   1.00 68.50  ? 138  ASP C CB    1 
ATOM   7757  C  CG    . ASP D  2  137 ? -20.374  -31.033 67.863   1.00 74.13  ? 138  ASP C CG    1 
ATOM   7758  O  OD1   . ASP D  2  137 ? -20.977  -31.615 66.939   1.00 72.13  ? 138  ASP C OD1   1 
ATOM   7759  O  OD2   . ASP D  2  137 ? -20.245  -31.506 69.017   1.00 89.28  ? 138  ASP C OD2   1 
ATOM   7760  N  N     . ILE D  2  138 ? -16.991  -27.997 65.914   1.00 52.34  ? 139  ILE C N     1 
ATOM   7761  C  CA    . ILE D  2  138 ? -16.291  -26.674 65.875   1.00 57.28  ? 139  ILE C CA    1 
ATOM   7762  C  C     . ILE D  2  138 ? -17.014  -25.771 64.860   1.00 65.52  ? 139  ILE C C     1 
ATOM   7763  O  O     . ILE D  2  138 ? -16.938  -24.530 65.001   1.00 68.83  ? 139  ILE C O     1 
ATOM   7764  C  CB    . ILE D  2  138 ? -14.787  -26.806 65.563   1.00 53.00  ? 139  ILE C CB    1 
ATOM   7765  C  CG1   . ILE D  2  138 ? -14.055  -25.486 65.831   1.00 49.82  ? 139  ILE C CG1   1 
ATOM   7766  C  CG2   . ILE D  2  138 ? -14.558  -27.307 64.141   1.00 52.00  ? 139  ILE C CG2   1 
ATOM   7767  C  CD1   . ILE D  2  138 ? -12.535  -25.568 65.726   1.00 49.80  ? 139  ILE C CD1   1 
ATOM   7768  N  N     . ASN D  2  139 ? -17.711  -26.376 63.899   1.00 70.01  ? 140  ASN C N     1 
ATOM   7769  C  CA    . ASN D  2  139 ? -18.408  -25.683 62.784   1.00 69.63  ? 140  ASN C CA    1 
ATOM   7770  C  C     . ASN D  2  139 ? -19.886  -25.429 63.103   1.00 65.16  ? 140  ASN C C     1 
ATOM   7771  O  O     . ASN D  2  139 ? -20.586  -24.955 62.190   1.00 72.21  ? 140  ASN C O     1 
ATOM   7772  C  CB    . ASN D  2  139 ? -18.226  -26.475 61.484   1.00 71.71  ? 140  ASN C CB    1 
ATOM   7773  C  CG    . ASN D  2  139 ? -16.871  -26.218 60.862   1.00 71.64  ? 140  ASN C CG    1 
ATOM   7774  O  OD1   . ASN D  2  139 ? -16.309  -25.126 61.027   1.00 61.55  ? 140  ASN C OD1   1 
ATOM   7775  N  ND2   . ASN D  2  139 ? -16.351  -27.212 60.152   1.00 72.05  ? 140  ASN C ND2   1 
ATOM   7776  N  N     . LYS D  2  140 ? -20.346  -25.688 64.331   1.00 63.67  ? 141  LYS C N     1 
ATOM   7777  C  CA    . LYS D  2  140 ? -21.786  -25.550 64.715   1.00 64.70  ? 141  LYS C CA    1 
ATOM   7778  C  C     . LYS D  2  140 ? -21.951  -24.424 65.745   1.00 67.34  ? 141  LYS C C     1 
ATOM   7779  O  O     . LYS D  2  140 ? -22.794  -24.545 66.647   1.00 65.28  ? 141  LYS C O     1 
ATOM   7780  C  CB    . LYS D  2  140 ? -22.285  -26.904 65.214   1.00 68.92  ? 141  LYS C CB    1 
ATOM   7781  C  CG    . LYS D  2  140 ? -22.440  -27.941 64.110   1.00 73.53  ? 141  LYS C CG    1 
ATOM   7782  C  CD    . LYS D  2  140 ? -22.475  -29.372 64.596   1.00 75.02  ? 141  LYS C CD    1 
ATOM   7783  C  CE    . LYS D  2  140 ? -23.313  -30.315 63.756   1.00 76.79  ? 141  LYS C CE    1 
ATOM   7784  N  NZ    . LYS D  2  140 ? -23.776  -31.455 64.585   1.00 77.36  ? 141  LYS C NZ    1 
ATOM   7785  N  N     . ASP D  2  141 ? -21.173  -23.342 65.599   1.00 70.76  ? 142  ASP C N     1 
ATOM   7786  C  CA    . ASP D  2  141 ? -21.223  -22.140 66.475   1.00 65.90  ? 142  ASP C CA    1 
ATOM   7787  C  C     . ASP D  2  141 ? -21.193  -22.565 67.949   1.00 69.69  ? 142  ASP C C     1 
ATOM   7788  O  O     . ASP D  2  141 ? -22.049  -22.078 68.732   1.00 62.49  ? 142  ASP C O     1 
ATOM   7789  C  CB    . ASP D  2  141 ? -22.471  -21.302 66.171   1.00 64.62  ? 142  ASP C CB    1 
ATOM   7790  C  CG    . ASP D  2  141 ? -22.466  -19.977 66.906   1.00 64.59  ? 142  ASP C CG    1 
ATOM   7791  O  OD1   . ASP D  2  141 ? -21.362  -19.412 67.078   1.00 63.52  ? 142  ASP C OD1   1 
ATOM   7792  O  OD2   . ASP D  2  141 ? -23.573  -19.536 67.288   1.00 63.29  ? 142  ASP C OD2   1 
ATOM   7793  N  N     . THR D  2  142 ? -20.255  -23.442 68.316   1.00 74.48  ? 143  THR C N     1 
ATOM   7794  C  CA    . THR D  2  142 ? -20.091  -23.981 69.696   1.00 78.58  ? 143  THR C CA    1 
ATOM   7795  C  C     . THR D  2  142 ? -19.024  -23.184 70.454   1.00 70.73  ? 143  THR C C     1 
ATOM   7796  O  O     . THR D  2  142 ? -19.081  -23.154 71.689   1.00 71.21  ? 143  THR C O     1 
ATOM   7797  C  CB    . THR D  2  142 ? -19.704  -25.464 69.654   1.00 87.23  ? 143  THR C CB    1 
ATOM   7798  O  OG1   . THR D  2  142 ? -18.560  -25.594 68.805   1.00 90.28  ? 143  THR C OG1   1 
ATOM   7799  C  CG2   . THR D  2  142 ? -20.835  -26.339 69.161   1.00 85.45  ? 143  THR C CG2   1 
ATOM   7800  N  N     . ILE D  2  143 ? -18.080  -22.586 69.729   1.00 62.85  ? 144  ILE C N     1 
ATOM   7801  C  CA    . ILE D  2  143 ? -16.935  -21.819 70.301   1.00 61.11  ? 144  ILE C CA    1 
ATOM   7802  C  C     . ILE D  2  143 ? -16.784  -20.530 69.490   1.00 60.39  ? 144  ILE C C     1 
ATOM   7803  O  O     . ILE D  2  143 ? -17.134  -20.546 68.295   1.00 61.01  ? 144  ILE C O     1 
ATOM   7804  C  CB    . ILE D  2  143 ? -15.642  -22.672 70.311   1.00 62.59  ? 144  ILE C CB    1 
ATOM   7805  C  CG1   . ILE D  2  143 ? -15.205  -23.087 68.908   1.00 61.77  ? 144  ILE C CG1   1 
ATOM   7806  C  CG2   . ILE D  2  143 ? -15.794  -23.891 71.208   1.00 66.33  ? 144  ILE C CG2   1 
ATOM   7807  C  CD1   . ILE D  2  143 ? -14.331  -22.064 68.206   1.00 66.98  ? 144  ILE C CD1   1 
ATOM   7808  N  N     . ASP D  2  144 ? -16.283  -19.469 70.111   1.00 60.73  ? 145  ASP C N     1 
ATOM   7809  C  CA    . ASP D  2  144 ? -16.078  -18.146 69.463   1.00 61.41  ? 145  ASP C CA    1 
ATOM   7810  C  C     . ASP D  2  144 ? -14.792  -18.192 68.639   1.00 60.19  ? 145  ASP C C     1 
ATOM   7811  O  O     . ASP D  2  144 ? -13.756  -18.610 69.189   1.00 61.58  ? 145  ASP C O     1 
ATOM   7812  C  CB    . ASP D  2  144 ? -16.002  -17.014 70.491   1.00 66.60  ? 145  ASP C CB    1 
ATOM   7813  C  CG    . ASP D  2  144 ? -17.229  -16.921 71.380   1.00 68.48  ? 145  ASP C CG    1 
ATOM   7814  O  OD1   . ASP D  2  144 ? -18.250  -17.550 70.999   1.00 68.95  ? 145  ASP C OD1   1 
ATOM   7815  O  OD2   . ASP D  2  144 ? -17.165  -16.276 72.468   1.00 61.94  ? 145  ASP C OD2   1 
ATOM   7816  N  N     . PHE D  2  145 ? -14.864  -17.762 67.375   1.00 55.75  ? 146  PHE C N     1 
ATOM   7817  C  CA    . PHE D  2  145 ? -13.672  -17.478 66.535   1.00 55.47  ? 146  PHE C CA    1 
ATOM   7818  C  C     . PHE D  2  145 ? -13.194  -16.046 66.805   1.00 54.72  ? 146  PHE C C     1 
ATOM   7819  O  O     . PHE D  2  145 ? -13.962  -15.227 67.333   1.00 48.79  ? 146  PHE C O     1 
ATOM   7820  C  CB    . PHE D  2  145 ? -13.970  -17.723 65.054   1.00 50.20  ? 146  PHE C CB    1 
ATOM   7821  C  CG    . PHE D  2  145 ? -14.120  -19.183 64.716   1.00 44.95  ? 146  PHE C CG    1 
ATOM   7822  C  CD1   . PHE D  2  145 ? -15.319  -19.843 64.926   1.00 41.24  ? 146  PHE C CD1   1 
ATOM   7823  C  CD2   . PHE D  2  145 ? -13.048  -19.909 64.228   1.00 46.59  ? 146  PHE C CD2   1 
ATOM   7824  C  CE1   . PHE D  2  145 ? -15.456  -21.190 64.619   1.00 41.57  ? 146  PHE C CE1   1 
ATOM   7825  C  CE2   . PHE D  2  145 ? -13.182  -21.260 63.927   1.00 48.56  ? 146  PHE C CE2   1 
ATOM   7826  C  CZ    . PHE D  2  145 ? -14.397  -21.896 64.113   1.00 43.26  ? 146  PHE C CZ    1 
ATOM   7827  N  N     . ILE D  2  146 ? -11.927  -15.786 66.485   1.00 59.73  ? 147  ILE C N     1 
ATOM   7828  C  CA    . ILE D  2  146 ? -11.265  -14.451 66.602   1.00 61.32  ? 147  ILE C CA    1 
ATOM   7829  C  C     . ILE D  2  146 ? -10.365  -14.274 65.381   1.00 64.61  ? 147  ILE C C     1 
ATOM   7830  O  O     . ILE D  2  146 ? -10.046  -15.298 64.714   1.00 71.99  ? 147  ILE C O     1 
ATOM   7831  C  CB    . ILE D  2  146 ? -10.472  -14.313 67.920   1.00 56.82  ? 147  ILE C CB    1 
ATOM   7832  C  CG1   . ILE D  2  146 ? -9.311   -15.309 68.006   1.00 56.87  ? 147  ILE C CG1   1 
ATOM   7833  C  CG2   . ILE D  2  146 ? -11.399  -14.436 69.118   1.00 58.36  ? 147  ILE C CG2   1 
ATOM   7834  C  CD1   . ILE D  2  146 ? -8.276   -14.944 69.054   1.00 54.33  ? 147  ILE C CD1   1 
ATOM   7835  N  N     . ASP D  2  147 ? -9.989   -13.025 65.093   1.00 60.30  ? 148  ASP C N     1 
ATOM   7836  C  CA    . ASP D  2  147 ? -9.058   -12.705 63.986   1.00 69.31  ? 148  ASP C CA    1 
ATOM   7837  C  C     . ASP D  2  147 ? -7.685   -13.289 64.334   1.00 68.32  ? 148  ASP C C     1 
ATOM   7838  O  O     . ASP D  2  147 ? -7.314   -13.248 65.520   1.00 61.73  ? 148  ASP C O     1 
ATOM   7839  C  CB    . ASP D  2  147 ? -8.969   -11.197 63.747   1.00 74.28  ? 148  ASP C CB    1 
ATOM   7840  C  CG    . ASP D  2  147 ? -10.150  -10.603 63.013   1.00 77.67  ? 148  ASP C CG    1 
ATOM   7841  O  OD1   . ASP D  2  147 ? -11.150  -11.312 62.802   1.00 77.10  ? 148  ASP C OD1   1 
ATOM   7842  O  OD2   . ASP D  2  147 ? -9.998   -9.430  62.598   1.00 79.18  ? 148  ASP C OD2   1 
ATOM   7843  N  N     . ASN D  2  148 ? -6.972   -13.804 63.332   1.00 66.00  ? 149  ASN C N     1 
ATOM   7844  C  CA    . ASN D  2  148 ? -5.553   -14.213 63.470   1.00 61.60  ? 149  ASN C CA    1 
ATOM   7845  C  C     . ASN D  2  148 ? -4.695   -12.953 63.619   1.00 62.68  ? 149  ASN C C     1 
ATOM   7846  O  O     . ASN D  2  148 ? -5.255   -11.842 63.597   1.00 53.48  ? 149  ASN C O     1 
ATOM   7847  C  CB    . ASN D  2  148 ? -5.079   -15.036 62.273   1.00 56.04  ? 149  ASN C CB    1 
ATOM   7848  C  CG    . ASN D  2  148 ? -4.981   -14.179 61.040   1.00 47.96  ? 149  ASN C CG    1 
ATOM   7849  O  OD1   . ASN D  2  148 ? -5.762   -13.250 60.900   1.00 41.34  ? 149  ASN C OD1   1 
ATOM   7850  N  ND2   . ASN D  2  148 ? -4.029   -14.465 60.163   1.00 51.50  ? 149  ASN C ND2   1 
ATOM   7851  N  N     . TYR D  2  149 ? -3.376   -13.129 63.719   1.00 67.76  ? 150  TYR C N     1 
ATOM   7852  C  CA    . TYR D  2  149 ? -2.386   -12.060 64.018   1.00 68.62  ? 150  TYR C CA    1 
ATOM   7853  C  C     . TYR D  2  149 ? -2.423   -10.928 62.984   1.00 68.66  ? 150  TYR C C     1 
ATOM   7854  O  O     . TYR D  2  149 ? -2.151   -9.792  63.391   1.00 78.19  ? 150  TYR C O     1 
ATOM   7855  C  CB    . TYR D  2  149 ? -0.973   -12.633 64.095   1.00 70.57  ? 150  TYR C CB    1 
ATOM   7856  C  CG    . TYR D  2  149 ? -0.422   -13.181 62.805   1.00 72.78  ? 150  TYR C CG    1 
ATOM   7857  C  CD1   . TYR D  2  149 ? -0.788   -14.435 62.346   1.00 75.65  ? 150  TYR C CD1   1 
ATOM   7858  C  CD2   . TYR D  2  149 ? 0.499    -12.462 62.062   1.00 76.67  ? 150  TYR C CD2   1 
ATOM   7859  C  CE1   . TYR D  2  149 ? -0.259   -14.959 61.175   1.00 81.41  ? 150  TYR C CE1   1 
ATOM   7860  C  CE2   . TYR D  2  149 ? 1.041    -12.967 60.891   1.00 78.12  ? 150  TYR C CE2   1 
ATOM   7861  C  CZ    . TYR D  2  149 ? 0.662    -14.224 60.446   1.00 80.95  ? 150  TYR C CZ    1 
ATOM   7862  O  OH    . TYR D  2  149 ? 1.190    -14.744 59.302   1.00 70.71  ? 150  TYR C OH    1 
ATOM   7863  N  N     . ASP D  2  150 ? -2.702   -11.211 61.708   1.00 63.36  ? 151  ASP C N     1 
ATOM   7864  C  CA    . ASP D  2  150 ? -2.671   -10.177 60.636   1.00 58.40  ? 151  ASP C CA    1 
ATOM   7865  C  C     . ASP D  2  150 ? -4.095   -9.808  60.193   1.00 57.71  ? 151  ASP C C     1 
ATOM   7866  O  O     . ASP D  2  150 ? -4.220   -8.934  59.334   1.00 54.37  ? 151  ASP C O     1 
ATOM   7867  C  CB    . ASP D  2  150 ? -1.796   -10.615 59.458   1.00 56.18  ? 151  ASP C CB    1 
ATOM   7868  C  CG    . ASP D  2  150 ? -2.326   -11.806 58.688   1.00 53.24  ? 151  ASP C CG    1 
ATOM   7869  O  OD1   . ASP D  2  150 ? -3.556   -12.034 58.719   1.00 47.45  ? 151  ASP C OD1   1 
ATOM   7870  O  OD2   . ASP D  2  150 ? -1.493   -12.496 58.061   1.00 50.32  ? 151  ASP C OD2   1 
ATOM   7871  N  N     . GLY D  2  151 ? -5.127   -10.453 60.743   1.00 63.73  ? 152  GLY C N     1 
ATOM   7872  C  CA    . GLY D  2  151 ? -6.545   -10.155 60.437   1.00 62.49  ? 152  GLY C CA    1 
ATOM   7873  C  C     . GLY D  2  151 ? -7.006   -10.708 59.089   1.00 61.43  ? 152  GLY C C     1 
ATOM   7874  O  O     . GLY D  2  151 ? -8.141   -10.393 58.705   1.00 53.48  ? 152  GLY C O     1 
ATOM   7875  N  N     . ASN D  2  152 ? -6.200   -11.538 58.412   1.00 63.87  ? 153  ASN C N     1 
ATOM   7876  C  CA    . ASN D  2  152 ? -6.554   -12.175 57.113   1.00 71.90  ? 153  ASN C CA    1 
ATOM   7877  C  C     . ASN D  2  152 ? -7.212   -13.550 57.316   1.00 71.29  ? 153  ASN C C     1 
ATOM   7878  O  O     . ASN D  2  152 ? -7.580   -14.165 56.293   1.00 61.10  ? 153  ASN C O     1 
ATOM   7879  C  CB    . ASN D  2  152 ? -5.329   -12.345 56.207   1.00 79.36  ? 153  ASN C CB    1 
ATOM   7880  C  CG    . ASN D  2  152 ? -4.730   -11.025 55.772   1.00 87.86  ? 153  ASN C CG    1 
ATOM   7881  O  OD1   . ASN D  2  152 ? -5.452   -10.035 55.633   1.00 94.20  ? 153  ASN C OD1   1 
ATOM   7882  N  ND2   . ASN D  2  152 ? -3.420   -10.999 55.562   1.00 85.33  ? 153  ASN C ND2   1 
ATOM   7883  N  N     . GLU D  2  153 ? -7.344   -14.034 58.556   1.00 85.71  ? 154  GLU C N     1 
ATOM   7884  C  CA    . GLU D  2  153 ? -7.878   -15.391 58.866   1.00 86.43  ? 154  GLU C CA    1 
ATOM   7885  C  C     . GLU D  2  153 ? -8.660   -15.379 60.186   1.00 72.83  ? 154  GLU C C     1 
ATOM   7886  O  O     . GLU D  2  153 ? -8.423   -14.489 61.029   1.00 55.59  ? 154  GLU C O     1 
ATOM   7887  C  CB    . GLU D  2  153 ? -6.755   -16.436 58.963   1.00 94.03  ? 154  GLU C CB    1 
ATOM   7888  C  CG    . GLU D  2  153 ? -5.905   -16.591 57.704   1.00 94.02  ? 154  GLU C CG    1 
ATOM   7889  C  CD    . GLU D  2  153 ? -6.562   -17.337 56.544   1.00 92.10  ? 154  GLU C CD    1 
ATOM   7890  O  OE1   . GLU D  2  153 ? -7.727   -17.771 56.683   1.00 85.07  ? 154  GLU C OE1   1 
ATOM   7891  O  OE2   . GLU D  2  153 ? -5.899   -17.506 55.503   1.00 96.83  ? 154  GLU C OE2   1 
ATOM   7892  N  N     . ARG D  2  154 ? -9.559   -16.350 60.343   1.00 72.60  ? 155  ARG C N     1 
ATOM   7893  C  CA    . ARG D  2  154 ? -10.283  -16.621 61.607   1.00 77.60  ? 155  ARG C CA    1 
ATOM   7894  C  C     . ARG D  2  154 ? -9.693   -17.886 62.232   1.00 69.28  ? 155  ARG C C     1 
ATOM   7895  O  O     . ARG D  2  154 ? -9.466   -18.891 61.488   1.00 67.95  ? 155  ARG C O     1 
ATOM   7896  C  CB    . ARG D  2  154 ? -11.785  -16.788 61.356   1.00 87.15  ? 155  ARG C CB    1 
ATOM   7897  C  CG    . ARG D  2  154 ? -12.447  -15.587 60.683   1.00 84.02  ? 155  ARG C CG    1 
ATOM   7898  C  CD    . ARG D  2  154 ? -12.645  -14.393 61.604   1.00 85.72  ? 155  ARG C CD    1 
ATOM   7899  N  NE    . ARG D  2  154 ? -13.775  -14.575 62.512   1.00 88.60  ? 155  ARG C NE    1 
ATOM   7900  C  CZ    . ARG D  2  154 ? -14.069  -13.782 63.533   1.00 94.11  ? 155  ARG C CZ    1 
ATOM   7901  N  NH1   . ARG D  2  154 ? -13.333  -12.712 63.792   1.00 95.79  ? 155  ARG C NH1   1 
ATOM   7902  N  NH2   . ARG D  2  154 ? -15.115  -14.056 64.290   1.00 101.89 ? 155  ARG C NH2   1 
ATOM   7903  N  N     . GLU D  2  155 ? -9.414   -17.832 63.538   1.00 52.93  ? 156  GLU C N     1 
ATOM   7904  C  CA    . GLU D  2  155 ? -8.915   -18.997 64.309   1.00 47.14  ? 156  GLU C CA    1 
ATOM   7905  C  C     . GLU D  2  155 ? -9.795   -19.160 65.539   1.00 46.40  ? 156  GLU C C     1 
ATOM   7906  O  O     . GLU D  2  155 ? -10.369  -18.184 66.030   1.00 45.55  ? 156  GLU C O     1 
ATOM   7907  C  CB    . GLU D  2  155 ? -7.436   -18.832 64.663   1.00 44.33  ? 156  GLU C CB    1 
ATOM   7908  C  CG    . GLU D  2  155 ? -7.134   -17.669 65.600   1.00 42.95  ? 156  GLU C CG    1 
ATOM   7909  C  CD    . GLU D  2  155 ? -5.672   -17.563 66.017   1.00 44.55  ? 156  GLU C CD    1 
ATOM   7910  O  OE1   . GLU D  2  155 ? -5.187   -16.434 66.172   1.00 45.91  ? 156  GLU C OE1   1 
ATOM   7911  O  OE2   . GLU D  2  155 ? -5.019   -18.604 66.200   1.00 41.78  ? 156  GLU C OE2   1 
ATOM   7912  N  N     . PRO D  2  156 ? -9.946   -20.407 66.050   1.00 45.07  ? 157  PRO C N     1 
ATOM   7913  C  CA    . PRO D  2  156 ? -10.774  -20.666 67.221   1.00 45.02  ? 157  PRO C CA    1 
ATOM   7914  C  C     . PRO D  2  156 ? -10.053  -20.244 68.508   1.00 46.23  ? 157  PRO C C     1 
ATOM   7915  O  O     . PRO D  2  156 ? -8.914   -20.646 68.670   1.00 44.43  ? 157  PRO C O     1 
ATOM   7916  C  CB    . PRO D  2  156 ? -10.969  -22.186 67.188   1.00 41.44  ? 157  PRO C CB    1 
ATOM   7917  C  CG    . PRO D  2  156 ? -9.723   -22.697 66.529   1.00 40.61  ? 157  PRO C CG    1 
ATOM   7918  C  CD    . PRO D  2  156 ? -9.325   -21.631 65.527   1.00 41.52  ? 157  PRO C CD    1 
ATOM   7919  N  N     . SER D  2  157 ? -10.733  -19.466 69.357   1.00 46.71  ? 158  SER C N     1 
ATOM   7920  C  CA    . SER D  2  157 ? -10.276  -19.051 70.710   1.00 49.26  ? 158  SER C CA    1 
ATOM   7921  C  C     . SER D  2  157 ? -10.057  -20.286 71.597   1.00 51.33  ? 158  SER C C     1 
ATOM   7922  O  O     . SER D  2  157 ? -9.178   -20.232 72.471   1.00 54.16  ? 158  SER C O     1 
ATOM   7923  C  CB    . SER D  2  157 ? -11.269  -18.124 71.354   1.00 47.09  ? 158  SER C CB    1 
ATOM   7924  O  OG    . SER D  2  157 ? -12.408  -18.853 71.797   1.00 46.37  ? 158  SER C OG    1 
ATOM   7925  N  N     . VAL D  2  158 ? -10.850  -21.342 71.399   1.00 51.25  ? 159  VAL C N     1 
ATOM   7926  C  CA    . VAL D  2  158 ? -10.800  -22.597 72.200   1.00 55.15  ? 159  VAL C CA    1 
ATOM   7927  C  C     . VAL D  2  158 ? -11.424  -23.710 71.362   1.00 56.89  ? 159  VAL C C     1 
ATOM   7928  O  O     . VAL D  2  158 ? -12.257  -23.375 70.493   1.00 53.17  ? 159  VAL C O     1 
ATOM   7929  C  CB    . VAL D  2  158 ? -11.537  -22.417 73.538   1.00 61.65  ? 159  VAL C CB    1 
ATOM   7930  C  CG1   . VAL D  2  158 ? -13.023  -22.169 73.338   1.00 62.37  ? 159  VAL C CG1   1 
ATOM   7931  C  CG2   . VAL D  2  158 ? -11.312  -23.579 74.492   1.00 64.79  ? 159  VAL C CG2   1 
ATOM   7932  N  N     . LEU D  2  159 ? -11.066  -24.977 71.609   1.00 60.80  ? 160  LEU C N     1 
ATOM   7933  C  CA    . LEU D  2  159 ? -11.703  -26.115 70.896   1.00 61.66  ? 160  LEU C CA    1 
ATOM   7934  C  C     . LEU D  2  159 ? -12.880  -26.614 71.719   1.00 57.30  ? 160  LEU C C     1 
ATOM   7935  O  O     . LEU D  2  159 ? -12.926  -26.411 72.926   1.00 55.19  ? 160  LEU C O     1 
ATOM   7936  C  CB    . LEU D  2  159 ? -10.685  -27.227 70.646   1.00 67.24  ? 160  LEU C CB    1 
ATOM   7937  C  CG    . LEU D  2  159 ? -9.451   -26.833 69.834   1.00 79.88  ? 160  LEU C CG    1 
ATOM   7938  C  CD1   . LEU D  2  159 ? -8.715   -28.084 69.372   1.00 90.94  ? 160  LEU C CD1   1 
ATOM   7939  C  CD2   . LEU D  2  159 ? -9.800   -25.940 68.632   1.00 78.55  ? 160  LEU C CD2   1 
ATOM   7940  N  N     . PRO D  2  160 ? -13.894  -27.224 71.066   1.00 56.57  ? 161  PRO C N     1 
ATOM   7941  C  CA    . PRO D  2  160 ? -15.005  -27.860 71.777   1.00 55.24  ? 161  PRO C CA    1 
ATOM   7942  C  C     . PRO D  2  160 ? -14.549  -28.817 72.885   1.00 54.45  ? 161  PRO C C     1 
ATOM   7943  O  O     . PRO D  2  160 ? -15.139  -28.821 73.939   1.00 56.68  ? 161  PRO C O     1 
ATOM   7944  C  CB    . PRO D  2  160 ? -15.723  -28.623 70.664   1.00 53.33  ? 161  PRO C CB    1 
ATOM   7945  C  CG    . PRO D  2  160 ? -15.476  -27.770 69.433   1.00 56.87  ? 161  PRO C CG    1 
ATOM   7946  C  CD    . PRO D  2  160 ? -14.061  -27.255 69.602   1.00 57.10  ? 161  PRO C CD    1 
ATOM   7947  N  N     . ALA D  2  161 ? -13.506  -29.598 72.627   1.00 56.54  ? 162  ALA C N     1 
ATOM   7948  C  CA    . ALA D  2  161 ? -12.867  -30.478 73.635   1.00 63.41  ? 162  ALA C CA    1 
ATOM   7949  C  C     . ALA D  2  161 ? -13.921  -31.404 74.242   1.00 67.67  ? 162  ALA C C     1 
ATOM   7950  O  O     . ALA D  2  161 ? -14.284  -31.205 75.427   1.00 71.55  ? 162  ALA C O     1 
ATOM   7951  C  CB    . ALA D  2  161 ? -12.195  -29.640 74.700   1.00 61.18  ? 162  ALA C CB    1 
ATOM   7952  N  N     . ARG D  2  162 ? -14.388  -32.388 73.470   1.00 67.89  ? 163  ARG C N     1 
ATOM   7953  C  CA    . ARG D  2  162 ? -15.513  -33.257 73.891   1.00 68.33  ? 163  ARG C CA    1 
ATOM   7954  C  C     . ARG D  2  162 ? -15.006  -34.329 74.862   1.00 59.69  ? 163  ARG C C     1 
ATOM   7955  O  O     . ARG D  2  162 ? -15.873  -35.052 75.391   1.00 55.01  ? 163  ARG C O     1 
ATOM   7956  C  CB    . ARG D  2  162 ? -16.239  -33.828 72.670   1.00 71.99  ? 163  ARG C CB    1 
ATOM   7957  C  CG    . ARG D  2  162 ? -16.811  -32.766 71.736   1.00 74.98  ? 163  ARG C CG    1 
ATOM   7958  C  CD    . ARG D  2  162 ? -17.637  -31.697 72.433   1.00 77.31  ? 163  ARG C CD    1 
ATOM   7959  N  NE    . ARG D  2  162 ? -18.551  -32.289 73.398   1.00 86.75  ? 163  ARG C NE    1 
ATOM   7960  C  CZ    . ARG D  2  162 ? -19.730  -32.836 73.108   1.00 88.79  ? 163  ARG C CZ    1 
ATOM   7961  N  NH1   . ARG D  2  162 ? -20.167  -32.877 71.862   1.00 74.14  ? 163  ARG C NH1   1 
ATOM   7962  N  NH2   . ARG D  2  162 ? -20.471  -33.338 74.079   1.00 103.07 ? 163  ARG C NH2   1 
ATOM   7963  N  N     . PHE D  2  163 ? -13.688  -34.398 75.117   1.00 54.47  ? 164  PHE C N     1 
ATOM   7964  C  CA    . PHE D  2  163 ? -13.100  -35.132 76.272   1.00 60.85  ? 164  PHE C CA    1 
ATOM   7965  C  C     . PHE D  2  163 ? -12.213  -34.181 77