data_6R1U
# 
_entry.id   6R1U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6R1U         
WWPDB D_1292101290 
EMDB  EMD-4705     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 2' 
_pdbx_database_related.db_id          EMD-4705 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6R1U 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-15 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Marabelli, C.'   1 ? 
'Pilotto, S.'     2 ? 
'Chittori, S.'    3 ? 
'Subramaniam, S.' 4 ? 
'Mattevi, A.'     5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Cell Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2211-1247 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            27 
_citation.language                  ? 
_citation.page_first                387 
_citation.page_last                 399.e7 
_citation.title                     'A Tail-Based Mechanism Drives Nucleosome Demethylation by the LSD2/NPAC Multimeric Complex.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.celrep.2019.03.061 
_citation.pdbx_database_id_PubMed   30970244 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Marabelli, C.'       1  ? 
primary 'Marrocco, B.'        2  ? 
primary 'Pilotto, S.'         3  ? 
primary 'Chittori, S.'        4  ? 
primary 'Picaud, S.'          5  ? 
primary 'Marchese, S.'        6  ? 
primary 'Ciossani, G.'        7  ? 
primary 'Forneris, F.'        8  ? 
primary 'Filippakopoulos, P.' 9  ? 
primary 'Schoehn, G.'         10 ? 
primary 'Rhodes, D.'          11 ? 
primary 'Subramaniam, S.'     12 ? 
primary 'Mattevi, A.'         13 ? 
# 
_cell.angle_alpha                  90 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6R1U 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6R1U 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'                           15303.930 2 ?       ? ? ? 
2  polymer     man 'Histone H4'                             11263.231 2 ?       ? ? ? 
3  polymer     man 'Histone H2A'                            13978.241 2 ?       ? ? ? 
4  polymer     man 'Histone H2B 1.1'                        13524.752 2 ?       ? ? ? 
5  polymer     syn 'DNA (147-MER)'                          45610.043 1 ?       ? ? ? 
6  polymer     syn 'DNA (147-MER)'                          45138.770 1 ?       ? ? ? 
7  polymer     man 'Lysine-specific histone demethylase 1B' 87051.547 1 1.-.-.- ? ? ? 
8  polymer     man 'Putative oxidoreductase GLYR1'          13528.271 1 1.-.-.- ? ? ? 
9  polymer     man 'Histone H3'                             15305.945 1 ?       ? ? ? 
10 non-polymer man 'FLAVIN-ADENINE DINUCLEOTIDE'            785.550   1 ?       ? ? ? 
11 non-polymer syn 'ZINC ION'                               65.409    3 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
4 H2B1.1 
7 'Flavin-containing amine oxidase domain-containing protein 1,Lysine-specific histone demethylase 2' 
8 
;3-hydroxyisobutyrate dehydrogenase-like protein,Cytokine-like nuclear factor N-PAC,Glyoxylate reductase 1 homolog,Nuclear protein NP60,Nuclear protein of 60 kDa
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DG)(DA)(DT)
;
;ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCGAT
;
J   ? 
7 'polypeptide(L)'        no no 
;PLGSRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPS
PKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLI
LPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRP
DVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGV
LSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNP
VALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGI
QFSELEGQVLQFHLSNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGD
EVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPP
SASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMA
YSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
;
;PLGSRKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPS
PKAFMADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLI
LPPLLKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRP
DVMELDELYEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGV
LSVGADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNP
VALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGI
QFSELEGQVLQFHLSNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGD
EVQVTTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPP
SASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMA
YSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
;
K   ? 
8 'polypeptide(L)'        no no 
;PLGSPEFSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQ
TEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDK
;
;PLGSPEFSERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQ
TEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDK
;
L   ? 
9 'polypeptide(L)'        no no 
;ARTMQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTMQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
M   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   THR n 
1 4   LYS n 
1 5   GLN n 
1 6   THR n 
1 7   ALA n 
1 8   ARG n 
1 9   LYS n 
1 10  SER n 
1 11  THR n 
1 12  GLY n 
1 13  GLY n 
1 14  LYS n 
1 15  ALA n 
1 16  PRO n 
1 17  ARG n 
1 18  LYS n 
1 19  GLN n 
1 20  LEU n 
1 21  ALA n 
1 22  THR n 
1 23  LYS n 
1 24  ALA n 
1 25  ALA n 
1 26  ARG n 
1 27  LYS n 
1 28  SER n 
1 29  ALA n 
1 30  PRO n 
1 31  ALA n 
1 32  THR n 
1 33  GLY n 
1 34  GLY n 
1 35  VAL n 
1 36  LYS n 
1 37  LYS n 
1 38  PRO n 
1 39  HIS n 
1 40  ARG n 
1 41  TYR n 
1 42  ARG n 
1 43  PRO n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  ARG n 
1 50  GLU n 
1 51  ILE n 
1 52  ARG n 
1 53  ARG n 
1 54  TYR n 
1 55  GLN n 
1 56  LYS n 
1 57  SER n 
1 58  THR n 
1 59  GLU n 
1 60  LEU n 
1 61  LEU n 
1 62  ILE n 
1 63  ARG n 
1 64  LYS n 
1 65  LEU n 
1 66  PRO n 
1 67  PHE n 
1 68  GLN n 
1 69  ARG n 
1 70  LEU n 
1 71  VAL n 
1 72  ARG n 
1 73  GLU n 
1 74  ILE n 
1 75  ALA n 
1 76  GLN n 
1 77  ASP n 
1 78  PHE n 
1 79  LYS n 
1 80  THR n 
1 81  ASP n 
1 82  LEU n 
1 83  ARG n 
1 84  PHE n 
1 85  GLN n 
1 86  SER n 
1 87  SER n 
1 88  ALA n 
1 89  VAL n 
1 90  MET n 
1 91  ALA n 
1 92  LEU n 
1 93  GLN n 
1 94  GLU n 
1 95  ALA n 
1 96  SER n 
1 97  GLU n 
1 98  ALA n 
1 99  TYR n 
1 100 LEU n 
1 101 VAL n 
1 102 ALA n 
1 103 LEU n 
1 104 PHE n 
1 105 GLU n 
1 106 ASP n 
1 107 THR n 
1 108 ASN n 
1 109 LEU n 
1 110 CYS n 
1 111 ALA n 
1 112 ILE n 
1 113 HIS n 
1 114 ALA n 
1 115 LYS n 
1 116 ARG n 
1 117 VAL n 
1 118 THR n 
1 119 ILE n 
1 120 MET n 
1 121 PRO n 
1 122 LYS n 
1 123 ASP n 
1 124 ILE n 
1 125 GLN n 
1 126 LEU n 
1 127 ALA n 
1 128 ARG n 
1 129 ARG n 
1 130 ILE n 
1 131 ARG n 
1 132 GLY n 
1 133 GLU n 
1 134 ARG n 
1 135 ALA n 
2 1   SER n 
2 2   GLY n 
2 3   ARG n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   LYS n 
2 9   GLY n 
2 10  LEU n 
2 11  GLY n 
2 12  LYS n 
2 13  GLY n 
2 14  GLY n 
2 15  ALA n 
2 16  LYS n 
2 17  ARG n 
2 18  HIS n 
2 19  ARG n 
2 20  LYS n 
2 21  VAL n 
2 22  LEU n 
2 23  ARG n 
2 24  ASP n 
2 25  ASN n 
2 26  ILE n 
2 27  GLN n 
2 28  GLY n 
2 29  ILE n 
2 30  THR n 
2 31  LYS n 
2 32  PRO n 
2 33  ALA n 
2 34  ILE n 
2 35  ARG n 
2 36  ARG n 
2 37  LEU n 
2 38  ALA n 
2 39  ARG n 
2 40  ARG n 
2 41  GLY n 
2 42  GLY n 
2 43  VAL n 
2 44  LYS n 
2 45  ARG n 
2 46  ILE n 
2 47  SER n 
2 48  GLY n 
2 49  LEU n 
2 50  ILE n 
2 51  TYR n 
2 52  GLU n 
2 53  GLU n 
2 54  THR n 
2 55  ARG n 
2 56  GLY n 
2 57  VAL n 
2 58  LEU n 
2 59  LYS n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  ASN n 
2 65  VAL n 
2 66  ILE n 
2 67  ARG n 
2 68  ASP n 
2 69  ALA n 
2 70  VAL n 
2 71  THR n 
2 72  TYR n 
2 73  THR n 
2 74  GLU n 
2 75  HIS n 
2 76  ALA n 
2 77  LYS n 
2 78  ARG n 
2 79  LYS n 
2 80  THR n 
2 81  VAL n 
2 82  THR n 
2 83  ALA n 
2 84  MET n 
2 85  ASP n 
2 86  VAL n 
2 87  VAL n 
2 88  TYR n 
2 89  ALA n 
2 90  LEU n 
2 91  LYS n 
2 92  ARG n 
2 93  GLN n 
2 94  GLY n 
2 95  ARG n 
2 96  THR n 
2 97  LEU n 
2 98  TYR n 
2 99  GLY n 
2 100 PHE n 
2 101 GLY n 
2 102 GLY n 
3 1   SER n 
3 2   GLY n 
3 3   ARG n 
3 4   GLY n 
3 5   LYS n 
3 6   GLN n 
3 7   GLY n 
3 8   GLY n 
3 9   LYS n 
3 10  THR n 
3 11  ARG n 
3 12  ALA n 
3 13  LYS n 
3 14  ALA n 
3 15  LYS n 
3 16  THR n 
3 17  ARG n 
3 18  SER n 
3 19  SER n 
3 20  ARG n 
3 21  ALA n 
3 22  GLY n 
3 23  LEU n 
3 24  GLN n 
3 25  PHE n 
3 26  PRO n 
3 27  VAL n 
3 28  GLY n 
3 29  ARG n 
3 30  VAL n 
3 31  HIS n 
3 32  ARG n 
3 33  LEU n 
3 34  LEU n 
3 35  ARG n 
3 36  LYS n 
3 37  GLY n 
3 38  ASN n 
3 39  TYR n 
3 40  ALA n 
3 41  GLU n 
3 42  ARG n 
3 43  VAL n 
3 44  GLY n 
3 45  ALA n 
3 46  GLY n 
3 47  ALA n 
3 48  PRO n 
3 49  VAL n 
3 50  TYR n 
3 51  LEU n 
3 52  ALA n 
3 53  ALA n 
3 54  VAL n 
3 55  LEU n 
3 56  GLU n 
3 57  TYR n 
3 58  LEU n 
3 59  THR n 
3 60  ALA n 
3 61  GLU n 
3 62  ILE n 
3 63  LEU n 
3 64  GLU n 
3 65  LEU n 
3 66  ALA n 
3 67  GLY n 
3 68  ASN n 
3 69  ALA n 
3 70  ALA n 
3 71  ARG n 
3 72  ASP n 
3 73  ASN n 
3 74  LYS n 
3 75  LYS n 
3 76  THR n 
3 77  ARG n 
3 78  ILE n 
3 79  ILE n 
3 80  PRO n 
3 81  ARG n 
3 82  HIS n 
3 83  LEU n 
3 84  GLN n 
3 85  LEU n 
3 86  ALA n 
3 87  VAL n 
3 88  ARG n 
3 89  ASN n 
3 90  ASP n 
3 91  GLU n 
3 92  GLU n 
3 93  LEU n 
3 94  ASN n 
3 95  LYS n 
3 96  LEU n 
3 97  LEU n 
3 98  GLY n 
3 99  ARG n 
3 100 VAL n 
3 101 THR n 
3 102 ILE n 
3 103 ALA n 
3 104 GLN n 
3 105 GLY n 
3 106 GLY n 
3 107 VAL n 
3 108 LEU n 
3 109 PRO n 
3 110 ASN n 
3 111 ILE n 
3 112 GLN n 
3 113 SER n 
3 114 VAL n 
3 115 LEU n 
3 116 LEU n 
3 117 PRO n 
3 118 LYS n 
3 119 LYS n 
3 120 THR n 
3 121 GLU n 
3 122 SER n 
3 123 SER n 
3 124 LYS n 
3 125 SER n 
3 126 ALA n 
3 127 LYS n 
3 128 SER n 
3 129 LYS n 
4 1   ALA n 
4 2   LYS n 
4 3   SER n 
4 4   ALA n 
4 5   PRO n 
4 6   ALA n 
4 7   PRO n 
4 8   LYS n 
4 9   LYS n 
4 10  GLY n 
4 11  SER n 
4 12  LYS n 
4 13  LYS n 
4 14  ALA n 
4 15  VAL n 
4 16  THR n 
4 17  LYS n 
4 18  THR n 
4 19  GLN n 
4 20  LYS n 
4 21  LYS n 
4 22  ASP n 
4 23  GLY n 
4 24  LYS n 
4 25  LYS n 
4 26  ARG n 
4 27  ARG n 
4 28  LYS n 
4 29  THR n 
4 30  ARG n 
4 31  LYS n 
4 32  GLU n 
4 33  SER n 
4 34  TYR n 
4 35  ALA n 
4 36  ILE n 
4 37  TYR n 
4 38  VAL n 
4 39  TYR n 
4 40  LYS n 
4 41  VAL n 
4 42  LEU n 
4 43  LYS n 
4 44  GLN n 
4 45  VAL n 
4 46  HIS n 
4 47  PRO n 
4 48  ASP n 
4 49  THR n 
4 50  GLY n 
4 51  ILE n 
4 52  SER n 
4 53  SER n 
4 54  LYS n 
4 55  ALA n 
4 56  MET n 
4 57  SER n 
4 58  ILE n 
4 59  MET n 
4 60  ASN n 
4 61  SER n 
4 62  PHE n 
4 63  VAL n 
4 64  ASN n 
4 65  ASP n 
4 66  VAL n 
4 67  PHE n 
4 68  GLU n 
4 69  ARG n 
4 70  ILE n 
4 71  ALA n 
4 72  GLY n 
4 73  GLU n 
4 74  ALA n 
4 75  SER n 
4 76  ARG n 
4 77  LEU n 
4 78  ALA n 
4 79  HIS n 
4 80  TYR n 
4 81  ASN n 
4 82  LYS n 
4 83  ARG n 
4 84  SER n 
4 85  THR n 
4 86  ILE n 
4 87  THR n 
4 88  SER n 
4 89  ARG n 
4 90  GLU n 
4 91  ILE n 
4 92  GLN n 
4 93  THR n 
4 94  ALA n 
4 95  VAL n 
4 96  ARG n 
4 97  LEU n 
4 98  LEU n 
4 99  LEU n 
4 100 PRO n 
4 101 GLY n 
4 102 GLU n 
4 103 LEU n 
4 104 ALA n 
4 105 LYS n 
4 106 HIS n 
4 107 ALA n 
4 108 VAL n 
4 109 SER n 
4 110 GLU n 
4 111 GLY n 
4 112 THR n 
4 113 LYS n 
4 114 ALA n 
4 115 VAL n 
4 116 THR n 
4 117 LYS n 
4 118 TYR n 
4 119 THR n 
4 120 SER n 
4 121 ALA n 
4 122 LYS n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DG  n 
5 5   DG  n 
5 6   DA  n 
5 7   DT  n 
5 8   DG  n 
5 9   DT  n 
5 10  DA  n 
5 11  DT  n 
5 12  DA  n 
5 13  DT  n 
5 14  DA  n 
5 15  DT  n 
5 16  DC  n 
5 17  DT  n 
5 18  DG  n 
5 19  DA  n 
5 20  DC  n 
5 21  DA  n 
5 22  DC  n 
5 23  DG  n 
5 24  DT  n 
5 25  DG  n 
5 26  DC  n 
5 27  DC  n 
5 28  DT  n 
5 29  DG  n 
5 30  DG  n 
5 31  DA  n 
5 32  DG  n 
5 33  DA  n 
5 34  DC  n 
5 35  DT  n 
5 36  DA  n 
5 37  DG  n 
5 38  DG  n 
5 39  DG  n 
5 40  DA  n 
5 41  DG  n 
5 42  DT  n 
5 43  DA  n 
5 44  DA  n 
5 45  DT  n 
5 46  DC  n 
5 47  DC  n 
5 48  DC  n 
5 49  DC  n 
5 50  DT  n 
5 51  DT  n 
5 52  DG  n 
5 53  DG  n 
5 54  DC  n 
5 55  DG  n 
5 56  DG  n 
5 57  DT  n 
5 58  DT  n 
5 59  DA  n 
5 60  DA  n 
5 61  DA  n 
5 62  DA  n 
5 63  DC  n 
5 64  DG  n 
5 65  DC  n 
5 66  DG  n 
5 67  DG  n 
5 68  DG  n 
5 69  DG  n 
5 70  DG  n 
5 71  DA  n 
5 72  DC  n 
5 73  DA  n 
5 74  DG  n 
5 75  DC  n 
5 76  DG  n 
5 77  DC  n 
5 78  DG  n 
5 79  DT  n 
5 80  DA  n 
5 81  DC  n 
5 82  DG  n 
5 83  DT  n 
5 84  DG  n 
5 85  DC  n 
5 86  DG  n 
5 87  DT  n 
5 88  DT  n 
5 89  DT  n 
5 90  DA  n 
5 91  DA  n 
5 92  DG  n 
5 93  DC  n 
5 94  DG  n 
5 95  DG  n 
5 96  DT  n 
5 97  DG  n 
5 98  DC  n 
5 99  DT  n 
5 100 DA  n 
5 101 DG  n 
5 102 DA  n 
5 103 DG  n 
5 104 DC  n 
5 105 DT  n 
5 106 DG  n 
5 107 DT  n 
5 108 DC  n 
5 109 DT  n 
5 110 DA  n 
5 111 DC  n 
5 112 DG  n 
5 113 DA  n 
5 114 DC  n 
5 115 DC  n 
5 116 DA  n 
5 117 DA  n 
5 118 DT  n 
5 119 DT  n 
5 120 DG  n 
5 121 DA  n 
5 122 DG  n 
5 123 DC  n 
5 124 DG  n 
5 125 DG  n 
5 126 DC  n 
5 127 DC  n 
5 128 DT  n 
5 129 DC  n 
5 130 DG  n 
5 131 DG  n 
5 132 DC  n 
5 133 DA  n 
5 134 DC  n 
5 135 DC  n 
5 136 DG  n 
5 137 DG  n 
5 138 DG  n 
5 139 DA  n 
5 140 DT  n 
5 141 DT  n 
5 142 DC  n 
5 143 DT  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   PRO n 
7 2   LEU n 
7 3   GLY n 
7 4   SER n 
7 5   ARG n 
7 6   LYS n 
7 7   CYS n 
7 8   GLU n 
7 9   LYS n 
7 10  ALA n 
7 11  GLY n 
7 12  CYS n 
7 13  THR n 
7 14  ALA n 
7 15  THR n 
7 16  CYS n 
7 17  PRO n 
7 18  VAL n 
7 19  CYS n 
7 20  PHE n 
7 21  ALA n 
7 22  SER n 
7 23  ALA n 
7 24  SER n 
7 25  GLU n 
7 26  ARG n 
7 27  CYS n 
7 28  ALA n 
7 29  LYS n 
7 30  ASN n 
7 31  GLY n 
7 32  TYR n 
7 33  THR n 
7 34  SER n 
7 35  ARG n 
7 36  TRP n 
7 37  TYR n 
7 38  HIS n 
7 39  LEU n 
7 40  SER n 
7 41  CYS n 
7 42  GLY n 
7 43  GLU n 
7 44  HIS n 
7 45  PHE n 
7 46  CYS n 
7 47  ASN n 
7 48  GLU n 
7 49  CYS n 
7 50  PHE n 
7 51  ASP n 
7 52  HIS n 
7 53  TYR n 
7 54  TYR n 
7 55  ARG n 
7 56  SER n 
7 57  HIS n 
7 58  LYS n 
7 59  ASP n 
7 60  GLY n 
7 61  TYR n 
7 62  ASP n 
7 63  LYS n 
7 64  TYR n 
7 65  THR n 
7 66  THR n 
7 67  TRP n 
7 68  LYS n 
7 69  LYS n 
7 70  ILE n 
7 71  TRP n 
7 72  THR n 
7 73  SER n 
7 74  ASN n 
7 75  GLY n 
7 76  LYS n 
7 77  THR n 
7 78  GLU n 
7 79  PRO n 
7 80  SER n 
7 81  PRO n 
7 82  LYS n 
7 83  ALA n 
7 84  PHE n 
7 85  MET n 
7 86  ALA n 
7 87  ASP n 
7 88  GLN n 
7 89  GLN n 
7 90  LEU n 
7 91  PRO n 
7 92  TYR n 
7 93  TRP n 
7 94  VAL n 
7 95  GLN n 
7 96  CYS n 
7 97  THR n 
7 98  LYS n 
7 99  PRO n 
7 100 GLU n 
7 101 CYS n 
7 102 ARG n 
7 103 LYS n 
7 104 TRP n 
7 105 ARG n 
7 106 GLN n 
7 107 LEU n 
7 108 THR n 
7 109 LYS n 
7 110 GLU n 
7 111 ILE n 
7 112 GLN n 
7 113 LEU n 
7 114 THR n 
7 115 PRO n 
7 116 GLN n 
7 117 ILE n 
7 118 ALA n 
7 119 LYS n 
7 120 THR n 
7 121 TYR n 
7 122 ARG n 
7 123 CYS n 
7 124 GLY n 
7 125 MET n 
7 126 LYS n 
7 127 PRO n 
7 128 ASN n 
7 129 THR n 
7 130 ALA n 
7 131 ILE n 
7 132 LYS n 
7 133 PRO n 
7 134 GLU n 
7 135 THR n 
7 136 SER n 
7 137 ASP n 
7 138 HIS n 
7 139 CYS n 
7 140 SER n 
7 141 LEU n 
7 142 PRO n 
7 143 GLU n 
7 144 ASP n 
7 145 LEU n 
7 146 ARG n 
7 147 VAL n 
7 148 LEU n 
7 149 GLU n 
7 150 VAL n 
7 151 SER n 
7 152 ASN n 
7 153 HIS n 
7 154 TRP n 
7 155 TRP n 
7 156 TYR n 
7 157 SER n 
7 158 MET n 
7 159 LEU n 
7 160 ILE n 
7 161 LEU n 
7 162 PRO n 
7 163 PRO n 
7 164 LEU n 
7 165 LEU n 
7 166 LYS n 
7 167 ASP n 
7 168 SER n 
7 169 VAL n 
7 170 ALA n 
7 171 ALA n 
7 172 PRO n 
7 173 LEU n 
7 174 LEU n 
7 175 SER n 
7 176 ALA n 
7 177 TYR n 
7 178 TYR n 
7 179 PRO n 
7 180 ASP n 
7 181 CYS n 
7 182 VAL n 
7 183 GLY n 
7 184 MET n 
7 185 SER n 
7 186 PRO n 
7 187 SER n 
7 188 CYS n 
7 189 THR n 
7 190 SER n 
7 191 THR n 
7 192 ASN n 
7 193 ARG n 
7 194 ALA n 
7 195 ALA n 
7 196 ALA n 
7 197 THR n 
7 198 GLY n 
7 199 ASN n 
7 200 ALA n 
7 201 SER n 
7 202 PRO n 
7 203 GLY n 
7 204 LYS n 
7 205 LEU n 
7 206 GLU n 
7 207 HIS n 
7 208 SER n 
7 209 LYS n 
7 210 ALA n 
7 211 ALA n 
7 212 LEU n 
7 213 SER n 
7 214 VAL n 
7 215 HIS n 
7 216 VAL n 
7 217 PRO n 
7 218 GLY n 
7 219 MET n 
7 220 ASN n 
7 221 ARG n 
7 222 TYR n 
7 223 PHE n 
7 224 GLN n 
7 225 PRO n 
7 226 PHE n 
7 227 TYR n 
7 228 GLN n 
7 229 PRO n 
7 230 ASN n 
7 231 GLU n 
7 232 CYS n 
7 233 GLY n 
7 234 LYS n 
7 235 ALA n 
7 236 LEU n 
7 237 CYS n 
7 238 VAL n 
7 239 ARG n 
7 240 PRO n 
7 241 ASP n 
7 242 VAL n 
7 243 MET n 
7 244 GLU n 
7 245 LEU n 
7 246 ASP n 
7 247 GLU n 
7 248 LEU n 
7 249 TYR n 
7 250 GLU n 
7 251 PHE n 
7 252 PRO n 
7 253 GLU n 
7 254 TYR n 
7 255 SER n 
7 256 ARG n 
7 257 ASP n 
7 258 PRO n 
7 259 THR n 
7 260 MET n 
7 261 TYR n 
7 262 LEU n 
7 263 ALA n 
7 264 LEU n 
7 265 ARG n 
7 266 ASN n 
7 267 LEU n 
7 268 ILE n 
7 269 LEU n 
7 270 ALA n 
7 271 LEU n 
7 272 TRP n 
7 273 TYR n 
7 274 THR n 
7 275 ASN n 
7 276 CYS n 
7 277 LYS n 
7 278 GLU n 
7 279 ALA n 
7 280 LEU n 
7 281 THR n 
7 282 PRO n 
7 283 GLN n 
7 284 LYS n 
7 285 CYS n 
7 286 ILE n 
7 287 PRO n 
7 288 HIS n 
7 289 ILE n 
7 290 ILE n 
7 291 VAL n 
7 292 ARG n 
7 293 GLY n 
7 294 LEU n 
7 295 VAL n 
7 296 ARG n 
7 297 ILE n 
7 298 ARG n 
7 299 CYS n 
7 300 VAL n 
7 301 GLN n 
7 302 GLU n 
7 303 VAL n 
7 304 GLU n 
7 305 ARG n 
7 306 ILE n 
7 307 LEU n 
7 308 TYR n 
7 309 PHE n 
7 310 MET n 
7 311 THR n 
7 312 ARG n 
7 313 LYS n 
7 314 GLY n 
7 315 LEU n 
7 316 ILE n 
7 317 ASN n 
7 318 THR n 
7 319 GLY n 
7 320 VAL n 
7 321 LEU n 
7 322 SER n 
7 323 VAL n 
7 324 GLY n 
7 325 ALA n 
7 326 ASP n 
7 327 GLN n 
7 328 TYR n 
7 329 LEU n 
7 330 LEU n 
7 331 PRO n 
7 332 LYS n 
7 333 ASP n 
7 334 TYR n 
7 335 HIS n 
7 336 ASN n 
7 337 LYS n 
7 338 SER n 
7 339 VAL n 
7 340 ILE n 
7 341 ILE n 
7 342 ILE n 
7 343 GLY n 
7 344 ALA n 
7 345 GLY n 
7 346 PRO n 
7 347 ALA n 
7 348 GLY n 
7 349 LEU n 
7 350 ALA n 
7 351 ALA n 
7 352 ALA n 
7 353 ARG n 
7 354 GLN n 
7 355 LEU n 
7 356 HIS n 
7 357 ASN n 
7 358 PHE n 
7 359 GLY n 
7 360 ILE n 
7 361 LYS n 
7 362 VAL n 
7 363 THR n 
7 364 VAL n 
7 365 LEU n 
7 366 GLU n 
7 367 ALA n 
7 368 LYS n 
7 369 ASP n 
7 370 ARG n 
7 371 ILE n 
7 372 GLY n 
7 373 GLY n 
7 374 ARG n 
7 375 VAL n 
7 376 TRP n 
7 377 ASP n 
7 378 ASP n 
7 379 LYS n 
7 380 SER n 
7 381 PHE n 
7 382 LYS n 
7 383 GLY n 
7 384 VAL n 
7 385 THR n 
7 386 VAL n 
7 387 GLY n 
7 388 ARG n 
7 389 GLY n 
7 390 ALA n 
7 391 GLN n 
7 392 ILE n 
7 393 VAL n 
7 394 ASN n 
7 395 GLY n 
7 396 CYS n 
7 397 ILE n 
7 398 ASN n 
7 399 ASN n 
7 400 PRO n 
7 401 VAL n 
7 402 ALA n 
7 403 LEU n 
7 404 MET n 
7 405 CYS n 
7 406 GLU n 
7 407 GLN n 
7 408 LEU n 
7 409 GLY n 
7 410 ILE n 
7 411 SER n 
7 412 MET n 
7 413 HIS n 
7 414 LYS n 
7 415 PHE n 
7 416 GLY n 
7 417 GLU n 
7 418 ARG n 
7 419 CYS n 
7 420 ASP n 
7 421 LEU n 
7 422 ILE n 
7 423 GLN n 
7 424 GLU n 
7 425 GLY n 
7 426 GLY n 
7 427 ARG n 
7 428 ILE n 
7 429 THR n 
7 430 ASP n 
7 431 PRO n 
7 432 THR n 
7 433 ILE n 
7 434 ASP n 
7 435 LYS n 
7 436 ARG n 
7 437 MET n 
7 438 ASP n 
7 439 PHE n 
7 440 HIS n 
7 441 PHE n 
7 442 ASN n 
7 443 ALA n 
7 444 LEU n 
7 445 LEU n 
7 446 ASP n 
7 447 VAL n 
7 448 VAL n 
7 449 SER n 
7 450 GLU n 
7 451 TRP n 
7 452 ARG n 
7 453 LYS n 
7 454 ASP n 
7 455 LYS n 
7 456 THR n 
7 457 GLN n 
7 458 LEU n 
7 459 GLN n 
7 460 ASP n 
7 461 VAL n 
7 462 PRO n 
7 463 LEU n 
7 464 GLY n 
7 465 GLU n 
7 466 LYS n 
7 467 ILE n 
7 468 GLU n 
7 469 GLU n 
7 470 ILE n 
7 471 TYR n 
7 472 LYS n 
7 473 ALA n 
7 474 PHE n 
7 475 ILE n 
7 476 LYS n 
7 477 GLU n 
7 478 SER n 
7 479 GLY n 
7 480 ILE n 
7 481 GLN n 
7 482 PHE n 
7 483 SER n 
7 484 GLU n 
7 485 LEU n 
7 486 GLU n 
7 487 GLY n 
7 488 GLN n 
7 489 VAL n 
7 490 LEU n 
7 491 GLN n 
7 492 PHE n 
7 493 HIS n 
7 494 LEU n 
7 495 SER n 
7 496 ASN n 
7 497 LEU n 
7 498 GLU n 
7 499 TYR n 
7 500 ALA n 
7 501 CYS n 
7 502 GLY n 
7 503 SER n 
7 504 ASN n 
7 505 LEU n 
7 506 HIS n 
7 507 GLN n 
7 508 VAL n 
7 509 SER n 
7 510 ALA n 
7 511 ARG n 
7 512 SER n 
7 513 TRP n 
7 514 ASP n 
7 515 HIS n 
7 516 ASN n 
7 517 GLU n 
7 518 PHE n 
7 519 PHE n 
7 520 ALA n 
7 521 GLN n 
7 522 PHE n 
7 523 ALA n 
7 524 GLY n 
7 525 ASP n 
7 526 HIS n 
7 527 THR n 
7 528 LEU n 
7 529 LEU n 
7 530 THR n 
7 531 PRO n 
7 532 GLY n 
7 533 TYR n 
7 534 SER n 
7 535 VAL n 
7 536 ILE n 
7 537 ILE n 
7 538 GLU n 
7 539 LYS n 
7 540 LEU n 
7 541 ALA n 
7 542 GLU n 
7 543 GLY n 
7 544 LEU n 
7 545 ASP n 
7 546 ILE n 
7 547 GLN n 
7 548 LEU n 
7 549 LYS n 
7 550 SER n 
7 551 PRO n 
7 552 VAL n 
7 553 GLN n 
7 554 CYS n 
7 555 ILE n 
7 556 ASP n 
7 557 TYR n 
7 558 SER n 
7 559 GLY n 
7 560 ASP n 
7 561 GLU n 
7 562 VAL n 
7 563 GLN n 
7 564 VAL n 
7 565 THR n 
7 566 THR n 
7 567 THR n 
7 568 ASP n 
7 569 GLY n 
7 570 THR n 
7 571 GLY n 
7 572 TYR n 
7 573 SER n 
7 574 ALA n 
7 575 GLN n 
7 576 LYS n 
7 577 VAL n 
7 578 LEU n 
7 579 VAL n 
7 580 THR n 
7 581 VAL n 
7 582 PRO n 
7 583 LEU n 
7 584 ALA n 
7 585 LEU n 
7 586 LEU n 
7 587 GLN n 
7 588 LYS n 
7 589 GLY n 
7 590 ALA n 
7 591 ILE n 
7 592 GLN n 
7 593 PHE n 
7 594 ASN n 
7 595 PRO n 
7 596 PRO n 
7 597 LEU n 
7 598 SER n 
7 599 GLU n 
7 600 LYS n 
7 601 LYS n 
7 602 MET n 
7 603 LYS n 
7 604 ALA n 
7 605 ILE n 
7 606 ASN n 
7 607 SER n 
7 608 LEU n 
7 609 GLY n 
7 610 ALA n 
7 611 GLY n 
7 612 ILE n 
7 613 ILE n 
7 614 GLU n 
7 615 LYS n 
7 616 ILE n 
7 617 ALA n 
7 618 LEU n 
7 619 GLN n 
7 620 PHE n 
7 621 PRO n 
7 622 TYR n 
7 623 ARG n 
7 624 PHE n 
7 625 TRP n 
7 626 ASP n 
7 627 SER n 
7 628 LYS n 
7 629 VAL n 
7 630 GLN n 
7 631 GLY n 
7 632 ALA n 
7 633 ASP n 
7 634 PHE n 
7 635 PHE n 
7 636 GLY n 
7 637 HIS n 
7 638 VAL n 
7 639 PRO n 
7 640 PRO n 
7 641 SER n 
7 642 ALA n 
7 643 SER n 
7 644 LYS n 
7 645 ARG n 
7 646 GLY n 
7 647 LEU n 
7 648 PHE n 
7 649 ALA n 
7 650 VAL n 
7 651 PHE n 
7 652 TYR n 
7 653 ASP n 
7 654 MET n 
7 655 ASP n 
7 656 PRO n 
7 657 GLN n 
7 658 LYS n 
7 659 LYS n 
7 660 HIS n 
7 661 SER n 
7 662 VAL n 
7 663 LEU n 
7 664 MET n 
7 665 SER n 
7 666 VAL n 
7 667 ILE n 
7 668 ALA n 
7 669 GLY n 
7 670 GLU n 
7 671 ALA n 
7 672 VAL n 
7 673 ALA n 
7 674 SER n 
7 675 VAL n 
7 676 ARG n 
7 677 THR n 
7 678 LEU n 
7 679 ASP n 
7 680 ASP n 
7 681 LYS n 
7 682 GLN n 
7 683 VAL n 
7 684 LEU n 
7 685 GLN n 
7 686 GLN n 
7 687 CYS n 
7 688 MET n 
7 689 ALA n 
7 690 THR n 
7 691 LEU n 
7 692 ARG n 
7 693 GLU n 
7 694 LEU n 
7 695 PHE n 
7 696 LYS n 
7 697 GLU n 
7 698 GLN n 
7 699 GLU n 
7 700 VAL n 
7 701 PRO n 
7 702 ASP n 
7 703 PRO n 
7 704 THR n 
7 705 LYS n 
7 706 TYR n 
7 707 PHE n 
7 708 VAL n 
7 709 THR n 
7 710 ARG n 
7 711 TRP n 
7 712 SER n 
7 713 THR n 
7 714 ASP n 
7 715 PRO n 
7 716 TRP n 
7 717 ILE n 
7 718 GLN n 
7 719 MET n 
7 720 ALA n 
7 721 TYR n 
7 722 SER n 
7 723 PHE n 
7 724 VAL n 
7 725 LYS n 
7 726 THR n 
7 727 GLY n 
7 728 GLY n 
7 729 SER n 
7 730 GLY n 
7 731 GLU n 
7 732 ALA n 
7 733 TYR n 
7 734 ASP n 
7 735 ILE n 
7 736 ILE n 
7 737 ALA n 
7 738 GLU n 
7 739 ASP n 
7 740 ILE n 
7 741 GLN n 
7 742 GLY n 
7 743 THR n 
7 744 VAL n 
7 745 PHE n 
7 746 PHE n 
7 747 ALA n 
7 748 GLY n 
7 749 GLU n 
7 750 ALA n 
7 751 THR n 
7 752 ASN n 
7 753 ARG n 
7 754 HIS n 
7 755 PHE n 
7 756 PRO n 
7 757 GLN n 
7 758 THR n 
7 759 VAL n 
7 760 THR n 
7 761 GLY n 
7 762 ALA n 
7 763 TYR n 
7 764 LEU n 
7 765 SER n 
7 766 GLY n 
7 767 VAL n 
7 768 ARG n 
7 769 GLU n 
7 770 ALA n 
7 771 SER n 
7 772 LYS n 
7 773 ILE n 
7 774 ALA n 
7 775 ALA n 
7 776 PHE n 
8 1   PRO n 
8 2   LEU n 
8 3   GLY n 
8 4   SER n 
8 5   PRO n 
8 6   GLU n 
8 7   PHE n 
8 8   SER n 
8 9   GLU n 
8 10  ARG n 
8 11  GLY n 
8 12  SER n 
8 13  LYS n 
8 14  SER n 
8 15  PRO n 
8 16  LEU n 
8 17  LYS n 
8 18  ARG n 
8 19  ALA n 
8 20  GLN n 
8 21  GLU n 
8 22  GLN n 
8 23  SER n 
8 24  PRO n 
8 25  ARG n 
8 26  LYS n 
8 27  ARG n 
8 28  GLY n 
8 29  ARG n 
8 30  PRO n 
8 31  PRO n 
8 32  LYS n 
8 33  ASP n 
8 34  GLU n 
8 35  LYS n 
8 36  ASP n 
8 37  LEU n 
8 38  THR n 
8 39  ILE n 
8 40  PRO n 
8 41  GLU n 
8 42  SER n 
8 43  SER n 
8 44  THR n 
8 45  VAL n 
8 46  LYS n 
8 47  GLY n 
8 48  MET n 
8 49  MET n 
8 50  ALA n 
8 51  GLY n 
8 52  PRO n 
8 53  MET n 
8 54  ALA n 
8 55  ALA n 
8 56  PHE n 
8 57  LYS n 
8 58  TRP n 
8 59  GLN n 
8 60  PRO n 
8 61  THR n 
8 62  ALA n 
8 63  SER n 
8 64  GLU n 
8 65  PRO n 
8 66  VAL n 
8 67  LYS n 
8 68  ASP n 
8 69  ALA n 
8 70  ASP n 
8 71  PRO n 
8 72  HIS n 
8 73  PHE n 
8 74  HIS n 
8 75  HIS n 
8 76  PHE n 
8 77  LEU n 
8 78  LEU n 
8 79  SER n 
8 80  GLN n 
8 81  THR n 
8 82  GLU n 
8 83  LYS n 
8 84  PRO n 
8 85  ALA n 
8 86  VAL n 
8 87  CYS n 
8 88  TYR n 
8 89  GLN n 
8 90  ALA n 
8 91  ILE n 
8 92  THR n 
8 93  LYS n 
8 94  LYS n 
8 95  LEU n 
8 96  LYS n 
8 97  ILE n 
8 98  CYS n 
8 99  GLU n 
8 100 GLU n 
8 101 GLU n 
8 102 THR n 
8 103 GLY n 
8 104 SER n 
8 105 THR n 
8 106 SER n 
8 107 ILE n 
8 108 GLN n 
8 109 ALA n 
8 110 ALA n 
8 111 ASP n 
8 112 SER n 
8 113 THR n 
8 114 ALA n 
8 115 VAL n 
8 116 ASN n 
8 117 GLY n 
8 118 SER n 
8 119 ILE n 
8 120 THR n 
8 121 PRO n 
8 122 THR n 
8 123 ASP n 
8 124 LYS n 
9 1   ALA n 
9 2   ARG n 
9 3   THR n 
9 4   MET n 
9 5   GLN n 
9 6   THR n 
9 7   ALA n 
9 8   ARG n 
9 9   LYS n 
9 10  SER n 
9 11  THR n 
9 12  GLY n 
9 13  GLY n 
9 14  LYS n 
9 15  ALA n 
9 16  PRO n 
9 17  ARG n 
9 18  LYS n 
9 19  GLN n 
9 20  LEU n 
9 21  ALA n 
9 22  THR n 
9 23  LYS n 
9 24  ALA n 
9 25  ALA n 
9 26  ARG n 
9 27  LYS n 
9 28  SER n 
9 29  ALA n 
9 30  PRO n 
9 31  ALA n 
9 32  THR n 
9 33  GLY n 
9 34  GLY n 
9 35  VAL n 
9 36  LYS n 
9 37  LYS n 
9 38  PRO n 
9 39  HIS n 
9 40  ARG n 
9 41  TYR n 
9 42  ARG n 
9 43  PRO n 
9 44  GLY n 
9 45  THR n 
9 46  VAL n 
9 47  ALA n 
9 48  LEU n 
9 49  ARG n 
9 50  GLU n 
9 51  ILE n 
9 52  ARG n 
9 53  ARG n 
9 54  TYR n 
9 55  GLN n 
9 56  LYS n 
9 57  SER n 
9 58  THR n 
9 59  GLU n 
9 60  LEU n 
9 61  LEU n 
9 62  ILE n 
9 63  ARG n 
9 64  LYS n 
9 65  LEU n 
9 66  PRO n 
9 67  PHE n 
9 68  GLN n 
9 69  ARG n 
9 70  LEU n 
9 71  VAL n 
9 72  ARG n 
9 73  GLU n 
9 74  ILE n 
9 75  ALA n 
9 76  GLN n 
9 77  ASP n 
9 78  PHE n 
9 79  LYS n 
9 80  THR n 
9 81  ASP n 
9 82  LEU n 
9 83  ARG n 
9 84  PHE n 
9 85  GLN n 
9 86  SER n 
9 87  SER n 
9 88  ALA n 
9 89  VAL n 
9 90  MET n 
9 91  ALA n 
9 92  LEU n 
9 93  GLN n 
9 94  GLU n 
9 95  ALA n 
9 96  SER n 
9 97  GLU n 
9 98  ALA n 
9 99  TYR n 
9 100 LEU n 
9 101 VAL n 
9 102 ALA n 
9 103 LEU n 
9 104 PHE n 
9 105 GLU n 
9 106 ASP n 
9 107 THR n 
9 108 ASN n 
9 109 LEU n 
9 110 CYS n 
9 111 ALA n 
9 112 ILE n 
9 113 HIS n 
9 114 ALA n 
9 115 LYS n 
9 116 ARG n 
9 117 VAL n 
9 118 THR n 
9 119 ILE n 
9 120 MET n 
9 121 PRO n 
9 122 LYS n 
9 123 ASP n 
9 124 ILE n 
9 125 GLN n 
9 126 LEU n 
9 127 ALA n 
9 128 ARG n 
9 129 ARG n 
9 130 ILE n 
9 131 ARG n 
9 132 GLY n 
9 133 GLU n 
9 134 ARG n 
9 135 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                             ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                             ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591'        ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ?                             ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 776 Human                 ? 'KDM1B, AOF1, C6orf193, LSD2' ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 124 Human                 ? 'GLYR1, HIBDL, NP60'          ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? 
? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ?    ?     ? ? ? ? ? ? ? ? ? ? ? ? ? 
9 1 sample 'Biological sequence' 1 135 'African clawed frog' ? XELAEV_18002543mg             ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? 
? ? ? ? ? ? 'Escherichia coli'           511693 ? ? ? ? ? ? BL21 pLysS ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 147 'synthetic construct' ? 32630 ? 
6 1 sample 1 147 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA        P84233     ? 1 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   
2 UNP H4_XENLA         P62799     ? 2 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2   
3 UNP Q6AZJ8_XENLA     Q6AZJ8     ? 3 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2   
4 UNP H2B11_XENLA      P02281     ? 4 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5   
5 PDB 6R1U             6R1U       ? 5 ? 1   
6 PDB 6R1U             6R1U       ? 6 ? 1   
7 UNP KDM1B_HUMAN      Q8NB78     ? 7 
;RKCEKAGCTATCPVCFASASERCAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYDKYTTWKKIWTSNGKTEPSPKAF
MADQQLPYWVQCTKPECRKWRQLTKEIQLTPQIAKTYRCGMKPNTAIKPETSDHCSLPEDLRVLEVSNHWWYSMLILPPL
LKDSVAAPLLSAYYPDCVGMSPSCTSTNRAAATGNASPGKLEHSKAALSVHVPGMNRYFQPFYQPNECGKALCVRPDVME
LDELYEFPEYSRDPTMYLALRNLILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVG
ADQYLLPKDYHNKSVIIIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSFKGVTVGRGAQIVNGCINNPVALM
CEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLDVVSEWRKDKTQLQDVPLGEKIEEIYKAFIKESGIQFSE
LEGQVLQFHLSNLEYACGSNLHQVSARSWDHNEFFAQFAGDHTLLTPGYSVIIEKLAEGLDIQLKSPVQCIDYSGDEVQV
TTTDGTGYSAQKVLVTVPLALLQKGAIQFNPPLSEKKMKAINSLGAGIIEKIALQFPYRFWDSKVQGADFFGHVPPSASK
RGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFV
KTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF
;
51  
8 UNP GLYR1_HUMAN      Q49A26     ? 8 
;SERGSKSPLKRAQEQSPRKRGRPPKDEKDLTIPESSTVKGMMAGPMAAFKWQPTASEPVKDADPHFHHFLLSQTEKPAVC
YQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDK
;
152 
9 UNP A0A310TTQ1_XENLA A0A310TTQ1 ? 9 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6R1U A 1 ? 135 ? P84233     2   ? 136 ? 1   135 
2  2 6R1U B 1 ? 102 ? P62799     2   ? 103 ? 1   102 
3  3 6R1U C 1 ? 129 ? Q6AZJ8     2   ? 130 ? 1   129 
4  4 6R1U D 1 ? 122 ? P02281     5   ? 126 ? 1   122 
5  1 6R1U E 1 ? 135 ? P84233     2   ? 136 ? 1   135 
6  2 6R1U F 1 ? 102 ? P62799     2   ? 103 ? 1   102 
7  3 6R1U G 1 ? 129 ? Q6AZJ8     2   ? 130 ? 1   129 
8  4 6R1U H 1 ? 122 ? P02281     5   ? 126 ? 1   122 
9  5 6R1U I 1 ? 147 ? 6R1U       -73 ? 73  ? -73 73  
10 6 6R1U J 1 ? 147 ? 6R1U       -73 ? 73  ? -73 73  
11 7 6R1U K 5 ? 776 ? Q8NB78     51  ? 822 ? 51  822 
12 8 6R1U L 8 ? 124 ? Q49A26     152 ? 268 ? 152 268 
13 9 6R1U M 1 ? 135 ? A0A310TTQ1 2   ? 136 ? 1   135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  6R1U ALA A 102 ? UNP P84233     GLY 103 conflict         102 1  
4  6R1U THR D 29  ? UNP P02281     SER 33  conflict         29  2  
5  6R1U ALA E 102 ? UNP P84233     GLY 103 conflict         102 3  
8  6R1U THR H 29  ? UNP P02281     SER 33  conflict         29  4  
11 6R1U PRO K 1   ? UNP Q8NB78     ?   ?   'expression tag' 47  5  
11 6R1U LEU K 2   ? UNP Q8NB78     ?   ?   'expression tag' 48  6  
11 6R1U GLY K 3   ? UNP Q8NB78     ?   ?   'expression tag' 49  7  
11 6R1U SER K 4   ? UNP Q8NB78     ?   ?   'expression tag' 50  8  
12 6R1U PRO L 1   ? UNP Q49A26     ?   ?   'expression tag' 145 9  
12 6R1U LEU L 2   ? UNP Q49A26     ?   ?   'expression tag' 146 10 
12 6R1U GLY L 3   ? UNP Q49A26     ?   ?   'expression tag' 147 11 
12 6R1U SER L 4   ? UNP Q49A26     ?   ?   'expression tag' 148 12 
12 6R1U PRO L 5   ? UNP Q49A26     ?   ?   'expression tag' 149 13 
12 6R1U GLU L 6   ? UNP Q49A26     ?   ?   'expression tag' 150 14 
12 6R1U PHE L 7   ? UNP Q49A26     ?   ?   'expression tag' 151 15 
13 6R1U MET M 4   ? UNP A0A310TTQ1 LYS 5   conflict         4   16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE'        ? 'C27 H33 N9 O15 P2' 785.550 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6R1U 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6R1U 
_struct.title                        'Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 2' 
_struct.pdbx_descriptor              
;Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1, Lysine-specific histone demethylase 1B, Putative oxidoreductase GLYR1, Histone H3/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6R1U 
_struct_keywords.text            
;Histone demethylation, chromatin reader, flavoenzyme, epigenetics, evolution of protein function, molecular recognition., GENE REGULATION
;
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 4  ? 
I N N 5  ? 
J N N 6  ? 
K N N 7  ? 
L N N 8  ? 
M N N 9  ? 
N N N 10 ? 
O N N 11 ? 
P N N 11 ? 
Q N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 44  ? SER A 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 63  ? LYS A 79  ? ARG A 63  LYS A 79  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 85  ? HIS A 113 ? GLN A 85  HIS A 113 1 ? 29 
HELX_P HELX_P4  AA4 MET A 120 ? GLY A 132 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 THR B 30  ? GLY B 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P6  AA6 LEU B 49  ? ALA B 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P7  AA7 THR B 82  ? GLN B 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P8  AA8 PRO C 26  ? LYS C 36  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P9  AA9 GLY C 46  ? ASP C 72  ? GLY C 46  ASP C 72  1 ? 27 
HELX_P HELX_P10 AB1 ILE C 79  ? ASP C 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P11 AB2 ASP C 90  ? LEU C 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P12 AB3 TYR D 34  ? HIS D 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P13 AB4 SER D 52  ? HIS D 79  ? SER D 52  HIS D 79  1 ? 28 
HELX_P HELX_P14 AB5 THR D 87  ? LEU D 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P15 AB6 GLY D 101 ? SER D 120 ? GLY D 101 SER D 120 1 ? 20 
HELX_P HELX_P16 AB7 GLY E 44  ? SER E 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P17 AB8 ARG E 63  ? GLN E 76  ? ARG E 63  GLN E 76  1 ? 14 
HELX_P HELX_P18 AB9 GLN E 85  ? HIS E 113 ? GLN E 85  HIS E 113 1 ? 29 
HELX_P HELX_P19 AC1 MET E 120 ? ARG E 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P20 AC2 THR F 30  ? GLY F 42  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P21 AC3 LEU F 49  ? HIS F 75  ? LEU F 49  HIS F 75  1 ? 27 
HELX_P HELX_P22 AC4 THR F 82  ? GLN F 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P23 AC5 SER G 18  ? GLY G 22  ? SER G 18  GLY G 22  5 ? 5  
HELX_P HELX_P24 AC6 PRO G 26  ? LYS G 36  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P25 AC7 GLY G 46  ? ASP G 72  ? GLY G 46  ASP G 72  1 ? 27 
HELX_P HELX_P26 AC8 ILE G 79  ? ARG G 88  ? ILE G 79  ARG G 88  1 ? 10 
HELX_P HELX_P27 AC9 ASP G 90  ? LEU G 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P28 AD1 TYR H 34  ? HIS H 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P29 AD2 SER H 52  ? ASN H 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P30 AD3 THR H 87  ? LEU H 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P31 AD4 GLY H 101 ? SER H 120 ? GLY H 101 SER H 120 1 ? 20 
HELX_P HELX_P32 AD5 ASN K 47  ? ARG K 55  ? ASN K 93  ARG K 101 1 ? 9  
HELX_P HELX_P33 AD6 GLY K 60  ? TRP K 71  ? GLY K 106 TRP K 117 1 ? 12 
HELX_P HELX_P34 AD7 SER K 80  ? GLN K 89  ? SER K 126 GLN K 135 1 ? 10 
HELX_P HELX_P35 AD8 THR K 114 ? TYR K 121 ? THR K 160 TYR K 167 1 ? 8  
HELX_P HELX_P36 AD9 ASP K 137 ? LEU K 141 ? ASP K 183 LEU K 187 5 ? 5  
HELX_P HELX_P37 AE1 LEU K 145 ? VAL K 150 ? LEU K 191 VAL K 196 1 ? 6  
HELX_P HELX_P38 AE2 ASN K 152 ? MET K 158 ? ASN K 198 MET K 204 1 ? 7  
HELX_P HELX_P39 AE3 ALA K 170 ? LEU K 174 ? ALA K 216 LEU K 220 5 ? 5  
HELX_P HELX_P40 AE4 TYR K 178 ? VAL K 182 ? TYR K 224 VAL K 228 5 ? 5  
HELX_P HELX_P41 AE5 GLU K 244 ? PHE K 251 ? GLU K 290 PHE K 297 1 ? 8  
HELX_P HELX_P42 AE6 PRO K 252 ? SER K 255 ? PRO K 298 SER K 301 5 ? 4  
HELX_P HELX_P43 AE7 PRO K 258 ? ASN K 275 ? PRO K 304 ASN K 321 1 ? 18 
HELX_P HELX_P44 AE8 THR K 281 ? ILE K 286 ? THR K 327 ILE K 332 1 ? 6  
HELX_P HELX_P45 AE9 PRO K 287 ? ILE K 289 ? PRO K 333 ILE K 335 5 ? 3  
HELX_P HELX_P46 AF1 LEU K 294 ? LYS K 313 ? LEU K 340 LYS K 359 1 ? 20 
HELX_P HELX_P47 AF2 PRO K 331 ? HIS K 335 ? PRO K 377 HIS K 381 5 ? 5  
HELX_P HELX_P48 AF3 GLY K 345 ? GLY K 359 ? GLY K 391 GLY K 405 1 ? 15 
HELX_P HELX_P49 AF4 ASN K 399 ? GLY K 409 ? ASN K 445 GLY K 455 1 ? 11 
HELX_P HELX_P50 AF5 ASP K 430 ? ARG K 452 ? ASP K 476 ARG K 498 1 ? 23 
HELX_P HELX_P51 AF6 LYS K 453 ? LYS K 455 ? LYS K 499 LYS K 501 5 ? 3  
HELX_P HELX_P52 AF7 THR K 456 ? ASP K 460 ? THR K 502 ASP K 506 5 ? 5  
HELX_P HELX_P53 AF8 PRO K 462 ? SER K 478 ? PRO K 508 SER K 524 1 ? 17 
HELX_P HELX_P54 AF9 SER K 483 ? GLY K 502 ? SER K 529 GLY K 548 1 ? 20 
HELX_P HELX_P55 AG1 ASP K 514 ? PHE K 519 ? ASP K 560 PHE K 565 5 ? 6  
HELX_P HELX_P56 AG2 TYR K 533 ? GLU K 542 ? TYR K 579 GLU K 588 1 ? 10 
HELX_P HELX_P57 AG3 PRO K 582 ? GLY K 589 ? PRO K 628 GLY K 635 1 ? 8  
HELX_P HELX_P58 AG4 SER K 598 ? SER K 607 ? SER K 644 SER K 653 1 ? 10 
HELX_P HELX_P59 AG5 TRP K 625 ? GLN K 630 ? TRP K 671 GLN K 676 1 ? 6  
HELX_P HELX_P60 AG6 GLY K 669 ? VAL K 675 ? GLY K 715 VAL K 721 1 ? 7  
HELX_P HELX_P61 AG7 ASP K 679 ? PHE K 695 ? ASP K 725 PHE K 741 1 ? 17 
HELX_P HELX_P62 AG8 ARG K 710 ? ASP K 714 ? ARG K 756 ASP K 760 5 ? 5  
HELX_P HELX_P63 AG9 GLY K 730 ? GLU K 738 ? GLY K 776 GLU K 784 1 ? 9  
HELX_P HELX_P64 AH1 GLY K 748 ? ASN K 752 ? GLY K 794 ASN K 798 5 ? 5  
HELX_P HELX_P65 AH2 THR K 758 ? PHE K 776 ? THR K 804 PHE K 822 1 ? 19 
HELX_P HELX_P66 AH3 HIS L 75  ? SER L 79  ? HIS L 219 SER L 223 5 ? 5  
HELX_P HELX_P67 AH4 ALA M 1   ? GLN M 5   ? ALA M 1   GLN M 5   5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? K CYS 7   SG  ? ? ? 1_555 O ZN .   ZN ? ? K CYS 53  K ZN 902 1_555 ? ? ? ? ? ? ?               2.479 ? 
metalc2   metalc ? ? K CYS 12  SG  ? ? ? 1_555 O ZN .   ZN ? ? K CYS 58  K ZN 902 1_555 ? ? ? ? ? ? ?               2.377 ? 
metalc3   metalc ? ? K CYS 19  SG  ? ? ? 1_555 P ZN .   ZN ? ? K CYS 65  K ZN 903 1_555 ? ? ? ? ? ? ?               2.470 ? 
metalc4   metalc ? ? K CYS 27  SG  ? ? ? 1_555 P ZN .   ZN ? ? K CYS 73  K ZN 903 1_555 ? ? ? ? ? ? ?               2.478 ? 
metalc5   metalc ? ? K HIS 38  ND1 ? ? ? 1_555 O ZN .   ZN ? ? K HIS 84  K ZN 902 1_555 ? ? ? ? ? ? ?               2.386 ? 
metalc6   metalc ? ? K HIS 44  NE2 ? ? ? 1_555 O ZN .   ZN ? ? K HIS 90  K ZN 902 1_555 ? ? ? ? ? ? ?               2.160 ? 
metalc7   metalc ? ? K CYS 46  SG  ? ? ? 1_555 P ZN .   ZN ? ? K CYS 92  K ZN 903 1_555 ? ? ? ? ? ? ?               2.491 ? 
metalc8   metalc ? ? K CYS 49  SG  ? ? ? 1_555 P ZN .   ZN ? ? K CYS 95  K ZN 903 1_555 ? ? ? ? ? ? ?               2.253 ? 
metalc9   metalc ? ? K CYS 96  SG  ? ? ? 1_555 Q ZN .   ZN ? ? K CYS 142 K ZN 904 1_555 ? ? ? ? ? ? ?               2.338 ? 
metalc10  metalc ? ? K CYS 101 SG  ? ? ? 1_555 Q ZN .   ZN ? ? K CYS 147 K ZN 904 1_555 ? ? ? ? ? ? ?               2.312 ? 
metalc11  metalc ? ? K CYS 123 SG  ? ? ? 1_555 Q ZN .   ZN ? ? K CYS 169 K ZN 904 1_555 ? ? ? ? ? ? ?               2.470 ? 
metalc12  metalc ? ? K CYS 139 SG  ? ? ? 1_555 Q ZN .   ZN ? ? K CYS 185 K ZN 904 1_555 ? ? ? ? ? ? ?               2.365 ? 
hydrog1   hydrog ? ? I DA  1   N1  ? ? ? 1_555 J DT 147 N3 ? ? I DA  -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? I DA  1   N6  ? ? ? 1_555 J DT 147 O4 ? ? I DA  -73 J DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? I DT  2   N3  ? ? ? 1_555 J DA 146 N1 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4   hydrog ? ? I DT  2   O4  ? ? ? 1_555 J DA 146 N6 ? ? I DT  -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? I DC  3   N3  ? ? ? 1_555 J DG 145 N1 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? I DC  3   N4  ? ? ? 1_555 J DG 145 O6 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? I DC  3   O2  ? ? ? 1_555 J DG 145 N2 ? ? I DC  -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8   hydrog ? ? I DG  4   N1  ? ? ? 1_555 J DC 144 N3 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? I DG  4   N2  ? ? ? 1_555 J DC 144 O2 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? I DG  4   O6  ? ? ? 1_555 J DC 144 N4 ? ? I DG  -70 J DC 70  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11  hydrog ? ? I DG  5   N1  ? ? ? 1_555 J DC 143 N3 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12  hydrog ? ? I DG  5   N2  ? ? ? 1_555 J DC 143 O2 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13  hydrog ? ? I DG  5   O6  ? ? ? 1_555 J DC 143 N4 ? ? I DG  -69 J DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14  hydrog ? ? I DA  6   N1  ? ? ? 1_555 J DT 142 N3 ? ? I DA  -68 J DT 68  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog15  hydrog ? ? I DA  6   N1  ? ? ? 1_555 J DC 143 N4 ? ? I DA  -68 J DC 69  1_555 ? ? ? ? ? ? 'DA-DC MISPAIR' ?     ? 
hydrog16  hydrog ? ? I DT  7   N3  ? ? ? 1_555 J DA 141 N1 ? ? I DT  -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? I DT  7   O4  ? ? ? 1_555 J DA 141 N6 ? ? I DT  -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? I DG  8   N2  ? ? ? 1_555 J DC 140 O2 ? ? I DG  -66 J DC 66  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog19  hydrog ? ? I DT  9   N3  ? ? ? 1_555 J DA 139 N1 ? ? I DT  -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20  hydrog ? ? I DT  9   O4  ? ? ? 1_555 J DA 139 N6 ? ? I DT  -65 J DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? I DA  10  N1  ? ? ? 1_555 J DT 138 N3 ? ? I DA  -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? I DA  10  N6  ? ? ? 1_555 J DT 138 O4 ? ? I DA  -64 J DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23  hydrog ? ? I DT  11  N3  ? ? ? 1_555 J DA 137 N1 ? ? I DT  -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? I DT  11  O4  ? ? ? 1_555 J DA 137 N6 ? ? I DT  -63 J DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? I DA  12  N1  ? ? ? 1_555 J DT 136 N3 ? ? I DA  -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26  hydrog ? ? I DA  12  N6  ? ? ? 1_555 J DT 136 O4 ? ? I DA  -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog27  hydrog ? ? I DT  13  N3  ? ? ? 1_555 J DA 135 N1 ? ? I DT  -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog28  hydrog ? ? I DT  13  O4  ? ? ? 1_555 J DA 135 N6 ? ? I DT  -61 J DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog29  hydrog ? ? I DA  14  N1  ? ? ? 1_555 J DT 134 N3 ? ? I DA  -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30  hydrog ? ? I DA  14  N6  ? ? ? 1_555 J DT 134 O4 ? ? I DA  -60 J DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31  hydrog ? ? I DT  15  N3  ? ? ? 1_555 J DA 133 N1 ? ? I DT  -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32  hydrog ? ? I DT  15  O4  ? ? ? 1_555 J DA 133 N6 ? ? I DT  -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? I DC  16  N3  ? ? ? 1_555 J DG 132 N1 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? I DC  16  N4  ? ? ? 1_555 J DG 132 O6 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? I DC  16  O2  ? ? ? 1_555 J DG 132 N2 ? ? I DC  -58 J DG 58  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? I DT  17  N3  ? ? ? 1_555 J DA 131 N1 ? ? I DT  -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? I DT  17  O4  ? ? ? 1_555 J DA 131 N6 ? ? I DT  -57 J DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? I DG  18  N1  ? ? ? 1_555 J DC 130 N3 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? I DG  18  N2  ? ? ? 1_555 J DC 130 O2 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? I DG  18  O6  ? ? ? 1_555 J DC 130 N4 ? ? I DG  -56 J DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? I DA  19  N1  ? ? ? 1_555 J DT 129 N3 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? I DA  19  N6  ? ? ? 1_555 J DT 129 O4 ? ? I DA  -55 J DT 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? I DC  20  N3  ? ? ? 1_555 J DG 128 N1 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? I DC  20  N4  ? ? ? 1_555 J DG 128 O6 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? I DC  20  O2  ? ? ? 1_555 J DG 128 N2 ? ? I DC  -54 J DG 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog46  hydrog ? ? I DA  21  N1  ? ? ? 1_555 J DT 127 N3 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog47  hydrog ? ? I DA  21  N6  ? ? ? 1_555 J DT 127 O4 ? ? I DA  -53 J DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog48  hydrog ? ? I DC  22  N3  ? ? ? 1_555 J DG 126 N1 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog49  hydrog ? ? I DC  22  N4  ? ? ? 1_555 J DG 126 O6 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog50  hydrog ? ? I DC  22  O2  ? ? ? 1_555 J DG 126 N2 ? ? I DC  -52 J DG 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog51  hydrog ? ? I DG  23  N1  ? ? ? 1_555 J DC 125 N3 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? I DG  23  N2  ? ? ? 1_555 J DC 125 O2 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? I DG  23  O6  ? ? ? 1_555 J DC 125 N4 ? ? I DG  -51 J DC 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? I DT  24  N3  ? ? ? 1_555 J DA 124 N1 ? ? I DT  -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? I DT  24  O4  ? ? ? 1_555 J DA 124 N6 ? ? I DT  -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? I DG  25  N1  ? ? ? 1_555 J DC 123 N3 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? I DG  25  N2  ? ? ? 1_555 J DC 123 O2 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? I DG  25  O6  ? ? ? 1_555 J DC 123 N4 ? ? I DG  -49 J DC 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? I DC  26  N3  ? ? ? 1_555 J DG 122 N1 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? I DC  26  N4  ? ? ? 1_555 J DG 122 O6 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? I DC  26  O2  ? ? ? 1_555 J DG 122 N2 ? ? I DC  -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? I DC  27  N3  ? ? ? 1_555 J DG 121 N1 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? I DC  27  N4  ? ? ? 1_555 J DG 121 O6 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? I DC  27  O2  ? ? ? 1_555 J DG 121 N2 ? ? I DC  -47 J DG 47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog65  hydrog ? ? I DT  28  N3  ? ? ? 1_555 J DA 120 N1 ? ? I DT  -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? I DT  28  O4  ? ? ? 1_555 J DA 120 N6 ? ? I DT  -46 J DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? I DG  29  N1  ? ? ? 1_555 J DC 119 N3 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? I DG  29  N2  ? ? ? 1_555 J DC 119 O2 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? I DG  29  O6  ? ? ? 1_555 J DC 119 N4 ? ? I DG  -45 J DC 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? I DG  30  N1  ? ? ? 1_555 J DC 118 N3 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog71  hydrog ? ? I DG  30  N2  ? ? ? 1_555 J DC 118 O2 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? I DG  30  O6  ? ? ? 1_555 J DC 118 N4 ? ? I DG  -44 J DC 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? I DA  31  N1  ? ? ? 1_555 J DT 117 N3 ? ? I DA  -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? I DA  31  N6  ? ? ? 1_555 J DT 117 O4 ? ? I DA  -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? I DG  32  N1  ? ? ? 1_555 J DC 116 N3 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog76  hydrog ? ? I DG  32  N2  ? ? ? 1_555 J DC 116 O2 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog77  hydrog ? ? I DG  32  O6  ? ? ? 1_555 J DC 116 N4 ? ? I DG  -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog78  hydrog ? ? I DA  33  N1  ? ? ? 1_555 J DG 114 N1 ? ? I DA  -41 J DG 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog79  hydrog ? ? I DA  33  N6  ? ? ? 1_555 J DG 114 O6 ? ? I DA  -41 J DG 40  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog80  hydrog ? ? I DA  33  N1  ? ? ? 1_555 J DT 115 N3 ? ? I DA  -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? I DA  33  N6  ? ? ? 1_555 J DT 115 O4 ? ? I DA  -41 J DT 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? I DC  34  N3  ? ? ? 1_555 J DG 114 N1 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? I DC  34  N4  ? ? ? 1_555 J DG 114 O6 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? I DC  34  O2  ? ? ? 1_555 J DG 114 N2 ? ? I DC  -40 J DG 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? I DT  35  N3  ? ? ? 1_555 J DA 113 N1 ? ? I DT  -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? I DT  35  O4  ? ? ? 1_555 J DA 113 N6 ? ? I DT  -39 J DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? I DA  36  N1  ? ? ? 1_555 J DT 112 N3 ? ? I DA  -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? I DA  36  N6  ? ? ? 1_555 J DT 112 O4 ? ? I DA  -38 J DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? I DG  37  N1  ? ? ? 1_555 J DC 111 N3 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? I DG  37  N2  ? ? ? 1_555 J DC 111 O2 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? I DG  37  O6  ? ? ? 1_555 J DC 111 N4 ? ? I DG  -37 J DC 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? I DG  38  N1  ? ? ? 1_555 J DC 110 N3 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? I DG  38  N2  ? ? ? 1_555 J DC 110 O2 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? I DG  38  O6  ? ? ? 1_555 J DC 110 N4 ? ? I DG  -36 J DC 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? I DG  39  N1  ? ? ? 1_555 J DC 109 N3 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? I DG  39  N2  ? ? ? 1_555 J DC 109 O2 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? I DG  39  O6  ? ? ? 1_555 J DC 109 N4 ? ? I DG  -35 J DC 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? I DA  40  N1  ? ? ? 1_555 J DT 108 N3 ? ? I DA  -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog99  hydrog ? ? I DA  40  N6  ? ? ? 1_555 J DT 108 O4 ? ? I DA  -34 J DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? I DG  41  N1  ? ? ? 1_555 J DC 107 N3 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? I DG  41  N2  ? ? ? 1_555 J DC 107 O2 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog102 hydrog ? ? I DG  41  O6  ? ? ? 1_555 J DC 107 N4 ? ? I DG  -33 J DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? I DT  42  N3  ? ? ? 1_555 J DA 106 N1 ? ? I DT  -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? I DT  42  O4  ? ? ? 1_555 J DA 106 N6 ? ? I DT  -32 J DA 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? I DA  43  N1  ? ? ? 1_555 J DT 105 N3 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? I DA  43  N6  ? ? ? 1_555 J DT 105 O4 ? ? I DA  -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? I DA  44  N1  ? ? ? 1_555 J DT 104 N3 ? ? I DA  -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? I DA  44  N6  ? ? ? 1_555 J DT 104 O4 ? ? I DA  -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? I DT  45  N3  ? ? ? 1_555 J DA 103 N1 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? I DT  45  O4  ? ? ? 1_555 J DA 103 N6 ? ? I DT  -29 J DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? I DC  46  N3  ? ? ? 1_555 J DG 102 N1 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? I DC  46  N4  ? ? ? 1_555 J DG 102 O6 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? I DC  46  O2  ? ? ? 1_555 J DG 102 N2 ? ? I DC  -28 J DG 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? I DC  47  N3  ? ? ? 1_555 J DG 101 N1 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog115 hydrog ? ? I DC  47  N4  ? ? ? 1_555 J DG 101 O6 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? I DC  47  O2  ? ? ? 1_555 J DG 101 N2 ? ? I DC  -27 J DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? I DC  48  N3  ? ? ? 1_555 J DG 100 N1 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? I DC  48  N4  ? ? ? 1_555 J DG 100 O6 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog119 hydrog ? ? I DC  48  O2  ? ? ? 1_555 J DG 100 N2 ? ? I DC  -26 J DG 26  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog120 hydrog ? ? I DC  49  N3  ? ? ? 1_555 J DG 99  N1 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog121 hydrog ? ? I DC  49  N4  ? ? ? 1_555 J DG 99  O6 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? I DC  49  O2  ? ? ? 1_555 J DG 99  N2 ? ? I DC  -25 J DG 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? I DT  50  N3  ? ? ? 1_555 J DA 98  N1 ? ? I DT  -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? I DT  50  O4  ? ? ? 1_555 J DA 98  N6 ? ? I DT  -24 J DA 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? I DT  51  N3  ? ? ? 1_555 J DA 97  N1 ? ? I DT  -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? I DT  51  O4  ? ? ? 1_555 J DA 97  N6 ? ? I DT  -23 J DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? I DG  52  N1  ? ? ? 1_555 J DC 96  N3 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? I DG  52  N2  ? ? ? 1_555 J DC 96  O2 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? I DG  52  O6  ? ? ? 1_555 J DC 96  N4 ? ? I DG  -22 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? I DG  53  N1  ? ? ? 1_555 J DC 95  N3 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? I DG  53  N2  ? ? ? 1_555 J DC 95  O2 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? I DG  53  O6  ? ? ? 1_555 J DC 95  N4 ? ? I DG  -21 J DC 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? I DG  53  N1  ? ? ? 1_555 J DC 96  N3 ? ? I DG  -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? I DG  53  N2  ? ? ? 1_555 J DC 96  O2 ? ? I DG  -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog135 hydrog ? ? I DG  53  O6  ? ? ? 1_555 J DC 96  N4 ? ? I DG  -21 J DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog136 hydrog ? ? I DC  54  N3  ? ? ? 1_555 J DG 94  N1 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? I DC  54  N4  ? ? ? 1_555 J DG 94  O6 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? I DC  54  O2  ? ? ? 1_555 J DG 94  N2 ? ? I DC  -20 J DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? I DG  55  N1  ? ? ? 1_555 J DC 93  N3 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog140 hydrog ? ? I DG  55  N2  ? ? ? 1_555 J DC 93  O2 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? I DG  55  O6  ? ? ? 1_555 J DC 93  N4 ? ? I DG  -19 J DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? I DG  56  N1  ? ? ? 1_555 J DC 92  N3 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? I DG  56  N2  ? ? ? 1_555 J DC 92  O2 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? I DG  56  O6  ? ? ? 1_555 J DC 92  N4 ? ? I DG  -18 J DC 18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog145 hydrog ? ? I DT  57  N3  ? ? ? 1_555 J DA 91  N1 ? ? I DT  -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? I DT  57  O4  ? ? ? 1_555 J DA 91  N6 ? ? I DT  -17 J DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? I DT  58  N3  ? ? ? 1_555 J DA 90  N1 ? ? I DT  -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? I DT  58  O4  ? ? ? 1_555 J DA 90  N6 ? ? I DT  -16 J DA 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? I DA  59  N1  ? ? ? 1_555 J DT 89  N3 ? ? I DA  -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? I DA  59  N6  ? ? ? 1_555 J DT 89  O4 ? ? I DA  -15 J DT 15  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? I DA  60  N1  ? ? ? 1_555 J DT 88  N3 ? ? I DA  -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? I DA  60  N6  ? ? ? 1_555 J DT 88  O4 ? ? I DA  -14 J DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? I DA  61  N1  ? ? ? 1_555 J DT 87  N3 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? I DA  61  N6  ? ? ? 1_555 J DT 87  O4 ? ? I DA  -13 J DT 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? I DA  62  N1  ? ? ? 1_555 J DT 86  N3 ? ? I DA  -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? I DA  62  N6  ? ? ? 1_555 J DT 86  O4 ? ? I DA  -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog157 hydrog ? ? I DC  63  N3  ? ? ? 1_555 J DG 85  N1 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog158 hydrog ? ? I DC  63  N4  ? ? ? 1_555 J DG 85  O6 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? I DC  63  O2  ? ? ? 1_555 J DG 85  N2 ? ? I DC  -11 J DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? I DG  64  N1  ? ? ? 1_555 J DC 84  N3 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog161 hydrog ? ? I DG  64  N2  ? ? ? 1_555 J DC 84  O2 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? I DG  64  O6  ? ? ? 1_555 J DC 84  N4 ? ? I DG  -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? I DC  65  N3  ? ? ? 1_555 J DG 83  N1 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? I DC  65  N4  ? ? ? 1_555 J DG 83  O6 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog165 hydrog ? ? I DC  65  O2  ? ? ? 1_555 J DG 83  N2 ? ? I DC  -9  J DG 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? I DG  66  N1  ? ? ? 1_555 J DC 82  N3 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? I DG  66  N2  ? ? ? 1_555 J DC 82  O2 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? I DG  66  O6  ? ? ? 1_555 J DC 82  N4 ? ? I DG  -8  J DC 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog169 hydrog ? ? I DG  67  N1  ? ? ? 1_555 J DC 81  N3 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog170 hydrog ? ? I DG  67  N2  ? ? ? 1_555 J DC 81  O2 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog171 hydrog ? ? I DG  67  O6  ? ? ? 1_555 J DC 81  N4 ? ? I DG  -7  J DC 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog172 hydrog ? ? I DG  68  N1  ? ? ? 1_555 J DC 80  N3 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog173 hydrog ? ? I DG  68  N2  ? ? ? 1_555 J DC 80  O2 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog174 hydrog ? ? I DG  68  O6  ? ? ? 1_555 J DC 80  N4 ? ? I DG  -6  J DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog175 hydrog ? ? I DG  69  N1  ? ? ? 1_555 J DC 79  N3 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? I DG  69  N2  ? ? ? 1_555 J DC 79  O2 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? I DG  69  O6  ? ? ? 1_555 J DC 79  N4 ? ? I DG  -5  J DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? I DG  70  N1  ? ? ? 1_555 J DC 78  N3 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? I DG  70  N2  ? ? ? 1_555 J DC 78  O2 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? I DG  70  O6  ? ? ? 1_555 J DC 78  N4 ? ? I DG  -4  J DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog181 hydrog ? ? I DA  71  N1  ? ? ? 1_555 J DT 77  N3 ? ? I DA  -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog182 hydrog ? ? I DA  71  N6  ? ? ? 1_555 J DT 77  O4 ? ? I DA  -3  J DT 3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? I DC  72  N3  ? ? ? 1_555 J DG 76  N1 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? I DC  72  N4  ? ? ? 1_555 J DG 76  O6 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? I DC  72  O2  ? ? ? 1_555 J DG 76  N2 ? ? I DC  -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog186 hydrog ? ? I DA  73  N1  ? ? ? 1_555 J DT 75  N3 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? I DA  73  N6  ? ? ? 1_555 J DT 75  O4 ? ? I DA  -1  J DT 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? I DG  74  N1  ? ? ? 1_555 J DC 74  N3 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? I DG  74  N2  ? ? ? 1_555 J DC 74  O2 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog190 hydrog ? ? I DG  74  O6  ? ? ? 1_555 J DC 74  N4 ? ? I DG  0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog191 hydrog ? ? I DC  75  N3  ? ? ? 1_555 J DG 73  N1 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? I DC  75  N4  ? ? ? 1_555 J DG 73  O6 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? I DC  75  O2  ? ? ? 1_555 J DG 73  N2 ? ? I DC  1   J DG -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? I DG  76  N1  ? ? ? 1_555 J DC 72  N3 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog195 hydrog ? ? I DG  76  N2  ? ? ? 1_555 J DC 72  O2 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? I DG  76  O6  ? ? ? 1_555 J DC 72  N4 ? ? I DG  2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? I DC  77  N3  ? ? ? 1_555 J DG 71  N1 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? I DC  77  N4  ? ? ? 1_555 J DG 71  O6 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? I DC  77  O2  ? ? ? 1_555 J DG 71  N2 ? ? I DC  3   J DG -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? I DG  78  N1  ? ? ? 1_555 J DC 70  N3 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog201 hydrog ? ? I DG  78  N2  ? ? ? 1_555 J DC 70  O2 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? I DG  78  O6  ? ? ? 1_555 J DC 70  N4 ? ? I DG  4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? I DT  79  N3  ? ? ? 1_555 J DA 69  N1 ? ? I DT  5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? I DT  79  O4  ? ? ? 1_555 J DA 69  N6 ? ? I DT  5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? I DA  80  N1  ? ? ? 1_555 J DT 68  N3 ? ? I DA  6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? I DA  80  N6  ? ? ? 1_555 J DT 68  O4 ? ? I DA  6   J DT -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? I DC  81  N3  ? ? ? 1_555 J DG 67  N1 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog208 hydrog ? ? I DC  81  N4  ? ? ? 1_555 J DG 67  O6 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? I DC  81  O2  ? ? ? 1_555 J DG 67  N2 ? ? I DC  7   J DG -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? I DG  82  N1  ? ? ? 1_555 J DC 66  N3 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? I DG  82  N2  ? ? ? 1_555 J DC 66  O2 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? I DG  82  O6  ? ? ? 1_555 J DC 66  N4 ? ? I DG  8   J DC -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? I DT  83  N3  ? ? ? 1_555 J DA 65  N1 ? ? I DT  9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog214 hydrog ? ? I DT  83  O4  ? ? ? 1_555 J DA 65  N6 ? ? I DT  9   J DA -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog215 hydrog ? ? I DG  84  N1  ? ? ? 1_555 J DC 64  N3 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? I DG  84  N2  ? ? ? 1_555 J DC 64  O2 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? I DG  84  O6  ? ? ? 1_555 J DC 64  N4 ? ? I DG  10  J DC -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? I DC  85  N3  ? ? ? 1_555 J DG 63  N1 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? I DC  85  N4  ? ? ? 1_555 J DG 63  O6 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? I DC  85  O2  ? ? ? 1_555 J DG 63  N2 ? ? I DC  11  J DG -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? I DG  86  N1  ? ? ? 1_555 J DC 62  N3 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? I DG  86  N2  ? ? ? 1_555 J DC 62  O2 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? I DG  86  O6  ? ? ? 1_555 J DC 62  N4 ? ? I DG  12  J DC -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? I DT  87  N3  ? ? ? 1_555 J DA 61  N1 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog225 hydrog ? ? I DT  87  O4  ? ? ? 1_555 J DA 61  N6 ? ? I DT  13  J DA -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? I DT  88  N3  ? ? ? 1_555 J DA 60  N1 ? ? I DT  14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? I DT  88  O4  ? ? ? 1_555 J DA 60  N6 ? ? I DT  14  J DA -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? I DT  89  N3  ? ? ? 1_555 J DA 59  N1 ? ? I DT  15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? I DT  89  O4  ? ? ? 1_555 J DA 59  N6 ? ? I DT  15  J DA -15 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? I DA  90  N1  ? ? ? 1_555 J DT 58  N3 ? ? I DA  16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog231 hydrog ? ? I DA  90  N6  ? ? ? 1_555 J DT 58  O4 ? ? I DA  16  J DT -16 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog232 hydrog ? ? I DA  91  N1  ? ? ? 1_555 J DT 57  N3 ? ? I DA  17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog233 hydrog ? ? I DA  91  N6  ? ? ? 1_555 J DT 57  O4 ? ? I DA  17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? I DG  92  N1  ? ? ? 1_555 J DC 56  N3 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? I DG  92  N2  ? ? ? 1_555 J DC 56  O2 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog236 hydrog ? ? I DG  92  O6  ? ? ? 1_555 J DC 56  N4 ? ? I DG  18  J DC -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? I DC  93  N3  ? ? ? 1_555 J DG 55  N1 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? I DC  93  N4  ? ? ? 1_555 J DG 55  O6 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? I DC  93  O2  ? ? ? 1_555 J DG 55  N2 ? ? I DC  19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog240 hydrog ? ? I DG  94  N1  ? ? ? 1_555 J DC 54  N3 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog241 hydrog ? ? I DG  94  N2  ? ? ? 1_555 J DC 54  O2 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog242 hydrog ? ? I DG  94  O6  ? ? ? 1_555 J DC 54  N4 ? ? I DG  20  J DC -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? I DG  95  N1  ? ? ? 1_555 J DC 53  N3 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? I DG  95  N2  ? ? ? 1_555 J DC 53  O2 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? I DG  95  O6  ? ? ? 1_555 J DC 53  N4 ? ? I DG  21  J DC -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? I DT  96  N3  ? ? ? 1_555 J DA 52  N1 ? ? I DT  22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? I DT  96  O4  ? ? ? 1_555 J DA 52  N6 ? ? I DT  22  J DA -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? I DG  97  N1  ? ? ? 1_555 J DC 51  N3 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog249 hydrog ? ? I DG  97  N2  ? ? ? 1_555 J DC 51  O2 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog250 hydrog ? ? I DG  97  O6  ? ? ? 1_555 J DC 51  N4 ? ? I DG  23  J DC -23 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog251 hydrog ? ? I DC  98  N3  ? ? ? 1_555 J DG 50  N1 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? I DC  98  N4  ? ? ? 1_555 J DG 50  O6 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? I DC  98  O2  ? ? ? 1_555 J DG 50  N2 ? ? I DC  24  J DG -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? I DT  99  N3  ? ? ? 1_555 J DA 49  N1 ? ? I DT  25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog255 hydrog ? ? I DT  99  O4  ? ? ? 1_555 J DA 49  N6 ? ? I DT  25  J DA -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog256 hydrog ? ? I DA  100 N1  ? ? ? 1_555 J DT 48  N3 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog257 hydrog ? ? I DA  100 N6  ? ? ? 1_555 J DT 48  O4 ? ? I DA  26  J DT -26 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog258 hydrog ? ? I DG  101 N1  ? ? ? 1_555 J DC 47  N3 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog259 hydrog ? ? I DG  101 N2  ? ? ? 1_555 J DC 47  O2 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog260 hydrog ? ? I DG  101 O6  ? ? ? 1_555 J DC 47  N4 ? ? I DG  27  J DC -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog261 hydrog ? ? I DA  102 N1  ? ? ? 1_555 J DT 46  N3 ? ? I DA  28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog262 hydrog ? ? I DA  102 N6  ? ? ? 1_555 J DT 46  O4 ? ? I DA  28  J DT -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog263 hydrog ? ? I DG  103 N1  ? ? ? 1_555 J DC 45  N3 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog264 hydrog ? ? I DG  103 N2  ? ? ? 1_555 J DC 45  O2 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog265 hydrog ? ? I DG  103 O6  ? ? ? 1_555 J DC 45  N4 ? ? I DG  29  J DC -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog266 hydrog ? ? I DC  104 N3  ? ? ? 1_555 J DG 44  N1 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog267 hydrog ? ? I DC  104 N4  ? ? ? 1_555 J DG 44  O6 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog268 hydrog ? ? I DC  104 O2  ? ? ? 1_555 J DG 44  N2 ? ? I DC  30  J DG -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog269 hydrog ? ? I DT  105 N3  ? ? ? 1_555 J DA 43  N1 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog270 hydrog ? ? I DT  105 O4  ? ? ? 1_555 J DA 43  N6 ? ? I DT  31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog271 hydrog ? ? I DG  106 N1  ? ? ? 1_555 J DC 42  N3 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog272 hydrog ? ? I DG  106 N2  ? ? ? 1_555 J DC 42  O2 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog273 hydrog ? ? I DG  106 O6  ? ? ? 1_555 J DC 42  N4 ? ? I DG  32  J DC -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog274 hydrog ? ? I DT  107 N3  ? ? ? 1_555 J DA 41  N1 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog275 hydrog ? ? I DT  107 O4  ? ? ? 1_555 J DA 41  N6 ? ? I DT  33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog276 hydrog ? ? I DC  108 N3  ? ? ? 1_555 J DG 40  N1 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog277 hydrog ? ? I DC  108 N4  ? ? ? 1_555 J DG 40  O6 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog278 hydrog ? ? I DC  108 O2  ? ? ? 1_555 J DG 40  N2 ? ? I DC  34  J DG -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog279 hydrog ? ? I DT  109 N3  ? ? ? 1_555 J DA 39  N1 ? ? I DT  35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog280 hydrog ? ? I DT  109 O4  ? ? ? 1_555 J DA 39  N6 ? ? I DT  35  J DA -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog281 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DG 37  N1 ? ? I DA  36  J DG -37 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog282 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DG 37  O6 ? ? I DA  36  J DG -37 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog283 hydrog ? ? I DA  110 N1  ? ? ? 1_555 J DT 38  N3 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog284 hydrog ? ? I DA  110 N6  ? ? ? 1_555 J DT 38  O4 ? ? I DA  36  J DT -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog285 hydrog ? ? I DC  111 N3  ? ? ? 1_555 J DG 37  N1 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog286 hydrog ? ? I DC  111 N4  ? ? ? 1_555 J DG 37  O6 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog287 hydrog ? ? I DC  111 O2  ? ? ? 1_555 J DG 37  N2 ? ? I DC  37  J DG -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog288 hydrog ? ? I DG  112 N1  ? ? ? 1_555 J DC 36  N3 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog289 hydrog ? ? I DG  112 N2  ? ? ? 1_555 J DC 36  O2 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog290 hydrog ? ? I DG  112 O6  ? ? ? 1_555 J DC 36  N4 ? ? I DG  38  J DC -38 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog291 hydrog ? ? I DA  113 N1  ? ? ? 1_555 J DG 34  N1 ? ? I DA  39  J DG -40 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog292 hydrog ? ? I DA  113 N6  ? ? ? 1_555 J DG 34  O6 ? ? I DA  39  J DG -40 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog293 hydrog ? ? I DA  113 N1  ? ? ? 1_555 J DT 35  N3 ? ? I DA  39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog294 hydrog ? ? I DA  113 N6  ? ? ? 1_555 J DT 35  O4 ? ? I DA  39  J DT -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog295 hydrog ? ? I DC  114 N3  ? ? ? 1_555 J DG 34  N1 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog296 hydrog ? ? I DC  114 N4  ? ? ? 1_555 J DG 34  O6 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog297 hydrog ? ? I DC  114 O2  ? ? ? 1_555 J DG 34  N2 ? ? I DC  40  J DG -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog298 hydrog ? ? I DC  115 N3  ? ? ? 1_555 J DG 33  N1 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog299 hydrog ? ? I DC  115 N4  ? ? ? 1_555 J DG 33  O6 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog300 hydrog ? ? I DC  115 O2  ? ? ? 1_555 J DG 33  N2 ? ? I DC  41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog301 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J DT 31  N3 ? ? I DA  42  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog302 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J DT 31  O4 ? ? I DA  42  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog303 hydrog ? ? I DA  116 N1  ? ? ? 1_555 J DT 32  N3 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog304 hydrog ? ? I DA  116 N6  ? ? ? 1_555 J DT 32  O4 ? ? I DA  42  J DT -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog305 hydrog ? ? I DA  117 N1  ? ? ? 1_555 J DT 31  N3 ? ? I DA  43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog306 hydrog ? ? I DA  117 N6  ? ? ? 1_555 J DT 31  O4 ? ? I DA  43  J DT -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog307 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA 29  N1 ? ? I DT  44  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog308 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA 29  N6 ? ? I DT  44  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog309 hydrog ? ? I DT  118 N3  ? ? ? 1_555 J DA 30  N1 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog310 hydrog ? ? I DT  118 O4  ? ? ? 1_555 J DA 30  N6 ? ? I DT  44  J DA -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog311 hydrog ? ? I DT  119 N3  ? ? ? 1_555 J DA 29  N1 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog312 hydrog ? ? I DT  119 O4  ? ? ? 1_555 J DA 29  N6 ? ? I DT  45  J DA -45 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog313 hydrog ? ? I DG  120 N1  ? ? ? 1_555 J DC 28  N3 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog314 hydrog ? ? I DG  120 N2  ? ? ? 1_555 J DC 28  O2 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog315 hydrog ? ? I DG  120 O6  ? ? ? 1_555 J DC 28  N4 ? ? I DG  46  J DC -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog316 hydrog ? ? I DA  121 N1  ? ? ? 1_555 J DT 27  N3 ? ? I DA  47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog317 hydrog ? ? I DA  121 N6  ? ? ? 1_555 J DT 27  O4 ? ? I DA  47  J DT -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog318 hydrog ? ? I DG  122 N1  ? ? ? 1_555 J DC 26  N3 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog319 hydrog ? ? I DG  122 N2  ? ? ? 1_555 J DC 26  O2 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog320 hydrog ? ? I DG  122 O6  ? ? ? 1_555 J DC 26  N4 ? ? I DG  48  J DC -48 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog321 hydrog ? ? I DC  123 N3  ? ? ? 1_555 J DG 25  N1 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog322 hydrog ? ? I DC  123 N4  ? ? ? 1_555 J DG 25  O6 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog323 hydrog ? ? I DC  123 O2  ? ? ? 1_555 J DG 25  N2 ? ? I DC  49  J DG -49 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog324 hydrog ? ? I DG  124 N1  ? ? ? 1_555 J DC 24  N3 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog325 hydrog ? ? I DG  124 N2  ? ? ? 1_555 J DC 24  O2 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog326 hydrog ? ? I DG  124 O6  ? ? ? 1_555 J DC 24  N4 ? ? I DG  50  J DC -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog327 hydrog ? ? I DG  125 N1  ? ? ? 1_555 J DC 23  N3 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog328 hydrog ? ? I DG  125 N2  ? ? ? 1_555 J DC 23  O2 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog329 hydrog ? ? I DG  125 O6  ? ? ? 1_555 J DC 23  N4 ? ? I DG  51  J DC -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog330 hydrog ? ? I DC  126 N3  ? ? ? 1_555 J DG 22  N1 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog331 hydrog ? ? I DC  126 N4  ? ? ? 1_555 J DG 22  O6 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog332 hydrog ? ? I DC  126 O2  ? ? ? 1_555 J DG 22  N2 ? ? I DC  52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog333 hydrog ? ? I DC  127 N3  ? ? ? 1_555 J DG 21  N1 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog334 hydrog ? ? I DC  127 N4  ? ? ? 1_555 J DG 21  O6 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog335 hydrog ? ? I DC  127 O2  ? ? ? 1_555 J DG 21  N2 ? ? I DC  53  J DG -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog336 hydrog ? ? I DT  128 N3  ? ? ? 1_555 J DA 20  N1 ? ? I DT  54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog337 hydrog ? ? I DT  128 O4  ? ? ? 1_555 J DA 20  N6 ? ? I DT  54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog338 hydrog ? ? I DC  129 N3  ? ? ? 1_555 J DG 19  N1 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog339 hydrog ? ? I DC  129 N4  ? ? ? 1_555 J DG 19  O6 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog340 hydrog ? ? I DC  129 O2  ? ? ? 1_555 J DG 19  N2 ? ? I DC  55  J DG -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog341 hydrog ? ? I DG  130 N1  ? ? ? 1_555 J DC 18  N3 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog342 hydrog ? ? I DG  130 N2  ? ? ? 1_555 J DC 18  O2 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog343 hydrog ? ? I DG  130 O6  ? ? ? 1_555 J DC 18  N4 ? ? I DG  56  J DC -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog344 hydrog ? ? I DG  131 N1  ? ? ? 1_555 J DC 17  N3 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog345 hydrog ? ? I DG  131 N2  ? ? ? 1_555 J DC 17  O2 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog346 hydrog ? ? I DG  131 O6  ? ? ? 1_555 J DC 17  N4 ? ? I DG  57  J DC -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog347 hydrog ? ? I DC  132 N3  ? ? ? 1_555 J DG 16  N1 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog348 hydrog ? ? I DC  132 N4  ? ? ? 1_555 J DG 16  O6 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog349 hydrog ? ? I DC  132 O2  ? ? ? 1_555 J DG 16  N2 ? ? I DC  58  J DG -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog350 hydrog ? ? I DA  133 N1  ? ? ? 1_555 J DT 15  N3 ? ? I DA  59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog351 hydrog ? ? I DA  133 N6  ? ? ? 1_555 J DT 15  O4 ? ? I DA  59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog352 hydrog ? ? I DC  134 N3  ? ? ? 1_555 J DG 14  N1 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog353 hydrog ? ? I DC  134 N4  ? ? ? 1_555 J DG 14  O6 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog354 hydrog ? ? I DC  134 O2  ? ? ? 1_555 J DG 14  N2 ? ? I DC  60  J DG -60 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog355 hydrog ? ? I DC  135 N3  ? ? ? 1_555 J DG 13  N1 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog356 hydrog ? ? I DC  135 N4  ? ? ? 1_555 J DG 13  O6 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog357 hydrog ? ? I DC  135 O2  ? ? ? 1_555 J DG 13  N2 ? ? I DC  61  J DG -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog358 hydrog ? ? I DG  136 N1  ? ? ? 1_555 J DC 12  N3 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog359 hydrog ? ? I DG  136 N2  ? ? ? 1_555 J DC 12  O2 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog360 hydrog ? ? I DG  136 O6  ? ? ? 1_555 J DC 12  N4 ? ? I DG  62  J DC -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog361 hydrog ? ? I DG  137 N1  ? ? ? 1_555 J DC 11  N3 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog362 hydrog ? ? I DG  137 N2  ? ? ? 1_555 J DC 11  O2 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog363 hydrog ? ? I DG  137 O6  ? ? ? 1_555 J DC 11  N4 ? ? I DG  63  J DC -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog364 hydrog ? ? I DG  138 N1  ? ? ? 1_555 J DC 10  N3 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog365 hydrog ? ? I DG  138 N2  ? ? ? 1_555 J DC 10  O2 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog366 hydrog ? ? I DG  138 O6  ? ? ? 1_555 J DC 10  N4 ? ? I DG  64  J DC -64 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog367 hydrog ? ? I DA  139 N1  ? ? ? 1_555 J DT 9   N3 ? ? I DA  65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog368 hydrog ? ? I DA  139 N6  ? ? ? 1_555 J DT 9   O4 ? ? I DA  65  J DT -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog369 hydrog ? ? I DT  140 N3  ? ? ? 1_555 J DA 8   N1 ? ? I DT  66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog370 hydrog ? ? I DT  140 O4  ? ? ? 1_555 J DA 8   N6 ? ? I DT  66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog371 hydrog ? ? I DT  141 N3  ? ? ? 1_555 J DA 7   N1 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog372 hydrog ? ? I DT  141 O4  ? ? ? 1_555 J DA 7   N6 ? ? I DT  67  J DA -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog373 hydrog ? ? I DC  142 N3  ? ? ? 1_555 J DG 6   N1 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog374 hydrog ? ? I DC  142 N4  ? ? ? 1_555 J DG 6   O6 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog375 hydrog ? ? I DC  142 O2  ? ? ? 1_555 J DG 6   N2 ? ? I DC  68  J DG -68 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog376 hydrog ? ? I DT  143 N3  ? ? ? 1_555 J DA 5   N1 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog377 hydrog ? ? I DT  143 O4  ? ? ? 1_555 J DA 5   N6 ? ? I DT  69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog378 hydrog ? ? I DC  144 N3  ? ? ? 1_555 J DG 4   N1 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog379 hydrog ? ? I DC  144 N4  ? ? ? 1_555 J DG 4   O6 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog380 hydrog ? ? I DC  144 O2  ? ? ? 1_555 J DG 4   N2 ? ? I DC  70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog381 hydrog ? ? I DG  145 N1  ? ? ? 1_555 J DC 3   N3 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog382 hydrog ? ? I DG  145 N2  ? ? ? 1_555 J DC 3   O2 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog383 hydrog ? ? I DG  145 O6  ? ? ? 1_555 J DC 3   N4 ? ? I DG  71  J DC -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog384 hydrog ? ? I DA  146 N1  ? ? ? 1_555 J DT 2   N3 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog385 hydrog ? ? I DA  146 N6  ? ? ? 1_555 J DT 2   O4 ? ? I DA  72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog386 hydrog ? ? I DT  147 N3  ? ? ? 1_555 J DA 1   N1 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog387 hydrog ? ? I DT  147 O4  ? ? ? 1_555 J DA 1   N6 ? ? I DT  73  J DA -73 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 424 K . ? GLU 470 K GLY 425 K ? GLY 471 K 1 1.16  
2 ASN 594 K . ? ASN 640 K PRO 595 K ? PRO 641 K 1 -1.30 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 2 ? 
AB4 ? 3 ? 
AB5 ? 6 ? 
AB6 ? 4 ? 
AB7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB2 3 4 ? parallel      
AB2 4 5 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? parallel      
AB7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 THR A 118 ? ILE A 119 ? THR A 118 ILE A 119 
AA1 2 ARG B 45  ? ILE B 46  ? ARG B 45  ILE B 46  
AA2 1 THR B 96  ? TYR B 98  ? THR B 96  TYR B 98  
AA2 2 VAL G 100 ? ILE G 102 ? VAL G 100 ILE G 102 
AA3 1 ARG C 42  ? VAL C 43  ? ARG C 42  VAL C 43  
AA3 2 THR D 85  ? ILE D 86  ? THR D 85  ILE D 86  
AA4 1 VAL C 100 ? THR C 101 ? VAL C 100 THR C 101 
AA4 2 THR F 96  ? LEU F 97  ? THR F 96  LEU F 97  
AA5 1 ARG E 83  ? PHE E 84  ? ARG E 83  PHE E 84  
AA5 2 THR F 80  ? VAL F 81  ? THR F 80  VAL F 81  
AA6 1 THR E 118 ? ILE E 119 ? THR E 118 ILE E 119 
AA6 2 ARG F 45  ? ILE F 46  ? ARG F 45  ILE F 46  
AA7 1 ARG G 42  ? VAL G 43  ? ARG G 42  VAL G 43  
AA7 2 THR H 85  ? ILE H 86  ? THR H 85  ILE H 86  
AA8 1 ARG G 77  ? ILE G 78  ? ARG G 77  ILE G 78  
AA8 2 GLY H 50  ? ILE H 51  ? GLY H 50  ILE H 51  
AA9 1 TRP K 36  ? SER K 40  ? TRP K 82  SER K 86  
AA9 2 GLU K 43  ? CYS K 46  ? GLU K 89  CYS K 92  
AB1 1 TRP K 93  ? GLN K 95  ? TRP K 139 GLN K 141 
AB1 2 TRP K 104 ? GLN K 106 ? TRP K 150 GLN K 152 
AB2 1 ILE K 546 ? GLN K 547 ? ILE K 592 GLN K 593 
AB2 2 LYS K 361 ? LEU K 365 ? LYS K 407 LEU K 411 
AB2 3 SER K 338 ? ILE K 342 ? SER K 384 ILE K 388 
AB2 4 LYS K 576 ? VAL K 579 ? LYS K 622 VAL K 625 
AB2 5 VAL K 744 ? PHE K 746 ? VAL K 790 PHE K 792 
AB3 1 ASP K 377 ? ASP K 378 ? ASP K 423 ASP K 424 
AB3 2 VAL K 386 ? GLY K 387 ? VAL K 432 GLY K 433 
AB4 1 ILE K 392 ? ASN K 394 ? ILE K 438 ASN K 440 
AB4 2 HIS K 526 ? LEU K 528 ? HIS K 572 LEU K 574 
AB4 3 HIS K 413 ? LYS K 414 ? HIS K 459 LYS K 460 
AB5 1 LEU K 421 ? ILE K 422 ? LEU K 467 ILE K 468 
AB5 2 PHE K 634 ? HIS K 637 ? PHE K 680 HIS K 683 
AB5 3 LEU K 647 ? ASP K 653 ? LEU K 693 ASP K 699 
AB5 4 VAL K 662 ? ILE K 667 ? VAL K 708 ILE K 713 
AB5 5 GLU K 614 ? GLN K 619 ? GLU K 660 GLN K 665 
AB5 6 LYS K 705 ? VAL K 708 ? LYS K 751 VAL K 754 
AB6 1 GLY K 571 ? ALA K 574 ? GLY K 617 ALA K 620 
AB6 2 VAL K 562 ? THR K 566 ? VAL K 608 THR K 612 
AB6 3 VAL K 552 ? ASP K 556 ? VAL K 598 ASP K 602 
AB6 4 GLN K 592 ? ASN K 594 ? GLN K 638 ASN K 640 
AB7 1 LEU K 608 ? GLY K 611 ? LEU K 654 GLY K 657 
AB7 2 TYR K 721 ? VAL K 724 ? TYR K 767 VAL K 770 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 119 ? N ILE A 119 O ARG B 45  ? O ARG B 45  
AA2 1 2 N THR B 96  ? N THR B 96  O THR G 101 ? O THR G 101 
AA3 1 2 N ARG C 42  ? N ARG C 42  O ILE D 86  ? O ILE D 86  
AA4 1 2 N THR C 101 ? N THR C 101 O THR F 96  ? O THR F 96  
AA5 1 2 N ARG E 83  ? N ARG E 83  O VAL F 81  ? O VAL F 81  
AA6 1 2 N ILE E 119 ? N ILE E 119 O ARG F 45  ? O ARG F 45  
AA7 1 2 N ARG G 42  ? N ARG G 42  O ILE H 86  ? O ILE H 86  
AA8 1 2 N ILE G 78  ? N ILE G 78  O GLY H 50  ? O GLY H 50  
AA9 1 2 N TYR K 37  ? N TYR K 83  O PHE K 45  ? O PHE K 91  
AB1 1 2 N VAL K 94  ? N VAL K 140 O ARG K 105 ? O ARG K 151 
AB2 1 2 O GLN K 547 ? O GLN K 593 N VAL K 364 ? N VAL K 410 
AB2 2 3 O LEU K 365 ? O LEU K 411 N ILE K 341 ? N ILE K 387 
AB2 3 4 N ILE K 342 ? N ILE K 388 O LEU K 578 ? O LEU K 624 
AB2 4 5 N VAL K 579 ? N VAL K 625 O PHE K 745 ? O PHE K 791 
AB3 1 2 N ASP K 378 ? N ASP K 424 O VAL K 386 ? O VAL K 432 
AB4 1 2 N VAL K 393 ? N VAL K 439 O THR K 527 ? O THR K 573 
AB4 2 3 O LEU K 528 ? O LEU K 574 N HIS K 413 ? N HIS K 459 
AB5 1 2 N ILE K 422 ? N ILE K 468 O GLY K 636 ? O GLY K 682 
AB5 2 3 N PHE K 635 ? N PHE K 681 O PHE K 651 ? O PHE K 697 
AB5 3 4 N TYR K 652 ? N TYR K 698 O MET K 664 ? O MET K 710 
AB5 4 5 O LEU K 663 ? O LEU K 709 N LEU K 618 ? N LEU K 664 
AB5 5 6 N GLN K 619 ? N GLN K 665 O LYS K 705 ? O LYS K 751 
AB6 1 2 O TYR K 572 ? O TYR K 618 N VAL K 564 ? N VAL K 610 
AB6 2 3 O GLN K 563 ? O GLN K 609 N ASP K 556 ? N ASP K 602 
AB6 3 4 N GLN K 553 ? N GLN K 599 O GLN K 592 ? O GLN K 638 
AB7 1 2 N GLY K 609 ? N GLY K 655 O PHE K 723 ? O PHE K 769 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software K FAD 901 ? 27 'binding site for residue FAD K 901' 
AC2 Software K ZN  902 ? 4  'binding site for residue ZN K 902'  
AC3 Software K ZN  903 ? 4  'binding site for residue ZN K 903'  
AC4 Software K ZN  904 ? 4  'binding site for residue ZN K 904'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 27 ILE K 342 ? ILE K 388 . ? 1_555 ? 
2  AC1 27 GLY K 343 ? GLY K 389 . ? 1_555 ? 
3  AC1 27 GLY K 345 ? GLY K 391 . ? 1_555 ? 
4  AC1 27 PRO K 346 ? PRO K 392 . ? 1_555 ? 
5  AC1 27 ALA K 347 ? ALA K 393 . ? 1_555 ? 
6  AC1 27 LEU K 365 ? LEU K 411 . ? 1_555 ? 
7  AC1 27 GLU K 366 ? GLU K 412 . ? 1_555 ? 
8  AC1 27 ALA K 367 ? ALA K 413 . ? 1_555 ? 
9  AC1 27 LYS K 368 ? LYS K 414 . ? 1_555 ? 
10 AC1 27 GLY K 373 ? GLY K 419 . ? 1_555 ? 
11 AC1 27 ARG K 374 ? ARG K 420 . ? 1_555 ? 
12 AC1 27 ARG K 388 ? ARG K 434 . ? 1_555 ? 
13 AC1 27 GLY K 389 ? GLY K 435 . ? 1_555 ? 
14 AC1 27 ALA K 390 ? ALA K 436 . ? 1_555 ? 
15 AC1 27 ILE K 392 ? ILE K 438 . ? 1_555 ? 
16 AC1 27 VAL K 552 ? VAL K 598 . ? 1_555 ? 
17 AC1 27 VAL K 581 ? VAL K 627 . ? 1_555 ? 
18 AC1 27 PRO K 582 ? PRO K 628 . ? 1_555 ? 
19 AC1 27 TRP K 711 ? TRP K 757 . ? 1_555 ? 
20 AC1 27 TRP K 716 ? TRP K 762 . ? 1_555 ? 
21 AC1 27 ALA K 720 ? ALA K 766 . ? 1_555 ? 
22 AC1 27 GLY K 748 ? GLY K 794 . ? 1_555 ? 
23 AC1 27 GLU K 749 ? GLU K 795 . ? 1_555 ? 
24 AC1 27 GLN K 757 ? GLN K 803 . ? 1_555 ? 
25 AC1 27 THR K 758 ? THR K 804 . ? 1_555 ? 
26 AC1 27 VAL K 759 ? VAL K 805 . ? 1_555 ? 
27 AC1 27 ALA K 762 ? ALA K 808 . ? 1_555 ? 
28 AC2 4  CYS K 7   ? CYS K 53  . ? 1_555 ? 
29 AC2 4  CYS K 12  ? CYS K 58  . ? 1_555 ? 
30 AC2 4  HIS K 38  ? HIS K 84  . ? 1_555 ? 
31 AC2 4  HIS K 44  ? HIS K 90  . ? 1_555 ? 
32 AC3 4  CYS K 19  ? CYS K 65  . ? 1_555 ? 
33 AC3 4  CYS K 27  ? CYS K 73  . ? 1_555 ? 
34 AC3 4  CYS K 46  ? CYS K 92  . ? 1_555 ? 
35 AC3 4  CYS K 49  ? CYS K 95  . ? 1_555 ? 
36 AC4 4  CYS K 96  ? CYS K 142 . ? 1_555 ? 
37 AC4 4  CYS K 101 ? CYS K 147 . ? 1_555 ? 
38 AC4 4  CYS K 123 ? CYS K 169 . ? 1_555 ? 
39 AC4 4  CYS K 139 ? CYS K 185 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6R1U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . LYS A 1  37  ? 117.110 144.900 196.950 1.00 119.19 ? 37  LYS A N     1 
ATOM   2     C  CA    . LYS A 1  37  ? 117.031 146.313 196.490 1.00 119.19 ? 37  LYS A CA    1 
ATOM   3     C  C     . LYS A 1  37  ? 118.025 146.525 195.341 1.00 119.19 ? 37  LYS A C     1 
ATOM   4     O  O     . LYS A 1  37  ? 119.032 147.228 195.554 1.00 119.19 ? 37  LYS A O     1 
ATOM   5     C  CB    . LYS A 1  37  ? 117.321 147.270 197.650 1.00 119.19 ? 37  LYS A CB    1 
ATOM   6     C  CG    . LYS A 1  37  ? 116.277 147.283 198.760 1.00 119.19 ? 37  LYS A CG    1 
ATOM   7     C  CD    . LYS A 1  37  ? 116.617 148.226 199.895 1.00 119.19 ? 37  LYS A CD    1 
ATOM   8     C  CE    . LYS A 1  37  ? 115.565 148.253 200.982 1.00 119.19 ? 37  LYS A CE    1 
ATOM   9     N  NZ    . LYS A 1  37  ? 115.939 149.165 202.088 1.00 119.19 ? 37  LYS A NZ    1 
ATOM   10    N  N     . PRO A 1  38  ? 117.786 145.952 194.141 1.00 120.46 ? 38  PRO A N     1 
ATOM   11    C  CA    . PRO A 1  38  ? 118.697 146.121 193.002 1.00 120.46 ? 38  PRO A CA    1 
ATOM   12    C  C     . PRO A 1  38  ? 118.988 147.606 192.739 1.00 120.46 ? 38  PRO A C     1 
ATOM   13    O  O     . PRO A 1  38  ? 118.056 148.390 192.719 1.00 120.46 ? 38  PRO A O     1 
ATOM   14    C  CB    . PRO A 1  38  ? 117.904 145.530 191.827 1.00 120.46 ? 38  PRO A CB    1 
ATOM   15    C  CG    . PRO A 1  38  ? 117.000 144.506 192.474 1.00 120.46 ? 38  PRO A CG    1 
ATOM   16    C  CD    . PRO A 1  38  ? 116.634 145.108 193.816 1.00 120.46 ? 38  PRO A CD    1 
ATOM   17    N  N     . HIS A 1  39  ? 120.266 147.952 192.555 1.00 109.74 ? 39  HIS A N     1 
ATOM   18    C  CA    . HIS A 1  39  ? 120.657 149.365 192.304 1.00 109.74 ? 39  HIS A CA    1 
ATOM   19    C  C     . HIS A 1  39  ? 122.016 149.410 191.596 1.00 109.74 ? 39  HIS A C     1 
ATOM   20    O  O     . HIS A 1  39  ? 123.039 149.175 192.267 1.00 109.74 ? 39  HIS A O     1 
ATOM   21    C  CB    . HIS A 1  39  ? 120.685 150.148 193.622 1.00 109.74 ? 39  HIS A CB    1 
ATOM   22    C  CG    . HIS A 1  39  ? 121.723 149.664 194.579 1.00 109.74 ? 39  HIS A CG    1 
ATOM   23    N  ND1   . HIS A 1  39  ? 122.189 148.365 194.564 1.00 109.74 ? 39  HIS A ND1   1 
ATOM   24    C  CD2   . HIS A 1  39  ? 122.388 150.296 195.569 1.00 109.74 ? 39  HIS A CD2   1 
ATOM   25    C  CE1   . HIS A 1  39  ? 123.096 148.215 195.507 1.00 109.74 ? 39  HIS A CE1   1 
ATOM   26    N  NE2   . HIS A 1  39  ? 123.236 149.387 196.139 1.00 109.74 ? 39  HIS A NE2   1 
ATOM   27    N  N     . ARG A 1  40  ? 122.014 149.701 190.292 1.00 103.42 ? 40  ARG A N     1 
ATOM   28    C  CA    . ARG A 1  40  ? 123.280 149.786 189.520 1.00 103.42 ? 40  ARG A CA    1 
ATOM   29    C  C     . ARG A 1  40  ? 124.057 151.016 190.000 1.00 103.42 ? 40  ARG A C     1 
ATOM   30    O  O     . ARG A 1  40  ? 123.411 152.026 190.342 1.00 103.42 ? 40  ARG A O     1 
ATOM   31    C  CB    . ARG A 1  40  ? 122.990 149.863 188.018 1.00 103.42 ? 40  ARG A CB    1 
ATOM   32    C  CG    . ARG A 1  40  ? 121.914 150.874 187.643 1.00 103.42 ? 40  ARG A CG    1 
ATOM   33    C  CD    . ARG A 1  40  ? 121.073 150.408 186.469 1.00 103.42 ? 40  ARG A CD    1 
ATOM   34    N  NE    . ARG A 1  40  ? 119.963 149.567 186.893 1.00 103.42 ? 40  ARG A NE    1 
ATOM   35    C  CZ    . ARG A 1  40  ? 119.589 149.401 188.156 1.00 103.42 ? 40  ARG A CZ    1 
ATOM   36    N  NH1   . ARG A 1  40  ? 120.176 148.483 188.904 1.00 103.42 ? 40  ARG A NH1   1 
ATOM   37    N  NH2   . ARG A 1  40  ? 118.632 150.154 188.666 1.00 103.42 ? 40  ARG A NH2   1 
ATOM   38    N  N     . TYR A 1  41  ? 125.389 150.924 190.025 1.00 102.03 ? 41  TYR A N     1 
ATOM   39    C  CA    . TYR A 1  41  ? 126.245 152.050 190.482 1.00 102.03 ? 41  TYR A CA    1 
ATOM   40    C  C     . TYR A 1  41  ? 125.880 153.324 189.713 1.00 102.03 ? 41  TYR A C     1 
ATOM   41    O  O     . TYR A 1  41  ? 125.439 154.302 190.351 1.00 102.03 ? 41  TYR A O     1 
ATOM   42    C  CB    . TYR A 1  41  ? 127.725 151.682 190.339 1.00 102.03 ? 41  TYR A CB    1 
ATOM   43    C  CG    . TYR A 1  41  ? 128.128 150.440 191.093 1.00 102.03 ? 41  TYR A CG    1 
ATOM   44    C  CD1   . TYR A 1  41  ? 127.977 149.183 190.533 1.00 102.03 ? 41  TYR A CD1   1 
ATOM   45    C  CD2   . TYR A 1  41  ? 128.653 150.520 192.372 1.00 102.03 ? 41  TYR A CD2   1 
ATOM   46    C  CE1   . TYR A 1  41  ? 128.343 148.037 191.220 1.00 102.03 ? 41  TYR A CE1   1 
ATOM   47    C  CE2   . TYR A 1  41  ? 129.023 149.384 193.072 1.00 102.03 ? 41  TYR A CE2   1 
ATOM   48    C  CZ    . TYR A 1  41  ? 128.868 148.138 192.495 1.00 102.03 ? 41  TYR A CZ    1 
ATOM   49    O  OH    . TYR A 1  41  ? 129.230 147.012 193.178 1.00 102.03 ? 41  TYR A OH    1 
ATOM   50    N  N     . ARG A 1  42  ? 126.054 153.311 188.387 1.00 93.65  ? 42  ARG A N     1 
ATOM   51    C  CA    . ARG A 1  42  ? 125.740 154.474 187.581 1.00 93.65  ? 42  ARG A CA    1 
ATOM   52    C  C     . ARG A 1  42  ? 126.407 154.404 186.206 1.00 93.65  ? 42  ARG A C     1 
ATOM   53    O  O     . ARG A 1  42  ? 127.281 153.573 185.962 1.00 93.65  ? 42  ARG A O     1 
ATOM   54    C  CB    . ARG A 1  42  ? 126.178 155.722 188.342 1.00 93.65  ? 42  ARG A CB    1 
ATOM   55    C  CG    . ARG A 1  42  ? 125.390 155.960 189.604 1.00 93.65  ? 42  ARG A CG    1 
ATOM   56    C  CD    . ARG A 1  42  ? 125.926 157.161 190.334 1.00 93.65  ? 42  ARG A CD    1 
ATOM   57    N  NE    . ARG A 1  42  ? 125.821 158.353 189.508 1.00 93.65  ? 42  ARG A NE    1 
ATOM   58    C  CZ    . ARG A 1  42  ? 124.748 159.135 189.457 1.00 93.65  ? 42  ARG A CZ    1 
ATOM   59    N  NH1   . ARG A 1  42  ? 123.685 158.852 190.195 1.00 93.65  ? 42  ARG A NH1   1 
ATOM   60    N  NH2   . ARG A 1  42  ? 124.742 160.199 188.670 1.00 93.65  ? 42  ARG A NH2   1 
ATOM   61    N  N     . PRO A 1  43  ? 126.000 155.258 185.272 1.00 91.09  ? 43  PRO A N     1 
ATOM   62    C  CA    . PRO A 1  43  ? 126.755 155.376 184.023 1.00 91.09  ? 43  PRO A CA    1 
ATOM   63    C  C     . PRO A 1  43  ? 128.074 156.093 184.217 1.00 91.09  ? 43  PRO A C     1 
ATOM   64    O  O     . PRO A 1  43  ? 128.148 157.315 184.089 1.00 91.09  ? 43  PRO A O     1 
ATOM   65    C  CB    . PRO A 1  43  ? 125.817 156.178 183.117 1.00 91.09  ? 43  PRO A CB    1 
ATOM   66    C  CG    . PRO A 1  43  ? 124.480 155.923 183.653 1.00 91.09  ? 43  PRO A CG    1 
ATOM   67    C  CD    . PRO A 1  43  ? 124.647 155.823 185.129 1.00 91.09  ? 43  PRO A CD    1 
ATOM   68    N  N     . GLY A 1  44  ? 129.120 155.346 184.530 1.00 87.14  ? 44  GLY A N     1 
ATOM   69    C  CA    . GLY A 1  44  ? 130.414 155.949 184.758 1.00 87.14  ? 44  GLY A CA    1 
ATOM   70    C  C     . GLY A 1  44  ? 131.258 155.227 185.782 1.00 87.14  ? 44  GLY A C     1 
ATOM   71    O  O     . GLY A 1  44  ? 132.486 155.293 185.721 1.00 87.14  ? 44  GLY A O     1 
ATOM   72    N  N     . THR A 1  45  ? 130.633 154.505 186.703 1.00 86.83  ? 45  THR A N     1 
ATOM   73    C  CA    . THR A 1  45  ? 131.433 153.715 187.626 1.00 86.83  ? 45  THR A CA    1 
ATOM   74    C  C     . THR A 1  45  ? 131.953 152.453 186.958 1.00 86.83  ? 45  THR A C     1 
ATOM   75    O  O     . THR A 1  45  ? 133.138 152.126 187.097 1.00 86.83  ? 45  THR A O     1 
ATOM   76    C  CB    . THR A 1  45  ? 130.621 153.381 188.864 1.00 86.83  ? 45  THR A CB    1 
ATOM   77    O  OG1   . THR A 1  45  ? 130.247 154.603 189.504 1.00 86.83  ? 45  THR A OG1   1 
ATOM   78    C  CG2   . THR A 1  45  ? 131.448 152.552 189.826 1.00 86.83  ? 45  THR A CG2   1 
ATOM   79    N  N     . VAL A 1  46  ? 131.092 151.751 186.216 1.00 84.78  ? 46  VAL A N     1 
ATOM   80    C  CA    . VAL A 1  46  ? 131.546 150.652 185.367 1.00 84.78  ? 46  VAL A CA    1 
ATOM   81    C  C     . VAL A 1  46  ? 132.518 151.170 184.313 1.00 84.78  ? 46  VAL A C     1 
ATOM   82    O  O     . VAL A 1  46  ? 133.530 150.524 183.999 1.00 84.78  ? 46  VAL A O     1 
ATOM   83    C  CB    . VAL A 1  46  ? 130.332 149.939 184.741 1.00 84.78  ? 46  VAL A CB    1 
ATOM   84    C  CG1   . VAL A 1  46  ? 130.755 148.922 183.699 1.00 84.78  ? 46  VAL A CG1   1 
ATOM   85    C  CG2   . VAL A 1  46  ? 129.539 149.254 185.823 1.00 84.78  ? 46  VAL A CG2   1 
ATOM   86    N  N     . ALA A 1  47  ? 132.265 152.381 183.817 1.00 84.63  ? 47  ALA A N     1 
ATOM   87    C  CA    . ALA A 1  47  ? 133.128 152.984 182.814 1.00 84.63  ? 47  ALA A CA    1 
ATOM   88    C  C     . ALA A 1  47  ? 134.503 153.299 183.381 1.00 84.63  ? 47  ALA A C     1 
ATOM   89    O  O     . ALA A 1  47  ? 135.502 152.775 182.897 1.00 84.63  ? 47  ALA A O     1 
ATOM   90    C  CB    . ALA A 1  47  ? 132.475 154.241 182.248 1.00 84.63  ? 47  ALA A CB    1 
ATOM   91    N  N     . LEU A 1  48  ? 134.573 154.120 184.430 1.00 83.74  ? 48  LEU A N     1 
ATOM   92    C  CA    . LEU A 1  48  ? 135.880 154.565 184.919 1.00 83.74  ? 48  LEU A CA    1 
ATOM   93    C  C     . LEU A 1  48  ? 136.632 153.460 185.650 1.00 83.74  ? 48  LEU A C     1 
ATOM   94    O  O     . LEU A 1  48  ? 137.864 153.377 185.548 1.00 83.74  ? 48  LEU A O     1 
ATOM   95    C  CB    . LEU A 1  48  ? 135.732 155.778 185.829 1.00 83.74  ? 48  LEU A CB    1 
ATOM   96    C  CG    . LEU A 1  48  ? 135.782 157.174 185.229 1.00 83.74  ? 48  LEU A CG    1 
ATOM   97    C  CD1   . LEU A 1  48  ? 134.571 157.502 184.391 1.00 83.74  ? 48  LEU A CD1   1 
ATOM   98    C  CD2   . LEU A 1  48  ? 135.917 158.131 186.380 1.00 83.74  ? 48  LEU A CD2   1 
ATOM   99    N  N     . ARG A 1  49  ? 135.921 152.621 186.406 1.00 83.03  ? 49  ARG A N     1 
ATOM   100   C  CA    . ARG A 1  49  ? 136.566 151.471 187.027 1.00 83.03  ? 49  ARG A CA    1 
ATOM   101   C  C     . ARG A 1  49  ? 137.081 150.511 185.970 1.00 83.03  ? 49  ARG A C     1 
ATOM   102   O  O     . ARG A 1  49  ? 138.208 149.999 186.062 1.00 83.03  ? 49  ARG A O     1 
ATOM   103   C  CB    . ARG A 1  49  ? 135.593 150.758 187.959 1.00 83.03  ? 49  ARG A CB    1 
ATOM   104   C  CG    . ARG A 1  49  ? 136.253 149.663 188.758 1.00 83.03  ? 49  ARG A CG    1 
ATOM   105   C  CD    . ARG A 1  49  ? 135.307 148.994 189.744 1.00 83.03  ? 49  ARG A CD    1 
ATOM   106   N  NE    . ARG A 1  49  ? 134.290 148.145 189.126 1.00 83.03  ? 49  ARG A NE    1 
ATOM   107   C  CZ    . ARG A 1  49  ? 132.978 148.320 189.257 1.00 83.03  ? 49  ARG A CZ    1 
ATOM   108   N  NH1   . ARG A 1  49  ? 132.504 149.312 189.992 1.00 83.03  ? 49  ARG A NH1   1 
ATOM   109   N  NH2   . ARG A 1  49  ? 132.139 147.489 188.665 1.00 83.03  ? 49  ARG A NH2   1 
ATOM   110   N  N     . GLU A 1  50  ? 136.292 150.300 184.921 1.00 85.00  ? 50  GLU A N     1 
ATOM   111   C  CA    . GLU A 1  50  ? 136.703 149.389 183.872 1.00 85.00  ? 50  GLU A CA    1 
ATOM   112   C  C     . GLU A 1  50  ? 137.782 149.993 182.978 1.00 85.00  ? 50  GLU A C     1 
ATOM   113   O  O     . GLU A 1  50  ? 138.572 149.248 182.391 1.00 85.00  ? 50  GLU A O     1 
ATOM   114   C  CB    . GLU A 1  50  ? 135.439 148.951 183.139 1.00 85.00  ? 50  GLU A CB    1 
ATOM   115   C  CG    . GLU A 1  50  ? 135.595 147.944 182.045 1.00 85.00  ? 50  GLU A CG    1 
ATOM   116   C  CD    . GLU A 1  50  ? 135.422 148.583 180.694 1.00 85.00  ? 50  GLU A CD    1 
ATOM   117   O  OE1   . GLU A 1  50  ? 134.626 149.540 180.626 1.00 85.00  ? 50  GLU A OE1   1 
ATOM   118   O  OE2   . GLU A 1  50  ? 136.049 148.140 179.712 1.00 85.00  ? 50  GLU A OE2   1 
ATOM   119   N  N     . ILE A 1  51  ? 137.869 151.323 182.916 1.00 80.86  ? 51  ILE A N     1 
ATOM   120   C  CA    . ILE A 1  51  ? 139.021 151.996 182.325 1.00 80.86  ? 51  ILE A CA    1 
ATOM   121   C  C     . ILE A 1  51  ? 140.261 151.757 183.166 1.00 80.86  ? 51  ILE A C     1 
ATOM   122   O  O     . ILE A 1  51  ? 141.358 151.563 182.627 1.00 80.86  ? 51  ILE A O     1 
ATOM   123   C  CB    . ILE A 1  51  ? 138.729 153.501 182.139 1.00 80.86  ? 51  ILE A CB    1 
ATOM   124   C  CG1   . ILE A 1  51  ? 137.857 153.735 180.915 1.00 80.86  ? 51  ILE A CG1   1 
ATOM   125   C  CG2   . ILE A 1  51  ? 139.974 154.345 181.998 1.00 80.86  ? 51  ILE A CG2   1 
ATOM   126   C  CD1   . ILE A 1  51  ? 137.381 155.161 180.786 1.00 80.86  ? 51  ILE A CD1   1 
ATOM   127   N  N     . ARG A 1  52  ? 140.115 151.742 184.494 1.00 83.92  ? 52  ARG A N     1 
ATOM   128   C  CA    . ARG A 1  52  ? 141.272 151.440 185.334 1.00 83.92  ? 52  ARG A CA    1 
ATOM   129   C  C     . ARG A 1  52  ? 141.753 150.013 185.123 1.00 83.92  ? 52  ARG A C     1 
ATOM   130   O  O     . ARG A 1  52  ? 142.965 149.767 185.069 1.00 83.92  ? 52  ARG A O     1 
ATOM   131   C  CB    . ARG A 1  52  ? 140.960 151.676 186.806 1.00 83.92  ? 52  ARG A CB    1 
ATOM   132   C  CG    . ARG A 1  52  ? 140.801 153.130 187.202 1.00 83.92  ? 52  ARG A CG    1 
ATOM   133   C  CD    . ARG A 1  52  ? 140.542 153.236 188.692 1.00 83.92  ? 52  ARG A CD    1 
ATOM   134   N  NE    . ARG A 1  52  ? 140.283 154.606 189.120 1.00 83.92  ? 52  ARG A NE    1 
ATOM   135   C  CZ    . ARG A 1  52  ? 139.071 155.145 189.182 1.00 83.92  ? 52  ARG A CZ    1 
ATOM   136   N  NH1   . ARG A 1  52  ? 138.010 154.429 188.844 1.00 83.92  ? 52  ARG A NH1   1 
ATOM   137   N  NH2   . ARG A 1  52  ? 138.920 156.397 189.585 1.00 83.92  ? 52  ARG A NH2   1 
ATOM   138   N  N     . ARG A 1  53  ? 140.823 149.075 184.936 1.00 82.07  ? 53  ARG A N     1 
ATOM   139   C  CA    . ARG A 1  53  ? 141.242 147.704 184.664 1.00 82.07  ? 53  ARG A CA    1 
ATOM   140   C  C     . ARG A 1  53  ? 141.883 147.571 183.289 1.00 82.07  ? 53  ARG A C     1 
ATOM   141   O  O     . ARG A 1  53  ? 143.024 147.118 183.170 1.00 82.07  ? 53  ARG A O     1 
ATOM   142   C  CB    . ARG A 1  53  ? 140.080 146.727 184.776 1.00 82.07  ? 53  ARG A CB    1 
ATOM   143   C  CG    . ARG A 1  53  ? 140.589 145.349 184.468 1.00 82.07  ? 53  ARG A CG    1 
ATOM   144   C  CD    . ARG A 1  53  ? 139.576 144.270 184.594 1.00 82.07  ? 53  ARG A CD    1 
ATOM   145   N  NE    . ARG A 1  53  ? 140.197 143.022 184.187 1.00 82.07  ? 53  ARG A NE    1 
ATOM   146   C  CZ    . ARG A 1  53  ? 139.594 141.845 184.207 1.00 82.07  ? 53  ARG A CZ    1 
ATOM   147   N  NH1   . ARG A 1  53  ? 138.341 141.751 184.630 1.00 82.07  ? 53  ARG A NH1   1 
ATOM   148   N  NH2   . ARG A 1  53  ? 140.244 140.763 183.809 1.00 82.07  ? 53  ARG A NH2   1 
ATOM   149   N  N     . TYR A 1  54  ? 141.166 147.953 182.236 1.00 82.73  ? 54  TYR A N     1 
ATOM   150   C  CA    . TYR A 1  54  ? 141.695 147.709 180.903 1.00 82.73  ? 54  TYR A CA    1 
ATOM   151   C  C     . TYR A 1  54  ? 142.788 148.678 180.486 1.00 82.73  ? 54  TYR A C     1 
ATOM   152   O  O     . TYR A 1  54  ? 143.415 148.452 179.446 1.00 82.73  ? 54  TYR A O     1 
ATOM   153   C  CB    . TYR A 1  54  ? 140.575 147.719 179.871 1.00 82.73  ? 54  TYR A CB    1 
ATOM   154   C  CG    . TYR A 1  54  ? 139.768 146.452 179.889 1.00 82.73  ? 54  TYR A CG    1 
ATOM   155   C  CD1   . TYR A 1  54  ? 140.261 145.292 179.310 1.00 82.73  ? 54  TYR A CD1   1 
ATOM   156   C  CD2   . TYR A 1  54  ? 138.526 146.408 180.482 1.00 82.73  ? 54  TYR A CD2   1 
ATOM   157   C  CE1   . TYR A 1  54  ? 139.531 144.125 179.325 1.00 82.73  ? 54  TYR A CE1   1 
ATOM   158   C  CE2   . TYR A 1  54  ? 137.784 145.248 180.493 1.00 82.73  ? 54  TYR A CE2   1 
ATOM   159   C  CZ    . TYR A 1  54  ? 138.293 144.113 179.920 1.00 82.73  ? 54  TYR A CZ    1 
ATOM   160   O  OH    . TYR A 1  54  ? 137.557 142.957 179.935 1.00 82.73  ? 54  TYR A OH    1 
ATOM   161   N  N     . GLN A 1  55  ? 143.043 149.739 181.246 1.00 81.47  ? 55  GLN A N     1 
ATOM   162   C  CA    . GLN A 1  55  ? 144.342 150.382 181.113 1.00 81.47  ? 55  GLN A CA    1 
ATOM   163   C  C     . GLN A 1  55  ? 145.393 149.626 181.897 1.00 81.47  ? 55  GLN A C     1 
ATOM   164   O  O     . GLN A 1  55  ? 146.541 149.532 181.457 1.00 81.47  ? 55  GLN A O     1 
ATOM   165   C  CB    . GLN A 1  55  ? 144.313 151.845 181.572 1.00 81.47  ? 55  GLN A CB    1 
ATOM   166   C  CG    . GLN A 1  55  ? 143.685 152.804 180.579 1.00 81.47  ? 55  GLN A CG    1 
ATOM   167   C  CD    . GLN A 1  55  ? 143.868 154.263 180.951 1.00 81.47  ? 55  GLN A CD    1 
ATOM   168   O  OE1   . GLN A 1  55  ? 144.378 154.585 182.019 1.00 81.47  ? 55  GLN A OE1   1 
ATOM   169   N  NE2   . GLN A 1  55  ? 143.489 155.153 180.050 1.00 81.47  ? 55  GLN A NE2   1 
ATOM   170   N  N     . LYS A 1  56  ? 145.010 149.054 183.034 1.00 81.09  ? 56  LYS A N     1 
ATOM   171   C  CA    . LYS A 1  56  ? 146.005 148.446 183.902 1.00 81.09  ? 56  LYS A CA    1 
ATOM   172   C  C     . LYS A 1  56  ? 146.503 147.109 183.361 1.00 81.09  ? 56  LYS A C     1 
ATOM   173   O  O     . LYS A 1  56  ? 147.667 146.762 183.571 1.00 81.09  ? 56  LYS A O     1 
ATOM   174   C  CB    . LYS A 1  56  ? 145.414 148.300 185.305 1.00 81.09  ? 56  LYS A CB    1 
ATOM   175   C  CG    . LYS A 1  56  ? 146.423 148.047 186.398 1.00 81.09  ? 56  LYS A CG    1 
ATOM   176   C  CD    . LYS A 1  56  ? 145.759 148.164 187.751 1.00 81.09  ? 56  LYS A CD    1 
ATOM   177   C  CE    . LYS A 1  56  ? 146.763 147.999 188.863 1.00 81.09  ? 56  LYS A CE    1 
ATOM   178   N  NZ    . LYS A 1  56  ? 146.111 148.138 190.192 1.00 81.09  ? 56  LYS A NZ    1 
ATOM   179   N  N     . SER A 1  57  ? 145.667 146.365 182.641 1.00 78.67  ? 57  SER A N     1 
ATOM   180   C  CA    . SER A 1  57  ? 146.086 145.057 182.164 1.00 78.67  ? 57  SER A CA    1 
ATOM   181   C  C     . SER A 1  57  ? 146.930 145.191 180.909 1.00 78.67  ? 57  SER A C     1 
ATOM   182   O  O     . SER A 1  57  ? 147.099 146.276 180.352 1.00 78.67  ? 57  SER A O     1 
ATOM   183   C  CB    . SER A 1  57  ? 144.899 144.165 181.844 1.00 78.67  ? 57  SER A CB    1 
ATOM   184   O  OG    . SER A 1  57  ? 144.343 144.547 180.604 1.00 78.67  ? 57  SER A OG    1 
ATOM   185   N  N     . THR A 1  58  ? 147.433 144.045 180.443 1.00 79.25  ? 58  THR A N     1 
ATOM   186   C  CA    . THR A 1  58  ? 148.448 144.002 179.400 1.00 79.25  ? 58  THR A CA    1 
ATOM   187   C  C     . THR A 1  58  ? 148.089 143.145 178.199 1.00 79.25  ? 58  THR A C     1 
ATOM   188   O  O     . THR A 1  58  ? 148.717 143.304 177.149 1.00 79.25  ? 58  THR A O     1 
ATOM   189   C  CB    . THR A 1  58  ? 149.772 143.456 179.957 1.00 79.25  ? 58  THR A CB    1 
ATOM   190   O  OG1   . THR A 1  58  ? 149.573 142.118 180.418 1.00 79.25  ? 58  THR A OG1   1 
ATOM   191   C  CG2   . THR A 1  58  ? 150.278 144.292 181.109 1.00 79.25  ? 58  THR A CG2   1 
ATOM   192   N  N     . GLU A 1  59  ? 147.130 142.233 178.317 1.00 82.42  ? 59  GLU A N     1 
ATOM   193   C  CA    . GLU A 1  59  ? 147.025 141.166 177.336 1.00 82.42  ? 59  GLU A CA    1 
ATOM   194   C  C     . GLU A 1  59  ? 146.267 141.640 176.102 1.00 82.42  ? 59  GLU A C     1 
ATOM   195   O  O     . GLU A 1  59  ? 145.832 142.787 175.999 1.00 82.42  ? 59  GLU A O     1 
ATOM   196   C  CB    . GLU A 1  59  ? 146.366 139.935 177.956 1.00 82.42  ? 59  GLU A CB    1 
ATOM   197   C  CG    . GLU A 1  59  ? 144.870 140.036 178.166 1.00 82.42  ? 59  GLU A CG    1 
ATOM   198   C  CD    . GLU A 1  59  ? 144.482 140.680 179.476 1.00 82.42  ? 59  GLU A CD    1 
ATOM   199   O  OE1   . GLU A 1  59  ? 145.320 141.359 180.103 1.00 82.42  ? 59  GLU A OE1   1 
ATOM   200   O  OE2   . GLU A 1  59  ? 143.323 140.496 179.891 1.00 82.42  ? 59  GLU A OE2   1 
ATOM   201   N  N     . LEU A 1  60  ? 146.105 140.729 175.153 1.00 81.28  ? 60  LEU A N     1 
ATOM   202   C  CA    . LEU A 1  60  ? 145.588 141.041 173.833 1.00 81.28  ? 60  LEU A CA    1 
ATOM   203   C  C     . LEU A 1  60  ? 144.107 140.718 173.783 1.00 81.28  ? 60  LEU A C     1 
ATOM   204   O  O     . LEU A 1  60  ? 143.676 139.668 174.265 1.00 81.28  ? 60  LEU A O     1 
ATOM   205   C  CB    . LEU A 1  60  ? 146.334 140.254 172.762 1.00 81.28  ? 60  LEU A CB    1 
ATOM   206   C  CG    . LEU A 1  60  ? 147.729 140.759 172.389 1.00 81.28  ? 60  LEU A CG    1 
ATOM   207   C  CD1   . LEU A 1  60  ? 148.820 140.389 173.386 1.00 81.28  ? 60  LEU A CD1   1 
ATOM   208   C  CD2   . LEU A 1  60  ? 148.087 140.230 171.042 1.00 81.28  ? 60  LEU A CD2   1 
ATOM   209   N  N     . LEU A 1  61  ? 143.328 141.614 173.185 1.00 79.49  ? 61  LEU A N     1 
ATOM   210   C  CA    . LEU A 1  61  ? 141.901 141.600 173.473 1.00 79.49  ? 61  LEU A CA    1 
ATOM   211   C  C     . LEU A 1  61  ? 141.102 140.774 172.476 1.00 79.49  ? 61  LEU A C     1 
ATOM   212   O  O     . LEU A 1  61  ? 140.444 139.804 172.862 1.00 79.49  ? 61  LEU A O     1 
ATOM   213   C  CB    . LEU A 1  61  ? 141.345 143.023 173.525 1.00 79.49  ? 61  LEU A CB    1 
ATOM   214   C  CG    . LEU A 1  61  ? 141.485 143.750 174.862 1.00 79.49  ? 61  LEU A CG    1 
ATOM   215   C  CD1   . LEU A 1  61  ? 140.946 142.881 175.975 1.00 79.49  ? 61  LEU A CD1   1 
ATOM   216   C  CD2   . LEU A 1  61  ? 142.893 144.207 175.159 1.00 79.49  ? 61  LEU A CD2   1 
ATOM   217   N  N     . ILE A 1  62  ? 141.134 141.148 171.206 1.00 75.65  ? 62  ILE A N     1 
ATOM   218   C  CA    . ILE A 1  62  ? 140.200 140.575 170.248 1.00 75.65  ? 62  ILE A CA    1 
ATOM   219   C  C     . ILE A 1  62  ? 140.639 139.158 169.902 1.00 75.65  ? 62  ILE A C     1 
ATOM   220   O  O     . ILE A 1  62  ? 141.835 138.857 169.838 1.00 75.65  ? 62  ILE A O     1 
ATOM   221   C  CB    . ILE A 1  62  ? 140.059 141.488 169.022 1.00 75.65  ? 62  ILE A CB    1 
ATOM   222   C  CG1   . ILE A 1  62  ? 141.341 141.602 168.223 1.00 75.65  ? 62  ILE A CG1   1 
ATOM   223   C  CG2   . ILE A 1  62  ? 139.724 142.872 169.489 1.00 75.65  ? 62  ILE A CG2   1 
ATOM   224   C  CD1   . ILE A 1  62  ? 141.149 142.412 166.977 1.00 75.65  ? 62  ILE A CD1   1 
ATOM   225   N  N     . ARG A 1  63  ? 139.656 138.276 169.748 1.00 78.13  ? 63  ARG A N     1 
ATOM   226   C  CA    . ARG A 1  63  ? 139.867 136.847 169.924 1.00 78.13  ? 63  ARG A CA    1 
ATOM   227   C  C     . ARG A 1  63  ? 140.651 136.259 168.758 1.00 78.13  ? 63  ARG A C     1 
ATOM   228   O  O     . ARG A 1  63  ? 140.694 136.813 167.659 1.00 78.13  ? 63  ARG A O     1 
ATOM   229   C  CB    . ARG A 1  63  ? 138.527 136.135 170.087 1.00 78.13  ? 63  ARG A CB    1 
ATOM   230   C  CG    . ARG A 1  63  ? 137.706 136.571 171.307 1.00 78.13  ? 63  ARG A CG    1 
ATOM   231   C  CD    . ARG A 1  63  ? 138.319 136.159 172.634 1.00 78.13  ? 63  ARG A CD    1 
ATOM   232   N  NE    . ARG A 1  63  ? 139.224 137.166 173.179 1.00 78.13  ? 63  ARG A NE    1 
ATOM   233   C  CZ    . ARG A 1  63  ? 140.063 136.955 174.188 1.00 78.13  ? 63  ARG A CZ    1 
ATOM   234   N  NH1   . ARG A 1  63  ? 140.115 135.770 174.777 1.00 78.13  ? 63  ARG A NH1   1 
ATOM   235   N  NH2   . ARG A 1  63  ? 140.852 137.932 174.610 1.00 78.13  ? 63  ARG A NH2   1 
ATOM   236   N  N     . LYS A 1  64  ? 141.262 135.102 169.018 1.00 79.00  ? 64  LYS A N     1 
ATOM   237   C  CA    . LYS A 1  64  ? 142.336 134.597 168.169 1.00 79.00  ? 64  LYS A CA    1 
ATOM   238   C  C     . LYS A 1  64  ? 141.813 134.090 166.832 1.00 79.00  ? 64  LYS A C     1 
ATOM   239   O  O     . LYS A 1  64  ? 142.332 134.459 165.772 1.00 79.00  ? 64  LYS A O     1 
ATOM   240   C  CB    . LYS A 1  64  ? 143.084 133.489 168.902 1.00 79.00  ? 64  LYS A CB    1 
ATOM   241   C  CG    . LYS A 1  64  ? 143.643 133.908 170.247 1.00 79.00  ? 64  LYS A CG    1 
ATOM   242   C  CD    . LYS A 1  64  ? 144.785 134.890 170.101 1.00 79.00  ? 64  LYS A CD    1 
ATOM   243   C  CE    . LYS A 1  64  ? 145.360 135.273 171.457 1.00 79.00  ? 64  LYS A CE    1 
ATOM   244   N  NZ    . LYS A 1  64  ? 146.065 134.137 172.107 1.00 79.00  ? 64  LYS A NZ    1 
ATOM   245   N  N     . LEU A 1  65  ? 140.800 133.233 166.857 1.00 78.24  ? 65  LEU A N     1 
ATOM   246   C  CA    . LEU A 1  65  ? 140.275 132.672 165.616 1.00 78.24  ? 65  LEU A CA    1 
ATOM   247   C  C     . LEU A 1  65  ? 139.480 133.635 164.726 1.00 78.24  ? 65  LEU A C     1 
ATOM   248   O  O     . LEU A 1  65  ? 139.636 133.538 163.500 1.00 78.24  ? 65  LEU A O     1 
ATOM   249   C  CB    . LEU A 1  65  ? 139.437 131.428 165.907 1.00 78.24  ? 65  LEU A CB    1 
ATOM   250   C  CG    . LEU A 1  65  ? 140.269 130.243 166.377 1.00 78.24  ? 65  LEU A CG    1 
ATOM   251   C  CD1   . LEU A 1  65  ? 139.372 129.068 166.680 1.00 78.24  ? 65  LEU A CD1   1 
ATOM   252   C  CD2   . LEU A 1  65  ? 141.298 129.877 165.330 1.00 78.24  ? 65  LEU A CD2   1 
ATOM   253   N  N     . PRO A 1  66  ? 138.625 134.545 165.232 1.00 75.32  ? 66  PRO A N     1 
ATOM   254   C  CA    . PRO A 1  66  ? 138.018 135.507 164.296 1.00 75.32  ? 66  PRO A CA    1 
ATOM   255   C  C     . PRO A 1  66  ? 139.016 136.473 163.697 1.00 75.32  ? 66  PRO A C     1 
ATOM   256   O  O     . PRO A 1  66  ? 138.899 136.822 162.515 1.00 75.32  ? 66  PRO A O     1 
ATOM   257   C  CB    . PRO A 1  66  ? 136.981 136.236 165.157 1.00 75.32  ? 66  PRO A CB    1 
ATOM   258   C  CG    . PRO A 1  66  ? 136.673 135.312 166.222 1.00 75.32  ? 66  PRO A CG    1 
ATOM   259   C  CD    . PRO A 1  66  ? 137.953 134.641 166.544 1.00 75.32  ? 66  PRO A CD    1 
ATOM   260   N  N     . PHE A 1  67  ? 140.012 136.892 164.474 1.00 74.07  ? 67  PHE A N     1 
ATOM   261   C  CA    . PHE A 1  67  ? 141.039 137.762 163.924 1.00 74.07  ? 67  PHE A CA    1 
ATOM   262   C  C     . PHE A 1  67  ? 141.890 137.021 162.904 1.00 74.07  ? 67  PHE A C     1 
ATOM   263   O  O     . PHE A 1  67  ? 142.263 137.587 161.869 1.00 74.07  ? 67  PHE A O     1 
ATOM   264   C  CB    . PHE A 1  67  ? 141.913 138.312 165.041 1.00 74.07  ? 67  PHE A CB    1 
ATOM   265   C  CG    . PHE A 1  67  ? 142.913 139.303 164.573 1.00 74.07  ? 67  PHE A CG    1 
ATOM   266   C  CD1   . PHE A 1  67  ? 142.527 140.590 164.280 1.00 74.07  ? 67  PHE A CD1   1 
ATOM   267   C  CD2   . PHE A 1  67  ? 144.231 138.948 164.396 1.00 74.07  ? 67  PHE A CD2   1 
ATOM   268   C  CE1   . PHE A 1  67  ? 143.432 141.514 163.843 1.00 74.07  ? 67  PHE A CE1   1 
ATOM   269   C  CE2   . PHE A 1  67  ? 145.134 139.859 163.935 1.00 74.07  ? 67  PHE A CE2   1 
ATOM   270   C  CZ    . PHE A 1  67  ? 144.733 141.150 163.663 1.00 74.07  ? 67  PHE A CZ    1 
ATOM   271   N  N     . GLN A 1  68  ? 142.198 135.757 163.190 1.00 77.94  ? 68  GLN A N     1 
ATOM   272   C  CA    . GLN A 1  68  ? 143.008 134.953 162.283 1.00 77.94  ? 68  GLN A CA    1 
ATOM   273   C  C     . GLN A 1  68  ? 142.283 134.727 160.963 1.00 77.94  ? 68  GLN A C     1 
ATOM   274   O  O     . GLN A 1  68  ? 142.876 134.877 159.884 1.00 77.94  ? 68  GLN A O     1 
ATOM   275   C  CB    . GLN A 1  68  ? 143.354 133.634 162.968 1.00 77.94  ? 68  GLN A CB    1 
ATOM   276   C  CG    . GLN A 1  68  ? 144.288 132.722 162.212 1.00 77.94  ? 68  GLN A CG    1 
ATOM   277   C  CD    . GLN A 1  68  ? 144.715 131.536 163.056 1.00 77.94  ? 68  GLN A CD    1 
ATOM   278   O  OE1   . GLN A 1  68  ? 144.311 131.406 164.208 1.00 77.94  ? 68  GLN A OE1   1 
ATOM   279   N  NE2   . GLN A 1  68  ? 145.534 130.671 162.491 1.00 77.94  ? 68  GLN A NE2   1 
ATOM   280   N  N     . ARG A 1  69  ? 140.985 134.426 161.033 1.00 75.39  ? 69  ARG A N     1 
ATOM   281   C  CA    . ARG A 1  69  ? 140.173 134.326 159.825 1.00 75.39  ? 69  ARG A CA    1 
ATOM   282   C  C     . ARG A 1  69  ? 140.074 135.658 159.095 1.00 75.39  ? 69  ARG A C     1 
ATOM   283   O  O     . ARG A 1  69  ? 139.965 135.678 157.864 1.00 75.39  ? 69  ARG A O     1 
ATOM   284   C  CB    . ARG A 1  69  ? 138.776 133.821 160.178 1.00 75.39  ? 69  ARG A CB    1 
ATOM   285   C  CG    . ARG A 1  69  ? 138.708 132.376 160.595 1.00 75.39  ? 69  ARG A CG    1 
ATOM   286   C  CD    . ARG A 1  69  ? 137.269 131.905 160.662 1.00 75.39  ? 69  ARG A CD    1 
ATOM   287   N  NE    . ARG A 1  69  ? 136.491 132.616 161.669 1.00 75.39  ? 69  ARG A NE    1 
ATOM   288   C  CZ    . ARG A 1  69  ? 136.444 132.268 162.947 1.00 75.39  ? 69  ARG A CZ    1 
ATOM   289   N  NH1   . ARG A 1  69  ? 137.142 131.229 163.379 1.00 75.39  ? 69  ARG A NH1   1 
ATOM   290   N  NH2   . ARG A 1  69  ? 135.706 132.962 163.799 1.00 75.39  ? 69  ARG A NH2   1 
ATOM   291   N  N     . LEU A 1  70  ? 140.121 136.774 159.827 1.00 73.04  ? 70  LEU A N     1 
ATOM   292   C  CA    . LEU A 1  70  ? 140.093 138.083 159.183 1.00 73.04  ? 70  LEU A CA    1 
ATOM   293   C  C     . LEU A 1  70  ? 141.347 138.322 158.363 1.00 73.04  ? 70  LEU A C     1 
ATOM   294   O  O     . LEU A 1  70  ? 141.269 138.740 157.199 1.00 73.04  ? 70  LEU A O     1 
ATOM   295   C  CB    . LEU A 1  70  ? 139.951 139.182 160.226 1.00 73.04  ? 70  LEU A CB    1 
ATOM   296   C  CG    . LEU A 1  70  ? 140.020 140.571 159.601 1.00 73.04  ? 70  LEU A CG    1 
ATOM   297   C  CD1   . LEU A 1  70  ? 138.804 140.838 158.748 1.00 73.04  ? 70  LEU A CD1   1 
ATOM   298   C  CD2   . LEU A 1  70  ? 140.193 141.629 160.647 1.00 73.04  ? 70  LEU A CD2   1 
ATOM   299   N  N     . VAL A 1  71  ? 142.511 138.055 158.958 1.00 75.66  ? 71  VAL A N     1 
ATOM   300   C  CA    . VAL A 1  71  ? 143.780 138.269 158.271 1.00 75.66  ? 71  VAL A CA    1 
ATOM   301   C  C     . VAL A 1  71  ? 143.900 137.340 157.067 1.00 75.66  ? 71  VAL A C     1 
ATOM   302   O  O     . VAL A 1  71  ? 144.389 137.743 156.005 1.00 75.66  ? 71  VAL A O     1 
ATOM   303   C  CB    . VAL A 1  71  ? 144.948 138.094 159.262 1.00 75.66  ? 71  VAL A CB    1 
ATOM   304   C  CG1   . VAL A 1  71  ? 146.280 138.162 158.565 1.00 75.66  ? 71  VAL A CG1   1 
ATOM   305   C  CG2   . VAL A 1  71  ? 144.884 139.163 160.320 1.00 75.66  ? 71  VAL A CG2   1 
ATOM   306   N  N     . ARG A 1  72  ? 143.399 136.108 157.191 1.00 75.94  ? 72  ARG A N     1 
ATOM   307   C  CA    . ARG A 1  72  ? 143.424 135.208 156.040 1.00 75.94  ? 72  ARG A CA    1 
ATOM   308   C  C     . ARG A 1  72  ? 142.474 135.676 154.945 1.00 75.94  ? 72  ARG A C     1 
ATOM   309   O  O     . ARG A 1  72  ? 142.788 135.557 153.754 1.00 75.94  ? 72  ARG A O     1 
ATOM   310   C  CB    . ARG A 1  72  ? 143.083 133.786 156.477 1.00 75.94  ? 72  ARG A CB    1 
ATOM   311   C  CG    . ARG A 1  72  ? 144.130 133.170 157.379 1.00 75.94  ? 72  ARG A CG    1 
ATOM   312   C  CD    . ARG A 1  72  ? 143.711 131.808 157.895 1.00 75.94  ? 72  ARG A CD    1 
ATOM   313   N  NE    . ARG A 1  72  ? 144.608 131.332 158.944 1.00 75.94  ? 72  ARG A NE    1 
ATOM   314   C  CZ    . ARG A 1  72  ? 145.705 130.625 158.715 1.00 75.94  ? 72  ARG A CZ    1 
ATOM   315   N  NH1   . ARG A 1  72  ? 146.044 130.309 157.478 1.00 75.94  ? 72  ARG A NH1   1 
ATOM   316   N  NH2   . ARG A 1  72  ? 146.471 130.234 159.716 1.00 75.94  ? 72  ARG A NH2   1 
ATOM   317   N  N     . GLU A 1  73  ? 141.326 136.247 155.327 1.00 79.76  ? 73  GLU A N     1 
ATOM   318   C  CA    . GLU A 1  73  ? 140.355 136.692 154.331 1.00 79.76  ? 73  GLU A CA    1 
ATOM   319   C  C     . GLU A 1  73  ? 140.866 137.894 153.552 1.00 79.76  ? 73  GLU A C     1 
ATOM   320   O  O     . GLU A 1  73  ? 140.758 137.934 152.321 1.00 79.76  ? 73  GLU A O     1 
ATOM   321   C  CB    . GLU A 1  73  ? 139.029 137.042 154.983 1.00 79.76  ? 73  GLU A CB    1 
ATOM   322   C  CG    . GLU A 1  73  ? 138.010 137.452 153.954 1.00 79.76  ? 73  GLU A CG    1 
ATOM   323   C  CD    . GLU A 1  73  ? 136.717 137.904 154.559 1.00 79.76  ? 73  GLU A CD    1 
ATOM   324   O  OE1   . GLU A 1  73  ? 136.618 137.910 155.798 1.00 79.76  ? 73  GLU A OE1   1 
ATOM   325   O  OE2   . GLU A 1  73  ? 135.797 138.264 153.798 1.00 79.76  ? 73  GLU A OE2   1 
ATOM   326   N  N     . ILE A 1  74  ? 141.432 138.881 154.251 1.00 79.41  ? 74  ILE A N     1 
ATOM   327   C  CA    . ILE A 1  74  ? 142.028 140.016 153.557 1.00 79.41  ? 74  ILE A CA    1 
ATOM   328   C  C     . ILE A 1  74  ? 143.259 139.561 152.783 1.00 79.41  ? 74  ILE A C     1 
ATOM   329   O  O     . ILE A 1  74  ? 143.568 140.093 151.711 1.00 79.41  ? 74  ILE A O     1 
ATOM   330   C  CB    . ILE A 1  74  ? 142.347 141.135 154.564 1.00 79.41  ? 74  ILE A CB    1 
ATOM   331   C  CG1   . ILE A 1  74  ? 141.082 141.541 155.315 1.00 79.41  ? 74  ILE A CG1   1 
ATOM   332   C  CG2   . ILE A 1  74  ? 142.861 142.363 153.873 1.00 79.41  ? 74  ILE A CG2   1 
ATOM   333   C  CD1   . ILE A 1  74  ? 141.335 142.462 156.491 1.00 79.41  ? 74  ILE A CD1   1 
ATOM   334   N  N     . ALA A 1  75  ? 143.922 138.514 153.264 1.00 83.51  ? 75  ALA A N     1 
ATOM   335   C  CA    . ALA A 1  75  ? 145.096 137.978 152.595 1.00 83.51  ? 75  ALA A CA    1 
ATOM   336   C  C     . ALA A 1  75  ? 144.767 137.252 151.302 1.00 83.51  ? 75  ALA A C     1 
ATOM   337   O  O     . ALA A 1  75  ? 145.641 137.150 150.435 1.00 83.51  ? 75  ALA A O     1 
ATOM   338   C  CB    . ALA A 1  75  ? 145.834 137.034 153.537 1.00 83.51  ? 75  ALA A CB    1 
ATOM   339   N  N     . GLN A 1  76  ? 143.541 136.738 151.149 1.00 85.96  ? 76  GLN A N     1 
ATOM   340   C  CA    . GLN A 1  76  ? 143.207 136.013 149.924 1.00 85.96  ? 76  GLN A CA    1 
ATOM   341   C  C     . GLN A 1  76  ? 143.123 136.911 148.701 1.00 85.96  ? 76  GLN A C     1 
ATOM   342   O  O     . GLN A 1  76  ? 143.209 136.408 147.579 1.00 85.96  ? 76  GLN A O     1 
ATOM   343   C  CB    . GLN A 1  76  ? 141.883 135.270 150.065 1.00 85.96  ? 76  GLN A CB    1 
ATOM   344   C  CG    . GLN A 1  76  ? 141.934 134.060 150.948 1.00 85.96  ? 76  GLN A CG    1 
ATOM   345   C  CD    . GLN A 1  76  ? 140.636 133.297 150.918 1.00 85.96  ? 76  GLN A CD    1 
ATOM   346   O  OE1   . GLN A 1  76  ? 139.669 133.727 150.290 1.00 85.96  ? 76  GLN A OE1   1 
ATOM   347   N  NE2   . GLN A 1  76  ? 140.610 132.149 151.578 1.00 85.96  ? 76  GLN A NE2   1 
ATOM   348   N  N     . ASP A 1  77  ? 142.961 138.220 148.890 1.00 86.14  ? 77  ASP A N     1 
ATOM   349   C  CA    . ASP A 1  77  ? 142.726 139.094 147.751 1.00 86.14  ? 77  ASP A CA    1 
ATOM   350   C  C     . ASP A 1  77  ? 143.996 139.320 146.946 1.00 86.14  ? 77  ASP A C     1 
ATOM   351   O  O     . ASP A 1  77  ? 143.968 139.287 145.713 1.00 86.14  ? 77  ASP A O     1 
ATOM   352   C  CB    . ASP A 1  77  ? 142.153 140.422 148.226 1.00 86.14  ? 77  ASP A CB    1 
ATOM   353   C  CG    . ASP A 1  77  ? 140.775 140.275 148.812 1.00 86.14  ? 77  ASP A CG    1 
ATOM   354   O  OD1   . ASP A 1  77  ? 140.084 139.300 148.456 1.00 86.14  ? 77  ASP A OD1   1 
ATOM   355   O  OD2   . ASP A 1  77  ? 140.370 141.142 149.610 1.00 86.14  ? 77  ASP A OD2   1 
ATOM   356   N  N     . PHE A 1  78  ? 145.117 139.550 147.620 1.00 86.42  ? 78  PHE A N     1 
ATOM   357   C  CA    . PHE A 1  78  ? 146.335 139.873 146.897 1.00 86.42  ? 78  PHE A CA    1 
ATOM   358   C  C     . PHE A 1  78  ? 147.031 138.634 146.366 1.00 86.42  ? 78  PHE A C     1 
ATOM   359   O  O     . PHE A 1  78  ? 147.813 138.737 145.420 1.00 86.42  ? 78  PHE A O     1 
ATOM   360   C  CB    . PHE A 1  78  ? 147.283 140.655 147.796 1.00 86.42  ? 78  PHE A CB    1 
ATOM   361   C  CG    . PHE A 1  78  ? 146.648 141.847 148.435 1.00 86.42  ? 78  PHE A CG    1 
ATOM   362   C  CD1   . PHE A 1  78  ? 146.335 142.966 147.692 1.00 86.42  ? 78  PHE A CD1   1 
ATOM   363   C  CD2   . PHE A 1  78  ? 146.375 141.851 149.788 1.00 86.42  ? 78  PHE A CD2   1 
ATOM   364   C  CE1   . PHE A 1  78  ? 145.742 144.063 148.288 1.00 86.42  ? 78  PHE A CE1   1 
ATOM   365   C  CE2   . PHE A 1  78  ? 145.789 142.943 150.387 1.00 86.42  ? 78  PHE A CE2   1 
ATOM   366   C  CZ    . PHE A 1  78  ? 145.472 144.048 149.637 1.00 86.42  ? 78  PHE A CZ    1 
ATOM   367   N  N     . LYS A 1  79  ? 146.755 137.475 146.950 1.00 86.08  ? 79  LYS A N     1 
ATOM   368   C  CA    . LYS A 1  79  ? 147.358 136.221 146.529 1.00 86.08  ? 79  LYS A CA    1 
ATOM   369   C  C     . LYS A 1  79  ? 146.488 135.095 147.066 1.00 86.08  ? 79  LYS A C     1 
ATOM   370   O  O     . LYS A 1  79  ? 145.919 135.217 148.152 1.00 86.08  ? 79  LYS A O     1 
ATOM   371   C  CB    . LYS A 1  79  ? 148.797 136.096 147.043 1.00 86.08  ? 79  LYS A CB    1 
ATOM   372   C  CG    . LYS A 1  79  ? 149.555 134.900 146.532 1.00 86.08  ? 79  LYS A CG    1 
ATOM   373   C  CD    . LYS A 1  79  ? 150.961 134.905 147.075 1.00 86.08  ? 79  LYS A CD    1 
ATOM   374   C  CE    . LYS A 1  79  ? 151.769 133.742 146.530 1.00 86.08  ? 79  LYS A CE    1 
ATOM   375   N  NZ    . LYS A 1  79  ? 151.252 132.438 147.024 1.00 86.08  ? 79  LYS A NZ    1 
ATOM   376   N  N     . THR A 1  80  ? 146.369 134.021 146.299 1.00 86.99  ? 80  THR A N     1 
ATOM   377   C  CA    . THR A 1  80  ? 145.602 132.868 146.737 1.00 86.99  ? 80  THR A CA    1 
ATOM   378   C  C     . THR A 1  80  ? 146.473 131.893 147.521 1.00 86.99  ? 80  THR A C     1 
ATOM   379   O  O     . THR A 1  80  ? 147.683 131.789 147.296 1.00 86.99  ? 80  THR A O     1 
ATOM   380   C  CB    . THR A 1  80  ? 144.955 132.163 145.539 1.00 86.99  ? 80  THR A CB    1 
ATOM   381   O  OG1   . THR A 1  80  ? 144.244 131.003 145.989 1.00 86.99  ? 80  THR A OG1   1 
ATOM   382   C  CG2   . THR A 1  80  ? 145.989 131.764 144.499 1.00 86.99  ? 80  THR A CG2   1 
ATOM   383   N  N     . ASP A 1  81  ? 145.836 131.216 148.486 1.00 86.17  ? 81  ASP A N     1 
ATOM   384   C  CA    . ASP A 1  81  ? 146.367 130.050 149.198 1.00 86.17  ? 81  ASP A CA    1 
ATOM   385   C  C     . ASP A 1  81  ? 147.662 130.360 149.951 1.00 86.17  ? 81  ASP A C     1 
ATOM   386   O  O     . ASP A 1  81  ? 148.722 129.799 149.677 1.00 86.17  ? 81  ASP A O     1 
ATOM   387   C  CB    . ASP A 1  81  ? 146.565 128.885 148.232 1.00 86.17  ? 81  ASP A CB    1 
ATOM   388   C  CG    . ASP A 1  81  ? 145.273 128.444 147.607 1.00 86.17  ? 81  ASP A CG    1 
ATOM   389   O  OD1   . ASP A 1  81  ? 144.218 128.652 148.239 1.00 86.17  ? 81  ASP A OD1   1 
ATOM   390   O  OD2   . ASP A 1  81  ? 145.307 127.893 146.489 1.00 86.17  ? 81  ASP A OD2   1 
ATOM   391   N  N     . LEU A 1  82  ? 147.553 131.260 150.918 1.00 83.23  ? 82  LEU A N     1 
ATOM   392   C  CA    . LEU A 1  82  ? 148.698 131.634 151.730 1.00 83.23  ? 82  LEU A CA    1 
ATOM   393   C  C     . LEU A 1  82  ? 148.838 130.718 152.938 1.00 83.23  ? 82  LEU A C     1 
ATOM   394   O  O     . LEU A 1  82  ? 148.051 129.794 153.153 1.00 83.23  ? 82  LEU A O     1 
ATOM   395   C  CB    . LEU A 1  82  ? 148.580 133.085 152.176 1.00 83.23  ? 82  LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  82  ? 148.805 134.057 151.033 1.00 83.23  ? 82  LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  82  ? 148.503 135.473 151.471 1.00 83.23  ? 82  LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  82  ? 150.241 133.929 150.576 1.00 83.23  ? 82  LEU A CD2   1 
ATOM   399   N  N     . ARG A 1  83  ? 149.866 130.988 153.736 1.00 81.72  ? 83  ARG A N     1 
ATOM   400   C  CA    . ARG A 1  83  ? 150.104 130.322 155.004 1.00 81.72  ? 83  ARG A CA    1 
ATOM   401   C  C     . ARG A 1  83  ? 150.687 131.334 155.972 1.00 81.72  ? 83  ARG A C     1 
ATOM   402   O  O     . ARG A 1  83  ? 151.460 132.205 155.571 1.00 81.72  ? 83  ARG A O     1 
ATOM   403   C  CB    . ARG A 1  83  ? 151.067 129.138 154.864 1.00 81.72  ? 83  ARG A CB    1 
ATOM   404   C  CG    . ARG A 1  83  ? 150.489 127.899 154.205 1.00 81.72  ? 83  ARG A CG    1 
ATOM   405   C  CD    . ARG A 1  83  ? 151.530 126.792 154.111 1.00 81.72  ? 83  ARG A CD    1 
ATOM   406   N  NE    . ARG A 1  83  ? 151.016 125.631 153.396 1.00 81.72  ? 83  ARG A NE    1 
ATOM   407   C  CZ    . ARG A 1  83  ? 150.427 124.597 153.981 1.00 81.72  ? 83  ARG A CZ    1 
ATOM   408   N  NH1   . ARG A 1  83  ? 150.287 124.571 155.294 1.00 81.72  ? 83  ARG A NH1   1 
ATOM   409   N  NH2   . ARG A 1  83  ? 149.986 123.584 153.251 1.00 81.72  ? 83  ARG A NH2   1 
ATOM   410   N  N     . PHE A 1  84  ? 150.325 131.215 157.244 1.00 77.95  ? 84  PHE A N     1 
ATOM   411   C  CA    . PHE A 1  84  ? 150.802 132.128 158.273 1.00 77.95  ? 84  PHE A CA    1 
ATOM   412   C  C     . PHE A 1  84  ? 151.490 131.377 159.396 1.00 77.95  ? 84  PHE A C     1 
ATOM   413   O  O     . PHE A 1  84  ? 150.996 130.348 159.856 1.00 77.95  ? 84  PHE A O     1 
ATOM   414   C  CB    . PHE A 1  84  ? 149.662 132.937 158.861 1.00 77.95  ? 84  PHE A CB    1 
ATOM   415   C  CG    . PHE A 1  84  ? 149.149 133.985 157.950 1.00 77.95  ? 84  PHE A CG    1 
ATOM   416   C  CD1   . PHE A 1  84  ? 149.846 135.165 157.789 1.00 77.95  ? 84  PHE A CD1   1 
ATOM   417   C  CD2   . PHE A 1  84  ? 147.969 133.805 157.259 1.00 77.95  ? 84  PHE A CD2   1 
ATOM   418   C  CE1   . PHE A 1  84  ? 149.384 136.151 156.947 1.00 77.95  ? 84  PHE A CE1   1 
ATOM   419   C  CE2   . PHE A 1  84  ? 147.497 134.787 156.415 1.00 77.95  ? 84  PHE A CE2   1 
ATOM   420   C  CZ    . PHE A 1  84  ? 148.207 135.963 156.262 1.00 77.95  ? 84  PHE A CZ    1 
ATOM   421   N  N     . GLN A 1  85  ? 152.624 131.900 159.846 1.00 78.41  ? 85  GLN A N     1 
ATOM   422   C  CA    . GLN A 1  85  ? 153.089 131.538 161.173 1.00 78.41  ? 85  GLN A CA    1 
ATOM   423   C  C     . GLN A 1  85  ? 152.139 132.132 162.199 1.00 78.41  ? 85  GLN A C     1 
ATOM   424   O  O     . GLN A 1  85  ? 151.506 133.161 161.959 1.00 78.41  ? 85  GLN A O     1 
ATOM   425   C  CB    . GLN A 1  85  ? 154.505 132.042 161.415 1.00 78.41  ? 85  GLN A CB    1 
ATOM   426   C  CG    . GLN A 1  85  ? 155.567 131.365 160.581 1.00 78.41  ? 85  GLN A CG    1 
ATOM   427   C  CD    . GLN A 1  85  ? 156.956 131.870 160.908 1.00 78.41  ? 85  GLN A CD    1 
ATOM   428   O  OE1   . GLN A 1  85  ? 157.112 132.770 161.726 1.00 78.41  ? 85  GLN A OE1   1 
ATOM   429   N  NE2   . GLN A 1  85  ? 157.971 131.295 160.278 1.00 78.41  ? 85  GLN A NE2   1 
ATOM   430   N  N     . SER A 1  86  ? 152.021 131.464 163.345 1.00 77.25  ? 86  SER A N     1 
ATOM   431   C  CA    . SER A 1  86  ? 151.061 131.902 164.353 1.00 77.25  ? 86  SER A CA    1 
ATOM   432   C  C     . SER A 1  86  ? 151.496 133.208 165.006 1.00 77.25  ? 86  SER A C     1 
ATOM   433   O  O     . SER A 1  86  ? 150.665 134.092 165.275 1.00 77.25  ? 86  SER A O     1 
ATOM   434   C  CB    . SER A 1  86  ? 150.884 130.814 165.402 1.00 77.25  ? 86  SER A CB    1 
ATOM   435   O  OG    . SER A 1  86  ? 152.076 130.635 166.138 1.00 77.25  ? 86  SER A OG    1 
ATOM   436   N  N     . SER A 1  87  ? 152.801 133.352 165.245 1.00 79.19  ? 87  SER A N     1 
ATOM   437   C  CA    . SER A 1  87  ? 153.319 134.546 165.894 1.00 79.19  ? 87  SER A CA    1 
ATOM   438   C  C     . SER A 1  87  ? 153.163 135.777 165.014 1.00 79.19  ? 87  SER A C     1 
ATOM   439   O  O     . SER A 1  87  ? 153.053 136.890 165.532 1.00 79.19  ? 87  SER A O     1 
ATOM   440   C  CB    . SER A 1  87  ? 154.785 134.341 166.261 1.00 79.19  ? 87  SER A CB    1 
ATOM   441   O  OG    . SER A 1  87  ? 155.581 134.239 165.097 1.00 79.19  ? 87  SER A OG    1 
ATOM   442   N  N     . ALA A 1  88  ? 153.141 135.599 163.694 1.00 76.81  ? 88  ALA A N     1 
ATOM   443   C  CA    . ALA A 1  88  ? 152.873 136.720 162.805 1.00 76.81  ? 88  ALA A CA    1 
ATOM   444   C  C     . ALA A 1  88  ? 151.432 137.182 162.921 1.00 76.81  ? 88  ALA A C     1 
ATOM   445   O  O     . ALA A 1  88  ? 151.154 138.380 162.795 1.00 76.81  ? 88  ALA A O     1 
ATOM   446   C  CB    . ALA A 1  88  ? 153.180 136.337 161.367 1.00 76.81  ? 88  ALA A CB    1 
ATOM   447   N  N     . VAL A 1  89  ? 150.512 136.254 163.166 1.00 77.00  ? 89  VAL A N     1 
ATOM   448   C  CA    . VAL A 1  89  ? 149.135 136.642 163.430 1.00 77.00  ? 89  VAL A CA    1 
ATOM   449   C  C     . VAL A 1  89  ? 149.056 137.394 164.748 1.00 77.00  ? 89  VAL A C     1 
ATOM   450   O  O     . VAL A 1  89  ? 148.318 138.382 164.875 1.00 77.00  ? 89  VAL A O     1 
ATOM   451   C  CB    . VAL A 1  89  ? 148.230 135.399 163.414 1.00 77.00  ? 89  VAL A CB    1 
ATOM   452   C  CG1   . VAL A 1  89  ? 146.794 135.759 163.705 1.00 77.00  ? 89  VAL A CG1   1 
ATOM   453   C  CG2   . VAL A 1  89  ? 148.332 134.724 162.075 1.00 77.00  ? 89  VAL A CG2   1 
ATOM   454   N  N     . MET A 1  90  ? 149.862 136.978 165.733 1.00 79.44  ? 90  MET A N     1 
ATOM   455   C  CA    . MET A 1  90  ? 149.954 137.750 166.968 1.00 79.44  ? 90  MET A CA    1 
ATOM   456   C  C     . MET A 1  90  ? 150.559 139.125 166.723 1.00 79.44  ? 90  MET A C     1 
ATOM   457   O  O     . MET A 1  90  ? 150.208 140.090 167.410 1.00 79.44  ? 90  MET A O     1 
ATOM   458   C  CB    . MET A 1  90  ? 150.782 136.997 168.004 1.00 79.44  ? 90  MET A CB    1 
ATOM   459   C  CG    . MET A 1  90  ? 150.211 135.653 168.369 1.00 79.44  ? 90  MET A CG    1 
ATOM   460   S  SD    . MET A 1  90  ? 148.548 135.780 169.031 1.00 79.44  ? 90  MET A SD    1 
ATOM   461   C  CE    . MET A 1  90  ? 148.897 136.537 170.614 1.00 79.44  ? 90  MET A CE    1 
ATOM   462   N  N     . ALA A 1  91  ? 151.434 139.237 165.724 1.00 77.87  ? 91  ALA A N     1 
ATOM   463   C  CA    . ALA A 1  91  ? 152.089 140.507 165.440 1.00 77.87  ? 91  ALA A CA    1 
ATOM   464   C  C     . ALA A 1  91  ? 151.128 141.486 164.792 1.00 77.87  ? 91  ALA A C     1 
ATOM   465   O  O     . ALA A 1  91  ? 151.080 142.662 165.179 1.00 77.87  ? 91  ALA A O     1 
ATOM   466   C  CB    . ALA A 1  91  ? 153.302 140.281 164.544 1.00 77.87  ? 91  ALA A CB    1 
ATOM   467   N  N     . LEU A 1  92  ? 150.352 141.018 163.817 1.00 74.04  ? 92  LEU A N     1 
ATOM   468   C  CA    . LEU A 1  92  ? 149.321 141.865 163.234 1.00 74.04  ? 92  LEU A CA    1 
ATOM   469   C  C     . LEU A 1  92  ? 148.253 142.216 164.251 1.00 74.04  ? 92  LEU A C     1 
ATOM   470   O  O     . LEU A 1  92  ? 147.679 143.315 164.198 1.00 74.04  ? 92  LEU A O     1 
ATOM   471   C  CB    . LEU A 1  92  ? 148.705 141.168 162.032 1.00 74.04  ? 92  LEU A CB    1 
ATOM   472   C  CG    . LEU A 1  92  ? 149.746 140.946 160.943 1.00 74.04  ? 92  LEU A CG    1 
ATOM   473   C  CD1   . LEU A 1  92  ? 149.159 140.197 159.787 1.00 74.04  ? 92  LEU A CD1   1 
ATOM   474   C  CD2   . LEU A 1  92  ? 150.293 142.256 160.481 1.00 74.04  ? 92  LEU A CD2   1 
ATOM   475   N  N     . GLN A 1  93  ? 148.000 141.309 165.197 1.00 76.98  ? 93  GLN A N     1 
ATOM   476   C  CA    . GLN A 1  93  ? 147.085 141.608 166.289 1.00 76.98  ? 93  GLN A CA    1 
ATOM   477   C  C     . GLN A 1  93  ? 147.621 142.723 167.162 1.00 76.98  ? 93  GLN A C     1 
ATOM   478   O  O     . GLN A 1  93  ? 146.874 143.627 167.556 1.00 76.98  ? 93  GLN A O     1 
ATOM   479   C  CB    . GLN A 1  93  ? 146.845 140.342 167.102 1.00 76.98  ? 93  GLN A CB    1 
ATOM   480   C  CG    . GLN A 1  93  ? 145.804 140.458 168.169 1.00 76.98  ? 93  GLN A CG    1 
ATOM   481   C  CD    . GLN A 1  93  ? 145.574 139.133 168.848 1.00 76.98  ? 93  GLN A CD    1 
ATOM   482   O  OE1   . GLN A 1  93  ? 146.193 138.131 168.498 1.00 76.98  ? 93  GLN A OE1   1 
ATOM   483   N  NE2   . GLN A 1  93  ? 144.702 139.120 169.843 1.00 76.98  ? 93  GLN A NE2   1 
ATOM   484   N  N     . GLU A 1  94  ? 148.927 142.709 167.419 1.00 73.48  ? 94  GLU A N     1 
ATOM   485   C  CA    . GLU A 1  94  ? 149.499 143.675 168.341 1.00 73.48  ? 94  GLU A CA    1 
ATOM   486   C  C     . GLU A 1  94  ? 149.587 145.055 167.712 1.00 73.48  ? 94  GLU A C     1 
ATOM   487   O  O     . GLU A 1  94  ? 149.253 146.061 168.353 1.00 73.48  ? 94  GLU A O     1 
ATOM   488   C  CB    . GLU A 1  94  ? 150.874 143.198 168.789 1.00 73.48  ? 94  GLU A CB    1 
ATOM   489   C  CG    . GLU A 1  94  ? 151.466 144.001 169.916 1.00 73.48  ? 94  GLU A CG    1 
ATOM   490   C  CD    . GLU A 1  94  ? 150.782 143.738 171.245 1.00 73.48  ? 94  GLU A CD    1 
ATOM   491   O  OE1   . GLU A 1  94  ? 150.235 142.641 171.411 1.00 73.48  ? 94  GLU A OE1   1 
ATOM   492   O  OE2   . GLU A 1  94  ? 150.806 144.610 172.137 1.00 73.48  ? 94  GLU A OE2   1 
ATOM   493   N  N     . ALA A 1  95  ? 150.040 145.133 166.465 1.00 71.34  ? 95  ALA A N     1 
ATOM   494   C  CA    . ALA A 1  95  ? 150.093 146.439 165.823 1.00 71.34  ? 95  ALA A CA    1 
ATOM   495   C  C     . ALA A 1  95  ? 148.709 146.970 165.527 1.00 71.34  ? 95  ALA A C     1 
ATOM   496   O  O     . ALA A 1  95  ? 148.498 148.188 165.546 1.00 71.34  ? 95  ALA A O     1 
ATOM   497   C  CB    . ALA A 1  95  ? 150.889 146.374 164.535 1.00 71.34  ? 95  ALA A CB    1 
ATOM   498   N  N     . SER A 1  96  ? 147.751 146.081 165.276 1.00 72.12  ? 96  SER A N     1 
ATOM   499   C  CA    . SER A 1  96  ? 146.403 146.537 164.972 1.00 72.12  ? 96  SER A CA    1 
ATOM   500   C  C     . SER A 1  96  ? 145.703 147.074 166.211 1.00 72.12  ? 96  SER A C     1 
ATOM   501   O  O     . SER A 1  96  ? 145.024 148.110 166.148 1.00 72.12  ? 96  SER A O     1 
ATOM   502   C  CB    . SER A 1  96  ? 145.619 145.398 164.348 1.00 72.12  ? 96  SER A CB    1 
ATOM   503   O  OG    . SER A 1  96  ? 146.286 144.982 163.174 1.00 72.12  ? 96  SER A OG    1 
ATOM   504   N  N     . GLU A 1  97  ? 145.884 146.403 167.355 1.00 70.46  ? 97  GLU A N     1 
ATOM   505   C  CA    . GLU A 1  97  ? 145.335 146.959 168.581 1.00 70.46  ? 97  GLU A CA    1 
ATOM   506   C  C     . GLU A 1  97  ? 146.043 148.244 168.976 1.00 70.46  ? 97  GLU A C     1 
ATOM   507   O  O     . GLU A 1  97  ? 145.395 149.155 169.484 1.00 70.46  ? 97  GLU A O     1 
ATOM   508   C  CB    . GLU A 1  97  ? 145.374 145.945 169.732 1.00 70.46  ? 97  GLU A CB    1 
ATOM   509   C  CG    . GLU A 1  97  ? 146.734 145.456 170.202 1.00 70.46  ? 97  GLU A CG    1 
ATOM   510   C  CD    . GLU A 1  97  ? 147.398 146.368 171.218 1.00 70.46  ? 97  GLU A CD    1 
ATOM   511   O  OE1   . GLU A 1  97  ? 146.685 147.145 171.878 1.00 70.46  ? 97  GLU A OE1   1 
ATOM   512   O  OE2   . GLU A 1  97  ? 148.639 146.341 171.322 1.00 70.46  ? 97  GLU A OE2   1 
ATOM   513   N  N     . ALA A 1  98  ? 147.352 148.350 168.742 1.00 68.78  ? 98  ALA A N     1 
ATOM   514   C  CA    . ALA A 1  98  ? 148.040 149.563 169.171 1.00 68.78  ? 98  ALA A CA    1 
ATOM   515   C  C     . ALA A 1  98  ? 147.681 150.750 168.290 1.00 68.78  ? 98  ALA A C     1 
ATOM   516   O  O     . ALA A 1  98  ? 147.591 151.886 168.779 1.00 68.78  ? 98  ALA A O     1 
ATOM   517   C  CB    . ALA A 1  98  ? 149.544 149.342 169.172 1.00 68.78  ? 98  ALA A CB    1 
ATOM   518   N  N     . TYR A 1  99  ? 147.430 150.502 167.011 1.00 67.74  ? 99  TYR A N     1 
ATOM   519   C  CA    . TYR A 1  99  ? 146.999 151.581 166.143 1.00 67.74  ? 99  TYR A CA    1 
ATOM   520   C  C     . TYR A 1  99  ? 145.571 152.009 166.454 1.00 67.74  ? 99  TYR A C     1 
ATOM   521   O  O     . TYR A 1  99  ? 145.274 153.213 166.444 1.00 67.74  ? 99  TYR A O     1 
ATOM   522   C  CB    . TYR A 1  99  ? 147.126 151.168 164.688 1.00 67.74  ? 99  TYR A CB    1 
ATOM   523   C  CG    . TYR A 1  99  ? 146.565 152.190 163.755 1.00 67.74  ? 99  TYR A CG    1 
ATOM   524   C  CD1   . TYR A 1  99  ? 147.196 153.401 163.568 1.00 67.74  ? 99  TYR A CD1   1 
ATOM   525   C  CD2   . TYR A 1  99  ? 145.403 151.937 163.049 1.00 67.74  ? 99  TYR A CD2   1 
ATOM   526   C  CE1   . TYR A 1  99  ? 146.682 154.341 162.705 1.00 67.74  ? 99  TYR A CE1   1 
ATOM   527   C  CE2   . TYR A 1  99  ? 144.876 152.869 162.190 1.00 67.74  ? 99  TYR A CE2   1 
ATOM   528   C  CZ    . TYR A 1  99  ? 145.521 154.069 162.019 1.00 67.74  ? 99  TYR A CZ    1 
ATOM   529   O  OH    . TYR A 1  99  ? 144.988 154.987 161.154 1.00 67.74  ? 99  TYR A OH    1 
ATOM   530   N  N     . LEU A 1  100 ? 144.670 151.055 166.731 1.00 65.86  ? 100 LEU A N     1 
ATOM   531   C  CA    . LEU A 1  100 ? 143.315 151.458 167.107 1.00 65.86  ? 100 LEU A CA    1 
ATOM   532   C  C     . LEU A 1  100 ? 143.295 152.177 168.449 1.00 65.86  ? 100 LEU A C     1 
ATOM   533   O  O     . LEU A 1  100 ? 142.605 153.189 168.595 1.00 65.86  ? 100 LEU A O     1 
ATOM   534   C  CB    . LEU A 1  100 ? 142.362 150.269 167.156 1.00 65.86  ? 100 LEU A CB    1 
ATOM   535   C  CG    . LEU A 1  100 ? 141.921 149.621 165.854 1.00 65.86  ? 100 LEU A CG    1 
ATOM   536   C  CD1   . LEU A 1  100 ? 140.978 148.478 166.151 1.00 65.86  ? 100 LEU A CD1   1 
ATOM   537   C  CD2   . LEU A 1  100 ? 141.269 150.633 164.948 1.00 65.86  ? 100 LEU A CD2   1 
ATOM   538   N  N     . VAL A 1  101 ? 144.045 151.663 169.431 1.00 63.69  ? 101 VAL A N     1 
ATOM   539   C  CA    . VAL A 1  101 ? 144.113 152.262 170.760 1.00 63.69  ? 101 VAL A CA    1 
ATOM   540   C  C     . VAL A 1  101 ? 144.624 153.694 170.687 1.00 63.69  ? 101 VAL A C     1 
ATOM   541   O  O     . VAL A 1  101 ? 144.031 154.605 171.280 1.00 63.69  ? 101 VAL A O     1 
ATOM   542   C  CB    . VAL A 1  101 ? 144.971 151.385 171.689 1.00 63.69  ? 101 VAL A CB    1 
ATOM   543   C  CG1   . VAL A 1  101 ? 145.477 152.170 172.876 1.00 63.69  ? 101 VAL A CG1   1 
ATOM   544   C  CG2   . VAL A 1  101 ? 144.137 150.252 172.215 1.00 63.69  ? 101 VAL A CG2   1 
ATOM   545   N  N     . ALA A 1  102 ? 145.689 153.925 169.915 1.00 64.48  ? 102 ALA A N     1 
ATOM   546   C  CA    . ALA A 1  102 ? 146.182 155.286 169.751 1.00 64.48  ? 102 ALA A CA    1 
ATOM   547   C  C     . ALA A 1  102 ? 145.173 156.160 169.025 1.00 64.48  ? 102 ALA A C     1 
ATOM   548   O  O     . ALA A 1  102 ? 145.044 157.353 169.343 1.00 64.48  ? 102 ALA A O     1 
ATOM   549   C  CB    . ALA A 1  102 ? 147.515 155.277 169.009 1.00 64.48  ? 102 ALA A CB    1 
ATOM   550   N  N     . LEU A 1  103 ? 144.418 155.573 168.097 1.00 65.17  ? 103 LEU A N     1 
ATOM   551   C  CA    . LEU A 1  103 ? 143.349 156.325 167.455 1.00 65.17  ? 103 LEU A CA    1 
ATOM   552   C  C     . LEU A 1  103 ? 142.250 156.723 168.445 1.00 65.17  ? 103 LEU A C     1 
ATOM   553   O  O     . LEU A 1  103 ? 141.698 157.824 168.335 1.00 65.17  ? 103 LEU A O     1 
ATOM   554   C  CB    . LEU A 1  103 ? 142.776 155.521 166.296 1.00 65.17  ? 103 LEU A CB    1 
ATOM   555   C  CG    . LEU A 1  103 ? 141.687 156.205 165.486 1.00 65.17  ? 103 LEU A CG    1 
ATOM   556   C  CD1   . LEU A 1  103 ? 142.246 157.448 164.858 1.00 65.17  ? 103 LEU A CD1   1 
ATOM   557   C  CD2   . LEU A 1  103 ? 141.154 155.282 164.426 1.00 65.17  ? 103 LEU A CD2   1 
ATOM   558   N  N     . PHE A 1  104 ? 141.955 155.887 169.449 1.00 65.87  ? 104 PHE A N     1 
ATOM   559   C  CA    . PHE A 1  104 ? 140.944 156.295 170.423 1.00 65.87  ? 104 PHE A CA    1 
ATOM   560   C  C     . PHE A 1  104 ? 141.479 157.292 171.437 1.00 65.87  ? 104 PHE A C     1 
ATOM   561   O  O     . PHE A 1  104 ? 140.696 158.085 171.974 1.00 65.87  ? 104 PHE A O     1 
ATOM   562   C  CB    . PHE A 1  104 ? 140.357 155.104 171.171 1.00 65.87  ? 104 PHE A CB    1 
ATOM   563   C  CG    . PHE A 1  104 ? 139.595 154.174 170.306 1.00 65.87  ? 104 PHE A CG    1 
ATOM   564   C  CD1   . PHE A 1  104 ? 138.454 154.593 169.674 1.00 65.87  ? 104 PHE A CD1   1 
ATOM   565   C  CD2   . PHE A 1  104 ? 139.971 152.853 170.199 1.00 65.87  ? 104 PHE A CD2   1 
ATOM   566   C  CE1   . PHE A 1  104 ? 137.740 153.735 168.884 1.00 65.87  ? 104 PHE A CE1   1 
ATOM   567   C  CE2   . PHE A 1  104 ? 139.263 151.986 169.413 1.00 65.87  ? 104 PHE A CE2   1 
ATOM   568   C  CZ    . PHE A 1  104 ? 138.140 152.423 168.760 1.00 65.87  ? 104 PHE A CZ    1 
ATOM   569   N  N     . GLU A 1  105 ? 142.782 157.228 171.742 1.00 66.62  ? 105 GLU A N     1 
ATOM   570   C  CA    . GLU A 1  105 ? 143.438 158.289 172.502 1.00 66.62  ? 105 GLU A CA    1 
ATOM   571   C  C     . GLU A 1  105 ? 143.200 159.629 171.833 1.00 66.62  ? 105 GLU A C     1 
ATOM   572   O  O     . GLU A 1  105 ? 142.688 160.584 172.445 1.00 66.62  ? 105 GLU A O     1 
ATOM   573   C  CB    . GLU A 1  105 ? 144.946 158.029 172.570 1.00 66.62  ? 105 GLU A CB    1 
ATOM   574   C  CG    . GLU A 1  105 ? 145.404 156.767 173.266 1.00 66.62  ? 105 GLU A CG    1 
ATOM   575   C  CD    . GLU A 1  105 ? 145.340 156.839 174.771 1.00 66.62  ? 105 GLU A CD    1 
ATOM   576   O  OE1   . GLU A 1  105 ? 145.505 157.941 175.328 1.00 66.62  ? 105 GLU A OE1   1 
ATOM   577   O  OE2   . GLU A 1  105 ? 145.158 155.778 175.397 1.00 66.62  ? 105 GLU A OE2   1 
ATOM   578   N  N     . ASP A 1  106 ? 143.484 159.683 170.537 1.00 67.05  ? 106 ASP A N     1 
ATOM   579   C  CA    . ASP A 1  106 ? 143.467 160.973 169.882 1.00 67.05  ? 106 ASP A CA    1 
ATOM   580   C  C     . ASP A 1  106 ? 142.051 161.448 169.591 1.00 67.05  ? 106 ASP A C     1 
ATOM   581   O  O     . ASP A 1  106 ? 141.769 162.647 169.704 1.00 67.05  ? 106 ASP A O     1 
ATOM   582   C  CB    . ASP A 1  106 ? 144.257 160.912 168.595 1.00 67.05  ? 106 ASP A CB    1 
ATOM   583   C  CG    . ASP A 1  106 ? 144.694 162.256 168.166 1.00 67.05  ? 106 ASP A CG    1 
ATOM   584   O  OD1   . ASP A 1  106 ? 145.769 162.670 168.647 1.00 67.05  ? 106 ASP A OD1   1 
ATOM   585   O  OD2   . ASP A 1  106 ? 143.931 162.924 167.440 1.00 67.05  ? 106 ASP A OD2   1 
ATOM   586   N  N     . THR A 1  107 ? 141.143 160.536 169.225 1.00 64.23  ? 107 THR A N     1 
ATOM   587   C  CA    . THR A 1  107 ? 139.763 160.964 169.023 1.00 64.23  ? 107 THR A CA    1 
ATOM   588   C  C     . THR A 1  107 ? 139.087 161.296 170.346 1.00 64.23  ? 107 THR A C     1 
ATOM   589   O  O     . THR A 1  107 ? 138.111 162.059 170.358 1.00 64.23  ? 107 THR A O     1 
ATOM   590   C  CB    . THR A 1  107 ? 138.959 159.909 168.246 1.00 64.23  ? 107 THR A CB    1 
ATOM   591   O  OG1   . THR A 1  107 ? 137.752 160.498 167.759 1.00 64.23  ? 107 THR A OG1   1 
ATOM   592   C  CG2   . THR A 1  107 ? 138.567 158.748 169.110 1.00 64.23  ? 107 THR A CG2   1 
ATOM   593   N  N     . ASN A 1  108 ? 139.622 160.787 171.461 1.00 65.27  ? 108 ASN A N     1 
ATOM   594   C  CA    . ASN A 1  108 ? 139.136 161.206 172.765 1.00 65.27  ? 108 ASN A CA    1 
ATOM   595   C  C     . ASN A 1  108 ? 139.545 162.635 173.054 1.00 65.27  ? 108 ASN A C     1 
ATOM   596   O  O     . ASN A 1  108 ? 138.745 163.417 173.582 1.00 65.27  ? 108 ASN A O     1 
ATOM   597   C  CB    . ASN A 1  108 ? 139.668 160.282 173.847 1.00 65.27  ? 108 ASN A CB    1 
ATOM   598   C  CG    . ASN A 1  108 ? 138.910 160.415 175.120 1.00 65.27  ? 108 ASN A CG    1 
ATOM   599   O  OD1   . ASN A 1  108 ? 137.899 161.109 175.178 1.00 65.27  ? 108 ASN A OD1   1 
ATOM   600   N  ND2   . ASN A 1  108 ? 139.404 159.785 176.169 1.00 65.27  ? 108 ASN A ND2   1 
ATOM   601   N  N     . LEU A 1  109 ? 140.783 163.000 172.708 1.00 62.48  ? 109 LEU A N     1 
ATOM   602   C  CA    . LEU A 1  109 ? 141.174 164.399 172.831 1.00 62.48  ? 109 LEU A CA    1 
ATOM   603   C  C     . LEU A 1  109 ? 140.382 165.290 171.891 1.00 62.48  ? 109 LEU A C     1 
ATOM   604   O  O     . LEU A 1  109 ? 140.106 166.452 172.222 1.00 62.48  ? 109 LEU A O     1 
ATOM   605   C  CB    . LEU A 1  109 ? 142.657 164.543 172.563 1.00 62.48  ? 109 LEU A CB    1 
ATOM   606   C  CG    . LEU A 1  109 ? 143.521 163.921 173.641 1.00 62.48  ? 109 LEU A CG    1 
ATOM   607   C  CD1   . LEU A 1  109 ? 144.929 163.877 173.149 1.00 62.48  ? 109 LEU A CD1   1 
ATOM   608   C  CD2   . LEU A 1  109 ? 143.420 164.766 174.884 1.00 62.48  ? 109 LEU A CD2   1 
ATOM   609   N  N     . CYS A 1  110 ? 139.995 164.756 170.733 1.00 67.50  ? 110 CYS A N     1 
ATOM   610   C  CA    . CYS A 1  110 ? 139.161 165.504 169.802 1.00 67.50  ? 110 CYS A CA    1 
ATOM   611   C  C     . CYS A 1  110 ? 137.796 165.824 170.395 1.00 67.50  ? 110 CYS A C     1 
ATOM   612   O  O     . CYS A 1  110 ? 137.379 166.988 170.425 1.00 67.50  ? 110 CYS A O     1 
ATOM   613   C  CB    . CYS A 1  110 ? 138.994 164.721 168.509 1.00 67.50  ? 110 CYS A CB    1 
ATOM   614   S  SG    . CYS A 1  110 ? 137.842 165.505 167.390 1.00 67.50  ? 110 CYS A SG    1 
ATOM   615   N  N     . ALA A 1  111 ? 137.079 164.803 170.869 1.00 66.41  ? 111 ALA A N     1 
ATOM   616   C  CA    . ALA A 1  111 ? 135.727 165.043 171.360 1.00 66.41  ? 111 ALA A CA    1 
ATOM   617   C  C     . ALA A 1  111 ? 135.715 165.770 172.698 1.00 66.41  ? 111 ALA A C     1 
ATOM   618   O  O     . ALA A 1  111 ? 134.757 166.493 172.989 1.00 66.41  ? 111 ALA A O     1 
ATOM   619   C  CB    . ALA A 1  111 ? 134.970 163.726 171.470 1.00 66.41  ? 111 ALA A CB    1 
ATOM   620   N  N     . ILE A 1  112 ? 136.745 165.589 173.531 1.00 65.75  ? 112 ILE A N     1 
ATOM   621   C  CA    . ILE A 1  112 ? 136.866 166.416 174.729 1.00 65.75  ? 112 ILE A CA    1 
ATOM   622   C  C     . ILE A 1  112 ? 137.124 167.862 174.344 1.00 65.75  ? 112 ILE A C     1 
ATOM   623   O  O     . ILE A 1  112 ? 136.623 168.789 174.991 1.00 65.75  ? 112 ILE A O     1 
ATOM   624   C  CB    . ILE A 1  112 ? 137.955 165.852 175.660 1.00 65.75  ? 112 ILE A CB    1 
ATOM   625   C  CG1   . ILE A 1  112 ? 137.475 164.551 176.287 1.00 65.75  ? 112 ILE A CG1   1 
ATOM   626   C  CG2   . ILE A 1  112 ? 138.342 166.815 176.772 1.00 65.75  ? 112 ILE A CG2   1 
ATOM   627   C  CD1   . ILE A 1  112 ? 138.558 163.796 176.975 1.00 65.75  ? 112 ILE A CD1   1 
ATOM   628   N  N     . HIS A 1  113 ? 137.800 168.082 173.225 1.00 66.07  ? 113 HIS A N     1 
ATOM   629   C  CA    . HIS A 1  113 ? 137.988 169.457 172.798 1.00 66.07  ? 113 HIS A CA    1 
ATOM   630   C  C     . HIS A 1  113 ? 136.720 170.076 172.193 1.00 66.07  ? 113 HIS A C     1 
ATOM   631   O  O     . HIS A 1  113 ? 136.741 171.249 171.814 1.00 66.07  ? 113 HIS A O     1 
ATOM   632   C  CB    . HIS A 1  113 ? 139.141 169.511 171.805 1.00 66.07  ? 113 HIS A CB    1 
ATOM   633   C  CG    . HIS A 1  113 ? 139.759 170.862 171.685 1.00 66.07  ? 113 HIS A CG    1 
ATOM   634   N  ND1   . HIS A 1  113 ? 140.580 171.383 172.658 1.00 66.07  ? 113 HIS A ND1   1 
ATOM   635   C  CD2   . HIS A 1  113 ? 139.655 171.810 170.729 1.00 66.07  ? 113 HIS A CD2   1 
ATOM   636   C  CE1   . HIS A 1  113 ? 140.974 172.588 172.296 1.00 66.07  ? 113 HIS A CE1   1 
ATOM   637   N  NE2   . HIS A 1  113 ? 140.425 172.873 171.132 1.00 66.07  ? 113 HIS A NE2   1 
ATOM   638   N  N     . ALA A 1  114 ? 135.617 169.332 172.103 1.00 67.04  ? 114 ALA A N     1 
ATOM   639   C  CA    . ALA A 1  114 ? 134.319 169.882 171.738 1.00 67.04  ? 114 ALA A CA    1 
ATOM   640   C  C     . ALA A 1  114 ? 133.406 170.062 172.942 1.00 67.04  ? 114 ALA A C     1 
ATOM   641   O  O     . ALA A 1  114 ? 132.215 170.339 172.760 1.00 67.04  ? 114 ALA A O     1 
ATOM   642   C  CB    . ALA A 1  114 ? 133.633 168.985 170.709 1.00 67.04  ? 114 ALA A CB    1 
ATOM   643   N  N     . LYS A 1  115 ? 133.953 169.931 174.157 1.00 67.93  ? 115 LYS A N     1 
ATOM   644   C  CA    . LYS A 1  115 ? 133.196 169.811 175.411 1.00 67.93  ? 115 LYS A CA    1 
ATOM   645   C  C     . LYS A 1  115 ? 132.120 168.731 175.315 1.00 67.93  ? 115 LYS A C     1 
ATOM   646   O  O     . LYS A 1  115 ? 130.954 168.942 175.649 1.00 67.93  ? 115 LYS A O     1 
ATOM   647   C  CB    . LYS A 1  115 ? 132.621 171.155 175.849 1.00 67.93  ? 115 LYS A CB    1 
ATOM   648   C  CG    . LYS A 1  115 ? 133.682 172.097 176.397 1.00 67.93  ? 115 LYS A CG    1 
ATOM   649   C  CD    . LYS A 1  115 ? 133.069 173.404 176.870 1.00 67.93  ? 115 LYS A CD    1 
ATOM   650   C  CE    . LYS A 1  115 ? 134.110 174.354 177.437 1.00 67.93  ? 115 LYS A CE    1 
ATOM   651   N  NZ    . LYS A 1  115 ? 134.620 173.875 178.747 1.00 67.93  ? 115 LYS A NZ    1 
ATOM   652   N  N     . ARG A 1  116 ? 132.536 167.566 174.824 1.00 69.42  ? 116 ARG A N     1 
ATOM   653   C  CA    . ARG A 1  116 ? 131.752 166.342 174.818 1.00 69.42  ? 116 ARG A CA    1 
ATOM   654   C  C     . ARG A 1  116 ? 132.566 165.235 175.464 1.00 69.42  ? 116 ARG A C     1 
ATOM   655   O  O     . ARG A 1  116 ? 133.797 165.278 175.493 1.00 69.42  ? 116 ARG A O     1 
ATOM   656   C  CB    . ARG A 1  116 ? 131.345 165.917 173.398 1.00 69.42  ? 116 ARG A CB    1 
ATOM   657   C  CG    . ARG A 1  116 ? 130.259 166.771 172.788 1.00 69.42  ? 116 ARG A CG    1 
ATOM   658   C  CD    . ARG A 1  116 ? 129.717 166.198 171.476 1.00 69.42  ? 116 ARG A CD    1 
ATOM   659   N  NE    . ARG A 1  116 ? 130.585 166.378 170.314 1.00 69.42  ? 116 ARG A NE    1 
ATOM   660   C  CZ    . ARG A 1  116 ? 131.108 165.385 169.604 1.00 69.42  ? 116 ARG A CZ    1 
ATOM   661   N  NH1   . ARG A 1  116 ? 130.860 164.136 169.942 1.00 69.42  ? 116 ARG A NH1   1 
ATOM   662   N  NH2   . ARG A 1  116 ? 131.875 165.641 168.559 1.00 69.42  ? 116 ARG A NH2   1 
ATOM   663   N  N     . VAL A 1  117 ? 131.868 164.236 175.995 1.00 66.83  ? 117 VAL A N     1 
ATOM   664   C  CA    . VAL A 1  117 ? 132.535 163.092 176.601 1.00 66.83  ? 117 VAL A CA    1 
ATOM   665   C  C     . VAL A 1  117 ? 132.102 161.831 175.874 1.00 66.83  ? 117 VAL A C     1 
ATOM   666   O  O     . VAL A 1  117 ? 132.047 160.746 176.459 1.00 66.83  ? 117 VAL A O     1 
ATOM   667   C  CB    . VAL A 1  117 ? 132.252 162.999 178.113 1.00 66.83  ? 117 VAL A CB    1 
ATOM   668   C  CG1   . VAL A 1  117 ? 132.899 164.151 178.841 1.00 66.83  ? 117 VAL A CG1   1 
ATOM   669   C  CG2   . VAL A 1  117 ? 130.766 163.007 178.392 1.00 66.83  ? 117 VAL A CG2   1 
ATOM   670   N  N     . THR A 1  118 ? 131.799 161.956 174.588 1.00 67.08  ? 118 THR A N     1 
ATOM   671   C  CA    . THR A 1  118 ? 131.371 160.801 173.818 1.00 67.08  ? 118 THR A CA    1 
ATOM   672   C  C     . THR A 1  118 ? 131.989 160.842 172.430 1.00 67.08  ? 118 THR A C     1 
ATOM   673   O  O     . THR A 1  118 ? 131.911 161.859 171.737 1.00 67.08  ? 118 THR A O     1 
ATOM   674   C  CB    . THR A 1  118 ? 129.847 160.744 173.732 1.00 67.08  ? 118 THR A CB    1 
ATOM   675   O  OG1   . THR A 1  118 ? 129.316 160.639 175.055 1.00 67.08  ? 118 THR A OG1   1 
ATOM   676   C  CG2   . THR A 1  118 ? 129.393 159.551 172.916 1.00 67.08  ? 118 THR A CG2   1 
ATOM   677   N  N     . ILE A 1  119 ? 132.615 159.735 172.046 1.00 65.35  ? 119 ILE A N     1 
ATOM   678   C  CA    . ILE A 1  119 ? 133.204 159.613 170.724 1.00 65.35  ? 119 ILE A CA    1 
ATOM   679   C  C     . ILE A 1  119 ? 132.096 159.503 169.690 1.00 65.35  ? 119 ILE A C     1 
ATOM   680   O  O     . ILE A 1  119 ? 131.194 158.672 169.816 1.00 65.35  ? 119 ILE A O     1 
ATOM   681   C  CB    . ILE A 1  119 ? 134.124 158.393 170.677 1.00 65.35  ? 119 ILE A CB    1 
ATOM   682   C  CG1   . ILE A 1  119 ? 135.136 158.486 171.804 1.00 65.35  ? 119 ILE A CG1   1 
ATOM   683   C  CG2   . ILE A 1  119 ? 134.822 158.293 169.349 1.00 65.35  ? 119 ILE A CG2   1 
ATOM   684   C  CD1   . ILE A 1  119 ? 135.957 159.712 171.762 1.00 65.35  ? 119 ILE A CD1   1 
ATOM   685   N  N     . MET A 1  120 ? 132.165 160.334 168.662 1.00 74.01  ? 120 MET A N     1 
ATOM   686   C  CA    . MET A 1  120 ? 131.247 160.314 167.537 1.00 74.01  ? 120 MET A CA    1 
ATOM   687   C  C     . MET A 1  120 ? 132.060 160.201 166.256 1.00 74.01  ? 120 MET A C     1 
ATOM   688   O  O     . MET A 1  120 ? 133.235 160.567 166.260 1.00 74.01  ? 120 MET A O     1 
ATOM   689   C  CB    . MET A 1  120 ? 130.371 161.574 167.552 1.00 74.01  ? 120 MET A CB    1 
ATOM   690   C  CG    . MET A 1  120 ? 129.292 161.515 168.615 1.00 74.01  ? 120 MET A CG    1 
ATOM   691   S  SD    . MET A 1  120 ? 128.286 162.999 168.672 1.00 74.01  ? 120 MET A SD    1 
ATOM   692   C  CE    . MET A 1  120 ? 127.386 162.823 167.139 1.00 74.01  ? 120 MET A CE    1 
ATOM   693   N  N     . PRO A 1  121 ? 131.491 159.663 165.161 1.00 73.40  ? 121 PRO A N     1 
ATOM   694   C  CA    . PRO A 1  121 ? 132.345 159.237 164.036 1.00 73.40  ? 121 PRO A CA    1 
ATOM   695   C  C     . PRO A 1  121 ? 133.055 160.365 163.311 1.00 73.40  ? 121 PRO A C     1 
ATOM   696   O  O     . PRO A 1  121 ? 134.140 160.139 162.759 1.00 73.40  ? 121 PRO A O     1 
ATOM   697   C  CB    . PRO A 1  121 ? 131.364 158.523 163.101 1.00 73.40  ? 121 PRO A CB    1 
ATOM   698   C  CG    . PRO A 1  121 ? 130.255 158.122 163.957 1.00 73.40  ? 121 PRO A CG    1 
ATOM   699   C  CD    . PRO A 1  121 ? 130.105 159.217 164.941 1.00 73.40  ? 121 PRO A CD    1 
ATOM   700   N  N     . LYS A 1  122 ? 132.503 161.577 163.324 1.00 75.17  ? 122 LYS A N     1 
ATOM   701   C  CA    . LYS A 1  122 ? 133.209 162.698 162.718 1.00 75.17  ? 122 LYS A CA    1 
ATOM   702   C  C     . LYS A 1  122 ? 134.453 163.090 163.501 1.00 75.17  ? 122 LYS A C     1 
ATOM   703   O  O     . LYS A 1  122 ? 135.364 163.693 162.925 1.00 75.17  ? 122 LYS A O     1 
ATOM   704   C  CB    . LYS A 1  122 ? 132.267 163.890 162.561 1.00 75.17  ? 122 LYS A CB    1 
ATOM   705   C  CG    . LYS A 1  122 ? 131.688 164.444 163.844 1.00 75.17  ? 122 LYS A CG    1 
ATOM   706   C  CD    . LYS A 1  122 ? 130.736 165.593 163.534 1.00 75.17  ? 122 LYS A CD    1 
ATOM   707   C  CE    . LYS A 1  122 ? 130.038 166.117 164.773 1.00 75.17  ? 122 LYS A CE    1 
ATOM   708   N  NZ    . LYS A 1  122 ? 130.980 166.773 165.716 1.00 75.17  ? 122 LYS A NZ    1 
ATOM   709   N  N     . ASP A 1  123 ? 134.534 162.726 164.783 1.00 74.11  ? 123 ASP A N     1 
ATOM   710   C  CA    . ASP A 1  123 ? 135.768 162.934 165.532 1.00 74.11  ? 123 ASP A CA    1 
ATOM   711   C  C     . ASP A 1  123 ? 136.856 161.974 165.066 1.00 74.11  ? 123 ASP A C     1 
ATOM   712   O  O     . ASP A 1  123 ? 138.026 162.366 164.932 1.00 74.11  ? 123 ASP A O     1 
ATOM   713   C  CB    . ASP A 1  123 ? 135.499 162.755 167.020 1.00 74.11  ? 123 ASP A CB    1 
ATOM   714   C  CG    . ASP A 1  123 ? 134.472 163.726 167.543 1.00 74.11  ? 123 ASP A CG    1 
ATOM   715   O  OD1   . ASP A 1  123 ? 134.396 164.844 167.014 1.00 74.11  ? 123 ASP A OD1   1 
ATOM   716   O  OD2   . ASP A 1  123 ? 133.712 163.363 168.465 1.00 74.11  ? 123 ASP A OD2   1 
ATOM   717   N  N     . ILE A 1  124 ? 136.478 160.715 164.832 1.00 73.12  ? 124 ILE A N     1 
ATOM   718   C  CA    . ILE A 1  124 ? 137.371 159.726 164.232 1.00 73.12  ? 124 ILE A CA    1 
ATOM   719   C  C     . ILE A 1  124 ? 137.885 160.222 162.890 1.00 73.12  ? 124 ILE A C     1 
ATOM   720   O  O     . ILE A 1  124 ? 139.092 160.159 162.603 1.00 73.12  ? 124 ILE A O     1 
ATOM   721   C  CB    . ILE A 1  124 ? 136.626 158.390 164.076 1.00 73.12  ? 124 ILE A CB    1 
ATOM   722   C  CG1   . ILE A 1  124 ? 136.146 157.894 165.435 1.00 73.12  ? 124 ILE A CG1   1 
ATOM   723   C  CG2   . ILE A 1  124 ? 137.498 157.362 163.396 1.00 73.12  ? 124 ILE A CG2   1 
ATOM   724   C  CD1   . ILE A 1  124 ? 135.147 156.769 165.337 1.00 73.12  ? 124 ILE A CD1   1 
ATOM   725   N  N     . GLN A 1  125 ? 136.979 160.767 162.073 1.00 73.17  ? 125 GLN A N     1 
ATOM   726   C  CA    . GLN A 1  125 ? 137.357 161.336 160.785 1.00 73.17  ? 125 GLN A CA    1 
ATOM   727   C  C     . GLN A 1  125 ? 138.289 162.530 160.945 1.00 73.17  ? 125 GLN A C     1 
ATOM   728   O  O     . GLN A 1  125 ? 139.192 162.723 160.116 1.00 73.17  ? 125 GLN A O     1 
ATOM   729   C  CB    . GLN A 1  125 ? 136.092 161.718 160.025 1.00 73.17  ? 125 GLN A CB    1 
ATOM   730   C  CG    . GLN A 1  125 ? 135.243 160.500 159.705 1.00 73.17  ? 125 GLN A CG    1 
ATOM   731   C  CD    . GLN A 1  125 ? 133.872 160.838 159.165 1.00 73.17  ? 125 GLN A CD    1 
ATOM   732   O  OE1   . GLN A 1  125 ? 133.508 162.003 159.036 1.00 73.17  ? 125 GLN A OE1   1 
ATOM   733   N  NE2   . GLN A 1  125 ? 133.090 159.812 158.873 1.00 73.17  ? 125 GLN A NE2   1 
ATOM   734   N  N     . LEU A 1  126 ? 138.126 163.300 162.026 1.00 69.27  ? 126 LEU A N     1 
ATOM   735   C  CA    . LEU A 1  126 ? 139.019 164.430 162.258 1.00 69.27  ? 126 LEU A CA    1 
ATOM   736   C  C     . LEU A 1  126 ? 140.429 163.963 162.562 1.00 69.27  ? 126 LEU A C     1 
ATOM   737   O  O     . LEU A 1  126 ? 141.380 164.402 161.909 1.00 69.27  ? 126 LEU A O     1 
ATOM   738   C  CB    . LEU A 1  126 ? 138.525 165.314 163.396 1.00 69.27  ? 126 LEU A CB    1 
ATOM   739   C  CG    . LEU A 1  126 ? 139.441 166.539 163.462 1.00 69.27  ? 126 LEU A CG    1 
ATOM   740   C  CD1   . LEU A 1  126 ? 139.279 167.368 162.199 1.00 69.27  ? 126 LEU A CD1   1 
ATOM   741   C  CD2   . LEU A 1  126 ? 139.229 167.398 164.679 1.00 69.27  ? 126 LEU A CD2   1 
ATOM   742   N  N     . ALA A 1  127 ? 140.581 163.062 163.540 1.00 69.37  ? 127 ALA A N     1 
ATOM   743   C  CA    . ALA A 1  127 ? 141.918 162.618 163.924 1.00 69.37  ? 127 ALA A CA    1 
ATOM   744   C  C     . ALA A 1  127 ? 142.622 161.869 162.802 1.00 69.37  ? 127 ALA A C     1 
ATOM   745   O  O     . ALA A 1  127 ? 143.848 161.976 162.656 1.00 69.37  ? 127 ALA A O     1 
ATOM   746   C  CB    . ALA A 1  127 ? 141.839 161.736 165.160 1.00 69.37  ? 127 ALA A CB    1 
ATOM   747   N  N     . ARG A 1  128 ? 141.862 161.141 161.982 1.00 74.63  ? 128 ARG A N     1 
ATOM   748   C  CA    . ARG A 1  128 ? 142.461 160.538 160.800 1.00 74.63  ? 128 ARG A CA    1 
ATOM   749   C  C     . ARG A 1  128 ? 142.884 161.589 159.785 1.00 74.63  ? 128 ARG A C     1 
ATOM   750   O  O     . ARG A 1  128 ? 143.866 161.380 159.067 1.00 74.63  ? 128 ARG A O     1 
ATOM   751   C  CB    . ARG A 1  128 ? 141.499 159.539 160.169 1.00 74.63  ? 128 ARG A CB    1 
ATOM   752   C  CG    . ARG A 1  128 ? 141.275 158.330 161.033 1.00 74.63  ? 128 ARG A CG    1 
ATOM   753   C  CD    . ARG A 1  128 ? 140.292 157.360 160.423 1.00 74.63  ? 128 ARG A CD    1 
ATOM   754   N  NE    . ARG A 1  128 ? 140.801 156.695 159.228 1.00 74.63  ? 128 ARG A NE    1 
ATOM   755   C  CZ    . ARG A 1  128 ? 140.253 156.802 158.023 1.00 74.63  ? 128 ARG A CZ    1 
ATOM   756   N  NH1   . ARG A 1  128 ? 139.166 157.538 157.856 1.00 74.63  ? 128 ARG A NH1   1 
ATOM   757   N  NH2   . ARG A 1  128 ? 140.781 156.157 156.994 1.00 74.63  ? 128 ARG A NH2   1 
ATOM   758   N  N     . ARG A 1  129 ? 142.185 162.728 159.789 1.00 72.78  ? 129 ARG A N     1 
ATOM   759   C  CA    . ARG A 1  129 ? 142.502 163.850 158.866 1.00 72.78  ? 129 ARG A CA    1 
ATOM   760   C  C     . ARG A 1  129 ? 143.611 164.710 159.480 1.00 72.78  ? 129 ARG A C     1 
ATOM   761   O  O     . ARG A 1  129 ? 144.560 165.053 158.752 1.00 72.78  ? 129 ARG A O     1 
ATOM   762   C  CB    . ARG A 1  129 ? 141.253 164.696 158.607 1.00 72.78  ? 129 ARG A CB    1 
ATOM   763   C  CG    . ARG A 1  129 ? 141.536 166.181 158.428 1.00 72.78  ? 129 ARG A CG    1 
ATOM   764   C  CD    . ARG A 1  129 ? 142.645 166.441 157.426 1.00 72.78  ? 129 ARG A CD    1 
ATOM   765   N  NE    . ARG A 1  129 ? 142.134 166.835 156.122 1.00 72.78  ? 129 ARG A NE    1 
ATOM   766   C  CZ    . ARG A 1  129 ? 140.989 166.410 155.602 1.00 72.78  ? 129 ARG A CZ    1 
ATOM   767   N  NH1   . ARG A 1  129 ? 140.443 167.059 154.588 1.00 72.78  ? 129 ARG A NH1   1 
ATOM   768   N  NH2   . ARG A 1  129 ? 140.393 165.340 156.097 1.00 72.78  ? 129 ARG A NH2   1 
ATOM   769   N  N     . ILE A 1  130 ? 143.487 165.047 160.767 1.00 68.84  ? 130 ILE A N     1 
ATOM   770   C  CA    . ILE A 1  130 ? 144.509 165.892 161.453 1.00 68.84  ? 130 ILE A CA    1 
ATOM   771   C  C     . ILE A 1  130 ? 145.857 165.164 161.422 1.00 68.84  ? 130 ILE A C     1 
ATOM   772   O  O     . ILE A 1  130 ? 146.844 165.772 160.974 1.00 68.84  ? 130 ILE A O     1 
ATOM   773   C  CB    . ILE A 1  130 ? 144.074 166.223 162.895 1.00 68.84  ? 130 ILE A CB    1 
ATOM   774   C  CG1   . ILE A 1  130 ? 143.100 167.402 162.933 1.00 68.84  ? 130 ILE A CG1   1 
ATOM   775   C  CG2   . ILE A 1  130 ? 145.288 166.476 163.775 1.00 68.84  ? 130 ILE A CG2   1 
ATOM   776   C  CD1   . ILE A 1  130 ? 143.762 168.729 163.215 1.00 68.84  ? 130 ILE A CD1   1 
ATOM   777   N  N     . ARG A 1  131 ? 145.883 163.908 161.879 1.00 70.85  ? 131 ARG A N     1 
ATOM   778   C  CA    . ARG A 1  131 ? 147.138 163.110 161.903 1.00 70.85  ? 131 ARG A CA    1 
ATOM   779   C  C     . ARG A 1  131 ? 147.730 163.054 160.491 1.00 70.85  ? 131 ARG A C     1 
ATOM   780   O  O     . ARG A 1  131 ? 148.947 163.277 160.352 1.00 70.85  ? 131 ARG A O     1 
ATOM   781   C  CB    . ARG A 1  131 ? 146.864 161.701 162.434 1.00 70.85  ? 131 ARG A CB    1 
ATOM   782   C  CG    . ARG A 1  131 ? 146.378 161.668 163.876 1.00 70.85  ? 131 ARG A CG    1 
ATOM   783   C  CD    . ARG A 1  131 ? 147.486 161.297 164.843 1.00 70.85  ? 131 ARG A CD    1 
ATOM   784   N  NE    . ARG A 1  131 ? 147.460 159.881 165.179 1.00 70.85  ? 131 ARG A NE    1 
ATOM   785   C  CZ    . ARG A 1  131 ? 146.645 158.995 164.622 1.00 70.85  ? 131 ARG A CZ    1 
ATOM   786   N  NH1   . ARG A 1  131 ? 146.458 158.998 163.313 1.00 70.85  ? 131 ARG A NH1   1 
ATOM   787   N  NH2   . ARG A 1  131 ? 146.017 158.108 165.374 1.00 70.85  ? 131 ARG A NH2   1 
ATOM   788   N  N     . GLY A 1  132 ? 146.882 162.757 159.503 1.00 76.00  ? 132 GLY A N     1 
ATOM   789   C  CA    . GLY A 1  132 ? 147.293 162.628 158.093 1.00 76.00  ? 132 GLY A CA    1 
ATOM   790   C  C     . GLY A 1  132 ? 146.746 161.342 157.499 1.00 76.00  ? 132 GLY A C     1 
ATOM   791   O  O     . GLY A 1  132 ? 146.903 161.134 156.281 1.00 76.00  ? 132 GLY A O     1 
ATOM   792   N  N     . GLU A 1  133 ? 146.114 160.517 158.339 1.00 79.44  ? 133 GLU A N     1 
ATOM   793   C  CA    . GLU A 1  133 ? 145.518 159.220 157.917 1.00 79.44  ? 133 GLU A CA    1 
ATOM   794   C  C     . GLU A 1  133 ? 144.623 159.449 156.692 1.00 79.44  ? 133 GLU A C     1 
ATOM   795   O  O     . GLU A 1  133 ? 144.793 158.721 155.695 1.00 79.44  ? 133 GLU A O     1 
ATOM   796   C  CB    . GLU A 1  133 ? 144.755 158.592 159.086 1.00 79.44  ? 133 GLU A CB    1 
ATOM   797   C  CG    . GLU A 1  133 ? 143.526 157.800 158.670 1.00 79.44  ? 133 GLU A CG    1 
ATOM   798   C  CD    . GLU A 1  133 ? 142.279 158.089 159.491 1.00 79.44  ? 133 GLU A CD    1 
ATOM   799   O  OE1   . GLU A 1  133 ? 141.363 157.244 159.486 1.00 79.44  ? 133 GLU A OE1   1 
ATOM   800   O  OE2   . GLU A 1  133 ? 142.226 159.159 160.130 1.00 79.44  ? 133 GLU A OE2   1 
ATOM   801   N  N     . ARG A 1  134 ? 143.715 160.427 156.771 1.00 80.12  ? 134 ARG A N     1 
ATOM   802   C  CA    . ARG A 1  134 ? 142.796 160.737 155.643 1.00 80.12  ? 134 ARG A CA    1 
ATOM   803   C  C     . ARG A 1  134 ? 143.623 160.941 154.370 1.00 80.12  ? 134 ARG A C     1 
ATOM   804   O  O     . ARG A 1  134 ? 144.179 162.043 154.200 1.00 80.12  ? 134 ARG A O     1 
ATOM   805   C  CB    . ARG A 1  134 ? 141.958 161.979 155.962 1.00 80.12  ? 134 ARG A CB    1 
ATOM   806   C  CG    . ARG A 1  134 ? 140.857 162.262 154.951 1.00 80.12  ? 134 ARG A CG    1 
ATOM   807   C  CD    . ARG A 1  134 ? 139.586 161.491 155.255 1.00 80.12  ? 134 ARG A CD    1 
ATOM   808   N  NE    . ARG A 1  134 ? 139.155 160.664 154.136 1.00 80.12  ? 134 ARG A NE    1 
ATOM   809   C  CZ    . ARG A 1  134 ? 138.325 159.633 154.238 1.00 80.12  ? 134 ARG A CZ    1 
ATOM   810   N  NH1   . ARG A 1  134 ? 137.909 159.233 155.428 1.00 80.12  ? 134 ARG A NH1   1 
ATOM   811   N  NH2   . ARG A 1  134 ? 137.913 159.006 153.152 1.00 80.12  ? 134 ARG A NH2   1 
ATOM   812   N  N     . ALA A 1  135 ? 143.700 159.910 153.523 1.00 30.00  ? 135 ALA A N     1 
ATOM   813   C  CA    . ALA A 1  135 ? 144.471 159.980 152.259 1.00 30.00  ? 135 ALA A CA    1 
ATOM   814   C  C     . ALA A 1  135 ? 144.072 161.238 151.479 1.00 30.00  ? 135 ALA A C     1 
ATOM   815   O  O     . ALA A 1  135 ? 144.964 162.081 151.263 1.00 30.00  ? 135 ALA A O     1 
ATOM   816   C  CB    . ALA A 1  135 ? 144.238 158.730 151.447 1.00 30.00  ? 135 ALA A CB    1 
ATOM   817   N  N     . ARG B 2  17  ? 127.576 120.577 162.016 1.00 30.00  ? 17  ARG B N     1 
ATOM   818   C  CA    . ARG B 2  17  ? 128.324 121.808 162.240 1.00 30.00  ? 17  ARG B CA    1 
ATOM   819   C  C     . ARG B 2  17  ? 127.710 122.631 163.368 1.00 30.00  ? 17  ARG B C     1 
ATOM   820   O  O     . ARG B 2  17  ? 128.389 123.453 163.986 1.00 30.00  ? 17  ARG B O     1 
ATOM   821   C  CB    . ARG B 2  17  ? 128.386 122.639 160.957 1.00 30.00  ? 17  ARG B CB    1 
ATOM   822   C  CG    . ARG B 2  17  ? 127.959 121.884 159.708 1.00 30.00  ? 17  ARG B CG    1 
ATOM   823   C  CD    . ARG B 2  17  ? 126.451 121.933 159.523 1.00 30.00  ? 17  ARG B CD    1 
ATOM   824   N  NE    . ARG B 2  17  ? 126.024 121.228 158.318 1.00 30.00  ? 17  ARG B NE    1 
ATOM   825   C  CZ    . ARG B 2  17  ? 126.619 121.342 157.135 1.00 30.00  ? 17  ARG B CZ    1 
ATOM   826   N  NH1   . ARG B 2  17  ? 126.162 120.662 156.093 1.00 30.00  ? 17  ARG B NH1   1 
ATOM   827   N  NH2   . ARG B 2  17  ? 127.672 122.135 156.994 1.00 30.00  ? 17  ARG B NH2   1 
ATOM   828   N  N     . HIS B 2  18  ? 126.427 122.408 163.632 1.00 30.00  ? 18  HIS B N     1 
ATOM   829   C  CA    . HIS B 2  18  ? 125.730 123.137 164.683 1.00 30.00  ? 18  HIS B CA    1 
ATOM   830   C  C     . HIS B 2  18  ? 125.909 124.639 164.493 1.00 30.00  ? 18  HIS B C     1 
ATOM   831   O  O     . HIS B 2  18  ? 126.858 125.227 165.013 1.00 30.00  ? 18  HIS B O     1 
ATOM   832   C  CB    . HIS B 2  18  ? 126.243 122.714 166.061 1.00 30.00  ? 18  HIS B CB    1 
ATOM   833   C  CG    . HIS B 2  18  ? 125.437 121.626 166.698 1.00 30.00  ? 18  HIS B CG    1 
ATOM   834   N  ND1   . HIS B 2  18  ? 125.266 120.388 166.117 1.00 30.00  ? 18  HIS B ND1   1 
ATOM   835   C  CD2   . HIS B 2  18  ? 124.756 121.589 167.868 1.00 30.00  ? 18  HIS B CD2   1 
ATOM   836   C  CE1   . HIS B 2  18  ? 124.514 119.636 166.900 1.00 30.00  ? 18  HIS B CE1   1 
ATOM   837   N  NE2   . HIS B 2  18  ? 124.191 120.341 167.969 1.00 30.00  ? 18  HIS B NE2   1 
ATOM   838   N  N     . ARG B 2  19  ? 124.990 125.244 163.744 1.00 30.00  ? 19  ARG B N     1 
ATOM   839   C  CA    . ARG B 2  19  ? 125.020 126.678 163.459 1.00 30.00  ? 19  ARG B CA    1 
ATOM   840   C  C     . ARG B 2  19  ? 126.391 127.131 162.961 1.00 30.00  ? 19  ARG B C     1 
ATOM   841   O  O     . ARG B 2  19  ? 126.817 126.744 161.873 1.00 30.00  ? 19  ARG B O     1 
ATOM   842   C  CB    . ARG B 2  19  ? 124.597 127.492 164.686 1.00 30.00  ? 19  ARG B CB    1 
ATOM   843   C  CG    . ARG B 2  19  ? 123.339 128.318 164.479 1.00 30.00  ? 19  ARG B CG    1 
ATOM   844   C  CD    . ARG B 2  19  ? 122.243 127.907 165.448 1.00 30.00  ? 19  ARG B CD    1 
ATOM   845   N  NE    . ARG B 2  19  ? 120.943 127.798 164.791 1.00 30.00  ? 19  ARG B NE    1 
ATOM   846   C  CZ    . ARG B 2  19  ? 119.836 128.392 165.224 1.00 30.00  ? 19  ARG B CZ    1 
ATOM   847   N  NH1   . ARG B 2  19  ? 119.866 129.140 166.318 1.00 30.00  ? 19  ARG B NH1   1 
ATOM   848   N  NH2   . ARG B 2  19  ? 118.697 128.238 164.563 1.00 30.00  ? 19  ARG B NH2   1 
ATOM   849   N  N     . LYS B 2  20  ? 127.060 127.951 163.771 1.00 163.31 ? 20  LYS B N     1 
ATOM   850   C  CA    . LYS B 2  20  ? 128.393 128.495 163.477 1.00 163.31 ? 20  LYS B CA    1 
ATOM   851   C  C     . LYS B 2  20  ? 128.619 128.926 162.024 1.00 163.31 ? 20  LYS B C     1 
ATOM   852   O  O     . LYS B 2  20  ? 129.613 128.552 161.401 1.00 163.31 ? 20  LYS B O     1 
ATOM   853   C  CB    . LYS B 2  20  ? 129.497 127.534 163.949 1.00 163.31 ? 20  LYS B CB    1 
ATOM   854   C  CG    . LYS B 2  20  ? 129.807 126.384 163.003 1.00 163.31 ? 20  LYS B CG    1 
ATOM   855   C  CD    . LYS B 2  20  ? 131.184 126.536 162.379 1.00 163.31 ? 20  LYS B CD    1 
ATOM   856   C  CE    . LYS B 2  20  ? 131.193 126.053 160.937 1.00 163.31 ? 20  LYS B CE    1 
ATOM   857   N  NZ    . LYS B 2  20  ? 132.574 125.974 160.386 1.00 163.31 ? 20  LYS B NZ    1 
ATOM   858   N  N     . VAL B 2  21  ? 127.693 129.720 161.495 1.00 153.01 ? 21  VAL B N     1 
ATOM   859   C  CA    . VAL B 2  21  ? 127.791 130.201 160.123 1.00 153.01 ? 21  VAL B CA    1 
ATOM   860   C  C     . VAL B 2  21  ? 128.582 131.503 160.059 1.00 153.01 ? 21  VAL B C     1 
ATOM   861   O  O     . VAL B 2  21  ? 128.995 132.039 161.087 1.00 153.01 ? 21  VAL B O     1 
ATOM   862   C  CB    . VAL B 2  21  ? 126.400 130.423 159.500 1.00 153.01 ? 21  VAL B CB    1 
ATOM   863   C  CG1   . VAL B 2  21  ? 126.386 129.953 158.053 1.00 153.01 ? 21  VAL B CG1   1 
ATOM   864   C  CG2   . VAL B 2  21  ? 125.334 129.704 160.312 1.00 153.01 ? 21  VAL B CG2   1 
ATOM   865   N  N     . LEU B 2  22  ? 128.789 132.007 158.847 1.00 142.69 ? 22  LEU B N     1 
ATOM   866   C  CA    . LEU B 2  22  ? 129.530 133.247 158.651 1.00 142.69 ? 22  LEU B CA    1 
ATOM   867   C  C     . LEU B 2  22  ? 128.932 134.379 159.479 1.00 142.69 ? 22  LEU B C     1 
ATOM   868   O  O     . LEU B 2  22  ? 129.632 135.020 160.265 1.00 142.69 ? 22  LEU B O     1 
ATOM   869   C  CB    . LEU B 2  22  ? 129.553 133.631 157.170 1.00 142.69 ? 22  LEU B CB    1 
ATOM   870   C  CG    . LEU B 2  22  ? 130.909 134.051 156.601 1.00 142.69 ? 22  LEU B CG    1 
ATOM   871   C  CD1   . LEU B 2  22  ? 131.978 134.026 157.684 1.00 142.69 ? 22  LEU B CD1   1 
ATOM   872   C  CD2   . LEU B 2  22  ? 131.303 133.160 155.433 1.00 142.69 ? 22  LEU B CD2   1 
ATOM   873   N  N     . ARG B 2  23  ? 127.635 134.614 159.294 1.00 132.12 ? 23  ARG B N     1 
ATOM   874   C  CA    . ARG B 2  23  ? 126.909 135.661 160.012 1.00 132.12 ? 23  ARG B CA    1 
ATOM   875   C  C     . ARG B 2  23  ? 127.628 137.006 159.966 1.00 132.12 ? 23  ARG B C     1 
ATOM   876   O  O     . ARG B 2  23  ? 127.016 138.040 159.696 1.00 132.12 ? 23  ARG B O     1 
ATOM   877   C  CB    . ARG B 2  23  ? 126.655 135.245 161.465 1.00 132.12 ? 23  ARG B CB    1 
ATOM   878   C  CG    . ARG B 2  23  ? 125.241 134.756 161.732 1.00 132.12 ? 23  ARG B CG    1 
ATOM   879   C  CD    . ARG B 2  23  ? 124.424 135.804 162.468 1.00 132.12 ? 23  ARG B CD    1 
ATOM   880   N  NE    . ARG B 2  23  ? 125.261 136.677 163.287 1.00 132.12 ? 23  ARG B NE    1 
ATOM   881   C  CZ    . ARG B 2  23  ? 125.577 137.926 162.964 1.00 132.12 ? 23  ARG B CZ    1 
ATOM   882   N  NH1   . ARG B 2  23  ? 125.126 138.456 161.835 1.00 132.12 ? 23  ARG B NH1   1 
ATOM   883   N  NH2   . ARG B 2  23  ? 126.345 138.648 163.769 1.00 132.12 ? 23  ARG B NH2   1 
ATOM   884   N  N     . ASP B 2  24  ? 128.930 136.984 160.231 1.00 122.92 ? 24  ASP B N     1 
ATOM   885   C  CA    . ASP B 2  24  ? 129.734 138.198 160.224 1.00 122.92 ? 24  ASP B CA    1 
ATOM   886   C  C     . ASP B 2  24  ? 131.094 137.930 159.589 1.00 122.92 ? 24  ASP B C     1 
ATOM   887   O  O     . ASP B 2  24  ? 131.954 137.287 160.192 1.00 122.92 ? 24  ASP B O     1 
ATOM   888   C  CB    . ASP B 2  24  ? 129.913 138.729 161.647 1.00 122.92 ? 24  ASP B CB    1 
ATOM   889   C  CG    . ASP B 2  24  ? 130.461 137.681 162.595 1.00 122.92 ? 24  ASP B CG    1 
ATOM   890   O  OD1   . ASP B 2  24  ? 129.653 136.951 163.207 1.00 122.92 ? 24  ASP B OD1   1 
ATOM   891   O  OD2   . ASP B 2  24  ? 131.699 137.586 162.727 1.00 122.92 ? 24  ASP B OD2   1 
ATOM   892   N  N     . ASN B 2  25  ? 131.281 138.422 158.369 1.00 111.92 ? 25  ASN B N     1 
ATOM   893   C  CA    . ASN B 2  25  ? 132.533 138.233 157.646 1.00 111.92 ? 25  ASN B CA    1 
ATOM   894   C  C     . ASN B 2  25  ? 133.699 138.925 158.345 1.00 111.92 ? 25  ASN B C     1 
ATOM   895   O  O     . ASN B 2  25  ? 134.548 138.272 158.953 1.00 111.92 ? 25  ASN B O     1 
ATOM   896   C  CB    . ASN B 2  25  ? 132.403 138.746 156.210 1.00 111.92 ? 25  ASN B CB    1 
ATOM   897   C  CG    . ASN B 2  25  ? 132.960 137.772 155.191 1.00 111.92 ? 25  ASN B CG    1 
ATOM   898   O  OD1   . ASN B 2  25  ? 134.006 137.160 155.407 1.00 111.92 ? 25  ASN B OD1   1 
ATOM   899   N  ND2   . ASN B 2  25  ? 132.262 137.624 154.071 1.00 111.92 ? 25  ASN B ND2   1 
ATOM   900   N  N     . ILE B 2  26  ? 133.738 140.250 158.250 1.00 96.56  ? 26  ILE B N     1 
ATOM   901   C  CA    . ILE B 2  26  ? 134.800 141.030 158.872 1.00 96.56  ? 26  ILE B CA    1 
ATOM   902   C  C     . ILE B 2  26  ? 134.281 141.782 160.093 1.00 96.56  ? 26  ILE B C     1 
ATOM   903   O  O     . ILE B 2  26  ? 134.686 142.914 160.356 1.00 96.56  ? 26  ILE B O     1 
ATOM   904   C  CB    . ILE B 2  26  ? 135.414 142.039 157.883 1.00 96.56  ? 26  ILE B CB    1 
ATOM   905   C  CG1   . ILE B 2  26  ? 136.675 142.669 158.478 1.00 96.56  ? 26  ILE B CG1   1 
ATOM   906   C  CG2   . ILE B 2  26  ? 134.399 143.110 157.516 1.00 96.56  ? 26  ILE B CG2   1 
ATOM   907   C  CD1   . ILE B 2  26  ? 136.532 144.141 158.794 1.00 96.56  ? 26  ILE B CD1   1 
ATOM   908   N  N     . GLN B 2  27  ? 133.383 141.144 160.837 1.00 94.83  ? 27  GLN B N     1 
ATOM   909   C  CA    . GLN B 2  27  ? 132.806 141.755 162.028 1.00 94.83  ? 27  GLN B CA    1 
ATOM   910   C  C     . GLN B 2  27  ? 133.196 141.008 163.299 1.00 94.83  ? 27  GLN B C     1 
ATOM   911   O  O     . GLN B 2  27  ? 132.533 141.135 164.329 1.00 94.83  ? 27  GLN B O     1 
ATOM   912   C  CB    . GLN B 2  27  ? 131.282 141.830 161.909 1.00 94.83  ? 27  GLN B CB    1 
ATOM   913   C  CG    . GLN B 2  27  ? 130.782 142.143 160.508 1.00 94.83  ? 27  GLN B CG    1 
ATOM   914   C  CD    . GLN B 2  27  ? 130.879 143.618 160.170 1.00 94.83  ? 27  GLN B CD    1 
ATOM   915   O  OE1   . GLN B 2  27  ? 131.944 144.224 160.288 1.00 94.83  ? 27  GLN B OE1   1 
ATOM   916   N  NE2   . GLN B 2  27  ? 129.765 144.203 159.747 1.00 94.83  ? 27  GLN B NE2   1 
ATOM   917   N  N     . GLY B 2  28  ? 134.271 140.227 163.222 1.00 95.80  ? 28  GLY B N     1 
ATOM   918   C  CA    . GLY B 2  28  ? 134.747 139.475 164.369 1.00 95.80  ? 28  GLY B CA    1 
ATOM   919   C  C     . GLY B 2  28  ? 134.993 140.404 165.542 1.00 95.80  ? 28  GLY B C     1 
ATOM   920   O  O     . GLY B 2  28  ? 134.668 140.087 166.686 1.00 95.80  ? 28  GLY B O     1 
ATOM   921   N  N     . ILE B 2  29  ? 135.574 141.561 165.244 1.00 88.82  ? 29  ILE B N     1 
ATOM   922   C  CA    . ILE B 2  29  ? 135.865 142.598 166.277 1.00 88.82  ? 29  ILE B CA    1 
ATOM   923   C  C     . ILE B 2  29  ? 134.539 142.986 166.938 1.00 88.82  ? 29  ILE B C     1 
ATOM   924   O  O     . ILE B 2  29  ? 134.158 144.170 166.855 1.00 88.82  ? 29  ILE B O     1 
ATOM   925   C  CB    . ILE B 2  29  ? 136.556 143.815 165.632 1.00 88.82  ? 29  ILE B CB    1 
ATOM   926   C  CG1   . ILE B 2  29  ? 135.917 144.177 164.290 1.00 88.82  ? 29  ILE B CG1   1 
ATOM   927   C  CG2   . ILE B 2  29  ? 138.052 143.571 165.496 1.00 88.82  ? 29  ILE B CG2   1 
ATOM   928   C  CD1   . ILE B 2  29  ? 134.453 143.815 164.191 1.00 88.82  ? 29  ILE B CD1   1 
ATOM   929   N  N     . THR B 2  30  ? 133.870 142.014 167.565 1.00 88.47  ? 30  THR B N     1 
ATOM   930   C  CA    . THR B 2  30  ? 132.592 142.248 168.204 1.00 88.47  ? 30  THR B CA    1 
ATOM   931   C  C     . THR B 2  30  ? 132.503 143.669 168.732 1.00 88.47  ? 30  THR B C     1 
ATOM   932   O  O     . THR B 2  30  ? 133.509 144.358 168.916 1.00 88.47  ? 30  THR B O     1 
ATOM   933   C  CB    . THR B 2  30  ? 132.389 141.280 169.355 1.00 88.47  ? 30  THR B CB    1 
ATOM   934   O  OG1   . THR B 2  30  ? 133.272 141.633 170.423 1.00 88.47  ? 30  THR B OG1   1 
ATOM   935   C  CG2   . THR B 2  30  ? 132.714 139.882 168.903 1.00 88.47  ? 30  THR B CG2   1 
ATOM   936   N  N     . LYS B 2  31  ? 131.267 144.099 168.964 1.00 85.92  ? 31  LYS B N     1 
ATOM   937   C  CA    . LYS B 2  31  ? 130.995 145.350 169.672 1.00 85.92  ? 31  LYS B CA    1 
ATOM   938   C  C     . LYS B 2  31  ? 131.664 145.448 171.043 1.00 85.92  ? 31  LYS B C     1 
ATOM   939   O  O     . LYS B 2  31  ? 132.299 146.487 171.303 1.00 85.92  ? 31  LYS B O     1 
ATOM   940   C  CB    . LYS B 2  31  ? 129.472 145.544 169.734 1.00 85.92  ? 31  LYS B CB    1 
ATOM   941   C  CG    . LYS B 2  31  ? 129.011 146.788 170.454 1.00 85.92  ? 31  LYS B CG    1 
ATOM   942   C  CD    . LYS B 2  31  ? 127.491 146.864 170.500 1.00 85.92  ? 31  LYS B CD    1 
ATOM   943   C  CE    . LYS B 2  31  ? 127.001 148.157 171.143 1.00 85.92  ? 31  LYS B CE    1 
ATOM   944   N  NZ    . LYS B 2  31  ? 127.347 148.257 172.588 1.00 85.92  ? 31  LYS B NZ    1 
ATOM   945   N  N     . PRO B 2  32  ? 131.622 144.442 171.943 1.00 86.64  ? 32  PRO B N     1 
ATOM   946   C  CA    . PRO B 2  32  ? 132.389 144.586 173.185 1.00 86.64  ? 32  PRO B CA    1 
ATOM   947   C  C     . PRO B 2  32  ? 133.887 144.542 172.997 1.00 86.64  ? 32  PRO B C     1 
ATOM   948   O  O     . PRO B 2  32  ? 134.599 145.036 173.874 1.00 86.64  ? 32  PRO B O     1 
ATOM   949   C  CB    . PRO B 2  32  ? 131.915 143.410 174.044 1.00 86.64  ? 32  PRO B CB    1 
ATOM   950   C  CG    . PRO B 2  32  ? 131.449 142.442 173.113 1.00 86.64  ? 32  PRO B CG    1 
ATOM   951   C  CD    . PRO B 2  32  ? 130.806 143.213 172.024 1.00 86.64  ? 32  PRO B CD    1 
ATOM   952   N  N     . ALA B 2  33  ? 134.398 143.986 171.898 1.00 85.54  ? 33  ALA B N     1 
ATOM   953   C  CA    . ALA B 2  33  ? 135.842 144.001 171.687 1.00 85.54  ? 33  ALA B CA    1 
ATOM   954   C  C     . ALA B 2  33  ? 136.336 145.405 171.360 1.00 85.54  ? 33  ALA B C     1 
ATOM   955   O  O     . ALA B 2  33  ? 137.358 145.851 171.895 1.00 85.54  ? 33  ALA B O     1 
ATOM   956   C  CB    . ALA B 2  33  ? 136.218 143.029 170.581 1.00 85.54  ? 33  ALA B CB    1 
ATOM   957   N  N     . ILE B 2  34  ? 135.608 146.119 170.503 1.00 83.14  ? 34  ILE B N     1 
ATOM   958   C  CA    . ILE B 2  34  ? 135.894 147.524 170.251 1.00 83.14  ? 34  ILE B CA    1 
ATOM   959   C  C     . ILE B 2  34  ? 135.669 148.349 171.512 1.00 83.14  ? 34  ILE B C     1 
ATOM   960   O  O     . ILE B 2  34  ? 136.404 149.316 171.768 1.00 83.14  ? 34  ILE B O     1 
ATOM   961   C  CB    . ILE B 2  34  ? 135.049 148.002 169.055 1.00 83.14  ? 34  ILE B CB    1 
ATOM   962   C  CG1   . ILE B 2  34  ? 135.511 147.284 167.798 1.00 83.14  ? 34  ILE B CG1   1 
ATOM   963   C  CG2   . ILE B 2  34  ? 135.144 149.492 168.830 1.00 83.14  ? 34  ILE B CG2   1 
ATOM   964   C  CD1   . ILE B 2  34  ? 134.600 147.494 166.635 1.00 83.14  ? 34  ILE B CD1   1 
ATOM   965   N  N     . ARG B 2  35  ? 134.694 147.961 172.347 1.00 82.07  ? 35  ARG B N     1 
ATOM   966   C  CA    . ARG B 2  35  ? 134.568 148.587 173.660 1.00 82.07  ? 35  ARG B CA    1 
ATOM   967   C  C     . ARG B 2  35  ? 135.809 148.357 174.511 1.00 82.07  ? 35  ARG B C     1 
ATOM   968   O  O     . ARG B 2  35  ? 136.277 149.278 175.181 1.00 82.07  ? 35  ARG B O     1 
ATOM   969   C  CB    . ARG B 2  35  ? 133.329 148.076 174.387 1.00 82.07  ? 35  ARG B CB    1 
ATOM   970   C  CG    . ARG B 2  35  ? 132.029 148.564 173.799 1.00 82.07  ? 35  ARG B CG    1 
ATOM   971   C  CD    . ARG B 2  35  ? 130.810 147.980 174.500 1.00 82.07  ? 35  ARG B CD    1 
ATOM   972   N  NE    . ARG B 2  35  ? 130.653 148.470 175.864 1.00 82.07  ? 35  ARG B NE    1 
ATOM   973   C  CZ    . ARG B 2  35  ? 130.803 147.713 176.942 1.00 82.07  ? 35  ARG B CZ    1 
ATOM   974   N  NH1   . ARG B 2  35  ? 131.121 146.437 176.813 1.00 82.07  ? 35  ARG B NH1   1 
ATOM   975   N  NH2   . ARG B 2  35  ? 130.644 148.231 178.149 1.00 82.07  ? 35  ARG B NH2   1 
ATOM   976   N  N     . ARG B 2  36  ? 136.389 147.160 174.452 1.00 81.36  ? 36  ARG B N     1 
ATOM   977   C  CA    . ARG B 2  36  ? 137.533 146.871 175.307 1.00 81.36  ? 36  ARG B CA    1 
ATOM   978   C  C     . ARG B 2  36  ? 138.774 147.614 174.838 1.00 81.36  ? 36  ARG B C     1 
ATOM   979   O  O     . ARG B 2  36  ? 139.555 148.100 175.662 1.00 81.36  ? 36  ARG B O     1 
ATOM   980   C  CB    . ARG B 2  36  ? 137.801 145.368 175.366 1.00 81.36  ? 36  ARG B CB    1 
ATOM   981   C  CG    . ARG B 2  36  ? 136.779 144.555 176.157 1.00 81.36  ? 36  ARG B CG    1 
ATOM   982   C  CD    . ARG B 2  36  ? 137.303 143.162 176.422 1.00 81.36  ? 36  ARG B CD    1 
ATOM   983   N  NE    . ARG B 2  36  ? 137.663 142.501 175.180 1.00 81.36  ? 36  ARG B NE    1 
ATOM   984   C  CZ    . ARG B 2  36  ? 136.836 141.746 174.475 1.00 81.36  ? 36  ARG B CZ    1 
ATOM   985   N  NH1   . ARG B 2  36  ? 135.601 141.545 174.906 1.00 81.36  ? 36  ARG B NH1   1 
ATOM   986   N  NH2   . ARG B 2  36  ? 137.247 141.187 173.347 1.00 81.36  ? 36  ARG B NH2   1 
ATOM   987   N  N     . LEU B 2  37  ? 138.958 147.741 173.524 1.00 78.97  ? 37  LEU B N     1 
ATOM   988   C  CA    . LEU B 2  37  ? 140.085 148.521 173.030 1.00 78.97  ? 37  LEU B CA    1 
ATOM   989   C  C     . LEU B 2  37  ? 139.915 150.003 173.322 1.00 78.97  ? 37  LEU B C     1 
ATOM   990   O  O     . LEU B 2  37  ? 140.893 150.688 173.650 1.00 78.97  ? 37  LEU B O     1 
ATOM   991   C  CB    . LEU B 2  37  ? 140.259 148.317 171.532 1.00 78.97  ? 37  LEU B CB    1 
ATOM   992   C  CG    . LEU B 2  37  ? 140.594 146.901 171.097 1.00 78.97  ? 37  LEU B CG    1 
ATOM   993   C  CD1   . LEU B 2  37  ? 140.715 146.855 169.591 1.00 78.97  ? 37  LEU B CD1   1 
ATOM   994   C  CD2   . LEU B 2  37  ? 141.863 146.444 171.761 1.00 78.97  ? 37  LEU B CD2   1 
ATOM   995   N  N     . ALA B 2  38  ? 138.687 150.511 173.214 1.00 79.05  ? 38  ALA B N     1 
ATOM   996   C  CA    . ALA B 2  38  ? 138.453 151.915 173.514 1.00 79.05  ? 38  ALA B CA    1 
ATOM   997   C  C     . ALA B 2  38  ? 138.653 152.198 174.992 1.00 79.05  ? 38  ALA B C     1 
ATOM   998   O  O     . ALA B 2  38  ? 139.198 153.242 175.363 1.00 79.05  ? 38  ALA B O     1 
ATOM   999   C  CB    . ALA B 2  38  ? 137.050 152.322 173.081 1.00 79.05  ? 38  ALA B CB    1 
ATOM   1000  N  N     . ARG B 2  39  ? 138.252 151.267 175.852 1.00 77.08  ? 39  ARG B N     1 
ATOM   1001  C  CA    . ARG B 2  39  ? 138.471 151.471 177.274 1.00 77.08  ? 39  ARG B CA    1 
ATOM   1002  C  C     . ARG B 2  39  ? 139.914 151.252 177.684 1.00 77.08  ? 39  ARG B C     1 
ATOM   1003  O  O     . ARG B 2  39  ? 140.321 151.753 178.736 1.00 77.08  ? 39  ARG B O     1 
ATOM   1004  C  CB    . ARG B 2  39  ? 137.554 150.586 178.098 1.00 77.08  ? 39  ARG B CB    1 
ATOM   1005  C  CG    . ARG B 2  39  ? 136.290 151.282 178.512 1.00 77.08  ? 39  ARG B CG    1 
ATOM   1006  C  CD    . ARG B 2  39  ? 135.266 151.366 177.431 1.00 77.08  ? 39  ARG B CD    1 
ATOM   1007  N  NE    . ARG B 2  39  ? 134.028 151.937 177.934 1.00 77.08  ? 39  ARG B NE    1 
ATOM   1008  C  CZ    . ARG B 2  39  ? 133.073 151.230 178.519 1.00 77.08  ? 39  ARG B CZ    1 
ATOM   1009  N  NH1   . ARG B 2  39  ? 133.216 149.922 178.675 1.00 77.08  ? 39  ARG B NH1   1 
ATOM   1010  N  NH2   . ARG B 2  39  ? 131.980 151.833 178.953 1.00 77.08  ? 39  ARG B NH2   1 
ATOM   1011  N  N     . ARG B 2  40  ? 140.700 150.514 176.901 1.00 77.39  ? 40  ARG B N     1 
ATOM   1012  C  CA    . ARG B 2  40  ? 142.138 150.610 177.102 1.00 77.39  ? 40  ARG B CA    1 
ATOM   1013  C  C     . ARG B 2  40  ? 142.633 151.979 176.684 1.00 77.39  ? 40  ARG B C     1 
ATOM   1014  O  O     . ARG B 2  40  ? 143.502 152.556 177.341 1.00 77.39  ? 40  ARG B O     1 
ATOM   1015  C  CB    . ARG B 2  40  ? 142.880 149.506 176.349 1.00 77.39  ? 40  ARG B CB    1 
ATOM   1016  C  CG    . ARG B 2  40  ? 144.383 149.598 176.486 1.00 77.39  ? 40  ARG B CG    1 
ATOM   1017  C  CD    . ARG B 2  40  ? 145.132 148.486 175.802 1.00 77.39  ? 40  ARG B CD    1 
ATOM   1018  N  NE    . ARG B 2  40  ? 145.149 147.249 176.561 1.00 77.39  ? 40  ARG B NE    1 
ATOM   1019  C  CZ    . ARG B 2  40  ? 145.703 146.127 176.120 1.00 77.39  ? 40  ARG B CZ    1 
ATOM   1020  N  NH1   . ARG B 2  40  ? 146.272 146.095 174.923 1.00 77.39  ? 40  ARG B NH1   1 
ATOM   1021  N  NH2   . ARG B 2  40  ? 145.694 145.036 176.876 1.00 77.39  ? 40  ARG B NH2   1 
ATOM   1022  N  N     . GLY B 2  41  ? 142.043 152.550 175.646 1.00 75.41  ? 41  GLY B N     1 
ATOM   1023  C  CA    . GLY B 2  41  ? 142.435 153.889 175.268 1.00 75.41  ? 41  GLY B CA    1 
ATOM   1024  C  C     . GLY B 2  41  ? 141.963 154.987 176.190 1.00 75.41  ? 41  GLY B C     1 
ATOM   1025  O  O     . GLY B 2  41  ? 142.361 156.137 176.008 1.00 75.41  ? 41  GLY B O     1 
ATOM   1026  N  N     . GLY B 2  42  ? 141.136 154.676 177.175 1.00 74.13  ? 42  GLY B N     1 
ATOM   1027  C  CA    . GLY B 2  42  ? 140.598 155.724 178.013 1.00 74.13  ? 42  GLY B CA    1 
ATOM   1028  C  C     . GLY B 2  42  ? 139.461 156.460 177.344 1.00 74.13  ? 42  GLY B C     1 
ATOM   1029  O  O     . GLY B 2  42  ? 139.561 157.653 177.059 1.00 74.13  ? 42  GLY B O     1 
ATOM   1030  N  N     . VAL B 2  43  ? 138.374 155.743 177.080 1.00 74.49  ? 43  VAL B N     1 
ATOM   1031  C  CA    . VAL B 2  43  ? 137.193 156.275 176.416 1.00 74.49  ? 43  VAL B CA    1 
ATOM   1032  C  C     . VAL B 2  43  ? 135.977 155.876 177.232 1.00 74.49  ? 43  VAL B C     1 
ATOM   1033  O  O     . VAL B 2  43  ? 135.774 154.690 177.508 1.00 74.49  ? 43  VAL B O     1 
ATOM   1034  C  CB    . VAL B 2  43  ? 137.071 155.749 174.979 1.00 74.49  ? 43  VAL B CB    1 
ATOM   1035  C  CG1   . VAL B 2  43  ? 135.703 156.029 174.426 1.00 74.49  ? 43  VAL B CG1   1 
ATOM   1036  C  CG2   . VAL B 2  43  ? 138.122 156.382 174.105 1.00 74.49  ? 43  VAL B CG2   1 
ATOM   1037  N  N     . LYS B 2  44  ? 135.166 156.859 177.611 1.00 78.96  ? 44  LYS B N     1 
ATOM   1038  C  CA    . LYS B 2  44  ? 134.060 156.594 178.518 1.00 78.96  ? 44  LYS B CA    1 
ATOM   1039  C  C     . LYS B 2  44  ? 132.820 156.107 177.781 1.00 78.96  ? 44  LYS B C     1 
ATOM   1040  O  O     . LYS B 2  44  ? 132.348 154.992 178.021 1.00 78.96  ? 44  LYS B O     1 
ATOM   1041  C  CB    . LYS B 2  44  ? 133.749 157.854 179.321 1.00 78.96  ? 44  LYS B CB    1 
ATOM   1042  C  CG    . LYS B 2  44  ? 132.708 157.692 180.386 1.00 78.96  ? 44  LYS B CG    1 
ATOM   1043  C  CD    . LYS B 2  44  ? 132.587 158.992 181.137 1.00 78.96  ? 44  LYS B CD    1 
ATOM   1044  C  CE    . LYS B 2  44  ? 131.519 158.941 182.189 1.00 78.96  ? 44  LYS B CE    1 
ATOM   1045  N  NZ    . LYS B 2  44  ? 131.429 160.255 182.873 1.00 78.96  ? 44  LYS B NZ    1 
ATOM   1046  N  N     . ARG B 2  45  ? 132.291 156.915 176.870 1.00 85.56  ? 45  ARG B N     1 
ATOM   1047  C  CA    . ARG B 2  45  ? 131.012 156.648 176.233 1.00 85.56  ? 45  ARG B CA    1 
ATOM   1048  C  C     . ARG B 2  45  ? 131.187 156.582 174.723 1.00 85.56  ? 45  ARG B C     1 
ATOM   1049  O  O     . ARG B 2  45  ? 131.813 157.460 174.127 1.00 85.56  ? 45  ARG B O     1 
ATOM   1050  C  CB    . ARG B 2  45  ? 129.993 157.718 176.625 1.00 85.56  ? 45  ARG B CB    1 
ATOM   1051  C  CG    . ARG B 2  45  ? 128.579 157.469 176.149 1.00 85.56  ? 45  ARG B CG    1 
ATOM   1052  C  CD    . ARG B 2  45  ? 127.620 158.457 176.798 1.00 85.56  ? 45  ARG B CD    1 
ATOM   1053  N  NE    . ARG B 2  45  ? 126.234 158.307 176.360 1.00 85.56  ? 45  ARG B NE    1 
ATOM   1054  C  CZ    . ARG B 2  45  ? 125.703 158.971 175.338 1.00 85.56  ? 45  ARG B CZ    1 
ATOM   1055  N  NH1   . ARG B 2  45  ? 126.442 159.822 174.646 1.00 85.56  ? 45  ARG B NH1   1 
ATOM   1056  N  NH2   . ARG B 2  45  ? 124.436 158.787 175.008 1.00 85.56  ? 45  ARG B NH2   1 
ATOM   1057  N  N     . ILE B 2  46  ? 130.626 155.545 174.110 1.00 82.43  ? 46  ILE B N     1 
ATOM   1058  C  CA    . ILE B 2  46  ? 130.818 155.243 172.698 1.00 82.43  ? 46  ILE B CA    1 
ATOM   1059  C  C     . ILE B 2  46  ? 129.482 155.374 171.986 1.00 82.43  ? 46  ILE B C     1 
ATOM   1060  O  O     . ILE B 2  46  ? 128.496 154.766 172.411 1.00 82.43  ? 46  ILE B O     1 
ATOM   1061  C  CB    . ILE B 2  46  ? 131.376 153.821 172.522 1.00 82.43  ? 46  ILE B CB    1 
ATOM   1062  C  CG1   . ILE B 2  46  ? 132.746 153.710 173.167 1.00 82.43  ? 46  ILE B CG1   1 
ATOM   1063  C  CG2   . ILE B 2  46  ? 131.438 153.439 171.070 1.00 82.43  ? 46  ILE B CG2   1 
ATOM   1064  C  CD1   . ILE B 2  46  ? 133.221 152.289 173.280 1.00 82.43  ? 46  ILE B CD1   1 
ATOM   1065  N  N     . SER B 2  47  ? 129.453 156.113 170.881 1.00 85.03  ? 47  SER B N     1 
ATOM   1066  C  CA    . SER B 2  47  ? 128.207 156.258 170.143 1.00 85.03  ? 47  SER B CA    1 
ATOM   1067  C  C     . SER B 2  47  ? 127.889 154.995 169.348 1.00 85.03  ? 47  SER B C     1 
ATOM   1068  O  O     . SER B 2  47  ? 128.558 153.965 169.447 1.00 85.03  ? 47  SER B O     1 
ATOM   1069  C  CB    . SER B 2  47  ? 128.252 157.456 169.208 1.00 85.03  ? 47  SER B CB    1 
ATOM   1070  O  OG    . SER B 2  47  ? 127.047 157.543 168.470 1.00 85.03  ? 47  SER B OG    1 
ATOM   1071  N  N     . GLY B 2  48  ? 126.854 155.089 168.523 1.00 91.18  ? 48  GLY B N     1 
ATOM   1072  C  CA    . GLY B 2  48  ? 126.272 153.918 167.905 1.00 91.18  ? 48  GLY B CA    1 
ATOM   1073  C  C     . GLY B 2  48  ? 126.953 153.481 166.629 1.00 91.18  ? 48  GLY B C     1 
ATOM   1074  O  O     . GLY B 2  48  ? 127.229 152.295 166.445 1.00 91.18  ? 48  GLY B O     1 
ATOM   1075  N  N     . LEU B 2  49  ? 127.244 154.425 165.747 1.00 89.58  ? 49  LEU B N     1 
ATOM   1076  C  CA    . LEU B 2  49  ? 127.853 154.084 164.472 1.00 89.58  ? 49  LEU B CA    1 
ATOM   1077  C  C     . LEU B 2  49  ? 129.365 153.959 164.549 1.00 89.58  ? 49  LEU B C     1 
ATOM   1078  O  O     . LEU B 2  49  ? 130.005 153.837 163.501 1.00 89.58  ? 49  LEU B O     1 
ATOM   1079  C  CB    . LEU B 2  49  ? 127.474 155.124 163.423 1.00 89.58  ? 49  LEU B CB    1 
ATOM   1080  C  CG    . LEU B 2  49  ? 125.993 155.177 163.057 1.00 89.58  ? 49  LEU B CG    1 
ATOM   1081  C  CD1   . LEU B 2  49  ? 125.721 156.334 162.120 1.00 89.58  ? 49  LEU B CD1   1 
ATOM   1082  C  CD2   . LEU B 2  49  ? 125.558 153.869 162.425 1.00 89.58  ? 49  LEU B CD2   1 
ATOM   1083  N  N     . ILE B 2  50  ? 129.940 154.000 165.754 1.00 86.75  ? 50  ILE B N     1 
ATOM   1084  C  CA    . ILE B 2  50  ? 131.385 153.921 165.931 1.00 86.75  ? 50  ILE B CA    1 
ATOM   1085  C  C     . ILE B 2  50  ? 131.908 152.572 165.476 1.00 86.75  ? 50  ILE B C     1 
ATOM   1086  O  O     . ILE B 2  50  ? 133.019 152.477 164.944 1.00 86.75  ? 50  ILE B O     1 
ATOM   1087  C  CB    . ILE B 2  50  ? 131.740 154.171 167.407 1.00 86.75  ? 50  ILE B CB    1 
ATOM   1088  C  CG1   . ILE B 2  50  ? 131.090 155.450 167.891 1.00 86.75  ? 50  ILE B CG1   1 
ATOM   1089  C  CG2   . ILE B 2  50  ? 133.237 154.294 167.602 1.00 86.75  ? 50  ILE B CG2   1 
ATOM   1090  C  CD1   . ILE B 2  50  ? 131.548 156.653 167.149 1.00 86.75  ? 50  ILE B CD1   1 
ATOM   1091  N  N     . TYR B 2  51  ? 131.104 151.524 165.638 1.00 88.32  ? 51  TYR B N     1 
ATOM   1092  C  CA    . TYR B 2  51  ? 131.614 150.172 165.474 1.00 88.32  ? 51  TYR B CA    1 
ATOM   1093  C  C     . TYR B 2  51  ? 131.850 149.842 164.010 1.00 88.32  ? 51  TYR B C     1 
ATOM   1094  O  O     . TYR B 2  51  ? 132.883 149.256 163.663 1.00 88.32  ? 51  TYR B O     1 
ATOM   1095  C  CB    . TYR B 2  51  ? 130.638 149.189 166.105 1.00 88.32  ? 51  TYR B CB    1 
ATOM   1096  C  CG    . TYR B 2  51  ? 130.355 149.546 167.533 1.00 88.32  ? 51  TYR B CG    1 
ATOM   1097  C  CD1   . TYR B 2  51  ? 131.283 149.296 168.531 1.00 88.32  ? 51  TYR B CD1   1 
ATOM   1098  C  CD2   . TYR B 2  51  ? 129.159 150.148 167.882 1.00 88.32  ? 51  TYR B CD2   1 
ATOM   1099  C  CE1   . TYR B 2  51  ? 131.024 149.641 169.835 1.00 88.32  ? 51  TYR B CE1   1 
ATOM   1100  C  CE2   . TYR B 2  51  ? 128.889 150.492 169.180 1.00 88.32  ? 51  TYR B CE2   1 
ATOM   1101  C  CZ    . TYR B 2  51  ? 129.820 150.235 170.154 1.00 88.32  ? 51  TYR B CZ    1 
ATOM   1102  O  OH    . TYR B 2  51  ? 129.542 150.582 171.451 1.00 88.32  ? 51  TYR B OH    1 
ATOM   1103  N  N     . GLU B 2  52  ? 130.921 150.239 163.139 1.00 91.70  ? 52  GLU B N     1 
ATOM   1104  C  CA    . GLU B 2  52  ? 131.065 149.968 161.712 1.00 91.70  ? 52  GLU B CA    1 
ATOM   1105  C  C     . GLU B 2  52  ? 132.237 150.741 161.115 1.00 91.70  ? 52  GLU B C     1 
ATOM   1106  O  O     . GLU B 2  52  ? 133.018 150.190 160.323 1.00 91.70  ? 52  GLU B O     1 
ATOM   1107  C  CB    . GLU B 2  52  ? 129.762 150.310 160.995 1.00 91.70  ? 52  GLU B CB    1 
ATOM   1108  C  CG    . GLU B 2  52  ? 129.794 150.060 159.508 1.00 91.70  ? 52  GLU B CG    1 
ATOM   1109  C  CD    . GLU B 2  52  ? 129.918 148.591 159.160 1.00 91.70  ? 52  GLU B CD    1 
ATOM   1110  O  OE1   . GLU B 2  52  ? 129.459 147.737 159.946 1.00 91.70  ? 52  GLU B OE1   1 
ATOM   1111  O  OE2   . GLU B 2  52  ? 130.486 148.287 158.094 1.00 91.70  ? 52  GLU B OE2   1 
ATOM   1112  N  N     . GLU B 2  53  ? 132.396 152.003 161.519 1.00 86.39  ? 53  GLU B N     1 
ATOM   1113  C  CA    . GLU B 2  53  ? 133.549 152.783 161.096 1.00 86.39  ? 53  GLU B CA    1 
ATOM   1114  C  C     . GLU B 2  53  ? 134.840 152.216 161.662 1.00 86.39  ? 53  GLU B C     1 
ATOM   1115  O  O     . GLU B 2  53  ? 135.880 152.268 161.001 1.00 86.39  ? 53  GLU B O     1 
ATOM   1116  C  CB    . GLU B 2  53  ? 133.371 154.242 161.513 1.00 86.39  ? 53  GLU B CB    1 
ATOM   1117  C  CG    . GLU B 2  53  ? 134.492 155.168 161.085 1.00 86.39  ? 53  GLU B CG    1 
ATOM   1118  C  CD    . GLU B 2  53  ? 134.610 155.298 159.580 1.00 86.39  ? 53  GLU B CD    1 
ATOM   1119  O  OE1   . GLU B 2  53  ? 133.582 155.196 158.882 1.00 86.39  ? 53  GLU B OE1   1 
ATOM   1120  O  OE2   . GLU B 2  53  ? 135.739 155.494 159.090 1.00 86.39  ? 53  GLU B OE2   1 
ATOM   1121  N  N     . THR B 2  54  ? 134.783 151.634 162.858 1.00 82.88  ? 54  THR B N     1 
ATOM   1122  C  CA    . THR B 2  54  ? 135.977 151.047 163.444 1.00 82.88  ? 54  THR B CA    1 
ATOM   1123  C  C     . THR B 2  54  ? 136.403 149.810 162.672 1.00 82.88  ? 54  THR B C     1 
ATOM   1124  O  O     . THR B 2  54  ? 137.600 149.601 162.434 1.00 82.88  ? 54  THR B O     1 
ATOM   1125  C  CB    . THR B 2  54  ? 135.714 150.712 164.904 1.00 82.88  ? 54  THR B CB    1 
ATOM   1126  O  OG1   . THR B 2  54  ? 135.250 151.890 165.568 1.00 82.88  ? 54  THR B OG1   1 
ATOM   1127  C  CG2   . THR B 2  54  ? 136.976 150.269 165.577 1.00 82.88  ? 54  THR B CG2   1 
ATOM   1128  N  N     . ARG B 2  55  ? 135.426 149.015 162.233 1.00 87.41  ? 55  ARG B N     1 
ATOM   1129  C  CA    . ARG B 2  55  ? 135.717 147.891 161.350 1.00 87.41  ? 55  ARG B CA    1 
ATOM   1130  C  C     . ARG B 2  55  ? 136.298 148.372 160.029 1.00 87.41  ? 55  ARG B C     1 
ATOM   1131  O  O     . ARG B 2  55  ? 137.184 147.725 159.459 1.00 87.41  ? 55  ARG B O     1 
ATOM   1132  C  CB    . ARG B 2  55  ? 134.451 147.085 161.092 1.00 87.41  ? 55  ARG B CB    1 
ATOM   1133  C  CG    . ARG B 2  55  ? 133.836 146.447 162.313 1.00 87.41  ? 55  ARG B CG    1 
ATOM   1134  C  CD    . ARG B 2  55  ? 132.566 145.733 161.915 1.00 87.41  ? 55  ARG B CD    1 
ATOM   1135  N  NE    . ARG B 2  55  ? 131.845 145.167 163.046 1.00 87.41  ? 55  ARG B NE    1 
ATOM   1136  C  CZ    . ARG B 2  55  ? 130.856 145.787 163.677 1.00 87.41  ? 55  ARG B CZ    1 
ATOM   1137  N  NH1   . ARG B 2  55  ? 130.473 146.987 163.284 1.00 87.41  ? 55  ARG B NH1   1 
ATOM   1138  N  NH2   . ARG B 2  55  ? 130.245 145.199 164.692 1.00 87.41  ? 55  ARG B NH2   1 
ATOM   1139  N  N     . GLY B 2  56  ? 135.818 149.516 159.536 1.00 82.12  ? 56  GLY B N     1 
ATOM   1140  C  CA    . GLY B 2  56  ? 136.363 150.060 158.301 1.00 82.12  ? 56  GLY B CA    1 
ATOM   1141  C  C     . GLY B 2  56  ? 137.802 150.521 158.435 1.00 82.12  ? 56  GLY B C     1 
ATOM   1142  O  O     . GLY B 2  56  ? 138.632 150.240 157.567 1.00 82.12  ? 56  GLY B O     1 
ATOM   1143  N  N     . VAL B 2  57  ? 138.118 151.221 159.526 1.00 77.80  ? 57  VAL B N     1 
ATOM   1144  C  CA    . VAL B 2  57  ? 139.468 151.735 159.728 1.00 77.80  ? 57  VAL B CA    1 
ATOM   1145  C  C     . VAL B 2  57  ? 140.446 150.595 159.945 1.00 77.80  ? 57  VAL B C     1 
ATOM   1146  O  O     . VAL B 2  57  ? 141.540 150.576 159.357 1.00 77.80  ? 57  VAL B O     1 
ATOM   1147  C  CB    . VAL B 2  57  ? 139.481 152.727 160.900 1.00 77.80  ? 57  VAL B CB    1 
ATOM   1148  C  CG1   . VAL B 2  57  ? 140.894 153.149 161.226 1.00 77.80  ? 57  VAL B CG1   1 
ATOM   1149  C  CG2   . VAL B 2  57  ? 138.676 153.935 160.540 1.00 77.80  ? 57  VAL B CG2   1 
ATOM   1150  N  N     . LEU B 2  58  ? 140.056 149.613 160.765 1.00 75.66  ? 58  LEU B N     1 
ATOM   1151  C  CA    . LEU B 2  58  ? 140.878 148.424 160.955 1.00 75.66  ? 58  LEU B CA    1 
ATOM   1152  C  C     . LEU B 2  58  ? 141.067 147.670 159.649 1.00 75.66  ? 58  LEU B C     1 
ATOM   1153  O  O     . LEU B 2  58  ? 142.156 147.146 159.378 1.00 75.66  ? 58  LEU B O     1 
ATOM   1154  C  CB    . LEU B 2  58  ? 140.243 147.519 162.005 1.00 75.66  ? 58  LEU B CB    1 
ATOM   1155  C  CG    . LEU B 2  58  ? 140.958 146.203 162.285 1.00 75.66  ? 58  LEU B CG    1 
ATOM   1156  C  CD1   . LEU B 2  58  ? 142.314 146.466 162.868 1.00 75.66  ? 58  LEU B CD1   1 
ATOM   1157  C  CD2   . LEU B 2  58  ? 140.131 145.349 163.214 1.00 75.66  ? 58  LEU B CD2   1 
ATOM   1158  N  N     . LYS B 2  59  ? 140.032 147.650 158.806 1.00 77.02  ? 59  LYS B N     1 
ATOM   1159  C  CA    . LYS B 2  59  ? 140.147 146.984 157.518 1.00 77.02  ? 59  LYS B CA    1 
ATOM   1160  C  C     . LYS B 2  59  ? 141.135 147.703 156.612 1.00 77.02  ? 59  LYS B C     1 
ATOM   1161  O  O     . LYS B 2  59  ? 141.930 147.053 155.932 1.00 77.02  ? 59  LYS B O     1 
ATOM   1162  C  CB    . LYS B 2  59  ? 138.784 146.879 156.843 1.00 77.02  ? 59  LYS B CB    1 
ATOM   1163  C  CG    . LYS B 2  59  ? 138.829 146.138 155.516 1.00 77.02  ? 59  LYS B CG    1 
ATOM   1164  C  CD    . LYS B 2  59  ? 137.462 145.952 154.902 1.00 77.02  ? 59  LYS B CD    1 
ATOM   1165  C  CE    . LYS B 2  59  ? 136.931 147.247 154.327 1.00 77.02  ? 59  LYS B CE    1 
ATOM   1166  N  NZ    . LYS B 2  59  ? 135.637 147.024 153.633 1.00 77.02  ? 59  LYS B NZ    1 
ATOM   1167  N  N     . VAL B 2  60  ? 141.130 149.039 156.619 1.00 78.86  ? 60  VAL B N     1 
ATOM   1168  C  CA    . VAL B 2  60  ? 142.059 149.788 155.772 1.00 78.86  ? 60  VAL B CA    1 
ATOM   1169  C  C     . VAL B 2  60  ? 143.489 149.589 156.245 1.00 78.86  ? 60  VAL B C     1 
ATOM   1170  O  O     . VAL B 2  60  ? 144.399 149.349 155.433 1.00 78.86  ? 60  VAL B O     1 
ATOM   1171  C  CB    . VAL B 2  60  ? 141.679 151.279 155.738 1.00 78.86  ? 60  VAL B CB    1 
ATOM   1172  C  CG1   . VAL B 2  60  ? 142.752 152.095 155.048 1.00 78.86  ? 60  VAL B CG1   1 
ATOM   1173  C  CG2   . VAL B 2  60  ? 140.361 151.463 155.011 1.00 78.86  ? 60  VAL B CG2   1 
ATOM   1174  N  N     . PHE B 2  61  ? 143.694 149.625 157.565 1.00 76.28  ? 61  PHE B N     1 
ATOM   1175  C  CA    . PHE B 2  61  ? 145.029 149.448 158.121 1.00 76.28  ? 61  PHE B CA    1 
ATOM   1176  C  C     . PHE B 2  61  ? 145.582 148.063 157.822 1.00 76.28  ? 61  PHE B C     1 
ATOM   1177  O  O     . PHE B 2  61  ? 146.727 147.931 157.375 1.00 76.28  ? 61  PHE B O     1 
ATOM   1178  C  CB    . PHE B 2  61  ? 145.007 149.701 159.622 1.00 76.28  ? 61  PHE B CB    1 
ATOM   1179  C  CG    . PHE B 2  61  ? 146.313 149.456 160.284 1.00 76.28  ? 61  PHE B CG    1 
ATOM   1180  C  CD1   . PHE B 2  61  ? 147.374 150.308 160.079 1.00 76.28  ? 61  PHE B CD1   1 
ATOM   1181  C  CD2   . PHE B 2  61  ? 146.480 148.379 161.124 1.00 76.28  ? 61  PHE B CD2   1 
ATOM   1182  C  CE1   . PHE B 2  61  ? 148.586 150.085 160.692 1.00 76.28  ? 61  PHE B CE1   1 
ATOM   1183  C  CE2   . PHE B 2  61  ? 147.685 148.153 161.745 1.00 76.28  ? 61  PHE B CE2   1 
ATOM   1184  C  CZ    . PHE B 2  61  ? 148.742 149.009 161.525 1.00 76.28  ? 61  PHE B CZ    1 
ATOM   1185  N  N     . LEU B 2  62  ? 144.765 147.025 158.004 1.00 74.74  ? 62  LEU B N     1 
ATOM   1186  C  CA    . LEU B 2  62  ? 145.232 145.681 157.691 1.00 74.74  ? 62  LEU B CA    1 
ATOM   1187  C  C     . LEU B 2  62  ? 145.420 145.466 156.197 1.00 74.74  ? 62  LEU B C     1 
ATOM   1188  O  O     . LEU B 2  62  ? 146.326 144.722 155.809 1.00 74.74  ? 62  LEU B O     1 
ATOM   1189  C  CB    . LEU B 2  62  ? 144.272 144.646 158.257 1.00 74.74  ? 62  LEU B CB    1 
ATOM   1190  C  CG    . LEU B 2  62  ? 144.375 144.547 159.768 1.00 74.74  ? 62  LEU B CG    1 
ATOM   1191  C  CD1   . LEU B 2  62  ? 143.309 143.645 160.317 1.00 74.74  ? 62  LEU B CD1   1 
ATOM   1192  C  CD2   . LEU B 2  62  ? 145.737 144.001 160.081 1.00 74.74  ? 62  LEU B CD2   1 
ATOM   1193  N  N     . GLU B 2  63  ? 144.595 146.101 155.357 1.00 79.75  ? 63  GLU B N     1 
ATOM   1194  C  CA    . GLU B 2  63  ? 144.782 145.999 153.912 1.00 79.75  ? 63  GLU B CA    1 
ATOM   1195  C  C     . GLU B 2  63  ? 146.117 146.572 153.483 1.00 79.75  ? 63  GLU B C     1 
ATOM   1196  O  O     . GLU B 2  63  ? 146.814 145.978 152.650 1.00 79.75  ? 63  GLU B O     1 
ATOM   1197  C  CB    . GLU B 2  63  ? 143.655 146.700 153.156 1.00 79.75  ? 63  GLU B CB    1 
ATOM   1198  C  CG    . GLU B 2  63  ? 142.386 145.892 152.989 1.00 79.75  ? 63  GLU B CG    1 
ATOM   1199  C  CD    . GLU B 2  63  ? 141.283 146.669 152.301 1.00 79.75  ? 63  GLU B CD    1 
ATOM   1200  O  OE1   . GLU B 2  63  ? 141.471 147.878 152.059 1.00 79.75  ? 63  GLU B OE1   1 
ATOM   1201  O  OE2   . GLU B 2  63  ? 140.225 146.069 152.011 1.00 79.75  ? 63  GLU B OE2   1 
ATOM   1202  N  N     . ASN B 2  64  ? 146.506 147.713 154.052 1.00 78.68  ? 64  ASN B N     1 
ATOM   1203  C  CA    . ASN B 2  64  ? 147.810 148.250 153.697 1.00 78.68  ? 64  ASN B CA    1 
ATOM   1204  C  C     . ASN B 2  64  ? 148.936 147.400 154.261 1.00 78.68  ? 64  ASN B C     1 
ATOM   1205  O  O     . ASN B 2  64  ? 149.899 147.098 153.544 1.00 78.68  ? 64  ASN B O     1 
ATOM   1206  C  CB    . ASN B 2  64  ? 147.936 149.695 154.155 1.00 78.68  ? 64  ASN B CB    1 
ATOM   1207  C  CG    . ASN B 2  64  ? 147.232 150.645 153.228 1.00 78.68  ? 64  ASN B CG    1 
ATOM   1208  O  OD1   . ASN B 2  64  ? 147.286 150.489 152.012 1.00 78.68  ? 64  ASN B OD1   1 
ATOM   1209  N  ND2   . ASN B 2  64  ? 146.567 151.646 153.792 1.00 78.68  ? 64  ASN B ND2   1 
ATOM   1210  N  N     . VAL B 2  65  ? 148.807 146.954 155.514 1.00 75.94  ? 65  VAL B N     1 
ATOM   1211  C  CA    . VAL B 2  65  ? 149.920 146.271 156.170 1.00 75.94  ? 65  VAL B CA    1 
ATOM   1212  C  C     . VAL B 2  65  ? 150.171 144.902 155.547 1.00 75.94  ? 65  VAL B C     1 
ATOM   1213  O  O     . VAL B 2  65  ? 151.319 144.547 155.258 1.00 75.94  ? 65  VAL B O     1 
ATOM   1214  C  CB    . VAL B 2  65  ? 149.678 146.182 157.685 1.00 75.94  ? 65  VAL B CB    1 
ATOM   1215  C  CG1   . VAL B 2  65  ? 150.669 145.268 158.330 1.00 75.94  ? 65  VAL B CG1   1 
ATOM   1216  C  CG2   . VAL B 2  65  ? 149.837 147.549 158.294 1.00 75.94  ? 65  VAL B CG2   1 
ATOM   1217  N  N     . ILE B 2  66  ? 149.123 144.139 155.264 1.00 75.78  ? 66  ILE B N     1 
ATOM   1218  C  CA    . ILE B 2  66  ? 149.399 142.833 154.686 1.00 75.78  ? 66  ILE B CA    1 
ATOM   1219  C  C     . ILE B 2  66  ? 149.458 142.866 153.167 1.00 75.78  ? 66  ILE B C     1 
ATOM   1220  O  O     . ILE B 2  66  ? 149.952 141.900 152.570 1.00 75.78  ? 66  ILE B O     1 
ATOM   1221  C  CB    . ILE B 2  66  ? 148.394 141.765 155.139 1.00 75.78  ? 66  ILE B CB    1 
ATOM   1222  C  CG1   . ILE B 2  66  ? 147.075 141.911 154.414 1.00 75.78  ? 66  ILE B CG1   1 
ATOM   1223  C  CG2   . ILE B 2  66  ? 148.133 141.908 156.610 1.00 75.78  ? 66  ILE B CG2   1 
ATOM   1224  C  CD1   . ILE B 2  66  ? 146.137 140.802 154.726 1.00 75.78  ? 66  ILE B CD1   1 
ATOM   1225  N  N     . ARG B 2  67  ? 148.974 143.940 152.522 1.00 79.09  ? 67  ARG B N     1 
ATOM   1226  C  CA    . ARG B 2  67  ? 149.354 144.167 151.128 1.00 79.09  ? 67  ARG B CA    1 
ATOM   1227  C  C     . ARG B 2  67  ? 150.856 144.356 151.020 1.00 79.09  ? 67  ARG B C     1 
ATOM   1228  O  O     . ARG B 2  67  ? 151.499 143.825 150.108 1.00 79.09  ? 67  ARG B O     1 
ATOM   1229  C  CB    . ARG B 2  67  ? 148.659 145.394 150.532 1.00 79.09  ? 67  ARG B CB    1 
ATOM   1230  C  CG    . ARG B 2  67  ? 148.996 145.573 149.042 1.00 79.09  ? 67  ARG B CG    1 
ATOM   1231  C  CD    . ARG B 2  67  ? 148.617 146.918 148.437 1.00 79.09  ? 67  ARG B CD    1 
ATOM   1232  N  NE    . ARG B 2  67  ? 147.188 147.162 148.282 1.00 79.09  ? 67  ARG B NE    1 
ATOM   1233  C  CZ    . ARG B 2  67  ? 146.519 148.109 148.929 1.00 79.09  ? 67  ARG B CZ    1 
ATOM   1234  N  NH1   . ARG B 2  67  ? 147.145 148.896 149.791 1.00 79.09  ? 67  ARG B NH1   1 
ATOM   1235  N  NH2   . ARG B 2  67  ? 145.223 148.269 148.715 1.00 79.09  ? 67  ARG B NH2   1 
ATOM   1236  N  N     . ASP B 2  68  ? 151.438 145.094 151.957 1.00 81.08  ? 68  ASP B N     1 
ATOM   1237  C  CA    . ASP B 2  68  ? 152.877 145.266 151.905 1.00 81.08  ? 68  ASP B CA    1 
ATOM   1238  C  C     . ASP B 2  68  ? 153.610 144.034 152.405 1.00 81.08  ? 68  ASP B C     1 
ATOM   1239  O  O     . ASP B 2  68  ? 154.724 143.761 151.953 1.00 81.08  ? 68  ASP B O     1 
ATOM   1240  C  CB    . ASP B 2  68  ? 153.274 146.486 152.713 1.00 81.08  ? 68  ASP B CB    1 
ATOM   1241  C  CG    . ASP B 2  68  ? 152.583 147.729 152.223 1.00 81.08  ? 68  ASP B CG    1 
ATOM   1242  O  OD1   . ASP B 2  68  ? 152.182 147.746 151.042 1.00 81.08  ? 68  ASP B OD1   1 
ATOM   1243  O  OD2   . ASP B 2  68  ? 152.417 148.677 153.017 1.00 81.08  ? 68  ASP B OD2   1 
ATOM   1244  N  N     . ALA B 2  69  ? 153.000 143.271 153.312 1.00 76.45  ? 69  ALA B N     1 
ATOM   1245  C  CA    . ALA B 2  69  ? 153.675 142.107 153.871 1.00 76.45  ? 69  ALA B CA    1 
ATOM   1246  C  C     . ALA B 2  69  ? 153.691 140.952 152.885 1.00 76.45  ? 69  ALA B C     1 
ATOM   1247  O  O     . ALA B 2  69  ? 154.686 140.215 152.796 1.00 76.45  ? 69  ALA B O     1 
ATOM   1248  C  CB    . ALA B 2  69  ? 153.003 141.688 155.170 1.00 76.45  ? 69  ALA B CB    1 
ATOM   1249  N  N     . VAL B 2  70  ? 152.609 140.793 152.116 1.00 74.52  ? 70  VAL B N     1 
ATOM   1250  C  CA    . VAL B 2  70  ? 152.534 139.699 151.160 1.00 74.52  ? 70  VAL B CA    1 
ATOM   1251  C  C     . VAL B 2  70  ? 153.532 139.889 150.033 1.00 74.52  ? 70  VAL B C     1 
ATOM   1252  O  O     . VAL B 2  70  ? 153.964 138.909 149.427 1.00 74.52  ? 70  VAL B O     1 
ATOM   1253  C  CB    . VAL B 2  70  ? 151.095 139.543 150.620 1.00 74.52  ? 70  VAL B CB    1 
ATOM   1254  C  CG1   . VAL B 2  70  ? 150.728 140.644 149.642 1.00 74.52  ? 70  VAL B CG1   1 
ATOM   1255  C  CG2   . VAL B 2  70  ? 150.883 138.168 150.005 1.00 74.52  ? 70  VAL B CG2   1 
ATOM   1256  N  N     . THR B 2  71  ? 153.969 141.121 149.781 1.00 77.60  ? 71  THR B N     1 
ATOM   1257  C  CA    . THR B 2  71  ? 154.964 141.339 148.749 1.00 77.60  ? 71  THR B CA    1 
ATOM   1258  C  C     . THR B 2  71  ? 156.336 140.898 149.228 1.00 77.60  ? 71  THR B C     1 
ATOM   1259  O  O     . THR B 2  71  ? 157.121 140.345 148.450 1.00 77.60  ? 71  THR B O     1 
ATOM   1260  C  CB    . THR B 2  71  ? 154.977 142.807 148.363 1.00 77.60  ? 71  THR B CB    1 
ATOM   1261  O  OG1   . THR B 2  71  ? 153.630 143.237 148.150 1.00 77.60  ? 71  THR B OG1   1 
ATOM   1262  C  CG2   . THR B 2  71  ? 155.713 142.977 147.075 1.00 77.60  ? 71  THR B CG2   1 
ATOM   1263  N  N     . TYR B 2  72  ? 156.627 141.114 150.512 1.00 77.63  ? 72  TYR B N     1 
ATOM   1264  C  CA    . TYR B 2  72  ? 157.831 140.545 151.108 1.00 77.63  ? 72  TYR B CA    1 
ATOM   1265  C  C     . TYR B 2  72  ? 157.787 139.030 151.097 1.00 77.63  ? 72  TYR B C     1 
ATOM   1266  O  O     . TYR B 2  72  ? 158.821 138.374 150.936 1.00 77.63  ? 72  TYR B O     1 
ATOM   1267  C  CB    . TYR B 2  72  ? 158.011 141.029 152.538 1.00 77.63  ? 72  TYR B CB    1 
ATOM   1268  C  CG    . TYR B 2  72  ? 158.520 142.421 152.654 1.00 77.63  ? 72  TYR B CG    1 
ATOM   1269  C  CD1   . TYR B 2  72  ? 159.848 142.697 152.415 1.00 77.63  ? 72  TYR B CD1   1 
ATOM   1270  C  CD2   . TYR B 2  72  ? 157.692 143.449 153.055 1.00 77.63  ? 72  TYR B CD2   1 
ATOM   1271  C  CE1   . TYR B 2  72  ? 160.334 143.968 152.535 1.00 77.63  ? 72  TYR B CE1   1 
ATOM   1272  C  CE2   . TYR B 2  72  ? 158.166 144.729 153.182 1.00 77.63  ? 72  TYR B CE2   1 
ATOM   1273  C  CZ    . TYR B 2  72  ? 159.490 144.981 152.916 1.00 77.63  ? 72  TYR B CZ    1 
ATOM   1274  O  OH    . TYR B 2  72  ? 159.982 146.256 153.038 1.00 77.63  ? 72  TYR B OH    1 
ATOM   1275  N  N     . THR B 2  73  ? 156.604 138.453 151.277 1.00 76.08  ? 73  THR B N     1 
ATOM   1276  C  CA    . THR B 2  73  ? 156.536 137.003 151.207 1.00 76.08  ? 73  THR B CA    1 
ATOM   1277  C  C     . THR B 2  73  ? 156.639 136.522 149.761 1.00 76.08  ? 73  THR B C     1 
ATOM   1278  O  O     . THR B 2  73  ? 157.153 135.430 149.505 1.00 76.08  ? 73  THR B O     1 
ATOM   1279  C  CB    . THR B 2  73  ? 155.262 136.531 151.902 1.00 76.08  ? 73  THR B CB    1 
ATOM   1280  O  OG1   . THR B 2  73  ? 155.237 137.080 153.222 1.00 76.08  ? 73  THR B OG1   1 
ATOM   1281  C  CG2   . THR B 2  73  ? 155.237 135.024 152.052 1.00 76.08  ? 73  THR B CG2   1 
ATOM   1282  N  N     . GLU B 2  74  ? 156.238 137.348 148.801 1.00 79.50  ? 74  GLU B N     1 
ATOM   1283  C  CA    . GLU B 2  74  ? 156.348 136.935 147.410 1.00 79.50  ? 74  GLU B CA    1 
ATOM   1284  C  C     . GLU B 2  74  ? 157.757 137.091 146.867 1.00 79.50  ? 74  GLU B C     1 
ATOM   1285  O  O     . GLU B 2  74  ? 158.125 136.372 145.935 1.00 79.50  ? 74  GLU B O     1 
ATOM   1286  C  CB    . GLU B 2  74  ? 155.383 137.716 146.521 1.00 79.50  ? 74  GLU B CB    1 
ATOM   1287  C  CG    . GLU B 2  74  ? 153.930 137.266 146.587 1.00 79.50  ? 74  GLU B CG    1 
ATOM   1288  C  CD    . GLU B 2  74  ? 153.018 138.079 145.678 1.00 79.50  ? 74  GLU B CD    1 
ATOM   1289  O  OE1   . GLU B 2  74  ? 153.479 139.096 145.115 1.00 79.50  ? 74  GLU B OE1   1 
ATOM   1290  O  OE2   . GLU B 2  74  ? 151.839 137.695 145.521 1.00 79.50  ? 74  GLU B OE2   1 
ATOM   1291  N  N     . HIS B 2  75  ? 158.549 138.021 147.411 1.00 80.98  ? 75  HIS B N     1 
ATOM   1292  C  CA    . HIS B 2  75  ? 159.864 138.264 146.830 1.00 80.98  ? 75  HIS B CA    1 
ATOM   1293  C  C     . HIS B 2  75  ? 160.830 137.134 147.122 1.00 80.98  ? 75  HIS B C     1 
ATOM   1294  O  O     . HIS B 2  75  ? 161.678 136.816 146.285 1.00 80.98  ? 75  HIS B O     1 
ATOM   1295  C  CB    . HIS B 2  75  ? 160.474 139.554 147.342 1.00 80.98  ? 75  HIS B CB    1 
ATOM   1296  C  CG    . HIS B 2  75  ? 161.761 139.893 146.668 1.00 80.98  ? 75  HIS B CG    1 
ATOM   1297  N  ND1   . HIS B 2  75  ? 161.817 140.509 145.440 1.00 80.98  ? 75  HIS B ND1   1 
ATOM   1298  C  CD2   . HIS B 2  75  ? 163.040 139.621 147.012 1.00 80.98  ? 75  HIS B CD2   1 
ATOM   1299  C  CE1   . HIS B 2  75  ? 163.078 140.659 145.083 1.00 80.98  ? 75  HIS B CE1   1 
ATOM   1300  N  NE2   . HIS B 2  75  ? 163.842 140.121 146.015 1.00 80.98  ? 75  HIS B NE2   1 
ATOM   1301  N  N     . ALA B 2  76  ? 160.714 136.508 148.284 1.00 76.55  ? 76  ALA B N     1 
ATOM   1302  C  CA    . ALA B 2  76  ? 161.488 135.310 148.566 1.00 76.55  ? 76  ALA B CA    1 
ATOM   1303  C  C     . ALA B 2  76  ? 160.920 134.067 147.897 1.00 76.55  ? 76  ALA B C     1 
ATOM   1304  O  O     . ALA B 2  76  ? 161.458 132.980 148.126 1.00 76.55  ? 76  ALA B O     1 
ATOM   1305  C  CB    . ALA B 2  76  ? 161.575 135.086 150.072 1.00 76.55  ? 76  ALA B CB    1 
ATOM   1306  N  N     . LYS B 2  77  ? 159.839 134.214 147.116 1.00 77.43  ? 77  LYS B N     1 
ATOM   1307  C  CA    . LYS B 2  77  ? 159.155 133.137 146.391 1.00 77.43  ? 77  LYS B CA    1 
ATOM   1308  C  C     . LYS B 2  77  ? 158.635 132.067 147.341 1.00 77.43  ? 77  LYS B C     1 
ATOM   1309  O  O     . LYS B 2  77  ? 158.549 130.891 146.987 1.00 77.43  ? 77  LYS B O     1 
ATOM   1310  C  CB    . LYS B 2  77  ? 160.054 132.521 145.322 1.00 77.43  ? 77  LYS B CB    1 
ATOM   1311  C  CG    . LYS B 2  77  ? 160.505 133.508 144.275 1.00 77.43  ? 77  LYS B CG    1 
ATOM   1312  C  CD    . LYS B 2  77  ? 161.473 132.856 143.310 1.00 77.43  ? 77  LYS B CD    1 
ATOM   1313  C  CE    . LYS B 2  77  ? 162.038 133.856 142.325 1.00 77.43  ? 77  LYS B CE    1 
ATOM   1314  N  NZ    . LYS B 2  77  ? 163.041 133.226 141.429 1.00 77.43  ? 77  LYS B NZ    1 
ATOM   1315  N  N     . ARG B 2  78  ? 158.279 132.480 148.549 1.00 75.76  ? 78  ARG B N     1 
ATOM   1316  C  CA    . ARG B 2  78  ? 157.812 131.586 149.590 1.00 75.76  ? 78  ARG B CA    1 
ATOM   1317  C  C     . ARG B 2  78  ? 156.315 131.768 149.770 1.00 75.76  ? 78  ARG B C     1 
ATOM   1318  O  O     . ARG B 2  78  ? 155.771 132.850 149.547 1.00 75.76  ? 78  ARG B O     1 
ATOM   1319  C  CB    . ARG B 2  78  ? 158.533 131.865 150.903 1.00 75.76  ? 78  ARG B CB    1 
ATOM   1320  C  CG    . ARG B 2  78  ? 160.028 131.690 150.810 1.00 75.76  ? 78  ARG B CG    1 
ATOM   1321  C  CD    . ARG B 2  78  ? 160.687 131.791 152.164 1.00 75.76  ? 78  ARG B CD    1 
ATOM   1322  N  NE    . ARG B 2  78  ? 160.587 133.116 152.754 1.00 75.76  ? 78  ARG B NE    1 
ATOM   1323  C  CZ    . ARG B 2  78  ? 159.887 133.383 153.848 1.00 75.76  ? 78  ARG B CZ    1 
ATOM   1324  N  NH1   . ARG B 2  78  ? 159.224 132.415 154.458 1.00 75.76  ? 78  ARG B NH1   1 
ATOM   1325  N  NH2   . ARG B 2  78  ? 159.848 134.614 154.332 1.00 75.76  ? 78  ARG B NH2   1 
ATOM   1326  N  N     . LYS B 2  79  ? 155.651 130.698 150.181 1.00 75.77  ? 79  LYS B N     1 
ATOM   1327  C  CA    . LYS B 2  79  ? 154.202 130.684 150.265 1.00 75.77  ? 79  LYS B CA    1 
ATOM   1328  C  C     . LYS B 2  79  ? 153.709 130.827 151.695 1.00 75.77  ? 79  LYS B C     1 
ATOM   1329  O  O     . LYS B 2  79  ? 152.507 130.694 151.943 1.00 75.77  ? 79  LYS B O     1 
ATOM   1330  C  CB    . LYS B 2  79  ? 153.668 129.399 149.637 1.00 75.77  ? 79  LYS B CB    1 
ATOM   1331  C  CG    . LYS B 2  79  ? 153.997 129.292 148.158 1.00 75.77  ? 79  LYS B CG    1 
ATOM   1332  C  CD    . LYS B 2  79  ? 153.525 127.989 147.537 1.00 75.77  ? 79  LYS B CD    1 
ATOM   1333  C  CE    . LYS B 2  79  ? 153.958 127.908 146.076 1.00 75.77  ? 79  LYS B CE    1 
ATOM   1334  N  NZ    . LYS B 2  79  ? 153.547 126.649 145.399 1.00 75.77  ? 79  LYS B NZ    1 
ATOM   1335  N  N     . THR B 2  80  ? 154.603 131.104 152.638 1.00 76.94  ? 80  THR B N     1 
ATOM   1336  C  CA    . THR B 2  80  ? 154.246 131.198 154.047 1.00 76.94  ? 80  THR B CA    1 
ATOM   1337  C  C     . THR B 2  80  ? 154.699 132.543 154.593 1.00 76.94  ? 80  THR B C     1 
ATOM   1338  O  O     . THR B 2  80  ? 155.894 132.850 154.582 1.00 76.94  ? 80  THR B O     1 
ATOM   1339  C  CB    . THR B 2  80  ? 154.880 130.063 154.847 1.00 76.94  ? 80  THR B CB    1 
ATOM   1340  O  OG1   . THR B 2  80  ? 154.432 128.809 154.326 1.00 76.94  ? 80  THR B OG1   1 
ATOM   1341  C  CG2   . THR B 2  80  ? 154.494 130.166 156.303 1.00 76.94  ? 80  THR B CG2   1 
ATOM   1342  N  N     . VAL B 2  81  ? 153.747 133.338 155.071 1.00 74.71  ? 81  VAL B N     1 
ATOM   1343  C  CA    . VAL B 2  81  ? 154.073 134.613 155.690 1.00 74.71  ? 81  VAL B CA    1 
ATOM   1344  C  C     . VAL B 2  81  ? 154.642 134.356 157.077 1.00 74.71  ? 81  VAL B C     1 
ATOM   1345  O  O     . VAL B 2  81  ? 154.101 133.547 157.841 1.00 74.71  ? 81  VAL B O     1 
ATOM   1346  C  CB    . VAL B 2  81  ? 152.824 135.500 155.745 1.00 74.71  ? 81  VAL B CB    1 
ATOM   1347  C  CG1   . VAL B 2  81  ? 153.092 136.773 156.507 1.00 74.71  ? 81  VAL B CG1   1 
ATOM   1348  C  CG2   . VAL B 2  81  ? 152.355 135.806 154.345 1.00 74.71  ? 81  VAL B CG2   1 
ATOM   1349  N  N     . THR B 2  82  ? 155.758 135.004 157.396 1.00 73.44  ? 82  THR B N     1 
ATOM   1350  C  CA    . THR B 2  82  ? 156.406 134.837 158.688 1.00 73.44  ? 82  THR B CA    1 
ATOM   1351  C  C     . THR B 2  82  ? 156.243 136.095 159.528 1.00 73.44  ? 82  THR B C     1 
ATOM   1352  O  O     . THR B 2  82  ? 155.592 137.061 159.131 1.00 73.44  ? 82  THR B O     1 
ATOM   1353  C  CB    . THR B 2  82  ? 157.887 134.518 158.529 1.00 73.44  ? 82  THR B CB    1 
ATOM   1354  O  OG1   . THR B 2  82  ? 158.568 135.680 158.051 1.00 73.44  ? 82  THR B OG1   1 
ATOM   1355  C  CG2   . THR B 2  82  ? 158.078 133.397 157.538 1.00 73.44  ? 82  THR B CG2   1 
ATOM   1356  N  N     . ALA B 2  83  ? 156.870 136.077 160.701 1.00 75.43  ? 83  ALA B N     1 
ATOM   1357  C  CA    . ALA B 2  83  ? 156.780 137.198 161.625 1.00 75.43  ? 83  ALA B CA    1 
ATOM   1358  C  C     . ALA B 2  83  ? 157.728 138.317 161.230 1.00 75.43  ? 83  ALA B C     1 
ATOM   1359  O  O     . ALA B 2  83  ? 157.380 139.499 161.357 1.00 75.43  ? 83  ALA B O     1 
ATOM   1360  C  CB    . ALA B 2  83  ? 157.071 136.726 163.046 1.00 75.43  ? 83  ALA B CB    1 
ATOM   1361  N  N     . MET B 2  84  ? 158.924 137.957 160.752 1.00 73.77  ? 84  MET B N     1 
ATOM   1362  C  CA    . MET B 2  84  ? 159.870 138.942 160.241 1.00 73.77  ? 84  MET B CA    1 
ATOM   1363  C  C     . MET B 2  84  ? 159.295 139.720 159.069 1.00 73.77  ? 84  MET B C     1 
ATOM   1364  O  O     . MET B 2  84  ? 159.600 140.909 158.915 1.00 73.77  ? 84  MET B O     1 
ATOM   1365  C  CB    . MET B 2  84  ? 161.153 138.260 159.797 1.00 73.77  ? 84  MET B CB    1 
ATOM   1366  C  CG    . MET B 2  84  ? 161.988 137.652 160.895 1.00 73.77  ? 84  MET B CG    1 
ATOM   1367  S  SD    . MET B 2  84  ? 162.746 138.852 162.000 1.00 73.77  ? 84  MET B SD    1 
ATOM   1368  C  CE    . MET B 2  84  ? 163.613 137.740 163.111 1.00 73.77  ? 84  MET B CE    1 
ATOM   1369  N  N     . ASP B 2  85  ? 158.464 139.063 158.250 1.00 77.57  ? 85  ASP B N     1 
ATOM   1370  C  CA    . ASP B 2  85  ? 157.743 139.709 157.159 1.00 77.57  ? 85  ASP B CA    1 
ATOM   1371  C  C     . ASP B 2  85  ? 156.953 140.909 157.648 1.00 77.57  ? 85  ASP B C     1 
ATOM   1372  O  O     . ASP B 2  85  ? 157.197 142.047 157.232 1.00 77.57  ? 85  ASP B O     1 
ATOM   1373  C  CB    . ASP B 2  85  ? 156.783 138.713 156.514 1.00 77.57  ? 85  ASP B CB    1 
ATOM   1374  C  CG    . ASP B 2  85  ? 157.485 137.546 155.878 1.00 77.57  ? 85  ASP B CG    1 
ATOM   1375  O  OD1   . ASP B 2  85  ? 158.645 137.708 155.445 1.00 77.57  ? 85  ASP B OD1   1 
ATOM   1376  O  OD2   . ASP B 2  85  ? 156.878 136.454 155.814 1.00 77.57  ? 85  ASP B OD2   1 
ATOM   1377  N  N     . VAL B 2  86  ? 156.034 140.674 158.580 1.00 72.44  ? 86  VAL B N     1 
ATOM   1378  C  CA    . VAL B 2  86  ? 155.168 141.758 159.002 1.00 72.44  ? 86  VAL B CA    1 
ATOM   1379  C  C     . VAL B 2  86  ? 155.859 142.743 159.921 1.00 72.44  ? 86  VAL B C     1 
ATOM   1380  O  O     . VAL B 2  86  ? 155.447 143.898 159.951 1.00 72.44  ? 86  VAL B O     1 
ATOM   1381  C  CB    . VAL B 2  86  ? 153.897 141.245 159.683 1.00 72.44  ? 86  VAL B CB    1 
ATOM   1382  C  CG1   . VAL B 2  86  ? 153.067 140.468 158.699 1.00 72.44  ? 86  VAL B CG1   1 
ATOM   1383  C  CG2   . VAL B 2  86  ? 154.243 140.385 160.870 1.00 72.44  ? 86  VAL B CG2   1 
ATOM   1384  N  N     . VAL B 2  87  ? 156.895 142.351 160.665 1.00 70.95  ? 87  VAL B N     1 
ATOM   1385  C  CA    . VAL B 2  87  ? 157.600 143.354 161.460 1.00 70.95  ? 87  VAL B CA    1 
ATOM   1386  C  C     . VAL B 2  87  ? 158.391 144.286 160.555 1.00 70.95  ? 87  VAL B C     1 
ATOM   1387  O  O     . VAL B 2  87  ? 158.430 145.501 160.777 1.00 70.95  ? 87  VAL B O     1 
ATOM   1388  C  CB    . VAL B 2  87  ? 158.489 142.682 162.518 1.00 70.95  ? 87  VAL B CB    1 
ATOM   1389  C  CG1   . VAL B 2  87  ? 159.316 143.706 163.274 1.00 70.95  ? 87  VAL B CG1   1 
ATOM   1390  C  CG2   . VAL B 2  87  ? 157.623 141.958 163.483 1.00 70.95  ? 87  VAL B CG2   1 
ATOM   1391  N  N     . TYR B 2  88  ? 158.985 143.744 159.488 1.00 73.27  ? 88  TYR B N     1 
ATOM   1392  C  CA    . TYR B 2  88  ? 159.668 144.583 158.509 1.00 73.27  ? 88  TYR B CA    1 
ATOM   1393  C  C     . TYR B 2  88  ? 158.697 145.504 157.775 1.00 73.27  ? 88  TYR B C     1 
ATOM   1394  O  O     . TYR B 2  88  ? 158.968 146.705 157.618 1.00 73.27  ? 88  TYR B O     1 
ATOM   1395  C  CB    . TYR B 2  88  ? 160.431 143.700 157.534 1.00 73.27  ? 88  TYR B CB    1 
ATOM   1396  C  CG    . TYR B 2  88  ? 161.692 143.139 158.126 1.00 73.27  ? 88  TYR B CG    1 
ATOM   1397  C  CD1   . TYR B 2  88  ? 162.330 143.785 159.168 1.00 73.27  ? 88  TYR B CD1   1 
ATOM   1398  C  CD2   . TYR B 2  88  ? 162.226 141.937 157.672 1.00 73.27  ? 88  TYR B CD2   1 
ATOM   1399  C  CE1   . TYR B 2  88  ? 163.486 143.272 159.722 1.00 73.27  ? 88  TYR B CE1   1 
ATOM   1400  C  CE2   . TYR B 2  88  ? 163.368 141.406 158.225 1.00 73.27  ? 88  TYR B CE2   1 
ATOM   1401  C  CZ    . TYR B 2  88  ? 163.999 142.079 159.248 1.00 73.27  ? 88  TYR B CZ    1 
ATOM   1402  O  OH    . TYR B 2  88  ? 165.147 141.557 159.799 1.00 73.27  ? 88  TYR B OH    1 
ATOM   1403  N  N     . ALA B 2  89  ? 157.543 144.976 157.361 1.00 71.02  ? 89  ALA B N     1 
ATOM   1404  C  CA    . ALA B 2  89  ? 156.569 145.818 156.674 1.00 71.02  ? 89  ALA B CA    1 
ATOM   1405  C  C     . ALA B 2  89  ? 155.920 146.826 157.609 1.00 71.02  ? 89  ALA B C     1 
ATOM   1406  O  O     . ALA B 2  89  ? 155.466 147.879 157.155 1.00 71.02  ? 89  ALA B O     1 
ATOM   1407  C  CB    . ALA B 2  89  ? 155.498 144.963 156.010 1.00 71.02  ? 89  ALA B CB    1 
ATOM   1408  N  N     . LEU B 2  90  ? 155.874 146.543 158.906 1.00 70.18  ? 90  LEU B N     1 
ATOM   1409  C  CA    . LEU B 2  90  ? 155.415 147.561 159.842 1.00 70.18  ? 90  LEU B CA    1 
ATOM   1410  C  C     . LEU B 2  90  ? 156.469 148.629 160.046 1.00 70.18  ? 90  LEU B C     1 
ATOM   1411  O  O     . LEU B 2  90  ? 156.136 149.807 160.212 1.00 70.18  ? 90  LEU B O     1 
ATOM   1412  C  CB    . LEU B 2  90  ? 155.051 146.941 161.179 1.00 70.18  ? 90  LEU B CB    1 
ATOM   1413  C  CG    . LEU B 2  90  ? 153.713 146.243 161.245 1.00 70.18  ? 90  LEU B CG    1 
ATOM   1414  C  CD1   . LEU B 2  90  ? 153.745 145.435 162.498 1.00 70.18  ? 90  LEU B CD1   1 
ATOM   1415  C  CD2   . LEU B 2  90  ? 152.606 147.257 161.274 1.00 70.18  ? 90  LEU B CD2   1 
ATOM   1416  N  N     . LYS B 2  91  ? 157.740 148.220 160.084 1.00 67.99  ? 91  LYS B N     1 
ATOM   1417  C  CA    . LYS B 2  91  ? 158.842 149.164 160.223 1.00 67.99  ? 91  LYS B CA    1 
ATOM   1418  C  C     . LYS B 2  91  ? 158.857 150.163 159.087 1.00 67.99  ? 91  LYS B C     1 
ATOM   1419  O  O     . LYS B 2  91  ? 159.058 151.361 159.308 1.00 67.99  ? 91  LYS B O     1 
ATOM   1420  C  CB    . LYS B 2  91  ? 160.162 148.411 160.250 1.00 67.99  ? 91  LYS B CB    1 
ATOM   1421  C  CG    . LYS B 2  91  ? 161.387 149.296 160.255 1.00 67.99  ? 91  LYS B CG    1 
ATOM   1422  C  CD    . LYS B 2  91  ? 162.625 148.442 160.150 1.00 67.99  ? 91  LYS B CD    1 
ATOM   1423  C  CE    . LYS B 2  91  ? 163.868 149.279 160.018 1.00 67.99  ? 91  LYS B CE    1 
ATOM   1424  N  NZ    . LYS B 2  91  ? 165.047 148.407 159.791 1.00 67.99  ? 91  LYS B NZ    1 
ATOM   1425  N  N     . ARG B 2  92  ? 158.603 149.686 157.871 1.00 69.48  ? 92  ARG B N     1 
ATOM   1426  C  CA    . ARG B 2  92  ? 158.661 150.557 156.706 1.00 69.48  ? 92  ARG B CA    1 
ATOM   1427  C  C     . ARG B 2  92  ? 157.553 151.602 156.738 1.00 69.48  ? 92  ARG B C     1 
ATOM   1428  O  O     . ARG B 2  92  ? 157.758 152.731 156.288 1.00 69.48  ? 92  ARG B O     1 
ATOM   1429  C  CB    . ARG B 2  92  ? 158.573 149.698 155.445 1.00 69.48  ? 92  ARG B CB    1 
ATOM   1430  C  CG    . ARG B 2  92  ? 159.193 150.247 154.171 1.00 69.48  ? 92  ARG B CG    1 
ATOM   1431  C  CD    . ARG B 2  92  ? 158.316 151.240 153.433 1.00 69.48  ? 92  ARG B CD    1 
ATOM   1432  N  NE    . ARG B 2  92  ? 156.901 150.897 153.507 1.00 69.48  ? 92  ARG B NE    1 
ATOM   1433  C  CZ    . ARG B 2  92  ? 156.302 149.970 152.775 1.00 69.48  ? 92  ARG B CZ    1 
ATOM   1434  N  NH1   . ARG B 2  92  ? 156.984 149.249 151.908 1.00 69.48  ? 92  ARG B NH1   1 
ATOM   1435  N  NH2   . ARG B 2  92  ? 155.011 149.763 152.931 1.00 69.48  ? 92  ARG B NH2   1 
ATOM   1436  N  N     . GLN B 2  93  ? 156.398 151.272 157.301 1.00 72.62  ? 93  GLN B N     1 
ATOM   1437  C  CA    . GLN B 2  93  ? 155.332 152.253 157.411 1.00 72.62  ? 93  GLN B CA    1 
ATOM   1438  C  C     . GLN B 2  93  ? 155.472 153.152 158.621 1.00 72.62  ? 93  GLN B C     1 
ATOM   1439  O  O     . GLN B 2  93  ? 154.515 153.853 158.952 1.00 72.62  ? 93  GLN B O     1 
ATOM   1440  C  CB    . GLN B 2  93  ? 153.970 151.563 157.452 1.00 72.62  ? 93  GLN B CB    1 
ATOM   1441  C  CG    . GLN B 2  93  ? 153.556 150.974 156.126 1.00 72.62  ? 93  GLN B CG    1 
ATOM   1442  C  CD    . GLN B 2  93  ? 152.175 150.373 156.163 1.00 72.62  ? 93  GLN B CD    1 
ATOM   1443  O  OE1   . GLN B 2  93  ? 151.557 150.279 157.217 1.00 72.62  ? 93  GLN B OE1   1 
ATOM   1444  N  NE2   . GLN B 2  93  ? 151.669 149.989 155.003 1.00 72.62  ? 93  GLN B NE2   1 
ATOM   1445  N  N     . GLY B 2  94  ? 156.621 153.153 159.286 1.00 74.29  ? 94  GLY B N     1 
ATOM   1446  C  CA    . GLY B 2  94  ? 156.822 154.020 160.433 1.00 74.29  ? 94  GLY B CA    1 
ATOM   1447  C  C     . GLY B 2  94  ? 156.028 153.634 161.657 1.00 74.29  ? 94  GLY B C     1 
ATOM   1448  O  O     . GLY B 2  94  ? 155.577 154.513 162.393 1.00 74.29  ? 94  GLY B O     1 
ATOM   1449  N  N     . ARG B 2  95  ? 155.809 152.341 161.871 1.00 70.86  ? 95  ARG B N     1 
ATOM   1450  C  CA    . ARG B 2  95  ? 155.035 151.830 162.996 1.00 70.86  ? 95  ARG B CA    1 
ATOM   1451  C  C     . ARG B 2  95  ? 155.759 150.651 163.614 1.00 70.86  ? 95  ARG B C     1 
ATOM   1452  O  O     . ARG B 2  95  ? 155.192 149.569 163.767 1.00 70.86  ? 95  ARG B O     1 
ATOM   1453  C  CB    . ARG B 2  95  ? 153.631 151.417 162.572 1.00 70.86  ? 95  ARG B CB    1 
ATOM   1454  C  CG    . ARG B 2  95  ? 152.800 152.554 162.067 1.00 70.86  ? 95  ARG B CG    1 
ATOM   1455  C  CD    . ARG B 2  95  ? 151.370 152.157 161.839 1.00 70.86  ? 95  ARG B CD    1 
ATOM   1456  N  NE    . ARG B 2  95  ? 150.641 153.231 161.183 1.00 70.86  ? 95  ARG B NE    1 
ATOM   1457  C  CZ    . ARG B 2  95  ? 150.114 154.274 161.810 1.00 70.86  ? 95  ARG B CZ    1 
ATOM   1458  N  NH1   . ARG B 2  95  ? 150.243 154.411 163.123 1.00 70.86  ? 95  ARG B NH1   1 
ATOM   1459  N  NH2   . ARG B 2  95  ? 149.470 155.196 161.116 1.00 70.86  ? 95  ARG B NH2   1 
ATOM   1460  N  N     . THR B 2  96  ? 157.040 150.835 163.931 1.00 63.59  ? 96  THR B N     1 
ATOM   1461  C  CA    . THR B 2  96  ? 157.915 149.724 164.287 1.00 63.59  ? 96  THR B CA    1 
ATOM   1462  C  C     . THR B 2  96  ? 157.507 149.084 165.609 1.00 63.59  ? 96  THR B C     1 
ATOM   1463  O  O     . THR B 2  96  ? 157.108 149.761 166.559 1.00 63.59  ? 96  THR B O     1 
ATOM   1464  C  CB    . THR B 2  96  ? 159.357 150.210 164.367 1.00 63.59  ? 96  THR B CB    1 
ATOM   1465  O  OG1   . THR B 2  96  ? 159.634 151.014 163.218 1.00 63.59  ? 96  THR B OG1   1 
ATOM   1466  C  CG2   . THR B 2  96  ? 160.333 149.037 164.342 1.00 63.59  ? 96  THR B CG2   1 
ATOM   1467  N  N     . LEU B 2  97  ? 157.618 147.761 165.654 1.00 56.94  ? 97  LEU B N     1 
ATOM   1468  C  CA    . LEU B 2  97  ? 157.013 146.928 166.683 1.00 56.94  ? 97  LEU B CA    1 
ATOM   1469  C  C     . LEU B 2  97  ? 158.040 145.897 167.108 1.00 56.94  ? 97  LEU B C     1 
ATOM   1470  O  O     . LEU B 2  97  ? 158.346 144.986 166.339 1.00 56.94  ? 97  LEU B O     1 
ATOM   1471  C  CB    . LEU B 2  97  ? 155.769 146.247 166.137 1.00 56.94  ? 97  LEU B CB    1 
ATOM   1472  C  CG    . LEU B 2  97  ? 155.033 145.235 166.992 1.00 56.94  ? 97  LEU B CG    1 
ATOM   1473  C  CD1   . LEU B 2  97  ? 154.532 145.866 168.255 1.00 56.94  ? 97  LEU B CD1   1 
ATOM   1474  C  CD2   . LEU B 2  97  ? 153.876 144.729 166.182 1.00 56.94  ? 97  LEU B CD2   1 
ATOM   1475  N  N     . TYR B 2  98  ? 158.559 146.018 168.320 1.00 49.90  ? 98  TYR B N     1 
ATOM   1476  C  CA    . TYR B 2  98  ? 159.587 145.089 168.751 1.00 49.90  ? 98  TYR B CA    1 
ATOM   1477  C  C     . TYR B 2  98  ? 158.926 143.811 169.247 1.00 49.90  ? 98  TYR B C     1 
ATOM   1478  O  O     . TYR B 2  98  ? 157.707 143.665 169.227 1.00 49.90  ? 98  TYR B O     1 
ATOM   1479  C  CB    . TYR B 2  98  ? 160.439 145.677 169.868 1.00 49.90  ? 98  TYR B CB    1 
ATOM   1480  C  CG    . TYR B 2  98  ? 161.190 146.950 169.573 1.00 49.90  ? 98  TYR B CG    1 
ATOM   1481  C  CD1   . TYR B 2  98  ? 161.410 147.387 168.282 1.00 49.90  ? 98  TYR B CD1   1 
ATOM   1482  C  CD2   . TYR B 2  98  ? 161.674 147.723 170.611 1.00 49.90  ? 98  TYR B CD2   1 
ATOM   1483  C  CE1   . TYR B 2  98  ? 162.081 148.558 168.041 1.00 49.90  ? 98  TYR B CE1   1 
ATOM   1484  C  CE2   . TYR B 2  98  ? 162.342 148.886 170.381 1.00 49.90  ? 98  TYR B CE2   1 
ATOM   1485  C  CZ    . TYR B 2  98  ? 162.548 149.299 169.095 1.00 49.90  ? 98  TYR B CZ    1 
ATOM   1486  O  OH    . TYR B 2  98  ? 163.208 150.464 168.842 1.00 49.90  ? 98  TYR B OH    1 
ATOM   1487  N  N     . GLY B 2  99  ? 159.733 142.888 169.748 1.00 53.29  ? 99  GLY B N     1 
ATOM   1488  C  CA    . GLY B 2  99  ? 159.195 141.688 170.345 1.00 53.29  ? 99  GLY B CA    1 
ATOM   1489  C  C     . GLY B 2  99  ? 158.935 140.552 169.391 1.00 53.29  ? 99  GLY B C     1 
ATOM   1490  O  O     . GLY B 2  99  ? 158.308 139.567 169.791 1.00 53.29  ? 99  GLY B O     1 
ATOM   1491  N  N     . PHE B 2  100 ? 159.364 140.664 168.142 1.00 53.05  ? 100 PHE B N     1 
ATOM   1492  C  CA    . PHE B 2  100 ? 159.327 139.521 167.240 1.00 53.05  ? 100 PHE B CA    1 
ATOM   1493  C  C     . PHE B 2  100 ? 160.595 139.361 166.433 1.00 53.05  ? 100 PHE B C     1 
ATOM   1494  O  O     . PHE B 2  100 ? 160.804 138.288 165.864 1.00 53.05  ? 100 PHE B O     1 
ATOM   1495  C  CB    . PHE B 2  100 ? 158.147 139.625 166.278 1.00 53.05  ? 100 PHE B CB    1 
ATOM   1496  C  CG    . PHE B 2  100 ? 156.812 139.710 166.960 1.00 53.05  ? 100 PHE B CG    1 
ATOM   1497  C  CD1   . PHE B 2  100 ? 156.228 138.594 167.512 1.00 53.05  ? 100 PHE B CD1   1 
ATOM   1498  C  CD2   . PHE B 2  100 ? 156.136 140.905 167.028 1.00 53.05  ? 100 PHE B CD2   1 
ATOM   1499  C  CE1   . PHE B 2  100 ? 155.012 138.678 168.129 1.00 53.05  ? 100 PHE B CE1   1 
ATOM   1500  C  CE2   . PHE B 2  100 ? 154.928 140.986 167.644 1.00 53.05  ? 100 PHE B CE2   1 
ATOM   1501  C  CZ    . PHE B 2  100 ? 154.365 139.871 168.191 1.00 53.05  ? 100 PHE B CZ    1 
ATOM   1502  N  N     . GLY B 2  101 ? 161.455 140.367 166.372 1.00 58.27  ? 101 GLY B N     1 
ATOM   1503  C  CA    . GLY B 2  101 ? 162.695 140.276 165.629 1.00 58.27  ? 101 GLY B CA    1 
ATOM   1504  C  C     . GLY B 2  101 ? 163.226 141.624 165.191 1.00 58.27  ? 101 GLY B C     1 
ATOM   1505  O  O     . GLY B 2  101 ? 164.012 142.252 165.896 1.00 58.27  ? 101 GLY B O     1 
ATOM   1506  N  N     . THR C 3  16  ? 175.246 155.148 124.343 1.00 82.66  ? 16  THR C N     1 
ATOM   1507  C  CA    . THR C 3  16  ? 173.830 155.421 124.525 1.00 82.66  ? 16  THR C CA    1 
ATOM   1508  C  C     . THR C 3  16  ? 173.072 154.129 124.750 1.00 82.66  ? 16  THR C C     1 
ATOM   1509  O  O     . THR C 3  16  ? 172.367 153.652 123.864 1.00 82.66  ? 16  THR C O     1 
ATOM   1510  C  CB    . THR C 3  16  ? 173.224 156.142 123.318 1.00 82.66  ? 16  THR C CB    1 
ATOM   1511  O  OG1   . THR C 3  16  ? 173.247 155.272 122.182 1.00 82.66  ? 16  THR C OG1   1 
ATOM   1512  C  CG2   . THR C 3  16  ? 174.019 157.394 123.000 1.00 82.66  ? 16  THR C CG2   1 
ATOM   1513  N  N     . ARG C 3  17  ? 173.211 153.563 125.951 1.00 74.64  ? 17  ARG C N     1 
ATOM   1514  C  CA    . ARG C 3  17  ? 172.457 152.368 126.304 1.00 74.64  ? 17  ARG C CA    1 
ATOM   1515  C  C     . ARG C 3  17  ? 170.978 152.653 126.499 1.00 74.64  ? 17  ARG C C     1 
ATOM   1516  O  O     . ARG C 3  17  ? 170.180 151.708 126.540 1.00 74.64  ? 17  ARG C O     1 
ATOM   1517  C  CB    . ARG C 3  17  ? 173.036 151.724 127.558 1.00 74.64  ? 17  ARG C CB    1 
ATOM   1518  C  CG    . ARG C 3  17  ? 174.419 151.149 127.344 1.00 74.64  ? 17  ARG C CG    1 
ATOM   1519  C  CD    . ARG C 3  17  ? 174.848 150.290 128.510 1.00 74.64  ? 17  ARG C CD    1 
ATOM   1520  N  NE    . ARG C 3  17  ? 175.204 151.036 129.707 1.00 74.64  ? 17  ARG C NE    1 
ATOM   1521  C  CZ    . ARG C 3  17  ? 175.356 150.478 130.903 1.00 74.64  ? 17  ARG C CZ    1 
ATOM   1522  N  NH1   . ARG C 3  17  ? 175.146 149.181 131.064 1.00 74.64  ? 17  ARG C NH1   1 
ATOM   1523  N  NH2   . ARG C 3  17  ? 175.693 151.222 131.942 1.00 74.64  ? 17  ARG C NH2   1 
ATOM   1524  N  N     . SER C 3  18  ? 170.611 153.925 126.636 1.00 76.37  ? 18  SER C N     1 
ATOM   1525  C  CA    . SER C 3  18  ? 169.232 154.341 126.440 1.00 76.37  ? 18  SER C CA    1 
ATOM   1526  C  C     . SER C 3  18  ? 168.725 153.913 125.069 1.00 76.37  ? 18  SER C C     1 
ATOM   1527  O  O     . SER C 3  18  ? 167.610 153.397 124.947 1.00 76.37  ? 18  SER C O     1 
ATOM   1528  C  CB    . SER C 3  18  ? 169.135 155.853 126.590 1.00 76.37  ? 18  SER C CB    1 
ATOM   1529  O  OG    . SER C 3  18  ? 169.619 156.264 127.854 1.00 76.37  ? 18  SER C OG    1 
ATOM   1530  N  N     . SER C 3  19  ? 169.538 154.103 124.026 1.00 79.97  ? 19  SER C N     1 
ATOM   1531  C  CA    . SER C 3  19  ? 169.164 153.629 122.699 1.00 79.97  ? 19  SER C CA    1 
ATOM   1532  C  C     . SER C 3  19  ? 169.251 152.116 122.587 1.00 79.97  ? 19  SER C C     1 
ATOM   1533  O  O     . SER C 3  19  ? 168.546 151.525 121.764 1.00 79.97  ? 19  SER C O     1 
ATOM   1534  C  CB    . SER C 3  19  ? 170.049 154.270 121.632 1.00 79.97  ? 19  SER C CB    1 
ATOM   1535  O  OG    . SER C 3  19  ? 171.387 153.826 121.755 1.00 79.97  ? 19  SER C OG    1 
ATOM   1536  N  N     . ARG C 3  20  ? 170.090 151.474 123.398 1.00 82.41  ? 20  ARG C N     1 
ATOM   1537  C  CA    . ARG C 3  20  ? 170.062 150.023 123.501 1.00 82.41  ? 20  ARG C CA    1 
ATOM   1538  C  C     . ARG C 3  20  ? 168.835 149.518 124.240 1.00 82.41  ? 20  ARG C C     1 
ATOM   1539  O  O     . ARG C 3  20  ? 168.577 148.311 124.218 1.00 82.41  ? 20  ARG C O     1 
ATOM   1540  C  CB    . ARG C 3  20  ? 171.309 149.508 124.217 1.00 82.41  ? 20  ARG C CB    1 
ATOM   1541  C  CG    . ARG C 3  20  ? 172.614 149.623 123.452 1.00 82.41  ? 20  ARG C CG    1 
ATOM   1542  C  CD    . ARG C 3  20  ? 173.748 149.091 124.321 1.00 82.41  ? 20  ARG C CD    1 
ATOM   1543  N  NE    . ARG C 3  20  ? 175.061 149.171 123.688 1.00 82.41  ? 20  ARG C NE    1 
ATOM   1544  C  CZ    . ARG C 3  20  ? 175.596 148.190 122.974 1.00 82.41  ? 20  ARG C CZ    1 
ATOM   1545  N  NH1   . ARG C 3  20  ? 174.932 147.055 122.801 1.00 82.41  ? 20  ARG C NH1   1 
ATOM   1546  N  NH2   . ARG C 3  20  ? 176.794 148.337 122.434 1.00 82.41  ? 20  ARG C NH2   1 
ATOM   1547  N  N     . ALA C 3  21  ? 168.091 150.395 124.911 1.00 77.96  ? 21  ALA C N     1 
ATOM   1548  C  CA    . ALA C 3  21  ? 166.852 149.999 125.553 1.00 77.96  ? 21  ALA C CA    1 
ATOM   1549  C  C     . ALA C 3  21  ? 165.635 150.798 125.114 1.00 77.96  ? 21  ALA C C     1 
ATOM   1550  O  O     . ALA C 3  21  ? 164.517 150.422 125.477 1.00 77.96  ? 21  ALA C O     1 
ATOM   1551  C  CB    . ALA C 3  21  ? 166.984 150.101 127.076 1.00 77.96  ? 21  ALA C CB    1 
ATOM   1552  N  N     . GLY C 3  22  ? 165.801 151.867 124.344 1.00 79.53  ? 22  GLY C N     1 
ATOM   1553  C  CA    . GLY C 3  22  ? 164.653 152.631 123.895 1.00 79.53  ? 22  GLY C CA    1 
ATOM   1554  C  C     . GLY C 3  22  ? 164.145 153.643 124.895 1.00 79.53  ? 22  GLY C C     1 
ATOM   1555  O  O     . GLY C 3  22  ? 162.932 153.856 124.994 1.00 79.53  ? 22  GLY C O     1 
ATOM   1556  N  N     . LEU C 3  23  ? 165.041 154.278 125.647 1.00 73.20  ? 23  LEU C N     1 
ATOM   1557  C  CA    . LEU C 3  23  ? 164.614 155.261 126.631 1.00 73.20  ? 23  LEU C CA    1 
ATOM   1558  C  C     . LEU C 3  23  ? 165.368 156.559 126.415 1.00 73.20  ? 23  LEU C C     1 
ATOM   1559  O  O     . LEU C 3  23  ? 166.055 156.718 125.403 1.00 73.20  ? 23  LEU C O     1 
ATOM   1560  C  CB    . LEU C 3  23  ? 164.844 154.773 128.059 1.00 73.20  ? 23  LEU C CB    1 
ATOM   1561  C  CG    . LEU C 3  23  ? 163.877 153.730 128.623 1.00 73.20  ? 23  LEU C CG    1 
ATOM   1562  C  CD1   . LEU C 3  23  ? 162.426 154.082 128.335 1.00 73.20  ? 23  LEU C CD1   1 
ATOM   1563  C  CD2   . LEU C 3  23  ? 164.200 152.316 128.190 1.00 73.20  ? 23  LEU C CD2   1 
ATOM   1564  N  N     . GLN C 3  24  ? 165.235 157.502 127.349 1.00 72.11  ? 24  GLN C N     1 
ATOM   1565  C  CA    . GLN C 3  24  ? 165.967 158.762 127.280 1.00 72.11  ? 24  GLN C CA    1 
ATOM   1566  C  C     . GLN C 3  24  ? 166.560 159.142 128.632 1.00 72.11  ? 24  GLN C C     1 
ATOM   1567  O  O     . GLN C 3  24  ? 166.623 160.328 128.966 1.00 72.11  ? 24  GLN C O     1 
ATOM   1568  C  CB    . GLN C 3  24  ? 165.075 159.904 126.790 1.00 72.11  ? 24  GLN C CB    1 
ATOM   1569  C  CG    . GLN C 3  24  ? 164.476 159.720 125.402 1.00 72.11  ? 24  GLN C CG    1 
ATOM   1570  C  CD    . GLN C 3  24  ? 165.505 159.740 124.287 1.00 72.11  ? 24  GLN C CD    1 
ATOM   1571  O  OE1   . GLN C 3  24  ? 166.418 160.564 124.283 1.00 72.11  ? 24  GLN C OE1   1 
ATOM   1572  N  NE2   . GLN C 3  24  ? 165.365 158.825 123.337 1.00 72.11  ? 24  GLN C NE2   1 
ATOM   1573  N  N     . PHE C 3  25  ? 167.007 158.175 129.430 1.00 71.49  ? 25  PHE C N     1 
ATOM   1574  C  CA    . PHE C 3  25  ? 167.642 158.383 130.724 1.00 71.49  ? 25  PHE C CA    1 
ATOM   1575  C  C     . PHE C 3  25  ? 169.033 157.768 130.770 1.00 71.49  ? 25  PHE C C     1 
ATOM   1576  O  O     . PHE C 3  25  ? 169.285 156.757 130.112 1.00 71.49  ? 25  PHE C O     1 
ATOM   1577  C  CB    . PHE C 3  25  ? 166.797 157.809 131.874 1.00 71.49  ? 25  PHE C CB    1 
ATOM   1578  C  CG    . PHE C 3  25  ? 165.855 158.797 132.472 1.00 71.49  ? 25  PHE C CG    1 
ATOM   1579  C  CD1   . PHE C 3  25  ? 165.845 160.101 132.041 1.00 71.49  ? 25  PHE C CD1   1 
ATOM   1580  C  CD2   . PHE C 3  25  ? 165.066 158.452 133.546 1.00 71.49  ? 25  PHE C CD2   1 
ATOM   1581  C  CE1   . PHE C 3  25  ? 165.006 161.020 132.609 1.00 71.49  ? 25  PHE C CE1   1 
ATOM   1582  C  CE2   . PHE C 3  25  ? 164.237 159.374 134.129 1.00 71.49  ? 25  PHE C CE2   1 
ATOM   1583  C  CZ    . PHE C 3  25  ? 164.206 160.659 133.655 1.00 71.49  ? 25  PHE C CZ    1 
ATOM   1584  N  N     . PRO C 3  26  ? 169.962 158.346 131.541 1.00 68.33  ? 26  PRO C N     1 
ATOM   1585  C  CA    . PRO C 3  26  ? 171.338 157.838 131.545 1.00 68.33  ? 26  PRO C CA    1 
ATOM   1586  C  C     . PRO C 3  26  ? 171.454 156.543 132.327 1.00 68.33  ? 26  PRO C C     1 
ATOM   1587  O  O     . PRO C 3  26  ? 171.407 156.534 133.562 1.00 68.33  ? 26  PRO C O     1 
ATOM   1588  C  CB    . PRO C 3  26  ? 172.125 158.978 132.202 1.00 68.33  ? 26  PRO C CB    1 
ATOM   1589  C  CG    . PRO C 3  26  ? 171.139 159.674 133.047 1.00 68.33  ? 26  PRO C CG    1 
ATOM   1590  C  CD    . PRO C 3  26  ? 169.838 159.577 132.345 1.00 68.33  ? 26  PRO C CD    1 
ATOM   1591  N  N     . VAL C 3  27  ? 171.626 155.438 131.610 1.00 62.77  ? 27  VAL C N     1 
ATOM   1592  C  CA    . VAL C 3  27  ? 171.793 154.155 132.271 1.00 62.77  ? 27  VAL C CA    1 
ATOM   1593  C  C     . VAL C 3  27  ? 173.137 154.103 132.972 1.00 62.77  ? 27  VAL C C     1 
ATOM   1594  O  O     . VAL C 3  27  ? 173.262 153.566 134.077 1.00 62.77  ? 27  VAL C O     1 
ATOM   1595  C  CB    . VAL C 3  27  ? 171.630 153.020 131.248 1.00 62.77  ? 27  VAL C CB    1 
ATOM   1596  C  CG1   . VAL C 3  27  ? 171.845 151.671 131.883 1.00 62.77  ? 27  VAL C CG1   1 
ATOM   1597  C  CG2   . VAL C 3  27  ? 170.257 153.089 130.635 1.00 62.77  ? 27  VAL C CG2   1 
ATOM   1598  N  N     . GLY C 3  28  ? 174.156 154.706 132.373 1.00 67.03  ? 28  GLY C N     1 
ATOM   1599  C  CA    . GLY C 3  28  ? 175.478 154.633 132.956 1.00 67.03  ? 28  GLY C CA    1 
ATOM   1600  C  C     . GLY C 3  28  ? 175.636 155.523 134.169 1.00 67.03  ? 28  GLY C C     1 
ATOM   1601  O  O     . GLY C 3  28  ? 176.288 155.141 135.140 1.00 67.03  ? 28  GLY C O     1 
ATOM   1602  N  N     . ARG C 3  29  ? 175.049 156.721 134.131 1.00 73.40  ? 29  ARG C N     1 
ATOM   1603  C  CA    . ARG C 3  29  ? 175.161 157.629 135.267 1.00 73.40  ? 29  ARG C CA    1 
ATOM   1604  C  C     . ARG C 3  29  ? 174.373 157.102 136.465 1.00 73.40  ? 29  ARG C C     1 
ATOM   1605  O  O     . ARG C 3  29  ? 174.866 157.115 137.603 1.00 73.40  ? 29  ARG C O     1 
ATOM   1606  C  CB    . ARG C 3  29  ? 174.683 159.028 134.875 1.00 73.40  ? 29  ARG C CB    1 
ATOM   1607  C  CG    . ARG C 3  29  ? 174.918 160.078 135.948 1.00 73.40  ? 29  ARG C CG    1 
ATOM   1608  C  CD    . ARG C 3  29  ? 174.263 161.423 135.632 1.00 73.40  ? 29  ARG C CD    1 
ATOM   1609  N  NE    . ARG C 3  29  ? 174.861 162.119 134.499 1.00 73.40  ? 29  ARG C NE    1 
ATOM   1610  C  CZ    . ARG C 3  29  ? 174.386 163.253 134.000 1.00 73.40  ? 29  ARG C CZ    1 
ATOM   1611  N  NH1   . ARG C 3  29  ? 173.318 163.816 134.538 1.00 73.40  ? 29  ARG C NH1   1 
ATOM   1612  N  NH2   . ARG C 3  29  ? 174.977 163.832 132.967 1.00 73.40  ? 29  ARG C NH2   1 
ATOM   1613  N  N     . VAL C 3  30  ? 173.158 156.605 136.216 1.00 67.81  ? 30  VAL C N     1 
ATOM   1614  C  CA    . VAL C 3  30  ? 172.370 155.969 137.267 1.00 67.81  ? 30  VAL C CA    1 
ATOM   1615  C  C     . VAL C 3  30  ? 173.070 154.714 137.766 1.00 67.81  ? 30  VAL C C     1 
ATOM   1616  O  O     . VAL C 3  30  ? 173.099 154.443 138.969 1.00 67.81  ? 30  VAL C O     1 
ATOM   1617  C  CB    . VAL C 3  30  ? 170.947 155.687 136.747 1.00 67.81  ? 30  VAL C CB    1 
ATOM   1618  C  CG1   . VAL C 3  30  ? 170.186 154.793 137.672 1.00 67.81  ? 30  VAL C CG1   1 
ATOM   1619  C  CG2   . VAL C 3  30  ? 170.185 156.978 136.606 1.00 67.81  ? 30  VAL C CG2   1 
ATOM   1620  N  N     . HIS C 3  31  ? 173.711 153.979 136.861 1.00 65.60  ? 31  HIS C N     1 
ATOM   1621  C  CA    . HIS C 3  31  ? 174.438 152.764 137.219 1.00 65.60  ? 31  HIS C CA    1 
ATOM   1622  C  C     . HIS C 3  31  ? 175.626 153.064 138.122 1.00 65.60  ? 31  HIS C C     1 
ATOM   1623  O  O     . HIS C 3  31  ? 175.906 152.310 139.067 1.00 65.60  ? 31  HIS C O     1 
ATOM   1624  C  CB    . HIS C 3  31  ? 174.910 152.071 135.954 1.00 65.60  ? 31  HIS C CB    1 
ATOM   1625  C  CG    . HIS C 3  31  ? 175.712 150.847 136.210 1.00 65.60  ? 31  HIS C CG    1 
ATOM   1626  N  ND1   . HIS C 3  31  ? 175.149 149.667 136.634 1.00 65.60  ? 31  HIS C ND1   1 
ATOM   1627  C  CD2   . HIS C 3  31  ? 177.037 150.615 136.095 1.00 65.60  ? 31  HIS C CD2   1 
ATOM   1628  C  CE1   . HIS C 3  31  ? 176.095 148.758 136.772 1.00 65.60  ? 31  HIS C CE1   1 
ATOM   1629  N  NE2   . HIS C 3  31  ? 177.251 149.308 136.450 1.00 65.60  ? 31  HIS C NE2   1 
ATOM   1630  N  N     . ARG C 3  32  ? 176.343 154.148 137.821 1.00 71.62  ? 32  ARG C N     1 
ATOM   1631  C  CA    . ARG C 3  32  ? 177.351 154.682 138.728 1.00 71.62  ? 32  ARG C CA    1 
ATOM   1632  C  C     . ARG C 3  32  ? 176.736 154.984 140.083 1.00 71.62  ? 32  ARG C C     1 
ATOM   1633  O  O     . ARG C 3  32  ? 177.288 154.608 141.124 1.00 71.62  ? 32  ARG C O     1 
ATOM   1634  C  CB    . ARG C 3  32  ? 177.966 155.946 138.113 1.00 71.62  ? 32  ARG C CB    1 
ATOM   1635  C  CG    . ARG C 3  32  ? 179.217 156.553 138.781 1.00 71.62  ? 32  ARG C CG    1 
ATOM   1636  C  CD    . ARG C 3  32  ? 178.911 157.558 139.908 1.00 71.62  ? 32  ARG C CD    1 
ATOM   1637  N  NE    . ARG C 3  32  ? 177.965 158.600 139.529 1.00 71.62  ? 32  ARG C NE    1 
ATOM   1638  C  CZ    . ARG C 3  32  ? 178.306 159.780 139.028 1.00 71.62  ? 32  ARG C CZ    1 
ATOM   1639  N  NH1   . ARG C 3  32  ? 179.582 160.085 138.865 1.00 71.62  ? 32  ARG C NH1   1 
ATOM   1640  N  NH2   . ARG C 3  32  ? 177.370 160.660 138.711 1.00 71.62  ? 32  ARG C NH2   1 
ATOM   1641  N  N     . LEU C 3  33  ? 175.579 155.645 140.087 1.00 71.97  ? 33  LEU C N     1 
ATOM   1642  C  CA    . LEU C 3  33  ? 175.013 156.098 141.350 1.00 71.97  ? 33  LEU C CA    1 
ATOM   1643  C  C     . LEU C 3  33  ? 174.449 154.944 142.167 1.00 71.97  ? 33  LEU C C     1 
ATOM   1644  O  O     . LEU C 3  33  ? 174.305 155.063 143.386 1.00 71.97  ? 33  LEU C O     1 
ATOM   1645  C  CB    . LEU C 3  33  ? 173.957 157.159 141.088 1.00 71.97  ? 33  LEU C CB    1 
ATOM   1646  C  CG    . LEU C 3  33  ? 174.581 158.461 140.607 1.00 71.97  ? 33  LEU C CG    1 
ATOM   1647  C  CD1   . LEU C 3  33  ? 173.506 159.423 140.144 1.00 71.97  ? 33  LEU C CD1   1 
ATOM   1648  C  CD2   . LEU C 3  33  ? 175.393 159.063 141.736 1.00 71.97  ? 33  LEU C CD2   1 
ATOM   1649  N  N     . LEU C 3  34  ? 174.119 153.824 141.525 1.00 67.24  ? 34  LEU C N     1 
ATOM   1650  C  CA    . LEU C 3  34  ? 173.810 152.633 142.303 1.00 67.24  ? 34  LEU C CA    1 
ATOM   1651  C  C     . LEU C 3  34  ? 175.072 151.968 142.813 1.00 67.24  ? 34  LEU C C     1 
ATOM   1652  O  O     . LEU C 3  34  ? 175.057 151.384 143.898 1.00 67.24  ? 34  LEU C O     1 
ATOM   1653  C  CB    . LEU C 3  34  ? 173.004 151.615 141.504 1.00 67.24  ? 34  LEU C CB    1 
ATOM   1654  C  CG    . LEU C 3  34  ? 171.480 151.666 141.547 1.00 67.24  ? 34  LEU C CG    1 
ATOM   1655  C  CD1   . LEU C 3  34  ? 170.990 151.736 142.983 1.00 67.24  ? 34  LEU C CD1   1 
ATOM   1656  C  CD2   . LEU C 3  34  ? 170.901 152.753 140.719 1.00 67.24  ? 34  LEU C CD2   1 
ATOM   1657  N  N     . ARG C 3  35  ? 176.159 152.012 142.045 1.00 67.67  ? 35  ARG C N     1 
ATOM   1658  C  CA    . ARG C 3  35  ? 177.352 151.335 142.531 1.00 67.67  ? 35  ARG C CA    1 
ATOM   1659  C  C     . ARG C 3  35  ? 178.087 152.147 143.578 1.00 67.67  ? 35  ARG C C     1 
ATOM   1660  O  O     . ARG C 3  35  ? 178.825 151.578 144.384 1.00 67.67  ? 35  ARG C O     1 
ATOM   1661  C  CB    . ARG C 3  35  ? 178.319 151.018 141.396 1.00 67.67  ? 35  ARG C CB    1 
ATOM   1662  C  CG    . ARG C 3  35  ? 177.888 149.913 140.470 1.00 67.67  ? 35  ARG C CG    1 
ATOM   1663  C  CD    . ARG C 3  35  ? 179.012 149.585 139.505 1.00 67.67  ? 35  ARG C CD    1 
ATOM   1664  N  NE    . ARG C 3  35  ? 179.277 150.684 138.579 1.00 67.67  ? 35  ARG C NE    1 
ATOM   1665  C  CZ    . ARG C 3  35  ? 180.386 151.418 138.588 1.00 67.67  ? 35  ARG C CZ    1 
ATOM   1666  N  NH1   . ARG C 3  35  ? 181.334 151.180 139.482 1.00 67.67  ? 35  ARG C NH1   1 
ATOM   1667  N  NH2   . ARG C 3  35  ? 180.542 152.399 137.711 1.00 67.67  ? 35  ARG C NH2   1 
ATOM   1668  N  N     . LYS C 3  36  ? 177.910 153.458 143.595 1.00 71.73  ? 36  LYS C N     1 
ATOM   1669  C  CA    . LYS C 3  36  ? 178.734 154.305 144.441 1.00 71.73  ? 36  LYS C CA    1 
ATOM   1670  C  C     . LYS C 3  36  ? 177.915 154.981 145.526 1.00 71.73  ? 36  LYS C C     1 
ATOM   1671  O  O     . LYS C 3  36  ? 178.073 156.167 145.805 1.00 71.73  ? 36  LYS C O     1 
ATOM   1672  C  CB    . LYS C 3  36  ? 179.493 155.329 143.607 1.00 71.73  ? 36  LYS C CB    1 
ATOM   1673  C  CG    . LYS C 3  36  ? 180.561 154.680 142.746 1.00 71.73  ? 36  LYS C CG    1 
ATOM   1674  C  CD    . LYS C 3  36  ? 181.344 155.696 141.956 1.00 71.73  ? 36  LYS C CD    1 
ATOM   1675  C  CE    . LYS C 3  36  ? 182.320 155.004 141.026 1.00 71.73  ? 36  LYS C CE    1 
ATOM   1676  N  NZ    . LYS C 3  36  ? 183.079 155.968 140.178 1.00 71.73  ? 36  LYS C NZ    1 
ATOM   1677  N  N     . GLY C 3  37  ? 177.035 154.216 146.149 1.00 73.83  ? 37  GLY C N     1 
ATOM   1678  C  CA    . GLY C 3  37  ? 176.303 154.713 147.285 1.00 73.83  ? 37  GLY C CA    1 
ATOM   1679  C  C     . GLY C 3  37  ? 176.308 153.696 148.397 1.00 73.83  ? 37  GLY C C     1 
ATOM   1680  O  O     . GLY C 3  37  ? 175.667 153.915 149.427 1.00 73.83  ? 37  GLY C O     1 
ATOM   1681  N  N     . ASN C 3  38  ? 177.039 152.600 148.188 1.00 77.12  ? 38  ASN C N     1 
ATOM   1682  C  CA    . ASN C 3  38  ? 177.139 151.468 149.111 1.00 77.12  ? 38  ASN C CA    1 
ATOM   1683  C  C     . ASN C 3  38  ? 175.754 150.934 149.482 1.00 77.12  ? 38  ASN C C     1 
ATOM   1684  O  O     . ASN C 3  38  ? 175.274 151.088 150.596 1.00 77.12  ? 38  ASN C O     1 
ATOM   1685  C  CB    . ASN C 3  38  ? 177.940 151.833 150.367 1.00 77.12  ? 38  ASN C CB    1 
ATOM   1686  C  CG    . ASN C 3  38  ? 179.422 151.961 150.100 1.00 77.12  ? 38  ASN C CG    1 
ATOM   1687  O  OD1   . ASN C 3  38  ? 179.976 151.228 149.290 1.00 77.12  ? 38  ASN C OD1   1 
ATOM   1688  N  ND2   . ASN C 3  38  ? 180.082 152.861 150.814 1.00 77.12  ? 38  ASN C ND2   1 
ATOM   1689  N  N     . TYR C 3  39  ? 175.081 150.363 148.495 1.00 71.31  ? 39  TYR C N     1 
ATOM   1690  C  CA    . TYR C 3  39  ? 173.781 149.748 148.737 1.00 71.31  ? 39  TYR C CA    1 
ATOM   1691  C  C     . TYR C 3  39  ? 173.893 148.237 148.871 1.00 71.31  ? 39  TYR C C     1 
ATOM   1692  O  O     . TYR C 3  39  ? 173.517 147.672 149.900 1.00 71.31  ? 39  TYR C O     1 
ATOM   1693  C  CB    . TYR C 3  39  ? 172.821 150.140 147.623 1.00 71.31  ? 39  TYR C CB    1 
ATOM   1694  C  CG    . TYR C 3  39  ? 172.433 151.580 147.722 1.00 71.31  ? 39  TYR C CG    1 
ATOM   1695  C  CD1   . TYR C 3  39  ? 171.366 151.966 148.508 1.00 71.31  ? 39  TYR C CD1   1 
ATOM   1696  C  CD2   . TYR C 3  39  ? 173.166 152.560 147.076 1.00 71.31  ? 39  TYR C CD2   1 
ATOM   1697  C  CE1   . TYR C 3  39  ? 171.008 153.277 148.611 1.00 71.31  ? 39  TYR C CE1   1 
ATOM   1698  C  CE2   . TYR C 3  39  ? 172.819 153.873 147.177 1.00 71.31  ? 39  TYR C CE2   1 
ATOM   1699  C  CZ    . TYR C 3  39  ? 171.742 154.225 147.945 1.00 71.31  ? 39  TYR C CZ    1 
ATOM   1700  O  OH    . TYR C 3  39  ? 171.390 155.540 148.053 1.00 71.31  ? 39  TYR C OH    1 
ATOM   1701  N  N     . ALA C 3  40  ? 174.412 147.577 147.852 1.00 74.94  ? 40  ALA C N     1 
ATOM   1702  C  CA    . ALA C 3  40  ? 174.840 146.191 147.931 1.00 74.94  ? 40  ALA C CA    1 
ATOM   1703  C  C     . ALA C 3  40  ? 176.351 146.151 147.790 1.00 74.94  ? 40  ALA C C     1 
ATOM   1704  O  O     . ALA C 3  40  ? 177.009 147.181 147.679 1.00 74.94  ? 40  ALA C O     1 
ATOM   1705  C  CB    . ALA C 3  40  ? 174.170 145.345 146.848 1.00 74.94  ? 40  ALA C CB    1 
ATOM   1706  N  N     . GLU C 3  41  ? 176.911 144.947 147.801 1.00 75.96  ? 41  GLU C N     1 
ATOM   1707  C  CA    . GLU C 3  41  ? 178.303 144.838 147.395 1.00 75.96  ? 41  GLU C CA    1 
ATOM   1708  C  C     . GLU C 3  41  ? 178.419 144.846 145.877 1.00 75.96  ? 41  GLU C C     1 
ATOM   1709  O  O     . GLU C 3  41  ? 179.448 145.263 145.333 1.00 75.96  ? 41  GLU C O     1 
ATOM   1710  C  CB    . GLU C 3  41  ? 178.946 143.584 147.992 1.00 75.96  ? 41  GLU C CB    1 
ATOM   1711  C  CG    . GLU C 3  41  ? 180.469 143.531 147.809 1.00 75.96  ? 41  GLU C CG    1 
ATOM   1712  C  CD    . GLU C 3  41  ? 181.107 142.331 148.452 1.00 75.96  ? 41  GLU C CD    1 
ATOM   1713  O  OE1   . GLU C 3  41  ? 180.378 141.528 149.065 1.00 75.96  ? 41  GLU C OE1   1 
ATOM   1714  O  OE2   . GLU C 3  41  ? 182.337 142.187 148.331 1.00 75.96  ? 41  GLU C OE2   1 
ATOM   1715  N  N     . ARG C 3  42  ? 177.361 144.446 145.178 1.00 74.26  ? 42  ARG C N     1 
ATOM   1716  C  CA    . ARG C 3  42  ? 177.427 144.323 143.733 1.00 74.26  ? 42  ARG C CA    1 
ATOM   1717  C  C     . ARG C 3  42  ? 176.042 144.524 143.139 1.00 74.26  ? 42  ARG C C     1 
ATOM   1718  O  O     . ARG C 3  42  ? 175.033 144.238 143.779 1.00 74.26  ? 42  ARG C O     1 
ATOM   1719  C  CB    . ARG C 3  42  ? 178.028 142.974 143.361 1.00 74.26  ? 42  ARG C CB    1 
ATOM   1720  C  CG    . ARG C 3  42  ? 177.248 141.790 143.849 1.00 74.26  ? 42  ARG C CG    1 
ATOM   1721  C  CD    . ARG C 3  42  ? 178.131 140.569 143.811 1.00 74.26  ? 42  ARG C CD    1 
ATOM   1722  N  NE    . ARG C 3  42  ? 178.558 140.231 142.461 1.00 74.26  ? 42  ARG C NE    1 
ATOM   1723  C  CZ    . ARG C 3  42  ? 179.636 139.510 142.201 1.00 74.26  ? 42  ARG C CZ    1 
ATOM   1724  N  NH1   . ARG C 3  42  ? 180.389 139.080 143.204 1.00 74.26  ? 42  ARG C NH1   1 
ATOM   1725  N  NH2   . ARG C 3  42  ? 179.972 139.236 140.949 1.00 74.26  ? 42  ARG C NH2   1 
ATOM   1726  N  N     . VAL C 3  43  ? 176.003 145.057 141.920 1.00 70.57  ? 43  VAL C N     1 
ATOM   1727  C  CA    . VAL C 3  43  ? 174.768 145.477 141.267 1.00 70.57  ? 43  VAL C CA    1 
ATOM   1728  C  C     . VAL C 3  43  ? 174.670 144.781 139.922 1.00 70.57  ? 43  VAL C C     1 
ATOM   1729  O  O     . VAL C 3  43  ? 175.574 144.905 139.092 1.00 70.57  ? 43  VAL C O     1 
ATOM   1730  C  CB    . VAL C 3  43  ? 174.722 147.002 141.073 1.00 70.57  ? 43  VAL C CB    1 
ATOM   1731  C  CG1   . VAL C 3  43  ? 173.457 147.416 140.350 1.00 70.57  ? 43  VAL C CG1   1 
ATOM   1732  C  CG2   . VAL C 3  43  ? 174.829 147.709 142.399 1.00 70.57  ? 43  VAL C CG2   1 
ATOM   1733  N  N     . GLY C 3  44  ? 173.549 144.106 139.683 1.00 79.43  ? 44  GLY C N     1 
ATOM   1734  C  CA    . GLY C 3  44  ? 173.340 143.350 138.460 1.00 79.43  ? 44  GLY C CA    1 
ATOM   1735  C  C     . GLY C 3  44  ? 173.276 144.148 137.173 1.00 79.43  ? 44  GLY C C     1 
ATOM   1736  O  O     . GLY C 3  44  ? 173.497 145.362 137.160 1.00 79.43  ? 44  GLY C O     1 
ATOM   1737  N  N     . ALA C 3  45  ? 172.962 143.478 136.071 1.00 73.06  ? 45  ALA C N     1 
ATOM   1738  C  CA    . ALA C 3  45  ? 173.035 144.145 134.780 1.00 73.06  ? 45  ALA C CA    1 
ATOM   1739  C  C     . ALA C 3  45  ? 171.770 144.943 134.486 1.00 73.06  ? 45  ALA C C     1 
ATOM   1740  O  O     . ALA C 3  45  ? 171.840 146.120 134.118 1.00 73.06  ? 45  ALA C O     1 
ATOM   1741  C  CB    . ALA C 3  45  ? 173.289 143.119 133.678 1.00 73.06  ? 45  ALA C CB    1 
ATOM   1742  N  N     . GLY C 3  46  ? 170.602 144.319 134.650 1.00 67.33  ? 46  GLY C N     1 
ATOM   1743  C  CA    . GLY C 3  46  ? 169.371 144.912 134.161 1.00 67.33  ? 46  GLY C CA    1 
ATOM   1744  C  C     . GLY C 3  46  ? 168.806 146.017 135.019 1.00 67.33  ? 46  GLY C C     1 
ATOM   1745  O  O     . GLY C 3  46  ? 167.901 146.723 134.568 1.00 67.33  ? 46  GLY C O     1 
ATOM   1746  N  N     . ALA C 3  47  ? 169.335 146.193 136.227 1.00 64.62  ? 47  ALA C N     1 
ATOM   1747  C  CA    . ALA C 3  47  ? 168.685 147.051 137.221 1.00 64.62  ? 47  ALA C CA    1 
ATOM   1748  C  C     . ALA C 3  47  ? 168.638 148.539 136.873 1.00 64.62  ? 47  ALA C C     1 
ATOM   1749  O  O     . ALA C 3  47  ? 167.561 149.144 137.061 1.00 64.62  ? 47  ALA C O     1 
ATOM   1750  C  CB    . ALA C 3  47  ? 169.333 146.805 138.590 1.00 64.62  ? 47  ALA C CB    1 
ATOM   1751  N  N     . PRO C 3  48  ? 169.707 149.206 136.389 1.00 65.87  ? 48  PRO C N     1 
ATOM   1752  C  CA    . PRO C 3  48  ? 169.550 150.640 136.096 1.00 65.87  ? 48  PRO C CA    1 
ATOM   1753  C  C     . PRO C 3  48  ? 168.659 150.919 134.902 1.00 65.87  ? 48  PRO C C     1 
ATOM   1754  O  O     . PRO C 3  48  ? 168.091 152.016 134.801 1.00 65.87  ? 48  PRO C O     1 
ATOM   1755  C  CB    . PRO C 3  48  ? 170.988 151.110 135.849 1.00 65.87  ? 48  PRO C CB    1 
ATOM   1756  C  CG    . PRO C 3  48  ? 171.820 150.119 136.491 1.00 65.87  ? 48  PRO C CG    1 
ATOM   1757  C  CD    . PRO C 3  48  ? 171.133 148.839 136.270 1.00 65.87  ? 48  PRO C CD    1 
ATOM   1758  N  N     . VAL C 3  49  ? 168.522 149.947 133.998 1.00 65.15  ? 49  VAL C N     1 
ATOM   1759  C  CA    . VAL C 3  49  ? 167.517 150.032 132.945 1.00 65.15  ? 49  VAL C CA    1 
ATOM   1760  C  C     . VAL C 3  49  ? 166.127 150.084 133.560 1.00 65.15  ? 49  VAL C C     1 
ATOM   1761  O  O     . VAL C 3  49  ? 165.272 150.890 133.156 1.00 65.15  ? 49  VAL C O     1 
ATOM   1762  C  CB    . VAL C 3  49  ? 167.659 148.836 131.989 1.00 65.15  ? 49  VAL C CB    1 
ATOM   1763  C  CG1   . VAL C 3  49  ? 166.605 148.880 130.899 1.00 65.15  ? 49  VAL C CG1   1 
ATOM   1764  C  CG2   . VAL C 3  49  ? 169.044 148.797 131.400 1.00 65.15  ? 49  VAL C CG2   1 
ATOM   1765  N  N     . TYR C 3  50  ? 165.902 149.253 134.577 1.00 63.15  ? 50  TYR C N     1 
ATOM   1766  C  CA    . TYR C 3  50  ? 164.594 149.171 135.204 1.00 63.15  ? 50  TYR C CA    1 
ATOM   1767  C  C     . TYR C 3  50  ? 164.273 150.461 135.937 1.00 63.15  ? 50  TYR C C     1 
ATOM   1768  O  O     . TYR C 3  50  ? 163.218 151.075 135.715 1.00 63.15  ? 50  TYR C O     1 
ATOM   1769  C  CB    . TYR C 3  50  ? 164.563 147.992 136.168 1.00 63.15  ? 50  TYR C CB    1 
ATOM   1770  C  CG    . TYR C 3  50  ? 163.171 147.608 136.579 1.00 63.15  ? 50  TYR C CG    1 
ATOM   1771  C  CD1   . TYR C 3  50  ? 162.430 146.726 135.815 1.00 63.15  ? 50  TYR C CD1   1 
ATOM   1772  C  CD2   . TYR C 3  50  ? 162.569 148.168 137.689 1.00 63.15  ? 50  TYR C CD2   1 
ATOM   1773  C  CE1   . TYR C 3  50  ? 161.150 146.373 136.178 1.00 63.15  ? 50  TYR C CE1   1 
ATOM   1774  C  CE2   . TYR C 3  50  ? 161.286 147.839 138.048 1.00 63.15  ? 50  TYR C CE2   1 
ATOM   1775  C  CZ    . TYR C 3  50  ? 160.584 146.941 137.289 1.00 63.15  ? 50  TYR C CZ    1 
ATOM   1776  O  OH    . TYR C 3  50  ? 159.307 146.602 137.635 1.00 63.15  ? 50  TYR C OH    1 
ATOM   1777  N  N     . LEU C 3  51  ? 165.197 150.906 136.789 1.00 59.38  ? 51  LEU C N     1 
ATOM   1778  C  CA    . LEU C 3  51  ? 164.967 152.094 137.602 1.00 59.38  ? 51  LEU C CA    1 
ATOM   1779  C  C     . LEU C 3  51  ? 164.871 153.347 136.745 1.00 59.38  ? 51  LEU C C     1 
ATOM   1780  O  O     . LEU C 3  51  ? 164.079 154.256 137.032 1.00 59.38  ? 51  LEU C O     1 
ATOM   1781  C  CB    . LEU C 3  51  ? 166.085 152.217 138.631 1.00 59.38  ? 51  LEU C CB    1 
ATOM   1782  C  CG    . LEU C 3  51  ? 166.050 153.405 139.569 1.00 59.38  ? 51  LEU C CG    1 
ATOM   1783  C  CD1   . LEU C 3  51  ? 164.772 153.405 140.316 1.00 59.38  ? 51  LEU C CD1   1 
ATOM   1784  C  CD2   . LEU C 3  51  ? 167.181 153.250 140.523 1.00 59.38  ? 51  LEU C CD2   1 
ATOM   1785  N  N     . ALA C 3  52  ? 165.643 153.388 135.657 1.00 62.13  ? 52  ALA C N     1 
ATOM   1786  C  CA    . ALA C 3  52  ? 165.539 154.500 134.723 1.00 62.13  ? 52  ALA C CA    1 
ATOM   1787  C  C     . ALA C 3  52  ? 164.181 154.520 134.035 1.00 62.13  ? 52  ALA C C     1 
ATOM   1788  O  O     . ALA C 3  52  ? 163.617 155.597 133.799 1.00 62.13  ? 52  ALA C O     1 
ATOM   1789  C  CB    . ALA C 3  52  ? 166.659 154.417 133.697 1.00 62.13  ? 52  ALA C CB    1 
ATOM   1790  N  N     . ALA C 3  53  ? 163.634 153.341 133.728 1.00 65.10  ? 53  ALA C N     1 
ATOM   1791  C  CA    . ALA C 3  53  ? 162.309 153.293 133.119 1.00 65.10  ? 53  ALA C CA    1 
ATOM   1792  C  C     . ALA C 3  53  ? 161.237 153.803 134.073 1.00 65.10  ? 53  ALA C C     1 
ATOM   1793  O  O     . ALA C 3  53  ? 160.333 154.553 133.665 1.00 65.10  ? 53  ALA C O     1 
ATOM   1794  C  CB    . ALA C 3  53  ? 161.987 151.872 132.676 1.00 65.10  ? 53  ALA C CB    1 
ATOM   1795  N  N     . VAL C 3  54  ? 161.340 153.422 135.351 1.00 61.94  ? 54  VAL C N     1 
ATOM   1796  C  CA    . VAL C 3  54  ? 160.359 153.850 136.345 1.00 61.94  ? 54  VAL C CA    1 
ATOM   1797  C  C     . VAL C 3  54  ? 160.410 155.358 136.526 1.00 61.94  ? 54  VAL C C     1 
ATOM   1798  O  O     . VAL C 3  54  ? 159.378 156.045 136.520 1.00 61.94  ? 54  VAL C O     1 
ATOM   1799  C  CB    . VAL C 3  54  ? 160.601 153.109 137.667 1.00 61.94  ? 54  VAL C CB    1 
ATOM   1800  C  CG1   . VAL C 3  54  ? 159.685 153.623 138.731 1.00 61.94  ? 54  VAL C CG1   1 
ATOM   1801  C  CG2   . VAL C 3  54  ? 160.393 151.634 137.462 1.00 61.94  ? 54  VAL C CG2   1 
ATOM   1802  N  N     . LEU C 3  55  ? 161.618 155.903 136.621 1.00 65.06  ? 55  LEU C N     1 
ATOM   1803  C  CA    . LEU C 3  55  ? 161.753 157.339 136.828 1.00 65.06  ? 55  LEU C CA    1 
ATOM   1804  C  C     . LEU C 3  55  ? 161.344 158.139 135.596 1.00 65.06  ? 55  LEU C C     1 
ATOM   1805  O  O     . LEU C 3  55  ? 160.853 159.268 135.728 1.00 65.06  ? 55  LEU C O     1 
ATOM   1806  C  CB    . LEU C 3  55  ? 163.182 157.653 137.258 1.00 65.06  ? 55  LEU C CB    1 
ATOM   1807  C  CG    . LEU C 3  55  ? 163.434 157.756 138.765 1.00 65.06  ? 55  LEU C CG    1 
ATOM   1808  C  CD1   . LEU C 3  55  ? 162.963 156.572 139.550 1.00 65.06  ? 55  LEU C CD1   1 
ATOM   1809  C  CD2   . LEU C 3  55  ? 164.911 157.838 138.942 1.00 65.06  ? 55  LEU C CD2   1 
ATOM   1810  N  N     . GLU C 3  56  ? 161.485 157.564 134.400 1.00 71.03  ? 56  GLU C N     1 
ATOM   1811  C  CA    . GLU C 3  56  ? 160.989 158.262 133.220 1.00 71.03  ? 56  GLU C CA    1 
ATOM   1812  C  C     . GLU C 3  56  ? 159.468 158.262 133.187 1.00 71.03  ? 56  GLU C C     1 
ATOM   1813  O  O     . GLU C 3  56  ? 158.856 159.241 132.742 1.00 71.03  ? 56  GLU C O     1 
ATOM   1814  C  CB    . GLU C 3  56  ? 161.566 157.657 131.938 1.00 71.03  ? 56  GLU C CB    1 
ATOM   1815  C  CG    . GLU C 3  56  ? 161.162 158.435 130.683 1.00 71.03  ? 56  GLU C CG    1 
ATOM   1816  C  CD    . GLU C 3  56  ? 161.882 157.996 129.444 1.00 71.03  ? 56  GLU C CD    1 
ATOM   1817  O  OE1   . GLU C 3  56  ? 162.728 157.097 129.555 1.00 71.03  ? 56  GLU C OE1   1 
ATOM   1818  O  OE2   . GLU C 3  56  ? 161.610 158.555 128.361 1.00 71.03  ? 56  GLU C OE2   1 
ATOM   1819  N  N     . TYR C 3  57  ? 158.846 157.185 133.669 1.00 71.20  ? 57  TYR C N     1 
ATOM   1820  C  CA    . TYR C 3  57  ? 157.390 157.169 133.793 1.00 71.20  ? 57  TYR C CA    1 
ATOM   1821  C  C     . TYR C 3  57  ? 156.903 158.261 134.738 1.00 71.20  ? 57  TYR C C     1 
ATOM   1822  O  O     . TYR C 3  57  ? 156.081 159.105 134.354 1.00 71.20  ? 57  TYR C O     1 
ATOM   1823  C  CB    . TYR C 3  57  ? 156.916 155.809 134.280 1.00 71.20  ? 57  TYR C CB    1 
ATOM   1824  C  CG    . TYR C 3  57  ? 155.435 155.774 134.522 1.00 71.20  ? 57  TYR C CG    1 
ATOM   1825  C  CD1   . TYR C 3  57  ? 154.547 155.777 133.463 1.00 71.20  ? 57  TYR C CD1   1 
ATOM   1826  C  CD2   . TYR C 3  57  ? 154.921 155.736 135.807 1.00 71.20  ? 57  TYR C CD2   1 
ATOM   1827  C  CE1   . TYR C 3  57  ? 153.187 155.739 133.676 1.00 71.20  ? 57  TYR C CE1   1 
ATOM   1828  C  CE2   . TYR C 3  57  ? 153.563 155.697 136.029 1.00 71.20  ? 57  TYR C CE2   1 
ATOM   1829  C  CZ    . TYR C 3  57  ? 152.701 155.710 134.962 1.00 71.20  ? 57  TYR C CZ    1 
ATOM   1830  O  OH    . TYR C 3  57  ? 151.346 155.678 135.179 1.00 71.20  ? 57  TYR C OH    1 
ATOM   1831  N  N     . LEU C 3  58  ? 157.440 158.275 135.963 1.00 71.31  ? 58  LEU C N     1 
ATOM   1832  C  CA    . LEU C 3  58  ? 157.005 159.214 136.996 1.00 71.31  ? 58  LEU C CA    1 
ATOM   1833  C  C     . LEU C 3  58  ? 157.230 160.657 136.562 1.00 71.31  ? 58  LEU C C     1 
ATOM   1834  O  O     . LEU C 3  58  ? 156.317 161.496 136.635 1.00 71.31  ? 58  LEU C O     1 
ATOM   1835  C  CB    . LEU C 3  58  ? 157.761 158.925 138.291 1.00 71.31  ? 58  LEU C CB    1 
ATOM   1836  C  CG    . LEU C 3  58  ? 157.528 157.514 138.815 1.00 71.31  ? 58  LEU C CG    1 
ATOM   1837  C  CD1   . LEU C 3  58  ? 158.428 157.215 139.980 1.00 71.31  ? 58  LEU C CD1   1 
ATOM   1838  C  CD2   . LEU C 3  58  ? 156.107 157.364 139.215 1.00 71.31  ? 58  LEU C CD2   1 
ATOM   1839  N  N     . THR C 3  59  ? 158.437 160.924 136.047 1.00 71.32  ? 59  THR C N     1 
ATOM   1840  C  CA    . THR C 3  59  ? 158.787 162.209 135.451 1.00 71.32  ? 59  THR C CA    1 
ATOM   1841  C  C     . THR C 3  59  ? 157.815 162.603 134.343 1.00 71.32  ? 59  THR C C     1 
ATOM   1842  O  O     . THR C 3  59  ? 157.409 163.771 134.238 1.00 71.32  ? 59  THR C O     1 
ATOM   1843  C  CB    . THR C 3  59  ? 160.202 162.121 134.889 1.00 71.32  ? 59  THR C CB    1 
ATOM   1844  O  OG1   . THR C 3  59  ? 161.097 161.680 135.914 1.00 71.32  ? 59  THR C OG1   1 
ATOM   1845  C  CG2   . THR C 3  59  ? 160.661 163.463 134.376 1.00 71.32  ? 59  THR C CG2   1 
ATOM   1846  N  N     . ALA C 3  60  ? 157.389 161.620 133.548 1.00 76.38  ? 60  ALA C N     1 
ATOM   1847  C  CA    . ALA C 3  60  ? 156.566 161.892 132.378 1.00 76.38  ? 60  ALA C CA    1 
ATOM   1848  C  C     . ALA C 3  60  ? 155.177 162.368 132.774 1.00 76.38  ? 60  ALA C C     1 
ATOM   1849  O  O     . ALA C 3  60  ? 154.708 163.401 132.283 1.00 76.38  ? 60  ALA C O     1 
ATOM   1850  C  CB    . ALA C 3  60  ? 156.485 160.650 131.490 1.00 76.38  ? 60  ALA C CB    1 
ATOM   1851  N  N     . GLU C 3  61  ? 154.496 161.642 133.671 1.00 78.25  ? 61  GLU C N     1 
ATOM   1852  C  CA    . GLU C 3  61  ? 153.150 162.126 133.982 1.00 78.25  ? 61  GLU C CA    1 
ATOM   1853  C  C     . GLU C 3  61  ? 153.165 163.314 134.933 1.00 78.25  ? 61  GLU C C     1 
ATOM   1854  O  O     . GLU C 3  61  ? 152.193 164.083 134.951 1.00 78.25  ? 61  GLU C O     1 
ATOM   1855  C  CB    . GLU C 3  61  ? 152.244 161.051 134.570 1.00 78.25  ? 61  GLU C CB    1 
ATOM   1856  C  CG    . GLU C 3  61  ? 152.655 160.573 135.918 1.00 78.25  ? 61  GLU C CG    1 
ATOM   1857  C  CD    . GLU C 3  61  ? 153.277 159.222 135.834 1.00 78.25  ? 61  GLU C CD    1 
ATOM   1858  O  OE1   . GLU C 3  61  ? 153.358 158.704 134.707 1.00 78.25  ? 61  GLU C OE1   1 
ATOM   1859  O  OE2   . GLU C 3  61  ? 153.705 158.692 136.879 1.00 78.25  ? 61  GLU C OE2   1 
ATOM   1860  N  N     . ILE C 3  62  ? 154.229 163.497 135.723 1.00 75.23  ? 62  ILE C N     1 
ATOM   1861  C  CA    . ILE C 3  62  ? 154.235 164.688 136.568 1.00 75.23  ? 62  ILE C CA    1 
ATOM   1862  C  C     . ILE C 3  62  ? 154.450 165.932 135.710 1.00 75.23  ? 62  ILE C C     1 
ATOM   1863  O  O     . ILE C 3  62  ? 153.781 166.956 135.903 1.00 75.23  ? 62  ILE C O     1 
ATOM   1864  C  CB    . ILE C 3  62  ? 155.252 164.543 137.720 1.00 75.23  ? 62  ILE C CB    1 
ATOM   1865  C  CG1   . ILE C 3  62  ? 155.039 165.600 138.780 1.00 75.23  ? 62  ILE C CG1   1 
ATOM   1866  C  CG2   . ILE C 3  62  ? 156.702 164.652 137.302 1.00 75.23  ? 62  ILE C CG2   1 
ATOM   1867  C  CD1   . ILE C 3  62  ? 155.819 165.280 140.013 1.00 75.23  ? 62  ILE C CD1   1 
ATOM   1868  N  N     . LEU C 3  63  ? 155.280 165.821 134.670 1.00 78.14  ? 63  LEU C N     1 
ATOM   1869  C  CA    . LEU C 3  63  ? 155.419 166.926 133.741 1.00 78.14  ? 63  LEU C CA    1 
ATOM   1870  C  C     . LEU C 3  63  ? 154.215 167.055 132.826 1.00 78.14  ? 63  LEU C C     1 
ATOM   1871  O  O     . LEU C 3  63  ? 153.985 168.132 132.278 1.00 78.14  ? 63  LEU C O     1 
ATOM   1872  C  CB    . LEU C 3  63  ? 156.694 166.760 132.926 1.00 78.14  ? 63  LEU C CB    1 
ATOM   1873  C  CG    . LEU C 3  63  ? 157.938 167.053 133.742 1.00 78.14  ? 63  LEU C CG    1 
ATOM   1874  C  CD1   . LEU C 3  63  ? 159.166 166.660 132.984 1.00 78.14  ? 63  LEU C CD1   1 
ATOM   1875  C  CD2   . LEU C 3  63  ? 157.958 168.526 134.020 1.00 78.14  ? 63  LEU C CD2   1 
ATOM   1876  N  N     . GLU C 3  64  ? 153.438 165.989 132.654 1.00 83.61  ? 64  GLU C N     1 
ATOM   1877  C  CA    . GLU C 3  64  ? 152.233 166.104 131.842 1.00 83.61  ? 64  GLU C CA    1 
ATOM   1878  C  C     . GLU C 3  64  ? 151.152 166.866 132.589 1.00 83.61  ? 64  GLU C C     1 
ATOM   1879  O  O     . GLU C 3  64  ? 150.498 167.750 132.022 1.00 83.61  ? 64  GLU C O     1 
ATOM   1880  C  CB    . GLU C 3  64  ? 151.731 164.727 131.428 1.00 83.61  ? 64  GLU C CB    1 
ATOM   1881  C  CG    . GLU C 3  64  ? 150.540 164.798 130.488 1.00 83.61  ? 64  GLU C CG    1 
ATOM   1882  C  CD    . GLU C 3  64  ? 150.214 163.462 129.864 1.00 83.61  ? 64  GLU C CD    1 
ATOM   1883  O  OE1   . GLU C 3  64  ? 150.901 162.475 130.193 1.00 83.61  ? 64  GLU C OE1   1 
ATOM   1884  O  OE2   . GLU C 3  64  ? 149.288 163.401 129.028 1.00 83.61  ? 64  GLU C OE2   1 
ATOM   1885  N  N     . LEU C 3  65  ? 150.955 166.540 133.868 1.00 78.82  ? 65  LEU C N     1 
ATOM   1886  C  CA    . LEU C 3  65  ? 149.963 167.256 134.661 1.00 78.82  ? 65  LEU C CA    1 
ATOM   1887  C  C     . LEU C 3  65  ? 150.397 168.691 134.909 1.00 78.82  ? 65  LEU C C     1 
ATOM   1888  O  O     . LEU C 3  65  ? 149.559 169.596 134.998 1.00 78.82  ? 65  LEU C O     1 
ATOM   1889  C  CB    . LEU C 3  65  ? 149.714 166.526 135.974 1.00 78.82  ? 65  LEU C CB    1 
ATOM   1890  C  CG    . LEU C 3  65  ? 149.021 165.185 135.760 1.00 78.82  ? 65  LEU C CG    1 
ATOM   1891  C  CD1   . LEU C 3  65  ? 148.890 164.441 137.069 1.00 78.82  ? 65  LEU C CD1   1 
ATOM   1892  C  CD2   . LEU C 3  65  ? 147.659 165.390 135.114 1.00 78.82  ? 65  LEU C CD2   1 
ATOM   1893  N  N     . ALA C 3  66  ? 151.708 168.925 134.974 1.00 80.00  ? 66  ALA C N     1 
ATOM   1894  C  CA    . ALA C 3  66  ? 152.180 170.302 134.916 1.00 80.00  ? 66  ALA C CA    1 
ATOM   1895  C  C     . ALA C 3  66  ? 152.023 170.881 133.520 1.00 80.00  ? 66  ALA C C     1 
ATOM   1896  O  O     . ALA C 3  66  ? 152.075 172.100 133.353 1.00 80.00  ? 66  ALA C O     1 
ATOM   1897  C  CB    . ALA C 3  66  ? 153.636 170.382 135.362 1.00 80.00  ? 66  ALA C CB    1 
ATOM   1898  N  N     . GLY C 3  67  ? 151.848 170.032 132.508 1.00 83.04  ? 67  GLY C N     1 
ATOM   1899  C  CA    . GLY C 3  67  ? 151.651 170.531 131.158 1.00 83.04  ? 67  GLY C CA    1 
ATOM   1900  C  C     . GLY C 3  67  ? 150.251 171.069 130.937 1.00 83.04  ? 67  GLY C C     1 
ATOM   1901  O  O     . GLY C 3  67  ? 150.077 172.208 130.493 1.00 83.04  ? 67  GLY C O     1 
ATOM   1902  N  N     . ASN C 3  68  ? 149.236 170.258 131.239 1.00 84.87  ? 68  ASN C N     1 
ATOM   1903  C  CA    . ASN C 3  68  ? 147.857 170.730 131.152 1.00 84.87  ? 68  ASN C CA    1 
ATOM   1904  C  C     . ASN C 3  68  ? 147.587 171.802 132.191 1.00 84.87  ? 68  ASN C C     1 
ATOM   1905  O  O     . ASN C 3  68  ? 147.042 172.866 131.878 1.00 84.87  ? 68  ASN C O     1 
ATOM   1906  C  CB    . ASN C 3  68  ? 146.890 169.566 131.319 1.00 84.87  ? 68  ASN C CB    1 
ATOM   1907  C  CG    . ASN C 3  68  ? 146.809 168.707 130.082 1.00 84.87  ? 68  ASN C CG    1 
ATOM   1908  O  OD1   . ASN C 3  68  ? 146.771 169.217 128.963 1.00 84.87  ? 68  ASN C OD1   1 
ATOM   1909  N  ND2   . ASN C 3  68  ? 146.779 167.394 130.271 1.00 84.87  ? 68  ASN C ND2   1 
ATOM   1910  N  N     . ALA C 3  69  ? 148.023 171.567 133.429 1.00 81.23  ? 69  ALA C N     1 
ATOM   1911  C  CA    . ALA C 3  69  ? 147.843 172.575 134.465 1.00 81.23  ? 69  ALA C CA    1 
ATOM   1912  C  C     . ALA C 3  69  ? 148.816 173.734 134.319 1.00 81.23  ? 69  ALA C C     1 
ATOM   1913  O  O     . ALA C 3  69  ? 148.775 174.662 135.132 1.00 81.23  ? 69  ALA C O     1 
ATOM   1914  C  CB    . ALA C 3  69  ? 147.975 171.942 135.846 1.00 81.23  ? 69  ALA C CB    1 
ATOM   1915  N  N     . ALA C 3  70  ? 149.708 173.687 133.330 1.00 84.86  ? 70  ALA C N     1 
ATOM   1916  C  CA    . ALA C 3  70  ? 150.437 174.880 132.927 1.00 84.86  ? 70  ALA C CA    1 
ATOM   1917  C  C     . ALA C 3  70  ? 149.678 175.629 131.842 1.00 84.86  ? 70  ALA C C     1 
ATOM   1918  O  O     . ALA C 3  70  ? 149.679 176.865 131.808 1.00 84.86  ? 70  ALA C O     1 
ATOM   1919  C  CB    . ALA C 3  70  ? 151.835 174.510 132.447 1.00 84.86  ? 70  ALA C CB    1 
ATOM   1920  N  N     . ARG C 3  71  ? 149.024 174.893 130.945 1.00 87.11  ? 71  ARG C N     1 
ATOM   1921  C  CA    . ARG C 3  71  ? 148.249 175.539 129.897 1.00 87.11  ? 71  ARG C CA    1 
ATOM   1922  C  C     . ARG C 3  71  ? 147.011 176.207 130.467 1.00 87.11  ? 71  ARG C C     1 
ATOM   1923  O  O     . ARG C 3  71  ? 146.504 177.170 129.885 1.00 87.11  ? 71  ARG C O     1 
ATOM   1924  C  CB    . ARG C 3  71  ? 147.875 174.514 128.827 1.00 87.11  ? 71  ARG C CB    1 
ATOM   1925  C  CG    . ARG C 3  71  ? 147.197 175.055 127.588 1.00 87.11  ? 71  ARG C CG    1 
ATOM   1926  C  CD    . ARG C 3  71  ? 146.906 173.920 126.661 1.00 87.11  ? 71  ARG C CD    1 
ATOM   1927  N  NE    . ARG C 3  71  ? 146.034 172.958 127.315 1.00 87.11  ? 71  ARG C NE    1 
ATOM   1928  C  CZ    . ARG C 3  71  ? 145.779 171.749 126.835 1.00 87.11  ? 71  ARG C CZ    1 
ATOM   1929  N  NH1   . ARG C 3  71  ? 146.333 171.368 125.698 1.00 87.11  ? 71  ARG C NH1   1 
ATOM   1930  N  NH2   . ARG C 3  71  ? 144.981 170.920 127.487 1.00 87.11  ? 71  ARG C NH2   1 
ATOM   1931  N  N     . ASP C 3  72  ? 146.522 175.738 131.618 1.00 93.96  ? 72  ASP C N     1 
ATOM   1932  C  CA    . ASP C 3  72  ? 145.386 176.400 132.249 1.00 93.96  ? 72  ASP C CA    1 
ATOM   1933  C  C     . ASP C 3  72  ? 145.733 177.783 132.782 1.00 93.96  ? 72  ASP C C     1 
ATOM   1934  O  O     . ASP C 3  72  ? 144.837 178.625 132.904 1.00 93.96  ? 72  ASP C O     1 
ATOM   1935  C  CB    . ASP C 3  72  ? 144.816 175.539 133.369 1.00 93.96  ? 72  ASP C CB    1 
ATOM   1936  C  CG    . ASP C 3  72  ? 144.108 174.312 132.844 1.00 93.96  ? 72  ASP C CG    1 
ATOM   1937  O  OD1   . ASP C 3  72  ? 143.662 174.345 131.676 1.00 93.96  ? 72  ASP C OD1   1 
ATOM   1938  O  OD2   . ASP C 3  72  ? 143.971 173.329 133.601 1.00 93.96  ? 72  ASP C OD2   1 
ATOM   1939  N  N     . ASN C 3  73  ? 147.001 178.048 133.093 1.00 94.52  ? 73  ASN C N     1 
ATOM   1940  C  CA    . ASN C 3  73  ? 147.452 179.409 133.356 1.00 94.52  ? 73  ASN C CA    1 
ATOM   1941  C  C     . ASN C 3  73  ? 147.898 180.139 132.104 1.00 94.52  ? 73  ASN C C     1 
ATOM   1942  O  O     . ASN C 3  73  ? 148.467 181.232 132.217 1.00 94.52  ? 73  ASN C O     1 
ATOM   1943  C  CB    . ASN C 3  73  ? 148.580 179.423 134.385 1.00 94.52  ? 73  ASN C CB    1 
ATOM   1944  C  CG    . ASN C 3  73  ? 148.067 179.340 135.802 1.00 94.52  ? 73  ASN C CG    1 
ATOM   1945  O  OD1   . ASN C 3  73  ? 147.041 179.933 136.134 1.00 94.52  ? 73  ASN C OD1   1 
ATOM   1946  N  ND2   . ASN C 3  73  ? 148.788 178.631 136.656 1.00 94.52  ? 73  ASN C ND2   1 
ATOM   1947  N  N     . LYS C 3  74  ? 147.686 179.539 130.931 1.00 97.27  ? 74  LYS C N     1 
ATOM   1948  C  CA    . LYS C 3  74  ? 147.873 180.147 129.612 1.00 97.27  ? 74  LYS C CA    1 
ATOM   1949  C  C     . LYS C 3  74  ? 149.322 180.565 129.356 1.00 97.27  ? 74  LYS C C     1 
ATOM   1950  O  O     . LYS C 3  74  ? 149.582 181.434 128.519 1.00 97.27  ? 74  LYS C O     1 
ATOM   1951  C  CB    . LYS C 3  74  ? 146.919 181.332 129.419 1.00 97.27  ? 74  LYS C CB    1 
ATOM   1952  C  CG    . LYS C 3  74  ? 145.446 180.961 129.507 1.00 97.27  ? 74  LYS C CG    1 
ATOM   1953  C  CD    . LYS C 3  74  ? 144.578 182.193 129.299 1.00 97.27  ? 74  LYS C CD    1 
ATOM   1954  C  CE    . LYS C 3  74  ? 143.093 181.896 129.410 1.00 97.27  ? 74  LYS C CE    1 
ATOM   1955  N  NZ    . LYS C 3  74  ? 142.264 183.121 129.191 1.00 97.27  ? 74  LYS C NZ    1 
ATOM   1956  N  N     . LYS C 3  75  ? 150.268 179.947 130.051 1.00 91.87  ? 75  LYS C N     1 
ATOM   1957  C  CA    . LYS C 3  75  ? 151.677 180.264 129.943 1.00 91.87  ? 75  LYS C CA    1 
ATOM   1958  C  C     . LYS C 3  75  ? 152.347 179.335 128.942 1.00 91.87  ? 75  LYS C C     1 
ATOM   1959  O  O     . LYS C 3  75  ? 151.706 178.521 128.277 1.00 91.87  ? 75  LYS C O     1 
ATOM   1960  C  CB    . LYS C 3  75  ? 152.348 180.133 131.305 1.00 91.87  ? 75  LYS C CB    1 
ATOM   1961  C  CG    . LYS C 3  75  ? 151.794 181.025 132.382 1.00 91.87  ? 75  LYS C CG    1 
ATOM   1962  C  CD    . LYS C 3  75  ? 152.150 182.467 132.135 1.00 91.87  ? 75  LYS C CD    1 
ATOM   1963  C  CE    . LYS C 3  75  ? 151.779 183.317 133.323 1.00 91.87  ? 75  LYS C CE    1 
ATOM   1964  N  NZ    . LYS C 3  75  ? 150.307 183.443 133.447 1.00 91.87  ? 75  LYS C NZ    1 
ATOM   1965  N  N     . THR C 3  76  ? 153.665 179.462 128.834 1.00 94.32  ? 76  THR C N     1 
ATOM   1966  C  CA    . THR C 3  76  ? 154.486 178.437 128.213 1.00 94.32  ? 76  THR C CA    1 
ATOM   1967  C  C     . THR C 3  76  ? 155.559 177.878 129.129 1.00 94.32  ? 76  THR C C     1 
ATOM   1968  O  O     . THR C 3  76  ? 156.029 176.764 128.882 1.00 94.32  ? 76  THR C O     1 
ATOM   1969  C  CB    . THR C 3  76  ? 155.170 178.967 126.948 1.00 94.32  ? 76  THR C CB    1 
ATOM   1970  O  OG1   . THR C 3  76  ? 156.005 180.076 127.288 1.00 94.32  ? 76  THR C OG1   1 
ATOM   1971  C  CG2   . THR C 3  76  ? 154.142 179.399 125.917 1.00 94.32  ? 76  THR C CG2   1 
ATOM   1972  N  N     . ARG C 3  77  ? 155.960 178.592 130.165 1.00 94.18  ? 77  ARG C N     1 
ATOM   1973  C  CA    . ARG C 3  77  ? 156.983 178.115 131.081 1.00 94.18  ? 77  ARG C CA    1 
ATOM   1974  C  C     . ARG C 3  77  ? 156.324 177.609 132.357 1.00 94.18  ? 77  ARG C C     1 
ATOM   1975  O  O     . ARG C 3  77  ? 155.551 178.334 132.991 1.00 94.18  ? 77  ARG C O     1 
ATOM   1976  C  CB    . ARG C 3  77  ? 157.999 179.216 131.375 1.00 94.18  ? 77  ARG C CB    1 
ATOM   1977  C  CG    . ARG C 3  77  ? 158.957 179.452 130.218 1.00 94.18  ? 77  ARG C CG    1 
ATOM   1978  C  CD    . ARG C 3  77  ? 159.966 180.567 130.477 1.00 94.18  ? 77  ARG C CD    1 
ATOM   1979  N  NE    . ARG C 3  77  ? 159.370 181.897 130.397 1.00 94.18  ? 77  ARG C NE    1 
ATOM   1980  C  CZ    . ARG C 3  77  ? 160.024 183.025 130.672 1.00 94.18  ? 77  ARG C CZ    1 
ATOM   1981  N  NH1   . ARG C 3  77  ? 161.290 182.984 131.047 1.00 94.18  ? 77  ARG C NH1   1 
ATOM   1982  N  NH2   . ARG C 3  77  ? 159.414 184.197 130.568 1.00 94.18  ? 77  ARG C NH2   1 
ATOM   1983  N  N     . ILE C 3  78  ? 156.619 176.361 132.711 1.00 82.50  ? 78  ILE C N     1 
ATOM   1984  C  CA    . ILE C 3  78  ? 156.160 175.800 133.972 1.00 82.50  ? 78  ILE C CA    1 
ATOM   1985  C  C     . ILE C 3  78  ? 156.965 176.406 135.110 1.00 82.50  ? 78  ILE C C     1 
ATOM   1986  O  O     . ILE C 3  78  ? 158.199 176.353 135.107 1.00 82.50  ? 78  ILE C O     1 
ATOM   1987  C  CB    . ILE C 3  78  ? 156.307 174.276 133.953 1.00 82.50  ? 78  ILE C CB    1 
ATOM   1988  C  CG1   . ILE C 3  78  ? 155.425 173.671 132.873 1.00 82.50  ? 78  ILE C CG1   1 
ATOM   1989  C  CG2   . ILE C 3  78  ? 156.001 173.685 135.292 1.00 82.50  ? 78  ILE C CG2   1 
ATOM   1990  C  CD1   . ILE C 3  78  ? 155.722 172.216 132.614 1.00 82.50  ? 78  ILE C CD1   1 
ATOM   1991  N  N     . ILE C 3  79  ? 156.275 176.987 136.085 1.00 80.42  ? 79  ILE C N     1 
ATOM   1992  C  CA    . ILE C 3  79  ? 156.930 177.507 137.281 1.00 80.42  ? 79  ILE C CA    1 
ATOM   1993  C  C     . ILE C 3  79  ? 156.608 176.516 138.396 1.00 80.42  ? 79  ILE C C     1 
ATOM   1994  O  O     . ILE C 3  79  ? 155.738 175.658 138.193 1.00 80.42  ? 79  ILE C O     1 
ATOM   1995  C  CB    . ILE C 3  79  ? 156.471 178.940 137.600 1.00 80.42  ? 79  ILE C CB    1 
ATOM   1996  C  CG1   . ILE C 3  79  ? 155.117 178.941 138.294 1.00 80.42  ? 79  ILE C CG1   1 
ATOM   1997  C  CG2   . ILE C 3  79  ? 156.412 179.756 136.332 1.00 80.42  ? 79  ILE C CG2   1 
ATOM   1998  C  CD1   . ILE C 3  79  ? 154.774 180.275 138.898 1.00 80.42  ? 79  ILE C CD1   1 
ATOM   1999  N  N     . PRO C 3  80  ? 157.279 176.562 139.559 1.00 77.53  ? 80  PRO C N     1 
ATOM   2000  C  CA    . PRO C 3  80  ? 156.938 175.626 140.646 1.00 77.53  ? 80  PRO C CA    1 
ATOM   2001  C  C     . PRO C 3  80  ? 155.508 175.678 141.171 1.00 77.53  ? 80  PRO C C     1 
ATOM   2002  O  O     . PRO C 3  80  ? 155.129 174.736 141.875 1.00 77.53  ? 80  PRO C O     1 
ATOM   2003  C  CB    . PRO C 3  80  ? 157.919 176.019 141.752 1.00 77.53  ? 80  PRO C CB    1 
ATOM   2004  C  CG    . PRO C 3  80  ? 159.064 176.500 141.047 1.00 77.53  ? 80  PRO C CG    1 
ATOM   2005  C  CD    . PRO C 3  80  ? 158.576 177.207 139.842 1.00 77.53  ? 80  PRO C CD    1 
ATOM   2006  N  N     . ARG C 3  81  ? 154.722 176.730 140.895 1.00 76.90  ? 81  ARG C N     1 
ATOM   2007  C  CA    . ARG C 3  81  ? 153.297 176.693 141.223 1.00 76.90  ? 81  ARG C CA    1 
ATOM   2008  C  C     . ARG C 3  81  ? 152.603 175.577 140.471 1.00 76.90  ? 81  ARG C C     1 
ATOM   2009  O  O     . ARG C 3  81  ? 151.745 174.870 141.020 1.00 76.90  ? 81  ARG C O     1 
ATOM   2010  C  CB    . ARG C 3  81  ? 152.637 178.025 140.881 1.00 76.90  ? 81  ARG C CB    1 
ATOM   2011  C  CG    . ARG C 3  81  ? 151.144 178.082 141.143 1.00 76.90  ? 81  ARG C CG    1 
ATOM   2012  C  CD    . ARG C 3  81  ? 150.894 177.980 142.620 1.00 76.90  ? 81  ARG C CD    1 
ATOM   2013  N  NE    . ARG C 3  81  ? 149.495 178.136 142.991 1.00 76.90  ? 81  ARG C NE    1 
ATOM   2014  C  CZ    . ARG C 3  81  ? 149.047 177.981 144.229 1.00 76.90  ? 81  ARG C CZ    1 
ATOM   2015  N  NH1   . ARG C 3  81  ? 149.889 177.678 145.203 1.00 76.90  ? 81  ARG C NH1   1 
ATOM   2016  N  NH2   . ARG C 3  81  ? 147.761 178.134 144.501 1.00 76.90  ? 81  ARG C NH2   1 
ATOM   2017  N  N     . HIS C 3  82  ? 152.987 175.391 139.215 1.00 82.08  ? 82  HIS C N     1 
ATOM   2018  C  CA    . HIS C 3  82  ? 152.387 174.351 138.412 1.00 82.08  ? 82  HIS C CA    1 
ATOM   2019  C  C     . HIS C 3  82  ? 152.807 172.975 138.899 1.00 82.08  ? 82  HIS C C     1 
ATOM   2020  O  O     . HIS C 3  82  ? 152.031 172.023 138.781 1.00 82.08  ? 82  HIS C O     1 
ATOM   2021  C  CB    . HIS C 3  82  ? 152.757 174.555 136.952 1.00 82.08  ? 82  HIS C CB    1 
ATOM   2022  C  CG    . HIS C 3  82  ? 152.391 175.909 136.426 1.00 82.08  ? 82  HIS C CG    1 
ATOM   2023  N  ND1   . HIS C 3  82  ? 153.291 176.947 136.377 1.00 82.08  ? 82  HIS C ND1   1 
ATOM   2024  C  CD2   . HIS C 3  82  ? 151.222 176.402 135.962 1.00 82.08  ? 82  HIS C CD2   1 
ATOM   2025  C  CE1   . HIS C 3  82  ? 152.701 178.018 135.878 1.00 82.08  ? 82  HIS C CE1   1 
ATOM   2026  N  NE2   . HIS C 3  82  ? 151.444 177.712 135.616 1.00 82.08  ? 82  HIS C NE2   1 
ATOM   2027  N  N     . LEU C 3  83  ? 154.001 172.851 139.485 1.00 77.16  ? 83  LEU C N     1 
ATOM   2028  C  CA    . LEU C 3  83  ? 154.366 171.583 140.109 1.00 77.16  ? 83  LEU C CA    1 
ATOM   2029  C  C     . LEU C 3  83  ? 153.649 171.385 141.432 1.00 77.16  ? 83  LEU C C     1 
ATOM   2030  O  O     . LEU C 3  83  ? 153.357 170.244 141.804 1.00 77.16  ? 83  LEU C O     1 
ATOM   2031  C  CB    . LEU C 3  83  ? 155.873 171.480 140.318 1.00 77.16  ? 83  LEU C CB    1 
ATOM   2032  C  CG    . LEU C 3  83  ? 156.673 171.295 139.034 1.00 77.16  ? 83  LEU C CG    1 
ATOM   2033  C  CD1   . LEU C 3  83  ? 158.141 171.085 139.342 1.00 77.16  ? 83  LEU C CD1   1 
ATOM   2034  C  CD2   . LEU C 3  83  ? 156.130 170.153 138.215 1.00 77.16  ? 83  LEU C CD2   1 
ATOM   2035  N  N     . GLN C 3  84  ? 153.346 172.479 142.133 1.00 76.61  ? 84  GLN C N     1 
ATOM   2036  C  CA    . GLN C 3  84  ? 152.581 172.402 143.371 1.00 76.61  ? 84  GLN C CA    1 
ATOM   2037  C  C     . GLN C 3  84  ? 151.195 171.825 143.125 1.00 76.61  ? 84  GLN C C     1 
ATOM   2038  O  O     . GLN C 3  84  ? 150.857 170.757 143.649 1.00 76.61  ? 84  GLN C O     1 
ATOM   2039  C  CB    . GLN C 3  84  ? 152.472 173.785 144.011 1.00 76.61  ? 84  GLN C CB    1 
ATOM   2040  C  CG    . GLN C 3  84  ? 151.673 173.802 145.279 1.00 76.61  ? 84  GLN C CG    1 
ATOM   2041  C  CD    . GLN C 3  84  ? 152.364 173.078 146.391 1.00 76.61  ? 84  GLN C CD    1 
ATOM   2042  O  OE1   . GLN C 3  84  ? 153.566 173.218 146.575 1.00 76.61  ? 84  GLN C OE1   1 
ATOM   2043  N  NE2   . GLN C 3  84  ? 151.609 172.299 147.147 1.00 76.61  ? 84  GLN C NE2   1 
ATOM   2044  N  N     . LEU C 3  85  ? 150.385 172.489 142.295 1.00 75.29  ? 85  LEU C N     1 
ATOM   2045  C  CA    . LEU C 3  85  ? 149.045 171.933 142.145 1.00 75.29  ? 85  LEU C CA    1 
ATOM   2046  C  C     . LEU C 3  85  ? 149.024 170.750 141.196 1.00 75.29  ? 85  LEU C C     1 
ATOM   2047  O  O     . LEU C 3  85  ? 148.083 169.946 141.252 1.00 75.29  ? 85  LEU C O     1 
ATOM   2048  C  CB    . LEU C 3  85  ? 148.036 172.976 141.679 1.00 75.29  ? 85  LEU C CB    1 
ATOM   2049  C  CG    . LEU C 3  85  ? 147.813 173.186 140.190 1.00 75.29  ? 85  LEU C CG    1 
ATOM   2050  C  CD1   . LEU C 3  85  ? 146.506 173.922 139.984 1.00 75.29  ? 85  LEU C CD1   1 
ATOM   2051  C  CD2   . LEU C 3  85  ? 148.943 173.943 139.585 1.00 75.29  ? 85  LEU C CD2   1 
ATOM   2052  N  N     . ALA C 3  86  ? 150.047 170.614 140.353 1.00 74.33  ? 86  ALA C N     1 
ATOM   2053  C  CA    . ALA C 3  86  ? 150.142 169.444 139.497 1.00 74.33  ? 86  ALA C CA    1 
ATOM   2054  C  C     . ALA C 3  86  ? 150.364 168.187 140.315 1.00 74.33  ? 86  ALA C C     1 
ATOM   2055  O  O     . ALA C 3  86  ? 149.819 167.128 139.990 1.00 74.33  ? 86  ALA C O     1 
ATOM   2056  C  CB    . ALA C 3  86  ? 151.267 169.613 138.484 1.00 74.33  ? 86  ALA C CB    1 
ATOM   2057  N  N     . VAL C 3  87  ? 151.149 168.281 141.387 1.00 74.61  ? 87  VAL C N     1 
ATOM   2058  C  CA    . VAL C 3  87  ? 151.245 167.144 142.294 1.00 74.61  ? 87  VAL C CA    1 
ATOM   2059  C  C     . VAL C 3  87  ? 149.978 167.015 143.124 1.00 74.61  ? 87  VAL C C     1 
ATOM   2060  O  O     . VAL C 3  87  ? 149.351 165.952 143.159 1.00 74.61  ? 87  VAL C O     1 
ATOM   2061  C  CB    . VAL C 3  87  ? 152.483 167.260 143.192 1.00 74.61  ? 87  VAL C CB    1 
ATOM   2062  C  CG1   . VAL C 3  87  ? 152.431 166.192 144.240 1.00 74.61  ? 87  VAL C CG1   1 
ATOM   2063  C  CG2   . VAL C 3  87  ? 153.713 167.063 142.385 1.00 74.61  ? 87  VAL C CG2   1 
ATOM   2064  N  N     . ARG C 3  88  ? 149.565 168.104 143.781 1.00 69.91  ? 88  ARG C N     1 
ATOM   2065  C  CA    . ARG C 3  88  ? 148.526 167.988 144.798 1.00 69.91  ? 88  ARG C CA    1 
ATOM   2066  C  C     . ARG C 3  88  ? 147.134 167.738 144.235 1.00 69.91  ? 88  ARG C C     1 
ATOM   2067  O  O     . ARG C 3  88  ? 146.211 167.513 145.022 1.00 69.91  ? 88  ARG C O     1 
ATOM   2068  C  CB    . ARG C 3  88  ? 148.483 169.237 145.671 1.00 69.91  ? 88  ARG C CB    1 
ATOM   2069  C  CG    . ARG C 3  88  ? 149.757 169.514 146.439 1.00 69.91  ? 88  ARG C CG    1 
ATOM   2070  C  CD    . ARG C 3  88  ? 150.082 168.438 147.445 1.00 69.91  ? 88  ARG C CD    1 
ATOM   2071  N  NE    . ARG C 3  88  ? 151.162 168.866 148.327 1.00 69.91  ? 88  ARG C NE    1 
ATOM   2072  C  CZ    . ARG C 3  88  ? 152.450 168.703 148.069 1.00 69.91  ? 88  ARG C CZ    1 
ATOM   2073  N  NH1   . ARG C 3  88  ? 152.826 168.124 146.950 1.00 69.91  ? 88  ARG C NH1   1 
ATOM   2074  N  NH2   . ARG C 3  88  ? 153.359 169.125 148.930 1.00 69.91  ? 88  ARG C NH2   1 
ATOM   2075  N  N     . ASN C 3  89  ? 146.947 167.756 142.915 1.00 79.05  ? 89  ASN C N     1 
ATOM   2076  C  CA    . ASN C 3  89  ? 145.622 167.445 142.386 1.00 79.05  ? 89  ASN C CA    1 
ATOM   2077  C  C     . ASN C 3  89  ? 145.384 165.946 142.239 1.00 79.05  ? 89  ASN C C     1 
ATOM   2078  O  O     . ASN C 3  89  ? 144.299 165.463 142.574 1.00 79.05  ? 89  ASN C O     1 
ATOM   2079  C  CB    . ASN C 3  89  ? 145.402 168.157 141.057 1.00 79.05  ? 89  ASN C CB    1 
ATOM   2080  C  CG    . ASN C 3  89  ? 144.999 169.593 141.247 1.00 79.05  ? 89  ASN C CG    1 
ATOM   2081  O  OD1   . ASN C 3  89  ? 144.150 169.892 142.078 1.00 79.05  ? 89  ASN C OD1   1 
ATOM   2082  N  ND2   . ASN C 3  89  ? 145.616 170.494 140.494 1.00 79.05  ? 89  ASN C ND2   1 
ATOM   2083  N  N     . ASP C 3  90  ? 146.352 165.196 141.727 1.00 79.03  ? 90  ASP C N     1 
ATOM   2084  C  CA    . ASP C 3  90  ? 146.177 163.754 141.678 1.00 79.03  ? 90  ASP C CA    1 
ATOM   2085  C  C     . ASP C 3  90  ? 146.360 163.167 143.069 1.00 79.03  ? 90  ASP C C     1 
ATOM   2086  O  O     . ASP C 3  90  ? 147.103 163.697 143.894 1.00 79.03  ? 90  ASP C O     1 
ATOM   2087  C  CB    . ASP C 3  90  ? 147.168 163.114 140.711 1.00 79.03  ? 90  ASP C CB    1 
ATOM   2088  C  CG    . ASP C 3  90  ? 146.960 161.619 140.570 1.00 79.03  ? 90  ASP C CG    1 
ATOM   2089  O  OD1   . ASP C 3  90  ? 146.001 161.214 139.885 1.00 79.03  ? 90  ASP C OD1   1 
ATOM   2090  O  OD2   . ASP C 3  90  ? 147.732 160.853 141.186 1.00 79.03  ? 90  ASP C OD2   1 
ATOM   2091  N  N     . GLU C 3  91  ? 145.653 162.067 143.331 1.00 79.21  ? 91  GLU C N     1 
ATOM   2092  C  CA    . GLU C 3  91  ? 145.769 161.414 144.629 1.00 79.21  ? 91  GLU C CA    1 
ATOM   2093  C  C     . GLU C 3  91  ? 147.113 160.718 144.779 1.00 79.21  ? 91  GLU C C     1 
ATOM   2094  O  O     . GLU C 3  91  ? 147.769 160.842 145.817 1.00 79.21  ? 91  GLU C O     1 
ATOM   2095  C  CB    . GLU C 3  91  ? 144.621 160.424 144.815 1.00 79.21  ? 91  GLU C CB    1 
ATOM   2096  C  CG    . GLU C 3  91  ? 144.464 159.876 146.232 1.00 79.21  ? 91  GLU C CG    1 
ATOM   2097  C  CD    . GLU C 3  91  ? 145.289 158.630 146.482 1.00 79.21  ? 91  GLU C CD    1 
ATOM   2098  O  OE1   . GLU C 3  91  ? 145.564 157.902 145.510 1.00 79.21  ? 91  GLU C OE1   1 
ATOM   2099  O  OE2   . GLU C 3  91  ? 145.661 158.378 147.646 1.00 79.21  ? 91  GLU C OE2   1 
ATOM   2100  N  N     . GLU C 3  92  ? 147.537 159.982 143.753 1.00 77.39  ? 92  GLU C N     1 
ATOM   2101  C  CA    . GLU C 3  92  ? 148.655 159.062 143.923 1.00 77.39  ? 92  GLU C CA    1 
ATOM   2102  C  C     . GLU C 3  92  ? 149.985 159.798 143.995 1.00 77.39  ? 92  GLU C C     1 
ATOM   2103  O  O     . GLU C 3  92  ? 150.864 159.429 144.784 1.00 77.39  ? 92  GLU C O     1 
ATOM   2104  C  CB    . GLU C 3  92  ? 148.645 158.045 142.793 1.00 77.39  ? 92  GLU C CB    1 
ATOM   2105  C  CG    . GLU C 3  92  ? 147.439 157.156 142.879 1.00 77.39  ? 92  GLU C CG    1 
ATOM   2106  C  CD    . GLU C 3  92  ? 147.352 156.159 141.760 1.00 77.39  ? 92  GLU C CD    1 
ATOM   2107  O  OE1   . GLU C 3  92  ? 148.168 156.229 140.817 1.00 77.39  ? 92  GLU C OE1   1 
ATOM   2108  O  OE2   . GLU C 3  92  ? 146.454 155.299 141.831 1.00 77.39  ? 92  GLU C OE2   1 
ATOM   2109  N  N     . LEU C 3  93  ? 150.137 160.845 143.191 1.00 74.15  ? 93  LEU C N     1 
ATOM   2110  C  CA    . LEU C 3  93  ? 151.332 161.670 143.267 1.00 74.15  ? 93  LEU C CA    1 
ATOM   2111  C  C     . LEU C 3  93  ? 151.394 162.428 144.581 1.00 74.15  ? 93  LEU C C     1 
ATOM   2112  O  O     . LEU C 3  93  ? 152.487 162.683 145.096 1.00 74.15  ? 93  LEU C O     1 
ATOM   2113  C  CB    . LEU C 3  93  ? 151.358 162.637 142.094 1.00 74.15  ? 93  LEU C CB    1 
ATOM   2114  C  CG    . LEU C 3  93  ? 151.362 161.904 140.761 1.00 74.15  ? 93  LEU C CG    1 
ATOM   2115  C  CD1   . LEU C 3  93  ? 151.169 162.874 139.628 1.00 74.15  ? 93  LEU C CD1   1 
ATOM   2116  C  CD2   . LEU C 3  93  ? 152.659 161.161 140.602 1.00 74.15  ? 93  LEU C CD2   1 
ATOM   2117  N  N     . ASN C 3  94  ? 150.236 162.784 145.136 1.00 73.37  ? 94  ASN C N     1 
ATOM   2118  C  CA    . ASN C 3  94  ? 150.208 163.421 146.445 1.00 73.37  ? 94  ASN C CA    1 
ATOM   2119  C  C     . ASN C 3  94  ? 150.608 162.437 147.532 1.00 73.37  ? 94  ASN C C     1 
ATOM   2120  O  O     . ASN C 3  94  ? 151.351 162.791 148.449 1.00 73.37  ? 94  ASN C O     1 
ATOM   2121  C  CB    . ASN C 3  94  ? 148.822 163.985 146.725 1.00 73.37  ? 94  ASN C CB    1 
ATOM   2122  C  CG    . ASN C 3  94  ? 148.808 164.954 147.888 1.00 73.37  ? 94  ASN C CG    1 
ATOM   2123  O  OD1   . ASN C 3  94  ? 149.840 165.250 148.488 1.00 73.37  ? 94  ASN C OD1   1 
ATOM   2124  N  ND2   . ASN C 3  94  ? 147.628 165.462 148.210 1.00 73.37  ? 94  ASN C ND2   1 
ATOM   2125  N  N     . LYS C 3  95  ? 150.137 161.195 147.438 1.00 74.14  ? 95  LYS C N     1 
ATOM   2126  C  CA    . LYS C 3  95  ? 150.481 160.195 148.440 1.00 74.14  ? 95  LYS C CA    1 
ATOM   2127  C  C     . LYS C 3  95  ? 151.936 159.765 148.322 1.00 74.14  ? 95  LYS C C     1 
ATOM   2128  O  O     . LYS C 3  95  ? 152.535 159.344 149.316 1.00 74.14  ? 95  LYS C O     1 
ATOM   2129  C  CB    . LYS C 3  95  ? 149.548 158.992 148.309 1.00 74.14  ? 95  LYS C CB    1 
ATOM   2130  C  CG    . LYS C 3  95  ? 149.592 158.053 149.485 1.00 74.14  ? 95  LYS C CG    1 
ATOM   2131  C  CD    . LYS C 3  95  ? 149.072 158.777 150.715 1.00 74.14  ? 95  LYS C CD    1 
ATOM   2132  C  CE    . LYS C 3  95  ? 148.982 157.854 151.914 1.00 74.14  ? 95  LYS C CE    1 
ATOM   2133  N  NZ    . LYS C 3  95  ? 148.529 158.561 153.146 1.00 74.14  ? 95  LYS C NZ    1 
ATOM   2134  N  N     . LEU C 3  96  ? 152.539 159.905 147.148 1.00 70.63  ? 96  LEU C N     1 
ATOM   2135  C  CA    . LEU C 3  96  ? 153.971 159.680 147.072 1.00 70.63  ? 96  LEU C CA    1 
ATOM   2136  C  C     . LEU C 3  96  ? 154.739 160.838 147.686 1.00 70.63  ? 96  LEU C C     1 
ATOM   2137  O  O     . LEU C 3  96  ? 155.851 160.641 148.180 1.00 70.63  ? 96  LEU C O     1 
ATOM   2138  C  CB    . LEU C 3  96  ? 154.378 159.446 145.618 1.00 70.63  ? 96  LEU C CB    1 
ATOM   2139  C  CG    . LEU C 3  96  ? 155.765 158.907 145.238 1.00 70.63  ? 96  LEU C CG    1 
ATOM   2140  C  CD1   . LEU C 3  96  ? 156.827 159.966 145.054 1.00 70.63  ? 96  LEU C CD1   1 
ATOM   2141  C  CD2   . LEU C 3  96  ? 156.214 157.922 146.288 1.00 70.63  ? 96  LEU C CD2   1 
ATOM   2142  N  N     . LEU C 3  97  ? 154.162 162.035 147.693 1.00 66.98  ? 97  LEU C N     1 
ATOM   2143  C  CA    . LEU C 3  97  ? 154.885 163.242 148.075 1.00 66.98  ? 97  LEU C CA    1 
ATOM   2144  C  C     . LEU C 3  97  ? 154.223 163.982 149.228 1.00 66.98  ? 97  LEU C C     1 
ATOM   2145  O  O     . LEU C 3  97  ? 154.352 165.201 149.340 1.00 66.98  ? 97  LEU C O     1 
ATOM   2146  C  CB    . LEU C 3  97  ? 155.021 164.176 146.879 1.00 66.98  ? 97  LEU C CB    1 
ATOM   2147  C  CG    . LEU C 3  97  ? 155.840 163.607 145.741 1.00 66.98  ? 97  LEU C CG    1 
ATOM   2148  C  CD1   . LEU C 3  97  ? 155.787 164.567 144.607 1.00 66.98  ? 97  LEU C CD1   1 
ATOM   2149  C  CD2   . LEU C 3  97  ? 157.241 163.449 146.226 1.00 66.98  ? 97  LEU C CD2   1 
ATOM   2150  N  N     . GLY C 3  98  ? 153.527 163.263 150.100 1.00 68.56  ? 98  GLY C N     1 
ATOM   2151  C  CA    . GLY C 3  98  ? 152.752 163.904 151.142 1.00 68.56  ? 98  GLY C CA    1 
ATOM   2152  C  C     . GLY C 3  98  ? 153.539 164.487 152.282 1.00 68.56  ? 98  GLY C C     1 
ATOM   2153  O  O     . GLY C 3  98  ? 152.972 165.221 153.093 1.00 68.56  ? 98  GLY C O     1 
ATOM   2154  N  N     . ARG C 3  99  ? 154.824 164.173 152.375 1.00 72.21  ? 99  ARG C N     1 
ATOM   2155  C  CA    . ARG C 3  99  ? 155.692 164.719 153.405 1.00 72.21  ? 99  ARG C CA    1 
ATOM   2156  C  C     . ARG C 3  99  ? 156.696 165.703 152.835 1.00 72.21  ? 99  ARG C C     1 
ATOM   2157  O  O     . ARG C 3  99  ? 157.654 166.059 153.521 1.00 72.21  ? 99  ARG C O     1 
ATOM   2158  C  CB    . ARG C 3  99  ? 156.433 163.588 154.122 1.00 72.21  ? 99  ARG C CB    1 
ATOM   2159  C  CG    . ARG C 3  99  ? 155.550 162.633 154.900 1.00 72.21  ? 99  ARG C CG    1 
ATOM   2160  C  CD    . ARG C 3  99  ? 155.100 163.214 156.233 1.00 72.21  ? 99  ARG C CD    1 
ATOM   2161  N  NE    . ARG C 3  99  ? 154.224 162.287 156.950 1.00 72.21  ? 99  ARG C NE    1 
ATOM   2162  C  CZ    . ARG C 3  99  ? 152.893 162.339 156.928 1.00 72.21  ? 99  ARG C CZ    1 
ATOM   2163  N  NH1   . ARG C 3  99  ? 152.273 163.293 156.251 1.00 72.21  ? 99  ARG C NH1   1 
ATOM   2164  N  NH2   . ARG C 3  99  ? 152.175 161.450 157.600 1.00 72.21  ? 99  ARG C NH2   1 
ATOM   2165  N  N     . VAL C 3  100 ? 156.511 166.139 151.596 1.00 67.89  ? 100 VAL C N     1 
ATOM   2166  C  CA    . VAL C 3  100 ? 157.505 166.933 150.890 1.00 67.89  ? 100 VAL C CA    1 
ATOM   2167  C  C     . VAL C 3  100 ? 156.955 168.326 150.661 1.00 67.89  ? 100 VAL C C     1 
ATOM   2168  O  O     . VAL C 3  100 ? 155.925 168.495 150.001 1.00 67.89  ? 100 VAL C O     1 
ATOM   2169  C  CB    . VAL C 3  100 ? 157.905 166.293 149.560 1.00 67.89  ? 100 VAL C CB    1 
ATOM   2170  C  CG1   . VAL C 3  100 ? 158.695 167.273 148.755 1.00 67.89  ? 100 VAL C CG1   1 
ATOM   2171  C  CG2   . VAL C 3  100 ? 158.737 165.048 149.808 1.00 67.89  ? 100 VAL C CG2   1 
ATOM   2172  N  N     . THR C 3  101 ? 157.646 169.320 151.192 1.00 66.43  ? 101 THR C N     1 
ATOM   2173  C  CA    . THR C 3  101 ? 157.334 170.698 150.875 1.00 66.43  ? 101 THR C CA    1 
ATOM   2174  C  C     . THR C 3  101 ? 157.990 171.044 149.547 1.00 66.43  ? 101 THR C C     1 
ATOM   2175  O  O     . THR C 3  101 ? 159.086 170.572 149.245 1.00 66.43  ? 101 THR C O     1 
ATOM   2176  C  CB    . THR C 3  101 ? 157.827 171.622 151.991 1.00 66.43  ? 101 THR C CB    1 
ATOM   2177  O  OG1   . THR C 3  101 ? 157.273 171.193 153.240 1.00 66.43  ? 101 THR C OG1   1 
ATOM   2178  C  CG2   . THR C 3  101 ? 157.401 173.062 151.755 1.00 66.43  ? 101 THR C CG2   1 
ATOM   2179  N  N     . ILE C 3  102 ? 157.291 171.831 148.738 1.00 62.18  ? 102 ILE C N     1 
ATOM   2180  C  CA    . ILE C 3  102 ? 157.830 172.402 147.517 1.00 62.18  ? 102 ILE C CA    1 
ATOM   2181  C  C     . ILE C 3  102 ? 158.034 173.888 147.753 1.00 62.18  ? 102 ILE C C     1 
ATOM   2182  O  O     . ILE C 3  102 ? 157.100 174.584 148.159 1.00 62.18  ? 102 ILE C O     1 
ATOM   2183  C  CB    . ILE C 3  102 ? 156.879 172.177 146.340 1.00 62.18  ? 102 ILE C CB    1 
ATOM   2184  C  CG1   . ILE C 3  102 ? 156.522 170.709 146.236 1.00 62.18  ? 102 ILE C CG1   1 
ATOM   2185  C  CG2   . ILE C 3  102 ? 157.516 172.644 145.091 1.00 62.18  ? 102 ILE C CG2   1 
ATOM   2186  C  CD1   . ILE C 3  102 ? 157.700 169.836 146.011 1.00 62.18  ? 102 ILE C CD1   1 
ATOM   2187  N  N     . ALA C 3  103 ? 159.244 174.373 147.512 1.00 66.38  ? 103 ALA C N     1 
ATOM   2188  C  CA    . ALA C 3  103 ? 159.514 175.793 147.677 1.00 66.38  ? 103 ALA C CA    1 
ATOM   2189  C  C     . ALA C 3  103 ? 158.838 176.579 146.568 1.00 66.38  ? 103 ALA C C     1 
ATOM   2190  O  O     . ALA C 3  103 ? 158.765 176.112 145.431 1.00 66.38  ? 103 ALA C O     1 
ATOM   2191  C  CB    . ALA C 3  103 ? 161.016 176.054 147.660 1.00 66.38  ? 103 ALA C CB    1 
ATOM   2192  N  N     . GLN C 3  104 ? 158.349 177.774 146.914 1.00 67.95  ? 104 GLN C N     1 
ATOM   2193  C  CA    . GLN C 3  104 ? 157.526 178.619 146.040 1.00 67.95  ? 104 GLN C CA    1 
ATOM   2194  C  C     . GLN C 3  104 ? 156.318 177.865 145.483 1.00 67.95  ? 104 GLN C C     1 
ATOM   2195  O  O     . GLN C 3  104 ? 155.945 178.015 144.319 1.00 67.95  ? 104 GLN C O     1 
ATOM   2196  C  CB    . GLN C 3  104 ? 158.342 179.230 144.896 1.00 67.95  ? 104 GLN C CB    1 
ATOM   2197  C  CG    . GLN C 3  104 ? 159.286 180.351 145.279 1.00 67.95  ? 104 GLN C CG    1 
ATOM   2198  C  CD    . GLN C 3  104 ? 160.622 179.856 145.777 1.00 67.95  ? 104 GLN C CD    1 
ATOM   2199  O  OE1   . GLN C 3  104 ? 160.962 178.693 145.605 1.00 67.95  ? 104 GLN C OE1   1 
ATOM   2200  N  NE2   . GLN C 3  104 ? 161.397 180.742 146.383 1.00 67.95  ? 104 GLN C NE2   1 
ATOM   2201  N  N     . GLY C 3  105 ? 155.708 177.032 146.317 1.00 70.66  ? 105 GLY C N     1 
ATOM   2202  C  CA    . GLY C 3  105 ? 154.546 176.294 145.874 1.00 70.66  ? 105 GLY C CA    1 
ATOM   2203  C  C     . GLY C 3  105 ? 153.224 176.909 146.277 1.00 70.66  ? 105 GLY C C     1 
ATOM   2204  O  O     . GLY C 3  105 ? 152.338 177.093 145.439 1.00 70.66  ? 105 GLY C O     1 
ATOM   2205  N  N     . GLY C 3  106 ? 153.077 177.245 147.553 1.00 73.18  ? 106 GLY C N     1 
ATOM   2206  C  CA    . GLY C 3  106 ? 151.789 177.694 148.043 1.00 73.18  ? 106 GLY C CA    1 
ATOM   2207  C  C     . GLY C 3  106 ? 150.865 176.524 148.338 1.00 73.18  ? 106 GLY C C     1 
ATOM   2208  O  O     . GLY C 3  106 ? 151.296 175.431 148.703 1.00 73.18  ? 106 GLY C O     1 
ATOM   2209  N  N     . VAL C 3  107 ? 149.563 176.768 148.180 1.00 71.68  ? 107 VAL C N     1 
ATOM   2210  C  CA    . VAL C 3  107 ? 148.535 175.784 148.484 1.00 71.68  ? 107 VAL C CA    1 
ATOM   2211  C  C     . VAL C 3  107 ? 147.536 175.703 147.336 1.00 71.68  ? 107 VAL C C     1 
ATOM   2212  O  O     . VAL C 3  107 ? 147.432 176.600 146.500 1.00 71.68  ? 107 VAL C O     1 
ATOM   2213  C  CB    . VAL C 3  107 ? 147.784 176.107 149.790 1.00 71.68  ? 107 VAL C CB    1 
ATOM   2214  C  CG1   . VAL C 3  107 ? 148.699 176.014 150.985 1.00 71.68  ? 107 VAL C CG1   1 
ATOM   2215  C  CG2   . VAL C 3  107 ? 147.211 177.488 149.704 1.00 71.68  ? 107 VAL C CG2   1 
ATOM   2216  N  N     . LEU C 3  108 ? 146.797 174.600 147.315 1.00 76.43  ? 108 LEU C N     1 
ATOM   2217  C  CA    . LEU C 3  108 ? 145.581 174.531 146.528 1.00 76.43  ? 108 LEU C CA    1 
ATOM   2218  C  C     . LEU C 3  108 ? 144.524 175.419 147.181 1.00 76.43  ? 108 LEU C C     1 
ATOM   2219  O  O     . LEU C 3  108 ? 144.525 175.591 148.400 1.00 76.43  ? 108 LEU C O     1 
ATOM   2220  C  CB    . LEU C 3  108 ? 145.090 173.085 146.451 1.00 76.43  ? 108 LEU C CB    1 
ATOM   2221  C  CG    . LEU C 3  108 ? 143.961 172.632 145.510 1.00 76.43  ? 108 LEU C CG    1 
ATOM   2222  C  CD1   . LEU C 3  108 ? 144.180 171.201 145.087 1.00 76.43  ? 108 LEU C CD1   1 
ATOM   2223  C  CD2   . LEU C 3  108 ? 142.584 172.748 146.145 1.00 76.43  ? 108 LEU C CD2   1 
ATOM   2224  N  N     . PRO C 3  109 ? 143.607 176.000 146.394 1.00 75.14  ? 109 PRO C N     1 
ATOM   2225  C  CA    . PRO C 3  109 ? 142.495 176.749 146.997 1.00 75.14  ? 109 PRO C CA    1 
ATOM   2226  C  C     . PRO C 3  109 ? 141.498 175.861 147.722 1.00 75.14  ? 109 PRO C C     1 
ATOM   2227  O  O     . PRO C 3  109 ? 140.411 175.581 147.213 1.00 75.14  ? 109 PRO C O     1 
ATOM   2228  C  CB    . PRO C 3  109 ? 141.842 177.439 145.793 1.00 75.14  ? 109 PRO C CB    1 
ATOM   2229  C  CG    . PRO C 3  109 ? 142.901 177.512 144.788 1.00 75.14  ? 109 PRO C CG    1 
ATOM   2230  C  CD    . PRO C 3  109 ? 143.710 176.265 144.953 1.00 75.14  ? 109 PRO C CD    1 
ATOM   2231  N  N     . ASN C 3  110 ? 141.871 175.403 148.907 1.00 84.43  ? 110 ASN C N     1 
ATOM   2232  C  CA    . ASN C 3  110 ? 140.949 174.731 149.803 1.00 84.43  ? 110 ASN C CA    1 
ATOM   2233  C  C     . ASN C 3  110 ? 140.269 175.789 150.655 1.00 84.43  ? 110 ASN C C     1 
ATOM   2234  O  O     . ASN C 3  110 ? 140.936 176.650 151.236 1.00 84.43  ? 110 ASN C O     1 
ATOM   2235  C  CB    . ASN C 3  110 ? 141.701 173.727 150.677 1.00 84.43  ? 110 ASN C CB    1 
ATOM   2236  C  CG    . ASN C 3  110 ? 140.783 172.799 151.449 1.00 84.43  ? 110 ASN C CG    1 
ATOM   2237  O  OD1   . ASN C 3  110 ? 139.563 172.874 151.344 1.00 84.43  ? 110 ASN C OD1   1 
ATOM   2238  N  ND2   . ASN C 3  110 ? 141.377 171.917 152.237 1.00 84.43  ? 110 ASN C ND2   1 
ATOM   2239  N  N     . ILE C 3  111 ? 138.941 175.748 150.696 1.00 92.24  ? 111 ILE C N     1 
ATOM   2240  C  CA    . ILE C 3  111 ? 138.139 176.616 151.547 1.00 92.24  ? 111 ILE C CA    1 
ATOM   2241  C  C     . ILE C 3  111 ? 137.133 175.729 152.257 1.00 92.24  ? 111 ILE C C     1 
ATOM   2242  O  O     . ILE C 3  111 ? 136.374 175.006 151.602 1.00 92.24  ? 111 ILE C O     1 
ATOM   2243  C  CB    . ILE C 3  111 ? 137.413 177.715 150.753 1.00 92.24  ? 111 ILE C CB    1 
ATOM   2244  C  CG1   . ILE C 3  111 ? 138.403 178.640 150.048 1.00 92.24  ? 111 ILE C CG1   1 
ATOM   2245  C  CG2   . ILE C 3  111 ? 136.541 178.536 151.676 1.00 92.24  ? 111 ILE C CG2   1 
ATOM   2246  C  CD1   . ILE C 3  111 ? 137.758 179.538 149.021 1.00 92.24  ? 111 ILE C CD1   1 
ATOM   2247  N  N     . GLN C 3  112 ? 137.142 175.757 153.585 1.00 104.17 ? 112 GLN C N     1 
ATOM   2248  C  CA    . GLN C 3  112 ? 136.151 175.002 154.339 1.00 104.17 ? 112 GLN C CA    1 
ATOM   2249  C  C     . GLN C 3  112 ? 134.771 175.617 154.165 1.00 104.17 ? 112 GLN C C     1 
ATOM   2250  O  O     . GLN C 3  112 ? 134.614 176.840 154.131 1.00 104.17 ? 112 GLN C O     1 
ATOM   2251  C  CB    . GLN C 3  112 ? 136.530 174.941 155.811 1.00 104.17 ? 112 GLN C CB    1 
ATOM   2252  C  CG    . GLN C 3  112 ? 137.708 174.033 156.066 1.00 104.17 ? 112 GLN C CG    1 
ATOM   2253  C  CD    . GLN C 3  112 ? 137.414 172.599 155.666 1.00 104.17 ? 112 GLN C CD    1 
ATOM   2254  O  OE1   . GLN C 3  112 ? 137.919 172.112 154.655 1.00 104.17 ? 112 GLN C OE1   1 
ATOM   2255  N  NE2   . GLN C 3  112 ? 136.601 171.916 156.460 1.00 104.17 ? 112 GLN C NE2   1 
ATOM   2256  N  N     . SER C 3  113 ? 133.768 174.748 154.057 1.00 111.62 ? 113 SER C N     1 
ATOM   2257  C  CA    . SER C 3  113 ? 132.453 175.160 153.586 1.00 111.62 ? 113 SER C CA    1 
ATOM   2258  C  C     . SER C 3  113 ? 131.702 176.008 154.599 1.00 111.62 ? 113 SER C C     1 
ATOM   2259  O  O     . SER C 3  113 ? 130.766 176.716 154.221 1.00 111.62 ? 113 SER C O     1 
ATOM   2260  C  CB    . SER C 3  113 ? 131.629 173.926 153.223 1.00 111.62 ? 113 SER C CB    1 
ATOM   2261  O  OG    . SER C 3  113 ? 132.236 173.200 152.164 1.00 111.62 ? 113 SER C OG    1 
ATOM   2262  N  N     . VAL C 3  114 ? 132.096 175.965 155.871 1.00 109.22 ? 114 VAL C N     1 
ATOM   2263  C  CA    . VAL C 3  114 ? 131.446 176.819 156.853 1.00 109.22 ? 114 VAL C CA    1 
ATOM   2264  C  C     . VAL C 3  114 ? 131.914 178.259 156.706 1.00 109.22 ? 114 VAL C C     1 
ATOM   2265  O  O     . VAL C 3  114 ? 131.210 179.181 157.136 1.00 109.22 ? 114 VAL C O     1 
ATOM   2266  C  CB    . VAL C 3  114 ? 131.685 176.265 158.271 1.00 109.22 ? 114 VAL C CB    1 
ATOM   2267  C  CG1   . VAL C 3  114 ? 133.098 176.524 158.743 1.00 109.22 ? 114 VAL C CG1   1 
ATOM   2268  C  CG2   . VAL C 3  114 ? 130.667 176.791 159.265 1.00 109.22 ? 114 VAL C CG2   1 
ATOM   2269  N  N     . LEU C 3  115 ? 133.056 178.492 156.059 1.00 111.39 ? 115 LEU C N     1 
ATOM   2270  C  CA    . LEU C 3  115 ? 133.530 179.855 155.874 1.00 111.39 ? 115 LEU C CA    1 
ATOM   2271  C  C     . LEU C 3  115 ? 132.860 180.551 154.704 1.00 111.39 ? 115 LEU C C     1 
ATOM   2272  O  O     . LEU C 3  115 ? 132.914 181.782 154.627 1.00 111.39 ? 115 LEU C O     1 
ATOM   2273  C  CB    . LEU C 3  115 ? 135.046 179.877 155.671 1.00 111.39 ? 115 LEU C CB    1 
ATOM   2274  C  CG    . LEU C 3  115 ? 135.922 179.439 156.842 1.00 111.39 ? 115 LEU C CG    1 
ATOM   2275  C  CD1   . LEU C 3  115 ? 137.366 179.447 156.419 1.00 111.39 ? 115 LEU C CD1   1 
ATOM   2276  C  CD2   . LEU C 3  115 ? 135.724 180.325 158.040 1.00 111.39 ? 115 LEU C CD2   1 
ATOM   2277  N  N     . LEU C 3  116 ? 132.217 179.777 153.826 1.00 116.63 ? 116 LEU C N     1 
ATOM   2278  C  CA    . LEU C 3  116 ? 131.505 180.367 152.662 1.00 116.63 ? 116 LEU C CA    1 
ATOM   2279  C  C     . LEU C 3  116 ? 130.327 181.196 153.186 1.00 116.63 ? 116 LEU C C     1 
ATOM   2280  O  O     . LEU C 3  116 ? 129.403 180.603 153.771 1.00 116.63 ? 116 LEU C O     1 
ATOM   2281  C  CB    . LEU C 3  116 ? 131.025 179.239 151.744 1.00 116.63 ? 116 LEU C CB    1 
ATOM   2282  C  CG    . LEU C 3  116 ? 131.594 179.263 150.328 1.00 116.63 ? 116 LEU C CG    1 
ATOM   2283  C  CD1   . LEU C 3  116 ? 130.816 178.329 149.412 1.00 116.63 ? 116 LEU C CD1   1 
ATOM   2284  C  CD2   . LEU C 3  116 ? 131.596 180.678 149.769 1.00 116.63 ? 116 LEU C CD2   1 
ATOM   2285  N  N     . PRO C 3  117 ? 130.321 182.537 153.006 1.00 120.24 ? 117 PRO C N     1 
ATOM   2286  C  CA    . PRO C 3  117 ? 129.226 183.379 153.498 1.00 120.24 ? 117 PRO C CA    1 
ATOM   2287  C  C     . PRO C 3  117 ? 127.916 183.088 152.754 1.00 120.24 ? 117 PRO C C     1 
ATOM   2288  O  O     . PRO C 3  117 ? 127.823 183.416 151.586 1.00 120.24 ? 117 PRO C O     1 
ATOM   2289  C  CB    . PRO C 3  117 ? 129.701 184.806 153.184 1.00 120.24 ? 117 PRO C CB    1 
ATOM   2290  C  CG    . PRO C 3  117 ? 130.660 184.627 152.030 1.00 120.24 ? 117 PRO C CG    1 
ATOM   2291  C  CD    . PRO C 3  117 ? 131.351 183.307 152.310 1.00 120.24 ? 117 PRO C CD    1 
ATOM   2292  N  N     . LYS C 3  118 ? 126.940 182.513 153.463 1.00 123.98 ? 118 LYS C N     1 
ATOM   2293  C  CA    . LYS C 3  118 ? 125.611 182.188 152.875 1.00 123.98 ? 118 LYS C CA    1 
ATOM   2294  C  C     . LYS C 3  118 ? 124.639 183.337 153.165 1.00 123.98 ? 118 LYS C C     1 
ATOM   2295  O  O     . LYS C 3  118 ? 125.008 184.247 153.934 1.00 123.98 ? 118 LYS C O     1 
ATOM   2296  C  CB    . LYS C 3  118 ? 125.079 180.880 153.469 1.00 123.98 ? 118 LYS C CB    1 
ATOM   2297  C  CG    . LYS C 3  118 ? 125.024 180.837 154.990 1.00 123.98 ? 118 LYS C CG    1 
ATOM   2298  C  CD    . LYS C 3  118 ? 126.385 180.964 155.641 1.00 123.98 ? 118 LYS C CD    1 
ATOM   2299  C  CE    . LYS C 3  118 ? 126.665 182.353 156.174 1.00 123.98 ? 118 LYS C CE    1 
ATOM   2300  N  NZ    . LYS C 3  118 ? 125.668 183.337 155.692 1.00 123.98 ? 118 LYS C NZ    1 
ATOM   2301  N  N     . LYS C 3  119 ? 123.437 183.278 152.579 1.00 121.47 ? 119 LYS C N     1 
ATOM   2302  C  CA    . LYS C 3  119 ? 122.405 184.328 152.783 1.00 121.47 ? 119 LYS C CA    1 
ATOM   2303  C  C     . LYS C 3  119 ? 121.255 184.100 151.795 1.00 121.47 ? 119 LYS C C     1 
ATOM   2304  O  O     . LYS C 3  119 ? 121.151 182.980 151.259 1.00 121.47 ? 119 LYS C O     1 
ATOM   2305  C  CB    . LYS C 3  119 ? 123.017 185.721 152.602 1.00 121.47 ? 119 LYS C CB    1 
ATOM   2306  C  CG    . LYS C 3  119 ? 123.918 185.880 151.385 1.00 121.47 ? 119 LYS C CG    1 
ATOM   2307  C  CD    . LYS C 3  119 ? 123.334 185.286 150.121 1.00 121.47 ? 119 LYS C CD    1 
ATOM   2308  C  CE    . LYS C 3  119 ? 123.710 183.833 149.920 1.00 121.47 ? 119 LYS C CE    1 
ATOM   2309  N  NZ    . LYS C 3  119 ? 122.520 182.991 149.647 1.00 121.47 ? 119 LYS C NZ    1 
ATOM   2310  N  N     . THR C 3  120 ? 120.431 185.130 151.574 1.00 30.00  ? 120 THR C N     1 
ATOM   2311  C  CA    . THR C 3  120 ? 119.280 185.031 150.634 1.00 30.00  ? 120 THR C CA    1 
ATOM   2312  C  C     . THR C 3  120 ? 119.581 185.844 149.370 1.00 30.00  ? 120 THR C C     1 
ATOM   2313  O  O     . THR C 3  120 ? 120.501 186.683 149.442 1.00 30.00  ? 120 THR C O     1 
ATOM   2314  C  CB    . THR C 3  120 ? 117.979 185.489 151.305 1.00 30.00  ? 120 THR C CB    1 
ATOM   2315  O  OG1   . THR C 3  120 ? 117.985 186.916 151.360 1.00 30.00  ? 120 THR C OG1   1 
ATOM   2316  C  CG2   . THR C 3  120 ? 117.803 184.923 152.696 1.00 30.00  ? 120 THR C CG2   1 
ATOM   2317  N  N     . ARG D 4  26  ? 192.410 179.852 135.344 1.00 30.00  ? 26  ARG D N     1 
ATOM   2318  C  CA    . ARG D 4  26  ? 191.805 178.576 135.814 1.00 30.00  ? 26  ARG D CA    1 
ATOM   2319  C  C     . ARG D 4  26  ? 190.277 178.695 135.768 1.00 30.00  ? 26  ARG D C     1 
ATOM   2320  O  O     . ARG D 4  26  ? 189.759 179.790 136.065 1.00 30.00  ? 26  ARG D O     1 
ATOM   2321  C  CB    . ARG D 4  26  ? 192.288 178.250 137.232 1.00 30.00  ? 26  ARG D CB    1 
ATOM   2322  C  CG    . ARG D 4  26  ? 193.771 177.923 137.324 1.00 30.00  ? 26  ARG D CG    1 
ATOM   2323  C  CD    . ARG D 4  26  ? 194.197 177.560 138.734 1.00 30.00  ? 26  ARG D CD    1 
ATOM   2324  N  NE    . ARG D 4  26  ? 195.628 177.315 138.835 1.00 30.00  ? 26  ARG D NE    1 
ATOM   2325  C  CZ    . ARG D 4  26  ? 196.276 177.093 139.972 1.00 30.00  ? 26  ARG D CZ    1 
ATOM   2326  N  NH1   . ARG D 4  26  ? 197.598 177.099 139.995 1.00 30.00  ? 26  ARG D NH1   1 
ATOM   2327  N  NH2   . ARG D 4  26  ? 195.599 176.865 141.085 1.00 30.00  ? 26  ARG D NH2   1 
ATOM   2328  N  N     . ARG D 4  27  ? 189.591 177.603 135.413 1.00 30.00  ? 27  ARG D N     1 
ATOM   2329  C  CA    . ARG D 4  27  ? 188.105 177.594 135.330 1.00 30.00  ? 27  ARG D CA    1 
ATOM   2330  C  C     . ARG D 4  27  ? 187.525 177.161 136.682 1.00 30.00  ? 27  ARG D C     1 
ATOM   2331  O  O     . ARG D 4  27  ? 187.872 177.785 137.704 1.00 30.00  ? 27  ARG D O     1 
ATOM   2332  C  CB    . ARG D 4  27  ? 187.638 176.666 134.206 1.00 30.00  ? 27  ARG D CB    1 
ATOM   2333  C  CG    . ARG D 4  27  ? 187.943 177.183 132.806 1.00 30.00  ? 27  ARG D CG    1 
ATOM   2334  C  CD    . ARG D 4  27  ? 188.389 178.633 132.808 1.00 30.00  ? 27  ARG D CD    1 
ATOM   2335  N  NE    . ARG D 4  27  ? 187.271 179.556 132.948 1.00 30.00  ? 27  ARG D NE    1 
ATOM   2336  C  CZ    . ARG D 4  27  ? 187.325 180.852 132.659 1.00 30.00  ? 27  ARG D CZ    1 
ATOM   2337  N  NH1   . ARG D 4  27  ? 186.288 181.448 132.096 1.00 30.00  ? 27  ARG D NH1   1 
ATOM   2338  N  NH2   . ARG D 4  27  ? 188.415 181.547 132.933 1.00 30.00  ? 27  ARG D NH2   1 
ATOM   2339  N  N     . LYS D 4  28  ? 186.673 176.129 136.676 1.00 106.37 ? 28  LYS D N     1 
ATOM   2340  C  CA    . LYS D 4  28  ? 186.044 175.620 137.924 1.00 106.37 ? 28  LYS D CA    1 
ATOM   2341  C  C     . LYS D 4  28  ? 185.448 174.232 137.667 1.00 106.37 ? 28  LYS D C     1 
ATOM   2342  O  O     . LYS D 4  28  ? 185.183 173.910 136.491 1.00 106.37 ? 28  LYS D O     1 
ATOM   2343  C  CB    . LYS D 4  28  ? 184.967 176.593 138.416 1.00 106.37 ? 28  LYS D CB    1 
ATOM   2344  C  CG    . LYS D 4  28  ? 183.750 176.729 137.513 1.00 106.37 ? 28  LYS D CG    1 
ATOM   2345  C  CD    . LYS D 4  28  ? 184.015 176.314 136.081 1.00 106.37 ? 28  LYS D CD    1 
ATOM   2346  C  CE    . LYS D 4  28  ? 183.751 177.422 135.084 1.00 106.37 ? 28  LYS D CE    1 
ATOM   2347  N  NZ    . LYS D 4  28  ? 183.007 176.930 133.900 1.00 106.37 ? 28  LYS D NZ    1 
ATOM   2348  N  N     . THR D 4  29  ? 185.252 173.450 138.733 1.00 105.05 ? 29  THR D N     1 
ATOM   2349  C  CA    . THR D 4  29  ? 184.675 172.083 138.625 1.00 105.05 ? 29  THR D CA    1 
ATOM   2350  C  C     . THR D 4  29  ? 183.277 172.168 138.001 1.00 105.05 ? 29  THR D C     1 
ATOM   2351  O  O     . THR D 4  29  ? 183.045 173.091 137.197 1.00 105.05 ? 29  THR D O     1 
ATOM   2352  C  CB    . THR D 4  29  ? 184.644 171.386 139.991 1.00 105.05 ? 29  THR D CB    1 
ATOM   2353  O  OG1   . THR D 4  29  ? 183.365 171.618 140.582 1.00 105.05 ? 29  THR D OG1   1 
ATOM   2354  C  CG2   . THR D 4  29  ? 185.733 171.871 140.924 1.00 105.05 ? 29  THR D CG2   1 
ATOM   2355  N  N     . ARG D 4  30  ? 182.390 171.236 138.365 1.00 101.76 ? 30  ARG D N     1 
ATOM   2356  C  CA    . ARG D 4  30  ? 181.004 171.214 137.828 1.00 101.76 ? 30  ARG D CA    1 
ATOM   2357  C  C     . ARG D 4  30  ? 180.090 170.474 138.813 1.00 101.76 ? 30  ARG D C     1 
ATOM   2358  O  O     . ARG D 4  30  ? 180.162 170.768 140.021 1.00 101.76 ? 30  ARG D O     1 
ATOM   2359  C  CB    . ARG D 4  30  ? 180.974 170.545 136.450 1.00 101.76 ? 30  ARG D CB    1 
ATOM   2360  C  CG    . ARG D 4  30  ? 180.556 169.082 136.481 1.00 101.76 ? 30  ARG D CG    1 
ATOM   2361  C  CD    . ARG D 4  30  ? 181.355 168.280 137.490 1.00 101.76 ? 30  ARG D CD    1 
ATOM   2362  N  NE    . ARG D 4  30  ? 182.738 168.729 137.576 1.00 101.76 ? 30  ARG D NE    1 
ATOM   2363  C  CZ    . ARG D 4  30  ? 183.459 169.141 136.540 1.00 101.76 ? 30  ARG D CZ    1 
ATOM   2364  N  NH1   . ARG D 4  30  ? 183.035 168.917 135.307 1.00 101.76 ? 30  ARG D NH1   1 
ATOM   2365  N  NH2   . ARG D 4  30  ? 184.600 169.775 136.739 1.00 101.76 ? 30  ARG D NH2   1 
ATOM   2366  N  N     . LYS D 4  31  ? 179.270 169.551 138.302 1.00 96.81  ? 31  LYS D N     1 
ATOM   2367  C  CA    . LYS D 4  31  ? 178.353 168.783 139.133 1.00 96.81  ? 31  LYS D CA    1 
ATOM   2368  C  C     . LYS D 4  31  ? 177.129 168.497 138.284 1.00 96.81  ? 31  LYS D C     1 
ATOM   2369  O  O     . LYS D 4  31  ? 176.460 169.431 137.839 1.00 96.81  ? 31  LYS D O     1 
ATOM   2370  C  CB    . LYS D 4  31  ? 177.957 169.549 140.399 1.00 96.81  ? 31  LYS D CB    1 
ATOM   2371  C  CG    . LYS D 4  31  ? 179.068 169.742 141.421 1.00 96.81  ? 31  LYS D CG    1 
ATOM   2372  C  CD    . LYS D 4  31  ? 178.550 170.498 142.632 1.00 96.81  ? 31  LYS D CD    1 
ATOM   2373  C  CE    . LYS D 4  31  ? 179.624 170.725 143.677 1.00 96.81  ? 31  LYS D CE    1 
ATOM   2374  N  NZ    . LYS D 4  31  ? 179.111 171.530 144.825 1.00 96.81  ? 31  LYS D NZ    1 
ATOM   2375  N  N     . GLU D 4  32  ? 176.834 167.220 138.075 1.00 95.56  ? 32  GLU D N     1 
ATOM   2376  C  CA    . GLU D 4  32  ? 175.818 166.812 137.121 1.00 95.56  ? 32  GLU D CA    1 
ATOM   2377  C  C     . GLU D 4  32  ? 174.419 167.169 137.625 1.00 95.56  ? 32  GLU D C     1 
ATOM   2378  O  O     . GLU D 4  32  ? 174.227 167.635 138.749 1.00 95.56  ? 32  GLU D O     1 
ATOM   2379  C  CB    . GLU D 4  32  ? 175.920 165.312 136.884 1.00 95.56  ? 32  GLU D CB    1 
ATOM   2380  C  CG    . GLU D 4  32  ? 175.305 164.463 138.003 1.00 95.56  ? 32  GLU D CG    1 
ATOM   2381  C  CD    . GLU D 4  32  ? 176.185 164.269 139.233 1.00 95.56  ? 32  GLU D CD    1 
ATOM   2382  O  OE1   . GLU D 4  32  ? 177.174 165.006 139.426 1.00 95.56  ? 32  GLU D OE1   1 
ATOM   2383  O  OE2   . GLU D 4  32  ? 175.864 163.362 140.028 1.00 95.56  ? 32  GLU D OE2   1 
ATOM   2384  N  N     . SER D 4  33  ? 173.429 166.948 136.769 1.00 75.14  ? 33  SER D N     1 
ATOM   2385  C  CA    . SER D 4  33  ? 172.033 167.142 137.127 1.00 75.14  ? 33  SER D CA    1 
ATOM   2386  C  C     . SER D 4  33  ? 171.208 166.166 136.307 1.00 75.14  ? 33  SER D C     1 
ATOM   2387  O  O     . SER D 4  33  ? 171.743 165.241 135.693 1.00 75.14  ? 33  SER D O     1 
ATOM   2388  C  CB    . SER D 4  33  ? 171.610 168.589 136.877 1.00 75.14  ? 33  SER D CB    1 
ATOM   2389  O  OG    . SER D 4  33  ? 171.623 168.864 135.488 1.00 75.14  ? 33  SER D OG    1 
ATOM   2390  N  N     . TYR D 4  34  ? 169.899 166.378 136.286 1.00 67.80  ? 34  TYR D N     1 
ATOM   2391  C  CA    . TYR D 4  34  ? 169.010 165.651 135.394 1.00 67.80  ? 34  TYR D CA    1 
ATOM   2392  C  C     . TYR D 4  34  ? 168.340 166.583 134.404 1.00 67.80  ? 34  TYR D C     1 
ATOM   2393  O  O     . TYR D 4  34  ? 167.427 166.153 133.691 1.00 67.80  ? 34  TYR D O     1 
ATOM   2394  C  CB    . TYR D 4  34  ? 167.946 164.899 136.193 1.00 67.80  ? 34  TYR D CB    1 
ATOM   2395  C  CG    . TYR D 4  34  ? 168.465 163.726 136.975 1.00 67.80  ? 34  TYR D CG    1 
ATOM   2396  C  CD1   . TYR D 4  34  ? 169.645 163.097 136.625 1.00 67.80  ? 34  TYR D CD1   1 
ATOM   2397  C  CD2   . TYR D 4  34  ? 167.788 163.266 138.084 1.00 67.80  ? 34  TYR D CD2   1 
ATOM   2398  C  CE1   . TYR D 4  34  ? 170.121 162.027 137.345 1.00 67.80  ? 34  TYR D CE1   1 
ATOM   2399  C  CE2   . TYR D 4  34  ? 168.257 162.199 138.812 1.00 67.80  ? 34  TYR D CE2   1 
ATOM   2400  C  CZ    . TYR D 4  34  ? 169.419 161.586 138.438 1.00 67.80  ? 34  TYR D CZ    1 
ATOM   2401  O  OH    . TYR D 4  34  ? 169.880 160.526 139.174 1.00 67.80  ? 34  TYR D OH    1 
ATOM   2402  N  N     . ALA D 4  35  ? 168.787 167.840 134.336 1.00 63.70  ? 35  ALA D N     1 
ATOM   2403  C  CA    . ALA D 4  35  ? 167.999 168.907 133.733 1.00 63.70  ? 35  ALA D CA    1 
ATOM   2404  C  C     . ALA D 4  35  ? 167.842 168.734 132.232 1.00 63.70  ? 35  ALA D C     1 
ATOM   2405  O  O     . ALA D 4  35  ? 166.787 169.067 131.680 1.00 63.70  ? 35  ALA D O     1 
ATOM   2406  C  CB    . ALA D 4  35  ? 168.642 170.253 134.042 1.00 63.70  ? 35  ALA D CB    1 
ATOM   2407  N  N     . ILE D 4  36  ? 168.864 168.195 131.565 1.00 65.78  ? 36  ILE D N     1 
ATOM   2408  C  CA    . ILE D 4  36  ? 168.741 167.905 130.144 1.00 65.78  ? 36  ILE D CA    1 
ATOM   2409  C  C     . ILE D 4  36  ? 167.765 166.761 129.929 1.00 65.78  ? 36  ILE D C     1 
ATOM   2410  O  O     . ILE D 4  36  ? 166.943 166.793 129.007 1.00 65.78  ? 36  ILE D O     1 
ATOM   2411  C  CB    . ILE D 4  36  ? 170.125 167.625 129.521 1.00 65.78  ? 36  ILE D CB    1 
ATOM   2412  C  CG1   . ILE D 4  36  ? 170.926 168.917 129.388 1.00 65.78  ? 36  ILE D CG1   1 
ATOM   2413  C  CG2   . ILE D 4  36  ? 170.000 167.043 128.139 1.00 65.78  ? 36  ILE D CG2   1 
ATOM   2414  C  CD1   . ILE D 4  36  ? 171.821 169.241 130.537 1.00 65.78  ? 36  ILE D CD1   1 
ATOM   2415  N  N     . TYR D 4  37  ? 167.770 165.786 130.831 1.00 67.60  ? 37  TYR D N     1 
ATOM   2416  C  CA    . TYR D 4  37  ? 166.880 164.649 130.671 1.00 67.60  ? 37  TYR D CA    1 
ATOM   2417  C  C     . TYR D 4  37  ? 165.433 165.021 130.968 1.00 67.60  ? 37  TYR D C     1 
ATOM   2418  O  O     . TYR D 4  37  ? 164.523 164.612 130.235 1.00 67.60  ? 37  TYR D O     1 
ATOM   2419  C  CB    . TYR D 4  37  ? 167.342 163.513 131.564 1.00 67.60  ? 37  TYR D CB    1 
ATOM   2420  C  CG    . TYR D 4  37  ? 168.757 163.108 131.276 1.00 67.60  ? 37  TYR D CG    1 
ATOM   2421  C  CD1   . TYR D 4  37  ? 169.074 162.384 130.146 1.00 67.60  ? 37  TYR D CD1   1 
ATOM   2422  C  CD2   . TYR D 4  37  ? 169.772 163.443 132.143 1.00 67.60  ? 37  TYR D CD2   1 
ATOM   2423  C  CE1   . TYR D 4  37  ? 170.370 162.020 129.883 1.00 67.60  ? 37  TYR D CE1   1 
ATOM   2424  C  CE2   . TYR D 4  37  ? 171.064 163.076 131.894 1.00 67.60  ? 37  TYR D CE2   1 
ATOM   2425  C  CZ    . TYR D 4  37  ? 171.357 162.362 130.767 1.00 67.60  ? 37  TYR D CZ    1 
ATOM   2426  O  OH    . TYR D 4  37  ? 172.646 161.991 130.508 1.00 67.60  ? 37  TYR D OH    1 
ATOM   2427  N  N     . VAL D 4  38  ? 165.207 165.800 132.034 1.00 69.50  ? 38  VAL D N     1 
ATOM   2428  C  CA    . VAL D 4  38  ? 163.879 166.334 132.337 1.00 69.50  ? 38  VAL D CA    1 
ATOM   2429  C  C     . VAL D 4  38  ? 163.385 167.185 131.182 1.00 69.50  ? 38  VAL D C     1 
ATOM   2430  O  O     . VAL D 4  38  ? 162.207 167.121 130.793 1.00 69.50  ? 38  VAL D O     1 
ATOM   2431  C  CB    . VAL D 4  38  ? 163.916 167.135 133.653 1.00 69.50  ? 38  VAL D CB    1 
ATOM   2432  C  CG1   . VAL D 4  38  ? 162.597 167.825 133.928 1.00 69.50  ? 38  VAL D CG1   1 
ATOM   2433  C  CG2   . VAL D 4  38  ? 164.247 166.221 134.794 1.00 69.50  ? 38  VAL D CG2   1 
ATOM   2434  N  N     . TYR D 4  39  ? 164.298 167.941 130.577 1.00 69.91  ? 39  TYR D N     1 
ATOM   2435  C  CA    . TYR D 4  39  ? 163.949 168.716 129.404 1.00 69.91  ? 39  TYR D CA    1 
ATOM   2436  C  C     . TYR D 4  39  ? 163.565 167.810 128.239 1.00 69.91  ? 39  TYR D C     1 
ATOM   2437  O  O     . TYR D 4  39  ? 162.665 168.147 127.463 1.00 69.91  ? 39  TYR D O     1 
ATOM   2438  C  CB    . TYR D 4  39  ? 165.116 169.622 129.032 1.00 69.91  ? 39  TYR D CB    1 
ATOM   2439  C  CG    . TYR D 4  39  ? 164.754 170.650 128.016 1.00 69.91  ? 39  TYR D CG    1 
ATOM   2440  C  CD1   . TYR D 4  39  ? 164.072 171.796 128.388 1.00 69.91  ? 39  TYR D CD1   1 
ATOM   2441  C  CD2   . TYR D 4  39  ? 165.061 170.466 126.679 1.00 69.91  ? 39  TYR D CD2   1 
ATOM   2442  C  CE1   . TYR D 4  39  ? 163.726 172.735 127.467 1.00 69.91  ? 39  TYR D CE1   1 
ATOM   2443  C  CE2   . TYR D 4  39  ? 164.716 171.396 125.748 1.00 69.91  ? 39  TYR D CE2   1 
ATOM   2444  C  CZ    . TYR D 4  39  ? 164.046 172.529 126.149 1.00 69.91  ? 39  TYR D CZ    1 
ATOM   2445  O  OH    . TYR D 4  39  ? 163.692 173.470 125.219 1.00 69.91  ? 39  TYR D OH    1 
ATOM   2446  N  N     . LYS D 4  40  ? 164.184 166.632 128.142 1.00 67.76  ? 40  LYS D N     1 
ATOM   2447  C  CA    . LYS D 4  40  ? 163.868 165.732 127.040 1.00 67.76  ? 40  LYS D CA    1 
ATOM   2448  C  C     . LYS D 4  40  ? 162.514 165.064 127.223 1.00 67.76  ? 40  LYS D C     1 
ATOM   2449  O  O     . LYS D 4  40  ? 161.790 164.859 126.244 1.00 67.76  ? 40  LYS D O     1 
ATOM   2450  C  CB    . LYS D 4  40  ? 164.956 164.680 126.874 1.00 67.76  ? 40  LYS D CB    1 
ATOM   2451  C  CG    . LYS D 4  40  ? 166.217 165.183 126.200 1.00 67.76  ? 40  LYS D CG    1 
ATOM   2452  C  CD    . LYS D 4  40  ? 167.172 164.032 125.959 1.00 67.76  ? 40  LYS D CD    1 
ATOM   2453  C  CE    . LYS D 4  40  ? 168.400 164.471 125.198 1.00 67.76  ? 40  LYS D CE    1 
ATOM   2454  N  NZ    . LYS D 4  40  ? 169.277 163.308 124.925 1.00 67.76  ? 40  LYS D NZ    1 
ATOM   2455  N  N     . VAL D 4  41  ? 162.156 164.711 128.458 1.00 70.23  ? 41  VAL D N     1 
ATOM   2456  C  CA    . VAL D 4  41  ? 160.842 164.107 128.651 1.00 70.23  ? 41  VAL D CA    1 
ATOM   2457  C  C     . VAL D 4  41  ? 159.760 165.157 128.465 1.00 70.23  ? 41  VAL D C     1 
ATOM   2458  O  O     . VAL D 4  41  ? 158.677 164.861 127.929 1.00 70.23  ? 41  VAL D O     1 
ATOM   2459  C  CB    . VAL D 4  41  ? 160.746 163.439 130.032 1.00 70.23  ? 41  VAL D CB    1 
ATOM   2460  C  CG1   . VAL D 4  41  ? 159.472 162.641 130.150 1.00 70.23  ? 41  VAL D CG1   1 
ATOM   2461  C  CG2   . VAL D 4  41  ? 161.930 162.559 130.267 1.00 70.23  ? 41  VAL D CG2   1 
ATOM   2462  N  N     . LEU D 4  42  ? 160.049 166.401 128.866 1.00 73.16  ? 42  LEU D N     1 
ATOM   2463  C  CA    . LEU D 4  42  ? 159.144 167.509 128.578 1.00 73.16  ? 42  LEU D CA    1 
ATOM   2464  C  C     . LEU D 4  42  ? 158.961 167.697 127.080 1.00 73.16  ? 42  LEU D C     1 
ATOM   2465  O  O     . LEU D 4  42  ? 157.847 167.959 126.609 1.00 73.16  ? 42  LEU D O     1 
ATOM   2466  C  CB    . LEU D 4  42  ? 159.674 168.792 129.207 1.00 73.16  ? 42  LEU D CB    1 
ATOM   2467  C  CG    . LEU D 4  42  ? 158.784 170.006 128.977 1.00 73.16  ? 42  LEU D CG    1 
ATOM   2468  C  CD1   . LEU D 4  42  ? 157.462 169.801 129.655 1.00 73.16  ? 42  LEU D CD1   1 
ATOM   2469  C  CD2   . LEU D 4  42  ? 159.443 171.255 129.468 1.00 73.16  ? 42  LEU D CD2   1 
ATOM   2470  N  N     . LYS D 4  43  ? 160.036 167.523 126.308 1.00 75.30  ? 43  LYS D N     1 
ATOM   2471  C  CA    . LYS D 4  43  ? 159.896 167.515 124.860 1.00 75.30  ? 43  LYS D CA    1 
ATOM   2472  C  C     . LYS D 4  43  ? 159.155 166.291 124.343 1.00 75.30  ? 43  LYS D C     1 
ATOM   2473  O  O     . LYS D 4  43  ? 158.602 166.349 123.244 1.00 75.30  ? 43  LYS D O     1 
ATOM   2474  C  CB    . LYS D 4  43  ? 161.262 167.620 124.196 1.00 75.30  ? 43  LYS D CB    1 
ATOM   2475  C  CG    . LYS D 4  43  ? 161.891 168.965 124.406 1.00 75.30  ? 43  LYS D CG    1 
ATOM   2476  C  CD    . LYS D 4  43  ? 161.020 170.001 123.751 1.00 75.30  ? 43  LYS D CD    1 
ATOM   2477  C  CE    . LYS D 4  43  ? 161.601 171.385 123.847 1.00 75.30  ? 43  LYS D CE    1 
ATOM   2478  N  NZ    . LYS D 4  43  ? 160.705 172.393 123.219 1.00 75.30  ? 43  LYS D NZ    1 
ATOM   2479  N  N     . GLN D 4  44  ? 159.117 165.193 125.092 1.00 73.80  ? 44  GLN D N     1 
ATOM   2480  C  CA    . GLN D 4  44  ? 158.289 164.090 124.627 1.00 73.80  ? 44  GLN D CA    1 
ATOM   2481  C  C     . GLN D 4  44  ? 156.808 164.352 124.848 1.00 73.80  ? 44  GLN D C     1 
ATOM   2482  O  O     . GLN D 4  44  ? 155.984 163.951 124.024 1.00 73.80  ? 44  GLN D O     1 
ATOM   2483  C  CB    . GLN D 4  44  ? 158.671 162.778 125.303 1.00 73.80  ? 44  GLN D CB    1 
ATOM   2484  C  CG    . GLN D 4  44  ? 159.943 162.159 124.792 1.00 73.80  ? 44  GLN D CG    1 
ATOM   2485  C  CD    . GLN D 4  44  ? 160.132 160.753 125.316 1.00 73.80  ? 44  GLN D CD    1 
ATOM   2486  O  OE1   . GLN D 4  44  ? 159.338 160.267 126.116 1.00 73.80  ? 44  GLN D OE1   1 
ATOM   2487  N  NE2   . GLN D 4  44  ? 161.178 160.086 124.853 1.00 73.80  ? 44  GLN D NE2   1 
ATOM   2488  N  N     . VAL D 4  45  ? 156.444 165.019 125.942 1.00 78.31  ? 45  VAL D N     1 
ATOM   2489  C  CA    . VAL D 4  45  ? 155.033 165.062 126.322 1.00 78.31  ? 45  VAL D CA    1 
ATOM   2490  C  C     . VAL D 4  45  ? 154.291 166.249 125.714 1.00 78.31  ? 45  VAL D C     1 
ATOM   2491  O  O     . VAL D 4  45  ? 153.328 166.069 124.961 1.00 78.31  ? 45  VAL D O     1 
ATOM   2492  C  CB    . VAL D 4  45  ? 154.886 165.065 127.849 1.00 78.31  ? 45  VAL D CB    1 
ATOM   2493  C  CG1   . VAL D 4  45  ? 153.441 165.158 128.203 1.00 78.31  ? 45  VAL D CG1   1 
ATOM   2494  C  CG2   . VAL D 4  45  ? 155.462 163.806 128.421 1.00 78.31  ? 45  VAL D CG2   1 
ATOM   2495  N  N     . HIS D 4  46  ? 154.705 167.467 126.056 1.00 79.83  ? 46  HIS D N     1 
ATOM   2496  C  CA    . HIS D 4  46  ? 154.146 168.687 125.475 1.00 79.83  ? 46  HIS D CA    1 
ATOM   2497  C  C     . HIS D 4  46  ? 155.297 169.476 124.871 1.00 79.83  ? 46  HIS D C     1 
ATOM   2498  O  O     . HIS D 4  46  ? 155.899 170.321 125.550 1.00 79.83  ? 46  HIS D O     1 
ATOM   2499  C  CB    . HIS D 4  46  ? 153.402 169.512 126.516 1.00 79.83  ? 46  HIS D CB    1 
ATOM   2500  C  CG    . HIS D 4  46  ? 152.173 168.848 127.052 1.00 79.83  ? 46  HIS D CG    1 
ATOM   2501  N  ND1   . HIS D 4  46  ? 151.019 168.707 126.310 1.00 79.83  ? 46  HIS D ND1   1 
ATOM   2502  C  CD2   . HIS D 4  46  ? 151.899 168.329 128.270 1.00 79.83  ? 46  HIS D CD2   1 
ATOM   2503  C  CE1   . HIS D 4  46  ? 150.098 168.106 127.037 1.00 79.83  ? 46  HIS D CE1   1 
ATOM   2504  N  NE2   . HIS D 4  46  ? 150.607 167.863 128.233 1.00 79.83  ? 46  HIS D NE2   1 
ATOM   2505  N  N     . PRO D 4  47  ? 155.623 169.248 123.595 1.00 82.14  ? 47  PRO D N     1 
ATOM   2506  C  CA    . PRO D 4  47  ? 156.954 169.627 123.088 1.00 82.14  ? 47  PRO D CA    1 
ATOM   2507  C  C     . PRO D 4  47  ? 157.149 171.114 122.866 1.00 82.14  ? 47  PRO D C     1 
ATOM   2508  O  O     . PRO D 4  47  ? 158.292 171.581 122.885 1.00 82.14  ? 47  PRO D O     1 
ATOM   2509  C  CB    . PRO D 4  47  ? 157.047 168.866 121.759 1.00 82.14  ? 47  PRO D CB    1 
ATOM   2510  C  CG    . PRO D 4  47  ? 155.992 167.803 121.836 1.00 82.14  ? 47  PRO D CG    1 
ATOM   2511  C  CD    . PRO D 4  47  ? 154.888 168.420 122.630 1.00 82.14  ? 47  PRO D CD    1 
ATOM   2512  N  N     . ASP D 4  48  ? 156.084 171.876 122.651 1.00 83.15  ? 48  ASP D N     1 
ATOM   2513  C  CA    . ASP D 4  48  ? 156.201 173.297 122.341 1.00 83.15  ? 48  ASP D CA    1 
ATOM   2514  C  C     . ASP D 4  48  ? 155.927 174.159 123.563 1.00 83.15  ? 48  ASP D C     1 
ATOM   2515  O  O     . ASP D 4  48  ? 155.350 175.245 123.456 1.00 83.15  ? 48  ASP D O     1 
ATOM   2516  C  CB    . ASP D 4  48  ? 155.252 173.649 121.206 1.00 83.15  ? 48  ASP D CB    1 
ATOM   2517  C  CG    . ASP D 4  48  ? 155.540 172.856 119.954 1.00 83.15  ? 48  ASP D CG    1 
ATOM   2518  O  OD1   . ASP D 4  48  ? 156.705 172.463 119.756 1.00 83.15  ? 48  ASP D OD1   1 
ATOM   2519  O  OD2   . ASP D 4  48  ? 154.599 172.616 119.174 1.00 83.15  ? 48  ASP D OD2   1 
ATOM   2520  N  N     . THR D 4  49  ? 156.328 173.687 124.741 1.00 79.72  ? 49  THR D N     1 
ATOM   2521  C  CA    . THR D 4  49  ? 155.938 174.292 126.008 1.00 79.72  ? 49  THR D CA    1 
ATOM   2522  C  C     . THR D 4  49  ? 157.118 174.180 126.957 1.00 79.72  ? 49  THR D C     1 
ATOM   2523  O  O     . THR D 4  49  ? 157.524 173.069 127.307 1.00 79.72  ? 49  THR D O     1 
ATOM   2524  C  CB    . THR D 4  49  ? 154.712 173.579 126.586 1.00 79.72  ? 49  THR D CB    1 
ATOM   2525  O  OG1   . THR D 4  49  ? 153.667 173.540 125.607 1.00 79.72  ? 49  THR D OG1   1 
ATOM   2526  C  CG2   . THR D 4  49  ? 154.195 174.302 127.793 1.00 79.72  ? 49  THR D CG2   1 
ATOM   2527  N  N     . GLY D 4  50  ? 157.662 175.314 127.382 1.00 75.50  ? 50  GLY D N     1 
ATOM   2528  C  CA    . GLY D 4  50  ? 158.919 175.340 128.107 1.00 75.50  ? 50  GLY D CA    1 
ATOM   2529  C  C     . GLY D 4  50  ? 158.802 175.170 129.610 1.00 75.50  ? 50  GLY D C     1 
ATOM   2530  O  O     . GLY D 4  50  ? 157.761 174.803 130.155 1.00 75.50  ? 50  GLY D O     1 
ATOM   2531  N  N     . ILE D 4  51  ? 159.909 175.475 130.287 1.00 71.81  ? 51  ILE D N     1 
ATOM   2532  C  CA    . ILE D 4  51  ? 160.119 175.158 131.695 1.00 71.81  ? 51  ILE D CA    1 
ATOM   2533  C  C     . ILE D 4  51  ? 160.986 176.249 132.309 1.00 71.81  ? 51  ILE D C     1 
ATOM   2534  O  O     . ILE D 4  51  ? 161.879 176.786 131.648 1.00 71.81  ? 51  ILE D O     1 
ATOM   2535  C  CB    . ILE D 4  51  ? 160.747 173.751 131.835 1.00 71.81  ? 51  ILE D CB    1 
ATOM   2536  C  CG1   . ILE D 4  51  ? 161.018 173.367 133.287 1.00 71.81  ? 51  ILE D CG1   1 
ATOM   2537  C  CG2   . ILE D 4  51  ? 161.978 173.606 130.969 1.00 71.81  ? 51  ILE D CG2   1 
ATOM   2538  C  CD1   . ILE D 4  51  ? 159.803 173.121 134.088 1.00 71.81  ? 51  ILE D CD1   1 
ATOM   2539  N  N     . SER D 4  52  ? 160.697 176.622 133.554 1.00 70.23  ? 52  SER D N     1 
ATOM   2540  C  CA    . SER D 4  52  ? 161.487 177.629 134.249 1.00 70.23  ? 52  SER D CA    1 
ATOM   2541  C  C     . SER D 4  52  ? 162.485 176.966 135.192 1.00 70.23  ? 52  SER D C     1 
ATOM   2542  O  O     . SER D 4  52  ? 162.385 175.778 135.500 1.00 70.23  ? 52  SER D O     1 
ATOM   2543  C  CB    . SER D 4  52  ? 160.582 178.577 135.016 1.00 70.23  ? 52  SER D CB    1 
ATOM   2544  O  OG    . SER D 4  52  ? 159.911 177.844 136.008 1.00 70.23  ? 52  SER D OG    1 
ATOM   2545  N  N     . SER D 4  53  ? 163.454 177.760 135.660 1.00 72.92  ? 53  SER D N     1 
ATOM   2546  C  CA    . SER D 4  53  ? 164.664 177.204 136.267 1.00 72.92  ? 53  SER D CA    1 
ATOM   2547  C  C     . SER D 4  53  ? 164.435 176.702 137.683 1.00 72.92  ? 53  SER D C     1 
ATOM   2548  O  O     . SER D 4  53  ? 165.031 175.690 138.077 1.00 72.92  ? 53  SER D O     1 
ATOM   2549  C  CB    . SER D 4  53  ? 165.774 178.243 136.303 1.00 72.92  ? 53  SER D CB    1 
ATOM   2550  O  OG    . SER D 4  53  ? 165.465 179.235 137.259 1.00 72.92  ? 53  SER D OG    1 
ATOM   2551  N  N     . LYS D 4  54  ? 163.637 177.422 138.477 1.00 68.89  ? 54  LYS D N     1 
ATOM   2552  C  CA    . LYS D 4  54  ? 163.305 176.945 139.814 1.00 68.89  ? 54  LYS D CA    1 
ATOM   2553  C  C     . LYS D 4  54  ? 162.564 175.625 139.741 1.00 68.89  ? 54  LYS D C     1 
ATOM   2554  O  O     . LYS D 4  54  ? 162.836 174.708 140.523 1.00 68.89  ? 54  LYS D O     1 
ATOM   2555  C  CB    . LYS D 4  54  ? 162.461 177.972 140.560 1.00 68.89  ? 54  LYS D CB    1 
ATOM   2556  C  CG    . LYS D 4  54  ? 163.191 179.227 140.958 1.00 68.89  ? 54  LYS D CG    1 
ATOM   2557  C  CD    . LYS D 4  54  ? 162.233 180.201 141.628 1.00 68.89  ? 54  LYS D CD    1 
ATOM   2558  C  CE    . LYS D 4  54  ? 162.917 181.516 141.968 1.00 68.89  ? 54  LYS D CE    1 
ATOM   2559  N  NZ    . LYS D 4  54  ? 161.965 182.506 142.539 1.00 68.89  ? 54  LYS D NZ    1 
ATOM   2560  N  N     . ALA D 4  55  ? 161.666 175.491 138.768 1.00 67.45  ? 55  ALA D N     1 
ATOM   2561  C  CA    . ALA D 4  55  ? 160.965 174.229 138.597 1.00 67.45  ? 55  ALA D CA    1 
ATOM   2562  C  C     . ALA D 4  55  ? 161.894 173.155 138.074 1.00 67.45  ? 55  ALA D C     1 
ATOM   2563  O  O     . ALA D 4  55  ? 161.690 171.971 138.356 1.00 67.45  ? 55  ALA D O     1 
ATOM   2564  C  CB    . ALA D 4  55  ? 159.784 174.408 137.655 1.00 67.45  ? 55  ALA D CB    1 
ATOM   2565  N  N     . MET D 4  56  ? 162.920 173.552 137.332 1.00 71.34  ? 56  MET D N     1 
ATOM   2566  C  CA    . MET D 4  56  ? 163.912 172.596 136.870 1.00 71.34  ? 56  MET D CA    1 
ATOM   2567  C  C     . MET D 4  56  ? 164.723 172.039 138.030 1.00 71.34  ? 56  MET D C     1 
ATOM   2568  O  O     . MET D 4  56  ? 164.944 170.824 138.113 1.00 71.34  ? 56  MET D O     1 
ATOM   2569  C  CB    . MET D 4  56  ? 164.812 173.260 135.842 1.00 71.34  ? 56  MET D CB    1 
ATOM   2570  C  CG    . MET D 4  56  ? 165.822 172.326 135.308 1.00 71.34  ? 56  MET D CG    1 
ATOM   2571  S  SD    . MET D 4  56  ? 164.983 170.891 134.634 1.00 71.34  ? 56  MET D SD    1 
ATOM   2572  C  CE    . MET D 4  56  ? 164.283 171.588 133.148 1.00 71.34  ? 56  MET D CE    1 
ATOM   2573  N  N     . SER D 4  57  ? 165.141 172.903 138.957 1.00 64.74  ? 57  SER D N     1 
ATOM   2574  C  CA    . SER D 4  57  ? 165.873 172.405 140.115 1.00 64.74  ? 57  SER D CA    1 
ATOM   2575  C  C     . SER D 4  57  ? 164.964 171.648 141.075 1.00 64.74  ? 57  SER D C     1 
ATOM   2576  O  O     . SER D 4  57  ? 165.432 170.739 141.779 1.00 64.74  ? 57  SER D O     1 
ATOM   2577  C  CB    . SER D 4  57  ? 166.573 173.551 140.832 1.00 64.74  ? 57  SER D CB    1 
ATOM   2578  O  OG    . SER D 4  57  ? 167.239 173.066 141.976 1.00 64.74  ? 57  SER D OG    1 
ATOM   2579  N  N     . ILE D 4  58  ? 163.668 171.971 141.096 1.00 62.02  ? 58  ILE D N     1 
ATOM   2580  C  CA    . ILE D 4  58  ? 162.747 171.202 141.924 1.00 62.02  ? 58  ILE D CA    1 
ATOM   2581  C  C     . ILE D 4  58  ? 162.550 169.810 141.358 1.00 62.02  ? 58  ILE D C     1 
ATOM   2582  O  O     . ILE D 4  58  ? 162.566 168.824 142.104 1.00 62.02  ? 58  ILE D O     1 
ATOM   2583  C  CB    . ILE D 4  58  ? 161.420 171.959 142.106 1.00 62.02  ? 58  ILE D CB    1 
ATOM   2584  C  CG1   . ILE D 4  58  ? 161.644 173.085 143.100 1.00 62.02  ? 58  ILE D CG1   1 
ATOM   2585  C  CG2   . ILE D 4  58  ? 160.316 171.067 142.604 1.00 62.02  ? 58  ILE D CG2   1 
ATOM   2586  C  CD1   . ILE D 4  58  ? 160.476 173.951 143.331 1.00 62.02  ? 58  ILE D CD1   1 
ATOM   2587  N  N     . MET D 4  59  ? 162.407 169.699 140.035 1.00 63.51  ? 59  MET D N     1 
ATOM   2588  C  CA    . MET D 4  59  ? 162.349 168.383 139.407 1.00 63.51  ? 59  MET D CA    1 
ATOM   2589  C  C     . MET D 4  59  ? 163.634 167.610 139.629 1.00 63.51  ? 59  MET D C     1 
ATOM   2590  O  O     . MET D 4  59  ? 163.599 166.391 139.832 1.00 63.51  ? 59  MET D O     1 
ATOM   2591  C  CB    . MET D 4  59  ? 162.083 168.509 137.914 1.00 63.51  ? 59  MET D CB    1 
ATOM   2592  C  CG    . MET D 4  59  ? 160.683 168.902 137.564 1.00 63.51  ? 59  MET D CG    1 
ATOM   2593  S  SD    . MET D 4  59  ? 159.532 167.691 138.199 1.00 63.51  ? 59  MET D SD    1 
ATOM   2594  C  CE    . MET D 4  59  ? 160.064 166.251 137.293 1.00 63.51  ? 59  MET D CE    1 
ATOM   2595  N  N     . ASN D 4  60  ? 164.770 168.313 139.632 1.00 62.20  ? 60  ASN D N     1 
ATOM   2596  C  CA    . ASN D 4  60  ? 166.065 167.679 139.856 1.00 62.20  ? 60  ASN D CA    1 
ATOM   2597  C  C     . ASN D 4  60  ? 166.139 167.033 141.234 1.00 62.20  ? 60  ASN D C     1 
ATOM   2598  O  O     . ASN D 4  60  ? 166.438 165.835 141.361 1.00 62.20  ? 60  ASN D O     1 
ATOM   2599  C  CB    . ASN D 4  60  ? 167.162 168.719 139.698 1.00 62.20  ? 60  ASN D CB    1 
ATOM   2600  C  CG    . ASN D 4  60  ? 168.523 168.113 139.587 1.00 62.20  ? 60  ASN D CG    1 
ATOM   2601  O  OD1   . ASN D 4  60  ? 168.670 166.897 139.544 1.00 62.20  ? 60  ASN D OD1   1 
ATOM   2602  N  ND2   . ASN D 4  60  ? 169.545 168.961 139.560 1.00 62.20  ? 60  ASN D ND2   1 
ATOM   2603  N  N     . SER D 4  61  ? 165.832 167.803 142.279 1.00 58.42  ? 61  SER D N     1 
ATOM   2604  C  CA    . SER D 4  61  ? 165.849 167.224 143.617 1.00 58.42  ? 61  SER D CA    1 
ATOM   2605  C  C     . SER D 4  61  ? 164.703 166.252 143.842 1.00 58.42  ? 61  SER D C     1 
ATOM   2606  O  O     . SER D 4  61  ? 164.791 165.407 144.740 1.00 58.42  ? 61  SER D O     1 
ATOM   2607  C  CB    . SER D 4  61  ? 165.809 168.320 144.671 1.00 58.42  ? 61  SER D CB    1 
ATOM   2608  O  OG    . SER D 4  61  ? 167.000 169.083 144.640 1.00 58.42  ? 61  SER D OG    1 
ATOM   2609  N  N     . PHE D 4  62  ? 163.647 166.338 143.038 1.00 57.40  ? 62  PHE D N     1 
ATOM   2610  C  CA    . PHE D 4  62  ? 162.578 165.352 143.102 1.00 57.40  ? 62  PHE D CA    1 
ATOM   2611  C  C     . PHE D 4  62  ? 163.062 163.988 142.652 1.00 57.40  ? 62  PHE D C     1 
ATOM   2612  O  O     . PHE D 4  62  ? 162.812 162.972 143.317 1.00 57.40  ? 62  PHE D O     1 
ATOM   2613  C  CB    . PHE D 4  62  ? 161.403 165.793 142.241 1.00 57.40  ? 62  PHE D CB    1 
ATOM   2614  C  CG    . PHE D 4  62  ? 160.395 164.722 142.028 1.00 57.40  ? 62  PHE D CG    1 
ATOM   2615  C  CD1   . PHE D 4  62  ? 159.582 164.314 143.056 1.00 57.40  ? 62  PHE D CD1   1 
ATOM   2616  C  CD2   . PHE D 4  62  ? 160.262 164.114 140.795 1.00 57.40  ? 62  PHE D CD2   1 
ATOM   2617  C  CE1   . PHE D 4  62  ? 158.655 163.316 142.862 1.00 57.40  ? 62  PHE D CE1   1 
ATOM   2618  C  CE2   . PHE D 4  62  ? 159.334 163.111 140.598 1.00 57.40  ? 62  PHE D CE2   1 
ATOM   2619  C  CZ    . PHE D 4  62  ? 158.529 162.719 141.631 1.00 57.40  ? 62  PHE D CZ    1 
ATOM   2620  N  N     . VAL D 4  63  ? 163.748 163.943 141.516 1.00 57.12  ? 63  VAL D N     1 
ATOM   2621  C  CA    . VAL D 4  63  ? 164.171 162.655 141.004 1.00 57.12  ? 63  VAL D CA    1 
ATOM   2622  C  C     . VAL D 4  63  ? 165.357 162.129 141.814 1.00 57.12  ? 63  VAL D C     1 
ATOM   2623  O  O     . VAL D 4  63  ? 165.539 160.908 141.931 1.00 57.12  ? 63  VAL D O     1 
ATOM   2624  C  CB    . VAL D 4  63  ? 164.447 162.789 139.499 1.00 57.12  ? 63  VAL D CB    1 
ATOM   2625  C  CG1   . VAL D 4  63  ? 164.761 161.477 138.883 1.00 57.12  ? 63  VAL D CG1   1 
ATOM   2626  C  CG2   . VAL D 4  63  ? 163.238 163.336 138.813 1.00 57.12  ? 63  VAL D CG2   1 
ATOM   2627  N  N     . ASN D 4  64  ? 166.143 163.013 142.448 1.00 60.23  ? 64  ASN D N     1 
ATOM   2628  C  CA    . ASN D 4  64  ? 167.089 162.501 143.444 1.00 60.23  ? 64  ASN D CA    1 
ATOM   2629  C  C     . ASN D 4  64  ? 166.386 161.918 144.663 1.00 60.23  ? 64  ASN D C     1 
ATOM   2630  O  O     . ASN D 4  64  ? 166.858 160.917 145.217 1.00 60.23  ? 64  ASN D O     1 
ATOM   2631  C  CB    . ASN D 4  64  ? 168.078 163.567 143.900 1.00 60.23  ? 64  ASN D CB    1 
ATOM   2632  C  CG    . ASN D 4  64  ? 169.254 163.700 142.971 1.00 60.23  ? 64  ASN D CG    1 
ATOM   2633  O  OD1   . ASN D 4  64  ? 169.705 162.715 142.397 1.00 60.23  ? 64  ASN D OD1   1 
ATOM   2634  N  ND2   . ASN D 4  64  ? 169.798 164.904 142.861 1.00 60.23  ? 64  ASN D ND2   1 
ATOM   2635  N  N     . ASP D 4  65  ? 165.260 162.508 145.081 1.00 64.17  ? 65  ASP D N     1 
ATOM   2636  C  CA    . ASP D 4  65  ? 164.524 161.983 146.232 1.00 64.17  ? 65  ASP D CA    1 
ATOM   2637  C  C     . ASP D 4  65  ? 163.942 160.604 145.940 1.00 64.17  ? 65  ASP D C     1 
ATOM   2638  O  O     . ASP D 4  65  ? 164.089 159.677 146.750 1.00 64.17  ? 65  ASP D O     1 
ATOM   2639  C  CB    . ASP D 4  65  ? 163.409 162.951 146.619 1.00 64.17  ? 65  ASP D CB    1 
ATOM   2640  C  CG    . ASP D 4  65  ? 162.785 162.641 147.980 1.00 64.17  ? 65  ASP D CG    1 
ATOM   2641  O  OD1   . ASP D 4  65  ? 163.222 161.696 148.669 1.00 64.17  ? 65  ASP D OD1   1 
ATOM   2642  O  OD2   . ASP D 4  65  ? 161.836 163.359 148.366 1.00 64.17  ? 65  ASP D OD2   1 
ATOM   2643  N  N     . VAL D 4  66  ? 163.266 160.457 144.801 1.00 59.64  ? 66  VAL D N     1 
ATOM   2644  C  CA    . VAL D 4  66  ? 162.692 159.162 144.446 1.00 59.64  ? 66  VAL D CA    1 
ATOM   2645  C  C     . VAL D 4  66  ? 163.787 158.139 144.194 1.00 59.64  ? 66  VAL D C     1 
ATOM   2646  O  O     . VAL D 4  66  ? 163.648 156.963 144.560 1.00 59.64  ? 66  VAL D O     1 
ATOM   2647  C  CB    . VAL D 4  66  ? 161.758 159.334 143.239 1.00 59.64  ? 66  VAL D CB    1 
ATOM   2648  C  CG1   . VAL D 4  66  ? 161.262 158.008 142.709 1.00 59.64  ? 66  VAL D CG1   1 
ATOM   2649  C  CG2   . VAL D 4  66  ? 160.593 160.190 143.639 1.00 59.64  ? 66  VAL D CG2   1 
ATOM   2650  N  N     . PHE D 4  67  ? 164.910 158.582 143.628 1.00 60.97  ? 67  PHE D N     1 
ATOM   2651  C  CA    . PHE D 4  67  ? 166.044 157.699 143.408 1.00 60.97  ? 67  PHE D CA    1 
ATOM   2652  C  C     . PHE D 4  67  ? 166.600 157.162 144.718 1.00 60.97  ? 67  PHE D C     1 
ATOM   2653  O  O     . PHE D 4  67  ? 166.961 155.983 144.811 1.00 60.97  ? 67  PHE D O     1 
ATOM   2654  C  CB    . PHE D 4  67  ? 167.116 158.451 142.645 1.00 60.97  ? 67  PHE D CB    1 
ATOM   2655  C  CG    . PHE D 4  67  ? 168.328 157.645 142.360 1.00 60.97  ? 67  PHE D CG    1 
ATOM   2656  C  CD1   . PHE D 4  67  ? 168.310 156.688 141.377 1.00 60.97  ? 67  PHE D CD1   1 
ATOM   2657  C  CD2   . PHE D 4  67  ? 169.498 157.865 143.064 1.00 60.97  ? 67  PHE D CD2   1 
ATOM   2658  C  CE1   . PHE D 4  67  ? 169.428 155.966 141.104 1.00 60.97  ? 67  PHE D CE1   1 
ATOM   2659  C  CE2   . PHE D 4  67  ? 170.622 157.133 142.796 1.00 60.97  ? 67  PHE D CE2   1 
ATOM   2660  C  CZ    . PHE D 4  67  ? 170.580 156.180 141.818 1.00 60.97  ? 67  PHE D CZ    1 
ATOM   2661  N  N     . GLU D 4  68  ? 166.629 157.993 145.759 1.00 67.01  ? 68  GLU D N     1 
ATOM   2662  C  CA    . GLU D 4  68  ? 167.147 157.496 147.028 1.00 67.01  ? 68  GLU D CA    1 
ATOM   2663  C  C     . GLU D 4  68  ? 166.117 156.698 147.810 1.00 67.01  ? 68  GLU D C     1 
ATOM   2664  O  O     . GLU D 4  68  ? 166.495 155.848 148.623 1.00 67.01  ? 68  GLU D O     1 
ATOM   2665  C  CB    . GLU D 4  68  ? 167.678 158.637 147.892 1.00 67.01  ? 68  GLU D CB    1 
ATOM   2666  C  CG    . GLU D 4  68  ? 168.868 159.326 147.274 1.00 67.01  ? 68  GLU D CG    1 
ATOM   2667  C  CD    . GLU D 4  68  ? 170.028 158.388 147.068 1.00 67.01  ? 68  GLU D CD    1 
ATOM   2668  O  OE1   . GLU D 4  68  ? 170.262 157.521 147.929 1.00 67.01  ? 68  GLU D OE1   1 
ATOM   2669  O  OE2   . GLU D 4  68  ? 170.690 158.497 146.022 1.00 67.01  ? 68  GLU D OE2   1 
ATOM   2670  N  N     . ARG D 4  69  ? 164.824 156.960 147.601 1.00 65.11  ? 69  ARG D N     1 
ATOM   2671  C  CA    . ARG D 4  69  ? 163.816 156.096 148.202 1.00 65.11  ? 69  ARG D CA    1 
ATOM   2672  C  C     . ARG D 4  69  ? 163.864 154.700 147.603 1.00 65.11  ? 69  ARG D C     1 
ATOM   2673  O  O     . ARG D 4  69  ? 163.838 153.707 148.334 1.00 65.11  ? 69  ARG D O     1 
ATOM   2674  C  CB    . ARG D 4  69  ? 162.423 156.685 148.034 1.00 65.11  ? 69  ARG D CB    1 
ATOM   2675  C  CG    . ARG D 4  69  ? 162.084 157.818 148.969 1.00 65.11  ? 69  ARG D CG    1 
ATOM   2676  C  CD    . ARG D 4  69  ? 160.663 158.292 148.689 1.00 65.11  ? 69  ARG D CD    1 
ATOM   2677  N  NE    . ARG D 4  69  ? 160.258 159.415 149.525 1.00 65.11  ? 69  ARG D NE    1 
ATOM   2678  C  CZ    . ARG D 4  69  ? 159.095 160.043 149.403 1.00 65.11  ? 69  ARG D CZ    1 
ATOM   2679  N  NH1   . ARG D 4  69  ? 158.239 159.655 148.476 1.00 65.11  ? 69  ARG D NH1   1 
ATOM   2680  N  NH2   . ARG D 4  69  ? 158.788 161.055 150.200 1.00 65.11  ? 69  ARG D NH2   1 
ATOM   2681  N  N     . ILE D 4  70  ? 163.960 154.601 146.275 1.00 63.26  ? 70  ILE D N     1 
ATOM   2682  C  CA    . ILE D 4  70  ? 163.910 153.289 145.635 1.00 63.26  ? 70  ILE D CA    1 
ATOM   2683  C  C     . ILE D 4  70  ? 165.218 152.536 145.837 1.00 63.26  ? 70  ILE D C     1 
ATOM   2684  O  O     . ILE D 4  70  ? 165.218 151.330 146.113 1.00 63.26  ? 70  ILE D O     1 
ATOM   2685  C  CB    . ILE D 4  70  ? 163.558 153.422 144.147 1.00 63.26  ? 70  ILE D CB    1 
ATOM   2686  C  CG1   . ILE D 4  70  ? 162.178 154.035 143.983 1.00 63.26  ? 70  ILE D CG1   1 
ATOM   2687  C  CG2   . ILE D 4  70  ? 163.540 152.078 143.488 1.00 63.26  ? 70  ILE D CG2   1 
ATOM   2688  C  CD1   . ILE D 4  70  ? 161.835 154.352 142.571 1.00 63.26  ? 70  ILE D CD1   1 
ATOM   2689  N  N     . ALA D 4  71  ? 166.355 153.229 145.722 1.00 67.51  ? 71  ALA D N     1 
ATOM   2690  C  CA    . ALA D 4  71  ? 167.631 152.579 146.010 1.00 67.51  ? 71  ALA D CA    1 
ATOM   2691  C  C     . ALA D 4  71  ? 167.744 152.190 147.478 1.00 67.51  ? 71  ALA D C     1 
ATOM   2692  O  O     . ALA D 4  71  ? 168.298 151.130 147.800 1.00 67.51  ? 71  ALA D O     1 
ATOM   2693  C  CB    . ALA D 4  71  ? 168.786 153.491 145.611 1.00 67.51  ? 71  ALA D CB    1 
ATOM   2694  N  N     . GLY D 4  72  ? 167.196 153.013 148.373 1.00 69.53  ? 72  GLY D N     1 
ATOM   2695  C  CA    . GLY D 4  72  ? 167.199 152.658 149.782 1.00 69.53  ? 72  GLY D CA    1 
ATOM   2696  C  C     . GLY D 4  72  ? 166.337 151.449 150.080 1.00 69.53  ? 72  GLY D C     1 
ATOM   2697  O  O     . GLY D 4  72  ? 166.740 150.561 150.838 1.00 69.53  ? 72  GLY D O     1 
ATOM   2698  N  N     . GLU D 4  73  ? 165.144 151.393 149.485 1.00 69.65  ? 73  GLU D N     1 
ATOM   2699  C  CA    . GLU D 4  73  ? 164.290 150.222 149.643 1.00 69.65  ? 73  GLU D CA    1 
ATOM   2700  C  C     . GLU D 4  73  ? 164.910 148.983 149.020 1.00 69.65  ? 73  GLU D C     1 
ATOM   2701  O  O     . GLU D 4  73  ? 164.673 147.868 149.498 1.00 69.65  ? 73  GLU D O     1 
ATOM   2702  C  CB    . GLU D 4  73  ? 162.920 150.477 149.027 1.00 69.65  ? 73  GLU D CB    1 
ATOM   2703  C  CG    . GLU D 4  73  ? 162.049 151.407 149.811 1.00 69.65  ? 73  GLU D CG    1 
ATOM   2704  C  CD    . GLU D 4  73  ? 161.584 150.794 151.099 1.00 69.65  ? 73  GLU D CD    1 
ATOM   2705  O  OE1   . GLU D 4  73  ? 161.447 149.554 151.149 1.00 69.65  ? 73  GLU D OE1   1 
ATOM   2706  O  OE2   . GLU D 4  73  ? 161.349 151.554 152.059 1.00 69.65  ? 73  GLU D OE2   1 
ATOM   2707  N  N     . ALA D 4  74  ? 165.697 149.154 147.960 1.00 70.38  ? 74  ALA D N     1 
ATOM   2708  C  CA    . ALA D 4  74  ? 166.447 148.029 147.429 1.00 70.38  ? 74  ALA D CA    1 
ATOM   2709  C  C     . ALA D 4  74  ? 167.503 147.568 148.413 1.00 70.38  ? 74  ALA D C     1 
ATOM   2710  O  O     . ALA D 4  74  ? 167.794 146.371 148.490 1.00 70.38  ? 74  ALA D O     1 
ATOM   2711  C  CB    . ALA D 4  74  ? 167.088 148.402 146.103 1.00 70.38  ? 74  ALA D CB    1 
ATOM   2712  N  N     . SER D 4  75  ? 168.072 148.498 149.184 1.00 71.34  ? 75  SER D N     1 
ATOM   2713  C  CA    . SER D 4  75  ? 169.048 148.095 150.189 1.00 71.34  ? 75  SER D CA    1 
ATOM   2714  C  C     . SER D 4  75  ? 168.385 147.345 151.327 1.00 71.34  ? 75  SER D C     1 
ATOM   2715  O  O     . SER D 4  75  ? 168.877 146.292 151.753 1.00 71.34  ? 75  SER D O     1 
ATOM   2716  C  CB    . SER D 4  75  ? 169.799 149.306 150.729 1.00 71.34  ? 75  SER D CB    1 
ATOM   2717  O  OG    . SER D 4  75  ? 170.707 148.902 151.738 1.00 71.34  ? 75  SER D OG    1 
ATOM   2718  N  N     . ARG D 4  76  ? 167.254 147.859 151.818 1.00 72.78  ? 76  ARG D N     1 
ATOM   2719  C  CA    . ARG D 4  76  ? 166.583 147.216 152.941 1.00 72.78  ? 76  ARG D CA    1 
ATOM   2720  C  C     . ARG D 4  76  ? 165.946 145.907 152.518 1.00 72.78  ? 76  ARG D C     1 
ATOM   2721  O  O     . ARG D 4  76  ? 165.729 145.022 153.349 1.00 72.78  ? 76  ARG D O     1 
ATOM   2722  C  CB    . ARG D 4  76  ? 165.514 148.130 153.525 1.00 72.78  ? 76  ARG D CB    1 
ATOM   2723  C  CG    . ARG D 4  76  ? 166.021 149.421 154.085 1.00 72.78  ? 76  ARG D CG    1 
ATOM   2724  C  CD    . ARG D 4  76  ? 164.858 150.267 154.524 1.00 72.78  ? 76  ARG D CD    1 
ATOM   2725  N  NE    . ARG D 4  76  ? 165.294 151.596 154.919 1.00 72.78  ? 76  ARG D NE    1 
ATOM   2726  C  CZ    . ARG D 4  76  ? 165.392 152.616 154.078 1.00 72.78  ? 76  ARG D CZ    1 
ATOM   2727  N  NH1   . ARG D 4  76  ? 165.079 152.453 152.807 1.00 72.78  ? 76  ARG D NH1   1 
ATOM   2728  N  NH2   . ARG D 4  76  ? 165.796 153.800 154.506 1.00 72.78  ? 76  ARG D NH2   1 
ATOM   2729  N  N     . LEU D 4  77  ? 165.641 145.764 151.230 1.00 73.94  ? 77  LEU D N     1 
ATOM   2730  C  CA    . LEU D 4  77  ? 165.034 144.530 150.772 1.00 73.94  ? 77  LEU D CA    1 
ATOM   2731  C  C     . LEU D 4  77  ? 166.075 143.477 150.462 1.00 73.94  ? 77  LEU D C     1 
ATOM   2732  O  O     . LEU D 4  77  ? 165.832 142.290 150.688 1.00 73.94  ? 77  LEU D O     1 
ATOM   2733  C  CB    . LEU D 4  77  ? 164.165 144.797 149.555 1.00 73.94  ? 77  LEU D CB    1 
ATOM   2734  C  CG    . LEU D 4  77  ? 163.216 143.669 149.169 1.00 73.94  ? 77  LEU D CG    1 
ATOM   2735  C  CD1   . LEU D 4  77  ? 161.930 144.301 148.744 1.00 73.94  ? 77  LEU D CD1   1 
ATOM   2736  C  CD2   . LEU D 4  77  ? 163.747 142.855 148.023 1.00 73.94  ? 77  LEU D CD2   1 
ATOM   2737  N  N     . ALA D 4  78  ? 167.222 143.876 149.920 1.00 73.56  ? 78  ALA D N     1 
ATOM   2738  C  CA    . ALA D 4  78  ? 168.297 142.914 149.743 1.00 73.56  ? 78  ALA D CA    1 
ATOM   2739  C  C     . ALA D 4  78  ? 168.894 142.500 151.078 1.00 73.56  ? 78  ALA D C     1 
ATOM   2740  O  O     . ALA D 4  78  ? 169.403 141.382 151.211 1.00 73.56  ? 78  ALA D O     1 
ATOM   2741  C  CB    . ALA D 4  78  ? 169.378 143.491 148.842 1.00 73.56  ? 78  ALA D CB    1 
ATOM   2742  N  N     . HIS D 4  79  ? 168.792 143.356 152.090 1.00 76.98  ? 79  HIS D N     1 
ATOM   2743  C  CA    . HIS D 4  79  ? 169.402 143.090 153.384 1.00 76.98  ? 79  HIS D CA    1 
ATOM   2744  C  C     . HIS D 4  79  ? 168.562 142.141 154.245 1.00 76.98  ? 79  HIS D C     1 
ATOM   2745  O  O     . HIS D 4  79  ? 168.849 141.955 155.428 1.00 76.98  ? 79  HIS D O     1 
ATOM   2746  C  CB    . HIS D 4  79  ? 169.655 144.426 154.095 1.00 76.98  ? 79  HIS D CB    1 
ATOM   2747  C  CG    . HIS D 4  79  ? 170.627 144.347 155.232 1.00 76.98  ? 79  HIS D CG    1 
ATOM   2748  N  ND1   . HIS D 4  79  ? 171.959 144.049 155.052 1.00 76.98  ? 79  HIS D ND1   1 
ATOM   2749  C  CD2   . HIS D 4  79  ? 170.465 144.555 156.558 1.00 76.98  ? 79  HIS D CD2   1 
ATOM   2750  C  CE1   . HIS D 4  79  ? 172.573 144.058 156.221 1.00 76.98  ? 79  HIS D CE1   1 
ATOM   2751  N  NE2   . HIS D 4  79  ? 171.688 144.364 157.151 1.00 76.98  ? 79  HIS D NE2   1 
ATOM   2752  N  N     . TYR D 4  80  ? 167.546 141.506 153.675 1.00 79.50  ? 80  TYR D N     1 
ATOM   2753  C  CA    . TYR D 4  80  ? 166.740 140.534 154.394 1.00 79.50  ? 80  TYR D CA    1 
ATOM   2754  C  C     . TYR D 4  80  ? 166.907 139.125 153.875 1.00 79.50  ? 80  TYR D C     1 
ATOM   2755  O  O     . TYR D 4  80  ? 166.881 138.185 154.665 1.00 79.50  ? 80  TYR D O     1 
ATOM   2756  C  CB    . TYR D 4  80  ? 165.255 140.904 154.315 1.00 79.50  ? 80  TYR D CB    1 
ATOM   2757  C  CG    . TYR D 4  80  ? 164.882 142.183 155.035 1.00 79.50  ? 80  TYR D CG    1 
ATOM   2758  C  CD1   . TYR D 4  80  ? 165.685 142.703 156.042 1.00 79.50  ? 80  TYR D CD1   1 
ATOM   2759  C  CD2   . TYR D 4  80  ? 163.741 142.895 154.670 1.00 79.50  ? 80  TYR D CD2   1 
ATOM   2760  C  CE1   . TYR D 4  80  ? 165.351 143.869 156.686 1.00 79.50  ? 80  TYR D CE1   1 
ATOM   2761  C  CE2   . TYR D 4  80  ? 163.406 144.077 155.303 1.00 79.50  ? 80  TYR D CE2   1 
ATOM   2762  C  CZ    . TYR D 4  80  ? 164.211 144.550 156.317 1.00 79.50  ? 80  TYR D CZ    1 
ATOM   2763  O  OH    . TYR D 4  80  ? 163.889 145.714 156.962 1.00 79.50  ? 80  TYR D OH    1 
ATOM   2764  N  N     . ASN D 4  81  ? 167.087 138.951 152.572 1.00 79.71  ? 81  ASN D N     1 
ATOM   2765  C  CA    . ASN D 4  81  ? 167.085 137.633 151.965 1.00 79.71  ? 81  ASN D CA    1 
ATOM   2766  C  C     . ASN D 4  81  ? 168.464 136.999 151.914 1.00 79.71  ? 81  ASN D C     1 
ATOM   2767  O  O     . ASN D 4  81  ? 168.661 136.063 151.131 1.00 79.71  ? 81  ASN D O     1 
ATOM   2768  C  CB    . ASN D 4  81  ? 166.508 137.715 150.557 1.00 79.71  ? 81  ASN D CB    1 
ATOM   2769  C  CG    . ASN D 4  81  ? 165.068 138.102 150.555 1.00 79.71  ? 81  ASN D CG    1 
ATOM   2770  O  OD1   . ASN D 4  81  ? 164.295 137.644 151.386 1.00 79.71  ? 81  ASN D OD1   1 
ATOM   2771  N  ND2   . ASN D 4  81  ? 164.696 138.962 149.626 1.00 79.71  ? 81  ASN D ND2   1 
ATOM   2772  N  N     . LYS D 4  82  ? 169.409 137.493 152.725 1.00 84.33  ? 82  LYS D N     1 
ATOM   2773  C  CA    . LYS D 4  82  ? 170.816 137.065 152.736 1.00 84.33  ? 82  LYS D CA    1 
ATOM   2774  C  C     . LYS D 4  82  ? 171.446 137.187 151.352 1.00 84.33  ? 82  LYS D C     1 
ATOM   2775  O  O     . LYS D 4  82  ? 172.249 136.352 150.934 1.00 84.33  ? 82  LYS D O     1 
ATOM   2776  C  CB    . LYS D 4  82  ? 170.979 135.641 153.270 1.00 84.33  ? 82  LYS D CB    1 
ATOM   2777  C  CG    . LYS D 4  82  ? 170.522 135.427 154.694 1.00 84.33  ? 82  LYS D CG    1 
ATOM   2778  C  CD    . LYS D 4  82  ? 170.941 134.042 155.150 1.00 84.33  ? 82  LYS D CD    1 
ATOM   2779  C  CE    . LYS D 4  82  ? 170.169 132.960 154.412 1.00 84.33  ? 82  LYS D CE    1 
ATOM   2780  N  NZ    . LYS D 4  82  ? 170.481 131.593 154.905 1.00 84.33  ? 82  LYS D NZ    1 
ATOM   2781  N  N     . ARG D 4  83  ? 171.067 138.230 150.624 1.00 87.79  ? 83  ARG D N     1 
ATOM   2782  C  CA    . ARG D 4  83  ? 171.580 138.461 149.288 1.00 87.79  ? 83  ARG D CA    1 
ATOM   2783  C  C     . ARG D 4  83  ? 172.265 139.816 149.221 1.00 87.79  ? 83  ARG D C     1 
ATOM   2784  O  O     . ARG D 4  83  ? 171.878 140.763 149.909 1.00 87.79  ? 83  ARG D O     1 
ATOM   2785  C  CB    . ARG D 4  83  ? 170.471 138.369 148.251 1.00 87.79  ? 83  ARG D CB    1 
ATOM   2786  C  CG    . ARG D 4  83  ? 170.055 136.946 148.037 1.00 87.79  ? 83  ARG D CG    1 
ATOM   2787  C  CD    . ARG D 4  83  ? 168.946 136.808 147.036 1.00 87.79  ? 83  ARG D CD    1 
ATOM   2788  N  NE    . ARG D 4  83  ? 168.703 135.401 146.737 1.00 87.79  ? 83  ARG D NE    1 
ATOM   2789  C  CZ    . ARG D 4  83  ? 167.890 134.614 147.430 1.00 87.79  ? 83  ARG D CZ    1 
ATOM   2790  N  NH1   . ARG D 4  83  ? 167.232 135.090 148.474 1.00 87.79  ? 83  ARG D NH1   1 
ATOM   2791  N  NH2   . ARG D 4  83  ? 167.738 133.351 147.076 1.00 87.79  ? 83  ARG D NH2   1 
ATOM   2792  N  N     . SER D 4  84  ? 173.294 139.889 148.391 1.00 87.58  ? 84  SER D N     1 
ATOM   2793  C  CA    . SER D 4  84  ? 174.137 141.067 148.277 1.00 87.58  ? 84  SER D CA    1 
ATOM   2794  C  C     . SER D 4  84  ? 174.206 141.558 146.839 1.00 87.58  ? 84  SER D C     1 
ATOM   2795  O  O     . SER D 4  84  ? 175.245 142.023 146.376 1.00 87.58  ? 84  SER D O     1 
ATOM   2796  C  CB    . SER D 4  84  ? 175.531 140.766 148.808 1.00 87.58  ? 84  SER D CB    1 
ATOM   2797  O  OG    . SER D 4  84  ? 176.127 139.748 148.035 1.00 87.58  ? 84  SER D OG    1 
ATOM   2798  N  N     . THR D 4  85  ? 173.088 141.474 146.123 1.00 86.10  ? 85  THR D N     1 
ATOM   2799  C  CA    . THR D 4  85  ? 173.033 141.823 144.711 1.00 86.10  ? 85  THR D CA    1 
ATOM   2800  C  C     . THR D 4  85  ? 171.699 142.490 144.424 1.00 86.10  ? 85  THR D C     1 
ATOM   2801  O  O     . THR D 4  85  ? 170.656 141.995 144.854 1.00 86.10  ? 85  THR D O     1 
ATOM   2802  C  CB    . THR D 4  85  ? 173.212 140.580 143.829 1.00 86.10  ? 85  THR D CB    1 
ATOM   2803  O  OG1   . THR D 4  85  ? 174.452 139.941 144.151 1.00 86.10  ? 85  THR D OG1   1 
ATOM   2804  C  CG2   . THR D 4  85  ? 173.229 140.948 142.360 1.00 86.10  ? 85  THR D CG2   1 
ATOM   2805  N  N     . ILE D 4  86  ? 171.731 143.613 143.727 1.00 76.06  ? 86  ILE D N     1 
ATOM   2806  C  CA    . ILE D 4  86  ? 170.529 144.342 143.366 1.00 76.06  ? 86  ILE D CA    1 
ATOM   2807  C  C     . ILE D 4  86  ? 170.315 144.128 141.875 1.00 76.06  ? 86  ILE D C     1 
ATOM   2808  O  O     . ILE D 4  86  ? 170.904 144.828 141.044 1.00 76.06  ? 86  ILE D O     1 
ATOM   2809  C  CB    . ILE D 4  86  ? 170.640 145.826 143.717 1.00 76.06  ? 86  ILE D CB    1 
ATOM   2810  C  CG1   . ILE D 4  86  ? 170.888 145.984 145.209 1.00 76.06  ? 86  ILE D CG1   1 
ATOM   2811  C  CG2   . ILE D 4  86  ? 169.372 146.551 143.383 1.00 76.06  ? 86  ILE D CG2   1 
ATOM   2812  C  CD1   . ILE D 4  86  ? 171.185 147.387 145.633 1.00 76.06  ? 86  ILE D CD1   1 
ATOM   2813  N  N     . THR D 4  87  ? 169.487 143.148 141.530 1.00 82.11  ? 87  THR D N     1 
ATOM   2814  C  CA    . THR D 4  87  ? 169.060 142.943 140.155 1.00 82.11  ? 87  THR D CA    1 
ATOM   2815  C  C     . THR D 4  87  ? 167.793 143.758 139.915 1.00 82.11  ? 87  THR D C     1 
ATOM   2816  O  O     . THR D 4  87  ? 167.341 144.501 140.787 1.00 82.11  ? 87  THR D O     1 
ATOM   2817  C  CB    . THR D 4  87  ? 168.832 141.462 139.882 1.00 82.11  ? 87  THR D CB    1 
ATOM   2818  O  OG1   . THR D 4  87  ? 167.729 141.002 140.670 1.00 82.11  ? 87  THR D OG1   1 
ATOM   2819  C  CG2   . THR D 4  87  ? 170.071 140.671 140.253 1.00 82.11  ? 87  THR D CG2   1 
ATOM   2820  N  N     . SER D 4  88  ? 167.190 143.616 138.736 1.00 84.57  ? 88  SER D N     1 
ATOM   2821  C  CA    . SER D 4  88  ? 166.015 144.416 138.419 1.00 84.57  ? 88  SER D CA    1 
ATOM   2822  C  C     . SER D 4  88  ? 164.781 143.965 139.174 1.00 84.57  ? 88  SER D C     1 
ATOM   2823  O  O     . SER D 4  88  ? 163.864 144.767 139.370 1.00 84.57  ? 88  SER D O     1 
ATOM   2824  C  CB    . SER D 4  88  ? 165.713 144.353 136.929 1.00 84.57  ? 88  SER D CB    1 
ATOM   2825  O  OG    . SER D 4  88  ? 165.220 143.074 136.595 1.00 84.57  ? 88  SER D OG    1 
ATOM   2826  N  N     . ARG D 4  89  ? 164.735 142.702 139.583 1.00 80.54  ? 89  ARG D N     1 
ATOM   2827  C  CA    . ARG D 4  89  ? 163.547 142.169 140.233 1.00 80.54  ? 89  ARG D CA    1 
ATOM   2828  C  C     . ARG D 4  89  ? 163.328 142.801 141.599 1.00 80.54  ? 89  ARG D C     1 
ATOM   2829  O  O     . ARG D 4  89  ? 162.182 143.029 142.008 1.00 80.54  ? 89  ARG D O     1 
ATOM   2830  C  CB    . ARG D 4  89  ? 163.690 140.661 140.344 1.00 80.54  ? 89  ARG D CB    1 
ATOM   2831  C  CG    . ARG D 4  89  ? 162.517 139.946 140.904 1.00 80.54  ? 89  ARG D CG    1 
ATOM   2832  C  CD    . ARG D 4  89  ? 162.836 138.483 140.959 1.00 80.54  ? 89  ARG D CD    1 
ATOM   2833  N  NE    . ARG D 4  89  ? 161.713 137.719 141.470 1.00 80.54  ? 89  ARG D NE    1 
ATOM   2834  C  CZ    . ARG D 4  89  ? 161.523 137.458 142.753 1.00 80.54  ? 89  ARG D CZ    1 
ATOM   2835  N  NH1   . ARG D 4  89  ? 162.392 137.897 143.653 1.00 80.54  ? 89  ARG D NH1   1 
ATOM   2836  N  NH2   . ARG D 4  89  ? 160.467 136.756 143.133 1.00 80.54  ? 89  ARG D NH2   1 
ATOM   2837  N  N     . GLU D 4  90  ? 164.417 143.119 142.298 1.00 81.90  ? 90  GLU D N     1 
ATOM   2838  C  CA    . GLU D 4  90  ? 164.311 143.834 143.560 1.00 81.90  ? 90  GLU D CA    1 
ATOM   2839  C  C     . GLU D 4  90  ? 163.804 145.242 143.351 1.00 81.90  ? 90  GLU D C     1 
ATOM   2840  O  O     . GLU D 4  90  ? 163.084 145.774 144.202 1.00 81.90  ? 90  GLU D O     1 
ATOM   2841  C  CB    . GLU D 4  90  ? 165.664 143.872 144.259 1.00 81.90  ? 90  GLU D CB    1 
ATOM   2842  C  CG    . GLU D 4  90  ? 166.130 142.533 144.778 1.00 81.90  ? 90  GLU D CG    1 
ATOM   2843  C  CD    . GLU D 4  90  ? 166.823 141.700 143.725 1.00 81.90  ? 90  GLU D CD    1 
ATOM   2844  O  OE1   . GLU D 4  90  ? 167.010 142.202 142.600 1.00 81.90  ? 90  GLU D OE1   1 
ATOM   2845  O  OE2   . GLU D 4  90  ? 167.162 140.535 144.010 1.00 81.90  ? 90  GLU D OE2   1 
ATOM   2846  N  N     . ILE D 4  91  ? 164.159 145.856 142.228 1.00 78.73  ? 91  ILE D N     1 
ATOM   2847  C  CA    . ILE D 4  91  ? 163.612 147.165 141.932 1.00 78.73  ? 91  ILE D CA    1 
ATOM   2848  C  C     . ILE D 4  91  ? 162.135 147.039 141.587 1.00 78.73  ? 91  ILE D C     1 
ATOM   2849  O  O     . ILE D 4  91  ? 161.349 147.946 141.876 1.00 78.73  ? 91  ILE D O     1 
ATOM   2850  C  CB    . ILE D 4  91  ? 164.406 147.831 140.802 1.00 78.73  ? 91  ILE D CB    1 
ATOM   2851  C  CG1   . ILE D 4  91  ? 165.900 147.720 141.062 1.00 78.73  ? 91  ILE D CG1   1 
ATOM   2852  C  CG2   . ILE D 4  91  ? 164.077 149.303 140.725 1.00 78.73  ? 91  ILE D CG2   1 
ATOM   2853  C  CD1   . ILE D 4  91  ? 166.364 148.446 142.282 1.00 78.73  ? 91  ILE D CD1   1 
ATOM   2854  N  N     . GLN D 4  92  ? 161.722 145.906 141.003 1.00 84.27  ? 92  GLN D N     1 
ATOM   2855  C  CA    . GLN D 4  92  ? 160.303 145.676 140.736 1.00 84.27  ? 92  GLN D CA    1 
ATOM   2856  C  C     . GLN D 4  92  ? 159.508 145.570 142.028 1.00 84.27  ? 92  GLN D C     1 
ATOM   2857  O  O     . GLN D 4  92  ? 158.439 146.183 142.167 1.00 84.27  ? 92  GLN D O     1 
ATOM   2858  C  CB    . GLN D 4  92  ? 160.106 144.411 139.903 1.00 84.27  ? 92  GLN D CB    1 
ATOM   2859  C  CG    . GLN D 4  92  ? 158.639 144.090 139.669 1.00 84.27  ? 92  GLN D CG    1 
ATOM   2860  C  CD    . GLN D 4  92  ? 158.428 142.865 138.823 1.00 84.27  ? 92  GLN D CD    1 
ATOM   2861  O  OE1   . GLN D 4  92  ? 159.380 142.222 138.394 1.00 84.27  ? 92  GLN D OE1   1 
ATOM   2862  N  NE2   . GLN D 4  92  ? 157.171 142.523 138.591 1.00 84.27  ? 92  GLN D NE2   1 
ATOM   2863  N  N     . THR D 4  93  ? 160.020 144.802 142.986 1.00 82.34  ? 93  THR D N     1 
ATOM   2864  C  CA    . THR D 4  93  ? 159.336 144.670 144.262 1.00 82.34  ? 93  THR D CA    1 
ATOM   2865  C  C     . THR D 4  93  ? 159.314 145.989 145.020 1.00 82.34  ? 93  THR D C     1 
ATOM   2866  O  O     . THR D 4  93  ? 158.266 146.391 145.542 1.00 82.34  ? 93  THR D O     1 
ATOM   2867  C  CB    . THR D 4  93  ? 160.012 143.583 145.084 1.00 82.34  ? 93  THR D CB    1 
ATOM   2868  O  OG1   . THR D 4  93  ? 159.984 142.355 144.350 1.00 82.34  ? 93  THR D OG1   1 
ATOM   2869  C  CG2   . THR D 4  93  ? 159.289 143.389 146.376 1.00 82.34  ? 93  THR D CG2   1 
ATOM   2870  N  N     . ALA D 4  94  ? 160.444 146.701 145.044 1.00 79.42  ? 94  ALA D N     1 
ATOM   2871  C  CA    . ALA D 4  94  ? 160.526 147.940 145.809 1.00 79.42  ? 94  ALA D CA    1 
ATOM   2872  C  C     . ALA D 4  94  ? 159.674 149.041 145.200 1.00 79.42  ? 94  ALA D C     1 
ATOM   2873  O  O     . ALA D 4  94  ? 159.123 149.871 145.934 1.00 79.42  ? 94  ALA D O     1 
ATOM   2874  C  CB    . ALA D 4  94  ? 161.978 148.393 145.917 1.00 79.42  ? 94  ALA D CB    1 
ATOM   2875  N  N     . VAL D 4  95  ? 159.534 149.055 143.876 1.00 79.48  ? 95  VAL D N     1 
ATOM   2876  C  CA    . VAL D 4  95  ? 158.563 149.950 143.266 1.00 79.48  ? 95  VAL D CA    1 
ATOM   2877  C  C     . VAL D 4  95  ? 157.151 149.517 143.630 1.00 79.48  ? 95  VAL D C     1 
ATOM   2878  O  O     . VAL D 4  95  ? 156.308 150.351 143.987 1.00 79.48  ? 95  VAL D O     1 
ATOM   2879  C  CB    . VAL D 4  95  ? 158.784 150.024 141.747 1.00 79.48  ? 95  VAL D CB    1 
ATOM   2880  C  CG1   . VAL D 4  95  ? 157.603 150.655 141.059 1.00 79.48  ? 95  VAL D CG1   1 
ATOM   2881  C  CG2   . VAL D 4  95  ? 159.987 150.875 141.468 1.00 79.48  ? 95  VAL D CG2   1 
ATOM   2882  N  N     . ARG D 4  96  ? 156.898 148.207 143.666 1.00 82.45  ? 96  ARG D N     1 
ATOM   2883  C  CA    . ARG D 4  96  ? 155.585 147.735 144.107 1.00 82.45  ? 96  ARG D CA    1 
ATOM   2884  C  C     . ARG D 4  96  ? 155.355 147.885 145.603 1.00 82.45  ? 96  ARG D C     1 
ATOM   2885  O  O     . ARG D 4  96  ? 154.276 147.519 146.070 1.00 82.45  ? 96  ARG D O     1 
ATOM   2886  C  CB    . ARG D 4  96  ? 155.375 146.278 143.696 1.00 82.45  ? 96  ARG D CB    1 
ATOM   2887  C  CG    . ARG D 4  96  ? 155.096 146.133 142.223 1.00 82.45  ? 96  ARG D CG    1 
ATOM   2888  C  CD    . ARG D 4  96  ? 155.081 144.695 141.751 1.00 82.45  ? 96  ARG D CD    1 
ATOM   2889  N  NE    . ARG D 4  96  ? 153.980 143.910 142.287 1.00 82.45  ? 96  ARG D NE    1 
ATOM   2890  C  CZ    . ARG D 4  96  ? 153.840 142.607 142.078 1.00 82.45  ? 96  ARG D CZ    1 
ATOM   2891  N  NH1   . ARG D 4  96  ? 154.724 141.953 141.337 1.00 82.45  ? 96  ARG D NH1   1 
ATOM   2892  N  NH2   . ARG D 4  96  ? 152.816 141.952 142.599 1.00 82.45  ? 96  ARG D NH2   1 
ATOM   2893  N  N     . LEU D 4  97  ? 156.312 148.404 146.361 1.00 78.42  ? 97  LEU D N     1 
ATOM   2894  C  CA    . LEU D 4  97  ? 156.037 148.844 147.716 1.00 78.42  ? 97  LEU D CA    1 
ATOM   2895  C  C     . LEU D 4  97  ? 155.952 150.351 147.856 1.00 78.42  ? 97  LEU D C     1 
ATOM   2896  O  O     . LEU D 4  97  ? 155.205 150.833 148.713 1.00 78.42  ? 97  LEU D O     1 
ATOM   2897  C  CB    . LEU D 4  97  ? 157.101 148.324 148.676 1.00 78.42  ? 97  LEU D CB    1 
ATOM   2898  C  CG    . LEU D 4  97  ? 157.012 146.828 148.908 1.00 78.42  ? 97  LEU D CG    1 
ATOM   2899  C  CD1   . LEU D 4  97  ? 158.120 146.393 149.838 1.00 78.42  ? 97  LEU D CD1   1 
ATOM   2900  C  CD2   . LEU D 4  97  ? 155.650 146.475 149.473 1.00 78.42  ? 97  LEU D CD2   1 
ATOM   2901  N  N     . LEU D 4  98  ? 156.691 151.124 147.062 1.00 78.09  ? 98  LEU D N     1 
ATOM   2902  C  CA    . LEU D 4  98  ? 156.620 152.570 147.255 1.00 78.09  ? 98  LEU D CA    1 
ATOM   2903  C  C     . LEU D 4  98  ? 155.417 153.180 146.554 1.00 78.09  ? 98  LEU D C     1 
ATOM   2904  O  O     . LEU D 4  98  ? 154.561 153.798 147.195 1.00 78.09  ? 98  LEU D O     1 
ATOM   2905  C  CB    . LEU D 4  98  ? 157.899 153.246 146.782 1.00 78.09  ? 98  LEU D CB    1 
ATOM   2906  C  CG    . LEU D 4  98  ? 159.082 152.995 147.702 1.00 78.09  ? 98  LEU D CG    1 
ATOM   2907  C  CD1   . LEU D 4  98  ? 160.290 153.677 147.134 1.00 78.09  ? 98  LEU D CD1   1 
ATOM   2908  C  CD2   . LEU D 4  98  ? 158.778 153.514 149.085 1.00 78.09  ? 98  LEU D CD2   1 
ATOM   2909  N  N     . LEU D 4  99  ? 155.336 153.023 145.248 1.00 86.92  ? 99  LEU D N     1 
ATOM   2910  C  CA    . LEU D 4  99  ? 154.349 153.753 144.470 1.00 86.92  ? 99  LEU D CA    1 
ATOM   2911  C  C     . LEU D 4  99  ? 152.965 153.150 144.666 1.00 86.92  ? 99  LEU D C     1 
ATOM   2912  O  O     . LEU D 4  99  ? 152.818 151.927 144.619 1.00 86.92  ? 99  LEU D O     1 
ATOM   2913  C  CB    . LEU D 4  99  ? 154.733 153.732 143.007 1.00 86.92  ? 99  LEU D CB    1 
ATOM   2914  C  CG    . LEU D 4  99  ? 156.105 154.350 142.771 1.00 86.92  ? 99  LEU D CG    1 
ATOM   2915  C  CD1   . LEU D 4  99  ? 156.485 154.245 141.318 1.00 86.92  ? 99  LEU D CD1   1 
ATOM   2916  C  CD2   . LEU D 4  99  ? 156.117 155.786 143.222 1.00 86.92  ? 99  LEU D CD2   1 
ATOM   2917  N  N     . PRO D 4  100 ? 151.951 153.953 144.930 1.00 89.77  ? 100 PRO D N     1 
ATOM   2918  C  CA    . PRO D 4  100 ? 150.628 153.409 145.267 1.00 89.77  ? 100 PRO D CA    1 
ATOM   2919  C  C     . PRO D 4  100 ? 149.793 153.070 144.041 1.00 89.77  ? 100 PRO D C     1 
ATOM   2920  O  O     . PRO D 4  100 ? 149.289 153.958 143.350 1.00 89.77  ? 100 PRO D O     1 
ATOM   2921  C  CB    . PRO D 4  100 ? 149.993 154.543 146.087 1.00 89.77  ? 100 PRO D CB    1 
ATOM   2922  C  CG    . PRO D 4  100 ? 151.132 155.410 146.507 1.00 89.77  ? 100 PRO D CG    1 
ATOM   2923  C  CD    . PRO D 4  100 ? 152.087 155.347 145.371 1.00 89.77  ? 100 PRO D CD    1 
ATOM   2924  N  N     . GLY D 4  101 ? 149.602 151.776 143.796 1.00 94.95  ? 101 GLY D N     1 
ATOM   2925  C  CA    . GLY D 4  101 ? 148.506 151.341 142.947 1.00 94.95  ? 101 GLY D CA    1 
ATOM   2926  C  C     . GLY D 4  101 ? 148.669 151.462 141.446 1.00 94.95  ? 101 GLY D C     1 
ATOM   2927  O  O     . GLY D 4  101 ? 149.366 150.657 140.826 1.00 94.95  ? 101 GLY D O     1 
ATOM   2928  N  N     . GLU D 4  102 ? 147.993 152.453 140.858 1.00 99.73  ? 102 GLU D N     1 
ATOM   2929  C  CA    . GLU D 4  102 ? 147.871 152.549 139.405 1.00 99.73  ? 102 GLU D CA    1 
ATOM   2930  C  C     . GLU D 4  102 ? 149.207 152.868 138.748 1.00 99.73  ? 102 GLU D C     1 
ATOM   2931  O  O     . GLU D 4  102 ? 149.625 152.202 137.787 1.00 99.73  ? 102 GLU D O     1 
ATOM   2932  C  CB    . GLU D 4  102 ? 146.842 153.622 139.055 1.00 99.73  ? 102 GLU D CB    1 
ATOM   2933  C  CG    . GLU D 4  102 ? 146.528 153.768 137.585 1.00 99.73  ? 102 GLU D CG    1 
ATOM   2934  C  CD    . GLU D 4  102 ? 145.688 152.629 137.059 1.00 99.73  ? 102 GLU D CD    1 
ATOM   2935  O  OE1   . GLU D 4  102 ? 144.938 152.026 137.854 1.00 99.73  ? 102 GLU D OE1   1 
ATOM   2936  O  OE2   . GLU D 4  102 ? 145.770 152.337 135.848 1.00 99.73  ? 102 GLU D OE2   1 
ATOM   2937  N  N     . LEU D 4  103 ? 149.901 153.880 139.261 1.00 97.36  ? 103 LEU D N     1 
ATOM   2938  C  CA    . LEU D 4  103 ? 151.193 154.226 138.695 1.00 97.36  ? 103 LEU D CA    1 
ATOM   2939  C  C     . LEU D 4  103 ? 152.256 153.215 139.086 1.00 97.36  ? 103 LEU D C     1 
ATOM   2940  O  O     . LEU D 4  103 ? 153.315 153.170 138.452 1.00 97.36  ? 103 LEU D O     1 
ATOM   2941  C  CB    . LEU D 4  103 ? 151.597 155.639 139.119 1.00 97.36  ? 103 LEU D CB    1 
ATOM   2942  C  CG    . LEU D 4  103 ? 152.309 155.932 140.435 1.00 97.36  ? 103 LEU D CG    1 
ATOM   2943  C  CD1   . LEU D 4  103 ? 152.668 157.395 140.459 1.00 97.36  ? 103 LEU D CD1   1 
ATOM   2944  C  CD2   . LEU D 4  103 ? 151.495 155.585 141.644 1.00 97.36  ? 103 LEU D CD2   1 
ATOM   2945  N  N     . ALA D 4  104 ? 151.997 152.393 140.101 1.00 95.89  ? 104 ALA D N     1 
ATOM   2946  C  CA    . ALA D 4  104 ? 152.831 151.221 140.306 1.00 95.89  ? 104 ALA D CA    1 
ATOM   2947  C  C     . ALA D 4  104 ? 152.636 150.212 139.185 1.00 95.89  ? 104 ALA D C     1 
ATOM   2948  O  O     . ALA D 4  104 ? 153.604 149.591 138.734 1.00 95.89  ? 104 ALA D O     1 
ATOM   2949  C  CB    . ALA D 4  104 ? 152.526 150.578 141.652 1.00 95.89  ? 104 ALA D CB    1 
ATOM   2950  N  N     . LYS D 4  105 ? 151.389 150.036 138.727 1.00 94.41  ? 105 LYS D N     1 
ATOM   2951  C  CA    . LYS D 4  105 ? 151.117 149.092 137.648 1.00 94.41  ? 105 LYS D CA    1 
ATOM   2952  C  C     . LYS D 4  105 ? 151.782 149.535 136.359 1.00 94.41  ? 105 LYS D C     1 
ATOM   2953  O  O     . LYS D 4  105 ? 152.496 148.754 135.719 1.00 94.41  ? 105 LYS D O     1 
ATOM   2954  C  CB    . LYS D 4  105 ? 149.614 148.937 137.415 1.00 94.41  ? 105 LYS D CB    1 
ATOM   2955  C  CG    . LYS D 4  105 ? 148.842 148.261 138.521 1.00 94.41  ? 105 LYS D CG    1 
ATOM   2956  C  CD    . LYS D 4  105 ? 147.403 148.063 138.096 1.00 94.41  ? 105 LYS D CD    1 
ATOM   2957  C  CE    . LYS D 4  105 ? 146.558 147.532 139.235 1.00 94.41  ? 105 LYS D CE    1 
ATOM   2958  N  NZ    . LYS D 4  105 ? 146.946 146.164 139.644 1.00 94.41  ? 105 LYS D NZ    1 
ATOM   2959  N  N     . HIS D 4  106 ? 151.573 150.793 135.967 1.00 97.89  ? 106 HIS D N     1 
ATOM   2960  C  CA    . HIS D 4  106 ? 152.162 151.236 134.709 1.00 97.89  ? 106 HIS D CA    1 
ATOM   2961  C  C     . HIS D 4  106 ? 153.660 151.453 134.840 1.00 97.89  ? 106 HIS D C     1 
ATOM   2962  O  O     . HIS D 4  106 ? 154.389 151.327 133.850 1.00 97.89  ? 106 HIS D O     1 
ATOM   2963  C  CB    . HIS D 4  106 ? 151.468 152.497 134.221 1.00 97.89  ? 106 HIS D CB    1 
ATOM   2964  C  CG    . HIS D 4  106 ? 150.043 152.275 133.832 1.00 97.89  ? 106 HIS D CG    1 
ATOM   2965  N  ND1   . HIS D 4  106 ? 149.684 151.624 132.672 1.00 97.89  ? 106 HIS D ND1   1 
ATOM   2966  C  CD2   . HIS D 4  106 ? 148.888 152.600 134.455 1.00 97.89  ? 106 HIS D CD2   1 
ATOM   2967  C  CE1   . HIS D 4  106 ? 148.368 151.566 132.592 1.00 97.89  ? 106 HIS D CE1   1 
ATOM   2968  N  NE2   . HIS D 4  106 ? 147.860 152.150 133.661 1.00 97.89  ? 106 HIS D NE2   1 
ATOM   2969  N  N     . ALA D 4  107 ? 154.131 151.756 136.046 1.00 99.44  ? 107 ALA D N     1 
ATOM   2970  C  CA    . ALA D 4  107 ? 155.563 151.879 136.277 1.00 99.44  ? 107 ALA D CA    1 
ATOM   2971  C  C     . ALA D 4  107 ? 156.261 150.543 136.091 1.00 99.44  ? 107 ALA D C     1 
ATOM   2972  O  O     . ALA D 4  107 ? 157.244 150.442 135.346 1.00 99.44  ? 107 ALA D O     1 
ATOM   2973  C  CB    . ALA D 4  107 ? 155.816 152.423 137.678 1.00 99.44  ? 107 ALA D CB    1 
ATOM   2974  N  N     . VAL D 4  108 ? 155.750 149.502 136.747 1.00 101.63 ? 108 VAL D N     1 
ATOM   2975  C  CA    . VAL D 4  108 ? 156.335 148.171 136.630 1.00 101.63 ? 108 VAL D CA    1 
ATOM   2976  C  C     . VAL D 4  108 ? 156.144 147.613 135.220 1.00 101.63 ? 108 VAL D C     1 
ATOM   2977  O  O     . VAL D 4  108 ? 157.027 146.914 134.694 1.00 101.63 ? 108 VAL D O     1 
ATOM   2978  C  CB    . VAL D 4  108 ? 155.740 147.274 137.736 1.00 101.63 ? 108 VAL D CB    1 
ATOM   2979  C  CG1   . VAL D 4  108 ? 156.084 145.812 137.547 1.00 101.63 ? 108 VAL D CG1   1 
ATOM   2980  C  CG2   . VAL D 4  108 ? 156.267 147.725 139.076 1.00 101.63 ? 108 VAL D CG2   1 
ATOM   2981  N  N     . SER D 4  109 ? 155.040 147.969 134.559 1.00 104.50 ? 109 SER D N     1 
ATOM   2982  C  CA    . SER D 4  109 ? 154.813 147.506 133.195 1.00 104.50 ? 109 SER D CA    1 
ATOM   2983  C  C     . SER D 4  109 ? 155.797 148.145 132.219 1.00 104.50 ? 109 SER D C     1 
ATOM   2984  O  O     . SER D 4  109 ? 156.321 147.467 131.325 1.00 104.50 ? 109 SER D O     1 
ATOM   2985  C  CB    . SER D 4  109 ? 153.372 147.797 132.785 1.00 104.50 ? 109 SER D CB    1 
ATOM   2986  O  OG    . SER D 4  109 ? 153.121 147.341 131.470 1.00 104.50 ? 109 SER D OG    1 
ATOM   2987  N  N     . GLU D 4  110 ? 156.085 149.439 132.395 1.00 107.16 ? 110 GLU D N     1 
ATOM   2988  C  CA    . GLU D 4  110 ? 157.154 150.062 131.620 1.00 107.16 ? 110 GLU D CA    1 
ATOM   2989  C  C     . GLU D 4  110 ? 158.518 149.495 131.972 1.00 107.16 ? 110 GLU D C     1 
ATOM   2990  O  O     . GLU D 4  110 ? 159.413 149.466 131.119 1.00 107.16 ? 110 GLU D O     1 
ATOM   2991  C  CB    . GLU D 4  110 ? 157.158 151.571 131.833 1.00 107.16 ? 110 GLU D CB    1 
ATOM   2992  C  CG    . GLU D 4  110 ? 156.054 152.290 131.110 1.00 107.16 ? 110 GLU D CG    1 
ATOM   2993  C  CD    . GLU D 4  110 ? 156.249 152.267 129.609 1.00 107.16 ? 110 GLU D CD    1 
ATOM   2994  O  OE1   . GLU D 4  110 ? 157.413 152.282 129.156 1.00 107.16 ? 110 GLU D OE1   1 
ATOM   2995  O  OE2   . GLU D 4  110 ? 155.243 152.233 128.876 1.00 107.16 ? 110 GLU D OE2   1 
ATOM   2996  N  N     . GLY D 4  111 ? 158.697 149.045 133.212 1.00 105.15 ? 111 GLY D N     1 
ATOM   2997  C  CA    . GLY D 4  111 ? 159.953 148.421 133.577 1.00 105.15 ? 111 GLY D CA    1 
ATOM   2998  C  C     . GLY D 4  111 ? 160.176 147.103 132.863 1.00 105.15 ? 111 GLY D C     1 
ATOM   2999  O  O     . GLY D 4  111 ? 161.281 146.823 132.387 1.00 105.15 ? 111 GLY D O     1 
ATOM   3000  N  N     . THR D 4  112 ? 159.133 146.284 132.761 1.00 107.68 ? 112 THR D N     1 
ATOM   3001  C  CA    . THR D 4  112 ? 159.235 145.061 131.975 1.00 107.68 ? 112 THR D CA    1 
ATOM   3002  C  C     . THR D 4  112 ? 159.410 145.377 130.497 1.00 107.68 ? 112 THR D C     1 
ATOM   3003  O  O     . THR D 4  112 ? 160.132 144.660 129.789 1.00 107.68 ? 112 THR D O     1 
ATOM   3004  C  CB    . THR D 4  112 ? 157.993 144.197 132.206 1.00 107.68 ? 112 THR D CB    1 
ATOM   3005  O  OG1   . THR D 4  112 ? 157.814 143.989 133.613 1.00 107.68 ? 112 THR D OG1   1 
ATOM   3006  C  CG2   . THR D 4  112 ? 158.135 142.834 131.540 1.00 107.68 ? 112 THR D CG2   1 
ATOM   3007  N  N     . LYS D 4  113 ? 158.796 146.473 130.030 1.00 106.23 ? 113 LYS D N     1 
ATOM   3008  C  CA    . LYS D 4  113 ? 159.015 146.929 128.661 1.00 106.23 ? 113 LYS D CA    1 
ATOM   3009  C  C     . LYS D 4  113 ? 160.464 147.315 128.404 1.00 106.23 ? 113 LYS D C     1 
ATOM   3010  O  O     . LYS D 4  113 ? 160.960 147.130 127.290 1.00 106.23 ? 113 LYS D O     1 
ATOM   3011  C  CB    . LYS D 4  113 ? 158.122 148.124 128.347 1.00 106.23 ? 113 LYS D CB    1 
ATOM   3012  C  CG    . LYS D 4  113 ? 156.667 147.807 128.097 1.00 106.23 ? 113 LYS D CG    1 
ATOM   3013  C  CD    . LYS D 4  113 ? 155.904 149.108 127.958 1.00 106.23 ? 113 LYS D CD    1 
ATOM   3014  C  CE    . LYS D 4  113 ? 156.353 149.852 126.706 1.00 106.23 ? 113 LYS D CE    1 
ATOM   3015  N  NZ    . LYS D 4  113 ? 155.619 151.128 126.479 1.00 106.23 ? 113 LYS D NZ    1 
ATOM   3016  N  N     . ALA D 4  114 ? 161.162 147.836 129.407 1.00 105.57 ? 114 ALA D N     1 
ATOM   3017  C  CA    . ALA D 4  114 ? 162.535 148.266 129.183 1.00 105.57 ? 114 ALA D CA    1 
ATOM   3018  C  C     . ALA D 4  114 ? 163.555 147.168 129.411 1.00 105.57 ? 114 ALA D C     1 
ATOM   3019  O  O     . ALA D 4  114 ? 164.612 147.178 128.773 1.00 105.57 ? 114 ALA D O     1 
ATOM   3020  C  CB    . ALA D 4  114 ? 162.875 149.442 130.083 1.00 105.57 ? 114 ALA D CB    1 
ATOM   3021  N  N     . VAL D 4  115 ? 163.287 146.245 130.332 1.00 107.49 ? 115 VAL D N     1 
ATOM   3022  C  CA    . VAL D 4  115 ? 164.134 145.061 130.450 1.00 107.49 ? 115 VAL D CA    1 
ATOM   3023  C  C     . VAL D 4  115 ? 164.022 144.209 129.196 1.00 107.49 ? 115 VAL D C     1 
ATOM   3024  O  O     . VAL D 4  115 ? 165.031 143.843 128.576 1.00 107.49 ? 115 VAL D O     1 
ATOM   3025  C  CB    . VAL D 4  115 ? 163.750 144.258 131.703 1.00 107.49 ? 115 VAL D CB    1 
ATOM   3026  C  CG1   . VAL D 4  115 ? 164.512 142.942 131.741 1.00 107.49 ? 115 VAL D CG1   1 
ATOM   3027  C  CG2   . VAL D 4  115 ? 164.022 145.065 132.944 1.00 107.49 ? 115 VAL D CG2   1 
ATOM   3028  N  N     . THR D 4  116 ? 162.790 143.885 128.801 1.00 109.51 ? 116 THR D N     1 
ATOM   3029  C  CA    . THR D 4  116 ? 162.579 143.013 127.656 1.00 109.51 ? 116 THR D CA    1 
ATOM   3030  C  C     . THR D 4  116 ? 162.946 143.718 126.360 1.00 109.51 ? 116 THR D C     1 
ATOM   3031  O  O     . THR D 4  116 ? 163.563 143.117 125.477 1.00 109.51 ? 116 THR D O     1 
ATOM   3032  C  CB    . THR D 4  116 ? 161.132 142.539 127.633 1.00 109.51 ? 116 THR D CB    1 
ATOM   3033  O  OG1   . THR D 4  116 ? 160.831 141.918 128.887 1.00 109.51 ? 116 THR D OG1   1 
ATOM   3034  C  CG2   . THR D 4  116 ? 160.922 141.530 126.530 1.00 109.51 ? 116 THR D CG2   1 
ATOM   3035  N  N     . LYS D 4  117 ? 162.620 145.008 126.254 1.00 109.82 ? 117 LYS D N     1 
ATOM   3036  C  CA    . LYS D 4  117 ? 163.035 145.794 125.095 1.00 109.82 ? 117 LYS D CA    1 
ATOM   3037  C  C     . LYS D 4  117 ? 164.545 145.972 125.063 1.00 109.82 ? 117 LYS D C     1 
ATOM   3038  O  O     . LYS D 4  117 ? 165.127 146.138 123.986 1.00 109.82 ? 117 LYS D O     1 
ATOM   3039  C  CB    . LYS D 4  117 ? 162.330 147.151 125.119 1.00 109.82 ? 117 LYS D CB    1 
ATOM   3040  C  CG    . LYS D 4  117 ? 162.507 148.044 123.895 1.00 109.82 ? 117 LYS D CG    1 
ATOM   3041  C  CD    . LYS D 4  117 ? 161.694 149.326 124.082 1.00 109.82 ? 117 LYS D CD    1 
ATOM   3042  C  CE    . LYS D 4  117 ? 161.909 150.342 122.969 1.00 109.82 ? 117 LYS D CE    1 
ATOM   3043  N  NZ    . LYS D 4  117 ? 161.324 149.903 121.674 1.00 109.82 ? 117 LYS D NZ    1 
ATOM   3044  N  N     . TYR D 4  118 ? 165.198 145.913 126.223 1.00 108.69 ? 118 TYR D N     1 
ATOM   3045  C  CA    . TYR D 4  118 ? 166.653 145.939 126.249 1.00 108.69 ? 118 TYR D CA    1 
ATOM   3046  C  C     . TYR D 4  118 ? 167.228 144.637 125.719 1.00 108.69 ? 118 TYR D C     1 
ATOM   3047  O  O     . TYR D 4  118 ? 167.958 144.624 124.723 1.00 108.69 ? 118 TYR D O     1 
ATOM   3048  C  CB    . TYR D 4  118 ? 167.151 146.201 127.671 1.00 108.69 ? 118 TYR D CB    1 
ATOM   3049  C  CG    . TYR D 4  118 ? 168.663 146.259 127.791 1.00 108.69 ? 118 TYR D CG    1 
ATOM   3050  C  CD1   . TYR D 4  118 ? 169.367 147.384 127.385 1.00 108.69 ? 118 TYR D CD1   1 
ATOM   3051  C  CD2   . TYR D 4  118 ? 169.380 145.184 128.302 1.00 108.69 ? 118 TYR D CD2   1 
ATOM   3052  C  CE1   . TYR D 4  118 ? 170.738 147.439 127.487 1.00 108.69 ? 118 TYR D CE1   1 
ATOM   3053  C  CE2   . TYR D 4  118 ? 170.746 145.231 128.405 1.00 108.69 ? 118 TYR D CE2   1 
ATOM   3054  C  CZ    . TYR D 4  118 ? 171.421 146.360 127.999 1.00 108.69 ? 118 TYR D CZ    1 
ATOM   3055  O  OH    . TYR D 4  118 ? 172.793 146.412 128.099 1.00 108.69 ? 118 TYR D OH    1 
ATOM   3056  N  N     . THR D 4  119 ? 166.896 143.523 126.369 1.00 109.93 ? 119 THR D N     1 
ATOM   3057  C  CA    . THR D 4  119 ? 167.600 142.277 126.109 1.00 109.93 ? 119 THR D CA    1 
ATOM   3058  C  C     . THR D 4  119 ? 167.208 141.621 124.792 1.00 109.93 ? 119 THR D C     1 
ATOM   3059  O  O     . THR D 4  119 ? 167.986 140.817 124.271 1.00 109.93 ? 119 THR D O     1 
ATOM   3060  C  CB    . THR D 4  119 ? 167.368 141.305 127.256 1.00 109.93 ? 119 THR D CB    1 
ATOM   3061  O  OG1   . THR D 4  119 ? 165.960 141.154 127.467 1.00 109.93 ? 119 THR D OG1   1 
ATOM   3062  C  CG2   . THR D 4  119 ? 168.013 141.831 128.515 1.00 109.93 ? 119 THR D CG2   1 
ATOM   3063  N  N     . SER D 4  120 ? 166.039 141.945 124.235 1.00 113.71 ? 120 SER D N     1 
ATOM   3064  C  CA    . SER D 4  120 ? 165.675 141.376 122.941 1.00 113.71 ? 120 SER D CA    1 
ATOM   3065  C  C     . SER D 4  120 ? 166.500 141.967 121.808 1.00 113.71 ? 120 SER D C     1 
ATOM   3066  O  O     . SER D 4  120 ? 166.575 141.365 120.734 1.00 113.71 ? 120 SER D O     1 
ATOM   3067  C  CB    . SER D 4  120 ? 164.185 141.578 122.655 1.00 113.71 ? 120 SER D CB    1 
ATOM   3068  O  OG    . SER D 4  120 ? 163.871 142.947 122.464 1.00 113.71 ? 120 SER D OG    1 
ATOM   3069  N  N     . ALA D 4  121 ? 167.117 143.119 122.027 1.00 111.32 ? 121 ALA D N     1 
ATOM   3070  C  CA    . ALA D 4  121 ? 168.032 143.688 121.059 1.00 111.32 ? 121 ALA D CA    1 
ATOM   3071  C  C     . ALA D 4  121 ? 169.347 142.917 121.065 1.00 111.32 ? 121 ALA D C     1 
ATOM   3072  O  O     . ALA D 4  121 ? 169.621 142.148 121.987 1.00 111.32 ? 121 ALA D O     1 
ATOM   3073  C  CB    . ALA D 4  121 ? 168.269 145.153 121.357 1.00 111.32 ? 121 ALA D CB    1 
ATOM   3074  N  N     . LYS E 1  36  ? 127.736 207.442 151.948 1.00 30.00  ? 36  LYS E N     1 
ATOM   3075  C  CA    . LYS E 1  36  ? 128.275 208.808 152.186 1.00 30.00  ? 36  LYS E CA    1 
ATOM   3076  C  C     . LYS E 1  36  ? 129.463 208.721 153.151 1.00 30.00  ? 36  LYS E C     1 
ATOM   3077  O  O     . LYS E 1  36  ? 130.378 209.561 153.041 1.00 30.00  ? 36  LYS E O     1 
ATOM   3078  C  CB    . LYS E 1  36  ? 127.181 209.724 152.742 1.00 30.00  ? 36  LYS E CB    1 
ATOM   3079  C  CG    . LYS E 1  36  ? 127.599 211.171 152.974 1.00 30.00  ? 36  LYS E CG    1 
ATOM   3080  C  CD    . LYS E 1  36  ? 128.482 211.353 154.190 1.00 30.00  ? 36  LYS E CD    1 
ATOM   3081  C  CE    . LYS E 1  36  ? 128.362 212.730 154.810 1.00 30.00  ? 36  LYS E CE    1 
ATOM   3082  N  NZ    . LYS E 1  36  ? 126.956 213.062 155.141 1.00 30.00  ? 36  LYS E NZ    1 
ATOM   3083  N  N     . LYS E 1  37  ? 129.439 207.739 154.059 1.00 30.00  ? 37  LYS E N     1 
ATOM   3084  C  CA    . LYS E 1  37  ? 130.535 207.553 155.048 1.00 30.00  ? 37  LYS E CA    1 
ATOM   3085  C  C     . LYS E 1  37  ? 130.626 206.071 155.431 1.00 30.00  ? 37  LYS E C     1 
ATOM   3086  O  O     . LYS E 1  37  ? 131.677 205.665 155.963 1.00 30.00  ? 37  LYS E O     1 
ATOM   3087  C  CB    . LYS E 1  37  ? 130.297 208.426 156.284 1.00 30.00  ? 37  LYS E CB    1 
ATOM   3088  C  CG    . LYS E 1  37  ? 128.859 208.882 156.494 1.00 30.00  ? 37  LYS E CG    1 
ATOM   3089  C  CD    . LYS E 1  37  ? 127.841 207.782 156.276 1.00 30.00  ? 37  LYS E CD    1 
ATOM   3090  C  CE    . LYS E 1  37  ? 126.484 208.303 155.853 1.00 30.00  ? 37  LYS E CE    1 
ATOM   3091  N  NZ    . LYS E 1  37  ? 125.910 207.504 154.746 1.00 30.00  ? 37  LYS E NZ    1 
ATOM   3092  N  N     . PRO E 1  38  ? 129.574 205.256 155.193 1.00 97.02  ? 38  PRO E N     1 
ATOM   3093  C  CA    . PRO E 1  38  ? 129.596 203.828 155.533 1.00 97.02  ? 38  PRO E CA    1 
ATOM   3094  C  C     . PRO E 1  38  ? 130.583 203.051 154.649 1.00 97.02  ? 38  PRO E C     1 
ATOM   3095  O  O     . PRO E 1  38  ? 131.670 202.749 155.111 1.00 97.02  ? 38  PRO E O     1 
ATOM   3096  C  CB    . PRO E 1  38  ? 128.167 203.347 155.232 1.00 97.02  ? 38  PRO E CB    1 
ATOM   3097  C  CG    . PRO E 1  38  ? 127.344 204.615 155.144 1.00 97.02  ? 38  PRO E CG    1 
ATOM   3098  C  CD    . PRO E 1  38  ? 128.297 205.662 154.608 1.00 97.02  ? 38  PRO E CD    1 
ATOM   3099  N  N     . HIS E 1  39  ? 130.173 202.748 153.413 1.00 96.78  ? 39  HIS E N     1 
ATOM   3100  C  CA    . HIS E 1  39  ? 131.023 201.999 152.449 1.00 96.78  ? 39  HIS E CA    1 
ATOM   3101  C  C     . HIS E 1  39  ? 131.577 200.734 153.117 1.00 96.78  ? 39  HIS E C     1 
ATOM   3102  O  O     . HIS E 1  39  ? 131.267 199.628 152.634 1.00 96.78  ? 39  HIS E O     1 
ATOM   3103  C  CB    . HIS E 1  39  ? 132.139 202.901 151.903 1.00 96.78  ? 39  HIS E CB    1 
ATOM   3104  C  CG    . HIS E 1  39  ? 132.320 202.801 150.425 1.00 96.78  ? 39  HIS E CG    1 
ATOM   3105  N  ND1   . HIS E 1  39  ? 132.486 201.590 149.781 1.00 96.78  ? 39  HIS E ND1   1 
ATOM   3106  C  CD2   . HIS E 1  39  ? 132.364 203.749 149.464 1.00 96.78  ? 39  HIS E CD2   1 
ATOM   3107  C  CE1   . HIS E 1  39  ? 132.624 201.797 148.487 1.00 96.78  ? 39  HIS E CE1   1 
ATOM   3108  N  NE2   . HIS E 1  39  ? 132.553 203.115 148.267 1.00 96.78  ? 39  HIS E NE2   1 
ATOM   3109  N  N     . ARG E 1  40  ? 132.361 200.905 154.186 1.00 93.21  ? 40  ARG E N     1 
ATOM   3110  C  CA    . ARG E 1  40  ? 132.943 199.782 154.893 1.00 93.21  ? 40  ARG E CA    1 
ATOM   3111  C  C     . ARG E 1  40  ? 132.421 198.464 154.352 1.00 93.21  ? 40  ARG E C     1 
ATOM   3112  O  O     . ARG E 1  40  ? 131.611 198.404 153.426 1.00 93.21  ? 40  ARG E O     1 
ATOM   3113  C  CB    . ARG E 1  40  ? 132.648 199.868 156.384 1.00 93.21  ? 40  ARG E CB    1 
ATOM   3114  C  CG    . ARG E 1  40  ? 133.452 200.878 157.134 1.00 93.21  ? 40  ARG E CG    1 
ATOM   3115  C  CD    . ARG E 1  40  ? 132.908 200.960 158.528 1.00 93.21  ? 40  ARG E CD    1 
ATOM   3116  N  NE    . ARG E 1  40  ? 132.895 199.650 159.163 1.00 93.21  ? 40  ARG E NE    1 
ATOM   3117  C  CZ    . ARG E 1  40  ? 133.905 199.155 159.858 1.00 93.21  ? 40  ARG E CZ    1 
ATOM   3118  N  NH1   . ARG E 1  40  ? 135.009 199.864 160.014 1.00 93.21  ? 40  ARG E NH1   1 
ATOM   3119  N  NH2   . ARG E 1  40  ? 133.804 197.956 160.407 1.00 93.21  ? 40  ARG E NH2   1 
ATOM   3120  N  N     . TYR E 1  41  ? 132.894 197.390 154.958 1.00 91.67  ? 41  TYR E N     1 
ATOM   3121  C  CA    . TYR E 1  41  ? 132.503 196.048 154.601 1.00 91.67  ? 41  TYR E CA    1 
ATOM   3122  C  C     . TYR E 1  41  ? 132.198 195.277 155.873 1.00 91.67  ? 41  TYR E C     1 
ATOM   3123  O  O     . TYR E 1  41  ? 132.458 195.742 156.984 1.00 91.67  ? 41  TYR E O     1 
ATOM   3124  C  CB    . TYR E 1  41  ? 133.598 195.372 153.781 1.00 91.67  ? 41  TYR E CB    1 
ATOM   3125  C  CG    . TYR E 1  41  ? 133.704 195.955 152.403 1.00 91.67  ? 41  TYR E CG    1 
ATOM   3126  C  CD1   . TYR E 1  41  ? 132.912 195.475 151.378 1.00 91.67  ? 41  TYR E CD1   1 
ATOM   3127  C  CD2   . TYR E 1  41  ? 134.556 197.009 152.132 1.00 91.67  ? 41  TYR E CD2   1 
ATOM   3128  C  CE1   . TYR E 1  41  ? 132.982 196.011 150.110 1.00 91.67  ? 41  TYR E CE1   1 
ATOM   3129  C  CE2   . TYR E 1  41  ? 134.635 197.560 150.871 1.00 91.67  ? 41  TYR E CE2   1 
ATOM   3130  C  CZ    . TYR E 1  41  ? 133.842 197.053 149.860 1.00 91.67  ? 41  TYR E CZ    1 
ATOM   3131  O  OH    . TYR E 1  41  ? 133.908 197.586 148.595 1.00 91.67  ? 41  TYR E OH    1 
ATOM   3132  N  N     . ARG E 1  42  ? 131.613 194.100 155.696 1.00 85.01  ? 42  ARG E N     1 
ATOM   3133  C  CA    . ARG E 1  42  ? 131.431 193.191 156.807 1.00 85.01  ? 42  ARG E CA    1 
ATOM   3134  C  C     . ARG E 1  42  ? 132.783 192.743 157.362 1.00 85.01  ? 42  ARG E C     1 
ATOM   3135  O  O     . ARG E 1  42  ? 133.798 192.767 156.663 1.00 85.01  ? 42  ARG E O     1 
ATOM   3136  C  CB    . ARG E 1  42  ? 130.636 191.966 156.370 1.00 85.01  ? 42  ARG E CB    1 
ATOM   3137  C  CG    . ARG E 1  42  ? 129.155 192.016 156.643 1.00 85.01  ? 42  ARG E CG    1 
ATOM   3138  C  CD    . ARG E 1  42  ? 128.429 193.005 155.782 1.00 85.01  ? 42  ARG E CD    1 
ATOM   3139  N  NE    . ARG E 1  42  ? 126.995 192.805 155.914 1.00 85.01  ? 42  ARG E NE    1 
ATOM   3140  C  CZ    . ARG E 1  42  ? 126.077 193.619 155.417 1.00 85.01  ? 42  ARG E CZ    1 
ATOM   3141  N  NH1   . ARG E 1  42  ? 126.441 194.704 154.763 1.00 85.01  ? 42  ARG E NH1   1 
ATOM   3142  N  NH2   . ARG E 1  42  ? 124.792 193.351 155.585 1.00 85.01  ? 42  ARG E NH2   1 
ATOM   3143  N  N     . PRO E 1  43  ? 132.826 192.349 158.607 1.00 81.90  ? 43  PRO E N     1 
ATOM   3144  C  CA    . PRO E 1  43  ? 134.009 191.655 159.105 1.00 81.90  ? 43  PRO E CA    1 
ATOM   3145  C  C     . PRO E 1  43  ? 134.057 190.237 158.572 1.00 81.90  ? 43  PRO E C     1 
ATOM   3146  O  O     . PRO E 1  43  ? 133.545 189.305 159.192 1.00 81.90  ? 43  PRO E O     1 
ATOM   3147  C  CB    . PRO E 1  43  ? 133.835 191.697 160.624 1.00 81.90  ? 43  PRO E CB    1 
ATOM   3148  C  CG    . PRO E 1  43  ? 132.395 191.883 160.829 1.00 81.90  ? 43  PRO E CG    1 
ATOM   3149  C  CD    . PRO E 1  43  ? 131.903 192.707 159.695 1.00 81.90  ? 43  PRO E CD    1 
ATOM   3150  N  N     . GLY E 1  44  ? 134.672 190.072 157.411 1.00 80.93  ? 44  GLY E N     1 
ATOM   3151  C  CA    . GLY E 1  44  ? 134.733 188.777 156.775 1.00 80.93  ? 44  GLY E CA    1 
ATOM   3152  C  C     . GLY E 1  44  ? 134.793 188.840 155.266 1.00 80.93  ? 44  GLY E C     1 
ATOM   3153  O  O     . GLY E 1  44  ? 135.252 187.891 154.630 1.00 80.93  ? 44  GLY E O     1 
ATOM   3154  N  N     . THR E 1  45  ? 134.379 189.956 154.672 1.00 80.50  ? 45  THR E N     1 
ATOM   3155  C  CA    . THR E 1  45  ? 134.581 190.122 153.239 1.00 80.50  ? 45  THR E CA    1 
ATOM   3156  C  C     . THR E 1  45  ? 136.044 190.385 152.929 1.00 80.50  ? 45  THR E C     1 
ATOM   3157  O  O     . THR E 1  45  ? 136.617 189.759 152.030 1.00 80.50  ? 45  THR E O     1 
ATOM   3158  C  CB    . THR E 1  45  ? 133.710 191.247 152.707 1.00 80.50  ? 45  THR E CB    1 
ATOM   3159  O  OG1   . THR E 1  45  ? 132.334 190.877 152.853 1.00 80.50  ? 45  THR E OG1   1 
ATOM   3160  C  CG2   . THR E 1  45  ? 134.009 191.503 151.240 1.00 80.50  ? 45  THR E CG2   1 
ATOM   3161  N  N     . VAL E 1  46  ? 136.672 191.293 153.683 1.00 77.58  ? 46  VAL E N     1 
ATOM   3162  C  CA    . VAL E 1  46  ? 138.114 191.501 153.573 1.00 77.58  ? 46  VAL E CA    1 
ATOM   3163  C  C     . VAL E 1  46  ? 138.862 190.233 153.974 1.00 77.58  ? 46  VAL E C     1 
ATOM   3164  O  O     . VAL E 1  46  ? 139.910 189.904 153.398 1.00 77.58  ? 46  VAL E O     1 
ATOM   3165  C  CB    . VAL E 1  46  ? 138.521 192.728 154.414 1.00 77.58  ? 46  VAL E CB    1 
ATOM   3166  C  CG1   . VAL E 1  46  ? 140.023 192.921 154.462 1.00 77.58  ? 46  VAL E CG1   1 
ATOM   3167  C  CG2   . VAL E 1  46  ? 137.871 193.962 153.843 1.00 77.58  ? 46  VAL E CG2   1 
ATOM   3168  N  N     . ALA E 1  47  ? 138.293 189.466 154.902 1.00 76.55  ? 47  ALA E N     1 
ATOM   3169  C  CA    . ALA E 1  47  ? 138.895 188.198 155.288 1.00 76.55  ? 47  ALA E CA    1 
ATOM   3170  C  C     . ALA E 1  47  ? 138.822 187.180 154.161 1.00 76.55  ? 47  ALA E C     1 
ATOM   3171  O  O     . ALA E 1  47  ? 139.843 186.608 153.786 1.00 76.55  ? 47  ALA E O     1 
ATOM   3172  C  CB    . ALA E 1  47  ? 138.223 187.662 156.549 1.00 76.55  ? 47  ALA E CB    1 
ATOM   3173  N  N     . LEU E 1  48  ? 137.633 186.950 153.594 1.00 76.49  ? 48  LEU E N     1 
ATOM   3174  C  CA    . LEU E 1  48  ? 137.493 185.871 152.615 1.00 76.49  ? 48  LEU E CA    1 
ATOM   3175  C  C     . LEU E 1  48  ? 138.106 186.235 151.269 1.00 76.49  ? 48  LEU E C     1 
ATOM   3176  O  O     . LEU E 1  48  ? 138.707 185.378 150.602 1.00 76.49  ? 48  LEU E O     1 
ATOM   3177  C  CB    . LEU E 1  48  ? 136.028 185.500 152.440 1.00 76.49  ? 48  LEU E CB    1 
ATOM   3178  C  CG    . LEU E 1  48  ? 135.414 184.778 153.623 1.00 76.49  ? 48  LEU E CG    1 
ATOM   3179  C  CD1   . LEU E 1  48  ? 133.937 184.641 153.399 1.00 76.49  ? 48  LEU E CD1   1 
ATOM   3180  C  CD2   . LEU E 1  48  ? 136.060 183.431 153.766 1.00 76.49  ? 48  LEU E CD2   1 
ATOM   3181  N  N     . ARG E 1  49  ? 137.950 187.492 150.843 1.00 75.96  ? 49  ARG E N     1 
ATOM   3182  C  CA    . ARG E 1  49  ? 138.672 187.964 149.672 1.00 75.96  ? 49  ARG E CA    1 
ATOM   3183  C  C     . ARG E 1  49  ? 140.172 187.927 149.918 1.00 75.96  ? 49  ARG E C     1 
ATOM   3184  O  O     . ARG E 1  49  ? 140.959 187.607 149.013 1.00 75.96  ? 49  ARG E O     1 
ATOM   3185  C  CB    . ARG E 1  49  ? 138.218 189.375 149.313 1.00 75.96  ? 49  ARG E CB    1 
ATOM   3186  C  CG    . ARG E 1  49  ? 138.761 189.860 147.994 1.00 75.96  ? 49  ARG E CG    1 
ATOM   3187  C  CD    . ARG E 1  49  ? 138.218 191.229 147.611 1.00 75.96  ? 49  ARG E CD    1 
ATOM   3188  N  NE    . ARG E 1  49  ? 138.720 192.329 148.435 1.00 75.96  ? 49  ARG E NE    1 
ATOM   3189  C  CZ    . ARG E 1  49  ? 137.962 193.116 149.194 1.00 75.96  ? 49  ARG E CZ    1 
ATOM   3190  N  NH1   . ARG E 1  49  ? 136.650 192.939 149.247 1.00 75.96  ? 49  ARG E NH1   1 
ATOM   3191  N  NH2   . ARG E 1  49  ? 138.517 194.093 149.889 1.00 75.96  ? 49  ARG E NH2   1 
ATOM   3192  N  N     . GLU E 1  50  ? 140.580 188.202 151.159 1.00 77.76  ? 50  GLU E N     1 
ATOM   3193  C  CA    . GLU E 1  50  ? 141.987 188.109 151.515 1.00 77.76  ? 50  GLU E CA    1 
ATOM   3194  C  C     . GLU E 1  50  ? 142.476 186.666 151.490 1.00 77.76  ? 50  GLU E C     1 
ATOM   3195  O  O     . GLU E 1  50  ? 143.642 186.416 151.172 1.00 77.76  ? 50  GLU E O     1 
ATOM   3196  C  CB    . GLU E 1  50  ? 142.204 188.743 152.886 1.00 77.76  ? 50  GLU E CB    1 
ATOM   3197  C  CG    . GLU E 1  50  ? 143.659 188.946 153.243 1.00 77.76  ? 50  GLU E CG    1 
ATOM   3198  C  CD    . GLU E 1  50  ? 143.879 189.607 154.592 1.00 77.76  ? 50  GLU E CD    1 
ATOM   3199  O  OE1   . GLU E 1  50  ? 142.887 189.889 155.297 1.00 77.76  ? 50  GLU E OE1   1 
ATOM   3200  O  OE2   . GLU E 1  50  ? 145.053 189.827 154.961 1.00 77.76  ? 50  GLU E OE2   1 
ATOM   3201  N  N     . ILE E 1  51  ? 141.599 185.706 151.791 1.00 73.48  ? 51  ILE E N     1 
ATOM   3202  C  CA    . ILE E 1  51  ? 141.946 184.295 151.666 1.00 73.48  ? 51  ILE E CA    1 
ATOM   3203  C  C     . ILE E 1  51  ? 142.086 183.916 150.203 1.00 73.48  ? 51  ILE E C     1 
ATOM   3204  O  O     . ILE E 1  51  ? 142.951 183.109 149.839 1.00 73.48  ? 51  ILE E O     1 
ATOM   3205  C  CB    . ILE E 1  51  ? 140.907 183.421 152.395 1.00 73.48  ? 51  ILE E CB    1 
ATOM   3206  C  CG1   . ILE E 1  51  ? 141.032 183.601 153.898 1.00 73.48  ? 51  ILE E CG1   1 
ATOM   3207  C  CG2   . ILE E 1  51  ? 141.085 181.948 152.125 1.00 73.48  ? 51  ILE E CG2   1 
ATOM   3208  C  CD1   . ILE E 1  51  ? 139.919 182.948 154.682 1.00 73.48  ? 51  ILE E CD1   1 
ATOM   3209  N  N     . ARG E 1  52  ? 141.270 184.512 149.331 1.00 74.84  ? 52  ARG E N     1 
ATOM   3210  C  CA    . ARG E 1  52  ? 141.448 184.240 147.909 1.00 74.84  ? 52  ARG E CA    1 
ATOM   3211  C  C     . ARG E 1  52  ? 142.768 184.802 147.402 1.00 74.84  ? 52  ARG E C     1 
ATOM   3212  O  O     . ARG E 1  52  ? 143.450 184.153 146.599 1.00 74.84  ? 52  ARG E O     1 
ATOM   3213  C  CB    . ARG E 1  52  ? 140.288 184.793 147.096 1.00 74.84  ? 52  ARG E CB    1 
ATOM   3214  C  CG    . ARG E 1  52  ? 138.986 184.042 147.290 1.00 74.84  ? 52  ARG E CG    1 
ATOM   3215  C  CD    . ARG E 1  52  ? 137.914 184.598 146.383 1.00 74.84  ? 52  ARG E CD    1 
ATOM   3216  N  NE    . ARG E 1  52  ? 136.616 183.981 146.627 1.00 74.84  ? 52  ARG E NE    1 
ATOM   3217  C  CZ    . ARG E 1  52  ? 135.719 184.465 147.477 1.00 74.84  ? 52  ARG E CZ    1 
ATOM   3218  N  NH1   . ARG E 1  52  ? 135.979 185.572 148.156 1.00 74.84  ? 52  ARG E NH1   1 
ATOM   3219  N  NH2   . ARG E 1  52  ? 134.560 183.848 147.645 1.00 74.84  ? 52  ARG E NH2   1 
ATOM   3220  N  N     . ARG E 1  53  ? 143.178 185.966 147.906 1.00 74.75  ? 53  ARG E N     1 
ATOM   3221  C  CA    . ARG E 1  53  ? 144.455 186.511 147.458 1.00 74.75  ? 53  ARG E CA    1 
ATOM   3222  C  C     . ARG E 1  53  ? 145.635 185.736 148.032 1.00 74.75  ? 53  ARG E C     1 
ATOM   3223  O  O     . ARG E 1  53  ? 146.512 185.292 147.286 1.00 74.75  ? 53  ARG E O     1 
ATOM   3224  C  CB    . ARG E 1  53  ? 144.593 187.983 147.814 1.00 74.75  ? 53  ARG E CB    1 
ATOM   3225  C  CG    . ARG E 1  53  ? 145.897 188.488 147.270 1.00 74.75  ? 53  ARG E CG    1 
ATOM   3226  C  CD    . ARG E 1  53  ? 146.168 189.917 147.555 1.00 74.75  ? 53  ARG E CD    1 
ATOM   3227  N  NE    . ARG E 1  53  ? 147.488 190.241 147.039 1.00 74.75  ? 53  ARG E NE    1 
ATOM   3228  C  CZ    . ARG E 1  53  ? 148.059 191.430 147.142 1.00 74.75  ? 53  ARG E CZ    1 
ATOM   3229  N  NH1   . ARG E 1  53  ? 147.422 192.421 147.747 1.00 74.75  ? 53  ARG E NH1   1 
ATOM   3230  N  NH2   . ARG E 1  53  ? 149.269 191.625 146.644 1.00 74.75  ? 53  ARG E NH2   1 
ATOM   3231  N  N     . TYR E 1  54  ? 145.687 185.571 149.348 1.00 74.36  ? 54  TYR E N     1 
ATOM   3232  C  CA    . TYR E 1  54  ? 146.871 184.946 149.920 1.00 74.36  ? 54  TYR E CA    1 
ATOM   3233  C  C     . TYR E 1  54  ? 146.887 183.435 149.797 1.00 74.36  ? 54  TYR E C     1 
ATOM   3234  O  O     . TYR E 1  54  ? 147.948 182.836 149.999 1.00 74.36  ? 54  TYR E O     1 
ATOM   3235  C  CB    . TYR E 1  54  ? 147.049 185.340 151.380 1.00 74.36  ? 54  TYR E CB    1 
ATOM   3236  C  CG    . TYR E 1  54  ? 147.551 186.744 151.537 1.00 74.36  ? 54  TYR E CG    1 
ATOM   3237  C  CD1   . TYR E 1  54  ? 148.862 187.067 151.219 1.00 74.36  ? 54  TYR E CD1   1 
ATOM   3238  C  CD2   . TYR E 1  54  ? 146.732 187.740 152.021 1.00 74.36  ? 54  TYR E CD2   1 
ATOM   3239  C  CE1   . TYR E 1  54  ? 149.332 188.354 151.361 1.00 74.36  ? 54  TYR E CE1   1 
ATOM   3240  C  CE2   . TYR E 1  54  ? 147.191 189.030 152.175 1.00 74.36  ? 54  TYR E CE2   1 
ATOM   3241  C  CZ    . TYR E 1  54  ? 148.491 189.330 151.836 1.00 74.36  ? 54  TYR E CZ    1 
ATOM   3242  O  OH    . TYR E 1  54  ? 148.952 190.614 151.986 1.00 74.36  ? 54  TYR E OH    1 
ATOM   3243  N  N     . GLN E 1  55  ? 145.766 182.790 149.488 1.00 73.58  ? 55  GLN E N     1 
ATOM   3244  C  CA    . GLN E 1  55  ? 145.890 181.440 148.962 1.00 73.58  ? 55  GLN E CA    1 
ATOM   3245  C  C     . GLN E 1  55  ? 146.300 181.477 147.505 1.00 73.58  ? 55  GLN E C     1 
ATOM   3246  O  O     . GLN E 1  55  ? 146.979 180.561 147.030 1.00 73.58  ? 55  GLN E O     1 
ATOM   3247  C  CB    . GLN E 1  55  ? 144.591 180.640 149.117 1.00 73.58  ? 55  GLN E CB    1 
ATOM   3248  C  CG    . GLN E 1  55  ? 144.326 180.131 150.522 1.00 73.58  ? 55  GLN E CG    1 
ATOM   3249  C  CD    . GLN E 1  55  ? 143.153 179.173 150.601 1.00 73.58  ? 55  GLN E CD    1 
ATOM   3250  O  OE1   . GLN E 1  55  ? 142.448 178.954 149.621 1.00 73.58  ? 55  GLN E OE1   1 
ATOM   3251  N  NE2   . GLN E 1  55  ? 142.966 178.566 151.760 1.00 73.58  ? 55  GLN E NE2   1 
ATOM   3252  N  N     . LYS E 1  56  ? 145.925 182.538 146.796 1.00 71.74  ? 56  LYS E N     1 
ATOM   3253  C  CA    . LYS E 1  56  ? 146.170 182.575 145.363 1.00 71.74  ? 56  LYS E CA    1 
ATOM   3254  C  C     . LYS E 1  56  ? 147.644 182.827 145.056 1.00 71.74  ? 56  LYS E C     1 
ATOM   3255  O  O     . LYS E 1  56  ? 148.220 182.160 144.193 1.00 71.74  ? 56  LYS E O     1 
ATOM   3256  C  CB    . LYS E 1  56  ? 145.269 183.636 144.733 1.00 71.74  ? 56  LYS E CB    1 
ATOM   3257  C  CG    . LYS E 1  56  ? 145.179 183.576 143.236 1.00 71.74  ? 56  LYS E CG    1 
ATOM   3258  C  CD    . LYS E 1  56  ? 144.072 184.480 142.740 1.00 71.74  ? 56  LYS E CD    1 
ATOM   3259  C  CE    . LYS E 1  56  ? 144.000 184.415 141.238 1.00 71.74  ? 56  LYS E CE    1 
ATOM   3260  N  NZ    . LYS E 1  56  ? 143.640 183.037 140.828 1.00 71.74  ? 56  LYS E NZ    1 
ATOM   3261  N  N     . SER E 1  57  ? 148.281 183.749 145.769 1.00 70.79  ? 57  SER E N     1 
ATOM   3262  C  CA    . SER E 1  57  ? 149.667 184.080 145.483 1.00 70.79  ? 57  SER E CA    1 
ATOM   3263  C  C     . SER E 1  57  ? 150.598 183.110 146.193 1.00 70.79  ? 57  SER E C     1 
ATOM   3264  O  O     . SER E 1  57  ? 150.168 182.220 146.927 1.00 70.79  ? 57  SER E O     1 
ATOM   3265  C  CB    . SER E 1  57  ? 150.000 185.498 145.914 1.00 70.79  ? 57  SER E CB    1 
ATOM   3266  O  OG    . SER E 1  57  ? 150.150 185.544 147.316 1.00 70.79  ? 57  SER E OG    1 
ATOM   3267  N  N     . THR E 1  58  ? 151.905 183.302 145.979 1.00 70.92  ? 58  THR E N     1 
ATOM   3268  C  CA    . THR E 1  58  ? 152.920 182.334 146.383 1.00 70.92  ? 58  THR E CA    1 
ATOM   3269  C  C     . THR E 1  58  ? 154.143 182.918 147.069 1.00 70.92  ? 58  THR E C     1 
ATOM   3270  O  O     . THR E 1  58  ? 154.969 182.138 147.552 1.00 70.92  ? 58  THR E O     1 
ATOM   3271  C  CB    . THR E 1  58  ? 153.441 181.548 145.168 1.00 70.92  ? 58  THR E CB    1 
ATOM   3272  O  OG1   . THR E 1  58  ? 153.905 182.466 144.172 1.00 70.92  ? 58  THR E OG1   1 
ATOM   3273  C  CG2   . THR E 1  58  ? 152.396 180.646 144.584 1.00 70.92  ? 58  THR E CG2   1 
ATOM   3274  N  N     . GLU E 1  59  ? 154.309 184.232 147.107 1.00 73.45  ? 59  GLU E N     1 
ATOM   3275  C  CA    . GLU E 1  59  ? 155.624 184.773 147.404 1.00 73.45  ? 59  GLU E CA    1 
ATOM   3276  C  C     . GLU E 1  59  ? 155.891 184.751 148.906 1.00 73.45  ? 59  GLU E C     1 
ATOM   3277  O  O     . GLU E 1  59  ? 155.041 184.381 149.717 1.00 73.45  ? 59  GLU E O     1 
ATOM   3278  C  CB    . GLU E 1  59  ? 155.761 186.188 146.845 1.00 73.45  ? 59  GLU E CB    1 
ATOM   3279  C  CG    . GLU E 1  59  ? 155.057 187.257 147.648 1.00 73.45  ? 59  GLU E CG    1 
ATOM   3280  C  CD    . GLU E 1  59  ? 153.613 187.450 147.260 1.00 73.45  ? 59  GLU E CD    1 
ATOM   3281  O  OE1   . GLU E 1  59  ? 153.033 186.566 146.599 1.00 73.45  ? 59  GLU E OE1   1 
ATOM   3282  O  OE2   . GLU E 1  59  ? 153.056 188.507 147.610 1.00 73.45  ? 59  GLU E OE2   1 
ATOM   3283  N  N     . LEU E 1  60  ? 157.092 185.169 149.273 1.00 71.52  ? 60  LEU E N     1 
ATOM   3284  C  CA    . LEU E 1  60  ? 157.569 185.055 150.638 1.00 71.52  ? 60  LEU E CA    1 
ATOM   3285  C  C     . LEU E 1  60  ? 157.235 186.339 151.378 1.00 71.52  ? 60  LEU E C     1 
ATOM   3286  O  O     . LEU E 1  60  ? 157.462 187.436 150.865 1.00 71.52  ? 60  LEU E O     1 
ATOM   3287  C  CB    . LEU E 1  60  ? 159.069 184.788 150.671 1.00 71.52  ? 60  LEU E CB    1 
ATOM   3288  C  CG    . LEU E 1  60  ? 159.515 183.337 150.484 1.00 71.52  ? 60  LEU E CG    1 
ATOM   3289  C  CD1   . LEU E 1  60  ? 158.838 182.447 151.511 1.00 71.52  ? 60  LEU E CD1   1 
ATOM   3290  C  CD2   . LEU E 1  60  ? 159.321 182.814 149.062 1.00 71.52  ? 60  LEU E CD2   1 
ATOM   3291  N  N     . LEU E 1  61  ? 156.705 186.197 152.583 1.00 70.72  ? 61  LEU E N     1 
ATOM   3292  C  CA    . LEU E 1  61  ? 155.888 187.264 153.138 1.00 70.72  ? 61  LEU E CA    1 
ATOM   3293  C  C     . LEU E 1  61  ? 156.122 187.514 154.622 1.00 70.72  ? 61  LEU E C     1 
ATOM   3294  O  O     . LEU E 1  61  ? 155.317 188.212 155.247 1.00 70.72  ? 61  LEU E O     1 
ATOM   3295  C  CB    . LEU E 1  61  ? 154.410 186.972 152.849 1.00 70.72  ? 61  LEU E CB    1 
ATOM   3296  C  CG    . LEU E 1  61  ? 153.617 185.870 153.543 1.00 70.72  ? 61  LEU E CG    1 
ATOM   3297  C  CD1   . LEU E 1  61  ? 152.173 186.095 153.208 1.00 70.72  ? 61  LEU E CD1   1 
ATOM   3298  C  CD2   . LEU E 1  61  ? 154.020 184.461 153.135 1.00 70.72  ? 61  LEU E CD2   1 
ATOM   3299  N  N     . ILE E 1  62  ? 157.175 186.964 155.203 1.00 68.50  ? 62  ILE E N     1 
ATOM   3300  C  CA    . ILE E 1  62  ? 157.772 187.499 156.417 1.00 68.50  ? 62  ILE E CA    1 
ATOM   3301  C  C     . ILE E 1  62  ? 159.039 188.218 155.991 1.00 68.50  ? 62  ILE E C     1 
ATOM   3302  O  O     . ILE E 1  62  ? 159.815 187.685 155.189 1.00 68.50  ? 62  ILE E O     1 
ATOM   3303  C  CB    . ILE E 1  62  ? 158.069 186.388 157.433 1.00 68.50  ? 62  ILE E CB    1 
ATOM   3304  C  CG1   . ILE E 1  62  ? 156.793 185.678 157.827 1.00 68.50  ? 62  ILE E CG1   1 
ATOM   3305  C  CG2   . ILE E 1  62  ? 158.679 186.954 158.672 1.00 68.50  ? 62  ILE E CG2   1 
ATOM   3306  C  CD1   . ILE E 1  62  ? 157.052 184.464 158.660 1.00 68.50  ? 62  ILE E CD1   1 
ATOM   3307  N  N     . ARG E 1  63  ? 159.240 189.430 156.506 1.00 71.18  ? 63  ARG E N     1 
ATOM   3308  C  CA    . ARG E 1  63  ? 160.240 190.339 155.957 1.00 71.18  ? 63  ARG E CA    1 
ATOM   3309  C  C     . ARG E 1  63  ? 161.652 189.829 156.224 1.00 71.18  ? 63  ARG E C     1 
ATOM   3310  O  O     . ARG E 1  63  ? 161.932 189.249 157.275 1.00 71.18  ? 63  ARG E O     1 
ATOM   3311  C  CB    . ARG E 1  63  ? 160.046 191.733 156.549 1.00 71.18  ? 63  ARG E CB    1 
ATOM   3312  C  CG    . ARG E 1  63  ? 158.661 192.345 156.295 1.00 71.18  ? 63  ARG E CG    1 
ATOM   3313  C  CD    . ARG E 1  63  ? 158.396 192.672 154.833 1.00 71.18  ? 63  ARG E CD    1 
ATOM   3314  N  NE    . ARG E 1  63  ? 157.788 191.564 154.102 1.00 71.18  ? 63  ARG E NE    1 
ATOM   3315  C  CZ    . ARG E 1  63  ? 157.717 191.494 152.779 1.00 71.18  ? 63  ARG E CZ    1 
ATOM   3316  N  NH1   . ARG E 1  63  ? 158.208 192.474 152.037 1.00 71.18  ? 63  ARG E NH1   1 
ATOM   3317  N  NH2   . ARG E 1  63  ? 157.153 190.446 152.194 1.00 71.18  ? 63  ARG E NH2   1 
ATOM   3318  N  N     . LYS E 1  64  ? 162.542 190.056 155.255 1.00 73.52  ? 64  LYS E N     1 
ATOM   3319  C  CA    . LYS E 1  64  ? 163.755 189.252 155.159 1.00 73.52  ? 64  LYS E CA    1 
ATOM   3320  C  C     . LYS E 1  64  ? 164.803 189.654 156.189 1.00 73.52  ? 64  LYS E C     1 
ATOM   3321  O  O     . LYS E 1  64  ? 165.529 188.794 156.704 1.00 73.52  ? 64  LYS E O     1 
ATOM   3322  C  CB    . LYS E 1  64  ? 164.309 189.329 153.738 1.00 73.52  ? 64  LYS E CB    1 
ATOM   3323  C  CG    . LYS E 1  64  ? 163.432 188.591 152.728 1.00 73.52  ? 64  LYS E CG    1 
ATOM   3324  C  CD    . LYS E 1  64  ? 164.063 188.485 151.343 1.00 73.52  ? 64  LYS E CD    1 
ATOM   3325  C  CE    . LYS E 1  64  ? 163.487 189.496 150.368 1.00 73.52  ? 64  LYS E CE    1 
ATOM   3326  N  NZ    . LYS E 1  64  ? 163.983 190.866 150.620 1.00 73.52  ? 64  LYS E NZ    1 
ATOM   3327  N  N     . LEU E 1  65  ? 164.905 190.938 156.514 1.00 72.88  ? 65  LEU E N     1 
ATOM   3328  C  CA    . LEU E 1  65  ? 165.855 191.315 157.559 1.00 72.88  ? 65  LEU E CA    1 
ATOM   3329  C  C     . LEU E 1  65  ? 165.420 191.001 158.996 1.00 72.88  ? 65  LEU E C     1 
ATOM   3330  O  O     . LEU E 1  65  ? 166.286 190.590 159.780 1.00 72.88  ? 65  LEU E O     1 
ATOM   3331  C  CB    . LEU E 1  65  ? 166.238 192.792 157.447 1.00 72.88  ? 65  LEU E CB    1 
ATOM   3332  C  CG    . LEU E 1  65  ? 167.176 193.086 156.284 1.00 72.88  ? 65  LEU E CG    1 
ATOM   3333  C  CD1   . LEU E 1  65  ? 167.474 194.564 156.218 1.00 72.88  ? 65  LEU E CD1   1 
ATOM   3334  C  CD2   . LEU E 1  65  ? 168.452 192.288 156.435 1.00 72.88  ? 65  LEU E CD2   1 
ATOM   3335  N  N     . PRO E 1  66  ? 164.151 191.178 159.415 1.00 70.54  ? 66  PRO E N     1 
ATOM   3336  C  CA    . PRO E 1  66  ? 163.803 190.690 160.760 1.00 70.54  ? 66  PRO E CA    1 
ATOM   3337  C  C     . PRO E 1  66  ? 163.859 189.184 160.882 1.00 70.54  ? 66  PRO E C     1 
ATOM   3338  O  O     . PRO E 1  66  ? 164.253 188.667 161.937 1.00 70.54  ? 66  PRO E O     1 
ATOM   3339  C  CB    . PRO E 1  66  ? 162.381 191.214 160.971 1.00 70.54  ? 66  PRO E CB    1 
ATOM   3340  C  CG    . PRO E 1  66  ? 162.280 192.364 160.102 1.00 70.54  ? 66  PRO E CG    1 
ATOM   3341  C  CD    . PRO E 1  66  ? 163.048 192.006 158.888 1.00 70.54  ? 66  PRO E CD    1 
ATOM   3342  N  N     . PHE E 1  67  ? 163.489 188.465 159.826 1.00 68.33  ? 67  PHE E N     1 
ATOM   3343  C  CA    . PHE E 1  67  ? 163.598 187.015 159.858 1.00 68.33  ? 67  PHE E CA    1 
ATOM   3344  C  C     . PHE E 1  67  ? 165.052 186.586 159.909 1.00 68.33  ? 67  PHE E C     1 
ATOM   3345  O  O     . PHE E 1  67  ? 165.405 185.659 160.646 1.00 68.33  ? 67  PHE E O     1 
ATOM   3346  C  CB    . PHE E 1  67  ? 162.908 186.414 158.639 1.00 68.33  ? 67  PHE E CB    1 
ATOM   3347  C  CG    . PHE E 1  67  ? 162.815 184.932 158.684 1.00 68.33  ? 67  PHE E CG    1 
ATOM   3348  C  CD1   . PHE E 1  67  ? 161.854 184.320 159.460 1.00 68.33  ? 67  PHE E CD1   1 
ATOM   3349  C  CD2   . PHE E 1  67  ? 163.693 184.146 157.971 1.00 68.33  ? 67  PHE E CD2   1 
ATOM   3350  C  CE1   . PHE E 1  67  ? 161.765 182.958 159.517 1.00 68.33  ? 67  PHE E CE1   1 
ATOM   3351  C  CE2   . PHE E 1  67  ? 163.614 182.785 158.037 1.00 68.33  ? 67  PHE E CE2   1 
ATOM   3352  C  CZ    . PHE E 1  67  ? 162.646 182.190 158.810 1.00 68.33  ? 67  PHE E CZ    1 
ATOM   3353  N  N     . GLN E 1  68  ? 165.905 187.274 159.150 1.00 72.38  ? 68  GLN E N     1 
ATOM   3354  C  CA    . GLN E 1  68  ? 167.324 186.951 159.109 1.00 72.38  ? 68  GLN E CA    1 
ATOM   3355  C  C     . GLN E 1  68  ? 167.984 187.196 160.459 1.00 72.38  ? 68  GLN E C     1 
ATOM   3356  O  O     . GLN E 1  68  ? 168.741 186.348 160.950 1.00 72.38  ? 68  GLN E O     1 
ATOM   3357  C  CB    . GLN E 1  68  ? 167.979 187.770 158.002 1.00 72.38  ? 68  GLN E CB    1 
ATOM   3358  C  CG    . GLN E 1  68  ? 169.432 187.476 157.732 1.00 72.38  ? 68  GLN E CG    1 
ATOM   3359  C  CD    . GLN E 1  68  ? 169.935 188.213 156.507 1.00 72.38  ? 68  GLN E CD    1 
ATOM   3360  O  OE1   . GLN E 1  68  ? 169.184 188.945 155.861 1.00 72.38  ? 68  GLN E OE1   1 
ATOM   3361  N  NE2   . GLN E 1  68  ? 171.203 188.029 156.180 1.00 72.38  ? 68  GLN E NE2   1 
ATOM   3362  N  N     . ARG E 1  69  ? 167.663 188.327 161.094 1.00 71.84  ? 69  ARG E N     1 
ATOM   3363  C  CA    . ARG E 1  69  ? 168.150 188.589 162.445 1.00 71.84  ? 69  ARG E CA    1 
ATOM   3364  C  C     . ARG E 1  69  ? 167.609 187.582 163.448 1.00 71.84  ? 69  ARG E C     1 
ATOM   3365  O  O     . ARG E 1  69  ? 168.297 187.247 164.420 1.00 71.84  ? 69  ARG E O     1 
ATOM   3366  C  CB    . ARG E 1  69  ? 167.766 190.003 162.874 1.00 71.84  ? 69  ARG E CB    1 
ATOM   3367  C  CG    . ARG E 1  69  ? 168.493 191.102 162.151 1.00 71.84  ? 69  ARG E CG    1 
ATOM   3368  C  CD    . ARG E 1  69  ? 168.232 192.440 162.808 1.00 71.84  ? 69  ARG E CD    1 
ATOM   3369  N  NE    . ARG E 1  69  ? 166.828 192.822 162.760 1.00 71.84  ? 69  ARG E NE    1 
ATOM   3370  C  CZ    . ARG E 1  69  ? 166.266 193.446 161.732 1.00 71.84  ? 69  ARG E CZ    1 
ATOM   3371  N  NH1   . ARG E 1  69  ? 166.985 193.741 160.659 1.00 71.84  ? 69  ARG E NH1   1 
ATOM   3372  N  NH2   . ARG E 1  69  ? 164.984 193.770 161.770 1.00 71.84  ? 69  ARG E NH2   1 
ATOM   3373  N  N     . LEU E 1  70  ? 166.391 187.087 163.224 1.00 69.43  ? 70  LEU E N     1 
ATOM   3374  C  CA    . LEU E 1  70  ? 165.818 186.087 164.117 1.00 69.43  ? 70  LEU E CA    1 
ATOM   3375  C  C     . LEU E 1  70  ? 166.569 184.773 164.032 1.00 69.43  ? 70  LEU E C     1 
ATOM   3376  O  O     . LEU E 1  70  ? 166.861 184.148 165.059 1.00 69.43  ? 70  LEU E O     1 
ATOM   3377  C  CB    . LEU E 1  70  ? 164.350 185.877 163.775 1.00 69.43  ? 70  LEU E CB    1 
ATOM   3378  C  CG    . LEU E 1  70  ? 163.602 184.827 164.584 1.00 69.43  ? 70  LEU E CG    1 
ATOM   3379  C  CD1   . LEU E 1  70  ? 163.614 185.187 166.048 1.00 69.43  ? 70  LEU E CD1   1 
ATOM   3380  C  CD2   . LEU E 1  70  ? 162.178 184.733 164.081 1.00 69.43  ? 70  LEU E CD2   1 
ATOM   3381  N  N     . VAL E 1  71  ? 166.898 184.348 162.813 1.00 73.21  ? 71  VAL E N     1 
ATOM   3382  C  CA    . VAL E 1  71  ? 167.639 183.108 162.620 1.00 73.21  ? 71  VAL E CA    1 
ATOM   3383  C  C     . VAL E 1  71  ? 169.049 183.234 163.187 1.00 73.21  ? 71  VAL E C     1 
ATOM   3384  O  O     . VAL E 1  71  ? 169.572 182.293 163.796 1.00 73.21  ? 71  VAL E O     1 
ATOM   3385  C  CB    . VAL E 1  71  ? 167.637 182.735 161.125 1.00 73.21  ? 71  VAL E CB    1 
ATOM   3386  C  CG1   . VAL E 1  71  ? 168.536 181.576 160.842 1.00 73.21  ? 71  VAL E CG1   1 
ATOM   3387  C  CG2   . VAL E 1  71  ? 166.239 182.388 160.687 1.00 73.21  ? 71  VAL E CG2   1 
ATOM   3388  N  N     . ARG E 1  72  ? 169.665 184.413 163.051 1.00 73.15  ? 72  ARG E N     1 
ATOM   3389  C  CA    . ARG E 1  72  ? 171.001 184.597 163.608 1.00 73.15  ? 72  ARG E CA    1 
ATOM   3390  C  C     . ARG E 1  72  ? 170.978 184.601 165.131 1.00 73.15  ? 72  ARG E C     1 
ATOM   3391  O  O     . ARG E 1  72  ? 171.854 184.008 165.770 1.00 73.15  ? 72  ARG E O     1 
ATOM   3392  C  CB    . ARG E 1  72  ? 171.618 185.888 163.077 1.00 73.15  ? 72  ARG E CB    1 
ATOM   3393  C  CG    . ARG E 1  72  ? 171.925 185.845 161.597 1.00 73.15  ? 72  ARG E CG    1 
ATOM   3394  C  CD    . ARG E 1  72  ? 172.401 187.188 161.079 1.00 73.15  ? 72  ARG E CD    1 
ATOM   3395  N  NE    . ARG E 1  72  ? 172.482 187.210 159.624 1.00 73.15  ? 72  ARG E NE    1 
ATOM   3396  C  CZ    . ARG E 1  72  ? 173.562 186.859 158.940 1.00 73.15  ? 72  ARG E CZ    1 
ATOM   3397  N  NH1   . ARG E 1  72  ? 174.647 186.464 159.583 1.00 73.15  ? 72  ARG E NH1   1 
ATOM   3398  N  NH2   . ARG E 1  72  ? 173.564 186.899 157.621 1.00 73.15  ? 72  ARG E NH2   1 
ATOM   3399  N  N     . GLU E 1  73  ? 169.965 185.233 165.734 1.00 77.93  ? 73  GLU E N     1 
ATOM   3400  C  CA    . GLU E 1  73  ? 169.926 185.316 167.190 1.00 77.93  ? 73  GLU E CA    1 
ATOM   3401  C  C     . GLU E 1  73  ? 169.590 183.971 167.818 1.00 77.93  ? 73  GLU E C     1 
ATOM   3402  O  O     . GLU E 1  73  ? 170.135 183.622 168.872 1.00 77.93  ? 73  GLU E O     1 
ATOM   3403  C  CB    . GLU E 1  73  ? 168.933 186.386 167.641 1.00 77.93  ? 73  GLU E CB    1 
ATOM   3404  C  CG    . GLU E 1  73  ? 168.905 186.561 169.143 1.00 77.93  ? 73  GLU E CG    1 
ATOM   3405  C  CD    . GLU E 1  73  ? 168.063 187.725 169.598 1.00 77.93  ? 73  GLU E CD    1 
ATOM   3406  O  OE1   . GLU E 1  73  ? 167.529 188.449 168.733 1.00 77.93  ? 73  GLU E OE1   1 
ATOM   3407  O  OE2   . GLU E 1  73  ? 167.923 187.910 170.823 1.00 77.93  ? 73  GLU E OE2   1 
ATOM   3408  N  N     . ILE E 1  74  ? 168.718 183.189 167.178 1.00 75.70  ? 74  ILE E N     1 
ATOM   3409  C  CA    . ILE E 1  74  ? 168.527 181.815 167.632 1.00 75.70  ? 74  ILE E CA    1 
ATOM   3410  C  C     . ILE E 1  74  ? 169.796 181.004 167.397 1.00 75.70  ? 74  ILE E C     1 
ATOM   3411  O  O     . ILE E 1  74  ? 170.157 180.145 168.210 1.00 75.70  ? 74  ILE E O     1 
ATOM   3412  C  CB    . ILE E 1  74  ? 167.293 181.205 166.939 1.00 75.70  ? 74  ILE E CB    1 
ATOM   3413  C  CG1   . ILE E 1  74  ? 166.033 181.959 167.357 1.00 75.70  ? 74  ILE E CG1   1 
ATOM   3414  C  CG2   . ILE E 1  74  ? 167.114 179.746 167.286 1.00 75.70  ? 74  ILE E CG2   1 
ATOM   3415  C  CD1   . ILE E 1  74  ? 164.811 181.625 166.532 1.00 75.70  ? 74  ILE E CD1   1 
ATOM   3416  N  N     . ALA E 1  75  ? 170.545 181.333 166.348 1.00 79.07  ? 75  ALA E N     1 
ATOM   3417  C  CA    . ALA E 1  75  ? 171.744 180.579 166.017 1.00 79.07  ? 75  ALA E CA    1 
ATOM   3418  C  C     . ALA E 1  75  ? 172.915 180.874 166.944 1.00 79.07  ? 75  ALA E C     1 
ATOM   3419  O  O     . ALA E 1  75  ? 173.840 180.058 167.018 1.00 79.07  ? 75  ALA E O     1 
ATOM   3420  C  CB    . ALA E 1  75  ? 172.158 180.865 164.578 1.00 79.07  ? 75  ALA E CB    1 
ATOM   3421  N  N     . GLN E 1  76  ? 172.907 182.011 167.646 1.00 81.34  ? 76  GLN E N     1 
ATOM   3422  C  CA    . GLN E 1  76  ? 174.041 182.347 168.501 1.00 81.34  ? 76  GLN E CA    1 
ATOM   3423  C  C     . GLN E 1  76  ? 174.138 181.468 169.737 1.00 81.34  ? 76  GLN E C     1 
ATOM   3424  O  O     . GLN E 1  76  ? 175.208 181.406 170.349 1.00 81.34  ? 76  GLN E O     1 
ATOM   3425  C  CB    . GLN E 1  76  ? 173.981 183.801 168.954 1.00 81.34  ? 76  GLN E CB    1 
ATOM   3426  C  CG    . GLN E 1  76  ? 174.258 184.814 167.879 1.00 81.34  ? 76  GLN E CG    1 
ATOM   3427  C  CD    . GLN E 1  76  ? 174.271 186.218 168.433 1.00 81.34  ? 76  GLN E CD    1 
ATOM   3428  O  OE1   . GLN E 1  76  ? 174.014 186.428 169.618 1.00 81.34  ? 76  GLN E OE1   1 
ATOM   3429  N  NE2   . GLN E 1  76  ? 174.577 187.188 167.582 1.00 81.34  ? 76  GLN E NE2   1 
ATOM   3430  N  N     . ASP E 1  77  ? 173.055 180.797 170.118 1.00 80.82  ? 77  ASP E N     1 
ATOM   3431  C  CA    . ASP E 1  77  ? 173.053 180.066 171.379 1.00 80.82  ? 77  ASP E CA    1 
ATOM   3432  C  C     . ASP E 1  77  ? 173.883 178.796 171.291 1.00 80.82  ? 77  ASP E C     1 
ATOM   3433  O  O     . ASP E 1  77  ? 174.623 178.467 172.225 1.00 80.82  ? 77  ASP E O     1 
ATOM   3434  C  CB    . ASP E 1  77  ? 171.621 179.735 171.787 1.00 80.82  ? 77  ASP E CB    1 
ATOM   3435  C  CG    . ASP E 1  77  ? 170.823 180.964 172.143 1.00 80.82  ? 77  ASP E CG    1 
ATOM   3436  O  OD1   . ASP E 1  77  ? 171.436 181.975 172.542 1.00 80.82  ? 77  ASP E OD1   1 
ATOM   3437  O  OD2   . ASP E 1  77  ? 169.582 180.918 172.043 1.00 80.82  ? 77  ASP E OD2   1 
ATOM   3438  N  N     . PHE E 1  78  ? 173.780 178.070 170.184 1.00 79.82  ? 78  PHE E N     1 
ATOM   3439  C  CA    . PHE E 1  78  ? 174.469 176.794 170.099 1.00 79.82  ? 78  PHE E CA    1 
ATOM   3440  C  C     . PHE E 1  78  ? 175.947 176.979 169.816 1.00 79.82  ? 78  PHE E C     1 
ATOM   3441  O  O     . PHE E 1  78  ? 176.770 176.203 170.309 1.00 79.82  ? 78  PHE E O     1 
ATOM   3442  C  CB    . PHE E 1  78  ? 173.831 175.928 169.023 1.00 79.82  ? 78  PHE E CB    1 
ATOM   3443  C  CG    . PHE E 1  78  ? 172.363 175.764 169.199 1.00 79.82  ? 78  PHE E CG    1 
ATOM   3444  C  CD1   . PHE E 1  78  ? 171.860 174.996 170.229 1.00 79.82  ? 78  PHE E CD1   1 
ATOM   3445  C  CD2   . PHE E 1  78  ? 171.478 176.374 168.332 1.00 79.82  ? 78  PHE E CD2   1 
ATOM   3446  C  CE1   . PHE E 1  78  ? 170.504 174.856 170.397 1.00 79.82  ? 78  PHE E CE1   1 
ATOM   3447  C  CE2   . PHE E 1  78  ? 170.123 176.228 168.494 1.00 79.82  ? 78  PHE E CE2   1 
ATOM   3448  C  CZ    . PHE E 1  78  ? 169.636 175.465 169.524 1.00 79.82  ? 78  PHE E CZ    1 
ATOM   3449  N  N     . LYS E 1  79  ? 176.295 178.006 169.050 1.00 79.99  ? 79  LYS E N     1 
ATOM   3450  C  CA    . LYS E 1  79  ? 177.680 178.301 168.732 1.00 79.99  ? 79  LYS E CA    1 
ATOM   3451  C  C     . LYS E 1  79  ? 177.714 179.768 168.328 1.00 79.99  ? 79  LYS E C     1 
ATOM   3452  O  O     . LYS E 1  79  ? 176.693 180.340 167.945 1.00 79.99  ? 79  LYS E O     1 
ATOM   3453  C  CB    . LYS E 1  79  ? 178.195 177.357 167.638 1.00 79.99  ? 79  LYS E CB    1 
ATOM   3454  C  CG    . LYS E 1  79  ? 179.692 177.309 167.470 1.00 79.99  ? 79  LYS E CG    1 
ATOM   3455  C  CD    . LYS E 1  79  ? 180.134 178.106 166.288 1.00 79.99  ? 79  LYS E CD    1 
ATOM   3456  C  CE    . LYS E 1  79  ? 179.717 177.424 165.010 1.00 79.99  ? 79  LYS E CE    1 
ATOM   3457  N  NZ    . LYS E 1  79  ? 180.164 178.203 163.828 1.00 79.99  ? 79  LYS E NZ    1 
ATOM   3458  N  N     . THR E 1  80  ? 178.880 180.387 168.464 1.00 81.37  ? 80  THR E N     1 
ATOM   3459  C  CA    . THR E 1  80  ? 179.006 181.828 168.302 1.00 81.37  ? 80  THR E CA    1 
ATOM   3460  C  C     . THR E 1  80  ? 179.764 182.165 167.024 1.00 81.37  ? 80  THR E C     1 
ATOM   3461  O  O     . THR E 1  80  ? 180.446 181.316 166.444 1.00 81.37  ? 80  THR E O     1 
ATOM   3462  C  CB    . THR E 1  80  ? 179.722 182.442 169.506 1.00 81.37  ? 80  THR E CB    1 
ATOM   3463  O  OG1   . THR E 1  80  ? 181.065 181.951 169.564 1.00 81.37  ? 80  THR E OG1   1 
ATOM   3464  C  CG2   . THR E 1  80  ? 179.009 182.053 170.784 1.00 81.37  ? 80  THR E CG2   1 
ATOM   3465  N  N     . ASP E 1  81  ? 179.619 183.427 166.598 1.00 82.93  ? 81  ASP E N     1 
ATOM   3466  C  CA    . ASP E 1  81  ? 180.377 184.036 165.498 1.00 82.93  ? 81  ASP E CA    1 
ATOM   3467  C  C     . ASP E 1  81  ? 180.156 183.275 164.184 1.00 82.93  ? 81  ASP E C     1 
ATOM   3468  O  O     . ASP E 1  81  ? 181.048 182.629 163.637 1.00 82.93  ? 81  ASP E O     1 
ATOM   3469  C  CB    . ASP E 1  81  ? 181.862 184.126 165.869 1.00 82.93  ? 81  ASP E CB    1 
ATOM   3470  C  CG    . ASP E 1  81  ? 182.664 184.941 164.888 1.00 82.93  ? 81  ASP E CG    1 
ATOM   3471  O  OD1   . ASP E 1  81  ? 182.537 186.180 164.908 1.00 82.93  ? 81  ASP E OD1   1 
ATOM   3472  O  OD2   . ASP E 1  81  ? 183.426 184.342 164.101 1.00 82.93  ? 81  ASP E OD2   1 
ATOM   3473  N  N     . LEU E 1  82  ? 178.919 183.344 163.709 1.00 79.76  ? 82  LEU E N     1 
ATOM   3474  C  CA    . LEU E 1  82  ? 178.469 182.536 162.584 1.00 79.76  ? 82  LEU E CA    1 
ATOM   3475  C  C     . LEU E 1  82  ? 178.476 183.310 161.277 1.00 79.76  ? 82  LEU E C     1 
ATOM   3476  O  O     . LEU E 1  82  ? 178.672 184.526 161.239 1.00 79.76  ? 82  LEU E O     1 
ATOM   3477  C  CB    . LEU E 1  82  ? 177.061 181.997 162.826 1.00 79.76  ? 82  LEU E CB    1 
ATOM   3478  C  CG    . LEU E 1  82  ? 176.931 180.590 163.388 1.00 79.76  ? 82  LEU E CG    1 
ATOM   3479  C  CD1   . LEU E 1  82  ? 177.505 179.623 162.379 1.00 79.76  ? 82  LEU E CD1   1 
ATOM   3480  C  CD2   . LEU E 1  82  ? 177.623 180.452 164.723 1.00 79.76  ? 82  LEU E CD2   1 
ATOM   3481  N  N     . ARG E 1  83  ? 178.216 182.571 160.198 1.00 78.32  ? 83  ARG E N     1 
ATOM   3482  C  CA    . ARG E 1  83  ? 178.060 183.107 158.854 1.00 78.32  ? 83  ARG E CA    1 
ATOM   3483  C  C     . ARG E 1  83  ? 177.049 182.254 158.102 1.00 78.32  ? 83  ARG E C     1 
ATOM   3484  O  O     . ARG E 1  83  ? 177.104 181.024 158.164 1.00 78.32  ? 83  ARG E O     1 
ATOM   3485  C  CB    . ARG E 1  83  ? 179.394 183.140 158.093 1.00 78.32  ? 83  ARG E CB    1 
ATOM   3486  C  CG    . ARG E 1  83  ? 180.331 184.271 158.502 1.00 78.32  ? 83  ARG E CG    1 
ATOM   3487  C  CD    . ARG E 1  83  ? 181.680 184.236 157.805 1.00 78.32  ? 83  ARG E CD    1 
ATOM   3488  N  NE    . ARG E 1  83  ? 182.516 185.337 158.267 1.00 78.32  ? 83  ARG E NE    1 
ATOM   3489  C  CZ    . ARG E 1  83  ? 183.294 185.283 159.343 1.00 78.32  ? 83  ARG E CZ    1 
ATOM   3490  N  NH1   . ARG E 1  83  ? 183.348 184.184 160.082 1.00 78.32  ? 83  ARG E NH1   1 
ATOM   3491  N  NH2   . ARG E 1  83  ? 184.017 186.335 159.693 1.00 78.32  ? 83  ARG E NH2   1 
ATOM   3492  N  N     . PHE E 1  84  ? 176.139 182.913 157.386 1.00 72.86  ? 84  PHE E N     1 
ATOM   3493  C  CA    . PHE E 1  84  ? 175.046 182.270 156.666 1.00 72.86  ? 84  PHE E CA    1 
ATOM   3494  C  C     . PHE E 1  84  ? 175.112 182.558 155.178 1.00 72.86  ? 84  PHE E C     1 
ATOM   3495  O  O     . PHE E 1  84  ? 175.351 183.695 154.777 1.00 72.86  ? 84  PHE E O     1 
ATOM   3496  C  CB    . PHE E 1  84  ? 173.703 182.760 157.177 1.00 72.86  ? 84  PHE E CB    1 
ATOM   3497  C  CG    . PHE E 1  84  ? 173.262 182.106 158.432 1.00 72.86  ? 84  PHE E CG    1 
ATOM   3498  C  CD1   . PHE E 1  84  ? 173.683 180.832 158.746 1.00 72.86  ? 84  PHE E CD1   1 
ATOM   3499  C  CD2   . PHE E 1  84  ? 172.453 182.775 159.322 1.00 72.86  ? 84  PHE E CD2   1 
ATOM   3500  C  CE1   . PHE E 1  84  ? 173.275 180.220 159.908 1.00 72.86  ? 84  PHE E CE1   1 
ATOM   3501  C  CE2   . PHE E 1  84  ? 172.050 182.174 160.492 1.00 72.86  ? 84  PHE E CE2   1 
ATOM   3502  C  CZ    . PHE E 1  84  ? 172.458 180.891 160.783 1.00 72.86  ? 84  PHE E CZ    1 
ATOM   3503  N  N     . GLN E 1  85  ? 174.858 181.545 154.357 1.00 69.76  ? 85  GLN E N     1 
ATOM   3504  C  CA    . GLN E 1  85  ? 174.476 181.839 152.985 1.00 69.76  ? 85  GLN E CA    1 
ATOM   3505  C  C     . GLN E 1  85  ? 173.078 182.432 152.973 1.00 69.76  ? 85  GLN E C     1 
ATOM   3506  O  O     . GLN E 1  85  ? 172.281 182.207 153.885 1.00 69.76  ? 85  GLN E O     1 
ATOM   3507  C  CB    . GLN E 1  85  ? 174.516 180.588 152.114 1.00 69.76  ? 85  GLN E CB    1 
ATOM   3508  C  CG    . GLN E 1  85  ? 175.902 180.077 151.801 1.00 69.76  ? 85  GLN E CG    1 
ATOM   3509  C  CD    . GLN E 1  85  ? 175.866 178.883 150.871 1.00 69.76  ? 85  GLN E CD    1 
ATOM   3510  O  OE1   . GLN E 1  85  ? 174.794 178.406 150.519 1.00 69.76  ? 85  GLN E OE1   1 
ATOM   3511  N  NE2   . GLN E 1  85  ? 177.033 178.400 150.462 1.00 69.76  ? 85  GLN E NE2   1 
ATOM   3512  N  N     . SER E 1  86  ? 172.779 183.210 151.933 1.00 67.31  ? 86  SER E N     1 
ATOM   3513  C  CA    . SER E 1  86  ? 171.485 183.884 151.876 1.00 67.31  ? 86  SER E CA    1 
ATOM   3514  C  C     . SER E 1  86  ? 170.359 182.903 151.571 1.00 67.31  ? 86  SER E C     1 
ATOM   3515  O  O     . SER E 1  86  ? 169.282 182.960 152.186 1.00 67.31  ? 86  SER E O     1 
ATOM   3516  C  CB    . SER E 1  86  ? 171.528 184.990 150.830 1.00 67.31  ? 86  SER E CB    1 
ATOM   3517  O  OG    . SER E 1  86  ? 171.668 184.442 149.536 1.00 67.31  ? 86  SER E OG    1 
ATOM   3518  N  N     . SER E 1  87  ? 170.600 181.981 150.638 1.00 69.79  ? 87  SER E N     1 
ATOM   3519  C  CA    . SER E 1  87  ? 169.585 181.015 150.246 1.00 69.79  ? 87  SER E CA    1 
ATOM   3520  C  C     . SER E 1  87  ? 169.246 180.043 151.365 1.00 69.79  ? 87  SER E C     1 
ATOM   3521  O  O     . SER E 1  87  ? 168.156 179.469 151.356 1.00 69.79  ? 87  SER E O     1 
ATOM   3522  C  CB    . SER E 1  87  ? 170.047 180.248 149.011 1.00 69.79  ? 87  SER E CB    1 
ATOM   3523  O  OG    . SER E 1  87  ? 171.169 179.443 149.313 1.00 69.79  ? 87  SER E OG    1 
ATOM   3524  N  N     . ALA E 1  88  ? 170.149 179.849 152.324 1.00 67.53  ? 88  ALA E N     1 
ATOM   3525  C  CA    . ALA E 1  88  ? 169.806 179.065 153.502 1.00 67.53  ? 88  ALA E CA    1 
ATOM   3526  C  C     . ALA E 1  88  ? 168.791 179.799 154.362 1.00 67.53  ? 88  ALA E C     1 
ATOM   3527  O  O     . ALA E 1  88  ? 167.907 179.174 154.955 1.00 67.53  ? 88  ALA E O     1 
ATOM   3528  C  CB    . ALA E 1  88  ? 171.060 178.751 154.306 1.00 67.53  ? 88  ALA E CB    1 
ATOM   3529  N  N     . VAL E 1  89  ? 168.891 181.126 154.426 1.00 67.86  ? 89  VAL E N     1 
ATOM   3530  C  CA    . VAL E 1  89  ? 167.887 181.895 155.143 1.00 67.86  ? 89  VAL E CA    1 
ATOM   3531  C  C     . VAL E 1  89  ? 166.564 181.834 154.396 1.00 67.86  ? 89  VAL E C     1 
ATOM   3532  O  O     . VAL E 1  89  ? 165.490 181.771 155.018 1.00 67.86  ? 89  VAL E O     1 
ATOM   3533  C  CB    . VAL E 1  89  ? 168.390 183.333 155.345 1.00 67.86  ? 89  VAL E CB    1 
ATOM   3534  C  CG1   . VAL E 1  89  ? 167.376 184.183 156.078 1.00 67.86  ? 89  VAL E CG1   1 
ATOM   3535  C  CG2   . VAL E 1  89  ? 169.686 183.310 156.107 1.00 67.86  ? 89  VAL E CG2   1 
ATOM   3536  N  N     . MET E 1  90  ? 166.620 181.793 153.059 1.00 67.74  ? 90  MET E N     1 
ATOM   3537  C  CA    . MET E 1  90  ? 165.418 181.502 152.278 1.00 67.74  ? 90  MET E CA    1 
ATOM   3538  C  C     . MET E 1  90  ? 164.846 180.131 152.615 1.00 67.74  ? 90  MET E C     1 
ATOM   3539  O  O     . MET E 1  90  ? 163.623 179.957 152.680 1.00 67.74  ? 90  MET E O     1 
ATOM   3540  C  CB    . MET E 1  90  ? 165.728 181.580 150.788 1.00 67.74  ? 90  MET E CB    1 
ATOM   3541  C  CG    . MET E 1  90  ? 165.903 182.966 150.252 1.00 67.74  ? 90  MET E CG    1 
ATOM   3542  S  SD    . MET E 1  90  ? 164.327 183.806 150.305 1.00 67.74  ? 90  MET E SD    1 
ATOM   3543  C  CE    . MET E 1  90  ? 163.444 182.843 149.077 1.00 67.74  ? 90  MET E CE    1 
ATOM   3544  N  N     . ALA E 1  91  ? 165.717 179.153 152.862 1.00 67.90  ? 91  ALA E N     1 
ATOM   3545  C  CA    . ALA E 1  91  ? 165.255 177.790 153.092 1.00 67.90  ? 91  ALA E CA    1 
ATOM   3546  C  C     . ALA E 1  91  ? 164.583 177.657 154.448 1.00 67.90  ? 91  ALA E C     1 
ATOM   3547  O  O     . ALA E 1  91  ? 163.527 177.020 154.564 1.00 67.90  ? 91  ALA E O     1 
ATOM   3548  C  CB    . ALA E 1  91  ? 166.419 176.816 152.975 1.00 67.90  ? 91  ALA E CB    1 
ATOM   3549  N  N     . LEU E 1  92  ? 165.166 178.270 155.475 1.00 66.36  ? 92  LEU E N     1 
ATOM   3550  C  CA    . LEU E 1  92  ? 164.498 178.309 156.768 1.00 66.36  ? 92  LEU E CA    1 
ATOM   3551  C  C     . LEU E 1  92  ? 163.217 179.123 156.714 1.00 66.36  ? 92  LEU E C     1 
ATOM   3552  O  O     . LEU E 1  92  ? 162.281 178.850 157.476 1.00 66.36  ? 92  LEU E O     1 
ATOM   3553  C  CB    . LEU E 1  92  ? 165.425 178.866 157.832 1.00 66.36  ? 92  LEU E CB    1 
ATOM   3554  C  CG    . LEU E 1  92  ? 166.298 177.843 158.551 1.00 66.36  ? 92  LEU E CG    1 
ATOM   3555  C  CD1   . LEU E 1  92  ? 167.440 177.368 157.729 1.00 66.36  ? 92  LEU E CD1   1 
ATOM   3556  C  CD2   . LEU E 1  92  ? 166.804 178.465 159.799 1.00 66.36  ? 92  LEU E CD2   1 
ATOM   3557  N  N     . GLN E 1  93  ? 163.152 180.110 155.820 1.00 67.71  ? 93  GLN E N     1 
ATOM   3558  C  CA    . GLN E 1  93  ? 161.894 180.811 155.609 1.00 67.71  ? 93  GLN E CA    1 
ATOM   3559  C  C     . GLN E 1  93  ? 160.843 179.889 155.014 1.00 67.71  ? 93  GLN E C     1 
ATOM   3560  O  O     . GLN E 1  93  ? 159.657 179.983 155.374 1.00 67.71  ? 93  GLN E O     1 
ATOM   3561  C  CB    . GLN E 1  93  ? 162.143 182.025 154.726 1.00 67.71  ? 93  GLN E CB    1 
ATOM   3562  C  CG    . GLN E 1  93  ? 160.989 182.959 154.586 1.00 67.71  ? 93  GLN E CG    1 
ATOM   3563  C  CD    . GLN E 1  93  ? 161.391 184.208 153.853 1.00 67.71  ? 93  GLN E CD    1 
ATOM   3564  O  OE1   . GLN E 1  93  ? 162.536 184.348 153.429 1.00 67.71  ? 93  GLN E OE1   1 
ATOM   3565  N  NE2   . GLN E 1  93  ? 160.458 185.131 153.705 1.00 67.71  ? 93  GLN E NE2   1 
ATOM   3566  N  N     . GLU E 1  94  ? 161.262 178.959 154.157 1.00 62.73  ? 94  GLU E N     1 
ATOM   3567  C  CA    . GLU E 1  94  ? 160.306 178.018 153.595 1.00 62.73  ? 94  GLU E CA    1 
ATOM   3568  C  C     . GLU E 1  94  ? 159.834 177.017 154.636 1.00 62.73  ? 94  GLU E C     1 
ATOM   3569  O  O     . GLU E 1  94  ? 158.666 176.620 154.635 1.00 62.73  ? 94  GLU E O     1 
ATOM   3570  C  CB    . GLU E 1  94  ? 160.907 177.282 152.409 1.00 62.73  ? 94  GLU E CB    1 
ATOM   3571  C  CG    . GLU E 1  94  ? 161.289 178.156 151.247 1.00 62.73  ? 94  GLU E CG    1 
ATOM   3572  C  CD    . GLU E 1  94  ? 160.116 178.842 150.591 1.00 62.73  ? 94  GLU E CD    1 
ATOM   3573  O  OE1   . GLU E 1  94  ? 158.981 178.328 150.633 1.00 62.73  ? 94  GLU E OE1   1 
ATOM   3574  O  OE2   . GLU E 1  94  ? 160.343 179.899 149.989 1.00 62.73  ? 94  GLU E OE2   1 
ATOM   3575  N  N     . ALA E 1  95  ? 160.729 176.583 155.522 1.00 63.25  ? 95  ALA E N     1 
ATOM   3576  C  CA    . ALA E 1  95  ? 160.294 175.670 156.569 1.00 63.25  ? 95  ALA E CA    1 
ATOM   3577  C  C     . ALA E 1  95  ? 159.379 176.361 157.559 1.00 63.25  ? 95  ALA E C     1 
ATOM   3578  O  O     . ALA E 1  95  ? 158.452 175.735 158.088 1.00 63.25  ? 95  ALA E O     1 
ATOM   3579  C  CB    . ALA E 1  95  ? 161.495 175.087 157.295 1.00 63.25  ? 95  ALA E CB    1 
ATOM   3580  N  N     . SER E 1  96  ? 159.615 177.650 157.797 1.00 63.41  ? 96  SER E N     1 
ATOM   3581  C  CA    . SER E 1  96  ? 158.752 178.422 158.680 1.00 63.41  ? 96  SER E CA    1 
ATOM   3582  C  C     . SER E 1  96  ? 157.352 178.558 158.102 1.00 63.41  ? 96  SER E C     1 
ATOM   3583  O  O     . SER E 1  96  ? 156.359 178.331 158.806 1.00 63.41  ? 96  SER E O     1 
ATOM   3584  C  CB    . SER E 1  96  ? 159.365 179.794 158.910 1.00 63.41  ? 96  SER E CB    1 
ATOM   3585  O  OG    . SER E 1  96  ? 160.647 179.658 159.488 1.00 63.41  ? 96  SER E OG    1 
ATOM   3586  N  N     . GLU E 1  97  ? 157.254 178.908 156.818 1.00 61.38  ? 97  GLU E N     1 
ATOM   3587  C  CA    . GLU E 1  97  ? 155.931 179.064 156.229 1.00 61.38  ? 97  GLU E CA    1 
ATOM   3588  C  C     . GLU E 1  97  ? 155.217 177.724 156.083 1.00 61.38  ? 97  GLU E C     1 
ATOM   3589  O  O     . GLU E 1  97  ? 154.002 177.649 156.283 1.00 61.38  ? 97  GLU E O     1 
ATOM   3590  C  CB    . GLU E 1  97  ? 156.015 179.801 154.892 1.00 61.38  ? 97  GLU E CB    1 
ATOM   3591  C  CG    . GLU E 1  97  ? 156.826 179.155 153.792 1.00 61.38  ? 97  GLU E CG    1 
ATOM   3592  C  CD    . GLU E 1  97  ? 156.022 178.189 152.952 1.00 61.38  ? 97  GLU E CD    1 
ATOM   3593  O  OE1   . GLU E 1  97  ? 154.781 178.270 152.992 1.00 61.38  ? 97  GLU E OE1   1 
ATOM   3594  O  OE2   . GLU E 1  97  ? 156.625 177.346 152.267 1.00 61.38  ? 97  GLU E OE2   1 
ATOM   3595  N  N     . ALA E 1  98  ? 155.948 176.654 155.771 1.00 58.75  ? 98  ALA E N     1 
ATOM   3596  C  CA    . ALA E 1  98  ? 155.304 175.353 155.599 1.00 58.75  ? 98  ALA E CA    1 
ATOM   3597  C  C     . ALA E 1  98  ? 154.789 174.816 156.919 1.00 58.75  ? 98  ALA E C     1 
ATOM   3598  O  O     . ALA E 1  98  ? 153.650 174.337 157.007 1.00 58.75  ? 98  ALA E O     1 
ATOM   3599  C  CB    . ALA E 1  98  ? 156.278 174.358 154.989 1.00 58.75  ? 98  ALA E CB    1 
ATOM   3600  N  N     . TYR E 1  99  ? 155.603 174.922 157.962 1.00 60.03  ? 99  TYR E N     1 
ATOM   3601  C  CA    . TYR E 1  99  ? 155.212 174.356 159.238 1.00 60.03  ? 99  TYR E CA    1 
ATOM   3602  C  C     . TYR E 1  99  ? 154.140 175.197 159.918 1.00 60.03  ? 99  TYR E C     1 
ATOM   3603  O  O     . TYR E 1  99  ? 153.188 174.641 160.486 1.00 60.03  ? 99  TYR E O     1 
ATOM   3604  C  CB    . TYR E 1  99  ? 156.438 174.205 160.120 1.00 60.03  ? 99  TYR E CB    1 
ATOM   3605  C  CG    . TYR E 1  99  ? 156.112 173.738 161.494 1.00 60.03  ? 99  TYR E CG    1 
ATOM   3606  C  CD1   . TYR E 1  99  ? 155.695 172.441 161.730 1.00 60.03  ? 99  TYR E CD1   1 
ATOM   3607  C  CD2   . TYR E 1  99  ? 156.228 174.597 162.566 1.00 60.03  ? 99  TYR E CD2   1 
ATOM   3608  C  CE1   . TYR E 1  99  ? 155.398 172.017 163.007 1.00 60.03  ? 99  TYR E CE1   1 
ATOM   3609  C  CE2   . TYR E 1  99  ? 155.933 174.188 163.838 1.00 60.03  ? 99  TYR E CE2   1 
ATOM   3610  C  CZ    . TYR E 1  99  ? 155.519 172.903 164.056 1.00 60.03  ? 99  TYR E CZ    1 
ATOM   3611  O  OH    . TYR E 1  99  ? 155.236 172.531 165.342 1.00 60.03  ? 99  TYR E OH    1 
ATOM   3612  N  N     . LEU E 1  100 ? 154.253 176.530 159.858 1.00 56.85  ? 100 LEU E N     1 
ATOM   3613  C  CA    . LEU E 1  100 ? 153.209 177.355 160.459 1.00 56.85  ? 100 LEU E CA    1 
ATOM   3614  C  C     . LEU E 1  100 ? 151.902 177.241 159.687 1.00 56.85  ? 100 LEU E C     1 
ATOM   3615  O  O     . LEU E 1  100 ? 150.842 177.044 160.292 1.00 56.85  ? 100 LEU E O     1 
ATOM   3616  C  CB    . LEU E 1  100 ? 153.630 178.818 160.555 1.00 56.85  ? 100 LEU E CB    1 
ATOM   3617  C  CG    . LEU E 1  100 ? 154.695 179.183 161.580 1.00 56.85  ? 100 LEU E CG    1 
ATOM   3618  C  CD1   . LEU E 1  100 ? 154.961 180.668 161.543 1.00 56.85  ? 100 LEU E CD1   1 
ATOM   3619  C  CD2   . LEU E 1  100 ? 154.287 178.740 162.959 1.00 56.85  ? 100 LEU E CD2   1 
ATOM   3620  N  N     . VAL E 1  101 ? 151.968 177.338 158.355 1.00 53.81  ? 101 VAL E N     1 
ATOM   3621  C  CA    . VAL E 1  101 ? 150.772 177.299 157.516 1.00 53.81  ? 101 VAL E CA    1 
ATOM   3622  C  C     . VAL E 1  101 ? 150.039 175.970 157.662 1.00 53.81  ? 101 VAL E C     1 
ATOM   3623  O  O     . VAL E 1  101 ? 148.813 175.944 157.836 1.00 53.81  ? 101 VAL E O     1 
ATOM   3624  C  CB    . VAL E 1  101 ? 151.150 177.608 156.055 1.00 53.81  ? 101 VAL E CB    1 
ATOM   3625  C  CG1   . VAL E 1  101 ? 150.127 177.059 155.093 1.00 53.81  ? 101 VAL E CG1   1 
ATOM   3626  C  CG2   . VAL E 1  101 ? 151.191 179.106 155.866 1.00 53.81  ? 101 VAL E CG2   1 
ATOM   3627  N  N     . ALA E 1  102 ? 150.779 174.860 157.668 1.00 53.60  ? 102 ALA E N     1 
ATOM   3628  C  CA    . ALA E 1  102 ? 150.135 173.569 157.886 1.00 53.60  ? 102 ALA E CA    1 
ATOM   3629  C  C     . ALA E 1  102 ? 149.574 173.459 159.295 1.00 53.60  ? 102 ALA E C     1 
ATOM   3630  O  O     . ALA E 1  102 ? 148.513 172.846 159.500 1.00 53.60  ? 102 ALA E O     1 
ATOM   3631  C  CB    . ALA E 1  102 ? 151.123 172.440 157.613 1.00 53.60  ? 102 ALA E CB    1 
ATOM   3632  N  N     . LEU E 1  103 ? 150.235 174.095 160.263 1.00 55.18  ? 103 LEU E N     1 
ATOM   3633  C  CA    . LEU E 1  103 ? 149.687 174.104 161.610 1.00 55.18  ? 103 LEU E CA    1 
ATOM   3634  C  C     . LEU E 1  103 ? 148.396 174.922 161.693 1.00 55.18  ? 103 LEU E C     1 
ATOM   3635  O  O     . LEU E 1  103 ? 147.534 174.619 162.524 1.00 55.18  ? 103 LEU E O     1 
ATOM   3636  C  CB    . LEU E 1  103 ? 150.746 174.605 162.585 1.00 55.18  ? 103 LEU E CB    1 
ATOM   3637  C  CG    . LEU E 1  103 ? 150.539 174.427 164.083 1.00 55.18  ? 103 LEU E CG    1 
ATOM   3638  C  CD1   . LEU E 1  103 ? 151.878 174.141 164.713 1.00 55.18  ? 103 LEU E CD1   1 
ATOM   3639  C  CD2   . LEU E 1  103 ? 149.945 175.668 164.716 1.00 55.18  ? 103 LEU E CD2   1 
ATOM   3640  N  N     . PHE E 1  104 ? 148.215 175.929 160.827 1.00 54.56  ? 104 PHE E N     1 
ATOM   3641  C  CA    . PHE E 1  104 ? 146.923 176.615 160.812 1.00 54.56  ? 104 PHE E CA    1 
ATOM   3642  C  C     . PHE E 1  104 ? 145.875 175.853 160.018 1.00 54.56  ? 104 PHE E C     1 
ATOM   3643  O  O     . PHE E 1  104 ? 144.678 176.077 160.227 1.00 54.56  ? 104 PHE E O     1 
ATOM   3644  C  CB    . PHE E 1  104 ? 147.025 178.023 160.236 1.00 54.56  ? 104 PHE E CB    1 
ATOM   3645  C  CG    . PHE E 1  104 ? 147.861 178.945 161.040 1.00 54.56  ? 104 PHE E CG    1 
ATOM   3646  C  CD1   . PHE E 1  104 ? 147.474 179.310 162.305 1.00 54.56  ? 104 PHE E CD1   1 
ATOM   3647  C  CD2   . PHE E 1  104 ? 148.988 179.521 160.496 1.00 54.56  ? 104 PHE E CD2   1 
ATOM   3648  C  CE1   . PHE E 1  104 ? 148.240 180.175 163.044 1.00 54.56  ? 104 PHE E CE1   1 
ATOM   3649  C  CE2   . PHE E 1  104 ? 149.756 180.386 161.226 1.00 54.56  ? 104 PHE E CE2   1 
ATOM   3650  C  CZ    . PHE E 1  104 ? 149.379 180.720 162.501 1.00 54.56  ? 104 PHE E CZ    1 
ATOM   3651  N  N     . GLU E 1  105 ? 146.296 175.009 159.072 1.00 53.80  ? 105 GLU E N     1 
ATOM   3652  C  CA    . GLU E 1  105 ? 145.356 174.090 158.435 1.00 53.80  ? 105 GLU E CA    1 
ATOM   3653  C  C     . GLU E 1  105 ? 144.714 173.190 159.478 1.00 53.80  ? 105 GLU E C     1 
ATOM   3654  O  O     . GLU E 1  105 ? 143.483 173.164 159.634 1.00 53.80  ? 105 GLU E O     1 
ATOM   3655  C  CB    . GLU E 1  105 ? 146.073 173.233 157.392 1.00 53.80  ? 105 GLU E CB    1 
ATOM   3656  C  CG    . GLU E 1  105 ? 146.752 173.979 156.267 1.00 53.80  ? 105 GLU E CG    1 
ATOM   3657  C  CD    . GLU E 1  105 ? 145.791 174.592 155.282 1.00 53.80  ? 105 GLU E CD    1 
ATOM   3658  O  OE1   . GLU E 1  105 ? 144.712 174.009 155.056 1.00 53.80  ? 105 GLU E OE1   1 
ATOM   3659  O  OE2   . GLU E 1  105 ? 146.124 175.655 154.723 1.00 53.80  ? 105 GLU E OE2   1 
ATOM   3660  N  N     . ASP E 1  106 ? 145.550 172.497 160.251 1.00 56.70  ? 106 ASP E N     1 
ATOM   3661  C  CA    . ASP E 1  106 ? 145.010 171.551 161.217 1.00 56.70  ? 106 ASP E CA    1 
ATOM   3662  C  C     . ASP E 1  106 ? 144.365 172.255 162.403 1.00 56.70  ? 106 ASP E C     1 
ATOM   3663  O  O     . ASP E 1  106 ? 143.395 171.736 162.972 1.00 56.70  ? 106 ASP E O     1 
ATOM   3664  C  CB    . ASP E 1  106 ? 146.108 170.605 161.682 1.00 56.70  ? 106 ASP E CB    1 
ATOM   3665  C  CG    . ASP E 1  106 ? 146.578 169.688 160.579 1.00 56.70  ? 106 ASP E CG    1 
ATOM   3666  O  OD1   . ASP E 1  106 ? 145.772 169.422 159.664 1.00 56.70  ? 106 ASP E OD1   1 
ATOM   3667  O  OD2   . ASP E 1  106 ? 147.743 169.229 160.614 1.00 56.70  ? 106 ASP E OD2   1 
ATOM   3668  N  N     . THR E 1  107 ? 144.866 173.434 162.775 1.00 55.98  ? 107 THR E N     1 
ATOM   3669  C  CA    . THR E 1  107 ? 144.235 174.201 163.846 1.00 55.98  ? 107 THR E CA    1 
ATOM   3670  C  C     . THR E 1  107 ? 142.863 174.702 163.421 1.00 55.98  ? 107 THR E C     1 
ATOM   3671  O  O     . THR E 1  107 ? 141.914 174.718 164.220 1.00 55.98  ? 107 THR E O     1 
ATOM   3672  C  CB    . THR E 1  107 ? 145.131 175.369 164.236 1.00 55.98  ? 107 THR E CB    1 
ATOM   3673  O  OG1   . THR E 1  107 ? 146.430 174.874 164.562 1.00 55.98  ? 107 THR E OG1   1 
ATOM   3674  C  CG2   . THR E 1  107 ? 144.586 176.091 165.442 1.00 55.98  ? 107 THR E CG2   1 
ATOM   3675  N  N     . ASN E 1  108 ? 142.736 175.076 162.149 1.00 54.03  ? 108 ASN E N     1 
ATOM   3676  C  CA    . ASN E 1  108 ? 141.461 175.554 161.632 1.00 54.03  ? 108 ASN E CA    1 
ATOM   3677  C  C     . ASN E 1  108 ? 140.442 174.429 161.570 1.00 54.03  ? 108 ASN E C     1 
ATOM   3678  O  O     . ASN E 1  108 ? 139.266 174.638 161.888 1.00 54.03  ? 108 ASN E O     1 
ATOM   3679  C  CB    . ASN E 1  108 ? 141.669 176.157 160.251 1.00 54.03  ? 108 ASN E CB    1 
ATOM   3680  C  CG    . ASN E 1  108 ? 140.513 176.990 159.808 1.00 54.03  ? 108 ASN E CG    1 
ATOM   3681  O  OD1   . ASN E 1  108 ? 139.548 177.176 160.541 1.00 54.03  ? 108 ASN E OD1   1 
ATOM   3682  N  ND2   . ASN E 1  108 ? 140.592 177.496 158.593 1.00 54.03  ? 108 ASN E ND2   1 
ATOM   3683  N  N     . LEU E 1  109 ? 140.875 173.227 161.181 1.00 53.39  ? 109 LEU E N     1 
ATOM   3684  C  CA    . LEU E 1  109 ? 139.951 172.098 161.207 1.00 53.39  ? 109 LEU E CA    1 
ATOM   3685  C  C     . LEU E 1  109 ? 139.579 171.723 162.631 1.00 53.39  ? 109 LEU E C     1 
ATOM   3686  O  O     . LEU E 1  109 ? 138.456 171.262 162.878 1.00 53.39  ? 109 LEU E O     1 
ATOM   3687  C  CB    . LEU E 1  109 ? 140.563 170.916 160.486 1.00 53.39  ? 109 LEU E CB    1 
ATOM   3688  C  CG    . LEU E 1  109 ? 140.790 171.184 159.005 1.00 53.39  ? 109 LEU E CG    1 
ATOM   3689  C  CD1   . LEU E 1  109 ? 141.608 170.074 158.423 1.00 53.39  ? 109 LEU E CD1   1 
ATOM   3690  C  CD2   . LEU E 1  109 ? 139.466 171.301 158.282 1.00 53.39  ? 109 LEU E CD2   1 
ATOM   3691  N  N     . CYS E 1  110 ? 140.500 171.936 163.571 1.00 57.47  ? 110 CYS E N     1 
ATOM   3692  C  CA    . CYS E 1  110 ? 140.204 171.715 164.981 1.00 57.47  ? 110 CYS E CA    1 
ATOM   3693  C  C     . CYS E 1  110 ? 139.097 172.640 165.477 1.00 57.47  ? 110 CYS E C     1 
ATOM   3694  O  O     . CYS E 1  110 ? 138.121 172.188 166.084 1.00 57.47  ? 110 CYS E O     1 
ATOM   3695  C  CB    . CYS E 1  110 ? 141.464 171.915 165.812 1.00 57.47  ? 110 CYS E CB    1 
ATOM   3696  S  SG    . CYS E 1  110 ? 141.133 171.912 167.567 1.00 57.47  ? 110 CYS E SG    1 
ATOM   3697  N  N     . ALA E 1  111 ? 139.231 173.945 165.227 1.00 55.52  ? 111 ALA E N     1 
ATOM   3698  C  CA    . ALA E 1  111 ? 138.236 174.882 165.737 1.00 55.52  ? 111 ALA E CA    1 
ATOM   3699  C  C     . ALA E 1  111 ? 136.913 174.790 164.989 1.00 55.52  ? 111 ALA E C     1 
ATOM   3700  O  O     . ALA E 1  111 ? 135.860 175.024 165.586 1.00 55.52  ? 111 ALA E O     1 
ATOM   3701  C  CB    . ALA E 1  111 ? 138.774 176.304 165.670 1.00 55.52  ? 111 ALA E CB    1 
ATOM   3702  N  N     . ILE E 1  112 ? 136.941 174.473 163.688 1.00 54.37  ? 112 ILE E N     1 
ATOM   3703  C  CA    . ILE E 1  112 ? 135.702 174.214 162.956 1.00 54.37  ? 112 ILE E CA    1 
ATOM   3704  C  C     . ILE E 1  112 ? 135.009 172.983 163.517 1.00 54.37  ? 112 ILE E C     1 
ATOM   3705  O  O     . ILE E 1  112 ? 133.778 172.929 163.617 1.00 54.37  ? 112 ILE E O     1 
ATOM   3706  C  CB    . ILE E 1  112 ? 135.988 174.088 161.446 1.00 54.37  ? 112 ILE E CB    1 
ATOM   3707  C  CG1   . ILE E 1  112 ? 136.341 175.453 160.868 1.00 54.37  ? 112 ILE E CG1   1 
ATOM   3708  C  CG2   . ILE E 1  112 ? 134.810 173.508 160.673 1.00 54.37  ? 112 ILE E CG2   1 
ATOM   3709  C  CD1   . ILE E 1  112 ? 136.912 175.390 159.481 1.00 54.37  ? 112 ILE E CD1   1 
ATOM   3710  N  N     . HIS E 1  113 ? 135.785 172.026 164.005 1.00 55.26  ? 113 HIS E N     1 
ATOM   3711  C  CA    . HIS E 1  113 ? 135.170 170.870 164.633 1.00 55.26  ? 113 HIS E CA    1 
ATOM   3712  C  C     . HIS E 1  113 ? 134.634 171.165 166.037 1.00 55.26  ? 113 HIS E C     1 
ATOM   3713  O  O     . HIS E 1  113 ? 134.124 170.256 166.696 1.00 55.26  ? 113 HIS E O     1 
ATOM   3714  C  CB    . HIS E 1  113 ? 136.180 169.725 164.665 1.00 55.26  ? 113 HIS E CB    1 
ATOM   3715  C  CG    . HIS E 1  113 ? 135.547 168.380 164.780 1.00 55.26  ? 113 HIS E CG    1 
ATOM   3716  N  ND1   . HIS E 1  113 ? 134.890 167.786 163.726 1.00 55.26  ? 113 HIS E ND1   1 
ATOM   3717  C  CD2   . HIS E 1  113 ? 135.448 167.521 165.818 1.00 55.26  ? 113 HIS E CD2   1 
ATOM   3718  C  CE1   . HIS E 1  113 ? 134.423 166.612 164.108 1.00 55.26  ? 113 HIS E CE1   1 
ATOM   3719  N  NE2   . HIS E 1  113 ? 134.748 166.428 165.373 1.00 55.26  ? 113 HIS E NE2   1 
ATOM   3720  N  N     . ALA E 1  114 ? 134.727 172.407 166.515 1.00 55.97  ? 114 ALA E N     1 
ATOM   3721  C  CA    . ALA E 1  114 ? 134.059 172.837 167.736 1.00 55.97  ? 114 ALA E CA    1 
ATOM   3722  C  C     . ALA E 1  114 ? 132.838 173.700 167.455 1.00 55.97  ? 114 ALA E C     1 
ATOM   3723  O  O     . ALA E 1  114 ? 132.295 174.297 168.392 1.00 55.97  ? 114 ALA E O     1 
ATOM   3724  C  CB    . ALA E 1  114 ? 135.031 173.598 168.633 1.00 55.97  ? 114 ALA E CB    1 
ATOM   3725  N  N     . LYS E 1  115 ? 132.394 173.755 166.196 1.00 56.47  ? 115 LYS E N     1 
ATOM   3726  C  CA    . LYS E 1  115 ? 131.414 174.727 165.690 1.00 56.47  ? 115 LYS E CA    1 
ATOM   3727  C  C     . LYS E 1  115 ? 131.803 176.157 166.064 1.00 56.47  ? 115 LYS E C     1 
ATOM   3728  O  O     . LYS E 1  115 ? 131.008 176.937 166.588 1.00 56.47  ? 115 LYS E O     1 
ATOM   3729  C  CB    . LYS E 1  115 ? 129.998 174.384 166.145 1.00 56.47  ? 115 LYS E CB    1 
ATOM   3730  C  CG    . LYS E 1  115 ? 129.429 173.178 165.413 1.00 56.47  ? 115 LYS E CG    1 
ATOM   3731  C  CD    . LYS E 1  115 ? 128.010 172.878 165.860 1.00 56.47  ? 115 LYS E CD    1 
ATOM   3732  C  CE    . LYS E 1  115 ? 127.427 171.689 165.128 1.00 56.47  ? 115 LYS E CE    1 
ATOM   3733  N  NZ    . LYS E 1  115 ? 127.156 172.027 163.707 1.00 56.47  ? 115 LYS E NZ    1 
ATOM   3734  N  N     . ARG E 1  116 ? 133.069 176.476 165.799 1.00 56.18  ? 116 ARG E N     1 
ATOM   3735  C  CA    . ARG E 1  116 ? 133.634 177.809 165.924 1.00 56.18  ? 116 ARG E CA    1 
ATOM   3736  C  C     . ARG E 1  116 ? 134.349 178.166 164.632 1.00 56.18  ? 116 ARG E C     1 
ATOM   3737  O  O     . ARG E 1  116 ? 134.981 177.316 164.004 1.00 56.18  ? 116 ARG E O     1 
ATOM   3738  C  CB    . ARG E 1  116 ? 134.622 177.909 167.095 1.00 56.18  ? 116 ARG E CB    1 
ATOM   3739  C  CG    . ARG E 1  116 ? 133.962 177.947 168.451 1.00 56.18  ? 116 ARG E CG    1 
ATOM   3740  C  CD    . ARG E 1  116 ? 134.926 178.346 169.579 1.00 56.18  ? 116 ARG E CD    1 
ATOM   3741  N  NE    . ARG E 1  116 ? 135.872 177.311 169.989 1.00 56.18  ? 116 ARG E NE    1 
ATOM   3742  C  CZ    . ARG E 1  116 ? 137.195 177.435 169.938 1.00 56.18  ? 116 ARG E CZ    1 
ATOM   3743  N  NH1   . ARG E 1  116 ? 137.736 178.553 169.494 1.00 56.18  ? 116 ARG E NH1   1 
ATOM   3744  N  NH2   . ARG E 1  116 ? 137.975 176.448 170.343 1.00 56.18  ? 116 ARG E NH2   1 
ATOM   3745  N  N     . VAL E 1  117 ? 134.245 179.426 164.230 1.00 54.95  ? 117 VAL E N     1 
ATOM   3746  C  CA    . VAL E 1  117 ? 134.935 179.902 163.042 1.00 54.95  ? 117 VAL E CA    1 
ATOM   3747  C  C     . VAL E 1  117 ? 136.130 180.768 163.413 1.00 54.95  ? 117 VAL E C     1 
ATOM   3748  O  O     . VAL E 1  117 ? 136.652 181.494 162.578 1.00 54.95  ? 117 VAL E O     1 
ATOM   3749  C  CB    . VAL E 1  117 ? 133.984 180.647 162.090 1.00 54.95  ? 117 VAL E CB    1 
ATOM   3750  C  CG1   . VAL E 1  117 ? 132.892 179.722 161.605 1.00 54.95  ? 117 VAL E CG1   1 
ATOM   3751  C  CG2   . VAL E 1  117 ? 133.388 181.864 162.761 1.00 54.95  ? 117 VAL E CG2   1 
ATOM   3752  N  N     . THR E 1  118 ? 136.579 180.700 164.660 1.00 55.27  ? 118 THR E N     1 
ATOM   3753  C  CA    . THR E 1  118 ? 137.697 181.513 165.110 1.00 55.27  ? 118 THR E CA    1 
ATOM   3754  C  C     . THR E 1  118 ? 138.635 180.646 165.926 1.00 55.27  ? 118 THR E C     1 
ATOM   3755  O  O     . THR E 1  118 ? 138.213 180.018 166.898 1.00 55.27  ? 118 THR E O     1 
ATOM   3756  C  CB    . THR E 1  118 ? 137.216 182.705 165.931 1.00 55.27  ? 118 THR E CB    1 
ATOM   3757  O  OG1   . THR E 1  118 ? 136.409 183.543 165.101 1.00 55.27  ? 118 THR E OG1   1 
ATOM   3758  C  CG2   . THR E 1  118 ? 138.388 183.488 166.482 1.00 55.27  ? 118 THR E CG2   1 
ATOM   3759  N  N     . ILE E 1  119 ? 139.891 180.608 165.533 1.00 54.53  ? 119 ILE E N     1 
ATOM   3760  C  CA    . ILE E 1  119 ? 140.854 179.754 166.200 1.00 54.53  ? 119 ILE E CA    1 
ATOM   3761  C  C     . ILE E 1  119 ? 141.305 180.417 167.493 1.00 54.53  ? 119 ILE E C     1 
ATOM   3762  O  O     . ILE E 1  119 ? 141.260 181.639 167.643 1.00 54.53  ? 119 ILE E O     1 
ATOM   3763  C  CB    . ILE E 1  119 ? 142.025 179.451 165.253 1.00 54.53  ? 119 ILE E CB    1 
ATOM   3764  C  CG1   . ILE E 1  119 ? 142.854 180.693 164.982 1.00 54.53  ? 119 ILE E CG1   1 
ATOM   3765  C  CG2   . ILE E 1  119 ? 141.492 178.962 163.937 1.00 54.53  ? 119 ILE E CG2   1 
ATOM   3766  C  CD1   . ILE E 1  119 ? 144.153 180.374 164.305 1.00 54.53  ? 119 ILE E CD1   1 
ATOM   3767  N  N     . MET E 1  120 ? 141.718 179.595 168.446 1.00 62.68  ? 120 MET E N     1 
ATOM   3768  C  CA    . MET E 1  120 ? 142.054 179.978 169.808 1.00 62.68  ? 120 MET E CA    1 
ATOM   3769  C  C     . MET E 1  120 ? 143.226 179.116 170.241 1.00 62.68  ? 120 MET E C     1 
ATOM   3770  O  O     . MET E 1  120 ? 143.458 178.058 169.648 1.00 62.68  ? 120 MET E O     1 
ATOM   3771  C  CB    . MET E 1  120 ? 140.831 179.810 170.724 1.00 62.68  ? 120 MET E CB    1 
ATOM   3772  C  CG    . MET E 1  120 ? 139.818 180.933 170.597 1.00 62.68  ? 120 MET E CG    1 
ATOM   3773  S  SD    . MET E 1  120 ? 138.379 180.706 171.642 1.00 62.68  ? 120 MET E SD    1 
ATOM   3774  C  CE    . MET E 1  120 ? 139.121 180.959 173.248 1.00 62.68  ? 120 MET E CE    1 
ATOM   3775  N  N     . PRO E 1  121 ? 144.021 179.550 171.243 1.00 62.99  ? 121 PRO E N     1 
ATOM   3776  C  CA    . PRO E 1  121 ? 145.324 178.894 171.467 1.00 62.99  ? 121 PRO E CA    1 
ATOM   3777  C  C     . PRO E 1  121 ? 145.242 177.448 171.921 1.00 62.99  ? 121 PRO E C     1 
ATOM   3778  O  O     . PRO E 1  121 ? 146.173 176.675 171.644 1.00 62.99  ? 121 PRO E O     1 
ATOM   3779  C  CB    . PRO E 1  121 ? 145.977 179.766 172.544 1.00 62.99  ? 121 PRO E CB    1 
ATOM   3780  C  CG    . PRO E 1  121 ? 145.321 181.053 172.432 1.00 62.99  ? 121 PRO E CG    1 
ATOM   3781  C  CD    . PRO E 1  121 ? 143.914 180.745 172.099 1.00 62.99  ? 121 PRO E CD    1 
ATOM   3782  N  N     . LYS E 1  122 ? 144.149 177.048 172.571 1.00 64.70  ? 122 LYS E N     1 
ATOM   3783  C  CA    . LYS E 1  122 ? 143.966 175.641 172.906 1.00 64.70  ? 122 LYS E CA    1 
ATOM   3784  C  C     . LYS E 1  122 ? 143.827 174.762 171.670 1.00 64.70  ? 122 LYS E C     1 
ATOM   3785  O  O     . LYS E 1  122 ? 144.152 173.575 171.739 1.00 64.70  ? 122 LYS E O     1 
ATOM   3786  C  CB    . LYS E 1  122 ? 142.748 175.460 173.810 1.00 64.70  ? 122 LYS E CB    1 
ATOM   3787  C  CG    . LYS E 1  122 ? 141.453 175.926 173.190 1.00 64.70  ? 122 LYS E CG    1 
ATOM   3788  C  CD    . LYS E 1  122 ? 140.247 175.522 174.012 1.00 64.70  ? 122 LYS E CD    1 
ATOM   3789  C  CE    . LYS E 1  122 ? 140.084 176.344 175.254 1.00 64.70  ? 122 LYS E CE    1 
ATOM   3790  N  NZ    . LYS E 1  122 ? 138.820 175.939 175.911 1.00 64.70  ? 122 LYS E NZ    1 
ATOM   3791  N  N     . ASP E 1  123 ? 143.387 175.320 170.541 1.00 63.59  ? 123 ASP E N     1 
ATOM   3792  C  CA    . ASP E 1  123 ? 143.311 174.537 169.314 1.00 63.59  ? 123 ASP E CA    1 
ATOM   3793  C  C     . ASP E 1  123 ? 144.698 174.296 168.737 1.00 63.59  ? 123 ASP E C     1 
ATOM   3794  O  O     . ASP E 1  123 ? 144.987 173.200 168.232 1.00 63.59  ? 123 ASP E O     1 
ATOM   3795  C  CB    . ASP E 1  123 ? 142.428 175.258 168.306 1.00 63.59  ? 123 ASP E CB    1 
ATOM   3796  C  CG    . ASP E 1  123 ? 141.013 175.417 168.793 1.00 63.59  ? 123 ASP E CG    1 
ATOM   3797  O  OD1   . ASP E 1  123 ? 140.536 174.524 169.508 1.00 63.59  ? 123 ASP E OD1   1 
ATOM   3798  O  OD2   . ASP E 1  123 ? 140.387 176.455 168.500 1.00 63.59  ? 123 ASP E OD2   1 
ATOM   3799  N  N     . ILE E 1  124 ? 145.551 175.322 168.793 1.00 62.79  ? 124 ILE E N     1 
ATOM   3800  C  CA    . ILE E 1  124 ? 146.965 175.183 168.458 1.00 62.79  ? 124 ILE E CA    1 
ATOM   3801  C  C     . ILE E 1  124 ? 147.597 174.083 169.296 1.00 62.79  ? 124 ILE E C     1 
ATOM   3802  O  O     . ILE E 1  124 ? 148.285 173.190 168.778 1.00 62.79  ? 124 ILE E O     1 
ATOM   3803  C  CB    . ILE E 1  124 ? 147.688 176.521 168.678 1.00 62.79  ? 124 ILE E CB    1 
ATOM   3804  C  CG1   . ILE E 1  124 ? 147.052 177.611 167.827 1.00 62.79  ? 124 ILE E CG1   1 
ATOM   3805  C  CG2   . ILE E 1  124 ? 149.157 176.391 168.373 1.00 62.79  ? 124 ILE E CG2   1 
ATOM   3806  C  CD1   . ILE E 1  124 ? 147.504 178.994 168.211 1.00 62.79  ? 124 ILE E CD1   1 
ATOM   3807  N  N     . GLN E 1  125 ? 147.322 174.110 170.603 1.00 64.45  ? 125 GLN E N     1 
ATOM   3808  C  CA    . GLN E 1  125 ? 147.833 173.091 171.510 1.00 64.45  ? 125 GLN E CA    1 
ATOM   3809  C  C     . GLN E 1  125 ? 147.281 171.710 171.184 1.00 64.45  ? 125 GLN E C     1 
ATOM   3810  O  O     . GLN E 1  125 ? 147.999 170.707 171.327 1.00 64.45  ? 125 GLN E O     1 
ATOM   3811  C  CB    . GLN E 1  125 ? 147.502 173.501 172.941 1.00 64.45  ? 125 GLN E CB    1 
ATOM   3812  C  CG    . GLN E 1  125 ? 148.217 174.784 173.327 1.00 64.45  ? 125 GLN E CG    1 
ATOM   3813  C  CD    . GLN E 1  125 ? 147.777 175.356 174.652 1.00 64.45  ? 125 GLN E CD    1 
ATOM   3814  O  OE1   . GLN E 1  125 ? 146.896 174.817 175.317 1.00 64.45  ? 125 GLN E OE1   1 
ATOM   3815  N  NE2   . GLN E 1  125 ? 148.375 176.472 175.035 1.00 64.45  ? 125 GLN E NE2   1 
ATOM   3816  N  N     . LEU E 1  126 ? 146.046 171.644 170.681 1.00 61.58  ? 126 LEU E N     1 
ATOM   3817  C  CA    . LEU E 1  126 ? 145.466 170.353 170.338 1.00 61.58  ? 126 LEU E CA    1 
ATOM   3818  C  C     . LEU E 1  126 ? 146.157 169.745 169.132 1.00 61.58  ? 126 LEU E C     1 
ATOM   3819  O  O     . LEU E 1  126 ? 146.606 168.597 169.189 1.00 61.58  ? 126 LEU E O     1 
ATOM   3820  C  CB    . LEU E 1  126 ? 143.971 170.461 170.062 1.00 61.58  ? 126 LEU E CB    1 
ATOM   3821  C  CG    . LEU E 1  126 ? 143.440 169.036 169.884 1.00 61.58  ? 126 LEU E CG    1 
ATOM   3822  C  CD1   . LEU E 1  126 ? 143.568 168.273 171.193 1.00 61.58  ? 126 LEU E CD1   1 
ATOM   3823  C  CD2   . LEU E 1  126 ? 142.028 168.957 169.375 1.00 61.58  ? 126 LEU E CD2   1 
ATOM   3824  N  N     . ALA E 1  127 ? 146.257 170.502 168.036 1.00 61.95  ? 127 ALA E N     1 
ATOM   3825  C  CA    . ALA E 1  127 ? 146.896 169.966 166.839 1.00 61.95  ? 127 ALA E CA    1 
ATOM   3826  C  C     . ALA E 1  127 ? 148.371 169.662 167.047 1.00 61.95  ? 127 ALA E C     1 
ATOM   3827  O  O     . ALA E 1  127 ? 148.893 168.723 166.433 1.00 61.95  ? 127 ALA E O     1 
ATOM   3828  C  CB    . ALA E 1  127 ? 146.737 170.938 165.675 1.00 61.95  ? 127 ALA E CB    1 
ATOM   3829  N  N     . ARG E 1  128 ? 149.039 170.403 167.932 1.00 66.17  ? 128 ARG E N     1 
ATOM   3830  C  CA    . ARG E 1  128 ? 150.413 170.052 168.257 1.00 66.17  ? 128 ARG E CA    1 
ATOM   3831  C  C     . ARG E 1  128 ? 150.487 168.757 169.057 1.00 66.17  ? 128 ARG E C     1 
ATOM   3832  O  O     . ARG E 1  128 ? 151.430 167.980 168.878 1.00 66.17  ? 128 ARG E O     1 
ATOM   3833  C  CB    . ARG E 1  128 ? 151.094 171.195 169.002 1.00 66.17  ? 128 ARG E CB    1 
ATOM   3834  C  CG    . ARG E 1  128 ? 151.341 172.381 168.111 1.00 66.17  ? 128 ARG E CG    1 
ATOM   3835  C  CD    . ARG E 1  128 ? 151.964 173.536 168.849 1.00 66.17  ? 128 ARG E CD    1 
ATOM   3836  N  NE    . ARG E 1  128 ? 153.341 173.279 169.252 1.00 66.17  ? 128 ARG E NE    1 
ATOM   3837  C  CZ    . ARG E 1  128 ? 153.759 173.265 170.510 1.00 66.17  ? 128 ARG E CZ    1 
ATOM   3838  N  NH1   . ARG E 1  128 ? 152.907 173.510 171.494 1.00 66.17  ? 128 ARG E NH1   1 
ATOM   3839  N  NH2   . ARG E 1  128 ? 155.035 173.027 170.783 1.00 66.17  ? 128 ARG E NH2   1 
ATOM   3840  N  N     . ARG E 1  129 ? 149.516 168.488 169.936 1.00 64.60  ? 129 ARG E N     1 
ATOM   3841  C  CA    . ARG E 1  129 ? 149.593 167.199 170.621 1.00 64.60  ? 129 ARG E CA    1 
ATOM   3842  C  C     . ARG E 1  129 ? 149.217 166.052 169.692 1.00 64.60  ? 129 ARG E C     1 
ATOM   3843  O  O     . ARG E 1  129 ? 149.784 164.959 169.802 1.00 64.60  ? 129 ARG E O     1 
ATOM   3844  C  CB    . ARG E 1  129 ? 148.709 167.168 171.867 1.00 64.60  ? 129 ARG E CB    1 
ATOM   3845  C  CG    . ARG E 1  129 ? 148.944 165.928 172.746 1.00 64.60  ? 129 ARG E CG    1 
ATOM   3846  C  CD    . ARG E 1  129 ? 147.925 165.806 173.869 1.00 64.60  ? 129 ARG E CD    1 
ATOM   3847  N  NE    . ARG E 1  129 ? 148.086 166.745 174.976 1.00 64.60  ? 129 ARG E NE    1 
ATOM   3848  C  CZ    . ARG E 1  129 ? 148.705 166.455 176.116 1.00 64.60  ? 129 ARG E CZ    1 
ATOM   3849  N  NH1   . ARG E 1  129 ? 149.201 165.241 176.316 1.00 64.60  ? 129 ARG E NH1   1 
ATOM   3850  N  NH2   . ARG E 1  129 ? 148.799 167.366 177.073 1.00 64.60  ? 129 ARG E NH2   1 
ATOM   3851  N  N     . ILE E 1  130 ? 148.294 166.286 168.756 1.00 61.31  ? 130 ILE E N     1 
ATOM   3852  C  CA    . ILE E 1  130 ? 147.863 165.227 167.845 1.00 61.31  ? 130 ILE E CA    1 
ATOM   3853  C  C     . ILE E 1  130 ? 148.985 164.858 166.881 1.00 61.31  ? 130 ILE E C     1 
ATOM   3854  O  O     . ILE E 1  130 ? 149.239 163.676 166.621 1.00 61.31  ? 130 ILE E O     1 
ATOM   3855  C  CB    . ILE E 1  130 ? 146.584 165.654 167.108 1.00 61.31  ? 130 ILE E CB    1 
ATOM   3856  C  CG1   . ILE E 1  130 ? 145.433 165.792 168.095 1.00 61.31  ? 130 ILE E CG1   1 
ATOM   3857  C  CG2   . ILE E 1  130 ? 146.237 164.687 166.013 1.00 61.31  ? 130 ILE E CG2   1 
ATOM   3858  C  CD1   . ILE E 1  130 ? 144.171 166.247 167.478 1.00 61.31  ? 130 ILE E CD1   1 
ATOM   3859  N  N     . ARG E 1  131 ? 149.724 165.853 166.397 1.00 60.46  ? 131 ARG E N     1 
ATOM   3860  C  CA    . ARG E 1  131 ? 150.904 165.519 165.610 1.00 60.46  ? 131 ARG E CA    1 
ATOM   3861  C  C     . ARG E 1  131 ? 152.048 164.964 166.449 1.00 60.46  ? 131 ARG E C     1 
ATOM   3862  O  O     . ARG E 1  131 ? 153.049 164.530 165.872 1.00 60.46  ? 131 ARG E O     1 
ATOM   3863  C  CB    . ARG E 1  131 ? 151.415 166.742 164.857 1.00 60.46  ? 131 ARG E CB    1 
ATOM   3864  C  CG    . ARG E 1  131 ? 150.573 167.199 163.697 1.00 60.46  ? 131 ARG E CG    1 
ATOM   3865  C  CD    . ARG E 1  131 ? 151.222 168.408 163.077 1.00 60.46  ? 131 ARG E CD    1 
ATOM   3866  N  NE    . ARG E 1  131 ? 150.505 168.879 161.907 1.00 60.46  ? 131 ARG E NE    1 
ATOM   3867  C  CZ    . ARG E 1  131 ? 150.816 169.986 161.250 1.00 60.46  ? 131 ARG E CZ    1 
ATOM   3868  N  NH1   . ARG E 1  131 ? 151.826 170.735 161.658 1.00 60.46  ? 131 ARG E NH1   1 
ATOM   3869  N  NH2   . ARG E 1  131 ? 150.112 170.348 160.192 1.00 60.46  ? 131 ARG E NH2   1 
ATOM   3870  N  N     . GLY E 1  132 ? 151.942 164.976 167.773 1.00 63.63  ? 132 GLY E N     1 
ATOM   3871  C  CA    . GLY E 1  132 ? 153.027 164.519 168.612 1.00 63.63  ? 132 GLY E CA    1 
ATOM   3872  C  C     . GLY E 1  132 ? 154.161 165.517 168.668 1.00 63.63  ? 132 GLY E C     1 
ATOM   3873  O  O     . GLY E 1  132 ? 155.266 165.235 168.201 1.00 63.63  ? 132 GLY E O     1 
ATOM   3874  N  N     . GLU E 1  133 ? 153.898 166.692 169.225 1.00 69.37  ? 133 GLU E N     1 
ATOM   3875  C  CA    . GLU E 1  133 ? 154.894 167.748 169.339 1.00 69.37  ? 133 GLU E CA    1 
ATOM   3876  C  C     . GLU E 1  133 ? 155.056 168.188 170.786 1.00 69.37  ? 133 GLU E C     1 
ATOM   3877  O  O     . GLU E 1  133 ? 155.251 169.368 171.083 1.00 69.37  ? 133 GLU E O     1 
ATOM   3878  C  CB    . GLU E 1  133 ? 154.537 168.935 168.451 1.00 69.37  ? 133 GLU E CB    1 
ATOM   3879  C  CG    . GLU E 1  133 ? 154.553 168.600 166.981 1.00 69.37  ? 133 GLU E CG    1 
ATOM   3880  C  CD    . GLU E 1  133 ? 154.210 169.782 166.119 1.00 69.37  ? 133 GLU E CD    1 
ATOM   3881  O  OE1   . GLU E 1  133 ? 153.877 170.850 166.673 1.00 69.37  ? 133 GLU E OE1   1 
ATOM   3882  O  OE2   . GLU E 1  133 ? 154.271 169.653 164.883 1.00 69.37  ? 133 GLU E OE2   1 
ATOM   3883  N  N     . ARG E 1  134 ? 154.965 167.232 171.703 1.00 72.76  ? 134 ARG E N     1 
ATOM   3884  C  CA    . ARG E 1  134 ? 155.315 167.445 173.101 1.00 72.76  ? 134 ARG E CA    1 
ATOM   3885  C  C     . ARG E 1  134 ? 156.141 166.270 173.614 1.00 72.76  ? 134 ARG E C     1 
ATOM   3886  O  O     . ARG E 1  134 ? 155.697 165.123 173.590 1.00 72.76  ? 134 ARG E O     1 
ATOM   3887  C  CB    . ARG E 1  134 ? 154.066 167.633 173.960 1.00 72.76  ? 134 ARG E CB    1 
ATOM   3888  C  CG    . ARG E 1  134 ? 153.397 168.969 173.773 1.00 72.76  ? 134 ARG E CG    1 
ATOM   3889  C  CD    . ARG E 1  134 ? 152.145 169.097 174.599 1.00 72.76  ? 134 ARG E CD    1 
ATOM   3890  N  NE    . ARG E 1  134 ? 151.540 170.412 174.421 1.00 72.76  ? 134 ARG E NE    1 
ATOM   3891  C  CZ    . ARG E 1  134 ? 150.388 170.789 174.962 1.00 72.76  ? 134 ARG E CZ    1 
ATOM   3892  N  NH1   . ARG E 1  134 ? 149.698 169.950 175.719 1.00 72.76  ? 134 ARG E NH1   1 
ATOM   3893  N  NH2   . ARG E 1  134 ? 149.926 172.011 174.743 1.00 72.76  ? 134 ARG E NH2   1 
ATOM   3894  N  N     . ARG F 2  23  ? 167.411 194.339 168.169 1.00 136.43 ? 23  ARG F N     1 
ATOM   3895  C  CA    . ARG F 2  23  ? 166.647 194.189 169.402 1.00 136.43 ? 23  ARG F CA    1 
ATOM   3896  C  C     . ARG F 2  23  ? 165.324 193.474 169.146 1.00 136.43 ? 23  ARG F C     1 
ATOM   3897  O  O     . ARG F 2  23  ? 164.663 193.721 168.137 1.00 136.43 ? 23  ARG F O     1 
ATOM   3898  C  CB    . ARG F 2  23  ? 166.392 195.554 170.043 1.00 136.43 ? 23  ARG F CB    1 
ATOM   3899  C  CG    . ARG F 2  23  ? 167.638 196.219 170.603 1.00 136.43 ? 23  ARG F CG    1 
ATOM   3900  C  CD    . ARG F 2  23  ? 167.282 197.398 171.493 1.00 136.43 ? 23  ARG F CD    1 
ATOM   3901  N  NE    . ARG F 2  23  ? 166.594 198.453 170.755 1.00 136.43 ? 23  ARG F NE    1 
ATOM   3902  C  CZ    . ARG F 2  23  ? 167.212 199.418 170.081 1.00 136.43 ? 23  ARG F CZ    1 
ATOM   3903  N  NH1   . ARG F 2  23  ? 166.505 200.337 169.437 1.00 136.43 ? 23  ARG F NH1   1 
ATOM   3904  N  NH2   . ARG F 2  23  ? 168.536 199.464 170.051 1.00 136.43 ? 23  ARG F NH2   1 
ATOM   3905  N  N     . ASP F 2  24  ? 164.951 192.591 170.070 1.00 123.01 ? 24  ASP F N     1 
ATOM   3906  C  CA    . ASP F 2  24  ? 163.711 191.822 169.974 1.00 123.01 ? 24  ASP F CA    1 
ATOM   3907  C  C     . ASP F 2  24  ? 163.546 191.156 168.610 1.00 123.01 ? 24  ASP F C     1 
ATOM   3908  O  O     . ASP F 2  24  ? 162.626 191.480 167.858 1.00 123.01 ? 24  ASP F O     1 
ATOM   3909  C  CB    . ASP F 2  24  ? 162.498 192.703 170.288 1.00 123.01 ? 24  ASP F CB    1 
ATOM   3910  C  CG    . ASP F 2  24  ? 161.593 192.095 171.341 1.00 123.01 ? 24  ASP F CG    1 
ATOM   3911  O  OD1   . ASP F 2  24  ? 161.166 190.935 171.162 1.00 123.01 ? 24  ASP F OD1   1 
ATOM   3912  O  OD2   . ASP F 2  24  ? 161.308 192.777 172.348 1.00 123.01 ? 24  ASP F OD2   1 
ATOM   3913  N  N     . ASN F 2  25  ? 164.442 190.226 168.299 1.00 110.89 ? 25  ASN F N     1 
ATOM   3914  C  CA    . ASN F 2  25  ? 164.400 189.515 167.027 1.00 110.89 ? 25  ASN F CA    1 
ATOM   3915  C  C     . ASN F 2  25  ? 163.102 188.730 166.870 1.00 110.89 ? 25  ASN F C     1 
ATOM   3916  O  O     . ASN F 2  25  ? 162.491 188.730 165.801 1.00 110.89 ? 25  ASN F O     1 
ATOM   3917  C  CB    . ASN F 2  25  ? 165.601 188.576 166.897 1.00 110.89 ? 25  ASN F CB    1 
ATOM   3918  C  CG    . ASN F 2  25  ? 166.207 188.594 165.508 1.00 110.89 ? 25  ASN F CG    1 
ATOM   3919  O  OD1   . ASN F 2  25  ? 166.544 187.549 164.951 1.00 110.89 ? 25  ASN F OD1   1 
ATOM   3920  N  ND2   . ASN F 2  25  ? 166.349 189.786 164.939 1.00 110.89 ? 25  ASN F ND2   1 
ATOM   3921  N  N     . ILE F 2  26  ? 162.685 188.061 167.940 1.00 93.35  ? 26  ILE F N     1 
ATOM   3922  C  CA    . ILE F 2  26  ? 161.429 187.251 167.918 1.00 93.35  ? 26  ILE F CA    1 
ATOM   3923  C  C     . ILE F 2  26  ? 160.232 188.158 167.612 1.00 93.35  ? 26  ILE F C     1 
ATOM   3924  O  O     . ILE F 2  26  ? 159.473 187.835 166.679 1.00 93.35  ? 26  ILE F O     1 
ATOM   3925  C  CB    . ILE F 2  26  ? 161.243 186.497 169.250 1.00 93.35  ? 26  ILE F CB    1 
ATOM   3926  C  CG1   . ILE F 2  26  ? 162.080 185.217 169.299 1.00 93.35  ? 26  ILE F CG1   1 
ATOM   3927  C  CG2   . ILE F 2  26  ? 159.772 186.220 169.512 1.00 93.35  ? 26  ILE F CG2   1 
ATOM   3928  C  CD1   . ILE F 2  26  ? 161.428 184.087 170.062 1.00 93.35  ? 26  ILE F CD1   1 
ATOM   3929  N  N     . GLN F 2  27  ? 160.076 189.247 168.371 1.00 90.17  ? 27  GLN F N     1 
ATOM   3930  C  CA    . GLN F 2  27  ? 158.938 190.182 168.159 1.00 90.17  ? 27  GLN F CA    1 
ATOM   3931  C  C     . GLN F 2  27  ? 158.914 190.643 166.697 1.00 90.17  ? 27  GLN F C     1 
ATOM   3932  O  O     . GLN F 2  27  ? 157.828 191.028 166.221 1.00 90.17  ? 27  GLN F O     1 
ATOM   3933  C  CB    . GLN F 2  27  ? 159.037 191.378 169.107 1.00 90.17  ? 27  GLN F CB    1 
ATOM   3934  C  CG    . GLN F 2  27  ? 157.773 191.605 169.922 1.00 90.17  ? 27  GLN F CG    1 
ATOM   3935  C  CD    . GLN F 2  27  ? 156.884 190.386 169.930 1.00 90.17  ? 27  GLN F CD    1 
ATOM   3936  O  OE1   . GLN F 2  27  ? 155.691 190.460 169.645 1.00 90.17  ? 27  GLN F OE1   1 
ATOM   3937  N  NE2   . GLN F 2  27  ? 157.466 189.243 170.257 1.00 90.17  ? 27  GLN F NE2   1 
ATOM   3938  N  N     . GLY F 2  28  ? 160.063 190.601 166.016 1.00 92.27  ? 28  GLY F N     1 
ATOM   3939  C  CA    . GLY F 2  28  ? 160.127 191.033 164.632 1.00 92.27  ? 28  GLY F CA    1 
ATOM   3940  C  C     . GLY F 2  28  ? 159.159 190.309 163.723 1.00 92.27  ? 28  GLY F C     1 
ATOM   3941  O  O     . GLY F 2  28  ? 158.844 190.815 162.641 1.00 92.27  ? 28  GLY F O     1 
ATOM   3942  N  N     . ILE F 2  29  ? 158.694 189.132 164.129 1.00 84.96  ? 29  ILE F N     1 
ATOM   3943  C  CA    . ILE F 2  29  ? 157.602 188.467 163.437 1.00 84.96  ? 29  ILE F CA    1 
ATOM   3944  C  C     . ILE F 2  29  ? 156.354 189.273 163.737 1.00 84.96  ? 29  ILE F C     1 
ATOM   3945  O  O     . ILE F 2  29  ? 155.810 189.195 164.843 1.00 84.96  ? 29  ILE F O     1 
ATOM   3946  C  CB    . ILE F 2  29  ? 157.445 187.010 163.891 1.00 84.96  ? 29  ILE F CB    1 
ATOM   3947  C  CG1   . ILE F 2  29  ? 158.757 186.253 163.698 1.00 84.96  ? 29  ILE F CG1   1 
ATOM   3948  C  CG2   . ILE F 2  29  ? 156.314 186.345 163.146 1.00 84.96  ? 29  ILE F CG2   1 
ATOM   3949  C  CD1   . ILE F 2  29  ? 159.252 186.249 162.290 1.00 84.96  ? 29  ILE F CD1   1 
ATOM   3950  N  N     . THR F 2  30  ? 155.906 190.058 162.767 1.00 84.04  ? 30  THR F N     1 
ATOM   3951  C  CA    . THR F 2  30  ? 154.868 191.038 163.028 1.00 84.04  ? 30  THR F CA    1 
ATOM   3952  C  C     . THR F 2  30  ? 153.523 190.353 163.190 1.00 84.04  ? 30  THR F C     1 
ATOM   3953  O  O     . THR F 2  30  ? 153.291 189.264 162.662 1.00 84.04  ? 30  THR F O     1 
ATOM   3954  C  CB    . THR F 2  30  ? 154.762 192.036 161.886 1.00 84.04  ? 30  THR F CB    1 
ATOM   3955  O  OG1   . THR F 2  30  ? 154.033 191.442 160.811 1.00 84.04  ? 30  THR F OG1   1 
ATOM   3956  C  CG2   . THR F 2  30  ? 156.146 192.385 161.382 1.00 84.04  ? 30  THR F CG2   1 
ATOM   3957  N  N     . LYS F 2  31  ? 152.649 191.001 163.951 1.00 81.79  ? 31  LYS F N     1 
ATOM   3958  C  CA    . LYS F 2  31  ? 151.254 190.580 164.002 1.00 81.79  ? 31  LYS F CA    1 
ATOM   3959  C  C     . LYS F 2  31  ? 150.568 190.552 162.635 1.00 81.79  ? 31  LYS F C     1 
ATOM   3960  O  O     . LYS F 2  31  ? 149.826 189.585 162.382 1.00 81.79  ? 31  LYS F O     1 
ATOM   3961  C  CB    . LYS F 2  31  ? 150.509 191.453 165.022 1.00 81.79  ? 31  LYS F CB    1 
ATOM   3962  C  CG    . LYS F 2  31  ? 149.047 191.135 165.169 1.00 81.79  ? 31  LYS F CG    1 
ATOM   3963  C  CD    . LYS F 2  31  ? 148.429 191.809 166.383 1.00 81.79  ? 31  LYS F CD    1 
ATOM   3964  C  CE    . LYS F 2  31  ? 148.226 193.294 166.172 1.00 81.79  ? 31  LYS F CE    1 
ATOM   3965  N  NZ    . LYS F 2  31  ? 147.495 193.914 167.309 1.00 81.79  ? 31  LYS F NZ    1 
ATOM   3966  N  N     . PRO F 2  32  ? 150.787 191.500 161.701 1.00 81.02  ? 32  PRO F N     1 
ATOM   3967  C  CA    . PRO F 2  32  ? 150.256 191.277 160.349 1.00 81.02  ? 32  PRO F CA    1 
ATOM   3968  C  C     . PRO F 2  32  ? 150.892 190.121 159.599 1.00 81.02  ? 32  PRO F C     1 
ATOM   3969  O  O     . PRO F 2  32  ? 150.232 189.572 158.714 1.00 81.02  ? 32  PRO F O     1 
ATOM   3970  C  CB    . PRO F 2  32  ? 150.519 192.608 159.636 1.00 81.02  ? 32  PRO F CB    1 
ATOM   3971  C  CG    . PRO F 2  32  ? 150.524 193.578 160.684 1.00 81.02  ? 32  PRO F CG    1 
ATOM   3972  C  CD    . PRO F 2  32  ? 151.174 192.918 161.845 1.00 81.02  ? 32  PRO F CD    1 
ATOM   3973  N  N     . ALA F 2  33  ? 152.130 189.727 159.905 1.00 80.40  ? 33  ALA F N     1 
ATOM   3974  C  CA    . ALA F 2  33  ? 152.710 188.590 159.192 1.00 80.40  ? 33  ALA F CA    1 
ATOM   3975  C  C     . ALA F 2  33  ? 152.065 187.280 159.624 1.00 80.40  ? 33  ALA F C     1 
ATOM   3976  O  O     . ALA F 2  33  ? 151.783 186.415 158.787 1.00 80.40  ? 33  ALA F O     1 
ATOM   3977  C  CB    . ALA F 2  33  ? 154.218 188.529 159.402 1.00 80.40  ? 33  ALA F CB    1 
ATOM   3978  N  N     . ILE F 2  34  ? 151.816 187.126 160.923 1.00 78.92  ? 34  ILE F N     1 
ATOM   3979  C  CA    . ILE F 2  34  ? 151.086 185.967 161.420 1.00 78.92  ? 34  ILE F CA    1 
ATOM   3980  C  C     . ILE F 2  34  ? 149.653 185.984 160.905 1.00 78.92  ? 34  ILE F C     1 
ATOM   3981  O  O     . ILE F 2  34  ? 149.082 184.930 160.576 1.00 78.92  ? 34  ILE F O     1 
ATOM   3982  C  CB    . ILE F 2  34  ? 151.169 185.931 162.956 1.00 78.92  ? 34  ILE F CB    1 
ATOM   3983  C  CG1   . ILE F 2  34  ? 152.609 185.678 163.367 1.00 78.92  ? 34  ILE F CG1   1 
ATOM   3984  C  CG2   . ILE F 2  34  ? 150.278 184.875 163.558 1.00 78.92  ? 34  ILE F CG2   1 
ATOM   3985  C  CD1   . ILE F 2  34  ? 152.850 185.900 164.822 1.00 78.92  ? 34  ILE F CD1   1 
ATOM   3986  N  N     . ARG F 2  35  ? 149.064 187.185 160.780 1.00 76.83  ? 35  ARG F N     1 
ATOM   3987  C  CA    . ARG F 2  35  ? 147.778 187.300 160.099 1.00 76.83  ? 35  ARG F CA    1 
ATOM   3988  C  C     . ARG F 2  35  ? 147.859 186.808 158.667 1.00 76.83  ? 35  ARG F C     1 
ATOM   3989  O  O     . ARG F 2  35  ? 146.999 186.042 158.235 1.00 76.83  ? 35  ARG F O     1 
ATOM   3990  C  CB    . ARG F 2  35  ? 147.266 188.737 160.125 1.00 76.83  ? 35  ARG F CB    1 
ATOM   3991  C  CG    . ARG F 2  35  ? 146.734 189.178 161.464 1.00 76.83  ? 35  ARG F CG    1 
ATOM   3992  C  CD    . ARG F 2  35  ? 146.225 190.611 161.435 1.00 76.83  ? 35  ARG F CD    1 
ATOM   3993  N  NE    . ARG F 2  35  ? 145.021 190.757 160.627 1.00 76.83  ? 35  ARG F NE    1 
ATOM   3994  C  CZ    . ARG F 2  35  ? 144.979 191.409 159.474 1.00 76.83  ? 35  ARG F CZ    1 
ATOM   3995  N  NH1   . ARG F 2  35  ? 146.074 191.969 158.992 1.00 76.83  ? 35  ARG F NH1   1 
ATOM   3996  N  NH2   . ARG F 2  35  ? 143.845 191.495 158.797 1.00 76.83  ? 35  ARG F NH2   1 
ATOM   3997  N  N     . ARG F 2  36  ? 148.921 187.170 157.950 1.00 75.08  ? 36  ARG F N     1 
ATOM   3998  C  CA    . ARG F 2  36  ? 149.025 186.817 156.538 1.00 75.08  ? 36  ARG F CA    1 
ATOM   3999  C  C     . ARG F 2  36  ? 149.210 185.322 156.345 1.00 75.08  ? 36  ARG F C     1 
ATOM   4000  O  O     . ARG F 2  36  ? 148.607 184.734 155.441 1.00 75.08  ? 36  ARG F O     1 
ATOM   4001  C  CB    . ARG F 2  36  ? 150.174 187.569 155.877 1.00 75.08  ? 36  ARG F CB    1 
ATOM   4002  C  CG    . ARG F 2  36  ? 149.931 189.030 155.559 1.00 75.08  ? 36  ARG F CG    1 
ATOM   4003  C  CD    . ARG F 2  36  ? 150.988 189.501 154.580 1.00 75.08  ? 36  ARG F CD    1 
ATOM   4004  N  NE    . ARG F 2  36  ? 152.320 189.326 155.131 1.00 75.08  ? 36  ARG F NE    1 
ATOM   4005  C  CZ    . ARG F 2  36  ? 152.958 190.260 155.821 1.00 75.08  ? 36  ARG F CZ    1 
ATOM   4006  N  NH1   . ARG F 2  36  ? 152.386 191.437 156.018 1.00 75.08  ? 36  ARG F NH1   1 
ATOM   4007  N  NH2   . ARG F 2  36  ? 154.168 190.023 156.299 1.00 75.08  ? 36  ARG F NH2   1 
ATOM   4008  N  N     . LEU F 2  37  ? 150.023 184.690 157.192 1.00 71.38  ? 37  LEU F N     1 
ATOM   4009  C  CA    . LEU F 2  37  ? 150.176 183.242 157.114 1.00 71.38  ? 37  LEU F CA    1 
ATOM   4010  C  C     . LEU F 2  37  ? 148.885 182.530 157.479 1.00 71.38  ? 37  LEU F C     1 
ATOM   4011  O  O     . LEU F 2  37  ? 148.577 181.474 156.910 1.00 71.38  ? 37  LEU F O     1 
ATOM   4012  C  CB    . LEU F 2  37  ? 151.293 182.784 158.036 1.00 71.38  ? 37  LEU F CB    1 
ATOM   4013  C  CG    . LEU F 2  37  ? 152.674 183.328 157.716 1.00 71.38  ? 37  LEU F CG    1 
ATOM   4014  C  CD1   . LEU F 2  37  ? 153.649 182.842 158.752 1.00 71.38  ? 37  LEU F CD1   1 
ATOM   4015  C  CD2   . LEU F 2  37  ? 153.081 182.890 156.347 1.00 71.38  ? 37  LEU F CD2   1 
ATOM   4016  N  N     . ALA F 2  38  ? 148.115 183.090 158.410 1.00 73.69  ? 38  ALA F N     1 
ATOM   4017  C  CA    . ALA F 2  38  ? 146.796 182.536 158.677 1.00 73.69  ? 38  ALA F CA    1 
ATOM   4018  C  C     . ALA F 2  38  ? 145.861 182.727 157.494 1.00 73.69  ? 38  ALA F C     1 
ATOM   4019  O  O     . ALA F 2  38  ? 144.993 181.882 157.253 1.00 73.69  ? 38  ALA F O     1 
ATOM   4020  C  CB    . ALA F 2  38  ? 146.200 183.167 159.928 1.00 73.69  ? 38  ALA F CB    1 
ATOM   4021  N  N     . ARG F 2  39  ? 146.025 183.819 156.742 1.00 71.03  ? 39  ARG F N     1 
ATOM   4022  C  CA    . ARG F 2  39  ? 145.195 184.033 155.565 1.00 71.03  ? 39  ARG F CA    1 
ATOM   4023  C  C     . ARG F 2  39  ? 145.533 183.051 154.460 1.00 71.03  ? 39  ARG F C     1 
ATOM   4024  O  O     . ARG F 2  39  ? 144.642 182.626 153.719 1.00 71.03  ? 39  ARG F O     1 
ATOM   4025  C  CB    . ARG F 2  39  ? 145.345 185.456 155.043 1.00 71.03  ? 39  ARG F CB    1 
ATOM   4026  C  CG    . ARG F 2  39  ? 144.816 186.514 155.959 1.00 71.03  ? 39  ARG F CG    1 
ATOM   4027  C  CD    . ARG F 2  39  ? 143.324 186.469 156.094 1.00 71.03  ? 39  ARG F CD    1 
ATOM   4028  N  NE    . ARG F 2  39  ? 142.866 187.635 156.830 1.00 71.03  ? 39  ARG F NE    1 
ATOM   4029  C  CZ    . ARG F 2  39  ? 142.683 187.661 158.140 1.00 71.03  ? 39  ARG F CZ    1 
ATOM   4030  N  NH1   . ARG F 2  39  ? 142.901 186.575 158.853 1.00 71.03  ? 39  ARG F NH1   1 
ATOM   4031  N  NH2   . ARG F 2  39  ? 142.277 188.769 158.734 1.00 71.03  ? 39  ARG F NH2   1 
ATOM   4032  N  N     . ARG F 2  40  ? 146.807 182.686 154.326 1.00 70.02  ? 40  ARG F N     1 
ATOM   4033  C  CA    . ARG F 2  40  ? 147.154 181.642 153.374 1.00 70.02  ? 40  ARG F CA    1 
ATOM   4034  C  C     . ARG F 2  40  ? 146.670 180.292 153.858 1.00 70.02  ? 40  ARG F C     1 
ATOM   4035  O  O     . ARG F 2  40  ? 146.261 179.452 153.054 1.00 70.02  ? 40  ARG F O     1 
ATOM   4036  C  CB    . ARG F 2  40  ? 148.661 181.622 153.132 1.00 70.02  ? 40  ARG F CB    1 
ATOM   4037  C  CG    . ARG F 2  40  ? 149.114 180.609 152.111 1.00 70.02  ? 40  ARG F CG    1 
ATOM   4038  C  CD    . ARG F 2  40  ? 150.589 180.716 151.870 1.00 70.02  ? 40  ARG F CD    1 
ATOM   4039  N  NE    . ARG F 2  40  ? 150.936 181.944 151.179 1.00 70.02  ? 40  ARG F NE    1 
ATOM   4040  C  CZ    . ARG F 2  40  ? 152.182 182.334 150.958 1.00 70.02  ? 40  ARG F CZ    1 
ATOM   4041  N  NH1   . ARG F 2  40  ? 153.194 181.590 151.381 1.00 70.02  ? 40  ARG F NH1   1 
ATOM   4042  N  NH2   . ARG F 2  40  ? 152.419 183.470 150.315 1.00 70.02  ? 40  ARG F NH2   1 
ATOM   4043  N  N     . GLY F 2  41  ? 146.660 180.079 155.167 1.00 69.57  ? 41  GLY F N     1 
ATOM   4044  C  CA    . GLY F 2  41  ? 146.140 178.830 155.674 1.00 69.57  ? 41  GLY F CA    1 
ATOM   4045  C  C     . GLY F 2  41  ? 144.641 178.681 155.555 1.00 69.57  ? 41  GLY F C     1 
ATOM   4046  O  O     . GLY F 2  41  ? 144.137 177.567 155.717 1.00 69.57  ? 41  GLY F O     1 
ATOM   4047  N  N     . GLY F 2  42  ? 143.924 179.756 155.270 1.00 67.41  ? 42  GLY F N     1 
ATOM   4048  C  CA    . GLY F 2  42  ? 142.482 179.675 155.263 1.00 67.41  ? 42  GLY F CA    1 
ATOM   4049  C  C     . GLY F 2  42  ? 141.863 179.857 156.624 1.00 67.41  ? 42  GLY F C     1 
ATOM   4050  O  O     . GLY F 2  42  ? 140.912 179.153 156.971 1.00 67.41  ? 42  GLY F O     1 
ATOM   4051  N  N     . VAL F 2  43  ? 142.379 180.792 157.411 1.00 68.06  ? 43  VAL F N     1 
ATOM   4052  C  CA    . VAL F 2  43  ? 141.867 181.089 158.739 1.00 68.06  ? 43  VAL F CA    1 
ATOM   4053  C  C     . VAL F 2  43  ? 141.190 182.445 158.682 1.00 68.06  ? 43  VAL F C     1 
ATOM   4054  O  O     . VAL F 2  43  ? 141.790 183.426 158.233 1.00 68.06  ? 43  VAL F O     1 
ATOM   4055  C  CB    . VAL F 2  43  ? 142.989 181.081 159.783 1.00 68.06  ? 43  VAL F CB    1 
ATOM   4056  C  CG1   . VAL F 2  43  ? 142.465 181.520 161.131 1.00 68.06  ? 43  VAL F CG1   1 
ATOM   4057  C  CG2   . VAL F 2  43  ? 143.592 179.706 159.861 1.00 68.06  ? 43  VAL F CG2   1 
ATOM   4058  N  N     . LYS F 2  44  ? 139.941 182.501 159.128 1.00 70.23  ? 44  LYS F N     1 
ATOM   4059  C  CA    . LYS F 2  44  ? 139.168 183.721 158.974 1.00 70.23  ? 44  LYS F CA    1 
ATOM   4060  C  C     . LYS F 2  44  ? 139.507 184.728 160.060 1.00 70.23  ? 44  LYS F C     1 
ATOM   4061  O  O     . LYS F 2  44  ? 139.973 185.834 159.771 1.00 70.23  ? 44  LYS F O     1 
ATOM   4062  C  CB    . LYS F 2  44  ? 137.681 183.391 158.987 1.00 70.23  ? 44  LYS F CB    1 
ATOM   4063  C  CG    . LYS F 2  44  ? 136.768 184.538 158.684 1.00 70.23  ? 44  LYS F CG    1 
ATOM   4064  C  CD    . LYS F 2  44  ? 135.361 184.010 158.623 1.00 70.23  ? 44  LYS F CD    1 
ATOM   4065  C  CE    . LYS F 2  44  ? 134.354 185.081 158.342 1.00 70.23  ? 44  LYS F CE    1 
ATOM   4066  N  NZ    . LYS F 2  44  ? 132.999 184.474 158.304 1.00 70.23  ? 44  LYS F NZ    1 
ATOM   4067  N  N     . ARG F 2  45  ? 139.301 184.354 161.316 1.00 81.20  ? 45  ARG F N     1 
ATOM   4068  C  CA    . ARG F 2  45  ? 139.405 185.274 162.436 1.00 81.20  ? 45  ARG F CA    1 
ATOM   4069  C  C     . ARG F 2  45  ? 140.390 184.749 163.475 1.00 81.20  ? 45  ARG F C     1 
ATOM   4070  O  O     . ARG F 2  45  ? 140.399 183.559 163.787 1.00 81.20  ? 45  ARG F O     1 
ATOM   4071  C  CB    . ARG F 2  45  ? 138.019 185.507 163.043 1.00 81.20  ? 45  ARG F CB    1 
ATOM   4072  C  CG    . ARG F 2  45  ? 138.020 186.405 164.244 1.00 81.20  ? 45  ARG F CG    1 
ATOM   4073  C  CD    . ARG F 2  45  ? 136.645 186.787 164.741 1.00 81.20  ? 45  ARG F CD    1 
ATOM   4074  N  NE    . ARG F 2  45  ? 136.778 187.358 166.076 1.00 81.20  ? 45  ARG F NE    1 
ATOM   4075  C  CZ    . ARG F 2  45  ? 135.801 187.938 166.759 1.00 81.20  ? 45  ARG F CZ    1 
ATOM   4076  N  NH1   . ARG F 2  45  ? 134.602 188.066 166.224 1.00 81.20  ? 45  ARG F NH1   1 
ATOM   4077  N  NH2   . ARG F 2  45  ? 136.033 188.411 167.973 1.00 81.20  ? 45  ARG F NH2   1 
ATOM   4078  N  N     . ILE F 2  46  ? 141.217 185.646 164.003 1.00 78.87  ? 46  ILE F N     1 
ATOM   4079  C  CA    . ILE F 2  46  ? 142.334 185.307 164.876 1.00 78.87  ? 46  ILE F CA    1 
ATOM   4080  C  C     . ILE F 2  46  ? 142.085 185.900 166.256 1.00 78.87  ? 46  ILE F C     1 
ATOM   4081  O  O     . ILE F 2  46  ? 141.825 187.102 166.380 1.00 78.87  ? 46  ILE F O     1 
ATOM   4082  C  CB    . ILE F 2  46  ? 143.645 185.841 164.286 1.00 78.87  ? 46  ILE F CB    1 
ATOM   4083  C  CG1   . ILE F 2  46  ? 143.884 185.213 162.923 1.00 78.87  ? 46  ILE F CG1   1 
ATOM   4084  C  CG2   . ILE F 2  46  ? 144.794 185.576 165.206 1.00 78.87  ? 46  ILE F CG2   1 
ATOM   4085  C  CD1   . ILE F 2  46  ? 144.933 185.922 162.135 1.00 78.87  ? 46  ILE F CD1   1 
ATOM   4086  N  N     . SER F 2  47  ? 142.222 185.081 167.295 1.00 81.63  ? 47  SER F N     1 
ATOM   4087  C  CA    . SER F 2  47  ? 141.951 185.529 168.656 1.00 81.63  ? 47  SER F CA    1 
ATOM   4088  C  C     . SER F 2  47  ? 143.115 186.352 169.200 1.00 81.63  ? 47  SER F C     1 
ATOM   4089  O  O     . SER F 2  47  ? 144.035 186.742 168.478 1.00 81.63  ? 47  SER F O     1 
ATOM   4090  C  CB    . SER F 2  47  ? 141.669 184.342 169.565 1.00 81.63  ? 47  SER F CB    1 
ATOM   4091  O  OG    . SER F 2  47  ? 141.497 184.784 170.898 1.00 81.63  ? 47  SER F OG    1 
ATOM   4092  N  N     . GLY F 2  48  ? 143.086 186.610 170.503 1.00 87.48  ? 48  GLY F N     1 
ATOM   4093  C  CA    . GLY F 2  48  ? 144.024 187.519 171.133 1.00 87.48  ? 48  GLY F CA    1 
ATOM   4094  C  C     . GLY F 2  48  ? 145.439 187.023 171.304 1.00 87.48  ? 48  GLY F C     1 
ATOM   4095  O  O     . GLY F 2  48  ? 146.369 187.574 170.713 1.00 87.48  ? 48  GLY F O     1 
ATOM   4096  N  N     . LEU F 2  49  ? 145.620 185.977 172.104 1.00 87.10  ? 49  LEU F N     1 
ATOM   4097  C  CA    . LEU F 2  49  ? 146.949 185.504 172.452 1.00 87.10  ? 49  LEU F CA    1 
ATOM   4098  C  C     . LEU F 2  49  ? 147.496 184.505 171.449 1.00 87.10  ? 49  LEU F C     1 
ATOM   4099  O  O     . LEU F 2  49  ? 148.356 183.695 171.809 1.00 87.10  ? 49  LEU F O     1 
ATOM   4100  C  CB    . LEU F 2  49  ? 146.935 184.889 173.851 1.00 87.10  ? 49  LEU F CB    1 
ATOM   4101  C  CG    . LEU F 2  49  ? 146.632 185.840 175.008 1.00 87.10  ? 49  LEU F CG    1 
ATOM   4102  C  CD1   . LEU F 2  49  ? 146.586 185.083 176.320 1.00 87.10  ? 49  LEU F CD1   1 
ATOM   4103  C  CD2   . LEU F 2  49  ? 147.652 186.960 175.070 1.00 87.10  ? 49  LEU F CD2   1 
ATOM   4104  N  N     . ILE F 2  50  ? 147.008 184.534 170.209 1.00 84.57  ? 50  ILE F N     1 
ATOM   4105  C  CA    . ILE F 2  50  ? 147.514 183.641 169.175 1.00 84.57  ? 50  ILE F CA    1 
ATOM   4106  C  C     . ILE F 2  50  ? 148.953 183.984 168.843 1.00 84.57  ? 50  ILE F C     1 
ATOM   4107  O  O     . ILE F 2  50  ? 149.759 183.099 168.542 1.00 84.57  ? 50  ILE F O     1 
ATOM   4108  C  CB    . ILE F 2  50  ? 146.626 183.738 167.925 1.00 84.57  ? 50  ILE F CB    1 
ATOM   4109  C  CG1   . ILE F 2  50  ? 145.165 183.584 168.305 1.00 84.57  ? 50  ILE F CG1   1 
ATOM   4110  C  CG2   . ILE F 2  50  ? 146.984 182.667 166.919 1.00 84.57  ? 50  ILE F CG2   1 
ATOM   4111  C  CD1   . ILE F 2  50  ? 144.845 182.259 168.896 1.00 84.57  ? 50  ILE F CD1   1 
ATOM   4112  N  N     . TYR F 2  51  ? 149.307 185.264 168.933 1.00 86.92  ? 51  TYR F N     1 
ATOM   4113  C  CA    . TYR F 2  51  ? 150.579 185.718 168.400 1.00 86.92  ? 51  TYR F CA    1 
ATOM   4114  C  C     . TYR F 2  51  ? 151.735 185.332 169.307 1.00 86.92  ? 51  TYR F C     1 
ATOM   4115  O  O     . TYR F 2  51  ? 152.821 184.997 168.818 1.00 86.92  ? 51  TYR F O     1 
ATOM   4116  C  CB    . TYR F 2  51  ? 150.523 187.224 168.196 1.00 86.92  ? 51  TYR F CB    1 
ATOM   4117  C  CG    . TYR F 2  51  ? 149.309 187.623 167.407 1.00 86.92  ? 51  TYR F CG    1 
ATOM   4118  C  CD1   . TYR F 2  51  ? 149.232 187.391 166.042 1.00 86.92  ? 51  TYR F CD1   1 
ATOM   4119  C  CD2   . TYR F 2  51  ? 148.231 188.230 168.032 1.00 86.92  ? 51  TYR F CD2   1 
ATOM   4120  C  CE1   . TYR F 2  51  ? 148.112 187.745 165.331 1.00 86.92  ? 51  TYR F CE1   1 
ATOM   4121  C  CE2   . TYR F 2  51  ? 147.113 188.595 167.329 1.00 86.92  ? 51  TYR F CE2   1 
ATOM   4122  C  CZ    . TYR F 2  51  ? 147.058 188.356 165.980 1.00 86.92  ? 51  TYR F CZ    1 
ATOM   4123  O  OH    . TYR F 2  51  ? 145.935 188.723 165.284 1.00 86.92  ? 51  TYR F OH    1 
ATOM   4124  N  N     . GLU F 2  52  ? 151.508 185.363 170.625 1.00 91.67  ? 52  GLU F N     1 
ATOM   4125  C  CA    . GLU F 2  52  ? 152.507 184.913 171.593 1.00 91.67  ? 52  GLU F CA    1 
ATOM   4126  C  C     . GLU F 2  52  ? 152.868 183.452 171.371 1.00 91.67  ? 52  GLU F C     1 
ATOM   4127  O  O     . GLU F 2  52  ? 154.049 183.098 171.236 1.00 91.67  ? 52  GLU F O     1 
ATOM   4128  C  CB    . GLU F 2  52  ? 151.968 185.108 173.007 1.00 91.67  ? 52  GLU F CB    1 
ATOM   4129  C  CG    . GLU F 2  52  ? 151.759 186.542 173.404 1.00 91.67  ? 52  GLU F CG    1 
ATOM   4130  C  CD    . GLU F 2  52  ? 153.064 187.259 173.629 1.00 91.67  ? 52  GLU F CD    1 
ATOM   4131  O  OE1   . GLU F 2  52  ? 154.035 186.596 174.048 1.00 91.67  ? 52  GLU F OE1   1 
ATOM   4132  O  OE2   . GLU F 2  52  ? 153.116 188.485 173.399 1.00 91.67  ? 52  GLU F OE2   1 
ATOM   4133  N  N     . GLU F 2  53  ? 151.849 182.591 171.307 1.00 83.08  ? 53  GLU F N     1 
ATOM   4134  C  CA    . GLU F 2  53  ? 152.072 181.175 171.072 1.00 83.08  ? 53  GLU F CA    1 
ATOM   4135  C  C     . GLU F 2  53  ? 152.620 180.923 169.678 1.00 83.08  ? 53  GLU F C     1 
ATOM   4136  O  O     . GLU F 2  53  ? 153.383 179.975 169.480 1.00 83.08  ? 53  GLU F O     1 
ATOM   4137  C  CB    . GLU F 2  53  ? 150.771 180.405 171.298 1.00 83.08  ? 53  GLU F CB    1 
ATOM   4138  C  CG    . GLU F 2  53  ? 150.885 178.895 171.172 1.00 83.08  ? 53  GLU F CG    1 
ATOM   4139  C  CD    . GLU F 2  53  ? 151.786 178.276 172.223 1.00 83.08  ? 53  GLU F CD    1 
ATOM   4140  O  OE1   . GLU F 2  53  ? 151.876 178.819 173.340 1.00 83.08  ? 53  GLU F OE1   1 
ATOM   4141  O  OE2   . GLU F 2  53  ? 152.421 177.245 171.923 1.00 83.08  ? 53  GLU F OE2   1 
ATOM   4142  N  N     . THR F 2  54  ? 152.293 181.783 168.716 1.00 78.64  ? 54  THR F N     1 
ATOM   4143  C  CA    . THR F 2  54  ? 152.803 181.590 167.366 1.00 78.64  ? 54  THR F CA    1 
ATOM   4144  C  C     . THR F 2  54  ? 154.297 181.858 167.310 1.00 78.64  ? 54  THR F C     1 
ATOM   4145  O  O     . THR F 2  54  ? 155.053 181.075 166.716 1.00 78.64  ? 54  THR F O     1 
ATOM   4146  C  CB    . THR F 2  54  ? 152.063 182.495 166.398 1.00 78.64  ? 54  THR F CB    1 
ATOM   4147  O  OG1   . THR F 2  54  ? 150.662 182.249 166.520 1.00 78.64  ? 54  THR F OG1   1 
ATOM   4148  C  CG2   . THR F 2  54  ? 152.471 182.179 164.993 1.00 78.64  ? 54  THR F CG2   1 
ATOM   4149  N  N     . ARG F 2  55  ? 154.741 182.932 167.966 1.00 82.47  ? 55  ARG F N     1 
ATOM   4150  C  CA    . ARG F 2  55  ? 156.171 183.186 168.089 1.00 82.47  ? 55  ARG F CA    1 
ATOM   4151  C  C     . ARG F 2  55  ? 156.864 182.090 168.883 1.00 82.47  ? 55  ARG F C     1 
ATOM   4152  O  O     . ARG F 2  55  ? 158.022 181.761 168.602 1.00 82.47  ? 55  ARG F O     1 
ATOM   4153  C  CB    . ARG F 2  55  ? 156.414 184.530 168.765 1.00 82.47  ? 55  ARG F CB    1 
ATOM   4154  C  CG    . ARG F 2  55  ? 155.885 185.724 168.013 1.00 82.47  ? 55  ARG F CG    1 
ATOM   4155  C  CD    . ARG F 2  55  ? 156.134 186.967 168.831 1.00 82.47  ? 55  ARG F CD    1 
ATOM   4156  N  NE    . ARG F 2  55  ? 155.530 188.162 168.261 1.00 82.47  ? 55  ARG F NE    1 
ATOM   4157  C  CZ    . ARG F 2  55  ? 154.329 188.610 168.600 1.00 82.47  ? 55  ARG F CZ    1 
ATOM   4158  N  NH1   . ARG F 2  55  ? 153.613 187.961 169.500 1.00 82.47  ? 55  ARG F NH1   1 
ATOM   4159  N  NH2   . ARG F 2  55  ? 153.849 189.711 168.044 1.00 82.47  ? 55  ARG F NH2   1 
ATOM   4160  N  N     . GLY F 2  56  ? 156.170 181.508 169.863 1.00 76.15  ? 56  GLY F N     1 
ATOM   4161  C  CA    . GLY F 2  56  ? 156.759 180.407 170.610 1.00 76.15  ? 56  GLY F CA    1 
ATOM   4162  C  C     . GLY F 2  56  ? 156.946 179.155 169.775 1.00 76.15  ? 56  GLY F C     1 
ATOM   4163  O  O     . GLY F 2  56  ? 157.997 178.513 169.837 1.00 76.15  ? 56  GLY F O     1 
ATOM   4164  N  N     . VAL F 2  57  ? 155.941 178.801 168.974 1.00 72.05  ? 57  VAL F N     1 
ATOM   4165  C  CA    . VAL F 2  57  ? 156.006 177.582 168.174 1.00 72.05  ? 57  VAL F CA    1 
ATOM   4166  C  C     . VAL F 2  57  ? 157.041 177.723 167.074 1.00 72.05  ? 57  VAL F C     1 
ATOM   4167  O  O     . VAL F 2  57  ? 157.865 176.820 166.853 1.00 72.05  ? 57  VAL F O     1 
ATOM   4168  C  CB    . VAL F 2  57  ? 154.616 177.247 167.613 1.00 72.05  ? 57  VAL F CB    1 
ATOM   4169  C  CG1   . VAL F 2  57  ? 154.702 176.127 166.616 1.00 72.05  ? 57  VAL F CG1   1 
ATOM   4170  C  CG2   . VAL F 2  57  ? 153.724 176.821 168.730 1.00 72.05  ? 57  VAL F CG2   1 
ATOM   4171  N  N     . LEU F 2  58  ? 157.031 178.871 166.386 1.00 66.72  ? 58  LEU F N     1 
ATOM   4172  C  CA    . LEU F 2  58  ? 158.062 179.166 165.397 1.00 66.72  ? 58  LEU F CA    1 
ATOM   4173  C  C     . LEU F 2  58  ? 159.444 179.170 166.030 1.00 66.72  ? 58  LEU F C     1 
ATOM   4174  O  O     . LEU F 2  58  ? 160.414 178.687 165.427 1.00 66.72  ? 58  LEU F O     1 
ATOM   4175  C  CB    . LEU F 2  58  ? 157.775 180.511 164.742 1.00 66.72  ? 58  LEU F CB    1 
ATOM   4176  C  CG    . LEU F 2  58  ? 158.810 180.995 163.735 1.00 66.72  ? 58  LEU F CG    1 
ATOM   4177  C  CD1   . LEU F 2  58  ? 158.865 180.047 162.581 1.00 66.72  ? 58  LEU F CD1   1 
ATOM   4178  C  CD2   . LEU F 2  58  ? 158.476 182.391 163.270 1.00 66.72  ? 58  LEU F CD2   1 
ATOM   4179  N  N     . LYS F 2  59  ? 159.534 179.661 167.265 1.00 69.61  ? 59  LYS F N     1 
ATOM   4180  C  CA    . LYS F 2  59  ? 160.801 179.671 167.977 1.00 69.61  ? 59  LYS F CA    1 
ATOM   4181  C  C     . LYS F 2  59  ? 161.295 178.261 168.255 1.00 69.61  ? 59  LYS F C     1 
ATOM   4182  O  O     . LYS F 2  59  ? 162.482 177.976 168.082 1.00 69.61  ? 59  LYS F O     1 
ATOM   4183  C  CB    . LYS F 2  59  ? 160.654 180.453 169.276 1.00 69.61  ? 59  LYS F CB    1 
ATOM   4184  C  CG    . LYS F 2  59  ? 161.929 180.577 170.070 1.00 69.61  ? 59  LYS F CG    1 
ATOM   4185  C  CD    . LYS F 2  59  ? 161.701 181.371 171.338 1.00 69.61  ? 59  LYS F CD    1 
ATOM   4186  C  CE    . LYS F 2  59  ? 162.994 181.540 172.100 1.00 69.61  ? 59  LYS F CE    1 
ATOM   4187  N  NZ    . LYS F 2  59  ? 163.480 180.234 172.616 1.00 69.61  ? 59  LYS F NZ    1 
ATOM   4188  N  N     . VAL F 2  60  ? 160.392 177.356 168.648 1.00 72.17  ? 60  VAL F N     1 
ATOM   4189  C  CA    . VAL F 2  60  ? 160.791 175.980 168.941 1.00 72.17  ? 60  VAL F CA    1 
ATOM   4190  C  C     . VAL F 2  60  ? 161.244 175.276 167.676 1.00 72.17  ? 60  VAL F C     1 
ATOM   4191  O  O     . VAL F 2  60  ? 162.292 174.611 167.659 1.00 72.17  ? 60  VAL F O     1 
ATOM   4192  C  CB    . VAL F 2  60  ? 159.641 175.221 169.624 1.00 72.17  ? 60  VAL F CB    1 
ATOM   4193  C  CG1   . VAL F 2  60  ? 159.946 173.741 169.707 1.00 72.17  ? 60  VAL F CG1   1 
ATOM   4194  C  CG2   . VAL F 2  60  ? 159.408 175.766 171.022 1.00 72.17  ? 60  VAL F CG2   1 
ATOM   4195  N  N     . PHE F 2  61  ? 160.488 175.454 166.589 1.00 69.35  ? 61  PHE F N     1 
ATOM   4196  C  CA    . PHE F 2  61  ? 160.811 174.780 165.339 1.00 69.35  ? 61  PHE F CA    1 
ATOM   4197  C  C     . PHE F 2  61  ? 162.137 175.258 164.766 1.00 69.35  ? 61  PHE F C     1 
ATOM   4198  O  O     . PHE F 2  61  ? 162.979 174.438 164.366 1.00 69.35  ? 61  PHE F O     1 
ATOM   4199  C  CB    . PHE F 2  61  ? 159.686 174.986 164.338 1.00 69.35  ? 61  PHE F CB    1 
ATOM   4200  C  CG    . PHE F 2  61  ? 159.964 174.397 163.011 1.00 69.35  ? 61  PHE F CG    1 
ATOM   4201  C  CD1   . PHE F 2  61  ? 160.018 173.033 162.849 1.00 69.35  ? 61  PHE F CD1   1 
ATOM   4202  C  CD2   . PHE F 2  61  ? 160.153 175.203 161.917 1.00 69.35  ? 61  PHE F CD2   1 
ATOM   4203  C  CE1   . PHE F 2  61  ? 160.276 172.480 161.618 1.00 69.35  ? 61  PHE F CE1   1 
ATOM   4204  C  CE2   . PHE F 2  61  ? 160.401 174.661 160.684 1.00 69.35  ? 61  PHE F CE2   1 
ATOM   4205  C  CZ    . PHE F 2  61  ? 160.464 173.292 160.533 1.00 69.35  ? 61  PHE F CZ    1 
ATOM   4206  N  N     . LEU F 2  62  ? 162.368 176.569 164.778 1.00 66.65  ? 62  LEU F N     1 
ATOM   4207  C  CA    . LEU F 2  62  ? 163.656 177.073 164.322 1.00 66.65  ? 62  LEU F CA    1 
ATOM   4208  C  C     . LEU F 2  62  ? 164.787 176.698 165.267 1.00 66.65  ? 62  LEU F C     1 
ATOM   4209  O  O     . LEU F 2  62  ? 165.926 176.561 164.821 1.00 66.65  ? 62  LEU F O     1 
ATOM   4210  C  CB    . LEU F 2  62  ? 163.598 178.584 164.141 1.00 66.65  ? 62  LEU F CB    1 
ATOM   4211  C  CG    . LEU F 2  62  ? 162.735 179.053 162.981 1.00 66.65  ? 62  LEU F CG    1 
ATOM   4212  C  CD1   . LEU F 2  62  ? 162.660 180.563 162.952 1.00 66.65  ? 62  LEU F CD1   1 
ATOM   4213  C  CD2   . LEU F 2  62  ? 163.326 178.522 161.706 1.00 66.65  ? 62  LEU F CD2   1 
ATOM   4214  N  N     . GLU F 2  63  ? 164.503 176.515 166.563 1.00 74.49  ? 63  GLU F N     1 
ATOM   4215  C  CA    . GLU F 2  63  ? 165.550 176.046 167.465 1.00 74.49  ? 63  GLU F CA    1 
ATOM   4216  C  C     . GLU F 2  63  ? 165.986 174.631 167.128 1.00 74.49  ? 63  GLU F C     1 
ATOM   4217  O  O     . GLU F 2  63  ? 167.189 174.332 167.139 1.00 74.49  ? 63  GLU F O     1 
ATOM   4218  C  CB    . GLU F 2  63  ? 165.102 176.118 168.922 1.00 74.49  ? 63  GLU F CB    1 
ATOM   4219  C  CG    . GLU F 2  63  ? 165.266 177.479 169.569 1.00 74.49  ? 63  GLU F CG    1 
ATOM   4220  C  CD    . GLU F 2  63  ? 164.735 177.518 170.984 1.00 74.49  ? 63  GLU F CD    1 
ATOM   4221  O  OE1   . GLU F 2  63  ? 164.122 176.519 171.413 1.00 74.49  ? 63  GLU F OE1   1 
ATOM   4222  O  OE2   . GLU F 2  63  ? 164.924 178.547 171.664 1.00 74.49  ? 63  GLU F OE2   1 
ATOM   4223  N  N     . ASN F 2  64  ? 165.039 173.751 166.810 1.00 74.78  ? 64  ASN F N     1 
ATOM   4224  C  CA    . ASN F 2  64  ? 165.434 172.390 166.464 1.00 74.78  ? 64  ASN F CA    1 
ATOM   4225  C  C     . ASN F 2  64  ? 166.150 172.345 165.122 1.00 74.78  ? 64  ASN F C     1 
ATOM   4226  O  O     . ASN F 2  64  ? 167.215 171.718 165.003 1.00 74.78  ? 64  ASN F O     1 
ATOM   4227  C  CB    . ASN F 2  64  ? 164.224 171.465 166.468 1.00 74.78  ? 64  ASN F CB    1 
ATOM   4228  C  CG    . ASN F 2  64  ? 163.819 171.066 167.862 1.00 74.78  ? 64  ASN F CG    1 
ATOM   4229  O  OD1   . ASN F 2  64  ? 164.667 170.806 168.711 1.00 74.78  ? 64  ASN F OD1   1 
ATOM   4230  N  ND2   . ASN F 2  64  ? 162.518 171.002 168.107 1.00 74.78  ? 64  ASN F ND2   1 
ATOM   4231  N  N     . VAL F 2  65  ? 165.610 173.043 164.119 1.00 72.23  ? 65  VAL F N     1 
ATOM   4232  C  CA    . VAL F 2  65  ? 166.193 172.998 162.778 1.00 72.23  ? 65  VAL F CA    1 
ATOM   4233  C  C     . VAL F 2  65  ? 167.575 173.640 162.763 1.00 72.23  ? 65  VAL F C     1 
ATOM   4234  O  O     . VAL F 2  65  ? 168.515 173.102 162.164 1.00 72.23  ? 65  VAL F O     1 
ATOM   4235  C  CB    . VAL F 2  65  ? 165.235 173.657 161.773 1.00 72.23  ? 65  VAL F CB    1 
ATOM   4236  C  CG1   . VAL F 2  65  ? 165.878 173.810 160.428 1.00 72.23  ? 65  VAL F CG1   1 
ATOM   4237  C  CG2   . VAL F 2  65  ? 163.992 172.821 161.636 1.00 72.23  ? 65  VAL F CG2   1 
ATOM   4238  N  N     . ILE F 2  66  ? 167.741 174.756 163.472 1.00 73.03  ? 66  ILE F N     1 
ATOM   4239  C  CA    . ILE F 2  66  ? 169.044 175.411 163.526 1.00 73.03  ? 66  ILE F CA    1 
ATOM   4240  C  C     . ILE F 2  66  ? 170.041 174.576 164.314 1.00 73.03  ? 66  ILE F C     1 
ATOM   4241  O  O     . ILE F 2  66  ? 171.206 174.472 163.916 1.00 73.03  ? 66  ILE F O     1 
ATOM   4242  C  CB    . ILE F 2  66  ? 168.906 176.839 164.086 1.00 73.03  ? 66  ILE F CB    1 
ATOM   4243  C  CG1   . ILE F 2  66  ? 168.316 177.748 163.025 1.00 73.03  ? 66  ILE F CG1   1 
ATOM   4244  C  CG2   . ILE F 2  66  ? 170.226 177.428 164.516 1.00 73.03  ? 66  ILE F CG2   1 
ATOM   4245  C  CD1   . ILE F 2  66  ? 167.930 179.096 163.549 1.00 73.03  ? 66  ILE F CD1   1 
ATOM   4246  N  N     . ARG F 2  67  ? 169.600 173.940 165.412 1.00 78.25  ? 67  ARG F N     1 
ATOM   4247  C  CA    . ARG F 2  67  ? 170.486 173.060 166.182 1.00 78.25  ? 67  ARG F CA    1 
ATOM   4248  C  C     . ARG F 2  67  ? 171.018 171.911 165.332 1.00 78.25  ? 67  ARG F C     1 
ATOM   4249  O  O     . ARG F 2  67  ? 172.221 171.606 165.354 1.00 78.25  ? 67  ARG F O     1 
ATOM   4250  C  CB    . ARG F 2  67  ? 169.753 172.495 167.398 1.00 78.25  ? 67  ARG F CB    1 
ATOM   4251  C  CG    . ARG F 2  67  ? 170.603 171.577 168.262 1.00 78.25  ? 67  ARG F CG    1 
ATOM   4252  C  CD    . ARG F 2  67  ? 169.777 170.925 169.357 1.00 78.25  ? 67  ARG F CD    1 
ATOM   4253  N  NE    . ARG F 2  67  ? 169.316 171.865 170.364 1.00 78.25  ? 67  ARG F NE    1 
ATOM   4254  C  CZ    . ARG F 2  67  ? 168.421 171.583 171.305 1.00 78.25  ? 67  ARG F CZ    1 
ATOM   4255  N  NH1   . ARG F 2  67  ? 167.879 170.378 171.363 1.00 78.25  ? 67  ARG F NH1   1 
ATOM   4256  N  NH2   . ARG F 2  67  ? 168.063 172.505 172.185 1.00 78.25  ? 67  ARG F NH2   1 
ATOM   4257  N  N     . ASP F 2  68  ? 170.147 171.310 164.526 1.00 79.20  ? 68  ASP F N     1 
ATOM   4258  C  CA    . ASP F 2  68  ? 170.597 170.205 163.695 1.00 79.20  ? 68  ASP F CA    1 
ATOM   4259  C  C     . ASP F 2  68  ? 171.428 170.696 162.519 1.00 79.20  ? 68  ASP F C     1 
ATOM   4260  O  O     . ASP F 2  68  ? 172.319 169.978 162.050 1.00 79.20  ? 68  ASP F O     1 
ATOM   4261  C  CB    . ASP F 2  68  ? 169.390 169.422 163.228 1.00 79.20  ? 68  ASP F CB    1 
ATOM   4262  C  CG    . ASP F 2  68  ? 168.531 168.987 164.384 1.00 79.20  ? 68  ASP F CG    1 
ATOM   4263  O  OD1   . ASP F 2  68  ? 169.074 168.877 165.501 1.00 79.20  ? 68  ASP F OD1   1 
ATOM   4264  O  OD2   . ASP F 2  68  ? 167.314 168.778 164.190 1.00 79.20  ? 68  ASP F OD2   1 
ATOM   4265  N  N     . ALA F 2  69  ? 171.169 171.916 162.048 1.00 76.38  ? 69  ALA F N     1 
ATOM   4266  C  CA    . ALA F 2  69  ? 171.966 172.475 160.965 1.00 76.38  ? 69  ALA F CA    1 
ATOM   4267  C  C     . ALA F 2  69  ? 173.367 172.836 161.433 1.00 76.38  ? 69  ALA F C     1 
ATOM   4268  O  O     . ALA F 2  69  ? 174.346 172.617 160.710 1.00 76.38  ? 69  ALA F O     1 
ATOM   4269  C  CB    . ALA F 2  69  ? 171.271 173.696 160.395 1.00 76.38  ? 69  ALA F CB    1 
ATOM   4270  N  N     . VAL F 2  70  ? 173.472 173.410 162.633 1.00 76.54  ? 70  VAL F N     1 
ATOM   4271  C  CA    . VAL F 2  70  ? 174.767 173.706 163.234 1.00 76.54  ? 70  VAL F CA    1 
ATOM   4272  C  C     . VAL F 2  70  ? 175.538 172.423 163.468 1.00 76.54  ? 70  VAL F C     1 
ATOM   4273  O  O     . VAL F 2  70  ? 176.747 172.362 163.223 1.00 76.54  ? 70  VAL F O     1 
ATOM   4274  C  CB    . VAL F 2  70  ? 174.579 174.510 164.531 1.00 76.54  ? 70  VAL F CB    1 
ATOM   4275  C  CG1   . VAL F 2  70  ? 175.869 174.607 165.312 1.00 76.54  ? 70  VAL F CG1   1 
ATOM   4276  C  CG2   . VAL F 2  70  ? 174.123 175.901 164.193 1.00 76.54  ? 70  VAL F CG2   1 
ATOM   4277  N  N     . THR F 2  71  ? 174.841 171.369 163.896 1.00 80.18  ? 71  THR F N     1 
ATOM   4278  C  CA    . THR F 2  71  ? 175.490 170.070 164.038 1.00 80.18  ? 71  THR F CA    1 
ATOM   4279  C  C     . THR F 2  71  ? 175.987 169.551 162.693 1.00 80.18  ? 71  THR F C     1 
ATOM   4280  O  O     . THR F 2  71  ? 177.078 168.982 162.605 1.00 80.18  ? 71  THR F O     1 
ATOM   4281  C  CB    . THR F 2  71  ? 174.521 169.080 164.662 1.00 80.18  ? 71  THR F CB    1 
ATOM   4282  O  OG1   . THR F 2  71  ? 173.967 169.658 165.845 1.00 80.18  ? 71  THR F OG1   1 
ATOM   4283  C  CG2   . THR F 2  71  ? 175.260 167.823 165.051 1.00 80.18  ? 71  THR F CG2   1 
ATOM   4284  N  N     . TYR F 2  72  ? 175.226 169.793 161.625 1.00 78.15  ? 72  TYR F N     1 
ATOM   4285  C  CA    . TYR F 2  72  ? 175.704 169.485 160.282 1.00 78.15  ? 72  TYR F CA    1 
ATOM   4286  C  C     . TYR F 2  72  ? 176.853 170.366 159.833 1.00 78.15  ? 72  TYR F C     1 
ATOM   4287  O  O     . TYR F 2  72  ? 177.561 169.996 158.892 1.00 78.15  ? 72  TYR F O     1 
ATOM   4288  C  CB    . TYR F 2  72  ? 174.571 169.612 159.273 1.00 78.15  ? 72  TYR F CB    1 
ATOM   4289  C  CG    . TYR F 2  72  ? 173.731 168.384 159.146 1.00 78.15  ? 72  TYR F CG    1 
ATOM   4290  C  CD1   . TYR F 2  72  ? 174.245 167.142 159.449 1.00 78.15  ? 72  TYR F CD1   1 
ATOM   4291  C  CD2   . TYR F 2  72  ? 172.411 168.467 158.734 1.00 78.15  ? 72  TYR F CD2   1 
ATOM   4292  C  CE1   . TYR F 2  72  ? 173.476 166.015 159.326 1.00 78.15  ? 72  TYR F CE1   1 
ATOM   4293  C  CE2   . TYR F 2  72  ? 171.633 167.343 158.618 1.00 78.15  ? 72  TYR F CE2   1 
ATOM   4294  C  CZ    . TYR F 2  72  ? 172.173 166.118 158.919 1.00 78.15  ? 72  TYR F CZ    1 
ATOM   4295  O  OH    . TYR F 2  72  ? 171.407 164.989 158.805 1.00 78.15  ? 72  TYR F OH    1 
ATOM   4296  N  N     . THR F 2  73  ? 177.063 171.517 160.456 1.00 78.78  ? 73  THR F N     1 
ATOM   4297  C  CA    . THR F 2  73  ? 178.072 172.430 159.947 1.00 78.78  ? 73  THR F CA    1 
ATOM   4298  C  C     . THR F 2  73  ? 179.370 172.382 160.740 1.00 78.78  ? 73  THR F C     1 
ATOM   4299  O  O     . THR F 2  73  ? 180.449 172.555 160.165 1.00 78.78  ? 73  THR F O     1 
ATOM   4300  C  CB    . THR F 2  73  ? 177.501 173.846 159.920 1.00 78.78  ? 73  THR F CB    1 
ATOM   4301  O  OG1   . THR F 2  73  ? 176.235 173.806 159.261 1.00 78.78  ? 73  THR F OG1   1 
ATOM   4302  C  CG2   . THR F 2  73  ? 178.384 174.764 159.119 1.00 78.78  ? 73  THR F CG2   1 
ATOM   4303  N  N     . GLU F 2  74  ? 179.295 172.092 162.033 1.00 83.97  ? 74  GLU F N     1 
ATOM   4304  C  CA    . GLU F 2  74  ? 180.497 171.888 162.823 1.00 83.97  ? 74  GLU F CA    1 
ATOM   4305  C  C     . GLU F 2  74  ? 181.226 170.615 162.431 1.00 83.97  ? 74  GLU F C     1 
ATOM   4306  O  O     . GLU F 2  74  ? 182.435 170.517 162.656 1.00 83.97  ? 74  GLU F O     1 
ATOM   4307  C  CB    . GLU F 2  74  ? 180.152 171.833 164.308 1.00 83.97  ? 74  GLU F CB    1 
ATOM   4308  C  CG    . GLU F 2  74  ? 179.677 173.151 164.898 1.00 83.97  ? 74  GLU F CG    1 
ATOM   4309  C  CD    . GLU F 2  74  ? 179.245 173.022 166.348 1.00 83.97  ? 74  GLU F CD    1 
ATOM   4310  O  OE1   . GLU F 2  74  ? 179.143 171.881 166.848 1.00 83.97  ? 74  GLU F OE1   1 
ATOM   4311  O  OE2   . GLU F 2  74  ? 179.014 174.071 166.990 1.00 83.97  ? 74  GLU F OE2   1 
ATOM   4312  N  N     . HIS F 2  75  ? 180.520 169.645 161.848 1.00 84.06  ? 75  HIS F N     1 
ATOM   4313  C  CA    . HIS F 2  75  ? 181.149 168.373 161.524 1.00 84.06  ? 75  HIS F CA    1 
ATOM   4314  C  C     . HIS F 2  75  ? 182.055 168.487 160.313 1.00 84.06  ? 75  HIS F C     1 
ATOM   4315  O  O     . HIS F 2  75  ? 183.060 167.775 160.228 1.00 84.06  ? 75  HIS F O     1 
ATOM   4316  C  CB    . HIS F 2  75  ? 180.097 167.308 161.278 1.00 84.06  ? 75  HIS F CB    1 
ATOM   4317  C  CG    . HIS F 2  75  ? 180.680 165.967 160.999 1.00 84.06  ? 75  HIS F CG    1 
ATOM   4318  N  ND1   . HIS F 2  75  ? 181.308 165.216 161.968 1.00 84.06  ? 75  HIS F ND1   1 
ATOM   4319  C  CD2   . HIS F 2  75  ? 180.751 165.247 159.857 1.00 84.06  ? 75  HIS F CD2   1 
ATOM   4320  C  CE1   . HIS F 2  75  ? 181.730 164.083 161.434 1.00 84.06  ? 75  HIS F CE1   1 
ATOM   4321  N  NE2   . HIS F 2  75  ? 181.405 164.079 160.154 1.00 84.06  ? 75  HIS F NE2   1 
ATOM   4322  N  N     . ALA F 2  76  ? 181.728 169.366 159.378 1.00 79.73  ? 76  ALA F N     1 
ATOM   4323  C  CA    . ALA F 2  76  ? 182.655 169.694 158.308 1.00 79.73  ? 76  ALA F CA    1 
ATOM   4324  C  C     . ALA F 2  76  ? 183.700 170.712 158.731 1.00 79.73  ? 76  ALA F C     1 
ATOM   4325  O  O     . ALA F 2  76  ? 184.545 171.072 157.904 1.00 79.73  ? 76  ALA F O     1 
ATOM   4326  C  CB    . ALA F 2  76  ? 181.894 170.213 157.091 1.00 79.73  ? 76  ALA F CB    1 
ATOM   4327  N  N     . LYS F 2  77  ? 183.632 171.186 159.985 1.00 80.40  ? 77  LYS F N     1 
ATOM   4328  C  CA    . LYS F 2  77  ? 184.579 172.129 160.586 1.00 80.40  ? 77  LYS F CA    1 
ATOM   4329  C  C     . LYS F 2  77  ? 184.619 173.447 159.819 1.00 80.40  ? 77  LYS F C     1 
ATOM   4330  O  O     . LYS F 2  77  ? 185.669 174.072 159.673 1.00 80.40  ? 77  LYS F O     1 
ATOM   4331  C  CB    . LYS F 2  77  ? 185.975 171.519 160.701 1.00 80.40  ? 77  LYS F CB    1 
ATOM   4332  C  CG    . LYS F 2  77  ? 186.021 170.302 161.582 1.00 80.40  ? 77  LYS F CG    1 
ATOM   4333  C  CD    . LYS F 2  77  ? 187.412 169.710 161.591 1.00 80.40  ? 77  LYS F CD    1 
ATOM   4334  C  CE    . LYS F 2  77  ? 187.466 168.437 162.408 1.00 80.40  ? 77  LYS F CE    1 
ATOM   4335  N  NZ    . LYS F 2  77  ? 188.816 167.827 162.358 1.00 80.40  ? 77  LYS F NZ    1 
ATOM   4336  N  N     . ARG F 2  78  ? 183.459 173.875 159.338 1.00 79.01  ? 78  ARG F N     1 
ATOM   4337  C  CA    . ARG F 2  78  ? 183.338 175.068 158.521 1.00 79.01  ? 78  ARG F CA    1 
ATOM   4338  C  C     . ARG F 2  78  ? 182.565 176.131 159.283 1.00 79.01  ? 78  ARG F C     1 
ATOM   4339  O  O     . ARG F 2  78  ? 181.595 175.829 159.983 1.00 79.01  ? 78  ARG F O     1 
ATOM   4340  C  CB    . ARG F 2  78  ? 182.627 174.754 157.206 1.00 79.01  ? 78  ARG F CB    1 
ATOM   4341  C  CG    . ARG F 2  78  ? 183.352 173.729 156.372 1.00 79.01  ? 78  ARG F CG    1 
ATOM   4342  C  CD    . ARG F 2  78  ? 182.735 173.582 155.003 1.00 79.01  ? 78  ARG F CD    1 
ATOM   4343  N  NE    . ARG F 2  78  ? 181.388 173.033 155.029 1.00 79.01  ? 78  ARG F NE    1 
ATOM   4344  C  CZ    . ARG F 2  78  ? 180.309 173.718 154.684 1.00 79.01  ? 78  ARG F CZ    1 
ATOM   4345  N  NH1   . ARG F 2  78  ? 180.423 174.977 154.296 1.00 79.01  ? 78  ARG F NH1   1 
ATOM   4346  N  NH2   . ARG F 2  78  ? 179.115 173.150 154.724 1.00 79.01  ? 78  ARG F NH2   1 
ATOM   4347  N  N     . LYS F 2  79  ? 182.996 177.379 159.140 1.00 79.89  ? 79  LYS F N     1 
ATOM   4348  C  CA    . LYS F 2  79  ? 182.379 178.477 159.868 1.00 79.89  ? 79  LYS F CA    1 
ATOM   4349  C  C     . LYS F 2  79  ? 181.091 178.959 159.218 1.00 79.89  ? 79  LYS F C     1 
ATOM   4350  O  O     . LYS F 2  79  ? 180.344 179.713 159.849 1.00 79.89  ? 79  LYS F O     1 
ATOM   4351  C  CB    . LYS F 2  79  ? 183.348 179.658 159.977 1.00 79.89  ? 79  LYS F CB    1 
ATOM   4352  C  CG    . LYS F 2  79  ? 184.226 179.713 161.228 1.00 79.89  ? 79  LYS F CG    1 
ATOM   4353  C  CD    . LYS F 2  79  ? 185.221 178.568 161.303 1.00 79.89  ? 79  LYS F CD    1 
ATOM   4354  C  CE    . LYS F 2  79  ? 186.049 178.613 162.578 1.00 79.89  ? 79  LYS F CE    1 
ATOM   4355  N  NZ    . LYS F 2  79  ? 186.900 179.834 162.649 1.00 79.89  ? 79  LYS F NZ    1 
ATOM   4356  N  N     . THR F 2  80  ? 180.814 178.552 157.987 1.00 81.48  ? 80  THR F N     1 
ATOM   4357  C  CA    . THR F 2  80  ? 179.700 179.085 157.220 1.00 81.48  ? 80  THR F CA    1 
ATOM   4358  C  C     . THR F 2  80  ? 178.654 178.001 157.004 1.00 81.48  ? 80  THR F C     1 
ATOM   4359  O  O     . THR F 2  80  ? 178.974 176.913 156.517 1.00 81.48  ? 80  THR F O     1 
ATOM   4360  C  CB    . THR F 2  80  ? 180.186 179.621 155.873 1.00 81.48  ? 80  THR F CB    1 
ATOM   4361  O  OG1   . THR F 2  80  ? 181.185 180.622 156.095 1.00 81.48  ? 80  THR F OG1   1 
ATOM   4362  C  CG2   . THR F 2  80  ? 179.041 180.234 155.100 1.00 81.48  ? 80  THR F CG2   1 
ATOM   4363  N  N     . VAL F 2  81  ? 177.416 178.302 157.364 1.00 78.47  ? 81  VAL F N     1 
ATOM   4364  C  CA    . VAL F 2  81  ? 176.305 177.388 157.137 1.00 78.47  ? 81  VAL F CA    1 
ATOM   4365  C  C     . VAL F 2  81  ? 175.793 177.589 155.723 1.00 78.47  ? 81  VAL F C     1 
ATOM   4366  O  O     . VAL F 2  81  ? 175.537 178.721 155.301 1.00 78.47  ? 81  VAL F O     1 
ATOM   4367  C  CB    . VAL F 2  81  ? 175.199 177.630 158.168 1.00 78.47  ? 81  VAL F CB    1 
ATOM   4368  C  CG1   . VAL F 2  81  ? 173.970 176.829 157.834 1.00 78.47  ? 81  VAL F CG1   1 
ATOM   4369  C  CG2   . VAL F 2  81  ? 175.698 177.299 159.550 1.00 78.47  ? 81  VAL F CG2   1 
ATOM   4370  N  N     . THR F 2  82  ? 175.662 176.499 154.972 1.00 78.13  ? 82  THR F N     1 
ATOM   4371  C  CA    . THR F 2  82  ? 175.148 176.573 153.618 1.00 78.13  ? 82  THR F CA    1 
ATOM   4372  C  C     . THR F 2  82  ? 173.686 176.158 153.591 1.00 78.13  ? 82  THR F C     1 
ATOM   4373  O  O     . THR F 2  82  ? 173.073 175.865 154.615 1.00 78.13  ? 82  THR F O     1 
ATOM   4374  C  CB    . THR F 2  82  ? 175.950 175.685 152.675 1.00 78.13  ? 82  THR F CB    1 
ATOM   4375  O  OG1   . THR F 2  82  ? 175.699 174.314 152.996 1.00 78.13  ? 82  THR F OG1   1 
ATOM   4376  C  CG2   . THR F 2  82  ? 177.426 175.960 152.830 1.00 78.13  ? 82  THR F CG2   1 
ATOM   4377  N  N     . ALA F 2  83  ? 173.129 176.109 152.387 1.00 78.28  ? 83  ALA F N     1 
ATOM   4378  C  CA    . ALA F 2  83  ? 171.738 175.734 152.196 1.00 78.28  ? 83  ALA F CA    1 
ATOM   4379  C  C     . ALA F 2  83  ? 171.548 174.231 152.121 1.00 78.28  ? 83  ALA F C     1 
ATOM   4380  O  O     . ALA F 2  83  ? 170.497 173.727 152.540 1.00 78.28  ? 83  ALA F O     1 
ATOM   4381  C  CB    . ALA F 2  83  ? 171.187 176.385 150.929 1.00 78.28  ? 83  ALA F CB    1 
ATOM   4382  N  N     . MET F 2  84  ? 172.542 173.504 151.597 1.00 79.24  ? 84  MET F N     1 
ATOM   4383  C  CA    . MET F 2  84  ? 172.484 172.047 151.608 1.00 79.24  ? 84  MET F CA    1 
ATOM   4384  C  C     . MET F 2  84  ? 172.487 171.496 153.019 1.00 79.24  ? 84  MET F C     1 
ATOM   4385  O  O     . MET F 2  84  ? 171.886 170.439 153.266 1.00 79.24  ? 84  MET F O     1 
ATOM   4386  C  CB    . MET F 2  84  ? 173.656 171.464 150.838 1.00 79.24  ? 84  MET F CB    1 
ATOM   4387  C  CG    . MET F 2  84  ? 173.566 171.678 149.368 1.00 79.24  ? 84  MET F CG    1 
ATOM   4388  S  SD    . MET F 2  84  ? 172.033 170.968 148.773 1.00 79.24  ? 84  MET F SD    1 
ATOM   4389  C  CE    . MET F 2  84  ? 172.308 169.237 149.092 1.00 79.24  ? 84  MET F CE    1 
ATOM   4390  N  N     . ASP F 2  85  ? 173.165 172.193 153.938 1.00 80.88  ? 85  ASP F N     1 
ATOM   4391  C  CA    . ASP F 2  85  ? 173.109 171.898 155.364 1.00 80.88  ? 85  ASP F CA    1 
ATOM   4392  C  C     . ASP F 2  85  ? 171.680 171.797 155.851 1.00 80.88  ? 85  ASP F C     1 
ATOM   4393  O  O     . ASP F 2  85  ? 171.263 170.773 156.401 1.00 80.88  ? 85  ASP F O     1 
ATOM   4394  C  CB    . ASP F 2  85  ? 173.820 172.997 156.146 1.00 80.88  ? 85  ASP F CB    1 
ATOM   4395  C  CG    . ASP F 2  85  ? 175.283 173.120 155.797 1.00 80.88  ? 85  ASP F CG    1 
ATOM   4396  O  OD1   . ASP F 2  85  ? 175.900 172.108 155.407 1.00 80.88  ? 85  ASP F OD1   1 
ATOM   4397  O  OD2   . ASP F 2  85  ? 175.820 174.246 155.907 1.00 80.88  ? 85  ASP F OD2   1 
ATOM   4398  N  N     . VAL F 2  86  ? 170.891 172.832 155.596 1.00 75.25  ? 86  VAL F N     1 
ATOM   4399  C  CA    . VAL F 2  86  ? 169.567 172.880 156.183 1.00 75.25  ? 86  VAL F CA    1 
ATOM   4400  C  C     . VAL F 2  86  ? 168.521 172.145 155.367 1.00 75.25  ? 86  VAL F C     1 
ATOM   4401  O  O     . VAL F 2  86  ? 167.467 171.809 155.912 1.00 75.25  ? 86  VAL F O     1 
ATOM   4402  C  CB    . VAL F 2  86  ? 169.133 174.331 156.404 1.00 75.25  ? 86  VAL F CB    1 
ATOM   4403  C  CG1   . VAL F 2  86  ? 170.197 175.038 157.176 1.00 75.25  ? 86  VAL F CG1   1 
ATOM   4404  C  CG2   . VAL F 2  86  ? 168.892 175.019 155.096 1.00 75.25  ? 86  VAL F CG2   1 
ATOM   4405  N  N     . VAL F 2  87  ? 168.763 171.885 154.082 1.00 73.51  ? 87  VAL F N     1 
ATOM   4406  C  CA    . VAL F 2  87  ? 167.866 170.978 153.379 1.00 73.51  ? 87  VAL F CA    1 
ATOM   4407  C  C     . VAL F 2  87  ? 168.078 169.558 153.876 1.00 73.51  ? 87  VAL F C     1 
ATOM   4408  O  O     . VAL F 2  87  ? 167.122 168.785 154.018 1.00 73.51  ? 87  VAL F O     1 
ATOM   4409  C  CB    . VAL F 2  87  ? 168.059 171.101 151.860 1.00 73.51  ? 87  VAL F CB    1 
ATOM   4410  C  CG1   . VAL F 2  87  ? 167.201 170.104 151.105 1.00 73.51  ? 87  VAL F CG1   1 
ATOM   4411  C  CG2   . VAL F 2  87  ? 167.680 172.475 151.444 1.00 73.51  ? 87  VAL F CG2   1 
ATOM   4412  N  N     . TYR F 2  88  ? 169.326 169.210 154.203 1.00 74.16  ? 88  TYR F N     1 
ATOM   4413  C  CA    . TYR F 2  88  ? 169.593 167.936 154.864 1.00 74.16  ? 88  TYR F CA    1 
ATOM   4414  C  C     . TYR F 2  88  ? 168.930 167.861 156.237 1.00 74.16  ? 88  TYR F C     1 
ATOM   4415  O  O     . TYR F 2  88  ? 168.293 166.855 156.579 1.00 74.16  ? 88  TYR F O     1 
ATOM   4416  C  CB    . TYR F 2  88  ? 171.095 167.733 154.972 1.00 74.16  ? 88  TYR F CB    1 
ATOM   4417  C  CG    . TYR F 2  88  ? 171.731 167.306 153.684 1.00 74.16  ? 88  TYR F CG    1 
ATOM   4418  C  CD1   . TYR F 2  88  ? 170.990 166.667 152.707 1.00 74.16  ? 88  TYR F CD1   1 
ATOM   4419  C  CD2   . TYR F 2  88  ? 173.071 167.567 153.428 1.00 74.16  ? 88  TYR F CD2   1 
ATOM   4420  C  CE1   . TYR F 2  88  ? 171.571 166.271 151.521 1.00 74.16  ? 88  TYR F CE1   1 
ATOM   4421  C  CE2   . TYR F 2  88  ? 173.659 167.192 152.245 1.00 74.16  ? 88  TYR F CE2   1 
ATOM   4422  C  CZ    . TYR F 2  88  ? 172.907 166.539 151.295 1.00 74.16  ? 88  TYR F CZ    1 
ATOM   4423  O  OH    . TYR F 2  88  ? 173.498 166.154 150.113 1.00 74.16  ? 88  TYR F OH    1 
ATOM   4424  N  N     . ALA F 2  89  ? 169.046 168.936 157.024 1.00 70.83  ? 89  ALA F N     1 
ATOM   4425  C  CA    . ALA F 2  89  ? 168.433 168.958 158.347 1.00 70.83  ? 89  ALA F CA    1 
ATOM   4426  C  C     . ALA F 2  89  ? 166.918 168.933 158.275 1.00 70.83  ? 89  ALA F C     1 
ATOM   4427  O  O     . ALA F 2  89  ? 166.268 168.381 159.167 1.00 70.83  ? 89  ALA F O     1 
ATOM   4428  C  CB    . ALA F 2  89  ? 168.885 170.185 159.128 1.00 70.83  ? 89  ALA F CB    1 
ATOM   4429  N  N     . LEU F 2  90  ? 166.333 169.504 157.230 1.00 69.40  ? 90  LEU F N     1 
ATOM   4430  C  CA    . LEU F 2  90  ? 164.896 169.374 157.084 1.00 69.40  ? 90  LEU F CA    1 
ATOM   4431  C  C     . LEU F 2  90  ? 164.502 168.006 156.574 1.00 69.40  ? 90  LEU F C     1 
ATOM   4432  O  O     . LEU F 2  90  ? 163.390 167.548 156.857 1.00 69.40  ? 90  LEU F O     1 
ATOM   4433  C  CB    . LEU F 2  90  ? 164.349 170.441 156.150 1.00 69.40  ? 90  LEU F CB    1 
ATOM   4434  C  CG    . LEU F 2  90  ? 164.325 171.831 156.748 1.00 69.40  ? 90  LEU F CG    1 
ATOM   4435  C  CD1   . LEU F 2  90  ? 163.876 172.782 155.683 1.00 69.40  ? 90  LEU F CD1   1 
ATOM   4436  C  CD2   . LEU F 2  90  ? 163.391 171.849 157.921 1.00 69.40  ? 90  LEU F CD2   1 
ATOM   4437  N  N     . LYS F 2  91  ? 165.378 167.348 155.813 1.00 68.15  ? 91  LYS F N     1 
ATOM   4438  C  CA    . LYS F 2  91  ? 165.070 166.004 155.351 1.00 68.15  ? 91  LYS F CA    1 
ATOM   4439  C  C     . LYS F 2  91  ? 165.021 165.033 156.510 1.00 68.15  ? 91  LYS F C     1 
ATOM   4440  O  O     . LYS F 2  91  ? 164.128 164.185 156.581 1.00 68.15  ? 91  LYS F O     1 
ATOM   4441  C  CB    . LYS F 2  91  ? 166.104 165.525 154.341 1.00 68.15  ? 91  LYS F CB    1 
ATOM   4442  C  CG    . LYS F 2  91  ? 165.757 164.176 153.732 1.00 68.15  ? 91  LYS F CG    1 
ATOM   4443  C  CD    . LYS F 2  91  ? 166.884 163.630 152.876 1.00 68.15  ? 91  LYS F CD    1 
ATOM   4444  C  CE    . LYS F 2  91  ? 167.111 164.481 151.648 1.00 68.15  ? 91  LYS F CE    1 
ATOM   4445  N  NZ    . LYS F 2  91  ? 165.966 164.459 150.711 1.00 68.15  ? 91  LYS F NZ    1 
ATOM   4446  N  N     . ARG F 2  92  ? 165.958 165.171 157.444 1.00 69.85  ? 92  ARG F N     1 
ATOM   4447  C  CA    . ARG F 2  92  ? 166.081 164.189 158.510 1.00 69.85  ? 92  ARG F CA    1 
ATOM   4448  C  C     . ARG F 2  92  ? 164.917 164.289 159.488 1.00 69.85  ? 92  ARG F C     1 
ATOM   4449  O  O     . ARG F 2  92  ? 164.502 163.280 160.060 1.00 69.85  ? 92  ARG F O     1 
ATOM   4450  C  CB    . ARG F 2  92  ? 167.420 164.388 159.216 1.00 69.85  ? 92  ARG F CB    1 
ATOM   4451  C  CG    . ARG F 2  92  ? 168.033 163.196 159.938 1.00 69.85  ? 92  ARG F CG    1 
ATOM   4452  C  CD    . ARG F 2  92  ? 167.477 162.965 161.331 1.00 69.85  ? 92  ARG F CD    1 
ATOM   4453  N  NE    . ARG F 2  92  ? 167.163 164.213 162.015 1.00 69.85  ? 92  ARG F NE    1 
ATOM   4454  C  CZ    . ARG F 2  92  ? 168.045 165.010 162.596 1.00 69.85  ? 92  ARG F CZ    1 
ATOM   4455  N  NH1   . ARG F 2  92  ? 169.331 164.721 162.569 1.00 69.85  ? 92  ARG F NH1   1 
ATOM   4456  N  NH2   . ARG F 2  92  ? 167.631 166.107 163.192 1.00 69.85  ? 92  ARG F NH2   1 
ATOM   4457  N  N     . GLN F 2  93  ? 164.350 165.475 159.660 1.00 73.14  ? 93  GLN F N     1 
ATOM   4458  C  CA    . GLN F 2  93  ? 163.182 165.612 160.514 1.00 73.14  ? 93  GLN F CA    1 
ATOM   4459  C  C     . GLN F 2  93  ? 161.886 165.301 159.801 1.00 73.14  ? 93  GLN F C     1 
ATOM   4460  O  O     . GLN F 2  93  ? 160.823 165.641 160.323 1.00 73.14  ? 93  GLN F O     1 
ATOM   4461  C  CB    . GLN F 2  93  ? 163.114 167.019 161.104 1.00 73.14  ? 93  GLN F CB    1 
ATOM   4462  C  CG    . GLN F 2  93  ? 164.176 167.283 162.143 1.00 73.14  ? 93  GLN F CG    1 
ATOM   4463  C  CD    . GLN F 2  93  ? 164.045 168.643 162.780 1.00 73.14  ? 93  GLN F CD    1 
ATOM   4464  O  OE1   . GLN F 2  93  ? 163.227 169.458 162.365 1.00 73.14  ? 93  GLN F OE1   1 
ATOM   4465  N  NE2   . GLN F 2  93  ? 164.837 168.887 163.812 1.00 73.14  ? 93  GLN F NE2   1 
ATOM   4466  N  N     . GLY F 2  94  ? 161.941 164.673 158.631 1.00 76.05  ? 94  GLY F N     1 
ATOM   4467  C  CA    . GLY F 2  94  ? 160.737 164.312 157.907 1.00 76.05  ? 94  GLY F CA    1 
ATOM   4468  C  C     . GLY F 2  94  ? 159.970 165.481 157.344 1.00 76.05  ? 94  GLY F C     1 
ATOM   4469  O  O     . GLY F 2  94  ? 158.737 165.453 157.331 1.00 76.05  ? 94  GLY F O     1 
ATOM   4470  N  N     . ARG F 2  95  ? 160.662 166.530 156.912 1.00 69.59  ? 95  ARG F N     1 
ATOM   4471  C  CA    . ARG F 2  95  ? 160.054 167.747 156.395 1.00 69.59  ? 95  ARG F CA    1 
ATOM   4472  C  C     . ARG F 2  95  ? 160.787 168.190 155.141 1.00 69.59  ? 95  ARG F C     1 
ATOM   4473  O  O     . ARG F 2  95  ? 161.252 169.326 155.048 1.00 69.59  ? 95  ARG F O     1 
ATOM   4474  C  CB    . ARG F 2  95  ? 160.066 168.862 157.432 1.00 69.59  ? 95  ARG F CB    1 
ATOM   4475  C  CG    . ARG F 2  95  ? 159.240 168.567 158.645 1.00 69.59  ? 95  ARG F CG    1 
ATOM   4476  C  CD    . ARG F 2  95  ? 159.192 169.738 159.577 1.00 69.59  ? 95  ARG F CD    1 
ATOM   4477  N  NE    . ARG F 2  95  ? 158.551 169.380 160.831 1.00 69.59  ? 95  ARG F NE    1 
ATOM   4478  C  CZ    . ARG F 2  95  ? 157.239 169.396 161.030 1.00 69.59  ? 95  ARG F CZ    1 
ATOM   4479  N  NH1   . ARG F 2  95  ? 156.415 169.743 160.051 1.00 69.59  ? 95  ARG F NH1   1 
ATOM   4480  N  NH2   . ARG F 2  95  ? 156.750 169.054 162.209 1.00 69.59  ? 95  ARG F NH2   1 
ATOM   4481  N  N     . THR F 2  96  ? 160.944 167.275 154.187 1.00 61.66  ? 96  THR F N     1 
ATOM   4482  C  CA    . THR F 2  96  ? 161.829 167.486 153.046 1.00 61.66  ? 96  THR F CA    1 
ATOM   4483  C  C     . THR F 2  96  ? 161.332 168.604 152.134 1.00 61.66  ? 96  THR F C     1 
ATOM   4484  O  O     . THR F 2  96  ? 160.134 168.752 151.891 1.00 61.66  ? 96  THR F O     1 
ATOM   4485  C  CB    . THR F 2  96  ? 161.956 166.189 152.255 1.00 61.66  ? 96  THR F CB    1 
ATOM   4486  O  OG1   . THR F 2  96  ? 162.214 165.117 153.165 1.00 61.66  ? 96  THR F OG1   1 
ATOM   4487  C  CG2   . THR F 2  96  ? 163.126 166.249 151.278 1.00 61.66  ? 96  THR F CG2   1 
ATOM   4488  N  N     . LEU F 2  97  ? 162.278 169.386 151.626 1.00 56.38  ? 97  LEU F N     1 
ATOM   4489  C  CA    . LEU F 2  97  ? 162.028 170.652 150.954 1.00 56.38  ? 97  LEU F CA    1 
ATOM   4490  C  C     . LEU F 2  97  ? 162.888 170.708 149.708 1.00 56.38  ? 97  LEU F C     1 
ATOM   4491  O  O     . LEU F 2  97  ? 164.113 170.803 149.809 1.00 56.38  ? 97  LEU F O     1 
ATOM   4492  C  CB    . LEU F 2  97  ? 162.377 171.806 151.880 1.00 56.38  ? 97  LEU F CB    1 
ATOM   4493  C  CG    . LEU F 2  97  ? 162.356 173.217 151.321 1.00 56.38  ? 97  LEU F CG    1 
ATOM   4494  C  CD1   . LEU F 2  97  ? 160.968 173.627 150.924 1.00 56.38  ? 97  LEU F CD1   1 
ATOM   4495  C  CD2   . LEU F 2  97  ? 162.896 174.141 152.369 1.00 56.38  ? 97  LEU F CD2   1 
ATOM   4496  N  N     . TYR F 2  98  ? 162.268 170.669 148.539 1.00 50.16  ? 98  TYR F N     1 
ATOM   4497  C  CA    . TYR F 2  98  ? 163.049 170.705 147.314 1.00 50.16  ? 98  TYR F CA    1 
ATOM   4498  C  C     . TYR F 2  98  ? 163.388 172.153 146.990 1.00 50.16  ? 98  TYR F C     1 
ATOM   4499  O  O     . TYR F 2  98  ? 162.981 173.078 147.689 1.00 50.16  ? 98  TYR F O     1 
ATOM   4500  C  CB    . TYR F 2  98  ? 162.285 170.088 146.151 1.00 50.16  ? 98  TYR F CB    1 
ATOM   4501  C  CG    . TYR F 2  98  ? 161.878 168.645 146.302 1.00 50.16  ? 98  TYR F CG    1 
ATOM   4502  C  CD1   . TYR F 2  98  ? 162.492 167.805 147.210 1.00 50.16  ? 98  TYR F CD1   1 
ATOM   4503  C  CD2   . TYR F 2  98  ? 160.850 168.132 145.534 1.00 50.16  ? 98  TYR F CD2   1 
ATOM   4504  C  CE1   . TYR F 2  98  ? 162.090 166.502 147.343 1.00 50.16  ? 98  TYR F CE1   1 
ATOM   4505  C  CE2   . TYR F 2  98  ? 160.447 166.839 145.658 1.00 50.16  ? 98  TYR F CE2   1 
ATOM   4506  C  CZ    . TYR F 2  98  ? 161.067 166.027 146.563 1.00 50.16  ? 98  TYR F CZ    1 
ATOM   4507  O  OH    . TYR F 2  98  ? 160.666 164.733 146.702 1.00 50.16  ? 98  TYR F OH    1 
ATOM   4508  N  N     . GLY F 2  99  ? 164.108 172.362 145.900 1.00 57.35  ? 99  GLY F N     1 
ATOM   4509  C  CA    . GLY F 2  99  ? 164.359 173.709 145.440 1.00 57.35  ? 99  GLY F CA    1 
ATOM   4510  C  C     . GLY F 2  99  ? 165.620 174.347 145.955 1.00 57.35  ? 99  GLY F C     1 
ATOM   4511  O  O     . GLY F 2  99  ? 165.808 175.552 145.752 1.00 57.35  ? 99  GLY F O     1 
ATOM   4512  N  N     . PHE F 2  100 ? 166.478 173.600 146.632 1.00 59.97  ? 100 PHE F N     1 
ATOM   4513  C  CA    . PHE F 2  100 ? 167.788 174.117 146.995 1.00 59.97  ? 100 PHE F CA    1 
ATOM   4514  C  C     . PHE F 2  100 ? 168.859 173.065 146.774 1.00 59.97  ? 100 PHE F C     1 
ATOM   4515  O  O     . PHE F 2  100 ? 169.977 173.237 147.265 1.00 59.97  ? 100 PHE F O     1 
ATOM   4516  C  CB    . PHE F 2  100 ? 167.824 174.580 148.445 1.00 59.97  ? 100 PHE F CB    1 
ATOM   4517  C  CG    . PHE F 2  100 ? 166.821 175.647 148.774 1.00 59.97  ? 100 PHE F CG    1 
ATOM   4518  C  CD1   . PHE F 2  100 ? 167.015 176.949 148.374 1.00 59.97  ? 100 PHE F CD1   1 
ATOM   4519  C  CD2   . PHE F 2  100 ? 165.702 175.348 149.512 1.00 59.97  ? 100 PHE F CD2   1 
ATOM   4520  C  CE1   . PHE F 2  100 ? 166.099 177.916 148.683 1.00 59.97  ? 100 PHE F CE1   1 
ATOM   4521  C  CE2   . PHE F 2  100 ? 164.795 176.311 149.817 1.00 59.97  ? 100 PHE F CE2   1 
ATOM   4522  C  CZ    . PHE F 2  100 ? 164.996 177.595 149.406 1.00 59.97  ? 100 PHE F CZ    1 
ATOM   4523  N  N     . GLY F 2  101 ? 168.546 171.987 146.071 1.00 82.45  ? 101 GLY F N     1 
ATOM   4524  C  CA    . GLY F 2  101 ? 169.492 170.921 145.834 1.00 82.45  ? 101 GLY F CA    1 
ATOM   4525  C  C     . GLY F 2  101 ? 169.336 169.818 146.853 1.00 82.45  ? 101 GLY F C     1 
ATOM   4526  O  O     . GLY F 2  101 ? 169.038 170.095 148.017 1.00 82.45  ? 101 GLY F O     1 
ATOM   4527  N  N     . GLY F 2  102 ? 169.508 168.567 146.432 1.00 91.69  ? 102 GLY F N     1 
ATOM   4528  C  CA    . GLY F 2  102 ? 169.527 167.437 147.346 1.00 91.69  ? 102 GLY F CA    1 
ATOM   4529  C  C     . GLY F 2  102 ? 168.215 167.070 148.021 1.00 91.69  ? 102 GLY F C     1 
ATOM   4530  O  O     . GLY F 2  102 ? 168.096 166.002 148.623 1.00 91.69  ? 102 GLY F O     1 
ATOM   4531  O  OXT   . GLY F 2  102 ? 167.237 167.816 147.999 1.00 91.69  ? 102 GLY F OXT   1 
ATOM   4532  N  N     . GLY G 3  8   ? 208.381 133.806 165.949 1.00 30.00  ? 8   GLY G N     1 
ATOM   4533  C  CA    . GLY G 3  8   ? 207.526 132.694 165.488 1.00 30.00  ? 8   GLY G CA    1 
ATOM   4534  C  C     . GLY G 3  8   ? 206.443 132.362 166.500 1.00 30.00  ? 8   GLY G C     1 
ATOM   4535  O  O     . GLY G 3  8   ? 206.477 131.247 167.058 1.00 30.00  ? 8   GLY G O     1 
ATOM   4536  N  N     . LYS G 3  9   ? 205.514 133.297 166.727 1.00 30.00  ? 9   LYS G N     1 
ATOM   4537  C  CA    . LYS G 3  9   ? 204.402 133.091 167.694 1.00 30.00  ? 9   LYS G CA    1 
ATOM   4538  C  C     . LYS G 3  9   ? 203.321 134.151 167.457 1.00 30.00  ? 9   LYS G C     1 
ATOM   4539  O  O     . LYS G 3  9   ? 203.678 135.293 167.106 1.00 30.00  ? 9   LYS G O     1 
ATOM   4540  C  CB    . LYS G 3  9   ? 204.928 133.159 169.132 1.00 30.00  ? 9   LYS G CB    1 
ATOM   4541  C  CG    . LYS G 3  9   ? 205.367 134.541 169.599 1.00 30.00  ? 9   LYS G CG    1 
ATOM   4542  C  CD    . LYS G 3  9   ? 206.835 134.612 169.963 1.00 30.00  ? 9   LYS G CD    1 
ATOM   4543  C  CE    . LYS G 3  9   ? 207.502 135.884 169.486 1.00 30.00  ? 9   LYS G CE    1 
ATOM   4544  N  NZ    . LYS G 3  9   ? 206.524 136.982 169.306 1.00 30.00  ? 9   LYS G NZ    1 
ATOM   4545  N  N     . THR G 3  10  ? 202.051 133.777 167.644 1.00 30.00  ? 10  THR G N     1 
ATOM   4546  C  CA    . THR G 3  10  ? 200.912 134.713 167.449 1.00 30.00  ? 10  THR G CA    1 
ATOM   4547  C  C     . THR G 3  10  ? 200.178 134.900 168.782 1.00 30.00  ? 10  THR G C     1 
ATOM   4548  O  O     . THR G 3  10  ? 199.050 135.433 168.763 1.00 30.00  ? 10  THR G O     1 
ATOM   4549  C  CB    . THR G 3  10  ? 199.964 134.210 166.354 1.00 30.00  ? 10  THR G CB    1 
ATOM   4550  O  OG1   . THR G 3  10  ? 199.184 133.145 166.898 1.00 30.00  ? 10  THR G OG1   1 
ATOM   4551  C  CG2   . THR G 3  10  ? 200.693 133.730 165.118 1.00 30.00  ? 10  THR G CG2   1 
ATOM   4552  N  N     . ARG G 3  11  ? 200.801 134.473 169.884 1.00 30.00  ? 11  ARG G N     1 
ATOM   4553  C  CA    . ARG G 3  11  ? 200.193 134.596 171.237 1.00 30.00  ? 11  ARG G CA    1 
ATOM   4554  C  C     . ARG G 3  11  ? 200.283 136.054 171.702 1.00 30.00  ? 11  ARG G C     1 
ATOM   4555  O  O     . ARG G 3  11  ? 199.319 136.806 171.461 1.00 30.00  ? 11  ARG G O     1 
ATOM   4556  C  CB    . ARG G 3  11  ? 200.898 133.660 172.224 1.00 30.00  ? 11  ARG G CB    1 
ATOM   4557  C  CG    . ARG G 3  11  ? 201.156 132.263 171.680 1.00 30.00  ? 11  ARG G CG    1 
ATOM   4558  C  CD    . ARG G 3  11  ? 202.325 131.581 172.366 1.00 30.00  ? 11  ARG G CD    1 
ATOM   4559  N  NE    . ARG G 3  11  ? 203.609 132.094 171.911 1.00 30.00  ? 11  ARG G NE    1 
ATOM   4560  C  CZ    . ARG G 3  11  ? 204.256 133.108 172.474 1.00 30.00  ? 11  ARG G CZ    1 
ATOM   4561  N  NH1   . ARG G 3  11  ? 205.406 132.898 173.092 1.00 30.00  ? 11  ARG G NH1   1 
ATOM   4562  N  NH2   . ARG G 3  11  ? 203.753 134.327 172.415 1.00 30.00  ? 11  ARG G NH2   1 
ATOM   4563  N  N     . ALA G 3  12  ? 201.400 136.418 172.342 1.00 30.00  ? 12  ALA G N     1 
ATOM   4564  C  CA    . ALA G 3  12  ? 201.627 137.794 172.845 1.00 30.00  ? 12  ALA G CA    1 
ATOM   4565  C  C     . ALA G 3  12  ? 200.430 138.251 173.687 1.00 30.00  ? 12  ALA G C     1 
ATOM   4566  O  O     . ALA G 3  12  ? 199.745 139.208 173.270 1.00 30.00  ? 12  ALA G O     1 
ATOM   4567  C  CB    . ALA G 3  12  ? 201.887 138.732 171.692 1.00 30.00  ? 12  ALA G CB    1 
ATOM   4568  N  N     . LYS G 3  13  ? 200.185 137.598 174.819 1.00 30.00  ? 13  LYS G N     1 
ATOM   4569  C  CA    . LYS G 3  13  ? 199.070 137.958 175.687 1.00 30.00  ? 13  LYS G CA    1 
ATOM   4570  C  C     . LYS G 3  13  ? 197.819 138.284 174.878 1.00 30.00  ? 13  LYS G C     1 
ATOM   4571  O  O     . LYS G 3  13  ? 197.823 139.194 174.049 1.00 30.00  ? 13  LYS G O     1 
ATOM   4572  C  CB    . LYS G 3  13  ? 199.446 139.144 176.578 1.00 30.00  ? 13  LYS G CB    1 
ATOM   4573  C  CG    . LYS G 3  13  ? 200.683 138.912 177.430 1.00 30.00  ? 13  LYS G CG    1 
ATOM   4574  C  CD    . LYS G 3  13  ? 201.011 140.134 178.272 1.00 30.00  ? 13  LYS G CD    1 
ATOM   4575  C  CE    . LYS G 3  13  ? 202.242 139.898 179.133 1.00 30.00  ? 13  LYS G CE    1 
ATOM   4576  N  NZ    . LYS G 3  13  ? 202.606 141.107 179.922 1.00 30.00  ? 13  LYS G NZ    1 
ATOM   4577  N  N     . ALA G 3  14  ? 196.738 137.557 175.142 1.00 30.00  ? 14  ALA G N     1 
ATOM   4578  C  CA    . ALA G 3  14  ? 195.473 137.793 174.454 1.00 30.00  ? 14  ALA G CA    1 
ATOM   4579  C  C     . ALA G 3  14  ? 194.627 138.762 175.274 1.00 30.00  ? 14  ALA G C     1 
ATOM   4580  O  O     . ALA G 3  14  ? 194.054 138.384 176.295 1.00 30.00  ? 14  ALA G O     1 
ATOM   4581  C  CB    . ALA G 3  14  ? 194.732 136.484 174.239 1.00 30.00  ? 14  ALA G CB    1 
ATOM   4582  N  N     . LYS G 3  15  ? 194.551 140.011 174.825 1.00 30.00  ? 15  LYS G N     1 
ATOM   4583  C  CA    . LYS G 3  15  ? 193.790 141.034 175.536 1.00 30.00  ? 15  LYS G CA    1 
ATOM   4584  C  C     . LYS G 3  15  ? 192.446 141.358 174.889 1.00 30.00  ? 15  LYS G C     1 
ATOM   4585  O  O     . LYS G 3  15  ? 191.782 142.318 175.278 1.00 30.00  ? 15  LYS G O     1 
ATOM   4586  C  CB    . LYS G 3  15  ? 194.617 142.313 175.671 1.00 30.00  ? 15  LYS G CB    1 
ATOM   4587  C  CG    . LYS G 3  15  ? 196.117 142.080 175.710 1.00 30.00  ? 15  LYS G CG    1 
ATOM   4588  C  CD    . LYS G 3  15  ? 196.792 143.027 176.688 1.00 30.00  ? 15  LYS G CD    1 
ATOM   4589  C  CE    . LYS G 3  15  ? 195.871 143.362 177.851 1.00 30.00  ? 15  LYS G CE    1 
ATOM   4590  N  NZ    . LYS G 3  15  ? 196.616 143.951 178.998 1.00 30.00  ? 15  LYS G NZ    1 
ATOM   4591  N  N     . THR G 3  16  ? 192.047 140.559 173.905 1.00 89.20  ? 16  THR G N     1 
ATOM   4592  C  CA    . THR G 3  16  ? 190.777 140.761 173.204 1.00 89.20  ? 16  THR G CA    1 
ATOM   4593  C  C     . THR G 3  16  ? 190.589 142.197 172.703 1.00 89.20  ? 16  THR G C     1 
ATOM   4594  O  O     . THR G 3  16  ? 191.519 142.805 172.170 1.00 89.20  ? 16  THR G O     1 
ATOM   4595  C  CB    . THR G 3  16  ? 189.566 140.324 174.063 1.00 89.20  ? 16  THR G CB    1 
ATOM   4596  O  OG1   . THR G 3  16  ? 189.233 141.344 175.016 1.00 89.20  ? 16  THR G OG1   1 
ATOM   4597  C  CG2   . THR G 3  16  ? 189.880 139.033 174.803 1.00 89.20  ? 16  THR G CG2   1 
ATOM   4598  N  N     . ARG G 3  17  ? 189.380 142.724 172.858 1.00 80.32  ? 17  ARG G N     1 
ATOM   4599  C  CA    . ARG G 3  17  ? 189.075 144.081 172.427 1.00 80.32  ? 17  ARG G CA    1 
ATOM   4600  C  C     . ARG G 3  17  ? 188.132 144.766 173.409 1.00 80.32  ? 17  ARG G C     1 
ATOM   4601  O  O     . ARG G 3  17  ? 188.325 145.930 173.758 1.00 80.32  ? 17  ARG G O     1 
ATOM   4602  C  CB    . ARG G 3  17  ? 188.457 144.072 171.028 1.00 80.32  ? 17  ARG G CB    1 
ATOM   4603  C  CG    . ARG G 3  17  ? 189.409 143.626 169.931 1.00 80.32  ? 17  ARG G CG    1 
ATOM   4604  C  CD    . ARG G 3  17  ? 188.741 143.689 168.567 1.00 80.32  ? 17  ARG G CD    1 
ATOM   4605  N  NE    . ARG G 3  17  ? 189.615 143.198 167.506 1.00 80.32  ? 17  ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 3  17  ? 189.239 143.038 166.242 1.00 80.32  ? 17  ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 3  17  ? 188.000 143.330 165.874 1.00 80.32  ? 17  ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 3  17  ? 190.102 142.586 165.343 1.00 80.32  ? 17  ARG G NH2   1 
ATOM   4609  N  N     . SER G 3  18  ? 187.114 144.033 173.850 1.00 81.93  ? 18  SER G N     1 
ATOM   4610  C  CA    . SER G 3  18  ? 186.133 144.564 174.790 1.00 81.93  ? 18  SER G CA    1 
ATOM   4611  C  C     . SER G 3  18  ? 186.808 145.146 176.025 1.00 81.93  ? 18  SER G C     1 
ATOM   4612  O  O     . SER G 3  18  ? 186.620 146.318 176.349 1.00 81.93  ? 18  SER G O     1 
ATOM   4613  C  CB    . SER G 3  18  ? 185.141 143.476 175.200 1.00 81.93  ? 18  SER G CB    1 
ATOM   4614  O  OG    . SER G 3  18  ? 183.971 144.041 175.765 1.00 81.93  ? 18  SER G OG    1 
ATOM   4615  N  N     . SER G 3  19  ? 187.590 144.319 176.711 1.00 88.26  ? 19  SER G N     1 
ATOM   4616  C  CA    . SER G 3  19  ? 188.302 144.758 177.903 1.00 88.26  ? 19  SER G CA    1 
ATOM   4617  C  C     . SER G 3  19  ? 189.167 145.957 177.548 1.00 88.26  ? 19  SER G C     1 
ATOM   4618  O  O     . SER G 3  19  ? 188.999 147.046 178.096 1.00 88.26  ? 19  SER G O     1 
ATOM   4619  C  CB    . SER G 3  19  ? 189.174 143.628 178.449 1.00 88.26  ? 19  SER G CB    1 
ATOM   4620  O  OG    . SER G 3  19  ? 190.133 143.221 177.488 1.00 88.26  ? 19  SER G OG    1 
ATOM   4621  N  N     . ARG G 3  20  ? 190.094 145.747 176.620 1.00 90.63  ? 20  ARG G N     1 
ATOM   4622  C  CA    . ARG G 3  20  ? 190.980 146.816 176.172 1.00 90.63  ? 20  ARG G CA    1 
ATOM   4623  C  C     . ARG G 3  20  ? 190.377 148.191 176.444 1.00 90.63  ? 20  ARG G C     1 
ATOM   4624  O  O     . ARG G 3  20  ? 191.066 149.099 176.908 1.00 90.63  ? 20  ARG G O     1 
ATOM   4625  C  CB    . ARG G 3  20  ? 191.298 146.661 174.684 1.00 90.63  ? 20  ARG G CB    1 
ATOM   4626  C  CG    . ARG G 3  20  ? 192.288 145.550 174.376 1.00 90.63  ? 20  ARG G CG    1 
ATOM   4627  C  CD    . ARG G 3  20  ? 192.617 145.494 172.893 1.00 90.63  ? 20  ARG G CD    1 
ATOM   4628  N  NE    . ARG G 3  20  ? 193.378 144.296 172.548 1.00 90.63  ? 20  ARG G NE    1 
ATOM   4629  C  CZ    . ARG G 3  20  ? 194.704 144.248 172.475 1.00 90.63  ? 20  ARG G CZ    1 
ATOM   4630  N  NH1   . ARG G 3  20  ? 195.423 145.334 172.723 1.00 90.63  ? 20  ARG G NH1   1 
ATOM   4631  N  NH2   . ARG G 3  20  ? 195.312 143.115 172.154 1.00 90.63  ? 20  ARG G NH2   1 
ATOM   4632  N  N     . ALA G 3  21  ? 189.089 148.337 176.151 1.00 88.31  ? 21  ALA G N     1 
ATOM   4633  C  CA    . ALA G 3  21  ? 188.400 149.594 176.367 1.00 88.31  ? 21  ALA G CA    1 
ATOM   4634  C  C     . ALA G 3  21  ? 187.682 149.671 177.707 1.00 88.31  ? 21  ALA G C     1 
ATOM   4635  O  O     . ALA G 3  21  ? 187.226 150.755 178.082 1.00 88.31  ? 21  ALA G O     1 
ATOM   4636  C  CB    . ALA G 3  21  ? 187.389 149.844 175.244 1.00 88.31  ? 21  ALA G CB    1 
ATOM   4637  N  N     . GLY G 3  22  ? 187.573 148.568 178.438 1.00 85.80  ? 22  GLY G N     1 
ATOM   4638  C  CA    . GLY G 3  22  ? 186.877 148.604 179.709 1.00 85.80  ? 22  GLY G CA    1 
ATOM   4639  C  C     . GLY G 3  22  ? 185.371 148.623 179.577 1.00 85.80  ? 22  GLY G C     1 
ATOM   4640  O  O     . GLY G 3  22  ? 184.698 149.383 180.283 1.00 85.80  ? 22  GLY G O     1 
ATOM   4641  N  N     . LEU G 3  23  ? 184.820 147.815 178.677 1.00 77.99  ? 23  LEU G N     1 
ATOM   4642  C  CA    . LEU G 3  23  ? 183.381 147.766 178.482 1.00 77.99  ? 23  LEU G CA    1 
ATOM   4643  C  C     . LEU G 3  23  ? 182.877 146.342 178.612 1.00 77.99  ? 23  LEU G C     1 
ATOM   4644  O  O     . LEU G 3  23  ? 183.624 145.450 179.021 1.00 77.99  ? 23  LEU G O     1 
ATOM   4645  C  CB    . LEU G 3  23  ? 182.989 148.316 177.117 1.00 77.99  ? 23  LEU G CB    1 
ATOM   4646  C  CG    . LEU G 3  23  ? 182.791 149.819 176.953 1.00 77.99  ? 23  LEU G CG    1 
ATOM   4647  C  CD1   . LEU G 3  23  ? 184.088 150.585 176.949 1.00 77.99  ? 23  LEU G CD1   1 
ATOM   4648  C  CD2   . LEU G 3  23  ? 182.036 150.056 175.670 1.00 77.99  ? 23  LEU G CD2   1 
ATOM   4649  N  N     . GLN G 3  24  ? 181.605 146.125 178.282 1.00 78.12  ? 24  GLN G N     1 
ATOM   4650  C  CA    . GLN G 3  24  ? 181.027 144.789 178.257 1.00 78.12  ? 24  GLN G CA    1 
ATOM   4651  C  C     . GLN G 3  24  ? 180.200 144.571 176.999 1.00 78.12  ? 24  GLN G C     1 
ATOM   4652  O  O     . GLN G 3  24  ? 179.180 143.877 177.044 1.00 78.12  ? 24  GLN G O     1 
ATOM   4653  C  CB    . GLN G 3  24  ? 180.154 144.531 179.484 1.00 78.12  ? 24  GLN G CB    1 
ATOM   4654  C  CG    . GLN G 3  24  ? 180.874 144.617 180.818 1.00 78.12  ? 24  GLN G CG    1 
ATOM   4655  C  CD    . GLN G 3  24  ? 181.919 143.537 181.003 1.00 78.12  ? 24  GLN G CD    1 
ATOM   4656  O  OE1   . GLN G 3  24  ? 181.703 142.381 180.644 1.00 78.12  ? 24  GLN G OE1   1 
ATOM   4657  N  NE2   . GLN G 3  24  ? 183.063 143.910 181.562 1.00 78.12  ? 24  GLN G NE2   1 
ATOM   4658  N  N     . PHE G 3  25  ? 180.610 145.160 175.879 1.00 74.98  ? 25  PHE G N     1 
ATOM   4659  C  CA    . PHE G 3  25  ? 179.947 145.000 174.596 1.00 74.98  ? 25  PHE G CA    1 
ATOM   4660  C  C     . PHE G 3  25  ? 180.898 144.464 173.539 1.00 74.98  ? 25  PHE G C     1 
ATOM   4661  O  O     . PHE G 3  25  ? 182.094 144.765 173.568 1.00 74.98  ? 25  PHE G O     1 
ATOM   4662  C  CB    . PHE G 3  25  ? 179.326 146.316 174.109 1.00 74.98  ? 25  PHE G CB    1 
ATOM   4663  C  CG    . PHE G 3  25  ? 177.897 146.482 174.506 1.00 74.98  ? 25  PHE G CG    1 
ATOM   4664  C  CD1   . PHE G 3  25  ? 177.217 145.452 175.115 1.00 74.98  ? 25  PHE G CD1   1 
ATOM   4665  C  CD2   . PHE G 3  25  ? 177.205 147.627 174.180 1.00 74.98  ? 25  PHE G CD2   1 
ATOM   4666  C  CE1   . PHE G 3  25  ? 175.897 145.588 175.451 1.00 74.98  ? 25  PHE G CE1   1 
ATOM   4667  C  CE2   . PHE G 3  25  ? 175.881 147.758 174.506 1.00 74.98  ? 25  PHE G CE2   1 
ATOM   4668  C  CZ    . PHE G 3  25  ? 175.228 146.738 175.147 1.00 74.98  ? 25  PHE G CZ    1 
ATOM   4669  N  N     . PRO G 3  26  ? 180.402 143.665 172.588 1.00 71.76  ? 26  PRO G N     1 
ATOM   4670  C  CA    . PRO G 3  26  ? 181.294 143.040 171.606 1.00 71.76  ? 26  PRO G CA    1 
ATOM   4671  C  C     . PRO G 3  26  ? 181.771 144.039 170.565 1.00 71.76  ? 26  PRO G C     1 
ATOM   4672  O  O     . PRO G 3  26  ? 181.013 144.460 169.691 1.00 71.76  ? 26  PRO G O     1 
ATOM   4673  C  CB    . PRO G 3  26  ? 180.412 141.948 170.988 1.00 71.76  ? 26  PRO G CB    1 
ATOM   4674  C  CG    . PRO G 3  26  ? 179.032 142.430 171.172 1.00 71.76  ? 26  PRO G CG    1 
ATOM   4675  C  CD    . PRO G 3  26  ? 179.016 143.180 172.450 1.00 71.76  ? 26  PRO G CD    1 
ATOM   4676  N  N     . VAL G 3  27  ? 183.044 144.411 170.656 1.00 66.16  ? 27  VAL G N     1 
ATOM   4677  C  CA    . VAL G 3  27  ? 183.604 145.309 169.660 1.00 66.16  ? 27  VAL G CA    1 
ATOM   4678  C  C     . VAL G 3  27  ? 183.733 144.594 168.329 1.00 66.16  ? 27  VAL G C     1 
ATOM   4679  O  O     . VAL G 3  27  ? 183.512 145.184 167.268 1.00 66.16  ? 27  VAL G O     1 
ATOM   4680  C  CB    . VAL G 3  27  ? 184.951 145.854 170.160 1.00 66.16  ? 27  VAL G CB    1 
ATOM   4681  C  CG1   . VAL G 3  27  ? 185.578 146.793 169.160 1.00 66.16  ? 27  VAL G CG1   1 
ATOM   4682  C  CG2   . VAL G 3  27  ? 184.751 146.559 171.474 1.00 66.16  ? 27  VAL G CG2   1 
ATOM   4683  N  N     . GLY G 3  28  ? 184.034 143.300 168.360 1.00 70.96  ? 28  GLY G N     1 
ATOM   4684  C  CA    . GLY G 3  28  ? 184.210 142.573 167.119 1.00 70.96  ? 28  GLY G CA    1 
ATOM   4685  C  C     . GLY G 3  28  ? 182.904 142.310 166.404 1.00 70.96  ? 28  GLY G C     1 
ATOM   4686  O  O     . GLY G 3  28  ? 182.832 142.415 165.180 1.00 70.96  ? 28  GLY G O     1 
ATOM   4687  N  N     . ARG G 3  29  ? 181.853 141.971 167.152 1.00 77.63  ? 29  ARG G N     1 
ATOM   4688  C  CA    . ARG G 3  29  ? 180.573 141.664 166.522 1.00 77.63  ? 29  ARG G CA    1 
ATOM   4689  C  C     . ARG G 3  29  ? 179.906 142.927 165.981 1.00 77.63  ? 29  ARG G C     1 
ATOM   4690  O  O     . ARG G 3  29  ? 179.398 142.935 164.850 1.00 77.63  ? 29  ARG G O     1 
ATOM   4691  C  CB    . ARG G 3  29  ? 179.651 140.955 167.513 1.00 77.63  ? 29  ARG G CB    1 
ATOM   4692  C  CG    . ARG G 3  29  ? 178.354 140.481 166.894 1.00 77.63  ? 29  ARG G CG    1 
ATOM   4693  C  CD    . ARG G 3  29  ? 177.358 139.980 167.927 1.00 77.63  ? 29  ARG G CD    1 
ATOM   4694  N  NE    . ARG G 3  29  ? 177.778 138.756 168.592 1.00 77.63  ? 29  ARG G NE    1 
ATOM   4695  C  CZ    . ARG G 3  29  ? 177.122 138.209 169.609 1.00 77.63  ? 29  ARG G CZ    1 
ATOM   4696  N  NH1   . ARG G 3  29  ? 176.020 138.775 170.063 1.00 77.63  ? 29  ARG G NH1   1 
ATOM   4697  N  NH2   . ARG G 3  29  ? 177.561 137.093 170.164 1.00 77.63  ? 29  ARG G NH2   1 
ATOM   4698  N  N     . VAL G 3  30  ? 179.901 144.001 166.779 1.00 70.70  ? 30  VAL G N     1 
ATOM   4699  C  CA    . VAL G 3  30  ? 179.404 145.294 166.317 1.00 70.70  ? 30  VAL G CA    1 
ATOM   4700  C  C     . VAL G 3  30  ? 180.242 145.791 165.151 1.00 70.70  ? 30  VAL G C     1 
ATOM   4701  O  O     . VAL G 3  30  ? 179.711 146.300 164.163 1.00 70.70  ? 30  VAL G O     1 
ATOM   4702  C  CB    . VAL G 3  30  ? 179.386 146.294 167.486 1.00 70.70  ? 30  VAL G CB    1 
ATOM   4703  C  CG1   . VAL G 3  30  ? 179.151 147.690 167.009 1.00 70.70  ? 30  VAL G CG1   1 
ATOM   4704  C  CG2   . VAL G 3  30  ? 178.303 145.931 168.464 1.00 70.70  ? 30  VAL G CG2   1 
ATOM   4705  N  N     . HIS G 3  31  ? 181.551 145.575 165.222 1.00 68.31  ? 31  HIS G N     1 
ATOM   4706  C  CA    . HIS G 3  31  ? 182.475 145.998 164.177 1.00 68.31  ? 31  HIS G CA    1 
ATOM   4707  C  C     . HIS G 3  31  ? 182.202 145.288 162.860 1.00 68.31  ? 31  HIS G C     1 
ATOM   4708  O  O     . HIS G 3  31  ? 182.192 145.917 161.792 1.00 68.31  ? 31  HIS G O     1 
ATOM   4709  C  CB    . HIS G 3  31  ? 183.892 145.706 164.632 1.00 68.31  ? 31  HIS G CB    1 
ATOM   4710  C  CG    . HIS G 3  31  ? 184.925 146.122 163.656 1.00 68.31  ? 31  HIS G CG    1 
ATOM   4711  N  ND1   . HIS G 3  31  ? 185.304 147.433 163.495 1.00 68.31  ? 31  HIS G ND1   1 
ATOM   4712  C  CD2   . HIS G 3  31  ? 185.664 145.403 162.783 1.00 68.31  ? 31  HIS G CD2   1 
ATOM   4713  C  CE1   . HIS G 3  31  ? 186.237 147.505 162.566 1.00 68.31  ? 31  HIS G CE1   1 
ATOM   4714  N  NE2   . HIS G 3  31  ? 186.473 146.287 162.117 1.00 68.31  ? 31  HIS G NE2   1 
ATOM   4715  N  N     . ARG G 3  32  ? 181.988 143.975 162.927 1.00 74.54  ? 32  ARG G N     1 
ATOM   4716  C  CA    . ARG G 3  32  ? 181.593 143.203 161.757 1.00 74.54  ? 32  ARG G CA    1 
ATOM   4717  C  C     . ARG G 3  32  ? 180.262 143.696 161.219 1.00 74.54  ? 32  ARG G C     1 
ATOM   4718  O  O     . ARG G 3  32  ? 180.075 143.802 160.000 1.00 74.54  ? 32  ARG G O     1 
ATOM   4719  C  CB    . ARG G 3  32  ? 181.527 141.724 162.138 1.00 74.54  ? 32  ARG G CB    1 
ATOM   4720  C  CG    . ARG G 3  32  ? 181.384 140.725 161.003 1.00 74.54  ? 32  ARG G CG    1 
ATOM   4721  C  CD    . ARG G 3  32  ? 179.939 140.291 160.774 1.00 74.54  ? 32  ARG G CD    1 
ATOM   4722  N  NE    . ARG G 3  32  ? 179.325 139.735 161.975 1.00 74.54  ? 32  ARG G NE    1 
ATOM   4723  C  CZ    . ARG G 3  32  ? 178.026 139.495 162.107 1.00 74.54  ? 32  ARG G CZ    1 
ATOM   4724  N  NH1   . ARG G 3  32  ? 177.197 139.742 161.105 1.00 74.54  ? 32  ARG G NH1   1 
ATOM   4725  N  NH2   . ARG G 3  32  ? 177.555 138.993 163.239 1.00 74.54  ? 32  ARG G NH2   1 
ATOM   4726  N  N     . LEU G 3  33  ? 179.339 144.045 162.114 1.00 73.90  ? 33  LEU G N     1 
ATOM   4727  C  CA    . LEU G 3  33  ? 178.060 144.567 161.661 1.00 73.90  ? 33  LEU G CA    1 
ATOM   4728  C  C     . LEU G 3  33  ? 178.166 145.963 161.070 1.00 73.90  ? 33  LEU G C     1 
ATOM   4729  O  O     . LEU G 3  33  ? 177.295 146.350 160.290 1.00 73.90  ? 33  LEU G O     1 
ATOM   4730  C  CB    . LEU G 3  33  ? 177.064 144.547 162.806 1.00 73.90  ? 33  LEU G CB    1 
ATOM   4731  C  CG    . LEU G 3  33  ? 176.562 143.144 163.108 1.00 73.90  ? 33  LEU G CG    1 
ATOM   4732  C  CD1   . LEU G 3  33  ? 175.770 143.129 164.398 1.00 73.90  ? 33  LEU G CD1   1 
ATOM   4733  C  CD2   . LEU G 3  33  ? 175.699 142.700 161.942 1.00 73.90  ? 33  LEU G CD2   1 
ATOM   4734  N  N     . LEU G 3  34  ? 179.200 146.733 161.414 1.00 68.62  ? 34  LEU G N     1 
ATOM   4735  C  CA    . LEU G 3  34  ? 179.402 147.984 160.700 1.00 68.62  ? 34  LEU G CA    1 
ATOM   4736  C  C     . LEU G 3  34  ? 180.038 147.754 159.348 1.00 68.62  ? 34  LEU G C     1 
ATOM   4737  O  O     . LEU G 3  34  ? 179.797 148.531 158.422 1.00 68.62  ? 34  LEU G O     1 
ATOM   4738  C  CB    . LEU G 3  34  ? 180.269 148.970 161.479 1.00 68.62  ? 34  LEU G CB    1 
ATOM   4739  C  CG    . LEU G 3  34  ? 179.632 150.018 162.395 1.00 68.62  ? 34  LEU G CG    1 
ATOM   4740  C  CD1   . LEU G 3  34  ? 178.492 150.731 161.684 1.00 68.62  ? 34  LEU G CD1   1 
ATOM   4741  C  CD2   . LEU G 3  34  ? 179.225 149.507 163.734 1.00 68.62  ? 34  LEU G CD2   1 
ATOM   4742  N  N     . ARG G 3  35  ? 180.876 146.727 159.209 1.00 71.07  ? 35  ARG G N     1 
ATOM   4743  C  CA    . ARG G 3  35  ? 181.476 146.531 157.902 1.00 71.07  ? 35  ARG G CA    1 
ATOM   4744  C  C     . ARG G 3  35  ? 180.554 145.824 156.935 1.00 71.07  ? 35  ARG G C     1 
ATOM   4745  O  O     . ARG G 3  35  ? 180.774 145.903 155.724 1.00 71.07  ? 35  ARG G O     1 
ATOM   4746  C  CB    . ARG G 3  35  ? 182.764 145.728 157.979 1.00 71.07  ? 35  ARG G CB    1 
ATOM   4747  C  CG    . ARG G 3  35  ? 183.927 146.393 158.653 1.00 71.07  ? 35  ARG G CG    1 
ATOM   4748  C  CD    . ARG G 3  35  ? 185.090 145.457 158.507 1.00 71.07  ? 35  ARG G CD    1 
ATOM   4749  N  NE    . ARG G 3  35  ? 184.804 144.187 159.163 1.00 71.07  ? 35  ARG G NE    1 
ATOM   4750  C  CZ    . ARG G 3  35  ? 185.482 143.067 158.947 1.00 71.07  ? 35  ARG G CZ    1 
ATOM   4751  N  NH1   . ARG G 3  35  ? 186.478 143.058 158.074 1.00 71.07  ? 35  ARG G NH1   1 
ATOM   4752  N  NH2   . ARG G 3  35  ? 185.154 141.955 159.588 1.00 71.07  ? 35  ARG G NH2   1 
ATOM   4753  N  N     . LYS G 3  36  ? 179.540 145.128 157.418 1.00 71.35  ? 36  LYS G N     1 
ATOM   4754  C  CA    . LYS G 3  36  ? 178.756 144.259 156.556 1.00 71.35  ? 36  LYS G CA    1 
ATOM   4755  C  C     . LYS G 3  36  ? 177.318 144.729 156.419 1.00 71.35  ? 36  LYS G C     1 
ATOM   4756  O  O     . LYS G 3  36  ? 176.379 143.939 156.477 1.00 71.35  ? 36  LYS G O     1 
ATOM   4757  C  CB    . LYS G 3  36  ? 178.812 142.822 157.044 1.00 71.35  ? 36  LYS G CB    1 
ATOM   4758  C  CG    . LYS G 3  36  ? 180.171 142.230 156.810 1.00 71.35  ? 36  LYS G CG    1 
ATOM   4759  C  CD    . LYS G 3  36  ? 180.215 140.771 157.128 1.00 71.35  ? 36  LYS G CD    1 
ATOM   4760  C  CE    . LYS G 3  36  ? 181.597 140.272 156.855 1.00 71.35  ? 36  LYS G CE    1 
ATOM   4761  N  NZ    . LYS G 3  36  ? 181.828 140.429 155.400 1.00 71.35  ? 36  LYS G NZ    1 
ATOM   4762  N  N     . GLY G 3  37  ? 177.142 146.021 156.223 1.00 73.92  ? 37  GLY G N     1 
ATOM   4763  C  CA    . GLY G 3  37  ? 175.838 146.528 155.889 1.00 73.92  ? 37  GLY G CA    1 
ATOM   4764  C  C     . GLY G 3  37  ? 175.953 147.594 154.832 1.00 73.92  ? 37  GLY G C     1 
ATOM   4765  O  O     . GLY G 3  37  ? 174.976 148.293 154.553 1.00 73.92  ? 37  GLY G O     1 
ATOM   4766  N  N     . ASN G 3  38  ? 177.146 147.701 154.243 1.00 76.68  ? 38  ASN G N     1 
ATOM   4767  C  CA    . ASN G 3  38  ? 177.495 148.683 153.216 1.00 76.68  ? 38  ASN G CA    1 
ATOM   4768  C  C     . ASN G 3  38  ? 177.173 150.107 153.683 1.00 76.68  ? 38  ASN G C     1 
ATOM   4769  O  O     . ASN G 3  38  ? 176.278 150.772 153.181 1.00 76.68  ? 38  ASN G O     1 
ATOM   4770  C  CB    . ASN G 3  38  ? 176.791 148.374 151.889 1.00 76.68  ? 38  ASN G CB    1 
ATOM   4771  C  CG    . ASN G 3  38  ? 177.157 147.016 151.332 1.00 76.68  ? 38  ASN G CG    1 
ATOM   4772  O  OD1   . ASN G 3  38  ? 176.299 146.158 151.145 1.00 76.68  ? 38  ASN G OD1   1 
ATOM   4773  N  ND2   . ASN G 3  38  ? 178.435 146.811 151.074 1.00 76.68  ? 38  ASN G ND2   1 
ATOM   4774  N  N     . TYR G 3  39  ? 177.889 150.545 154.705 1.00 72.63  ? 39  TYR G N     1 
ATOM   4775  C  CA    . TYR G 3  39  ? 177.708 151.907 155.178 1.00 72.63  ? 39  TYR G CA    1 
ATOM   4776  C  C     . TYR G 3  39  ? 178.822 152.837 154.741 1.00 72.63  ? 39  TYR G C     1 
ATOM   4777  O  O     . TYR G 3  39  ? 178.586 154.038 154.587 1.00 72.63  ? 39  TYR G O     1 
ATOM   4778  C  CB    . TYR G 3  39  ? 177.605 151.916 156.696 1.00 72.63  ? 39  TYR G CB    1 
ATOM   4779  C  CG    . TYR G 3  39  ? 176.351 151.265 157.183 1.00 72.63  ? 39  TYR G CG    1 
ATOM   4780  C  CD1   . TYR G 3  39  ? 175.175 151.981 157.266 1.00 72.63  ? 39  TYR G CD1   1 
ATOM   4781  C  CD2   . TYR G 3  39  ? 176.335 149.926 157.534 1.00 72.63  ? 39  TYR G CD2   1 
ATOM   4782  C  CE1   . TYR G 3  39  ? 174.025 151.398 157.715 1.00 72.63  ? 39  TYR G CE1   1 
ATOM   4783  C  CE2   . TYR G 3  39  ? 175.188 149.334 157.980 1.00 72.63  ? 39  TYR G CE2   1 
ATOM   4784  C  CZ    . TYR G 3  39  ? 174.038 150.073 158.068 1.00 72.63  ? 39  TYR G CZ    1 
ATOM   4785  O  OH    . TYR G 3  39  ? 172.881 149.486 158.508 1.00 72.63  ? 39  TYR G OH    1 
ATOM   4786  N  N     . ALA G 3  40  ? 180.020 152.298 154.546 1.00 80.88  ? 40  ALA G N     1 
ATOM   4787  C  CA    . ALA G 3  40  ? 181.171 153.005 154.010 1.00 80.88  ? 40  ALA G CA    1 
ATOM   4788  C  C     . ALA G 3  40  ? 182.171 151.959 153.567 1.00 80.88  ? 40  ALA G C     1 
ATOM   4789  O  O     . ALA G 3  40  ? 182.285 150.907 154.194 1.00 80.88  ? 40  ALA G O     1 
ATOM   4790  C  CB    . ALA G 3  40  ? 181.807 153.946 155.033 1.00 80.88  ? 40  ALA G CB    1 
ATOM   4791  N  N     . GLU G 3  41  ? 182.884 152.261 152.479 1.00 84.09  ? 41  GLU G N     1 
ATOM   4792  C  CA    . GLU G 3  41  ? 183.852 151.304 151.949 1.00 84.09  ? 41  GLU G CA    1 
ATOM   4793  C  C     . GLU G 3  41  ? 185.004 151.073 152.918 1.00 84.09  ? 41  GLU G C     1 
ATOM   4794  O  O     . GLU G 3  41  ? 185.559 149.970 152.976 1.00 84.09  ? 41  GLU G O     1 
ATOM   4795  C  CB    . GLU G 3  41  ? 184.381 151.786 150.599 1.00 84.09  ? 41  GLU G CB    1 
ATOM   4796  C  CG    . GLU G 3  41  ? 185.238 150.758 149.864 1.00 84.09  ? 41  GLU G CG    1 
ATOM   4797  C  CD    . GLU G 3  41  ? 185.772 151.282 148.560 1.00 84.09  ? 41  GLU G CD    1 
ATOM   4798  O  OE1   . GLU G 3  41  ? 185.489 152.450 148.231 1.00 84.09  ? 41  GLU G OE1   1 
ATOM   4799  O  OE2   . GLU G 3  41  ? 186.485 150.528 147.870 1.00 84.09  ? 41  GLU G OE2   1 
ATOM   4800  N  N     . ARG G 3  42  ? 185.356 152.080 153.701 1.00 81.56  ? 42  ARG G N     1 
ATOM   4801  C  CA    . ARG G 3  42  ? 186.342 151.935 154.753 1.00 81.56  ? 42  ARG G CA    1 
ATOM   4802  C  C     . ARG G 3  42  ? 185.673 152.224 156.088 1.00 81.56  ? 42  ARG G C     1 
ATOM   4803  O  O     . ARG G 3  42  ? 184.778 153.063 156.167 1.00 81.56  ? 42  ARG G O     1 
ATOM   4804  C  CB    . ARG G 3  42  ? 187.516 152.861 154.496 1.00 81.56  ? 42  ARG G CB    1 
ATOM   4805  C  CG    . ARG G 3  42  ? 188.242 152.480 153.213 1.00 81.56  ? 42  ARG G CG    1 
ATOM   4806  C  CD    . ARG G 3  42  ? 189.371 153.414 152.846 1.00 81.56  ? 42  ARG G CD    1 
ATOM   4807  N  NE    . ARG G 3  42  ? 190.458 153.349 153.812 1.00 81.56  ? 42  ARG G NE    1 
ATOM   4808  C  CZ    . ARG G 3  42  ? 191.458 152.482 153.740 1.00 81.56  ? 42  ARG G CZ    1 
ATOM   4809  N  NH1   . ARG G 3  42  ? 191.509 151.609 152.745 1.00 81.56  ? 42  ARG G NH1   1 
ATOM   4810  N  NH2   . ARG G 3  42  ? 192.409 152.491 154.659 1.00 81.56  ? 42  ARG G NH2   1 
ATOM   4811  N  N     . VAL G 3  43  ? 186.055 151.485 157.126 1.00 76.98  ? 43  VAL G N     1 
ATOM   4812  C  CA    . VAL G 3  43  ? 185.536 151.689 158.472 1.00 76.98  ? 43  VAL G CA    1 
ATOM   4813  C  C     . VAL G 3  43  ? 186.721 151.854 159.404 1.00 76.98  ? 43  VAL G C     1 
ATOM   4814  O  O     . VAL G 3  43  ? 187.600 150.988 159.446 1.00 76.98  ? 43  VAL G O     1 
ATOM   4815  C  CB    . VAL G 3  43  ? 184.651 150.521 158.936 1.00 76.98  ? 43  VAL G CB    1 
ATOM   4816  C  CG1   . VAL G 3  43  ? 184.173 150.743 160.355 1.00 76.98  ? 43  VAL G CG1   1 
ATOM   4817  C  CG2   . VAL G 3  43  ? 183.479 150.344 158.009 1.00 76.98  ? 43  VAL G CG2   1 
ATOM   4818  N  N     . GLY G 3  44  ? 186.725 152.935 160.174 1.00 83.54  ? 44  GLY G N     1 
ATOM   4819  C  CA    . GLY G 3  44  ? 187.895 153.396 160.888 1.00 83.54  ? 44  GLY G CA    1 
ATOM   4820  C  C     . GLY G 3  44  ? 188.339 152.500 162.036 1.00 83.54  ? 44  GLY G C     1 
ATOM   4821  O  O     . GLY G 3  44  ? 187.859 151.385 162.245 1.00 83.54  ? 44  GLY G O     1 
ATOM   4822  N  N     . ALA G 3  45  ? 189.291 153.029 162.800 1.00 80.38  ? 45  ALA G N     1 
ATOM   4823  C  CA    . ALA G 3  45  ? 189.955 152.235 163.824 1.00 80.38  ? 45  ALA G CA    1 
ATOM   4824  C  C     . ALA G 3  45  ? 189.066 152.019 165.042 1.00 80.38  ? 45  ALA G C     1 
ATOM   4825  O  O     . ALA G 3  45  ? 188.767 150.879 165.407 1.00 80.38  ? 45  ALA G O     1 
ATOM   4826  C  CB    . ALA G 3  45  ? 191.261 152.910 164.240 1.00 80.38  ? 45  ALA G CB    1 
ATOM   4827  N  N     . GLY G 3  46  ? 188.644 153.103 165.683 1.00 71.50  ? 46  GLY G N     1 
ATOM   4828  C  CA    . GLY G 3  46  ? 187.994 153.006 166.973 1.00 71.50  ? 46  GLY G CA    1 
ATOM   4829  C  C     . GLY G 3  46  ? 186.527 153.363 166.971 1.00 71.50  ? 46  GLY G C     1 
ATOM   4830  O  O     . GLY G 3  46  ? 185.993 153.792 167.994 1.00 71.50  ? 46  GLY G O     1 
ATOM   4831  N  N     . ALA G 3  47  ? 185.866 153.174 165.830 1.00 69.99  ? 47  ALA G N     1 
ATOM   4832  C  CA    . ALA G 3  47  ? 184.457 153.557 165.732 1.00 69.99  ? 47  ALA G CA    1 
ATOM   4833  C  C     . ALA G 3  47  ? 183.518 152.661 166.541 1.00 69.99  ? 47  ALA G C     1 
ATOM   4834  O  O     . ALA G 3  47  ? 182.700 153.211 167.307 1.00 69.99  ? 47  ALA G O     1 
ATOM   4835  C  CB    . ALA G 3  47  ? 184.056 153.662 164.256 1.00 69.99  ? 47  ALA G CB    1 
ATOM   4836  N  N     . PRO G 3  48  ? 183.553 151.319 166.460 1.00 69.33  ? 48  PRO G N     1 
ATOM   4837  C  CA    . PRO G 3  48  ? 182.620 150.549 167.293 1.00 69.33  ? 48  PRO G CA    1 
ATOM   4838  C  C     . PRO G 3  48  ? 182.973 150.538 168.767 1.00 69.33  ? 48  PRO G C     1 
ATOM   4839  O  O     . PRO G 3  48  ? 182.145 150.088 169.571 1.00 69.33  ? 48  PRO G O     1 
ATOM   4840  C  CB    . PRO G 3  48  ? 182.689 149.142 166.702 1.00 69.33  ? 48  PRO G CB    1 
ATOM   4841  C  CG    . PRO G 3  48  ? 184.000 149.055 166.154 1.00 69.33  ? 48  PRO G CG    1 
ATOM   4842  C  CD    . PRO G 3  48  ? 184.315 150.386 165.596 1.00 69.33  ? 48  PRO G CD    1 
ATOM   4843  N  N     . VAL G 3  49  ? 184.165 150.996 169.149 1.00 68.75  ? 49  VAL G N     1 
ATOM   4844  C  CA    . VAL G 3  49  ? 184.429 151.296 170.551 1.00 68.75  ? 49  VAL G CA    1 
ATOM   4845  C  C     . VAL G 3  49  ? 183.502 152.407 171.023 1.00 68.75  ? 49  VAL G C     1 
ATOM   4846  O  O     . VAL G 3  49  ? 182.813 152.280 172.048 1.00 68.75  ? 49  VAL G O     1 
ATOM   4847  C  CB    . VAL G 3  49  ? 185.905 151.686 170.739 1.00 68.75  ? 49  VAL G CB    1 
ATOM   4848  C  CG1   . VAL G 3  49  ? 186.176 152.066 172.186 1.00 68.75  ? 49  VAL G CG1   1 
ATOM   4849  C  CG2   . VAL G 3  49  ? 186.802 150.558 170.303 1.00 68.75  ? 49  VAL G CG2   1 
ATOM   4850  N  N     . TYR G 3  50  ? 183.461 153.499 170.256 1.00 66.54  ? 50  TYR G N     1 
ATOM   4851  C  CA    . TYR G 3  50  ? 182.609 154.637 170.574 1.00 66.54  ? 50  TYR G CA    1 
ATOM   4852  C  C     . TYR G 3  50  ? 181.145 154.233 170.550 1.00 66.54  ? 50  TYR G C     1 
ATOM   4853  O  O     . TYR G 3  50  ? 180.374 154.566 171.465 1.00 66.54  ? 50  TYR G O     1 
ATOM   4854  C  CB    . TYR G 3  50  ? 182.862 155.750 169.562 1.00 66.54  ? 50  TYR G CB    1 
ATOM   4855  C  CG    . TYR G 3  50  ? 182.249 157.080 169.921 1.00 66.54  ? 50  TYR G CG    1 
ATOM   4856  C  CD1   . TYR G 3  50  ? 182.901 157.955 170.771 1.00 66.54  ? 50  TYR G CD1   1 
ATOM   4857  C  CD2   . TYR G 3  50  ? 181.015 157.458 169.428 1.00 66.54  ? 50  TYR G CD2   1 
ATOM   4858  C  CE1   . TYR G 3  50  ? 182.351 159.175 171.100 1.00 66.54  ? 50  TYR G CE1   1 
ATOM   4859  C  CE2   . TYR G 3  50  ? 180.451 158.671 169.760 1.00 66.54  ? 50  TYR G CE2   1 
ATOM   4860  C  CZ    . TYR G 3  50  ? 181.127 159.523 170.595 1.00 66.54  ? 50  TYR G CZ    1 
ATOM   4861  O  OH    . TYR G 3  50  ? 180.586 160.734 170.940 1.00 66.54  ? 50  TYR G OH    1 
ATOM   4862  N  N     . LEU G 3  51  ? 180.763 153.456 169.543 1.00 62.46  ? 51  LEU G N     1 
ATOM   4863  C  CA    . LEU G 3  51  ? 179.355 153.140 169.384 1.00 62.46  ? 51  LEU G CA    1 
ATOM   4864  C  C     . LEU G 3  51  ? 178.891 152.127 170.422 1.00 62.46  ? 51  LEU G C     1 
ATOM   4865  O  O     . LEU G 3  51  ? 177.766 152.232 170.931 1.00 62.46  ? 51  LEU G O     1 
ATOM   4866  C  CB    . LEU G 3  51  ? 179.112 152.661 167.953 1.00 62.46  ? 51  LEU G CB    1 
ATOM   4867  C  CG    . LEU G 3  51  ? 177.694 152.672 167.392 1.00 62.46  ? 51  LEU G CG    1 
ATOM   4868  C  CD1   . LEU G 3  51  ? 176.974 151.383 167.626 1.00 62.46  ? 51  LEU G CD1   1 
ATOM   4869  C  CD2   . LEU G 3  51  ? 176.952 153.822 168.056 1.00 62.46  ? 51  LEU G CD2   1 
ATOM   4870  N  N     . ALA G 3  52  ? 179.754 151.178 170.777 1.00 65.31  ? 52  ALA G N     1 
ATOM   4871  C  CA    . ALA G 3  52  ? 179.438 150.261 171.859 1.00 65.31  ? 52  ALA G CA    1 
ATOM   4872  C  C     . ALA G 3  52  ? 179.337 150.984 173.193 1.00 65.31  ? 52  ALA G C     1 
ATOM   4873  O  O     . ALA G 3  52  ? 178.555 150.571 174.060 1.00 65.31  ? 52  ALA G O     1 
ATOM   4874  C  CB    . ALA G 3  52  ? 180.488 149.164 171.931 1.00 65.31  ? 52  ALA G CB    1 
ATOM   4875  N  N     . ALA G 3  53  ? 180.107 152.062 173.373 1.00 68.38  ? 53  ALA G N     1 
ATOM   4876  C  CA    . ALA G 3  53  ? 179.942 152.875 174.574 1.00 68.38  ? 53  ALA G CA    1 
ATOM   4877  C  C     . ALA G 3  53  ? 178.565 153.523 174.621 1.00 68.38  ? 53  ALA G C     1 
ATOM   4878  O  O     . ALA G 3  53  ? 177.906 153.519 175.676 1.00 68.38  ? 53  ALA G O     1 
ATOM   4879  C  CB    . ALA G 3  53  ? 181.034 153.936 174.646 1.00 68.38  ? 53  ALA G CB    1 
ATOM   4880  N  N     . VAL G 3  54  ? 178.107 154.057 173.482 1.00 66.65  ? 54  VAL G N     1 
ATOM   4881  C  CA    . VAL G 3  54  ? 176.806 154.723 173.446 1.00 66.65  ? 54  VAL G CA    1 
ATOM   4882  C  C     . VAL G 3  54  ? 175.682 153.732 173.721 1.00 66.65  ? 54  VAL G C     1 
ATOM   4883  O  O     . VAL G 3  54  ? 174.782 153.995 174.538 1.00 66.65  ? 54  VAL G O     1 
ATOM   4884  C  CB    . VAL G 3  54  ? 176.621 155.434 172.098 1.00 66.65  ? 54  VAL G CB    1 
ATOM   4885  C  CG1   . VAL G 3  54  ? 175.250 156.031 172.002 1.00 66.65  ? 54  VAL G CG1   1 
ATOM   4886  C  CG2   . VAL G 3  54  ? 177.665 156.506 171.947 1.00 66.65  ? 54  VAL G CG2   1 
ATOM   4887  N  N     . LEU G 3  55  ? 175.754 152.555 173.111 1.00 69.87  ? 55  LEU G N     1 
ATOM   4888  C  CA    . LEU G 3  55  ? 174.705 151.568 173.336 1.00 69.87  ? 55  LEU G CA    1 
ATOM   4889  C  C     . LEU G 3  55  ? 174.756 150.984 174.744 1.00 69.87  ? 55  LEU G C     1 
ATOM   4890  O  O     . LEU G 3  55  ? 173.710 150.595 175.283 1.00 69.87  ? 55  LEU G O     1 
ATOM   4891  C  CB    . LEU G 3  55  ? 174.782 150.468 172.285 1.00 69.87  ? 55  LEU G CB    1 
ATOM   4892  C  CG    . LEU G 3  55  ? 173.928 150.662 171.028 1.00 69.87  ? 55  LEU G CG    1 
ATOM   4893  C  CD1   . LEU G 3  55  ? 174.349 151.832 170.190 1.00 69.87  ? 55  LEU G CD1   1 
ATOM   4894  C  CD2   . LEU G 3  55  ? 174.021 149.409 170.216 1.00 69.87  ? 55  LEU G CD2   1 
ATOM   4895  N  N     . GLU G 3  56  ? 175.938 150.943 175.369 1.00 75.66  ? 56  GLU G N     1 
ATOM   4896  C  CA    . GLU G 3  56  ? 175.992 150.487 176.756 1.00 75.66  ? 56  GLU G CA    1 
ATOM   4897  C  C     . GLU G 3  56  ? 175.329 151.493 177.677 1.00 75.66  ? 56  GLU G C     1 
ATOM   4898  O  O     . GLU G 3  56  ? 174.629 151.105 178.624 1.00 75.66  ? 56  GLU G O     1 
ATOM   4899  C  CB    . GLU G 3  56  ? 177.430 150.230 177.206 1.00 75.66  ? 56  GLU G CB    1 
ATOM   4900  C  CG    . GLU G 3  56  ? 177.482 149.569 178.587 1.00 75.66  ? 56  GLU G CG    1 
ATOM   4901  C  CD    . GLU G 3  56  ? 178.880 149.312 179.097 1.00 75.66  ? 56  GLU G CD    1 
ATOM   4902  O  OE1   . GLU G 3  56  ? 179.841 149.710 178.416 1.00 75.66  ? 56  GLU G OE1   1 
ATOM   4903  O  OE2   . GLU G 3  56  ? 179.014 148.698 180.177 1.00 75.66  ? 56  GLU G OE2   1 
ATOM   4904  N  N     . TYR G 3  57  ? 175.523 152.786 177.401 1.00 75.40  ? 57  TYR G N     1 
ATOM   4905  C  CA    . TYR G 3  57  ? 174.839 153.805 178.189 1.00 75.40  ? 57  TYR G CA    1 
ATOM   4906  C  C     . TYR G 3  57  ? 173.330 153.703 178.041 1.00 75.40  ? 57  TYR G C     1 
ATOM   4907  O  O     . TYR G 3  57  ? 172.600 153.786 179.036 1.00 75.40  ? 57  TYR G O     1 
ATOM   4908  C  CB    . TYR G 3  57  ? 175.297 155.195 177.785 1.00 75.40  ? 57  TYR G CB    1 
ATOM   4909  C  CG    . TYR G 3  57  ? 174.581 156.252 178.574 1.00 75.40  ? 57  TYR G CG    1 
ATOM   4910  C  CD1   . TYR G 3  57  ? 174.873 156.444 179.913 1.00 75.40  ? 57  TYR G CD1   1 
ATOM   4911  C  CD2   . TYR G 3  57  ? 173.603 157.045 177.996 1.00 75.40  ? 57  TYR G CD2   1 
ATOM   4912  C  CE1   . TYR G 3  57  ? 174.219 157.401 180.652 1.00 75.40  ? 57  TYR G CE1   1 
ATOM   4913  C  CE2   . TYR G 3  57  ? 172.944 158.003 178.731 1.00 75.40  ? 57  TYR G CE2   1 
ATOM   4914  C  CZ    . TYR G 3  57  ? 173.255 158.174 180.057 1.00 75.40  ? 57  TYR G CZ    1 
ATOM   4915  O  OH    . TYR G 3  57  ? 172.602 159.134 180.793 1.00 75.40  ? 57  TYR G OH    1 
ATOM   4916  N  N     . LEU G 3  58  ? 172.846 153.501 176.813 1.00 74.78  ? 58  LEU G N     1 
ATOM   4917  C  CA    . LEU G 3  58  ? 171.402 153.470 176.588 1.00 74.78  ? 58  LEU G CA    1 
ATOM   4918  C  C     . LEU G 3  58  ? 170.760 152.242 177.222 1.00 74.78  ? 58  LEU G C     1 
ATOM   4919  O  O     . LEU G 3  58  ? 169.711 152.350 177.880 1.00 74.78  ? 58  LEU G O     1 
ATOM   4920  C  CB    . LEU G 3  58  ? 171.125 153.518 175.091 1.00 74.78  ? 58  LEU G CB    1 
ATOM   4921  C  CG    . LEU G 3  58  ? 171.549 154.868 174.529 1.00 74.78  ? 58  LEU G CG    1 
ATOM   4922  C  CD1   . LEU G 3  58  ? 171.525 154.894 173.025 1.00 74.78  ? 58  LEU G CD1   1 
ATOM   4923  C  CD2   . LEU G 3  58  ? 170.605 155.882 175.072 1.00 74.78  ? 58  LEU G CD2   1 
ATOM   4924  N  N     . THR G 3  59  ? 171.393 151.078 177.038 1.00 77.45  ? 59  THR G N     1 
ATOM   4925  C  CA    . THR G 3  59  ? 170.952 149.845 177.681 1.00 77.45  ? 59  THR G CA    1 
ATOM   4926  C  C     . THR G 3  59  ? 170.910 149.994 179.195 1.00 77.45  ? 59  THR G C     1 
ATOM   4927  O  O     . THR G 3  59  ? 169.926 149.603 179.840 1.00 77.45  ? 59  THR G O     1 
ATOM   4928  C  CB    . THR G 3  59  ? 171.892 148.710 177.291 1.00 77.45  ? 59  THR G CB    1 
ATOM   4929  O  OG1   . THR G 3  59  ? 171.931 148.588 175.865 1.00 77.45  ? 59  THR G OG1   1 
ATOM   4930  C  CG2   . THR G 3  59  ? 171.428 147.403 177.891 1.00 77.45  ? 59  THR G CG2   1 
ATOM   4931  N  N     . ALA G 3  60  ? 171.948 150.608 179.768 1.00 79.64  ? 60  ALA G N     1 
ATOM   4932  C  CA    . ALA G 3  60  ? 171.996 150.819 181.211 1.00 79.64  ? 60  ALA G CA    1 
ATOM   4933  C  C     . ALA G 3  60  ? 170.901 151.762 181.688 1.00 79.64  ? 60  ALA G C     1 
ATOM   4934  O  O     . ALA G 3  60  ? 170.378 151.590 182.797 1.00 79.64  ? 60  ALA G O     1 
ATOM   4935  C  CB    . ALA G 3  60  ? 173.366 151.359 181.614 1.00 79.64  ? 60  ALA G CB    1 
ATOM   4936  N  N     . GLU G 3  61  ? 170.525 152.742 180.865 1.00 81.21  ? 61  GLU G N     1 
ATOM   4937  C  CA    . GLU G 3  61  ? 169.465 153.663 181.264 1.00 81.21  ? 61  GLU G CA    1 
ATOM   4938  C  C     . GLU G 3  61  ? 168.110 152.973 181.298 1.00 81.21  ? 61  GLU G C     1 
ATOM   4939  O  O     . GLU G 3  61  ? 167.381 153.074 182.299 1.00 81.21  ? 61  GLU G O     1 
ATOM   4940  C  CB    . GLU G 3  61  ? 169.420 154.864 180.328 1.00 81.21  ? 61  GLU G CB    1 
ATOM   4941  C  CG    . GLU G 3  61  ? 170.555 155.833 180.524 1.00 81.21  ? 61  GLU G CG    1 
ATOM   4942  C  CD    . GLU G 3  61  ? 170.502 156.524 181.867 1.00 81.21  ? 61  GLU G CD    1 
ATOM   4943  O  OE1   . GLU G 3  61  ? 169.386 156.767 182.373 1.00 81.21  ? 61  GLU G OE1   1 
ATOM   4944  O  OE2   . GLU G 3  61  ? 171.577 156.827 182.420 1.00 81.21  ? 61  GLU G OE2   1 
ATOM   4945  N  N     . ILE G 3  62  ? 167.753 152.273 180.217 1.00 79.72  ? 62  ILE G N     1 
ATOM   4946  C  CA    . ILE G 3  62  ? 166.436 151.644 180.165 1.00 79.72  ? 62  ILE G CA    1 
ATOM   4947  C  C     . ILE G 3  62  ? 166.322 150.525 181.188 1.00 79.72  ? 62  ILE G C     1 
ATOM   4948  O  O     . ILE G 3  62  ? 165.331 150.450 181.926 1.00 79.72  ? 62  ILE G O     1 
ATOM   4949  C  CB    . ILE G 3  62  ? 166.122 151.158 178.743 1.00 79.72  ? 62  ILE G CB    1 
ATOM   4950  C  CG1   . ILE G 3  62  ? 165.827 152.348 177.851 1.00 79.72  ? 62  ILE G CG1   1 
ATOM   4951  C  CG2   . ILE G 3  62  ? 164.949 150.225 178.719 1.00 79.72  ? 62  ILE G CG2   1 
ATOM   4952  C  CD1   . ILE G 3  62  ? 165.603 151.968 176.434 1.00 79.72  ? 62  ILE G CD1   1 
ATOM   4953  N  N     . LEU G 3  63  ? 167.346 149.670 181.290 1.00 82.51  ? 63  LEU G N     1 
ATOM   4954  C  CA    . LEU G 3  63  ? 167.285 148.611 182.291 1.00 82.51  ? 63  LEU G CA    1 
ATOM   4955  C  C     . LEU G 3  63  ? 167.349 149.167 183.709 1.00 82.51  ? 63  LEU G C     1 
ATOM   4956  O  O     . LEU G 3  63  ? 166.809 148.551 184.635 1.00 82.51  ? 63  LEU G O     1 
ATOM   4957  C  CB    . LEU G 3  63  ? 168.399 147.590 182.084 1.00 82.51  ? 63  LEU G CB    1 
ATOM   4958  C  CG    . LEU G 3  63  ? 168.105 146.421 181.149 1.00 82.51  ? 63  LEU G CG    1 
ATOM   4959  C  CD1   . LEU G 3  63  ? 168.203 146.821 179.724 1.00 82.51  ? 63  LEU G CD1   1 
ATOM   4960  C  CD2   . LEU G 3  63  ? 169.039 145.281 181.423 1.00 82.51  ? 63  LEU G CD2   1 
ATOM   4961  N  N     . GLU G 3  64  ? 167.968 150.331 183.887 1.00 87.05  ? 64  GLU G N     1 
ATOM   4962  C  CA    . GLU G 3  64  ? 167.969 150.971 185.196 1.00 87.05  ? 64  GLU G CA    1 
ATOM   4963  C  C     . GLU G 3  64  ? 166.568 151.414 185.593 1.00 87.05  ? 64  GLU G C     1 
ATOM   4964  O  O     . GLU G 3  64  ? 166.110 151.131 186.707 1.00 87.05  ? 64  GLU G O     1 
ATOM   4965  C  CB    . GLU G 3  64  ? 168.921 152.161 185.197 1.00 87.05  ? 64  GLU G CB    1 
ATOM   4966  C  CG    . GLU G 3  64  ? 169.038 152.833 186.547 1.00 87.05  ? 64  GLU G CG    1 
ATOM   4967  C  CD    . GLU G 3  64  ? 170.020 153.979 186.531 1.00 87.05  ? 64  GLU G CD    1 
ATOM   4968  O  OE1   . GLU G 3  64  ? 170.585 154.260 185.453 1.00 87.05  ? 64  GLU G OE1   1 
ATOM   4969  O  OE2   . GLU G 3  64  ? 170.228 154.600 187.597 1.00 87.05  ? 64  GLU G OE2   1 
ATOM   4970  N  N     . LEU G 3  65  ? 165.868 152.100 184.685 1.00 81.58  ? 65  LEU G N     1 
ATOM   4971  C  CA    . LEU G 3  65  ? 164.530 152.579 185.019 1.00 81.58  ? 65  LEU G CA    1 
ATOM   4972  C  C     . LEU G 3  65  ? 163.526 151.442 185.122 1.00 81.58  ? 65  LEU G C     1 
ATOM   4973  O  O     . LEU G 3  65  ? 162.579 151.524 185.911 1.00 81.58  ? 65  LEU G O     1 
ATOM   4974  C  CB    . LEU G 3  65  ? 164.066 153.606 183.995 1.00 81.58  ? 65  LEU G CB    1 
ATOM   4975  C  CG    . LEU G 3  65  ? 164.846 154.912 184.085 1.00 81.58  ? 65  LEU G CG    1 
ATOM   4976  C  CD1   . LEU G 3  65  ? 164.412 155.860 182.990 1.00 81.58  ? 65  LEU G CD1   1 
ATOM   4977  C  CD2   . LEU G 3  65  ? 164.658 155.540 185.454 1.00 81.58  ? 65  LEU G CD2   1 
ATOM   4978  N  N     . ALA G 3  66  ? 163.720 150.370 184.358 1.00 85.16  ? 66  ALA G N     1 
ATOM   4979  C  CA    . ALA G 3  66  ? 162.893 149.192 184.563 1.00 85.16  ? 66  ALA G CA    1 
ATOM   4980  C  C     . ALA G 3  66  ? 163.249 148.472 185.849 1.00 85.16  ? 66  ALA G C     1 
ATOM   4981  O  O     . ALA G 3  66  ? 162.427 147.711 186.362 1.00 85.16  ? 66  ALA G O     1 
ATOM   4982  C  CB    . ALA G 3  66  ? 163.022 148.234 183.382 1.00 85.16  ? 66  ALA G CB    1 
ATOM   4983  N  N     . GLY G 3  67  ? 164.458 148.676 186.370 1.00 88.37  ? 67  GLY G N     1 
ATOM   4984  C  CA    . GLY G 3  67  ? 164.777 148.144 187.684 1.00 88.37  ? 67  GLY G CA    1 
ATOM   4985  C  C     . GLY G 3  67  ? 164.095 148.920 188.794 1.00 88.37  ? 67  GLY G C     1 
ATOM   4986  O  O     . GLY G 3  67  ? 163.545 148.329 189.733 1.00 88.37  ? 67  GLY G O     1 
ATOM   4987  N  N     . ASN G 3  68  ? 164.125 150.253 188.701 1.00 90.56  ? 68  ASN G N     1 
ATOM   4988  C  CA    . ASN G 3  68  ? 163.464 151.094 189.694 1.00 90.56  ? 68  ASN G CA    1 
ATOM   4989  C  C     . ASN G 3  68  ? 161.963 150.871 189.682 1.00 90.56  ? 68  ASN G C     1 
ATOM   4990  O  O     . ASN G 3  68  ? 161.339 150.684 190.735 1.00 90.56  ? 68  ASN G O     1 
ATOM   4991  C  CB    . ASN G 3  68  ? 163.784 152.559 189.431 1.00 90.56  ? 68  ASN G CB    1 
ATOM   4992  C  CG    . ASN G 3  68  ? 165.219 152.890 189.721 1.00 90.56  ? 68  ASN G CG    1 
ATOM   4993  O  OD1   . ASN G 3  68  ? 165.773 152.457 190.731 1.00 90.56  ? 68  ASN G OD1   1 
ATOM   4994  N  ND2   . ASN G 3  68  ? 165.842 153.653 188.830 1.00 90.56  ? 68  ASN G ND2   1 
ATOM   4995  N  N     . ALA G 3  69  ? 161.368 150.840 188.490 1.00 88.25  ? 69  ALA G N     1 
ATOM   4996  C  CA    . ALA G 3  69  ? 159.963 150.482 188.396 1.00 88.25  ? 69  ALA G CA    1 
ATOM   4997  C  C     . ALA G 3  69  ? 159.731 149.016 188.722 1.00 88.25  ? 69  ALA G C     1 
ATOM   4998  O  O     . ALA G 3  69  ? 158.616 148.651 189.104 1.00 88.25  ? 69  ALA G O     1 
ATOM   4999  C  CB    . ALA G 3  69  ? 159.423 150.802 187.005 1.00 88.25  ? 69  ALA G CB    1 
ATOM   5000  N  N     . ALA G 3  70  ? 160.763 148.181 188.614 1.00 88.15  ? 70  ALA G N     1 
ATOM   5001  C  CA    . ALA G 3  70  ? 160.594 146.765 188.901 1.00 88.15  ? 70  ALA G CA    1 
ATOM   5002  C  C     . ALA G 3  70  ? 160.442 146.517 190.395 1.00 88.15  ? 70  ALA G C     1 
ATOM   5003  O  O     . ALA G 3  70  ? 159.619 145.693 190.809 1.00 88.15  ? 70  ALA G O     1 
ATOM   5004  C  CB    . ALA G 3  70  ? 161.764 145.969 188.333 1.00 88.15  ? 70  ALA G CB    1 
ATOM   5005  N  N     . ARG G 3  71  ? 161.220 147.215 191.224 1.00 90.68  ? 71  ARG G N     1 
ATOM   5006  C  CA    . ARG G 3  71  ? 160.906 147.179 192.646 1.00 90.68  ? 71  ARG G CA    1 
ATOM   5007  C  C     . ARG G 3  71  ? 159.616 147.922 192.935 1.00 90.68  ? 71  ARG G C     1 
ATOM   5008  O  O     . ARG G 3  71  ? 158.789 147.455 193.723 1.00 90.68  ? 71  ARG G O     1 
ATOM   5009  C  CB    . ARG G 3  71  ? 162.028 147.773 193.487 1.00 90.68  ? 71  ARG G CB    1 
ATOM   5010  C  CG    . ARG G 3  71  ? 163.247 146.917 193.638 1.00 90.68  ? 71  ARG G CG    1 
ATOM   5011  C  CD    . ARG G 3  71  ? 164.194 147.573 194.613 1.00 90.68  ? 71  ARG G CD    1 
ATOM   5012  N  NE    . ARG G 3  71  ? 164.724 148.822 194.077 1.00 90.68  ? 71  ARG G NE    1 
ATOM   5013  C  CZ    . ARG G 3  71  ? 164.451 150.019 194.579 1.00 90.68  ? 71  ARG G CZ    1 
ATOM   5014  N  NH1   . ARG G 3  71  ? 163.650 150.122 195.625 1.00 90.68  ? 71  ARG G NH1   1 
ATOM   5015  N  NH2   . ARG G 3  71  ? 164.972 151.108 194.035 1.00 90.68  ? 71  ARG G NH2   1 
ATOM   5016  N  N     . ASP G 3  72  ? 159.406 149.063 192.281 1.00 98.62  ? 72  ASP G N     1 
ATOM   5017  C  CA    . ASP G 3  72  ? 158.271 149.914 192.618 1.00 98.62  ? 72  ASP G CA    1 
ATOM   5018  C  C     . ASP G 3  72  ? 156.945 149.422 192.052 1.00 98.62  ? 72  ASP G C     1 
ATOM   5019  O  O     . ASP G 3  72  ? 155.954 150.147 192.136 1.00 98.62  ? 72  ASP G O     1 
ATOM   5020  C  CB    . ASP G 3  72  ? 158.533 151.345 192.159 1.00 98.62  ? 72  ASP G CB    1 
ATOM   5021  C  CG    . ASP G 3  72  ? 159.578 152.034 193.004 1.00 98.62  ? 72  ASP G CG    1 
ATOM   5022  O  OD1   . ASP G 3  72  ? 159.704 151.674 194.194 1.00 98.62  ? 72  ASP G OD1   1 
ATOM   5023  O  OD2   . ASP G 3  72  ? 160.275 152.928 192.483 1.00 98.62  ? 72  ASP G OD2   1 
ATOM   5024  N  N     . ASN G 3  73  ? 156.899 148.224 191.479 1.00 94.42  ? 73  ASN G N     1 
ATOM   5025  C  CA    . ASN G 3  73  ? 155.629 147.534 191.311 1.00 94.42  ? 73  ASN G CA    1 
ATOM   5026  C  C     . ASN G 3  73  ? 155.740 146.083 191.761 1.00 94.42  ? 73  ASN G C     1 
ATOM   5027  O  O     . ASN G 3  73  ? 155.001 145.228 191.260 1.00 94.42  ? 73  ASN G O     1 
ATOM   5028  C  CB    . ASN G 3  73  ? 155.130 147.651 189.874 1.00 94.42  ? 73  ASN G CB    1 
ATOM   5029  C  CG    . ASN G 3  73  ? 154.513 149.013 189.594 1.00 94.42  ? 73  ASN G CG    1 
ATOM   5030  O  OD1   . ASN G 3  73  ? 153.717 149.516 190.384 1.00 94.42  ? 73  ASN G OD1   1 
ATOM   5031  N  ND2   . ASN G 3  73  ? 154.896 149.623 188.484 1.00 94.42  ? 73  ASN G ND2   1 
ATOM   5032  N  N     . LYS G 3  74  ? 156.675 145.807 192.677 1.00 95.91  ? 74  LYS G N     1 
ATOM   5033  C  CA    . LYS G 3  74  ? 156.686 144.624 193.538 1.00 95.91  ? 74  LYS G CA    1 
ATOM   5034  C  C     . LYS G 3  74  ? 156.820 143.320 192.751 1.00 95.91  ? 74  LYS G C     1 
ATOM   5035  O  O     . LYS G 3  74  ? 155.998 142.408 192.861 1.00 95.91  ? 74  LYS G O     1 
ATOM   5036  C  CB    . LYS G 3  74  ? 155.447 144.598 194.435 1.00 95.91  ? 74  LYS G CB    1 
ATOM   5037  C  CG    . LYS G 3  74  ? 155.460 145.639 195.535 1.00 95.91  ? 74  LYS G CG    1 
ATOM   5038  C  CD    . LYS G 3  74  ? 154.279 145.432 196.466 1.00 95.91  ? 74  LYS G CD    1 
ATOM   5039  C  CE    . LYS G 3  74  ? 154.307 146.400 197.635 1.00 95.91  ? 74  LYS G CE    1 
ATOM   5040  N  NZ    . LYS G 3  74  ? 153.188 146.160 198.590 1.00 95.91  ? 74  LYS G NZ    1 
ATOM   5041  N  N     . LYS G 3  75  ? 157.877 143.246 191.950 1.00 90.33  ? 75  LYS G N     1 
ATOM   5042  C  CA    . LYS G 3  75  ? 158.328 142.001 191.351 1.00 90.33  ? 75  LYS G CA    1 
ATOM   5043  C  C     . LYS G 3  75  ? 159.836 141.907 191.530 1.00 90.33  ? 75  LYS G C     1 
ATOM   5044  O  O     . LYS G 3  75  ? 160.475 142.814 192.068 1.00 90.33  ? 75  LYS G O     1 
ATOM   5045  C  CB    . LYS G 3  75  ? 157.956 141.912 189.865 1.00 90.33  ? 75  LYS G CB    1 
ATOM   5046  C  CG    . LYS G 3  75  ? 156.470 141.939 189.574 1.00 90.33  ? 75  LYS G CG    1 
ATOM   5047  C  CD    . LYS G 3  75  ? 155.784 140.698 190.082 1.00 90.33  ? 75  LYS G CD    1 
ATOM   5048  C  CE    . LYS G 3  75  ? 154.310 140.749 189.780 1.00 90.33  ? 75  LYS G CE    1 
ATOM   5049  N  NZ    . LYS G 3  75  ? 153.620 139.569 190.349 1.00 90.33  ? 75  LYS G NZ    1 
ATOM   5050  N  N     . THR G 3  76  ? 160.410 140.793 191.092 1.00 93.48  ? 76  THR G N     1 
ATOM   5051  C  CA    . THR G 3  76  ? 161.856 140.616 191.077 1.00 93.48  ? 76  THR G CA    1 
ATOM   5052  C  C     . THR G 3  76  ? 162.354 140.263 189.685 1.00 93.48  ? 76  THR G C     1 
ATOM   5053  O  O     . THR G 3  76  ? 163.384 139.608 189.535 1.00 93.48  ? 76  THR G O     1 
ATOM   5054  C  CB    . THR G 3  76  ? 162.293 139.539 192.066 1.00 93.48  ? 76  THR G CB    1 
ATOM   5055  O  OG1   . THR G 3  76  ? 161.626 138.310 191.753 1.00 93.48  ? 76  THR G OG1   1 
ATOM   5056  C  CG2   . THR G 3  76  ? 161.986 139.953 193.495 1.00 93.48  ? 76  THR G CG2   1 
ATOM   5057  N  N     . ARG G 3  77  ? 161.634 140.703 188.660 1.00 92.23  ? 77  ARG G N     1 
ATOM   5058  C  CA    . ARG G 3  77  ? 161.912 140.263 187.303 1.00 92.23  ? 77  ARG G CA    1 
ATOM   5059  C  C     . ARG G 3  77  ? 161.294 141.249 186.330 1.00 92.23  ? 77  ARG G C     1 
ATOM   5060  O  O     . ARG G 3  77  ? 160.100 141.548 186.426 1.00 92.23  ? 77  ARG G O     1 
ATOM   5061  C  CB    . ARG G 3  77  ? 161.360 138.862 187.076 1.00 92.23  ? 77  ARG G CB    1 
ATOM   5062  C  CG    . ARG G 3  77  ? 161.604 138.320 185.703 1.00 92.23  ? 77  ARG G CG    1 
ATOM   5063  C  CD    . ARG G 3  77  ? 161.143 136.885 185.604 1.00 92.23  ? 77  ARG G CD    1 
ATOM   5064  N  NE    . ARG G 3  77  ? 161.988 135.999 186.394 1.00 92.23  ? 77  ARG G NE    1 
ATOM   5065  C  CZ    . ARG G 3  77  ? 161.592 135.371 187.495 1.00 92.23  ? 77  ARG G CZ    1 
ATOM   5066  N  NH1   . ARG G 3  77  ? 160.358 135.543 187.950 1.00 92.23  ? 77  ARG G NH1   1 
ATOM   5067  N  NH2   . ARG G 3  77  ? 162.440 134.584 188.142 1.00 92.23  ? 77  ARG G NH2   1 
ATOM   5068  N  N     . ILE G 3  78  ? 162.096 141.750 185.400 1.00 84.75  ? 78  ILE G N     1 
ATOM   5069  C  CA    . ILE G 3  78  ? 161.623 142.736 184.438 1.00 84.75  ? 78  ILE G CA    1 
ATOM   5070  C  C     . ILE G 3  78  ? 160.768 142.045 183.388 1.00 84.75  ? 78  ILE G C     1 
ATOM   5071  O  O     . ILE G 3  78  ? 161.224 141.118 182.712 1.00 84.75  ? 78  ILE G O     1 
ATOM   5072  C  CB    . ILE G 3  78  ? 162.789 143.480 183.789 1.00 84.75  ? 78  ILE G CB    1 
ATOM   5073  C  CG1   . ILE G 3  78  ? 163.512 144.308 184.839 1.00 84.75  ? 78  ILE G CG1   1 
ATOM   5074  C  CG2   . ILE G 3  78  ? 162.299 144.370 182.689 1.00 84.75  ? 78  ILE G CG2   1 
ATOM   5075  C  CD1   . ILE G 3  78  ? 164.807 144.885 184.351 1.00 84.75  ? 78  ILE G CD1   1 
ATOM   5076  N  N     . ILE G 3  79  ? 159.528 142.495 183.257 1.00 80.30  ? 79  ILE G N     1 
ATOM   5077  C  CA    . ILE G 3  79  ? 158.613 142.043 182.216 1.00 80.30  ? 79  ILE G CA    1 
ATOM   5078  C  C     . ILE G 3  79  ? 158.499 143.192 181.220 1.00 80.30  ? 79  ILE G C     1 
ATOM   5079  O  O     . ILE G 3  79  ? 158.893 144.316 181.564 1.00 80.30  ? 79  ILE G O     1 
ATOM   5080  C  CB    . ILE G 3  79  ? 157.263 141.644 182.825 1.00 80.30  ? 79  ILE G CB    1 
ATOM   5081  C  CG1   . ILE G 3  79  ? 156.603 142.855 183.474 1.00 80.30  ? 79  ILE G CG1   1 
ATOM   5082  C  CG2   . ILE G 3  79  ? 157.466 140.547 183.838 1.00 80.30  ? 79  ILE G CG2   1 
ATOM   5083  C  CD1   . ILE G 3  79  ? 155.197 142.595 183.935 1.00 80.30  ? 79  ILE G CD1   1 
ATOM   5084  N  N     . PRO G 3  80  ? 158.011 142.977 179.991 1.00 75.28  ? 80  PRO G N     1 
ATOM   5085  C  CA    . PRO G 3  80  ? 157.902 144.101 179.046 1.00 75.28  ? 80  PRO G CA    1 
ATOM   5086  C  C     . PRO G 3  80  ? 156.947 145.211 179.465 1.00 75.28  ? 80  PRO G C     1 
ATOM   5087  O  O     . PRO G 3  80  ? 157.064 146.314 178.917 1.00 75.28  ? 80  PRO G O     1 
ATOM   5088  C  CB    . PRO G 3  80  ? 157.420 143.425 177.757 1.00 75.28  ? 80  PRO G CB    1 
ATOM   5089  C  CG    . PRO G 3  80  ? 157.898 142.069 177.856 1.00 75.28  ? 80  PRO G CG    1 
ATOM   5090  C  CD    . PRO G 3  80  ? 157.819 141.695 179.293 1.00 75.28  ? 80  PRO G CD    1 
ATOM   5091  N  N     . ARG G 3  81  ? 156.009 144.960 180.390 1.00 77.25  ? 81  ARG G N     1 
ATOM   5092  C  CA    . ARG G 3  81  ? 155.177 146.036 180.928 1.00 77.25  ? 81  ARG G CA    1 
ATOM   5093  C  C     . ARG G 3  81  ? 156.022 147.081 181.632 1.00 77.25  ? 81  ARG G C     1 
ATOM   5094  O  O     . ARG G 3  81  ? 155.821 148.289 181.452 1.00 77.25  ? 81  ARG G O     1 
ATOM   5095  C  CB    . ARG G 3  81  ? 154.136 145.473 181.893 1.00 77.25  ? 81  ARG G CB    1 
ATOM   5096  C  CG    . ARG G 3  81  ? 153.309 146.534 182.611 1.00 77.25  ? 81  ARG G CG    1 
ATOM   5097  C  CD    . ARG G 3  81  ? 152.438 147.274 181.637 1.00 77.25  ? 81  ARG G CD    1 
ATOM   5098  N  NE    . ARG G 3  81  ? 151.631 148.316 182.255 1.00 77.25  ? 81  ARG G NE    1 
ATOM   5099  C  CZ    . ARG G 3  81  ? 150.901 149.186 181.571 1.00 77.25  ? 81  ARG G CZ    1 
ATOM   5100  N  NH1   . ARG G 3  81  ? 150.871 149.131 180.251 1.00 77.25  ? 81  ARG G NH1   1 
ATOM   5101  N  NH2   . ARG G 3  81  ? 150.195 150.109 182.207 1.00 77.25  ? 81  ARG G NH2   1 
ATOM   5102  N  N     . HIS G 3  82  ? 156.993 146.629 182.416 1.00 81.11  ? 82  HIS G N     1 
ATOM   5103  C  CA    . HIS G 3  82  ? 157.939 147.549 183.010 1.00 81.11  ? 82  HIS G CA    1 
ATOM   5104  C  C     . HIS G 3  82  ? 158.818 148.232 181.978 1.00 81.11  ? 82  HIS G C     1 
ATOM   5105  O  O     . HIS G 3  82  ? 159.337 149.310 182.264 1.00 81.11  ? 82  HIS G O     1 
ATOM   5106  C  CB    . HIS G 3  82  ? 158.805 146.832 184.038 1.00 81.11  ? 82  HIS G CB    1 
ATOM   5107  C  CG    . HIS G 3  82  ? 158.099 146.540 185.321 1.00 81.11  ? 82  HIS G CG    1 
ATOM   5108  N  ND1   . HIS G 3  82  ? 157.433 145.359 185.559 1.00 81.11  ? 82  HIS G ND1   1 
ATOM   5109  C  CD2   . HIS G 3  82  ? 157.950 147.288 186.439 1.00 81.11  ? 82  HIS G CD2   1 
ATOM   5110  C  CE1   . HIS G 3  82  ? 156.908 145.388 186.769 1.00 81.11  ? 82  HIS G CE1   1 
ATOM   5111  N  NE2   . HIS G 3  82  ? 157.209 146.547 187.325 1.00 81.11  ? 82  HIS G NE2   1 
ATOM   5112  N  N     . LEU G 3  83  ? 158.998 147.655 180.789 1.00 77.77  ? 83  LEU G N     1 
ATOM   5113  C  CA    . LEU G 3  83  ? 159.678 148.409 179.743 1.00 77.77  ? 83  LEU G CA    1 
ATOM   5114  C  C     . LEU G 3  83  ? 158.770 149.456 179.123 1.00 77.77  ? 83  LEU G C     1 
ATOM   5115  O  O     . LEU G 3  83  ? 159.254 150.518 178.709 1.00 77.77  ? 83  LEU G O     1 
ATOM   5116  C  CB    . LEU G 3  83  ? 160.225 147.481 178.666 1.00 77.77  ? 83  LEU G CB    1 
ATOM   5117  C  CG    . LEU G 3  83  ? 161.411 146.663 179.168 1.00 77.77  ? 83  LEU G CG    1 
ATOM   5118  C  CD1   . LEU G 3  83  ? 161.945 145.756 178.091 1.00 77.77  ? 83  LEU G CD1   1 
ATOM   5119  C  CD2   . LEU G 3  83  ? 162.499 147.566 179.678 1.00 77.77  ? 83  LEU G CD2   1 
ATOM   5120  N  N     . GLN G 3  84  ? 157.465 149.183 179.073 1.00 76.19  ? 84  GLN G N     1 
ATOM   5121  C  CA    . GLN G 3  84  ? 156.495 150.177 178.627 1.00 76.19  ? 84  GLN G CA    1 
ATOM   5122  C  C     . GLN G 3  84  ? 156.496 151.391 179.545 1.00 76.19  ? 84  GLN G C     1 
ATOM   5123  O  O     . GLN G 3  84  ? 156.840 152.501 179.119 1.00 76.19  ? 84  GLN G O     1 
ATOM   5124  C  CB    . GLN G 3  84  ? 155.099 149.563 178.554 1.00 76.19  ? 84  GLN G CB    1 
ATOM   5125  C  CG    . GLN G 3  84  ? 154.014 150.513 178.119 1.00 76.19  ? 84  GLN G CG    1 
ATOM   5126  C  CD    . GLN G 3  84  ? 154.067 150.826 176.650 1.00 76.19  ? 84  GLN G CD    1 
ATOM   5127  O  OE1   . GLN G 3  84  ? 154.267 149.941 175.829 1.00 76.19  ? 84  GLN G OE1   1 
ATOM   5128  N  NE2   . GLN G 3  84  ? 153.875 152.090 176.307 1.00 76.19  ? 84  GLN G NE2   1 
ATOM   5129  N  N     . LEU G 3  85  ? 156.164 151.204 180.828 1.00 78.34  ? 85  LEU G N     1 
ATOM   5130  C  CA    . LEU G 3  85  ? 156.117 152.413 181.639 1.00 78.34  ? 85  LEU G CA    1 
ATOM   5131  C  C     . LEU G 3  85  ? 157.488 152.835 182.131 1.00 78.34  ? 85  LEU G C     1 
ATOM   5132  O  O     . LEU G 3  85  ? 157.614 153.921 182.704 1.00 78.34  ? 85  LEU G O     1 
ATOM   5133  C  CB    . LEU G 3  85  ? 155.168 152.284 182.833 1.00 78.34  ? 85  LEU G CB    1 
ATOM   5134  C  CG    . LEU G 3  85  ? 155.583 151.671 184.159 1.00 78.34  ? 85  LEU G CG    1 
ATOM   5135  C  CD1   . LEU G 3  85  ? 154.627 152.146 185.236 1.00 78.34  ? 85  LEU G CD1   1 
ATOM   5136  C  CD2   . LEU G 3  85  ? 155.538 150.187 184.077 1.00 78.34  ? 85  LEU G CD2   1 
ATOM   5137  N  N     . ALA G 3  86  ? 158.515 152.023 181.913 1.00 75.97  ? 86  ALA G N     1 
ATOM   5138  C  CA    . ALA G 3  86  ? 159.869 152.496 182.151 1.00 75.97  ? 86  ALA G CA    1 
ATOM   5139  C  C     . ALA G 3  86  ? 160.274 153.500 181.089 1.00 75.97  ? 86  ALA G C     1 
ATOM   5140  O  O     . ALA G 3  86  ? 160.799 154.571 181.406 1.00 75.97  ? 86  ALA G O     1 
ATOM   5141  C  CB    . ALA G 3  86  ? 160.852 151.333 182.175 1.00 75.97  ? 86  ALA G CB    1 
ATOM   5142  N  N     . VAL G 3  87  ? 160.031 153.170 179.821 1.00 77.95  ? 87  VAL G N     1 
ATOM   5143  C  CA    . VAL G 3  87  ? 160.434 154.077 178.755 1.00 77.95  ? 87  VAL G CA    1 
ATOM   5144  C  C     . VAL G 3  87  ? 159.522 155.296 178.706 1.00 77.95  ? 87  VAL G C     1 
ATOM   5145  O  O     . VAL G 3  87  ? 159.998 156.433 178.603 1.00 77.95  ? 87  VAL G O     1 
ATOM   5146  C  CB    . VAL G 3  87  ? 160.476 153.332 177.410 1.00 77.95  ? 87  VAL G CB    1 
ATOM   5147  C  CG1   . VAL G 3  87  ? 160.647 154.300 176.277 1.00 77.95  ? 87  VAL G CG1   1 
ATOM   5148  C  CG2   . VAL G 3  87  ? 161.638 152.372 177.397 1.00 77.95  ? 87  VAL G CG2   1 
ATOM   5149  N  N     . ARG G 3  88  ? 158.209 155.096 178.842 1.00 71.30  ? 88  ARG G N     1 
ATOM   5150  C  CA    . ARG G 3  88  ? 157.298 156.215 178.621 1.00 71.30  ? 88  ARG G CA    1 
ATOM   5151  C  C     . ARG G 3  88  ? 157.279 157.241 179.748 1.00 71.30  ? 88  ARG G C     1 
ATOM   5152  O  O     . ARG G 3  88  ? 156.565 158.239 179.617 1.00 71.30  ? 88  ARG G O     1 
ATOM   5153  C  CB    . ARG G 3  88  ? 155.875 155.714 178.390 1.00 71.30  ? 88  ARG G CB    1 
ATOM   5154  C  CG    . ARG G 3  88  ? 155.716 154.858 177.160 1.00 71.30  ? 88  ARG G CG    1 
ATOM   5155  C  CD    . ARG G 3  88  ? 155.994 155.630 175.896 1.00 71.30  ? 88  ARG G CD    1 
ATOM   5156  N  NE    . ARG G 3  88  ? 155.649 154.838 174.724 1.00 71.30  ? 88  ARG G NE    1 
ATOM   5157  C  CZ    . ARG G 3  88  ? 156.480 154.005 174.119 1.00 71.30  ? 88  ARG G CZ    1 
ATOM   5158  N  NH1   . ARG G 3  88  ? 157.706 153.853 174.576 1.00 71.30  ? 88  ARG G NH1   1 
ATOM   5159  N  NH2   . ARG G 3  88  ? 156.079 153.324 173.061 1.00 71.30  ? 88  ARG G NH2   1 
ATOM   5160  N  N     . ASN G 3  89  ? 158.032 157.055 180.831 1.00 79.19  ? 89  ASN G N     1 
ATOM   5161  C  CA    . ASN G 3  89  ? 158.034 158.037 181.907 1.00 79.19  ? 89  ASN G CA    1 
ATOM   5162  C  C     . ASN G 3  89  ? 159.182 159.029 181.834 1.00 79.19  ? 89  ASN G C     1 
ATOM   5163  O  O     . ASN G 3  89  ? 159.015 160.176 182.261 1.00 79.19  ? 89  ASN G O     1 
ATOM   5164  C  CB    . ASN G 3  89  ? 158.043 157.344 183.267 1.00 79.19  ? 89  ASN G CB    1 
ATOM   5165  C  CG    . ASN G 3  89  ? 156.662 156.954 183.713 1.00 79.19  ? 89  ASN G CG    1 
ATOM   5166  O  OD1   . ASN G 3  89  ? 155.733 157.755 183.629 1.00 79.19  ? 89  ASN G OD1   1 
ATOM   5167  N  ND2   . ASN G 3  89  ? 156.506 155.720 184.174 1.00 79.19  ? 89  ASN G ND2   1 
ATOM   5168  N  N     . ASP G 3  90  ? 160.345 158.637 181.333 1.00 81.87  ? 90  ASP G N     1 
ATOM   5169  C  CA    . ASP G 3  90  ? 161.327 159.653 180.999 1.00 81.87  ? 90  ASP G CA    1 
ATOM   5170  C  C     . ASP G 3  90  ? 160.880 160.378 179.743 1.00 81.87  ? 90  ASP G C     1 
ATOM   5171  O  O     . ASP G 3  90  ? 160.240 159.799 178.864 1.00 81.87  ? 90  ASP G O     1 
ATOM   5172  C  CB    . ASP G 3  90  ? 162.708 159.046 180.779 1.00 81.87  ? 90  ASP G CB    1 
ATOM   5173  C  CG    . ASP G 3  90  ? 163.764 160.098 180.486 1.00 81.87  ? 90  ASP G CG    1 
ATOM   5174  O  OD1   . ASP G 3  90  ? 164.191 160.789 181.434 1.00 81.87  ? 90  ASP G OD1   1 
ATOM   5175  O  OD2   . ASP G 3  90  ? 164.131 160.261 179.302 1.00 81.87  ? 90  ASP G OD2   1 
ATOM   5176  N  N     . GLU G 3  91  ? 161.206 161.665 179.670 1.00 82.79  ? 91  GLU G N     1 
ATOM   5177  C  CA    . GLU G 3  91  ? 160.830 162.439 178.498 1.00 82.79  ? 91  GLU G CA    1 
ATOM   5178  C  C     . GLU G 3  91  ? 161.696 162.064 177.304 1.00 82.79  ? 91  GLU G C     1 
ATOM   5179  O  O     . GLU G 3  91  ? 161.188 161.813 176.206 1.00 82.79  ? 91  GLU G O     1 
ATOM   5180  C  CB    . GLU G 3  91  ? 160.944 163.927 178.814 1.00 82.79  ? 91  GLU G CB    1 
ATOM   5181  C  CG    . GLU G 3  91  ? 160.168 164.840 177.886 1.00 82.79  ? 91  GLU G CG    1 
ATOM   5182  C  CD    . GLU G 3  91  ? 160.919 165.186 176.625 1.00 82.79  ? 91  GLU G CD    1 
ATOM   5183  O  OE1   . GLU G 3  91  ? 162.162 165.128 176.640 1.00 82.79  ? 91  GLU G OE1   1 
ATOM   5184  O  OE2   . GLU G 3  91  ? 160.263 165.536 175.627 1.00 82.79  ? 91  GLU G OE2   1 
ATOM   5185  N  N     . GLU G 3  92  ? 163.005 161.987 177.507 1.00 82.85  ? 92  GLU G N     1 
ATOM   5186  C  CA    . GLU G 3  92  ? 163.921 161.904 176.381 1.00 82.85  ? 92  GLU G CA    1 
ATOM   5187  C  C     . GLU G 3  92  ? 163.991 160.503 175.795 1.00 82.85  ? 92  GLU G C     1 
ATOM   5188  O  O     . GLU G 3  92  ? 164.122 160.352 174.572 1.00 82.85  ? 92  GLU G O     1 
ATOM   5189  C  CB    . GLU G 3  92  ? 165.286 162.405 176.825 1.00 82.85  ? 92  GLU G CB    1 
ATOM   5190  C  CG    . GLU G 3  92  ? 165.204 163.869 177.208 1.00 82.85  ? 92  GLU G CG    1 
ATOM   5191  C  CD    . GLU G 3  92  ? 166.496 164.427 177.732 1.00 82.85  ? 92  GLU G CD    1 
ATOM   5192  O  OE1   . GLU G 3  92  ? 167.447 163.646 177.917 1.00 82.85  ? 92  GLU G OE1   1 
ATOM   5193  O  OE2   . GLU G 3  92  ? 166.557 165.651 177.963 1.00 82.85  ? 92  GLU G OE2   1 
ATOM   5194  N  N     . LEU G 3  93  ? 163.875 159.480 176.639 1.00 78.60  ? 93  LEU G N     1 
ATOM   5195  C  CA    . LEU G 3  93  ? 163.770 158.114 176.141 1.00 78.60  ? 93  LEU G CA    1 
ATOM   5196  C  C     . LEU G 3  93  ? 162.478 157.906 175.372 1.00 78.60  ? 93  LEU G C     1 
ATOM   5197  O  O     . LEU G 3  93  ? 162.444 157.123 174.420 1.00 78.60  ? 93  LEU G O     1 
ATOM   5198  C  CB    . LEU G 3  93  ? 163.850 157.131 177.303 1.00 78.60  ? 93  LEU G CB    1 
ATOM   5199  C  CG    . LEU G 3  93  ? 165.153 157.200 178.087 1.00 78.60  ? 93  LEU G CG    1 
ATOM   5200  C  CD1   . LEU G 3  93  ? 165.072 156.328 179.312 1.00 78.60  ? 93  LEU G CD1   1 
ATOM   5201  C  CD2   . LEU G 3  93  ? 166.298 156.775 177.209 1.00 78.60  ? 93  LEU G CD2   1 
ATOM   5202  N  N     . ASN G 3  94  ? 161.410 158.600 175.771 1.00 76.75  ? 94  ASN G N     1 
ATOM   5203  C  CA    . ASN G 3  94  ? 160.173 158.566 175.005 1.00 76.75  ? 94  ASN G CA    1 
ATOM   5204  C  C     . ASN G 3  94  ? 160.348 159.269 173.669 1.00 76.75  ? 94  ASN G C     1 
ATOM   5205  O  O     . ASN G 3  94  ? 159.811 158.816 172.654 1.00 76.75  ? 94  ASN G O     1 
ATOM   5206  C  CB    . ASN G 3  94  ? 159.050 159.217 175.801 1.00 76.75  ? 94  ASN G CB    1 
ATOM   5207  C  CG    . ASN G 3  94  ? 157.679 158.927 175.228 1.00 76.75  ? 94  ASN G CG    1 
ATOM   5208  O  OD1   . ASN G 3  94  ? 157.531 158.190 174.257 1.00 76.75  ? 94  ASN G OD1   1 
ATOM   5209  N  ND2   . ASN G 3  94  ? 156.660 159.511 175.839 1.00 76.75  ? 94  ASN G ND2   1 
ATOM   5210  N  N     . LYS G 3  95  ? 161.103 160.368 173.646 1.00 74.46  ? 95  LYS G N     1 
ATOM   5211  C  CA    . LYS G 3  95  ? 161.310 161.089 172.395 1.00 74.46  ? 95  LYS G CA    1 
ATOM   5212  C  C     . LYS G 3  95  ? 162.207 160.312 171.440 1.00 74.46  ? 95  LYS G C     1 
ATOM   5213  O  O     . LYS G 3  95  ? 162.082 160.450 170.220 1.00 74.46  ? 95  LYS G O     1 
ATOM   5214  C  CB    . LYS G 3  95  ? 161.887 162.472 172.688 1.00 74.46  ? 95  LYS G CB    1 
ATOM   5215  C  CG    . LYS G 3  95  ? 161.966 163.387 171.493 1.00 74.46  ? 95  LYS G CG    1 
ATOM   5216  C  CD    . LYS G 3  95  ? 162.459 164.754 171.882 1.00 74.46  ? 95  LYS G CD    1 
ATOM   5217  C  CE    . LYS G 3  95  ? 161.341 165.522 172.560 1.00 74.46  ? 95  LYS G CE    1 
ATOM   5218  N  NZ    . LYS G 3  95  ? 161.696 166.928 172.878 1.00 74.46  ? 95  LYS G NZ    1 
ATOM   5219  N  N     . LEU G 3  96  ? 163.083 159.455 171.956 1.00 72.50  ? 96  LEU G N     1 
ATOM   5220  C  CA    . LEU G 3  96  ? 163.819 158.608 171.029 1.00 72.50  ? 96  LEU G CA    1 
ATOM   5221  C  C     . LEU G 3  96  ? 162.938 157.496 170.488 1.00 72.50  ? 96  LEU G C     1 
ATOM   5222  O  O     . LEU G 3  96  ? 163.133 157.056 169.352 1.00 72.50  ? 96  LEU G O     1 
ATOM   5223  C  CB    . LEU G 3  96  ? 165.061 158.039 171.703 1.00 72.50  ? 96  LEU G CB    1 
ATOM   5224  C  CG    . LEU G 3  96  ? 166.137 157.372 170.844 1.00 72.50  ? 96  LEU G CG    1 
ATOM   5225  C  CD1   . LEU G 3  96  ? 167.467 157.669 171.460 1.00 72.50  ? 96  LEU G CD1   1 
ATOM   5226  C  CD2   . LEU G 3  96  ? 165.983 155.874 170.767 1.00 72.50  ? 96  LEU G CD2   1 
ATOM   5227  N  N     . LEU G 3  97  ? 161.951 157.049 171.262 1.00 68.45  ? 97  LEU G N     1 
ATOM   5228  C  CA    . LEU G 3  97  ? 161.162 155.872 170.918 1.00 68.45  ? 97  LEU G CA    1 
ATOM   5229  C  C     . LEU G 3  97  ? 159.697 156.202 170.681 1.00 68.45  ? 97  LEU G C     1 
ATOM   5230  O  O     . LEU G 3  97  ? 158.827 155.364 170.902 1.00 68.45  ? 97  LEU G O     1 
ATOM   5231  C  CB    . LEU G 3  97  ? 161.280 154.819 172.010 1.00 68.45  ? 97  LEU G CB    1 
ATOM   5232  C  CG    . LEU G 3  97  ? 162.692 154.299 172.166 1.00 68.45  ? 97  LEU G CG    1 
ATOM   5233  C  CD1   . LEU G 3  97  ? 162.719 153.357 173.315 1.00 68.45  ? 97  LEU G CD1   1 
ATOM   5234  C  CD2   . LEU G 3  97  ? 163.062 153.590 170.908 1.00 68.45  ? 97  LEU G CD2   1 
ATOM   5235  N  N     . GLY G 3  98  ? 159.414 157.413 170.210 1.00 70.41  ? 98  GLY G N     1 
ATOM   5236  C  CA    . GLY G 3  98  ? 158.038 157.854 170.104 1.00 70.41  ? 98  GLY G CA    1 
ATOM   5237  C  C     . GLY G 3  98  ? 157.252 157.245 168.973 1.00 70.41  ? 98  GLY G C     1 
ATOM   5238  O  O     . GLY G 3  98  ? 156.026 157.364 168.956 1.00 70.41  ? 98  GLY G O     1 
ATOM   5239  N  N     . ARG G 3  99  ? 157.920 156.601 168.022 1.00 75.12  ? 99  ARG G N     1 
ATOM   5240  C  CA    . ARG G 3  99  ? 157.241 155.950 166.913 1.00 75.12  ? 99  ARG G CA    1 
ATOM   5241  C  C     . ARG G 3  99  ? 157.309 154.438 167.030 1.00 75.12  ? 99  ARG G C     1 
ATOM   5242  O  O     . ARG G 3  99  ? 157.069 153.735 166.048 1.00 75.12  ? 99  ARG G O     1 
ATOM   5243  C  CB    . ARG G 3  99  ? 157.841 156.391 165.578 1.00 75.12  ? 99  ARG G CB    1 
ATOM   5244  C  CG    . ARG G 3  99  ? 157.864 157.885 165.368 1.00 75.12  ? 99  ARG G CG    1 
ATOM   5245  C  CD    . ARG G 3  99  ? 156.463 158.448 165.259 1.00 75.12  ? 99  ARG G CD    1 
ATOM   5246  N  NE    . ARG G 3  99  ? 156.475 159.911 165.223 1.00 75.12  ? 99  ARG G NE    1 
ATOM   5247  C  CZ    . ARG G 3  99  ? 155.386 160.668 165.316 1.00 75.12  ? 99  ARG G CZ    1 
ATOM   5248  N  NH1   . ARG G 3  99  ? 154.195 160.104 165.444 1.00 75.12  ? 99  ARG G NH1   1 
ATOM   5249  N  NH2   . ARG G 3  99  ? 155.489 161.987 165.282 1.00 75.12  ? 99  ARG G NH2   1 
ATOM   5250  N  N     . VAL G 3  100 ? 157.648 153.924 168.204 1.00 70.01  ? 100 VAL G N     1 
ATOM   5251  C  CA    . VAL G 3  100 ? 157.920 152.508 168.382 1.00 70.01  ? 100 VAL G CA    1 
ATOM   5252  C  C     . VAL G 3  100 ? 156.899 151.929 169.337 1.00 70.01  ? 100 VAL G C     1 
ATOM   5253  O  O     . VAL G 3  100 ? 156.835 152.325 170.506 1.00 70.01  ? 100 VAL G O     1 
ATOM   5254  C  CB    . VAL G 3  100 ? 159.336 152.257 168.907 1.00 70.01  ? 100 VAL G CB    1 
ATOM   5255  C  CG1   . VAL G 3  100 ? 159.467 150.830 169.326 1.00 70.01  ? 100 VAL G CG1   1 
ATOM   5256  C  CG2   . VAL G 3  100 ? 160.353 152.566 167.824 1.00 70.01  ? 100 VAL G CG2   1 
ATOM   5257  N  N     . THR G 3  101 ? 156.111 150.991 168.846 1.00 69.28  ? 101 THR G N     1 
ATOM   5258  C  CA    . THR G 3  101 ? 155.294 150.178 169.720 1.00 69.28  ? 101 THR G CA    1 
ATOM   5259  C  C     . THR G 3  101 ? 156.168 149.057 170.253 1.00 69.28  ? 101 THR G C     1 
ATOM   5260  O  O     . THR G 3  101 ? 157.049 148.562 169.550 1.00 69.28  ? 101 THR G O     1 
ATOM   5261  C  CB    . THR G 3  101 ? 154.091 149.618 168.959 1.00 69.28  ? 101 THR G CB    1 
ATOM   5262  O  OG1   . THR G 3  101 ? 153.384 150.693 168.330 1.00 69.28  ? 101 THR G OG1   1 
ATOM   5263  C  CG2   . THR G 3  101 ? 153.130 148.908 169.896 1.00 69.28  ? 101 THR G CG2   1 
ATOM   5264  N  N     . ILE G 3  102 ? 155.969 148.695 171.513 1.00 63.70  ? 102 ILE G N     1 
ATOM   5265  C  CA    . ILE G 3  102 ? 156.579 147.507 172.084 1.00 63.70  ? 102 ILE G CA    1 
ATOM   5266  C  C     . ILE G 3  102 ? 155.478 146.571 172.548 1.00 63.70  ? 102 ILE G C     1 
ATOM   5267  O  O     . ILE G 3  102 ? 154.550 146.985 173.250 1.00 63.70  ? 102 ILE G O     1 
ATOM   5268  C  CB    . ILE G 3  102 ? 157.562 147.872 173.203 1.00 63.70  ? 102 ILE G CB    1 
ATOM   5269  C  CG1   . ILE G 3  102 ? 156.954 148.872 174.160 1.00 63.70  ? 102 ILE G CG1   1 
ATOM   5270  C  CG2   . ILE G 3  102 ? 158.780 148.483 172.615 1.00 63.70  ? 102 ILE G CG2   1 
ATOM   5271  C  CD1   . ILE G 3  102 ? 157.824 149.154 175.325 1.00 63.70  ? 102 ILE G CD1   1 
ATOM   5272  N  N     . ALA G 3  103 ? 155.552 145.322 172.100 1.00 68.66  ? 103 ALA G N     1 
ATOM   5273  C  CA    . ALA G 3  103 ? 154.474 144.364 172.280 1.00 68.66  ? 103 ALA G CA    1 
ATOM   5274  C  C     . ALA G 3  103 ? 154.349 143.957 173.735 1.00 68.66  ? 103 ALA G C     1 
ATOM   5275  O  O     . ALA G 3  103 ? 155.329 143.969 174.482 1.00 68.66  ? 103 ALA G O     1 
ATOM   5276  C  CB    . ALA G 3  103 ? 154.722 143.128 171.423 1.00 68.66  ? 103 ALA G CB    1 
ATOM   5277  N  N     . GLN G 3  104 ? 153.124 143.580 174.124 1.00 68.83  ? 104 GLN G N     1 
ATOM   5278  C  CA    . GLN G 3  104 ? 152.735 143.343 175.519 1.00 68.83  ? 104 GLN G CA    1 
ATOM   5279  C  C     . GLN G 3  104 ? 153.103 144.522 176.414 1.00 68.83  ? 104 GLN G C     1 
ATOM   5280  O  O     . GLN G 3  104 ? 153.550 144.355 177.551 1.00 68.83  ? 104 GLN G O     1 
ATOM   5281  C  CB    . GLN G 3  104 ? 153.331 142.044 176.068 1.00 68.83  ? 104 GLN G CB    1 
ATOM   5282  C  CG    . GLN G 3  104 ? 152.691 140.761 175.569 1.00 68.83  ? 104 GLN G CG    1 
ATOM   5283  C  CD    . GLN G 3  104 ? 153.220 140.323 174.225 1.00 68.83  ? 104 GLN G CD    1 
ATOM   5284  O  OE1   . GLN G 3  104 ? 154.226 140.834 173.756 1.00 68.83  ? 104 GLN G OE1   1 
ATOM   5285  N  NE2   . GLN G 3  104 ? 152.559 139.354 173.611 1.00 68.83  ? 104 GLN G NE2   1 
ATOM   5286  N  N     . GLY G 3  105 ? 152.926 145.729 175.895 1.00 72.11  ? 105 GLY G N     1 
ATOM   5287  C  CA    . GLY G 3  105 ? 153.240 146.908 176.665 1.00 72.11  ? 105 GLY G CA    1 
ATOM   5288  C  C     . GLY G 3  105 ? 152.020 147.516 177.314 1.00 72.11  ? 105 GLY G C     1 
ATOM   5289  O  O     . GLY G 3  105 ? 152.051 147.871 178.492 1.00 72.11  ? 105 GLY G O     1 
ATOM   5290  N  N     . GLY G 3  106 ? 150.935 147.632 176.569 1.00 74.37  ? 106 GLY G N     1 
ATOM   5291  C  CA    . GLY G 3  106 ? 149.779 148.325 177.080 1.00 74.37  ? 106 GLY G CA    1 
ATOM   5292  C  C     . GLY G 3  106 ? 149.999 149.827 177.098 1.00 74.37  ? 106 GLY G C     1 
ATOM   5293  O  O     . GLY G 3  106 ? 150.829 150.380 176.372 1.00 74.37  ? 106 GLY G O     1 
ATOM   5294  N  N     . VAL G 3  107 ? 149.233 150.496 177.955 1.00 72.68  ? 107 VAL G N     1 
ATOM   5295  C  CA    . VAL G 3  107 ? 149.206 151.949 178.026 1.00 72.68  ? 107 VAL G CA    1 
ATOM   5296  C  C     . VAL G 3  107 ? 149.564 152.377 179.443 1.00 72.68  ? 107 VAL G C     1 
ATOM   5297  O  O     . VAL G 3  107 ? 149.066 151.802 180.416 1.00 72.68  ? 107 VAL G O     1 
ATOM   5298  C  CB    . VAL G 3  107 ? 147.819 152.499 177.627 1.00 72.68  ? 107 VAL G CB    1 
ATOM   5299  C  CG1   . VAL G 3  107 ? 147.805 154.007 177.636 1.00 72.68  ? 107 VAL G CG1   1 
ATOM   5300  C  CG2   . VAL G 3  107 ? 147.393 151.987 176.269 1.00 72.68  ? 107 VAL G CG2   1 
ATOM   5301  N  N     . LEU G 3  108 ? 150.442 153.367 179.557 1.00 75.01  ? 108 LEU G N     1 
ATOM   5302  C  CA    . LEU G 3  108 ? 150.672 154.018 180.836 1.00 75.01  ? 108 LEU G CA    1 
ATOM   5303  C  C     . LEU G 3  108 ? 149.402 154.747 181.268 1.00 75.01  ? 108 LEU G C     1 
ATOM   5304  O  O     . LEU G 3  108 ? 148.756 155.393 180.437 1.00 75.01  ? 108 LEU G O     1 
ATOM   5305  C  CB    . LEU G 3  108 ? 151.842 154.993 180.716 1.00 75.01  ? 108 LEU G CB    1 
ATOM   5306  C  CG    . LEU G 3  108 ? 152.473 155.637 181.949 1.00 75.01  ? 108 LEU G CG    1 
ATOM   5307  C  CD1   . LEU G 3  108 ? 153.944 155.814 181.679 1.00 75.01  ? 108 LEU G CD1   1 
ATOM   5308  C  CD2   . LEU G 3  108 ? 151.860 156.983 182.288 1.00 75.01  ? 108 LEU G CD2   1 
ATOM   5309  N  N     . PRO G 3  109 ? 149.018 154.683 182.565 1.00 75.76  ? 109 PRO G N     1 
ATOM   5310  C  CA    . PRO G 3  109 ? 147.696 155.181 182.974 1.00 75.76  ? 109 PRO G CA    1 
ATOM   5311  C  C     . PRO G 3  109 ? 147.536 156.687 182.877 1.00 75.76  ? 109 PRO G C     1 
ATOM   5312  O  O     . PRO G 3  109 ? 148.043 157.451 183.700 1.00 75.76  ? 109 PRO G O     1 
ATOM   5313  C  CB    . PRO G 3  109 ? 147.581 154.717 184.430 1.00 75.76  ? 109 PRO G CB    1 
ATOM   5314  C  CG    . PRO G 3  109 ? 148.501 153.585 184.538 1.00 75.76  ? 109 PRO G CG    1 
ATOM   5315  C  CD    . PRO G 3  109 ? 149.655 153.913 183.643 1.00 75.76  ? 109 PRO G CD    1 
ATOM   5316  N  N     . ASN G 3  110 ? 146.807 157.104 181.852 1.00 84.04  ? 110 ASN G N     1 
ATOM   5317  C  CA    . ASN G 3  110 ? 146.476 158.495 181.608 1.00 84.04  ? 110 ASN G CA    1 
ATOM   5318  C  C     . ASN G 3  110 ? 144.964 158.608 181.632 1.00 84.04  ? 110 ASN G C     1 
ATOM   5319  O  O     . ASN G 3  110 ? 144.268 157.794 181.019 1.00 84.04  ? 110 ASN G O     1 
ATOM   5320  C  CB    . ASN G 3  110 ? 147.036 158.956 180.263 1.00 84.04  ? 110 ASN G CB    1 
ATOM   5321  C  CG    . ASN G 3  110 ? 146.959 160.458 180.072 1.00 84.04  ? 110 ASN G CG    1 
ATOM   5322  O  OD1   . ASN G 3  110 ? 146.518 161.189 180.953 1.00 84.04  ? 110 ASN G OD1   1 
ATOM   5323  N  ND2   . ASN G 3  110 ? 147.392 160.922 178.908 1.00 84.04  ? 110 ASN G ND2   1 
ATOM   5324  N  N     . ILE G 3  111 ? 144.458 159.593 182.365 1.00 89.91  ? 111 ILE G N     1 
ATOM   5325  C  CA    . ILE G 3  111 ? 143.030 159.864 182.459 1.00 89.91  ? 111 ILE G CA    1 
ATOM   5326  C  C     . ILE G 3  111 ? 142.847 161.355 182.242 1.00 89.91  ? 111 ILE G C     1 
ATOM   5327  O  O     . ILE G 3  111 ? 143.473 162.164 182.938 1.00 89.91  ? 111 ILE G O     1 
ATOM   5328  C  CB    . ILE G 3  111 ? 142.445 159.440 183.814 1.00 89.91  ? 111 ILE G CB    1 
ATOM   5329  C  CG1   . ILE G 3  111 ? 142.582 157.933 184.026 1.00 89.91  ? 111 ILE G CG1   1 
ATOM   5330  C  CG2   . ILE G 3  111 ? 140.985 159.819 183.898 1.00 89.91  ? 111 ILE G CG2   1 
ATOM   5331  C  CD1   . ILE G 3  111 ? 142.352 157.496 185.447 1.00 89.91  ? 111 ILE G CD1   1 
ATOM   5332  N  N     . GLN G 3  112 ? 142.016 161.722 181.273 1.00 100.16 ? 112 GLN G N     1 
ATOM   5333  C  CA    . GLN G 3  112 ? 141.727 163.125 181.039 1.00 100.16 ? 112 GLN G CA    1 
ATOM   5334  C  C     . GLN G 3  112 ? 140.903 163.702 182.185 1.00 100.16 ? 112 GLN G C     1 
ATOM   5335  O  O     . GLN G 3  112 ? 140.193 162.989 182.899 1.00 100.16 ? 112 GLN G O     1 
ATOM   5336  C  CB    . GLN G 3  112 ? 140.991 163.314 179.719 1.00 100.16 ? 112 GLN G CB    1 
ATOM   5337  C  CG    . GLN G 3  112 ? 141.821 162.963 178.508 1.00 100.16 ? 112 GLN G CG    1 
ATOM   5338  C  CD    . GLN G 3  112 ? 142.985 163.907 178.311 1.00 100.16 ? 112 GLN G CD    1 
ATOM   5339  O  OE1   . GLN G 3  112 ? 142.869 165.113 178.523 1.00 100.16 ? 112 GLN G OE1   1 
ATOM   5340  N  NE2   . GLN G 3  112 ? 144.121 163.361 177.896 1.00 100.16 ? 112 GLN G NE2   1 
ATOM   5341  N  N     . SER G 3  113 ? 141.007 165.019 182.349 1.00 103.69 ? 113 SER G N     1 
ATOM   5342  C  CA    . SER G 3  113 ? 140.490 165.660 183.550 1.00 103.69 ? 113 SER G CA    1 
ATOM   5343  C  C     . SER G 3  113 ? 138.970 165.699 183.570 1.00 103.69 ? 113 SER G C     1 
ATOM   5344  O  O     . SER G 3  113 ? 138.368 165.687 184.648 1.00 103.69 ? 113 SER G O     1 
ATOM   5345  C  CB    . SER G 3  113 ? 141.062 167.071 183.667 1.00 103.69 ? 113 SER G CB    1 
ATOM   5346  O  OG    . SER G 3  113 ? 142.470 167.036 183.842 1.00 103.69 ? 113 SER G OG    1 
ATOM   5347  N  N     . VAL G 3  114 ? 138.329 165.734 182.402 1.00 103.64 ? 114 VAL G N     1 
ATOM   5348  C  CA    . VAL G 3  114 ? 136.872 165.773 182.377 1.00 103.64 ? 114 VAL G CA    1 
ATOM   5349  C  C     . VAL G 3  114 ? 136.256 164.420 182.670 1.00 103.64 ? 114 VAL G C     1 
ATOM   5350  O  O     . VAL G 3  114 ? 135.047 164.344 182.915 1.00 103.64 ? 114 VAL G O     1 
ATOM   5351  C  CB    . VAL G 3  114 ? 136.329 166.273 181.024 1.00 103.64 ? 114 VAL G CB    1 
ATOM   5352  C  CG1   . VAL G 3  114 ? 136.886 167.647 180.703 1.00 103.64 ? 114 VAL G CG1   1 
ATOM   5353  C  CG2   . VAL G 3  114 ? 136.642 165.295 179.926 1.00 103.64 ? 114 VAL G CG2   1 
ATOM   5354  N  N     . LEU G 3  115 ? 137.049 163.347 182.655 1.00 106.12 ? 115 LEU G N     1 
ATOM   5355  C  CA    . LEU G 3  115 ? 136.494 162.029 182.925 1.00 106.12 ? 115 LEU G CA    1 
ATOM   5356  C  C     . LEU G 3  115 ? 136.427 161.741 184.415 1.00 106.12 ? 115 LEU G C     1 
ATOM   5357  O  O     . LEU G 3  115 ? 135.547 160.988 184.848 1.00 106.12 ? 115 LEU G O     1 
ATOM   5358  C  CB    . LEU G 3  115 ? 137.314 160.955 182.217 1.00 106.12 ? 115 LEU G CB    1 
ATOM   5359  C  CG    . LEU G 3  115 ? 137.276 161.004 180.694 1.00 106.12 ? 115 LEU G CG    1 
ATOM   5360  C  CD1   . LEU G 3  115 ? 138.236 159.987 180.129 1.00 106.12 ? 115 LEU G CD1   1 
ATOM   5361  C  CD2   . LEU G 3  115 ? 135.888 160.762 180.169 1.00 106.12 ? 115 LEU G CD2   1 
ATOM   5362  N  N     . LEU G 3  116 ? 137.337 162.324 185.195 1.00 110.81 ? 116 LEU G N     1 
ATOM   5363  C  CA    . LEU G 3  116 ? 137.324 162.147 186.640 1.00 110.81 ? 116 LEU G CA    1 
ATOM   5364  C  C     . LEU G 3  116 ? 136.055 162.759 187.225 1.00 110.81 ? 116 LEU G C     1 
ATOM   5365  O  O     . LEU G 3  116 ? 135.598 163.803 186.742 1.00 110.81 ? 116 LEU G O     1 
ATOM   5366  C  CB    . LEU G 3  116 ? 138.557 162.790 187.273 1.00 110.81 ? 116 LEU G CB    1 
ATOM   5367  C  CG    . LEU G 3  116 ? 139.893 162.115 186.990 1.00 110.81 ? 116 LEU G CG    1 
ATOM   5368  C  CD1   . LEU G 3  116 ? 141.015 162.937 187.589 1.00 110.81 ? 116 LEU G CD1   1 
ATOM   5369  C  CD2   . LEU G 3  116 ? 139.887 160.713 187.559 1.00 110.81 ? 116 LEU G CD2   1 
ATOM   5370  N  N     . PRO G 3  117 ? 135.451 162.130 188.232 1.00 114.21 ? 117 PRO G N     1 
ATOM   5371  C  CA    . PRO G 3  117 ? 134.096 162.508 188.641 1.00 114.21 ? 117 PRO G CA    1 
ATOM   5372  C  C     . PRO G 3  117 ? 134.022 163.878 189.298 1.00 114.21 ? 117 PRO G C     1 
ATOM   5373  O  O     . PRO G 3  117 ? 134.972 164.354 189.922 1.00 114.21 ? 117 PRO G O     1 
ATOM   5374  C  CB    . PRO G 3  117 ? 133.710 161.405 189.631 1.00 114.21 ? 117 PRO G CB    1 
ATOM   5375  C  CG    . PRO G 3  117 ? 134.590 160.264 189.283 1.00 114.21 ? 117 PRO G CG    1 
ATOM   5376  C  CD    . PRO G 3  117 ? 135.879 160.880 188.877 1.00 114.21 ? 117 PRO G CD    1 
ATOM   5377  N  N     . LYS G 3  118 ? 132.866 164.511 189.125 1.00 122.66 ? 118 LYS G N     1 
ATOM   5378  C  CA    . LYS G 3  118 ? 132.621 165.888 189.554 1.00 122.66 ? 118 LYS G CA    1 
ATOM   5379  C  C     . LYS G 3  118 ? 132.013 165.926 190.951 1.00 122.66 ? 118 LYS G C     1 
ATOM   5380  O  O     . LYS G 3  118 ? 130.971 166.535 191.194 1.00 122.66 ? 118 LYS G O     1 
ATOM   5381  C  CB    . LYS G 3  118 ? 131.722 166.591 188.544 1.00 122.66 ? 118 LYS G CB    1 
ATOM   5382  C  CG    . LYS G 3  118 ? 132.430 167.223 187.340 1.00 122.66 ? 118 LYS G CG    1 
ATOM   5383  C  CD    . LYS G 3  118 ? 132.895 166.198 186.309 1.00 122.66 ? 118 LYS G CD    1 
ATOM   5384  C  CE    . LYS G 3  118 ? 131.736 165.470 185.652 1.00 122.66 ? 118 LYS G CE    1 
ATOM   5385  N  NZ    . LYS G 3  118 ? 132.198 164.502 184.612 1.00 122.66 ? 118 LYS G NZ    1 
ATOM   5386  N  N     . LYS G 3  119 ? 132.684 165.271 191.888 1.00 125.01 ? 119 LYS G N     1 
ATOM   5387  C  CA    . LYS G 3  119 ? 132.149 165.065 193.222 1.00 125.01 ? 119 LYS G CA    1 
ATOM   5388  C  C     . LYS G 3  119 ? 132.376 166.307 194.080 1.00 125.01 ? 119 LYS G C     1 
ATOM   5389  O  O     . LYS G 3  119 ? 132.779 167.368 193.601 1.00 125.01 ? 119 LYS G O     1 
ATOM   5390  C  CB    . LYS G 3  119 ? 132.789 163.829 193.845 1.00 125.01 ? 119 LYS G CB    1 
ATOM   5391  C  CG    . LYS G 3  119 ? 132.446 162.531 193.143 1.00 125.01 ? 119 LYS G CG    1 
ATOM   5392  C  CD    . LYS G 3  119 ? 133.100 161.354 193.837 1.00 125.01 ? 119 LYS G CD    1 
ATOM   5393  C  CE    . LYS G 3  119 ? 132.756 160.048 193.153 1.00 125.01 ? 119 LYS G CE    1 
ATOM   5394  N  NZ    . LYS G 3  119 ? 133.408 158.902 193.836 1.00 125.01 ? 119 LYS G NZ    1 
ATOM   5395  N  N     . THR G 3  120 ? 132.107 166.174 195.374 1.00 132.13 ? 120 THR G N     1 
ATOM   5396  C  CA    . THR G 3  120 ? 132.386 167.223 196.344 1.00 132.13 ? 120 THR G CA    1 
ATOM   5397  C  C     . THR G 3  120 ? 133.446 166.736 197.322 1.00 132.13 ? 120 THR G C     1 
ATOM   5398  O  O     . THR G 3  120 ? 133.648 165.532 197.477 1.00 132.13 ? 120 THR G O     1 
ATOM   5399  C  CB    . THR G 3  120 ? 131.123 167.636 197.122 1.00 132.13 ? 120 THR G CB    1 
ATOM   5400  O  OG1   . THR G 3  120 ? 130.599 166.502 197.820 1.00 132.13 ? 120 THR G OG1   1 
ATOM   5401  C  CG2   . THR G 3  120 ? 130.064 168.180 196.180 1.00 132.13 ? 120 THR G CG2   1 
ATOM   5402  N  N     . LYS H 4  24  ? 166.233 115.231 165.052 1.00 30.00  ? 24  LYS H N     1 
ATOM   5403  C  CA    . LYS H 4  24  ? 166.683 114.921 166.436 1.00 30.00  ? 24  LYS H CA    1 
ATOM   5404  C  C     . LYS H 4  24  ? 168.213 114.997 166.499 1.00 30.00  ? 24  LYS H C     1 
ATOM   5405  O  O     . LYS H 4  24  ? 168.733 115.859 167.235 1.00 30.00  ? 24  LYS H O     1 
ATOM   5406  C  CB    . LYS H 4  24  ? 166.184 113.537 166.863 1.00 30.00  ? 24  LYS H CB    1 
ATOM   5407  C  CG    . LYS H 4  24  ? 164.675 113.411 167.028 1.00 30.00  ? 24  LYS H CG    1 
ATOM   5408  C  CD    . LYS H 4  24  ? 164.229 112.021 167.427 1.00 30.00  ? 24  LYS H CD    1 
ATOM   5409  C  CE    . LYS H 4  24  ? 162.732 111.908 167.612 1.00 30.00  ? 24  LYS H CE    1 
ATOM   5410  N  NZ    . LYS H 4  24  ? 162.326 110.529 167.979 1.00 30.00  ? 24  LYS H NZ    1 
ATOM   5411  N  N     . LYS H 4  25  ? 168.897 114.124 165.751 1.00 30.00  ? 25  LYS H N     1 
ATOM   5412  C  CA    . LYS H 4  25  ? 170.385 114.100 165.728 1.00 30.00  ? 25  LYS H CA    1 
ATOM   5413  C  C     . LYS H 4  25  ? 170.880 114.706 164.410 1.00 30.00  ? 25  LYS H C     1 
ATOM   5414  O  O     . LYS H 4  25  ? 171.180 113.932 163.480 1.00 30.00  ? 25  LYS H O     1 
ATOM   5415  C  CB    . LYS H 4  25  ? 170.896 112.665 165.901 1.00 30.00  ? 25  LYS H CB    1 
ATOM   5416  C  CG    . LYS H 4  25  ? 170.793 112.102 167.311 1.00 30.00  ? 25  LYS H CG    1 
ATOM   5417  C  CD    . LYS H 4  25  ? 169.382 111.717 167.702 1.00 30.00  ? 25  LYS H CD    1 
ATOM   5418  C  CE    . LYS H 4  25  ? 169.205 111.546 169.196 1.00 30.00  ? 25  LYS H CE    1 
ATOM   5419  N  NZ    . LYS H 4  25  ? 168.484 110.293 169.523 1.00 30.00  ? 25  LYS H NZ    1 
ATOM   5420  N  N     . ARG H 4  26  ? 170.966 116.039 164.349 1.00 30.00  ? 26  ARG H N     1 
ATOM   5421  C  CA    . ARG H 4  26  ? 171.435 116.748 163.128 1.00 30.00  ? 26  ARG H CA    1 
ATOM   5422  C  C     . ARG H 4  26  ? 171.888 118.162 163.511 1.00 30.00  ? 26  ARG H C     1 
ATOM   5423  O  O     . ARG H 4  26  ? 171.333 118.719 164.478 1.00 30.00  ? 26  ARG H O     1 
ATOM   5424  C  CB    . ARG H 4  26  ? 170.320 116.794 162.078 1.00 30.00  ? 26  ARG H CB    1 
ATOM   5425  C  CG    . ARG H 4  26  ? 170.820 116.919 160.646 1.00 30.00  ? 26  ARG H CG    1 
ATOM   5426  C  CD    . ARG H 4  26  ? 170.392 118.221 159.996 1.00 30.00  ? 26  ARG H CD    1 
ATOM   5427  N  NE    . ARG H 4  26  ? 171.457 118.825 159.209 1.00 30.00  ? 26  ARG H NE    1 
ATOM   5428  C  CZ    . ARG H 4  26  ? 172.447 118.147 158.639 1.00 30.00  ? 26  ARG H CZ    1 
ATOM   5429  N  NH1   . ARG H 4  26  ? 173.194 117.331 159.361 1.00 30.00  ? 26  ARG H NH1   1 
ATOM   5430  N  NH2   . ARG H 4  26  ? 172.687 118.289 157.348 1.00 30.00  ? 26  ARG H NH2   1 
ATOM   5431  N  N     . ARG H 4  27  ? 172.859 118.711 162.773 1.00 30.00  ? 27  ARG H N     1 
ATOM   5432  C  CA    . ARG H 4  27  ? 173.383 120.077 163.046 1.00 30.00  ? 27  ARG H CA    1 
ATOM   5433  C  C     . ARG H 4  27  ? 172.241 121.092 162.909 1.00 30.00  ? 27  ARG H C     1 
ATOM   5434  O  O     . ARG H 4  27  ? 171.436 120.952 161.968 1.00 30.00  ? 27  ARG H O     1 
ATOM   5435  C  CB    . ARG H 4  27  ? 174.536 120.409 162.095 1.00 30.00  ? 27  ARG H CB    1 
ATOM   5436  C  CG    . ARG H 4  27  ? 174.177 120.303 160.620 1.00 30.00  ? 27  ARG H CG    1 
ATOM   5437  C  CD    . ARG H 4  27  ? 175.394 120.401 159.721 1.00 30.00  ? 27  ARG H CD    1 
ATOM   5438  N  NE    . ARG H 4  27  ? 175.688 119.146 159.045 1.00 30.00  ? 27  ARG H NE    1 
ATOM   5439  C  CZ    . ARG H 4  27  ? 176.433 118.172 159.556 1.00 30.00  ? 27  ARG H CZ    1 
ATOM   5440  N  NH1   . ARG H 4  27  ? 176.312 117.846 160.832 1.00 30.00  ? 27  ARG H NH1   1 
ATOM   5441  N  NH2   . ARG H 4  27  ? 177.295 117.527 158.791 1.00 30.00  ? 27  ARG H NH2   1 
ATOM   5442  N  N     . LYS H 4  28  ? 172.188 122.074 163.815 1.00 104.56 ? 28  LYS H N     1 
ATOM   5443  C  CA    . LYS H 4  28  ? 171.125 123.115 163.792 1.00 104.56 ? 28  LYS H CA    1 
ATOM   5444  C  C     . LYS H 4  28  ? 171.537 124.246 162.841 1.00 104.56 ? 28  LYS H C     1 
ATOM   5445  O  O     . LYS H 4  28  ? 171.653 123.986 161.627 1.00 104.56 ? 28  LYS H O     1 
ATOM   5446  C  CB    . LYS H 4  28  ? 170.871 123.652 165.204 1.00 104.56 ? 28  LYS H CB    1 
ATOM   5447  C  CG    . LYS H 4  28  ? 169.815 124.745 165.304 1.00 104.56 ? 28  LYS H CG    1 
ATOM   5448  C  CD    . LYS H 4  28  ? 168.456 124.313 164.799 1.00 104.56 ? 28  LYS H CD    1 
ATOM   5449  C  CE    . LYS H 4  28  ? 167.334 125.220 165.262 1.00 104.56 ? 28  LYS H CE    1 
ATOM   5450  N  NZ    . LYS H 4  28  ? 167.529 126.613 164.797 1.00 104.56 ? 28  LYS H NZ    1 
ATOM   5451  N  N     . THR H 4  29  ? 171.745 125.450 163.384 1.00 106.03 ? 29  THR H N     1 
ATOM   5452  C  CA    . THR H 4  29  ? 172.142 126.630 162.569 1.00 106.03 ? 29  THR H CA    1 
ATOM   5453  C  C     . THR H 4  29  ? 172.676 127.730 163.494 1.00 106.03 ? 29  THR H C     1 
ATOM   5454  O  O     . THR H 4  29  ? 171.851 128.415 164.130 1.00 106.03 ? 29  THR H O     1 
ATOM   5455  C  CB    . THR H 4  29  ? 170.966 127.142 161.728 1.00 106.03 ? 29  THR H CB    1 
ATOM   5456  O  OG1   . THR H 4  29  ? 170.932 126.393 160.512 1.00 106.03 ? 29  THR H OG1   1 
ATOM   5457  C  CG2   . THR H 4  29  ? 171.064 128.619 161.417 1.00 106.03 ? 29  THR H CG2   1 
ATOM   5458  N  N     . ARG H 4  30  ? 174.002 127.884 163.560 1.00 97.22  ? 30  ARG H N     1 
ATOM   5459  C  CA    . ARG H 4  30  ? 174.623 128.920 164.429 1.00 97.22  ? 30  ARG H CA    1 
ATOM   5460  C  C     . ARG H 4  30  ? 173.744 130.176 164.414 1.00 97.22  ? 30  ARG H C     1 
ATOM   5461  O  O     . ARG H 4  30  ? 173.228 130.522 163.333 1.00 97.22  ? 30  ARG H O     1 
ATOM   5462  C  CB    . ARG H 4  30  ? 176.045 129.236 163.953 1.00 97.22  ? 30  ARG H CB    1 
ATOM   5463  C  CG    . ARG H 4  30  ? 176.956 128.020 163.857 1.00 97.22  ? 30  ARG H CG    1 
ATOM   5464  C  CD    . ARG H 4  30  ? 178.425 128.397 163.793 1.00 97.22  ? 30  ARG H CD    1 
ATOM   5465  N  NE    . ARG H 4  30  ? 179.245 127.359 163.184 1.00 97.22  ? 30  ARG H NE    1 
ATOM   5466  C  CZ    . ARG H 4  30  ? 180.573 127.332 163.216 1.00 97.22  ? 30  ARG H CZ    1 
ATOM   5467  N  NH1   . ARG H 4  30  ? 181.268 128.348 162.734 1.00 97.22  ? 30  ARG H NH1   1 
ATOM   5468  N  NH2   . ARG H 4  30  ? 181.202 126.290 163.730 1.00 97.22  ? 30  ARG H NH2   1 
ATOM   5469  N  N     . LYS H 4  31  ? 173.587 130.826 165.572 1.00 87.35  ? 31  LYS H N     1 
ATOM   5470  C  CA    . LYS H 4  31  ? 172.754 132.054 165.679 1.00 87.35  ? 31  LYS H CA    1 
ATOM   5471  C  C     . LYS H 4  31  ? 173.468 133.079 166.567 1.00 87.35  ? 31  LYS H C     1 
ATOM   5472  O  O     . LYS H 4  31  ? 174.421 132.688 167.270 1.00 87.35  ? 31  LYS H O     1 
ATOM   5473  C  CB    . LYS H 4  31  ? 171.370 131.711 166.238 1.00 87.35  ? 31  LYS H CB    1 
ATOM   5474  C  CG    . LYS H 4  31  ? 170.337 131.286 165.203 1.00 87.35  ? 31  LYS H CG    1 
ATOM   5475  C  CD    . LYS H 4  31  ? 170.229 132.248 164.040 1.00 87.35  ? 31  LYS H CD    1 
ATOM   5476  C  CE    . LYS H 4  31  ? 170.665 133.654 164.395 1.00 87.35  ? 31  LYS H CE    1 
ATOM   5477  N  NZ    . LYS H 4  31  ? 170.051 134.116 165.662 1.00 87.35  ? 31  LYS H NZ    1 
ATOM   5478  N  N     . GLU H 4  32  ? 173.017 134.337 166.529 1.00 85.33  ? 32  GLU H N     1 
ATOM   5479  C  CA    . GLU H 4  32  ? 173.629 135.421 167.346 1.00 85.33  ? 32  GLU H CA    1 
ATOM   5480  C  C     . GLU H 4  32  ? 172.550 136.066 168.225 1.00 85.33  ? 32  GLU H C     1 
ATOM   5481  O  O     . GLU H 4  32  ? 171.444 135.499 168.317 1.00 85.33  ? 32  GLU H O     1 
ATOM   5482  C  CB    . GLU H 4  32  ? 174.291 136.463 166.442 1.00 85.33  ? 32  GLU H CB    1 
ATOM   5483  C  CG    . GLU H 4  32  ? 175.205 137.419 167.187 1.00 85.33  ? 32  GLU H CG    1 
ATOM   5484  C  CD    . GLU H 4  32  ? 175.002 137.453 168.693 1.00 85.33  ? 32  GLU H CD    1 
ATOM   5485  O  OE1   . GLU H 4  32  ? 174.051 138.121 169.144 1.00 85.33  ? 32  GLU H OE1   1 
ATOM   5486  O  OE2   . GLU H 4  32  ? 175.796 136.810 169.408 1.00 85.33  ? 32  GLU H OE2   1 
ATOM   5487  N  N     . SER H 4  33  ? 172.874 137.209 168.838 1.00 71.84  ? 33  SER H N     1 
ATOM   5488  C  CA    . SER H 4  33  ? 171.941 137.921 169.709 1.00 71.84  ? 33  SER H CA    1 
ATOM   5489  C  C     . SER H 4  33  ? 172.684 139.062 170.389 1.00 71.84  ? 33  SER H C     1 
ATOM   5490  O  O     . SER H 4  33  ? 173.761 139.472 169.948 1.00 71.84  ? 33  SER H O     1 
ATOM   5491  C  CB    . SER H 4  33  ? 171.307 136.962 170.727 1.00 71.84  ? 33  SER H CB    1 
ATOM   5492  O  OG    . SER H 4  33  ? 170.492 137.681 171.631 1.00 71.84  ? 33  SER H OG    1 
ATOM   5493  N  N     . TYR H 4  34  ? 172.088 139.594 171.452 1.00 64.47  ? 34  TYR H N     1 
ATOM   5494  C  CA    . TYR H 4  34  ? 172.770 140.462 172.399 1.00 64.47  ? 34  TYR H CA    1 
ATOM   5495  C  C     . TYR H 4  34  ? 172.506 140.036 173.830 1.00 64.47  ? 34  TYR H C     1 
ATOM   5496  O  O     . TYR H 4  34  ? 172.955 140.724 174.752 1.00 64.47  ? 34  TYR H O     1 
ATOM   5497  C  CB    . TYR H 4  34  ? 172.332 141.919 172.243 1.00 64.47  ? 34  TYR H CB    1 
ATOM   5498  C  CG    . TYR H 4  34  ? 172.879 142.628 171.046 1.00 64.47  ? 34  TYR H CG    1 
ATOM   5499  C  CD1   . TYR H 4  34  ? 174.126 143.229 171.086 1.00 64.47  ? 34  TYR H CD1   1 
ATOM   5500  C  CD2   . TYR H 4  34  ? 172.148 142.704 169.878 1.00 64.47  ? 34  TYR H CD2   1 
ATOM   5501  C  CE1   . TYR H 4  34  ? 174.626 143.889 169.992 1.00 64.47  ? 34  TYR H CE1   1 
ATOM   5502  C  CE2   . TYR H 4  34  ? 172.640 143.355 168.776 1.00 64.47  ? 34  TYR H CE2   1 
ATOM   5503  C  CZ    . TYR H 4  34  ? 173.876 143.945 168.839 1.00 64.47  ? 34  TYR H CZ    1 
ATOM   5504  O  OH    . TYR H 4  34  ? 174.355 144.595 167.731 1.00 64.47  ? 34  TYR H OH    1 
ATOM   5505  N  N     . ALA H 4  35  ? 171.812 138.911 174.027 1.00 66.81  ? 35  ALA H N     1 
ATOM   5506  C  CA    . ALA H 4  35  ? 171.070 138.671 175.260 1.00 66.81  ? 35  ALA H CA    1 
ATOM   5507  C  C     . ALA H 4  35  ? 171.975 138.504 176.468 1.00 66.81  ? 35  ALA H C     1 
ATOM   5508  O  O     . ALA H 4  35  ? 171.623 138.954 177.565 1.00 66.81  ? 35  ALA H O     1 
ATOM   5509  C  CB    . ALA H 4  35  ? 170.186 137.441 175.095 1.00 66.81  ? 35  ALA H CB    1 
ATOM   5510  N  N     . ILE H 4  36  ? 173.152 137.902 176.287 1.00 71.18  ? 36  ILE H N     1 
ATOM   5511  C  CA    . ILE H 4  36  ? 174.051 137.764 177.421 1.00 71.18  ? 36  ILE H CA    1 
ATOM   5512  C  C     . ILE H 4  36  ? 174.681 139.096 177.775 1.00 71.18  ? 36  ILE H C     1 
ATOM   5513  O  O     . ILE H 4  36  ? 175.055 139.311 178.932 1.00 71.18  ? 36  ILE H O     1 
ATOM   5514  C  CB    . ILE H 4  36  ? 175.138 136.706 177.172 1.00 71.18  ? 36  ILE H CB    1 
ATOM   5515  C  CG1   . ILE H 4  36  ? 176.050 137.126 176.038 1.00 71.18  ? 36  ILE H CG1   1 
ATOM   5516  C  CG2   . ILE H 4  36  ? 174.521 135.375 176.832 1.00 71.18  ? 36  ILE H CG2   1 
ATOM   5517  C  CD1   . ILE H 4  36  ? 177.305 136.333 176.015 1.00 71.18  ? 36  ILE H CD1   1 
ATOM   5518  N  N     . TYR H 4  37  ? 174.764 140.026 176.825 1.00 70.66  ? 37  TYR H N     1 
ATOM   5519  C  CA    . TYR H 4  37  ? 175.326 141.324 177.149 1.00 70.66  ? 37  TYR H CA    1 
ATOM   5520  C  C     . TYR H 4  37  ? 174.328 142.165 177.926 1.00 70.66  ? 37  TYR H C     1 
ATOM   5521  O  O     . TYR H 4  37  ? 174.698 142.812 178.915 1.00 70.66  ? 37  TYR H O     1 
ATOM   5522  C  CB    . TYR H 4  37  ? 175.755 142.042 175.878 1.00 70.66  ? 37  TYR H CB    1 
ATOM   5523  C  CG    . TYR H 4  37  ? 176.764 141.274 175.076 1.00 70.66  ? 37  TYR H CG    1 
ATOM   5524  C  CD1   . TYR H 4  37  ? 178.080 141.187 175.479 1.00 70.66  ? 37  TYR H CD1   1 
ATOM   5525  C  CD2   . TYR H 4  37  ? 176.401 140.656 173.900 1.00 70.66  ? 37  TYR H CD2   1 
ATOM   5526  C  CE1   . TYR H 4  37  ? 179.003 140.484 174.739 1.00 70.66  ? 37  TYR H CE1   1 
ATOM   5527  C  CE2   . TYR H 4  37  ? 177.316 139.962 173.152 1.00 70.66  ? 37  TYR H CE2   1 
ATOM   5528  C  CZ    . TYR H 4  37  ? 178.612 139.879 173.575 1.00 70.66  ? 37  TYR H CZ    1 
ATOM   5529  O  OH    . TYR H 4  37  ? 179.531 139.191 172.836 1.00 70.66  ? 37  TYR H OH    1 
ATOM   5530  N  N     . VAL H 4  38  ? 173.062 142.148 177.498 1.00 73.69  ? 38  VAL H N     1 
ATOM   5531  C  CA    . VAL H 4  38  ? 171.990 142.816 178.231 1.00 73.69  ? 38  VAL H CA    1 
ATOM   5532  C  C     . VAL H 4  38  ? 171.860 142.219 179.620 1.00 73.69  ? 38  VAL H C     1 
ATOM   5533  O  O     . VAL H 4  38  ? 171.632 142.936 180.607 1.00 73.69  ? 38  VAL H O     1 
ATOM   5534  C  CB    . VAL H 4  38  ? 170.672 142.721 177.439 1.00 73.69  ? 38  VAL H CB    1 
ATOM   5535  C  CG1   . VAL H 4  38  ? 169.518 143.345 178.194 1.00 73.69  ? 38  VAL H CG1   1 
ATOM   5536  C  CG2   . VAL H 4  38  ? 170.832 143.397 176.111 1.00 73.69  ? 38  VAL H CG2   1 
ATOM   5537  N  N     . TYR H 4  39  ? 172.064 140.904 179.730 1.00 76.72  ? 39  TYR H N     1 
ATOM   5538  C  CA    . TYR H 4  39  ? 172.092 140.287 181.044 1.00 76.72  ? 39  TYR H CA    1 
ATOM   5539  C  C     . TYR H 4  39  ? 173.274 140.786 181.865 1.00 76.72  ? 39  TYR H C     1 
ATOM   5540  O  O     . TYR H 4  39  ? 173.145 140.965 183.080 1.00 76.72  ? 39  TYR H O     1 
ATOM   5541  C  CB    . TYR H 4  39  ? 172.132 138.768 180.909 1.00 76.72  ? 39  TYR H CB    1 
ATOM   5542  C  CG    . TYR H 4  39  ? 171.947 138.055 182.219 1.00 76.72  ? 39  TYR H CG    1 
ATOM   5543  C  CD1   . TYR H 4  39  ? 170.683 137.888 182.760 1.00 76.72  ? 39  TYR H CD1   1 
ATOM   5544  C  CD2   . TYR H 4  39  ? 173.039 137.576 182.930 1.00 76.72  ? 39  TYR H CD2   1 
ATOM   5545  C  CE1   . TYR H 4  39  ? 170.508 137.248 183.966 1.00 76.72  ? 39  TYR H CE1   1 
ATOM   5546  C  CE2   . TYR H 4  39  ? 172.875 136.940 184.139 1.00 76.72  ? 39  TYR H CE2   1 
ATOM   5547  C  CZ    . TYR H 4  39  ? 171.607 136.777 184.653 1.00 76.72  ? 39  TYR H CZ    1 
ATOM   5548  O  OH    . TYR H 4  39  ? 171.435 136.138 185.858 1.00 76.72  ? 39  TYR H OH    1 
ATOM   5549  N  N     . LYS H 4  40  ? 174.413 141.059 181.221 1.00 76.03  ? 40  LYS H N     1 
ATOM   5550  C  CA    . LYS H 4  40  ? 175.568 141.550 181.967 1.00 76.03  ? 40  LYS H CA    1 
ATOM   5551  C  C     . LYS H 4  40  ? 175.366 142.974 182.461 1.00 76.03  ? 40  LYS H C     1 
ATOM   5552  O  O     . LYS H 4  40  ? 175.772 143.306 183.584 1.00 76.03  ? 40  LYS H O     1 
ATOM   5553  C  CB    . LYS H 4  40  ? 176.836 141.458 181.125 1.00 76.03  ? 40  LYS H CB    1 
ATOM   5554  C  CG    . LYS H 4  40  ? 177.425 140.064 181.044 1.00 76.03  ? 40  LYS H CG    1 
ATOM   5555  C  CD    . LYS H 4  40  ? 178.729 140.085 180.280 1.00 76.03  ? 40  LYS H CD    1 
ATOM   5556  C  CE    . LYS H 4  40  ? 179.353 138.710 180.219 1.00 76.03  ? 40  LYS H CE    1 
ATOM   5557  N  NZ    . LYS H 4  40  ? 180.648 138.748 179.499 1.00 76.03  ? 40  LYS H NZ    1 
ATOM   5558  N  N     . VAL H 4  41  ? 174.742 143.833 181.652 1.00 80.32  ? 41  VAL H N     1 
ATOM   5559  C  CA    . VAL H 4  41  ? 174.488 145.190 182.124 1.00 80.32  ? 41  VAL H CA    1 
ATOM   5560  C  C     . VAL H 4  41  ? 173.417 145.167 183.204 1.00 80.32  ? 41  VAL H C     1 
ATOM   5561  O  O     . VAL H 4  41  ? 173.439 145.986 184.135 1.00 80.32  ? 41  VAL H O     1 
ATOM   5562  C  CB    . VAL H 4  41  ? 174.103 146.100 180.946 1.00 80.32  ? 41  VAL H CB    1 
ATOM   5563  C  CG1   . VAL H 4  41  ? 174.003 147.551 181.378 1.00 80.32  ? 41  VAL H CG1   1 
ATOM   5564  C  CG2   . VAL H 4  41  ? 175.105 145.965 179.846 1.00 80.32  ? 41  VAL H CG2   1 
ATOM   5565  N  N     . LEU H 4  42  ? 172.499 144.198 183.131 1.00 86.00  ? 42  LEU H N     1 
ATOM   5566  C  CA    . LEU H 4  42  ? 171.554 143.995 184.224 1.00 86.00  ? 42  LEU H CA    1 
ATOM   5567  C  C     . LEU H 4  42  ? 172.273 143.584 185.501 1.00 86.00  ? 42  LEU H C     1 
ATOM   5568  O  O     . LEU H 4  42  ? 171.898 144.017 186.596 1.00 86.00  ? 42  LEU H O     1 
ATOM   5569  C  CB    . LEU H 4  42  ? 170.522 142.942 183.837 1.00 86.00  ? 42  LEU H CB    1 
ATOM   5570  C  CG    . LEU H 4  42  ? 169.410 142.766 184.866 1.00 86.00  ? 42  LEU H CG    1 
ATOM   5571  C  CD1   . LEU H 4  42  ? 168.637 144.055 184.992 1.00 86.00  ? 42  LEU H CD1   1 
ATOM   5572  C  CD2   . LEU H 4  42  ? 168.490 141.628 184.503 1.00 86.00  ? 42  LEU H CD2   1 
ATOM   5573  N  N     . LYS H 4  43  ? 173.330 142.778 185.377 1.00 87.30  ? 43  LYS H N     1 
ATOM   5574  C  CA    . LYS H 4  43  ? 174.150 142.474 186.545 1.00 87.30  ? 43  LYS H CA    1 
ATOM   5575  C  C     . LYS H 4  43  ? 174.910 143.697 187.037 1.00 87.30  ? 43  LYS H C     1 
ATOM   5576  O  O     . LYS H 4  43  ? 175.219 143.787 188.229 1.00 87.30  ? 43  LYS H O     1 
ATOM   5577  C  CB    . LYS H 4  43  ? 175.125 141.340 186.238 1.00 87.30  ? 43  LYS H CB    1 
ATOM   5578  C  CG    . LYS H 4  43  ? 174.497 139.993 185.872 1.00 87.30  ? 43  LYS H CG    1 
ATOM   5579  C  CD    . LYS H 4  43  ? 173.879 139.250 187.057 1.00 87.30  ? 43  LYS H CD    1 
ATOM   5580  C  CE    . LYS H 4  43  ? 172.359 139.352 187.097 1.00 87.30  ? 43  LYS H CE    1 
ATOM   5581  N  NZ    . LYS H 4  43  ? 171.778 138.522 188.186 1.00 87.30  ? 43  LYS H NZ    1 
ATOM   5582  N  N     . GLN H 4  44  ? 175.209 144.653 186.158 1.00 85.87  ? 44  GLN H N     1 
ATOM   5583  C  CA    . GLN H 4  44  ? 175.895 145.846 186.640 1.00 85.87  ? 44  GLN H CA    1 
ATOM   5584  C  C     . GLN H 4  44  ? 174.962 146.807 187.366 1.00 85.87  ? 44  GLN H C     1 
ATOM   5585  O  O     . GLN H 4  44  ? 175.359 147.408 188.368 1.00 85.87  ? 44  GLN H O     1 
ATOM   5586  C  CB    . GLN H 4  44  ? 176.590 146.576 185.500 1.00 85.87  ? 44  GLN H CB    1 
ATOM   5587  C  CG    . GLN H 4  44  ? 177.822 145.880 184.986 1.00 85.87  ? 44  GLN H CG    1 
ATOM   5588  C  CD    . GLN H 4  44  ? 178.598 146.742 184.016 1.00 85.87  ? 44  GLN H CD    1 
ATOM   5589  O  OE1   . GLN H 4  44  ? 178.176 147.845 183.678 1.00 85.87  ? 44  GLN H OE1   1 
ATOM   5590  N  NE2   . GLN H 4  44  ? 179.746 146.251 183.578 1.00 85.87  ? 44  GLN H NE2   1 
ATOM   5591  N  N     . VAL H 4  45  ? 173.729 146.979 186.888 1.00 90.60  ? 45  VAL H N     1 
ATOM   5592  C  CA    . VAL H 4  45  ? 172.884 148.054 187.415 1.00 90.60  ? 45  VAL H CA    1 
ATOM   5593  C  C     . VAL H 4  45  ? 172.161 147.615 188.684 1.00 90.60  ? 45  VAL H C     1 
ATOM   5594  O  O     . VAL H 4  45  ? 172.357 148.189 189.760 1.00 90.60  ? 45  VAL H O     1 
ATOM   5595  C  CB    . VAL H 4  45  ? 171.887 148.530 186.350 1.00 90.60  ? 45  VAL H CB    1 
ATOM   5596  C  CG1   . VAL H 4  45  ? 170.970 149.565 186.947 1.00 90.60  ? 45  VAL H CG1   1 
ATOM   5597  C  CG2   . VAL H 4  45  ? 172.621 149.111 185.178 1.00 90.60  ? 45  VAL H CG2   1 
ATOM   5598  N  N     . HIS H 4  46  ? 171.295 146.610 188.570 1.00 94.50  ? 46  HIS H N     1 
ATOM   5599  C  CA    . HIS H 4  46  ? 170.615 146.013 189.716 1.00 94.50  ? 46  HIS H CA    1 
ATOM   5600  C  C     . HIS H 4  46  ? 171.035 144.553 189.750 1.00 94.50  ? 46  HIS H C     1 
ATOM   5601  O  O     . HIS H 4  46  ? 170.424 143.715 189.071 1.00 94.50  ? 46  HIS H O     1 
ATOM   5602  C  CB    . HIS H 4  46  ? 169.102 146.152 189.612 1.00 94.50  ? 46  HIS H CB    1 
ATOM   5603  C  CG    . HIS H 4  46  ? 168.615 147.562 189.709 1.00 94.50  ? 46  HIS H CG    1 
ATOM   5604  N  ND1   . HIS H 4  46  ? 168.579 148.256 190.900 1.00 94.50  ? 46  HIS H ND1   1 
ATOM   5605  C  CD2   . HIS H 4  46  ? 168.124 148.404 188.769 1.00 94.50  ? 46  HIS H CD2   1 
ATOM   5606  C  CE1   . HIS H 4  46  ? 168.095 149.468 190.688 1.00 94.50  ? 46  HIS H CE1   1 
ATOM   5607  N  NE2   . HIS H 4  46  ? 167.812 149.581 189.402 1.00 94.50  ? 46  HIS H NE2   1 
ATOM   5608  N  N     . PRO H 4  47  ? 172.068 144.210 190.525 1.00 94.03  ? 47  PRO H N     1 
ATOM   5609  C  CA    . PRO H 4  47  ? 172.720 142.902 190.358 1.00 94.03  ? 47  PRO H CA    1 
ATOM   5610  C  C     . PRO H 4  47  ? 171.873 141.721 190.783 1.00 94.03  ? 47  PRO H C     1 
ATOM   5611  O  O     . PRO H 4  47  ? 172.088 140.615 190.278 1.00 94.03  ? 47  PRO H O     1 
ATOM   5612  C  CB    . PRO H 4  47  ? 173.968 143.022 191.243 1.00 94.03  ? 47  PRO H CB    1 
ATOM   5613  C  CG    . PRO H 4  47  ? 174.181 144.491 191.411 1.00 94.03  ? 47  PRO H CG    1 
ATOM   5614  C  CD    . PRO H 4  47  ? 172.809 145.080 191.448 1.00 94.03  ? 47  PRO H CD    1 
ATOM   5615  N  N     . ASP H 4  48  ? 170.916 141.914 191.681 1.00 94.98  ? 48  ASP H N     1 
ATOM   5616  C  CA    . ASP H 4  48  ? 170.067 140.824 192.149 1.00 94.98  ? 48  ASP H CA    1 
ATOM   5617  C  C     . ASP H 4  48  ? 168.639 141.165 191.751 1.00 94.98  ? 48  ASP H C     1 
ATOM   5618  O  O     . ASP H 4  48  ? 167.857 141.664 192.564 1.00 94.98  ? 48  ASP H O     1 
ATOM   5619  C  CB    . ASP H 4  48  ? 170.219 140.680 193.615 1.00 94.98  ? 48  ASP H CB    1 
ATOM   5620  C  CG    . ASP H 4  48  ? 171.649 140.415 194.014 1.00 94.98  ? 48  ASP H CG    1 
ATOM   5621  O  OD1   . ASP H 4  48  ? 172.386 139.805 193.215 1.00 94.98  ? 48  ASP H OD1   1 
ATOM   5622  O  OD2   . ASP H 4  48  ? 172.045 140.841 195.117 1.00 94.98  ? 48  ASP H OD2   1 
ATOM   5623  N  N     . THR H 4  49  ? 168.299 140.876 190.497 1.00 91.02  ? 49  THR H N     1 
ATOM   5624  C  CA    . THR H 4  49  ? 167.027 141.214 189.873 1.00 91.02  ? 49  THR H CA    1 
ATOM   5625  C  C     . THR H 4  49  ? 166.959 140.455 188.556 1.00 91.02  ? 49  THR H C     1 
ATOM   5626  O  O     . THR H 4  49  ? 167.940 140.424 187.813 1.00 91.02  ? 49  THR H O     1 
ATOM   5627  C  CB    . THR H 4  49  ? 166.889 142.731 189.622 1.00 91.02  ? 49  THR H CB    1 
ATOM   5628  O  OG1   . THR H 4  49  ? 166.900 143.451 190.862 1.00 91.02  ? 49  THR H OG1   1 
ATOM   5629  C  CG2   . THR H 4  49  ? 165.599 143.063 188.898 1.00 91.02  ? 49  THR H CG2   1 
ATOM   5630  N  N     . GLY H 4  50  ? 165.810 139.839 188.275 1.00 85.64  ? 50  GLY H N     1 
ATOM   5631  C  CA    . GLY H 4  50  ? 165.655 139.044 187.079 1.00 85.64  ? 50  GLY H CA    1 
ATOM   5632  C  C     . GLY H 4  50  ? 165.112 139.824 185.891 1.00 85.64  ? 50  GLY H C     1 
ATOM   5633  O  O     . GLY H 4  50  ? 164.865 141.025 185.950 1.00 85.64  ? 50  GLY H O     1 
ATOM   5634  N  N     . ILE H 4  51  ? 164.929 139.100 184.790 1.00 78.30  ? 51  ILE H N     1 
ATOM   5635  C  CA    . ILE H 4  51  ? 164.361 139.649 183.565 1.00 78.30  ? 51  ILE H CA    1 
ATOM   5636  C  C     . ILE H 4  51  ? 163.657 138.517 182.828 1.00 78.30  ? 51  ILE H C     1 
ATOM   5637  O  O     . ILE H 4  51  ? 164.091 137.365 182.881 1.00 78.30  ? 51  ILE H O     1 
ATOM   5638  C  CB    . ILE H 4  51  ? 165.448 140.337 182.706 1.00 78.30  ? 51  ILE H CB    1 
ATOM   5639  C  CG1   . ILE H 4  51  ? 164.840 141.044 181.498 1.00 78.30  ? 51  ILE H CG1   1 
ATOM   5640  C  CG2   . ILE H 4  51  ? 166.536 139.367 182.288 1.00 78.30  ? 51  ILE H CG2   1 
ATOM   5641  C  CD1   . ILE H 4  51  ? 165.803 141.925 180.766 1.00 78.30  ? 51  ILE H CD1   1 
ATOM   5642  N  N     . SER H 4  52  ? 162.534 138.824 182.191 1.00 74.71  ? 52  SER H N     1 
ATOM   5643  C  CA    . SER H 4  52  ? 161.785 137.798 181.488 1.00 74.71  ? 52  SER H CA    1 
ATOM   5644  C  C     . SER H 4  52  ? 162.262 137.684 180.042 1.00 74.71  ? 52  SER H C     1 
ATOM   5645  O  O     . SER H 4  52  ? 163.026 138.510 179.548 1.00 74.71  ? 52  SER H O     1 
ATOM   5646  C  CB    . SER H 4  52  ? 160.300 138.107 181.544 1.00 74.71  ? 52  SER H CB    1 
ATOM   5647  O  OG    . SER H 4  52  ? 160.052 139.324 180.876 1.00 74.71  ? 52  SER H OG    1 
ATOM   5648  N  N     . SER H 4  53  ? 161.789 136.639 179.359 1.00 74.76  ? 53  SER H N     1 
ATOM   5649  C  CA    . SER H 4  53  ? 162.357 136.272 178.064 1.00 74.76  ? 53  SER H CA    1 
ATOM   5650  C  C     . SER H 4  53  ? 161.894 137.192 176.943 1.00 74.76  ? 53  SER H C     1 
ATOM   5651  O  O     . SER H 4  53  ? 162.705 137.604 176.101 1.00 74.76  ? 53  SER H O     1 
ATOM   5652  C  CB    . SER H 4  53  ? 161.999 134.828 177.723 1.00 74.76  ? 53  SER H CB    1 
ATOM   5653  O  OG    . SER H 4  53  ? 162.497 134.477 176.448 1.00 74.76  ? 53  SER H OG    1 
ATOM   5654  N  N     . LYS H 4  54  ? 160.599 137.510 176.903 1.00 67.40  ? 54  LYS H N     1 
ATOM   5655  C  CA    . LYS H 4  54  ? 160.122 138.411 175.863 1.00 67.40  ? 54  LYS H CA    1 
ATOM   5656  C  C     . LYS H 4  54  ? 160.644 139.820 176.068 1.00 67.40  ? 54  LYS H C     1 
ATOM   5657  O  O     . LYS H 4  54  ? 160.841 140.542 175.090 1.00 67.40  ? 54  LYS H O     1 
ATOM   5658  C  CB    . LYS H 4  54  ? 158.601 138.415 175.797 1.00 67.40  ? 54  LYS H CB    1 
ATOM   5659  C  CG    . LYS H 4  54  ? 158.030 137.148 175.213 1.00 67.40  ? 54  LYS H CG    1 
ATOM   5660  C  CD    . LYS H 4  54  ? 156.523 137.218 175.112 1.00 67.40  ? 54  LYS H CD    1 
ATOM   5661  C  CE    . LYS H 4  54  ? 156.101 138.148 173.993 1.00 67.40  ? 54  LYS H CE    1 
ATOM   5662  N  NZ    . LYS H 4  54  ? 156.440 137.613 172.648 1.00 67.40  ? 54  LYS H NZ    1 
ATOM   5663  N  N     . ALA H 4  55  ? 160.916 140.207 177.311 1.00 71.18  ? 55  ALA H N     1 
ATOM   5664  C  CA    . ALA H 4  55  ? 161.574 141.485 177.547 1.00 71.18  ? 55  ALA H CA    1 
ATOM   5665  C  C     . ALA H 4  55  ? 162.997 141.470 177.030 1.00 71.18  ? 55  ALA H C     1 
ATOM   5666  O  O     . ALA H 4  55  ? 163.494 142.493 176.543 1.00 71.18  ? 55  ALA H O     1 
ATOM   5667  C  CB    . ALA H 4  55  ? 161.557 141.815 179.032 1.00 71.18  ? 55  ALA H CB    1 
ATOM   5668  N  N     . MET H 4  56  ? 163.658 140.321 177.121 1.00 75.88  ? 56  MET H N     1 
ATOM   5669  C  CA    . MET H 4  56  ? 164.988 140.179 176.552 1.00 75.88  ? 56  MET H CA    1 
ATOM   5670  C  C     . MET H 4  56  ? 164.948 140.306 175.037 1.00 75.88  ? 56  MET H C     1 
ATOM   5671  O  O     . MET H 4  56  ? 165.832 140.934 174.437 1.00 75.88  ? 56  MET H O     1 
ATOM   5672  C  CB    . MET H 4  56  ? 165.582 138.843 176.976 1.00 75.88  ? 56  MET H CB    1 
ATOM   5673  C  CG    . MET H 4  56  ? 166.973 138.653 176.497 1.00 75.88  ? 56  MET H CG    1 
ATOM   5674  S  SD    . MET H 4  56  ? 168.000 139.986 177.113 1.00 75.88  ? 56  MET H SD    1 
ATOM   5675  C  CE    . MET H 4  56  ? 168.049 139.566 178.847 1.00 75.88  ? 56  MET H CE    1 
ATOM   5676  N  N     . SER H 4  57  ? 163.908 139.765 174.401 1.00 65.23  ? 57  SER H N     1 
ATOM   5677  C  CA    . SER H 4  57  ? 163.800 139.964 172.962 1.00 65.23  ? 57  SER H CA    1 
ATOM   5678  C  C     . SER H 4  57  ? 163.397 141.398 172.612 1.00 65.23  ? 57  SER H C     1 
ATOM   5679  O  O     . SER H 4  57  ? 163.747 141.881 171.521 1.00 65.23  ? 57  SER H O     1 
ATOM   5680  C  CB    . SER H 4  57  ? 162.822 138.968 172.357 1.00 65.23  ? 57  SER H CB    1 
ATOM   5681  O  OG    . SER H 4  57  ? 162.741 139.162 170.963 1.00 65.23  ? 57  SER H OG    1 
ATOM   5682  N  N     . ILE H 4  58  ? 162.693 142.092 173.516 1.00 62.23  ? 58  ILE H N     1 
ATOM   5683  C  CA    . ILE H 4  58  ? 162.431 143.519 173.323 1.00 62.23  ? 58  ILE H CA    1 
ATOM   5684  C  C     . ILE H 4  58  ? 163.734 144.292 173.296 1.00 62.23  ? 58  ILE H C     1 
ATOM   5685  O  O     . ILE H 4  58  ? 163.983 145.073 172.372 1.00 62.23  ? 58  ILE H O     1 
ATOM   5686  C  CB    . ILE H 4  58  ? 161.490 144.066 174.412 1.00 62.23  ? 58  ILE H CB    1 
ATOM   5687  C  CG1   . ILE H 4  58  ? 160.060 143.562 174.244 1.00 62.23  ? 58  ILE H CG1   1 
ATOM   5688  C  CG2   . ILE H 4  58  ? 161.491 145.582 174.409 1.00 62.23  ? 58  ILE H CG2   1 
ATOM   5689  C  CD1   . ILE H 4  58  ? 159.328 144.147 173.070 1.00 62.23  ? 58  ILE H CD1   1 
ATOM   5690  N  N     . MET H 4  59  ? 164.595 144.065 174.293 1.00 66.25  ? 59  MET H N     1 
ATOM   5691  C  CA    . MET H 4  59  ? 165.864 144.783 174.336 1.00 66.25  ? 59  MET H CA    1 
ATOM   5692  C  C     . MET H 4  59  ? 166.761 144.417 173.173 1.00 66.25  ? 59  MET H C     1 
ATOM   5693  O  O     . MET H 4  59  ? 167.514 145.270 172.691 1.00 66.25  ? 59  MET H O     1 
ATOM   5694  C  CB    . MET H 4  59  ? 166.610 144.528 175.639 1.00 66.25  ? 59  MET H CB    1 
ATOM   5695  C  CG    . MET H 4  59  ? 166.027 145.210 176.839 1.00 66.25  ? 59  MET H CG    1 
ATOM   5696  S  SD    . MET H 4  59  ? 165.813 146.970 176.543 1.00 66.25  ? 59  MET H SD    1 
ATOM   5697  C  CE    . MET H 4  59  ? 167.488 147.507 176.216 1.00 66.25  ? 59  MET H CE    1 
ATOM   5698  N  N     . ASN H 4  60  ? 166.683 143.167 172.707 1.00 64.38  ? 60  ASN H N     1 
ATOM   5699  C  CA    . ASN H 4  60  ? 167.447 142.756 171.535 1.00 64.38  ? 60  ASN H CA    1 
ATOM   5700  C  C     . ASN H 4  60  ? 167.036 143.557 170.306 1.00 64.38  ? 60  ASN H C     1 
ATOM   5701  O  O     . ASN H 4  60  ? 167.885 144.143 169.617 1.00 64.38  ? 60  ASN H O     1 
ATOM   5702  C  CB    . ASN H 4  60  ? 167.244 141.268 171.295 1.00 64.38  ? 60  ASN H CB    1 
ATOM   5703  C  CG    . ASN H 4  60  ? 168.251 140.694 170.339 1.00 64.38  ? 60  ASN H CG    1 
ATOM   5704  O  OD1   . ASN H 4  60  ? 169.151 141.388 169.882 1.00 64.38  ? 60  ASN H OD1   1 
ATOM   5705  N  ND2   . ASN H 4  60  ? 168.101 139.413 170.022 1.00 64.38  ? 60  ASN H ND2   1 
ATOM   5706  N  N     . SER H 4  61  ? 165.729 143.628 170.042 1.00 59.76  ? 61  SER H N     1 
ATOM   5707  C  CA    . SER H 4  61  ? 165.273 144.416 168.902 1.00 59.76  ? 61  SER H CA    1 
ATOM   5708  C  C     . SER H 4  61  ? 165.474 145.909 169.102 1.00 59.76  ? 61  SER H C     1 
ATOM   5709  O  O     . SER H 4  61  ? 165.584 146.641 168.113 1.00 59.76  ? 61  SER H O     1 
ATOM   5710  C  CB    . SER H 4  61  ? 163.806 144.129 168.618 1.00 59.76  ? 61  SER H CB    1 
ATOM   5711  O  OG    . SER H 4  61  ? 163.631 142.795 168.179 1.00 59.76  ? 61  SER H OG    1 
ATOM   5712  N  N     . PHE H 4  62  ? 165.553 146.367 170.347 1.00 58.77  ? 62  PHE H N     1 
ATOM   5713  C  CA    . PHE H 4  62  ? 165.866 147.768 170.610 1.00 58.77  ? 62  PHE H CA    1 
ATOM   5714  C  C     . PHE H 4  62  ? 167.289 148.093 170.205 1.00 58.77  ? 62  PHE H C     1 
ATOM   5715  O  O     . PHE H 4  62  ? 167.549 149.122 169.563 1.00 58.77  ? 62  PHE H O     1 
ATOM   5716  C  CB    . PHE H 4  62  ? 165.663 148.082 172.086 1.00 58.77  ? 62  PHE H CB    1 
ATOM   5717  C  CG    . PHE H 4  62  ? 166.133 149.438 172.467 1.00 58.77  ? 62  PHE H CG    1 
ATOM   5718  C  CD1   . PHE H 4  62  ? 165.419 150.551 172.104 1.00 58.77  ? 62  PHE H CD1   1 
ATOM   5719  C  CD2   . PHE H 4  62  ? 167.303 149.605 173.188 1.00 58.77  ? 62  PHE H CD2   1 
ATOM   5720  C  CE1   . PHE H 4  62  ? 165.859 151.811 172.449 1.00 58.77  ? 62  PHE H CE1   1 
ATOM   5721  C  CE2   . PHE H 4  62  ? 167.748 150.862 173.534 1.00 58.77  ? 62  PHE H CE2   1 
ATOM   5722  C  CZ    . PHE H 4  62  ? 167.025 151.968 173.161 1.00 58.77  ? 62  PHE H CZ    1 
ATOM   5723  N  N     . VAL H 4  63  ? 168.228 147.240 170.610 1.00 59.55  ? 63  VAL H N     1 
ATOM   5724  C  CA    . VAL H 4  63  ? 169.631 147.432 170.281 1.00 59.55  ? 63  VAL H CA    1 
ATOM   5725  C  C     . VAL H 4  63  ? 169.851 147.354 168.775 1.00 59.55  ? 63  VAL H C     1 
ATOM   5726  O  O     . VAL H 4  63  ? 170.619 148.148 168.209 1.00 59.55  ? 63  VAL H O     1 
ATOM   5727  C  CB    . VAL H 4  63  ? 170.477 146.410 171.057 1.00 59.55  ? 63  VAL H CB    1 
ATOM   5728  C  CG1   . VAL H 4  63  ? 171.892 146.387 170.574 1.00 59.55  ? 63  VAL H CG1   1 
ATOM   5729  C  CG2   . VAL H 4  63  ? 170.458 146.761 172.523 1.00 59.55  ? 63  VAL H CG2   1 
ATOM   5730  N  N     . ASN H 4  64  ? 169.142 146.444 168.089 1.00 59.32  ? 64  ASN H N     1 
ATOM   5731  C  CA    . ASN H 4  64  ? 169.232 146.438 166.628 1.00 59.32  ? 64  ASN H CA    1 
ATOM   5732  C  C     . ASN H 4  64  ? 168.659 147.710 166.017 1.00 59.32  ? 64  ASN H C     1 
ATOM   5733  O  O     . ASN H 4  64  ? 169.282 148.282 165.120 1.00 59.32  ? 64  ASN H O     1 
ATOM   5734  C  CB    . ASN H 4  64  ? 168.551 145.216 166.021 1.00 59.32  ? 64  ASN H CB    1 
ATOM   5735  C  CG    . ASN H 4  64  ? 169.441 143.995 166.027 1.00 59.32  ? 64  ASN H CG    1 
ATOM   5736  O  OD1   . ASN H 4  64  ? 170.649 144.103 165.830 1.00 59.32  ? 64  ASN H OD1   1 
ATOM   5737  N  ND2   . ASN H 4  64  ? 168.851 142.826 166.212 1.00 59.32  ? 64  ASN H ND2   1 
ATOM   5738  N  N     . ASP H 4  65  ? 167.526 148.201 166.539 1.00 63.93  ? 65  ASP H N     1 
ATOM   5739  C  CA    . ASP H 4  65  ? 166.866 149.384 165.972 1.00 63.93  ? 65  ASP H CA    1 
ATOM   5740  C  C     . ASP H 4  65  ? 167.733 150.630 166.092 1.00 63.93  ? 65  ASP H C     1 
ATOM   5741  O  O     . ASP H 4  65  ? 167.917 151.367 165.107 1.00 63.93  ? 65  ASP H O     1 
ATOM   5742  C  CB    . ASP H 4  65  ? 165.526 149.615 166.670 1.00 63.93  ? 65  ASP H CB    1 
ATOM   5743  C  CG    . ASP H 4  65  ? 164.650 150.658 165.968 1.00 63.93  ? 65  ASP H CG    1 
ATOM   5744  O  OD1   . ASP H 4  65  ? 165.023 151.179 164.895 1.00 63.93  ? 65  ASP H OD1   1 
ATOM   5745  O  OD2   . ASP H 4  65  ? 163.567 150.968 166.506 1.00 63.93  ? 65  ASP H OD2   1 
ATOM   5746  N  N     . VAL H 4  66  ? 168.255 150.894 167.295 1.00 60.61  ? 66  VAL H N     1 
ATOM   5747  C  CA    . VAL H 4  66  ? 169.161 152.026 167.470 1.00 60.61  ? 66  VAL H CA    1 
ATOM   5748  C  C     . VAL H 4  66  ? 170.404 151.835 166.619 1.00 60.61  ? 66  VAL H C     1 
ATOM   5749  O  O     . VAL H 4  66  ? 170.856 152.774 165.954 1.00 60.61  ? 66  VAL H O     1 
ATOM   5750  C  CB    . VAL H 4  66  ? 169.508 152.219 168.955 1.00 60.61  ? 66  VAL H CB    1 
ATOM   5751  C  CG1   . VAL H 4  66  ? 170.581 153.282 169.142 1.00 60.61  ? 66  VAL H CG1   1 
ATOM   5752  C  CG2   . VAL H 4  66  ? 168.272 152.615 169.700 1.00 60.61  ? 66  VAL H CG2   1 
ATOM   5753  N  N     . PHE H 4  67  ? 170.884 150.594 166.530 1.00 60.47  ? 67  PHE H N     1 
ATOM   5754  C  CA    . PHE H 4  67  ? 172.097 150.298 165.783 1.00 60.47  ? 67  PHE H CA    1 
ATOM   5755  C  C     . PHE H 4  67  ? 171.966 150.625 164.298 1.00 60.47  ? 67  PHE H C     1 
ATOM   5756  O  O     . PHE H 4  67  ? 172.888 151.199 163.706 1.00 60.47  ? 67  PHE H O     1 
ATOM   5757  C  CB    . PHE H 4  67  ? 172.471 148.843 165.972 1.00 60.47  ? 67  PHE H CB    1 
ATOM   5758  C  CG    . PHE H 4  67  ? 173.738 148.476 165.307 1.00 60.47  ? 67  PHE H CG    1 
ATOM   5759  C  CD1   . PHE H 4  67  ? 174.934 148.941 165.797 1.00 60.47  ? 67  PHE H CD1   1 
ATOM   5760  C  CD2   . PHE H 4  67  ? 173.735 147.656 164.198 1.00 60.47  ? 67  PHE H CD2   1 
ATOM   5761  C  CE1   . PHE H 4  67  ? 176.101 148.602 165.195 1.00 60.47  ? 67  PHE H CE1   1 
ATOM   5762  C  CE2   . PHE H 4  67  ? 174.904 147.313 163.589 1.00 60.47  ? 67  PHE H CE2   1 
ATOM   5763  C  CZ    . PHE H 4  67  ? 176.088 147.790 164.088 1.00 60.47  ? 67  PHE H CZ    1 
ATOM   5764  N  N     . GLU H 4  68  ? 170.819 150.324 163.679 1.00 63.15  ? 68  GLU H N     1 
ATOM   5765  C  CA    . GLU H 4  68  ? 170.689 150.765 162.294 1.00 63.15  ? 68  GLU H CA    1 
ATOM   5766  C  C     . GLU H 4  68  ? 170.322 152.240 162.185 1.00 63.15  ? 68  GLU H C     1 
ATOM   5767  O  O     . GLU H 4  68  ? 170.525 152.824 161.112 1.00 63.15  ? 68  GLU H O     1 
ATOM   5768  C  CB    . GLU H 4  68  ? 169.661 149.962 161.478 1.00 63.15  ? 68  GLU H CB    1 
ATOM   5769  C  CG    . GLU H 4  68  ? 168.212 150.376 161.676 1.00 63.15  ? 68  GLU H CG    1 
ATOM   5770  C  CD    . GLU H 4  68  ? 167.372 149.355 162.402 1.00 63.15  ? 68  GLU H CD    1 
ATOM   5771  O  OE1   . GLU H 4  68  ? 167.890 148.273 162.726 1.00 63.15  ? 68  GLU H OE1   1 
ATOM   5772  O  OE2   . GLU H 4  68  ? 166.192 149.646 162.682 1.00 63.15  ? 68  GLU H OE2   1 
ATOM   5773  N  N     . ARG H 4  69  ? 169.790 152.861 163.248 1.00 61.77  ? 69  ARG H N     1 
ATOM   5774  C  CA    . ARG H 4  69  ? 169.555 154.302 163.187 1.00 61.77  ? 69  ARG H CA    1 
ATOM   5775  C  C     . ARG H 4  69  ? 170.864 155.079 163.098 1.00 61.77  ? 69  ARG H C     1 
ATOM   5776  O  O     . ARG H 4  69  ? 171.093 155.810 162.130 1.00 61.77  ? 69  ARG H O     1 
ATOM   5777  C  CB    . ARG H 4  69  ? 168.741 154.784 164.380 1.00 61.77  ? 69  ARG H CB    1 
ATOM   5778  C  CG    . ARG H 4  69  ? 167.254 154.587 164.263 1.00 61.77  ? 69  ARG H CG    1 
ATOM   5779  C  CD    . ARG H 4  69  ? 166.572 155.190 165.482 1.00 61.77  ? 69  ARG H CD    1 
ATOM   5780  N  NE    . ARG H 4  69  ? 165.120 155.058 165.449 1.00 61.77  ? 69  ARG H NE    1 
ATOM   5781  C  CZ    . ARG H 4  69  ? 164.320 155.455 166.430 1.00 61.77  ? 69  ARG H CZ    1 
ATOM   5782  N  NH1   . ARG H 4  69  ? 164.836 155.997 167.518 1.00 61.77  ? 69  ARG H NH1   1 
ATOM   5783  N  NH2   . ARG H 4  69  ? 163.009 155.307 166.330 1.00 61.77  ? 69  ARG H NH2   1 
ATOM   5784  N  N     . ILE H 4  70  ? 171.746 154.931 164.096 1.00 63.06  ? 70  ILE H N     1 
ATOM   5785  C  CA    . ILE H 4  70  ? 173.024 155.645 164.018 1.00 63.06  ? 70  ILE H CA    1 
ATOM   5786  C  C     . ILE H 4  70  ? 173.963 155.072 162.963 1.00 63.06  ? 70  ILE H C     1 
ATOM   5787  O  O     . ILE H 4  70  ? 174.886 155.769 162.527 1.00 63.06  ? 70  ILE H O     1 
ATOM   5788  C  CB    . ILE H 4  70  ? 173.747 155.725 165.380 1.00 63.06  ? 70  ILE H CB    1 
ATOM   5789  C  CG1   . ILE H 4  70  ? 173.481 154.506 166.234 1.00 63.06  ? 70  ILE H CG1   1 
ATOM   5790  C  CG2   . ILE H 4  70  ? 173.342 156.932 166.145 1.00 63.06  ? 70  ILE H CG2   1 
ATOM   5791  C  CD1   . ILE H 4  70  ? 174.212 153.296 165.852 1.00 63.06  ? 70  ILE H CD1   1 
ATOM   5792  N  N     . ALA H 4  71  ? 173.782 153.813 162.557 1.00 63.59  ? 71  ALA H N     1 
ATOM   5793  C  CA    . ALA H 4  71  ? 174.566 153.321 161.435 1.00 63.59  ? 71  ALA H CA    1 
ATOM   5794  C  C     . ALA H 4  71  ? 174.160 154.019 160.143 1.00 63.59  ? 71  ALA H C     1 
ATOM   5795  O  O     . ALA H 4  71  ? 175.022 154.419 159.354 1.00 63.59  ? 71  ALA H O     1 
ATOM   5796  C  CB    . ALA H 4  71  ? 174.419 151.809 161.307 1.00 63.59  ? 71  ALA H CB    1 
ATOM   5797  N  N     . GLY H 4  72  ? 172.855 154.199 159.925 1.00 64.26  ? 72  GLY H N     1 
ATOM   5798  C  CA    . GLY H 4  72  ? 172.413 154.904 158.733 1.00 64.26  ? 72  GLY H CA    1 
ATOM   5799  C  C     . GLY H 4  72  ? 172.750 156.382 158.766 1.00 64.26  ? 72  GLY H C     1 
ATOM   5800  O  O     . GLY H 4  72  ? 173.124 156.971 157.742 1.00 64.26  ? 72  GLY H O     1 
ATOM   5801  N  N     . GLU H 4  73  ? 172.622 157.002 159.941 1.00 66.53  ? 73  GLU H N     1 
ATOM   5802  C  CA    . GLU H 4  73  ? 173.040 158.388 160.097 1.00 66.53  ? 73  GLU H CA    1 
ATOM   5803  C  C     . GLU H 4  73  ? 174.531 158.555 159.864 1.00 66.53  ? 73  GLU H C     1 
ATOM   5804  O  O     . GLU H 4  73  ? 174.964 159.570 159.308 1.00 66.53  ? 73  GLU H O     1 
ATOM   5805  C  CB    . GLU H 4  73  ? 172.676 158.893 161.485 1.00 66.53  ? 73  GLU H CB    1 
ATOM   5806  C  CG    . GLU H 4  73  ? 171.216 159.118 161.698 1.00 66.53  ? 73  GLU H CG    1 
ATOM   5807  C  CD    . GLU H 4  73  ? 170.707 160.293 160.914 1.00 66.53  ? 73  GLU H CD    1 
ATOM   5808  O  OE1   . GLU H 4  73  ? 171.498 161.221 160.647 1.00 66.53  ? 73  GLU H OE1   1 
ATOM   5809  O  OE2   . GLU H 4  73  ? 169.506 160.300 160.578 1.00 66.53  ? 73  GLU H OE2   1 
ATOM   5810  N  N     . ALA H 4  74  ? 175.326 157.566 160.265 1.00 69.31  ? 74  ALA H N     1 
ATOM   5811  C  CA    . ALA H 4  74  ? 176.733 157.587 159.907 1.00 69.31  ? 74  ALA H CA    1 
ATOM   5812  C  C     . ALA H 4  74  ? 176.923 157.404 158.414 1.00 69.31  ? 74  ALA H C     1 
ATOM   5813  O  O     . ALA H 4  74  ? 177.886 157.930 157.849 1.00 69.31  ? 74  ALA H O     1 
ATOM   5814  C  CB    . ALA H 4  74  ? 177.481 156.507 160.671 1.00 69.31  ? 74  ALA H CB    1 
ATOM   5815  N  N     . SER H 4  75  ? 176.006 156.681 157.759 1.00 70.54  ? 75  SER H N     1 
ATOM   5816  C  CA    . SER H 4  75  ? 176.151 156.433 156.328 1.00 70.54  ? 75  SER H CA    1 
ATOM   5817  C  C     . SER H 4  75  ? 175.941 157.702 155.526 1.00 70.54  ? 75  SER H C     1 
ATOM   5818  O  O     . SER H 4  75  ? 176.803 158.093 154.729 1.00 70.54  ? 75  SER H O     1 
ATOM   5819  C  CB    . SER H 4  75  ? 175.178 155.355 155.861 1.00 70.54  ? 75  SER H CB    1 
ATOM   5820  O  OG    . SER H 4  75  ? 175.223 155.229 154.452 1.00 70.54  ? 75  SER H OG    1 
ATOM   5821  N  N     . ARG H 4  76  ? 174.806 158.365 155.719 1.00 72.19  ? 76  ARG H N     1 
ATOM   5822  C  CA    . ARG H 4  76  ? 174.574 159.537 154.888 1.00 72.19  ? 76  ARG H CA    1 
ATOM   5823  C  C     . ARG H 4  76  ? 175.312 160.752 155.424 1.00 72.19  ? 76  ARG H C     1 
ATOM   5824  O  O     . ARG H 4  76  ? 175.708 161.625 154.640 1.00 72.19  ? 76  ARG H O     1 
ATOM   5825  C  CB    . ARG H 4  76  ? 173.075 159.792 154.735 1.00 72.19  ? 76  ARG H CB    1 
ATOM   5826  C  CG    . ARG H 4  76  ? 172.340 160.210 155.953 1.00 72.19  ? 76  ARG H CG    1 
ATOM   5827  C  CD    . ARG H 4  76  ? 170.874 160.200 155.628 1.00 72.19  ? 76  ARG H CD    1 
ATOM   5828  N  NE    . ARG H 4  76  ? 170.428 158.832 155.398 1.00 72.19  ? 76  ARG H NE    1 
ATOM   5829  C  CZ    . ARG H 4  76  ? 169.953 158.043 156.355 1.00 72.19  ? 76  ARG H CZ    1 
ATOM   5830  N  NH1   . ARG H 4  76  ? 169.849 158.501 157.590 1.00 72.19  ? 76  ARG H NH1   1 
ATOM   5831  N  NH2   . ARG H 4  76  ? 169.578 156.805 156.086 1.00 72.19  ? 76  ARG H NH2   1 
ATOM   5832  N  N     . LEU H 4  77  ? 175.567 160.788 156.738 1.00 70.09  ? 77  LEU H N     1 
ATOM   5833  C  CA    . LEU H 4  77  ? 176.378 161.855 157.306 1.00 70.09  ? 77  LEU H CA    1 
ATOM   5834  C  C     . LEU H 4  77  ? 177.823 161.748 156.858 1.00 70.09  ? 77  LEU H C     1 
ATOM   5835  O  O     . LEU H 4  77  ? 178.521 162.762 156.786 1.00 70.09  ? 77  LEU H O     1 
ATOM   5836  C  CB    . LEU H 4  77  ? 176.272 161.829 158.826 1.00 70.09  ? 77  LEU H CB    1 
ATOM   5837  C  CG    . LEU H 4  77  ? 176.811 162.968 159.701 1.00 70.09  ? 77  LEU H CG    1 
ATOM   5838  C  CD1   . LEU H 4  77  ? 178.260 162.802 160.096 1.00 70.09  ? 77  LEU H CD1   1 
ATOM   5839  C  CD2   . LEU H 4  77  ? 176.628 164.304 159.011 1.00 70.09  ? 77  LEU H CD2   1 
ATOM   5840  N  N     . ALA H 4  78  ? 178.298 160.543 156.579 1.00 71.54  ? 78  ALA H N     1 
ATOM   5841  C  CA    . ALA H 4  78  ? 179.600 160.424 155.951 1.00 71.54  ? 78  ALA H CA    1 
ATOM   5842  C  C     . ALA H 4  78  ? 179.517 160.588 154.447 1.00 71.54  ? 78  ALA H C     1 
ATOM   5843  O  O     . ALA H 4  78  ? 180.536 160.843 153.800 1.00 71.54  ? 78  ALA H O     1 
ATOM   5844  C  CB    . ALA H 4  78  ? 180.233 159.080 156.290 1.00 71.54  ? 78  ALA H CB    1 
ATOM   5845  N  N     . HIS H 4  79  ? 178.329 160.441 153.876 1.00 72.62  ? 79  HIS H N     1 
ATOM   5846  C  CA    . HIS H 4  79  ? 178.220 160.590 152.439 1.00 72.62  ? 79  HIS H CA    1 
ATOM   5847  C  C     . HIS H 4  79  ? 178.196 162.052 152.035 1.00 72.62  ? 79  HIS H C     1 
ATOM   5848  O  O     . HIS H 4  79  ? 178.576 162.386 150.910 1.00 72.62  ? 79  HIS H O     1 
ATOM   5849  C  CB    . HIS H 4  79  ? 176.969 159.885 151.924 1.00 72.62  ? 79  HIS H CB    1 
ATOM   5850  C  CG    . HIS H 4  79  ? 176.911 159.800 150.435 1.00 72.62  ? 79  HIS H CG    1 
ATOM   5851  N  ND1   . HIS H 4  79  ? 177.710 158.943 149.711 1.00 72.62  ? 79  HIS H ND1   1 
ATOM   5852  C  CD2   . HIS H 4  79  ? 176.176 160.483 149.529 1.00 72.62  ? 79  HIS H CD2   1 
ATOM   5853  C  CE1   . HIS H 4  79  ? 177.462 159.094 148.425 1.00 72.62  ? 79  HIS H CE1   1 
ATOM   5854  N  NE2   . HIS H 4  79  ? 176.531 160.021 148.288 1.00 72.62  ? 79  HIS H NE2   1 
ATOM   5855  N  N     . TYR H 4  80  ? 177.767 162.932 152.935 1.00 77.16  ? 80  TYR H N     1 
ATOM   5856  C  CA    . TYR H 4  80  ? 177.615 164.336 152.575 1.00 77.16  ? 80  TYR H CA    1 
ATOM   5857  C  C     . TYR H 4  80  ? 178.961 165.015 152.381 1.00 77.16  ? 80  TYR H C     1 
ATOM   5858  O  O     . TYR H 4  80  ? 179.115 165.855 151.491 1.00 77.16  ? 80  TYR H O     1 
ATOM   5859  C  CB    . TYR H 4  80  ? 176.813 165.070 153.644 1.00 77.16  ? 80  TYR H CB    1 
ATOM   5860  C  CG    . TYR H 4  80  ? 175.367 164.644 153.750 1.00 77.16  ? 80  TYR H CG    1 
ATOM   5861  C  CD1   . TYR H 4  80  ? 174.732 163.972 152.707 1.00 77.16  ? 80  TYR H CD1   1 
ATOM   5862  C  CD2   . TYR H 4  80  ? 174.641 164.887 154.912 1.00 77.16  ? 80  TYR H CD2   1 
ATOM   5863  C  CE1   . TYR H 4  80  ? 173.421 163.578 152.816 1.00 77.16  ? 80  TYR H CE1   1 
ATOM   5864  C  CE2   . TYR H 4  80  ? 173.324 164.496 155.024 1.00 77.16  ? 80  TYR H CE2   1 
ATOM   5865  C  CZ    . TYR H 4  80  ? 172.722 163.852 153.971 1.00 77.16  ? 80  TYR H CZ    1 
ATOM   5866  O  OH    . TYR H 4  80  ? 171.414 163.457 154.071 1.00 77.16  ? 80  TYR H OH    1 
ATOM   5867  N  N     . ASN H 4  81  ? 179.951 164.656 153.189 1.00 77.97  ? 81  ASN H N     1 
ATOM   5868  C  CA    . ASN H 4  81  ? 181.228 165.349 153.200 1.00 77.97  ? 81  ASN H CA    1 
ATOM   5869  C  C     . ASN H 4  81  ? 182.229 164.780 152.215 1.00 77.97  ? 81  ASN H C     1 
ATOM   5870  O  O     . ASN H 4  81  ? 183.425 165.054 152.363 1.00 77.97  ? 81  ASN H O     1 
ATOM   5871  C  CB    . ASN H 4  81  ? 181.839 165.308 154.594 1.00 77.97  ? 81  ASN H CB    1 
ATOM   5872  C  CG    . ASN H 4  81  ? 181.046 166.080 155.579 1.00 77.97  ? 81  ASN H CG    1 
ATOM   5873  O  OD1   . ASN H 4  81  ? 180.561 167.166 155.287 1.00 77.97  ? 81  ASN H OD1   1 
ATOM   5874  N  ND2   . ASN H 4  81  ? 180.898 165.526 156.759 1.00 77.97  ? 81  ASN H ND2   1 
ATOM   5875  N  N     . LYS H 4  82  ? 181.771 163.971 151.252 1.00 81.12  ? 82  LYS H N     1 
ATOM   5876  C  CA    . LYS H 4  82  ? 182.609 163.344 150.222 1.00 81.12  ? 82  LYS H CA    1 
ATOM   5877  C  C     . LYS H 4  82  ? 183.694 162.461 150.832 1.00 81.12  ? 82  LYS H C     1 
ATOM   5878  O  O     . LYS H 4  82  ? 184.797 162.348 150.297 1.00 81.12  ? 82  LYS H O     1 
ATOM   5879  C  CB    . LYS H 4  82  ? 183.216 164.394 149.286 1.00 81.12  ? 82  LYS H CB    1 
ATOM   5880  C  CG    . LYS H 4  82  ? 182.172 165.132 148.485 1.00 81.12  ? 82  LYS H CG    1 
ATOM   5881  C  CD    . LYS H 4  82  ? 182.755 166.369 147.859 1.00 81.12  ? 82  LYS H CD    1 
ATOM   5882  C  CE    . LYS H 4  82  ? 183.763 166.028 146.791 1.00 81.12  ? 82  LYS H CE    1 
ATOM   5883  N  NZ    . LYS H 4  82  ? 183.102 165.406 145.617 1.00 81.12  ? 82  LYS H NZ    1 
ATOM   5884  N  N     . ARG H 4  83  ? 183.385 161.845 151.966 1.00 81.05  ? 83  ARG H N     1 
ATOM   5885  C  CA    . ARG H 4  83  ? 184.271 160.902 152.620 1.00 81.05  ? 83  ARG H CA    1 
ATOM   5886  C  C     . ARG H 4  83  ? 183.887 159.478 152.240 1.00 81.05  ? 83  ARG H C     1 
ATOM   5887  O  O     . ARG H 4  83  ? 182.879 159.231 151.577 1.00 81.05  ? 83  ARG H O     1 
ATOM   5888  C  CB    . ARG H 4  83  ? 184.211 161.077 154.137 1.00 81.05  ? 83  ARG H CB    1 
ATOM   5889  C  CG    . ARG H 4  83  ? 184.619 162.441 154.626 1.00 81.05  ? 83  ARG H CG    1 
ATOM   5890  C  CD    . ARG H 4  83  ? 186.093 162.674 154.443 1.00 81.05  ? 83  ARG H CD    1 
ATOM   5891  N  NE    . ARG H 4  83  ? 186.528 163.887 155.131 1.00 81.05  ? 83  ARG H NE    1 
ATOM   5892  C  CZ    . ARG H 4  83  ? 186.575 165.092 154.578 1.00 81.05  ? 83  ARG H CZ    1 
ATOM   5893  N  NH1   . ARG H 4  83  ? 186.216 165.263 153.317 1.00 81.05  ? 83  ARG H NH1   1 
ATOM   5894  N  NH2   . ARG H 4  83  ? 186.987 166.125 155.290 1.00 81.05  ? 83  ARG H NH2   1 
ATOM   5895  N  N     . SER H 4  84  ? 184.712 158.531 152.673 1.00 83.17  ? 84  SER H N     1 
ATOM   5896  C  CA    . SER H 4  84  ? 184.441 157.119 152.458 1.00 83.17  ? 84  SER H CA    1 
ATOM   5897  C  C     . SER H 4  84  ? 184.829 156.293 153.676 1.00 83.17  ? 84  SER H C     1 
ATOM   5898  O  O     . SER H 4  84  ? 185.197 155.120 153.546 1.00 83.17  ? 84  SER H O     1 
ATOM   5899  C  CB    . SER H 4  84  ? 185.171 156.626 151.219 1.00 83.17  ? 84  SER H CB    1 
ATOM   5900  O  OG    . SER H 4  84  ? 186.557 156.833 151.371 1.00 83.17  ? 84  SER H OG    1 
ATOM   5901  N  N     . THR H 4  85  ? 184.758 156.894 154.866 1.00 83.30  ? 85  THR H N     1 
ATOM   5902  C  CA    . THR H 4  85  ? 185.269 156.280 156.085 1.00 83.30  ? 85  THR H CA    1 
ATOM   5903  C  C     . THR H 4  85  ? 184.408 156.726 157.256 1.00 83.30  ? 85  THR H C     1 
ATOM   5904  O  O     . THR H 4  85  ? 184.082 157.909 157.366 1.00 83.30  ? 85  THR H O     1 
ATOM   5905  C  CB    . THR H 4  85  ? 186.738 156.667 156.317 1.00 83.30  ? 85  THR H CB    1 
ATOM   5906  O  OG1   . THR H 4  85  ? 187.523 156.297 155.178 1.00 83.30  ? 85  THR H OG1   1 
ATOM   5907  C  CG2   . THR H 4  85  ? 187.306 155.956 157.528 1.00 83.30  ? 85  THR H CG2   1 
ATOM   5908  N  N     . ILE H 4  86  ? 184.025 155.788 158.108 1.00 74.61  ? 86  ILE H N     1 
ATOM   5909  C  CA    . ILE H 4  86  ? 183.281 156.084 159.320 1.00 74.61  ? 86  ILE H CA    1 
ATOM   5910  C  C     . ILE H 4  86  ? 184.258 156.054 160.486 1.00 74.61  ? 86  ILE H C     1 
ATOM   5911  O  O     . ILE H 4  86  ? 184.738 154.987 160.875 1.00 74.61  ? 86  ILE H O     1 
ATOM   5912  C  CB    . ILE H 4  86  ? 182.135 155.090 159.530 1.00 74.61  ? 86  ILE H CB    1 
ATOM   5913  C  CG1   . ILE H 4  86  ? 181.115 155.224 158.414 1.00 74.61  ? 86  ILE H CG1   1 
ATOM   5914  C  CG2   . ILE H 4  86  ? 181.457 155.334 160.833 1.00 74.61  ? 86  ILE H CG2   1 
ATOM   5915  C  CD1   . ILE H 4  86  ? 180.052 154.174 158.437 1.00 74.61  ? 86  ILE H CD1   1 
ATOM   5916  N  N     . THR H 4  87  ? 184.556 157.222 161.053 1.00 81.77  ? 87  THR H N     1 
ATOM   5917  C  CA    . THR H 4  87  ? 185.381 157.336 162.247 1.00 81.77  ? 87  THR H CA    1 
ATOM   5918  C  C     . THR H 4  87  ? 184.532 157.847 163.403 1.00 81.77  ? 87  THR H C     1 
ATOM   5919  O  O     . THR H 4  87  ? 183.337 158.106 163.265 1.00 81.77  ? 87  THR H O     1 
ATOM   5920  C  CB    . THR H 4  87  ? 186.576 158.261 162.009 1.00 81.77  ? 87  THR H CB    1 
ATOM   5921  O  OG1   . THR H 4  87  ? 186.109 159.593 161.783 1.00 81.77  ? 87  THR H OG1   1 
ATOM   5922  C  CG2   . THR H 4  87  ? 187.374 157.795 160.807 1.00 81.77  ? 87  THR H CG2   1 
ATOM   5923  N  N     . SER H 4  88  ? 185.175 158.012 164.558 1.00 86.01  ? 88  SER H N     1 
ATOM   5924  C  CA    . SER H 4  88  ? 184.436 158.301 165.778 1.00 86.01  ? 88  SER H CA    1 
ATOM   5925  C  C     . SER H 4  88  ? 183.881 159.715 165.818 1.00 86.01  ? 88  SER H C     1 
ATOM   5926  O  O     . SER H 4  88  ? 182.947 159.971 166.583 1.00 86.01  ? 88  SER H O     1 
ATOM   5927  C  CB    . SER H 4  88  ? 185.325 158.067 166.991 1.00 86.01  ? 88  SER H CB    1 
ATOM   5928  O  OG    . SER H 4  88  ? 185.682 156.701 167.079 1.00 86.01  ? 88  SER H OG    1 
ATOM   5929  N  N     . ARG H 4  89  ? 184.435 160.635 165.031 1.00 85.32  ? 89  ARG H N     1 
ATOM   5930  C  CA    . ARG H 4  89  ? 183.853 161.967 164.940 1.00 85.32  ? 89  ARG H CA    1 
ATOM   5931  C  C     . ARG H 4  89  ? 182.474 161.904 164.297 1.00 85.32  ? 89  ARG H C     1 
ATOM   5932  O  O     . ARG H 4  89  ? 181.547 162.613 164.716 1.00 85.32  ? 89  ARG H O     1 
ATOM   5933  C  CB    . ARG H 4  89  ? 184.799 162.879 164.159 1.00 85.32  ? 89  ARG H CB    1 
ATOM   5934  C  CG    . ARG H 4  89  ? 184.315 164.301 163.951 1.00 85.32  ? 89  ARG H CG    1 
ATOM   5935  C  CD    . ARG H 4  89  ? 184.185 165.016 165.276 1.00 85.32  ? 89  ARG H CD    1 
ATOM   5936  N  NE    . ARG H 4  89  ? 183.741 166.401 165.125 1.00 85.32  ? 89  ARG H NE    1 
ATOM   5937  C  CZ    . ARG H 4  89  ? 184.556 167.450 165.075 1.00 85.32  ? 89  ARG H CZ    1 
ATOM   5938  N  NH1   . ARG H 4  89  ? 185.865 167.280 165.174 1.00 85.32  ? 89  ARG H NH1   1 
ATOM   5939  N  NH2   . ARG H 4  89  ? 184.062 168.673 164.940 1.00 85.32  ? 89  ARG H NH2   1 
ATOM   5940  N  N     . GLU H 4  90  ? 182.311 161.014 163.319 1.00 82.64  ? 90  GLU H N     1 
ATOM   5941  C  CA    . GLU H 4  90  ? 181.028 160.838 162.650 1.00 82.64  ? 90  GLU H CA    1 
ATOM   5942  C  C     . GLU H 4  90  ? 180.002 160.220 163.578 1.00 82.64  ? 90  GLU H C     1 
ATOM   5943  O  O     . GLU H 4  90  ? 178.826 160.606 163.557 1.00 82.64  ? 90  GLU H O     1 
ATOM   5944  C  CB    . GLU H 4  90  ? 181.207 159.977 161.406 1.00 82.64  ? 90  GLU H CB    1 
ATOM   5945  C  CG    . GLU H 4  90  ? 181.872 160.697 160.252 1.00 82.64  ? 90  GLU H CG    1 
ATOM   5946  C  CD    . GLU H 4  90  ? 183.383 160.764 160.363 1.00 82.64  ? 90  GLU H CD    1 
ATOM   5947  O  OE1   . GLU H 4  90  ? 183.943 160.174 161.305 1.00 82.64  ? 90  GLU H OE1   1 
ATOM   5948  O  OE2   . GLU H 4  90  ? 184.013 161.430 159.518 1.00 82.64  ? 90  GLU H OE2   1 
ATOM   5949  N  N     . ILE H 4  91  ? 180.422 159.265 164.400 1.00 79.46  ? 91  ILE H N     1 
ATOM   5950  C  CA    . ILE H 4  91  ? 179.486 158.684 165.343 1.00 79.46  ? 91  ILE H CA    1 
ATOM   5951  C  C     . ILE H 4  91  ? 179.155 159.691 166.436 1.00 79.46  ? 91  ILE H C     1 
ATOM   5952  O  O     . ILE H 4  91  ? 178.039 159.695 166.961 1.00 79.46  ? 91  ILE H O     1 
ATOM   5953  C  CB    . ILE H 4  91  ? 180.052 157.381 165.921 1.00 79.46  ? 91  ILE H CB    1 
ATOM   5954  C  CG1   . ILE H 4  91  ? 180.559 156.486 164.805 1.00 79.46  ? 91  ILE H CG1   1 
ATOM   5955  C  CG2   . ILE H 4  91  ? 178.970 156.618 166.641 1.00 79.46  ? 91  ILE H CG2   1 
ATOM   5956  C  CD1   . ILE H 4  91  ? 179.488 156.016 163.871 1.00 79.46  ? 91  ILE H CD1   1 
ATOM   5957  N  N     . GLN H 4  92  ? 180.095 160.582 166.771 1.00 85.45  ? 92  GLN H N     1 
ATOM   5958  C  CA    . GLN H 4  92  ? 179.804 161.627 167.750 1.00 85.45  ? 92  GLN H CA    1 
ATOM   5959  C  C     . GLN H 4  92  ? 178.766 162.608 167.225 1.00 85.45  ? 92  GLN H C     1 
ATOM   5960  O  O     . GLN H 4  92  ? 177.845 163.000 167.957 1.00 85.45  ? 92  GLN H O     1 
ATOM   5961  C  CB    . GLN H 4  92  ? 181.081 162.369 168.131 1.00 85.45  ? 92  GLN H CB    1 
ATOM   5962  C  CG    . GLN H 4  92  ? 180.845 163.489 169.124 1.00 85.45  ? 92  GLN H CG    1 
ATOM   5963  C  CD    . GLN H 4  92  ? 182.115 164.181 169.527 1.00 85.45  ? 92  GLN H CD    1 
ATOM   5964  O  OE1   . GLN H 4  92  ? 183.197 163.819 169.076 1.00 85.45  ? 92  GLN H OE1   1 
ATOM   5965  N  NE2   . GLN H 4  92  ? 181.992 165.196 170.365 1.00 85.45  ? 92  GLN H NE2   1 
ATOM   5966  N  N     . THR H 4  93  ? 178.894 162.999 165.959 1.00 80.99  ? 93  THR H N     1 
ATOM   5967  C  CA    . THR H 4  93  ? 177.900 163.872 165.349 1.00 80.99  ? 93  THR H CA    1 
ATOM   5968  C  C     . THR H 4  93  ? 176.541 163.190 165.277 1.00 80.99  ? 93  THR H C     1 
ATOM   5969  O  O     . THR H 4  93  ? 175.524 163.774 165.670 1.00 80.99  ? 93  THR H O     1 
ATOM   5970  C  CB    . THR H 4  93  ? 178.369 164.282 163.961 1.00 80.99  ? 93  THR H CB    1 
ATOM   5971  O  OG1   . THR H 4  93  ? 179.595 165.011 164.074 1.00 80.99  ? 93  THR H OG1   1 
ATOM   5972  C  CG2   . THR H 4  93  ? 177.327 165.139 163.282 1.00 80.99  ? 93  THR H CG2   1 
ATOM   5973  N  N     . ALA H 4  94  ? 176.515 161.937 164.820 1.00 77.60  ? 94  ALA H N     1 
ATOM   5974  C  CA    . ALA H 4  94  ? 175.247 161.249 164.613 1.00 77.60  ? 94  ALA H CA    1 
ATOM   5975  C  C     . ALA H 4  94  ? 174.543 160.942 165.927 1.00 77.60  ? 94  ALA H C     1 
ATOM   5976  O  O     . ALA H 4  94  ? 173.307 160.981 165.989 1.00 77.60  ? 94  ALA H O     1 
ATOM   5977  C  CB    . ALA H 4  94  ? 175.469 159.967 163.819 1.00 77.60  ? 94  ALA H CB    1 
ATOM   5978  N  N     . VAL H 4  95  ? 175.304 160.673 166.985 1.00 77.99  ? 95  VAL H N     1 
ATOM   5979  C  CA    . VAL H 4  95  ? 174.698 160.563 168.303 1.00 77.99  ? 95  VAL H CA    1 
ATOM   5980  C  C     . VAL H 4  95  ? 174.195 161.922 168.760 1.00 77.99  ? 95  VAL H C     1 
ATOM   5981  O  O     . VAL H 4  95  ? 173.090 162.038 169.304 1.00 77.99  ? 95  VAL H O     1 
ATOM   5982  C  CB    . VAL H 4  95  ? 175.683 159.931 169.296 1.00 77.99  ? 95  VAL H CB    1 
ATOM   5983  C  CG1   . VAL H 4  95  ? 175.201 160.080 170.717 1.00 77.99  ? 95  VAL H CG1   1 
ATOM   5984  C  CG2   . VAL H 4  95  ? 175.803 158.465 168.999 1.00 77.99  ? 95  VAL H CG2   1 
ATOM   5985  N  N     . ARG H 4  96  ? 174.929 162.992 168.437 1.00 77.82  ? 96  ARG H N     1 
ATOM   5986  C  CA    . ARG H 4  96  ? 174.384 164.317 168.724 1.00 77.82  ? 96  ARG H CA    1 
ATOM   5987  C  C     . ARG H 4  96  ? 173.237 164.717 167.813 1.00 77.82  ? 96  ARG H C     1 
ATOM   5988  O  O     . ARG H 4  96  ? 172.694 165.808 167.991 1.00 77.82  ? 96  ARG H O     1 
ATOM   5989  C  CB    . ARG H 4  96  ? 175.460 165.390 168.644 1.00 77.82  ? 96  ARG H CB    1 
ATOM   5990  C  CG    . ARG H 4  96  ? 176.384 165.454 169.827 1.00 77.82  ? 96  ARG H CG    1 
ATOM   5991  C  CD    . ARG H 4  96  ? 177.333 166.602 169.626 1.00 77.82  ? 96  ARG H CD    1 
ATOM   5992  N  NE    . ARG H 4  96  ? 176.590 167.850 169.548 1.00 77.82  ? 96  ARG H NE    1 
ATOM   5993  C  CZ    . ARG H 4  96  ? 177.102 168.992 169.110 1.00 77.82  ? 96  ARG H CZ    1 
ATOM   5994  N  NH1   . ARG H 4  96  ? 178.362 169.043 168.702 1.00 77.82  ? 96  ARG H NH1   1 
ATOM   5995  N  NH2   . ARG H 4  96  ? 176.351 170.083 169.067 1.00 77.82  ? 96  ARG H NH2   1 
ATOM   5996  N  N     . LEU H 4  97  ? 172.853 163.898 166.844 1.00 74.35  ? 97  LEU H N     1 
ATOM   5997  C  CA    . LEU H 4  97  ? 171.614 164.130 166.130 1.00 74.35  ? 97  LEU H CA    1 
ATOM   5998  C  C     . LEU H 4  97  ? 170.464 163.280 166.637 1.00 74.35  ? 97  LEU H C     1 
ATOM   5999  O  O     . LEU H 4  97  ? 169.334 163.770 166.711 1.00 74.35  ? 97  LEU H O     1 
ATOM   6000  C  CB    . LEU H 4  97  ? 171.814 163.875 164.643 1.00 74.35  ? 97  LEU H CB    1 
ATOM   6001  C  CG    . LEU H 4  97  ? 172.674 164.945 163.998 1.00 74.35  ? 97  LEU H CG    1 
ATOM   6002  C  CD1   . LEU H 4  97  ? 172.933 164.580 162.564 1.00 74.35  ? 97  LEU H CD1   1 
ATOM   6003  C  CD2   . LEU H 4  97  ? 171.978 166.283 164.108 1.00 74.35  ? 97  LEU H CD2   1 
ATOM   6004  N  N     . LEU H 4  98  ? 170.702 162.022 166.992 1.00 76.19  ? 98  LEU H N     1 
ATOM   6005  C  CA    . LEU H 4  98  ? 169.563 161.210 167.402 1.00 76.19  ? 98  LEU H CA    1 
ATOM   6006  C  C     . LEU H 4  98  ? 169.270 161.287 168.885 1.00 76.19  ? 98  LEU H C     1 
ATOM   6007  O  O     . LEU H 4  98  ? 168.105 161.187 169.283 1.00 76.19  ? 98  LEU H O     1 
ATOM   6008  C  CB    . LEU H 4  98  ? 169.774 159.754 167.016 1.00 76.19  ? 98  LEU H CB    1 
ATOM   6009  C  CG    . LEU H 4  98  ? 169.754 159.587 165.509 1.00 76.19  ? 98  LEU H CG    1 
ATOM   6010  C  CD1   . LEU H 4  98  ? 170.005 158.155 165.177 1.00 76.19  ? 98  LEU H CD1   1 
ATOM   6011  C  CD2   . LEU H 4  98  ? 168.424 160.038 164.946 1.00 76.19  ? 98  LEU H CD2   1 
ATOM   6012  N  N     . LEU H 4  99  ? 170.268 161.459 169.699 1.00 86.04  ? 99  LEU H N     1 
ATOM   6013  C  CA    . LEU H 4  99  ? 170.044 161.399 171.132 1.00 86.04  ? 99  LEU H CA    1 
ATOM   6014  C  C     . LEU H 4  99  ? 169.559 162.753 171.636 1.00 86.04  ? 99  LEU H C     1 
ATOM   6015  O  O     . LEU H 4  99  ? 170.216 163.767 171.398 1.00 86.04  ? 99  LEU H O     1 
ATOM   6016  C  CB    . LEU H 4  99  ? 171.318 160.983 171.847 1.00 86.04  ? 99  LEU H CB    1 
ATOM   6017  C  CG    . LEU H 4  99  ? 171.603 159.496 172.074 1.00 86.04  ? 99  LEU H CG    1 
ATOM   6018  C  CD1   . LEU H 4  99  ? 170.562 158.946 173.001 1.00 86.04  ? 99  LEU H CD1   1 
ATOM   6019  C  CD2   . LEU H 4  99  ? 171.657 158.676 170.802 1.00 86.04  ? 99  LEU H CD2   1 
ATOM   6020  N  N     . PRO H 4  100 ? 168.431 162.809 172.316 1.00 89.46  ? 100 PRO H N     1 
ATOM   6021  C  CA    . PRO H 4  100 ? 167.848 164.107 172.674 1.00 89.46  ? 100 PRO H CA    1 
ATOM   6022  C  C     . PRO H 4  100 ? 168.487 164.797 173.869 1.00 89.46  ? 100 PRO H C     1 
ATOM   6023  O  O     . PRO H 4  100 ? 168.018 164.625 174.997 1.00 89.46  ? 100 PRO H O     1 
ATOM   6024  C  CB    . PRO H 4  100 ? 166.386 163.751 172.978 1.00 89.46  ? 100 PRO H CB    1 
ATOM   6025  C  CG    . PRO H 4  100 ? 166.158 162.452 172.318 1.00 89.46  ? 100 PRO H CG    1 
ATOM   6026  C  CD    . PRO H 4  100 ? 167.454 161.726 172.460 1.00 89.46  ? 100 PRO H CD    1 
ATOM   6027  N  N     . GLY H 4  101 ? 169.560 165.555 173.659 1.00 93.59  ? 101 GLY H N     1 
ATOM   6028  C  CA    . GLY H 4  101 ? 169.963 166.537 174.652 1.00 93.59  ? 101 GLY H CA    1 
ATOM   6029  C  C     . GLY H 4  101 ? 170.789 166.020 175.809 1.00 93.59  ? 101 GLY H C     1 
ATOM   6030  O  O     . GLY H 4  101 ? 171.995 165.813 175.665 1.00 93.59  ? 101 GLY H O     1 
ATOM   6031  N  N     . GLU H 4  102 ? 170.155 165.860 176.976 1.00 100.30 ? 102 GLU H N     1 
ATOM   6032  C  CA    . GLU H 4  102 ? 170.832 165.271 178.128 1.00 100.30 ? 102 GLU H CA    1 
ATOM   6033  C  C     . GLU H 4  102 ? 171.283 163.849 177.837 1.00 100.30 ? 102 GLU H C     1 
ATOM   6034  O  O     . GLU H 4  102 ? 172.346 163.422 178.300 1.00 100.30 ? 102 GLU H O     1 
ATOM   6035  C  CB    . GLU H 4  102 ? 169.908 165.284 179.343 1.00 100.30 ? 102 GLU H CB    1 
ATOM   6036  C  CG    . GLU H 4  102 ? 169.586 166.659 179.896 1.00 100.30 ? 102 GLU H CG    1 
ATOM   6037  C  CD    . GLU H 4  102 ? 170.745 167.276 180.645 1.00 100.30 ? 102 GLU H CD    1 
ATOM   6038  O  OE1   . GLU H 4  102 ? 171.536 166.515 181.239 1.00 100.30 ? 102 GLU H OE1   1 
ATOM   6039  O  OE2   . GLU H 4  102 ? 170.855 168.519 180.656 1.00 100.30 ? 102 GLU H OE2   1 
ATOM   6040  N  N     . LEU H 4  103 ? 170.495 163.114 177.056 1.00 96.39  ? 103 LEU H N     1 
ATOM   6041  C  CA    . LEU H 4  103 ? 170.897 161.802 176.581 1.00 96.39  ? 103 LEU H CA    1 
ATOM   6042  C  C     . LEU H 4  103 ? 172.051 161.859 175.598 1.00 96.39  ? 103 LEU H C     1 
ATOM   6043  O  O     . LEU H 4  103 ? 172.757 160.859 175.434 1.00 96.39  ? 103 LEU H O     1 
ATOM   6044  C  CB    . LEU H 4  103 ? 169.712 161.093 175.940 1.00 96.39  ? 103 LEU H CB    1 
ATOM   6045  C  CG    . LEU H 4  103 ? 169.009 160.063 176.812 1.00 96.39  ? 103 LEU H CG    1 
ATOM   6046  C  CD1   . LEU H 4  103 ? 169.966 158.938 177.000 1.00 96.39  ? 103 LEU H CD1   1 
ATOM   6047  C  CD2   . LEU H 4  103 ? 168.607 160.599 178.165 1.00 96.39  ? 103 LEU H CD2   1 
ATOM   6048  N  N     . ALA H 4  104 ? 172.260 162.989 174.928 1.00 92.81  ? 104 ALA H N     1 
ATOM   6049  C  CA    . ALA H 4  104 ? 173.425 163.082 174.064 1.00 92.81  ? 104 ALA H CA    1 
ATOM   6050  C  C     . ALA H 4  104 ? 174.702 163.251 174.871 1.00 92.81  ? 104 ALA H C     1 
ATOM   6051  O  O     . ALA H 4  104 ? 175.721 162.631 174.553 1.00 92.81  ? 104 ALA H O     1 
ATOM   6052  C  CB    . ALA H 4  104 ? 173.265 164.235 173.079 1.00 92.81  ? 104 ALA H CB    1 
ATOM   6053  N  N     . LYS H 4  105 ? 174.643 164.054 175.937 1.00 92.96  ? 105 LYS H N     1 
ATOM   6054  C  CA    . LYS H 4  105 ? 175.851 164.530 176.603 1.00 92.96  ? 105 LYS H CA    1 
ATOM   6055  C  C     . LYS H 4  105 ? 176.578 163.404 177.320 1.00 92.96  ? 105 LYS H C     1 
ATOM   6056  O  O     . LYS H 4  105 ? 177.796 163.251 177.175 1.00 92.96  ? 105 LYS H O     1 
ATOM   6057  C  CB    . LYS H 4  105 ? 175.494 165.644 177.581 1.00 92.96  ? 105 LYS H CB    1 
ATOM   6058  C  CG    . LYS H 4  105 ? 175.054 166.915 176.894 1.00 92.96  ? 105 LYS H CG    1 
ATOM   6059  C  CD    . LYS H 4  105 ? 174.495 167.913 177.876 1.00 92.96  ? 105 LYS H CD    1 
ATOM   6060  C  CE    . LYS H 4  105 ? 175.569 168.474 178.768 1.00 92.96  ? 105 LYS H CE    1 
ATOM   6061  N  NZ    . LYS H 4  105 ? 175.008 169.561 179.602 1.00 92.96  ? 105 LYS H NZ    1 
ATOM   6062  N  N     . HIS H 4  106 ? 175.847 162.598 178.088 1.00 93.96  ? 106 HIS H N     1 
ATOM   6063  C  CA    . HIS H 4  106 ? 176.493 161.506 178.803 1.00 93.96  ? 106 HIS H CA    1 
ATOM   6064  C  C     . HIS H 4  106 ? 176.890 160.388 177.858 1.00 93.96  ? 106 HIS H C     1 
ATOM   6065  O  O     . HIS H 4  106 ? 177.828 159.636 178.146 1.00 93.96  ? 106 HIS H O     1 
ATOM   6066  C  CB    . HIS H 4  106 ? 175.577 160.994 179.905 1.00 93.96  ? 106 HIS H CB    1 
ATOM   6067  C  CG    . HIS H 4  106 ? 175.327 161.999 180.981 1.00 93.96  ? 106 HIS H CG    1 
ATOM   6068  N  ND1   . HIS H 4  106 ? 176.265 162.306 181.941 1.00 93.96  ? 106 HIS H ND1   1 
ATOM   6069  C  CD2   . HIS H 4  106 ? 174.255 162.785 181.237 1.00 93.96  ? 106 HIS H CD2   1 
ATOM   6070  C  CE1   . HIS H 4  106 ? 175.780 163.230 182.751 1.00 93.96  ? 106 HIS H CE1   1 
ATOM   6071  N  NE2   . HIS H 4  106 ? 174.561 163.536 182.345 1.00 93.96  ? 106 HIS H NE2   1 
ATOM   6072  N  N     . ALA H 4  107 ? 176.200 160.273 176.727 1.00 95.47  ? 107 ALA H N     1 
ATOM   6073  C  CA    . ALA H 4  107 ? 176.643 159.357 175.691 1.00 95.47  ? 107 ALA H CA    1 
ATOM   6074  C  C     . ALA H 4  107 ? 177.971 159.803 175.099 1.00 95.47  ? 107 ALA H C     1 
ATOM   6075  O  O     . ALA H 4  107 ? 178.829 158.972 174.789 1.00 95.47  ? 107 ALA H O     1 
ATOM   6076  C  CB    . ALA H 4  107 ? 175.582 159.246 174.601 1.00 95.47  ? 107 ALA H CB    1 
ATOM   6077  N  N     . VAL H 4  108 ? 178.167 161.111 174.955 1.00 100.98 ? 108 VAL H N     1 
ATOM   6078  C  CA    . VAL H 4  108 ? 179.436 161.599 174.433 1.00 100.98 ? 108 VAL H CA    1 
ATOM   6079  C  C     . VAL H 4  108 ? 180.530 161.512 175.498 1.00 100.98 ? 108 VAL H C     1 
ATOM   6080  O  O     . VAL H 4  108 ? 181.697 161.250 175.178 1.00 100.98 ? 108 VAL H O     1 
ATOM   6081  C  CB    . VAL H 4  108 ? 179.239 163.021 173.870 1.00 100.98 ? 108 VAL H CB    1 
ATOM   6082  C  CG1   . VAL H 4  108 ? 180.555 163.683 173.476 1.00 100.98 ? 108 VAL H CG1   1 
ATOM   6083  C  CG2   . VAL H 4  108 ? 178.340 162.964 172.644 1.00 100.98 ? 108 VAL H CG2   1 
ATOM   6084  N  N     . SER H 4  109 ? 180.176 161.658 176.779 1.00 101.37 ? 109 SER H N     1 
ATOM   6085  C  CA    . SER H 4  109 ? 181.177 161.536 177.834 1.00 101.37 ? 109 SER H CA    1 
ATOM   6086  C  C     . SER H 4  109 ? 181.637 160.092 177.997 1.00 101.37 ? 109 SER H C     1 
ATOM   6087  O  O     . SER H 4  109 ? 182.840 159.827 178.133 1.00 101.37 ? 109 SER H O     1 
ATOM   6088  C  CB    . SER H 4  109 ? 180.619 162.082 179.146 1.00 101.37 ? 109 SER H CB    1 
ATOM   6089  O  OG    . SER H 4  109 ? 180.355 163.470 179.047 1.00 101.37 ? 109 SER H OG    1 
ATOM   6090  N  N     . GLU H 4  110 ? 180.698 159.146 177.959 1.00 101.11 ? 110 GLU H N     1 
ATOM   6091  C  CA    . GLU H 4  110 ? 181.075 157.737 177.956 1.00 101.11 ? 110 GLU H CA    1 
ATOM   6092  C  C     . GLU H 4  110 ? 181.786 157.352 176.671 1.00 101.11 ? 110 GLU H C     1 
ATOM   6093  O  O     . GLU H 4  110 ? 182.649 156.466 176.681 1.00 101.11 ? 110 GLU H O     1 
ATOM   6094  C  CB    . GLU H 4  110 ? 179.841 156.863 178.154 1.00 101.11 ? 110 GLU H CB    1 
ATOM   6095  C  CG    . GLU H 4  110 ? 179.302 156.877 179.566 1.00 101.11 ? 110 GLU H CG    1 
ATOM   6096  C  CD    . GLU H 4  110 ? 180.205 156.133 180.529 1.00 101.11 ? 110 GLU H CD    1 
ATOM   6097  O  OE1   . GLU H 4  110 ? 180.831 155.140 180.105 1.00 101.11 ? 110 GLU H OE1   1 
ATOM   6098  O  OE2   . GLU H 4  110 ? 180.296 156.539 181.707 1.00 101.11 ? 110 GLU H OE2   1 
ATOM   6099  N  N     . GLY H 4  111 ? 181.457 158.017 175.564 1.00 101.06 ? 111 GLY H N     1 
ATOM   6100  C  CA    . GLY H 4  111 ? 182.103 157.697 174.308 1.00 101.06 ? 111 GLY H CA    1 
ATOM   6101  C  C     . GLY H 4  111 ? 183.552 158.137 174.276 1.00 101.06 ? 111 GLY H C     1 
ATOM   6102  O  O     . GLY H 4  111 ? 184.434 157.379 173.872 1.00 101.06 ? 111 GLY H O     1 
ATOM   6103  N  N     . THR H 4  112 ? 183.817 159.365 174.713 1.00 103.84 ? 112 THR H N     1 
ATOM   6104  C  CA    . THR H 4  112 ? 185.190 159.847 174.780 1.00 103.84 ? 112 THR H CA    1 
ATOM   6105  C  C     . THR H 4  112 ? 185.975 159.103 175.850 1.00 103.84 ? 112 THR H C     1 
ATOM   6106  O  O     . THR H 4  112 ? 187.172 158.840 175.674 1.00 103.84 ? 112 THR H O     1 
ATOM   6107  C  CB    . THR H 4  112 ? 185.194 161.350 175.047 1.00 103.84 ? 112 THR H CB    1 
ATOM   6108  O  OG1   . THR H 4  112 ? 184.366 162.003 174.078 1.00 103.84 ? 112 THR H OG1   1 
ATOM   6109  C  CG2   . THR H 4  112 ? 186.599 161.927 174.943 1.00 103.84 ? 112 THR H CG2   1 
ATOM   6110  N  N     . LYS H 4  113 ? 185.306 158.721 176.942 1.00 100.83 ? 113 LYS H N     1 
ATOM   6111  C  CA    . LYS H 4  113 ? 185.962 157.926 177.972 1.00 100.83 ? 113 LYS H CA    1 
ATOM   6112  C  C     . LYS H 4  113 ? 186.328 156.538 177.457 1.00 100.83 ? 113 LYS H C     1 
ATOM   6113  O  O     . LYS H 4  113 ? 187.352 155.977 177.860 1.00 100.83 ? 113 LYS H O     1 
ATOM   6114  C  CB    . LYS H 4  113 ? 185.064 157.825 179.204 1.00 100.83 ? 113 LYS H CB    1 
ATOM   6115  C  CG    . LYS H 4  113 ? 185.704 157.144 180.403 1.00 100.83 ? 113 LYS H CG    1 
ATOM   6116  C  CD    . LYS H 4  113 ? 184.808 157.192 181.627 1.00 100.83 ? 113 LYS H CD    1 
ATOM   6117  C  CE    . LYS H 4  113 ? 183.651 156.217 181.496 1.00 100.83 ? 113 LYS H CE    1 
ATOM   6118  N  NZ    . LYS H 4  113 ? 182.818 156.150 182.732 1.00 100.83 ? 113 LYS H NZ    1 
ATOM   6119  N  N     . ALA H 4  114 ? 185.541 155.988 176.536 1.00 100.47 ? 114 ALA H N     1 
ATOM   6120  C  CA    . ALA H 4  114 ? 185.870 154.677 175.997 1.00 100.47 ? 114 ALA H CA    1 
ATOM   6121  C  C     . ALA H 4  114 ? 186.883 154.749 174.868 1.00 100.47 ? 114 ALA H C     1 
ATOM   6122  O  O     . ALA H 4  114 ? 187.655 153.806 174.678 1.00 100.47 ? 114 ALA H O     1 
ATOM   6123  C  CB    . ALA H 4  114 ? 184.615 153.979 175.501 1.00 100.47 ? 114 ALA H CB    1 
ATOM   6124  N  N     . VAL H 4  115 ? 186.871 155.830 174.090 1.00 102.53 ? 115 VAL H N     1 
ATOM   6125  C  CA    . VAL H 4  115 ? 187.898 156.021 173.072 1.00 102.53 ? 115 VAL H CA    1 
ATOM   6126  C  C     . VAL H 4  115 ? 189.257 156.220 173.724 1.00 102.53 ? 115 VAL H C     1 
ATOM   6127  O  O     . VAL H 4  115 ? 190.231 155.541 173.384 1.00 102.53 ? 115 VAL H O     1 
ATOM   6128  C  CB    . VAL H 4  115 ? 187.535 157.205 172.159 1.00 102.53 ? 115 VAL H CB    1 
ATOM   6129  C  CG1   . VAL H 4  115 ? 188.713 157.587 171.284 1.00 102.53 ? 115 VAL H CG1   1 
ATOM   6130  C  CG2   . VAL H 4  115 ? 186.357 156.841 171.291 1.00 102.53 ? 115 VAL H CG2   1 
ATOM   6131  N  N     . THR H 4  116 ? 189.336 157.148 174.679 1.00 104.83 ? 116 THR H N     1 
ATOM   6132  C  CA    . THR H 4  116 ? 190.601 157.428 175.342 1.00 104.83 ? 116 THR H CA    1 
ATOM   6133  C  C     . THR H 4  116 ? 191.020 156.266 176.226 1.00 104.83 ? 116 THR H C     1 
ATOM   6134  O  O     . THR H 4  116 ? 192.199 155.889 176.246 1.00 104.83 ? 116 THR H O     1 
ATOM   6135  C  CB    . THR H 4  116 ? 190.477 158.710 176.157 1.00 104.83 ? 116 THR H CB    1 
ATOM   6136  O  OG1   . THR H 4  116 ? 190.041 159.767 175.295 1.00 104.83 ? 116 THR H OG1   1 
ATOM   6137  C  CG2   . THR H 4  116 ? 191.812 159.094 176.760 1.00 104.83 ? 116 THR H CG2   1 
ATOM   6138  N  N     . LYS H 4  117 ? 190.062 155.666 176.935 1.00 100.91 ? 117 LYS H N     1 
ATOM   6139  C  CA    . LYS H 4  117 ? 190.354 154.525 177.795 1.00 100.91 ? 117 LYS H CA    1 
ATOM   6140  C  C     . LYS H 4  117 ? 190.784 153.315 176.979 1.00 100.91 ? 117 LYS H C     1 
ATOM   6141  O  O     . LYS H 4  117 ? 191.572 152.491 177.454 1.00 100.91 ? 117 LYS H O     1 
ATOM   6142  C  CB    . LYS H 4  117 ? 189.128 154.202 178.645 1.00 100.91 ? 117 LYS H CB    1 
ATOM   6143  C  CG    . LYS H 4  117 ? 189.348 153.207 179.775 1.00 100.91 ? 117 LYS H CG    1 
ATOM   6144  C  CD    . LYS H 4  117 ? 188.066 153.049 180.589 1.00 100.91 ? 117 LYS H CD    1 
ATOM   6145  C  CE    . LYS H 4  117 ? 188.275 152.242 181.863 1.00 100.91 ? 117 LYS H CE    1 
ATOM   6146  N  NZ    . LYS H 4  117 ? 188.588 150.817 181.599 1.00 100.91 ? 117 LYS H NZ    1 
ATOM   6147  N  N     . TYR H 4  118 ? 190.294 153.205 175.746 1.00 102.97 ? 118 TYR H N     1 
ATOM   6148  C  CA    . TYR H 4  118 ? 190.839 152.219 174.823 1.00 102.97 ? 118 TYR H CA    1 
ATOM   6149  C  C     . TYR H 4  118 ? 192.244 152.598 174.392 1.00 102.97 ? 118 TYR H C     1 
ATOM   6150  O  O     . TYR H 4  118 ? 193.141 151.748 174.355 1.00 102.97 ? 118 TYR H O     1 
ATOM   6151  C  CB    . TYR H 4  118 ? 189.936 152.088 173.599 1.00 102.97 ? 118 TYR H CB    1 
ATOM   6152  C  CG    . TYR H 4  118 ? 190.459 151.125 172.557 1.00 102.97 ? 118 TYR H CG    1 
ATOM   6153  C  CD1   . TYR H 4  118 ? 190.362 149.754 172.741 1.00 102.97 ? 118 TYR H CD1   1 
ATOM   6154  C  CD2   . TYR H 4  118 ? 191.053 151.593 171.390 1.00 102.97 ? 118 TYR H CD2   1 
ATOM   6155  C  CE1   . TYR H 4  118 ? 190.841 148.878 171.795 1.00 102.97 ? 118 TYR H CE1   1 
ATOM   6156  C  CE2   . TYR H 4  118 ? 191.535 150.727 170.446 1.00 102.97 ? 118 TYR H CE2   1 
ATOM   6157  C  CZ    . TYR H 4  118 ? 191.426 149.370 170.650 1.00 102.97 ? 118 TYR H CZ    1 
ATOM   6158  O  OH    . TYR H 4  118 ? 191.909 148.494 169.703 1.00 102.97 ? 118 TYR H OH    1 
ATOM   6159  N  N     . THR H 4  119 ? 192.448 153.869 174.064 1.00 103.23 ? 119 THR H N     1 
ATOM   6160  C  CA    . THR H 4  119 ? 193.659 154.305 173.389 1.00 103.23 ? 119 THR H CA    1 
ATOM   6161  C  C     . THR H 4  119 ? 194.864 154.295 174.322 1.00 103.23 ? 119 THR H C     1 
ATOM   6162  O  O     . THR H 4  119 ? 195.997 154.143 173.853 1.00 103.23 ? 119 THR H O     1 
ATOM   6163  C  CB    . THR H 4  119 ? 193.410 155.702 172.812 1.00 103.23 ? 119 THR H CB    1 
ATOM   6164  O  OG1   . THR H 4  119 ? 192.152 155.694 172.130 1.00 103.23 ? 119 THR H OG1   1 
ATOM   6165  C  CG2   . THR H 4  119 ? 194.474 156.086 171.799 1.00 103.23 ? 119 THR H CG2   1 
ATOM   6166  N  N     . SER H 4  120 ? 194.636 154.385 175.634 1.00 105.13 ? 120 SER H N     1 
ATOM   6167  C  CA    . SER H 4  120 ? 195.726 154.416 176.604 1.00 105.13 ? 120 SER H CA    1 
ATOM   6168  C  C     . SER H 4  120 ? 196.500 153.105 176.666 1.00 105.13 ? 120 SER H C     1 
ATOM   6169  O  O     . SER H 4  120 ? 197.642 153.099 177.134 1.00 105.13 ? 120 SER H O     1 
ATOM   6170  C  CB    . SER H 4  120 ? 195.184 154.754 177.994 1.00 105.13 ? 120 SER H CB    1 
ATOM   6171  O  OG    . SER H 4  120 ? 194.617 156.055 178.025 1.00 105.13 ? 120 SER H OG    1 
ATOM   6172  N  N     . ALA H 4  121 ? 195.911 152.005 176.211 1.00 105.42 ? 121 ALA H N     1 
ATOM   6173  C  CA    . ALA H 4  121 ? 196.636 150.748 176.119 1.00 105.42 ? 121 ALA H CA    1 
ATOM   6174  C  C     . ALA H 4  121 ? 197.447 150.699 174.829 1.00 105.42 ? 121 ALA H C     1 
ATOM   6175  O  O     . ALA H 4  121 ? 197.172 151.440 173.885 1.00 105.42 ? 121 ALA H O     1 
ATOM   6176  C  CB    . ALA H 4  121 ? 195.676 149.574 176.189 1.00 105.42 ? 121 ALA H CB    1 
ATOM   6177  P  P     . DA  I 5  1   ? 114.422 187.487 149.436 1.00 109.49 ? -73 DA  I P     1 
ATOM   6178  O  OP1   . DA  I 5  1   ? 115.215 187.609 148.193 1.00 109.49 ? -73 DA  I OP1   1 
ATOM   6179  O  OP2   . DA  I 5  1   ? 114.936 188.066 150.697 1.00 109.49 ? -73 DA  I OP2   1 
ATOM   6180  O  "O5'" . DA  I 5  1   ? 112.949 188.064 149.186 1.00 109.49 ? -73 DA  I "O5'" 1 
ATOM   6181  C  "C5'" . DA  I 5  1   ? 112.344 187.962 147.895 1.00 109.49 ? -73 DA  I "C5'" 1 
ATOM   6182  C  "C4'" . DA  I 5  1   ? 112.101 189.338 147.301 1.00 109.49 ? -73 DA  I "C4'" 1 
ATOM   6183  O  "O4'" . DA  I 5  1   ? 111.953 190.304 148.382 1.00 109.49 ? -73 DA  I "O4'" 1 
ATOM   6184  C  "C3'" . DA  I 5  1   ? 113.239 189.879 146.429 1.00 109.49 ? -73 DA  I "C3'" 1 
ATOM   6185  O  "O3'" . DA  I 5  1   ? 112.720 190.735 145.404 1.00 109.49 ? -73 DA  I "O3'" 1 
ATOM   6186  C  "C2'" . DA  I 5  1   ? 114.036 190.674 147.440 1.00 109.49 ? -73 DA  I "C2'" 1 
ATOM   6187  C  "C1'" . DA  I 5  1   ? 112.899 191.329 148.190 1.00 109.49 ? -73 DA  I "C1'" 1 
ATOM   6188  N  N9    . DA  I 5  1   ? 113.279 191.882 149.473 1.00 20.00  ? -73 DA  I N9    1 
ATOM   6189  C  C8    . DA  I 5  1   ? 113.227 191.284 150.707 1.00 20.00  ? -73 DA  I C8    1 
ATOM   6190  N  N7    . DA  I 5  1   ? 113.645 192.053 151.680 1.00 20.00  ? -73 DA  I N7    1 
ATOM   6191  C  C5    . DA  I 5  1   ? 114.004 193.239 151.055 1.00 20.00  ? -73 DA  I C5    1 
ATOM   6192  C  C6    . DA  I 5  1   ? 114.519 194.464 151.551 1.00 20.00  ? -73 DA  I C6    1 
ATOM   6193  N  N6    . DA  I 5  1   ? 114.758 194.697 152.848 1.00 20.00  ? -73 DA  I N6    1 
ATOM   6194  N  N1    . DA  I 5  1   ? 114.773 195.451 150.662 1.00 20.00  ? -73 DA  I N1    1 
ATOM   6195  C  C2    . DA  I 5  1   ? 114.520 195.224 149.366 1.00 20.00  ? -73 DA  I C2    1 
ATOM   6196  N  N3    . DA  I 5  1   ? 114.027 194.117 148.780 1.00 20.00  ? -73 DA  I N3    1 
ATOM   6197  C  C4    . DA  I 5  1   ? 113.789 193.151 149.690 1.00 20.00  ? -73 DA  I C4    1 
ATOM   6198  P  P     . DT  I 5  2   ? 113.424 190.782 143.958 1.00 110.37 ? -72 DT  I P     1 
ATOM   6199  O  OP1   . DT  I 5  2   ? 112.610 189.949 143.052 1.00 110.37 ? -72 DT  I OP1   1 
ATOM   6200  O  OP2   . DT  I 5  2   ? 114.852 190.459 144.157 1.00 110.37 ? -72 DT  I OP2   1 
ATOM   6201  O  "O5'" . DT  I 5  2   ? 113.306 192.314 143.490 1.00 110.37 ? -72 DT  I "O5'" 1 
ATOM   6202  C  "C5'" . DT  I 5  2   ? 113.608 192.665 142.127 1.00 110.37 ? -72 DT  I "C5'" 1 
ATOM   6203  C  "C4'" . DT  I 5  2   ? 113.856 194.159 141.977 1.00 110.37 ? -72 DT  I "C4'" 1 
ATOM   6204  O  "O4'" . DT  I 5  2   ? 114.125 194.733 143.280 1.00 110.37 ? -72 DT  I "O4'" 1 
ATOM   6205  C  "C3'" . DT  I 5  2   ? 115.079 194.531 141.154 1.00 110.37 ? -72 DT  I "C3'" 1 
ATOM   6206  O  "O3'" . DT  I 5  2   ? 114.985 195.902 140.759 1.00 110.37 ? -72 DT  I "O3'" 1 
ATOM   6207  C  "C2'" . DT  I 5  2   ? 116.163 194.351 142.197 1.00 110.37 ? -72 DT  I "C2'" 1 
ATOM   6208  C  "C1'" . DT  I 5  2   ? 115.501 195.062 143.366 1.00 110.37 ? -72 DT  I "C1'" 1 
ATOM   6209  N  N1    . DT  I 5  2   ? 115.968 194.662 144.674 1.00 20.00  ? -72 DT  I N1    1 
ATOM   6210  C  C2    . DT  I 5  2   ? 116.361 195.647 145.571 1.00 20.00  ? -72 DT  I C2    1 
ATOM   6211  O  O2    . DT  I 5  2   ? 116.345 196.852 145.314 1.00 20.00  ? -72 DT  I O2    1 
ATOM   6212  N  N3    . DT  I 5  2   ? 116.774 195.166 146.788 1.00 20.00  ? -72 DT  I N3    1 
ATOM   6213  C  C4    . DT  I 5  2   ? 116.843 193.859 147.198 1.00 20.00  ? -72 DT  I C4    1 
ATOM   6214  O  O4    . DT  I 5  2   ? 117.230 193.598 148.337 1.00 20.00  ? -72 DT  I O4    1 
ATOM   6215  C  C5    . DT  I 5  2   ? 116.436 192.880 146.209 1.00 20.00  ? -72 DT  I C5    1 
ATOM   6216  C  C7    . DT  I 5  2   ? 116.479 191.429 146.563 1.00 20.00  ? -72 DT  I C7    1 
ATOM   6217  C  C6    . DT  I 5  2   ? 116.031 193.328 145.008 1.00 20.00  ? -72 DT  I C6    1 
ATOM   6218  P  P     . DC  I 5  3   ? 115.799 196.458 139.489 1.00 110.64 ? -71 DC  I P     1 
ATOM   6219  O  OP1   . DC  I 5  3   ? 115.006 196.123 138.287 1.00 110.64 ? -71 DC  I OP1   1 
ATOM   6220  O  OP2   . DC  I 5  3   ? 117.202 196.008 139.585 1.00 110.64 ? -71 DC  I OP2   1 
ATOM   6221  O  "O5'" . DC  I 5  3   ? 115.783 198.047 139.687 1.00 110.64 ? -71 DC  I "O5'" 1 
ATOM   6222  C  "C5'" . DC  I 5  3   ? 115.830 198.597 141.003 1.00 110.64 ? -71 DC  I "C5'" 1 
ATOM   6223  C  "C4'" . DC  I 5  3   ? 116.833 199.737 141.108 1.00 110.64 ? -71 DC  I "C4'" 1 
ATOM   6224  O  "O4'" . DC  I 5  3   ? 117.548 199.608 142.362 1.00 110.64 ? -71 DC  I "O4'" 1 
ATOM   6225  C  "C3'" . DC  I 5  3   ? 117.936 199.735 140.068 1.00 110.64 ? -71 DC  I "C3'" 1 
ATOM   6226  O  "O3'" . DC  I 5  3   ? 118.598 201.002 140.074 1.00 110.64 ? -71 DC  I "O3'" 1 
ATOM   6227  C  "C2'" . DC  I 5  3   ? 118.839 198.657 140.640 1.00 110.64 ? -71 DC  I "C2'" 1 
ATOM   6228  C  "C1'" . DC  I 5  3   ? 118.830 199.052 142.112 1.00 110.64 ? -71 DC  I "C1'" 1 
ATOM   6229  N  N1    . DC  I 5  3   ? 119.041 197.854 143.052 1.00 20.00  ? -71 DC  I N1    1 
ATOM   6230  C  C2    . DC  I 5  3   ? 119.605 198.048 144.311 1.00 20.00  ? -71 DC  I C2    1 
ATOM   6231  O  O2    . DC  I 5  3   ? 119.944 199.189 144.646 1.00 20.00  ? -71 DC  I O2    1 
ATOM   6232  N  N3    . DC  I 5  3   ? 119.772 196.974 145.122 1.00 20.00  ? -71 DC  I N3    1 
ATOM   6233  C  C4    . DC  I 5  3   ? 119.397 195.751 144.730 1.00 20.00  ? -71 DC  I C4    1 
ATOM   6234  N  N4    . DC  I 5  3   ? 119.577 194.740 145.565 1.00 20.00  ? -71 DC  I N4    1 
ATOM   6235  C  C5    . DC  I 5  3   ? 118.819 195.526 143.441 1.00 20.00  ? -71 DC  I C5    1 
ATOM   6236  C  C6    . DC  I 5  3   ? 118.659 196.618 142.644 1.00 20.00  ? -71 DC  I C6    1 
ATOM   6237  P  P     . DG  I 5  4   ? 119.544 201.446 138.851 1.00 109.78 ? -70 DG  I P     1 
ATOM   6238  O  OP1   . DG  I 5  4   ? 118.662 201.683 137.691 1.00 109.78 ? -70 DG  I OP1   1 
ATOM   6239  O  OP2   . DG  I 5  4   ? 120.687 200.516 138.734 1.00 109.78 ? -70 DG  I OP2   1 
ATOM   6240  O  "O5'" . DG  I 5  4   ? 120.152 202.840 139.326 1.00 109.78 ? -70 DG  I "O5'" 1 
ATOM   6241  C  "C5'" . DG  I 5  4   ? 119.979 203.264 140.668 1.00 109.78 ? -70 DG  I "C5'" 1 
ATOM   6242  C  "C4'" . DG  I 5  4   ? 121.308 203.360 141.408 1.00 109.78 ? -70 DG  I "C4'" 1 
ATOM   6243  O  "O4'" . DG  I 5  4   ? 121.514 202.173 142.216 1.00 109.78 ? -70 DG  I "O4'" 1 
ATOM   6244  C  "C3'" . DG  I 5  4   ? 122.560 203.492 140.541 1.00 109.78 ? -70 DG  I "C3'" 1 
ATOM   6245  O  "O3'" . DG  I 5  4   ? 123.482 204.345 141.197 1.00 109.78 ? -70 DG  I "O3'" 1 
ATOM   6246  C  "C2'" . DG  I 5  4   ? 123.082 202.060 140.500 1.00 109.78 ? -70 DG  I "C2'" 1 
ATOM   6247  C  "C1'" . DG  I 5  4   ? 122.775 201.623 141.918 1.00 109.78 ? -70 DG  I "C1'" 1 
ATOM   6248  N  N9    . DG  I 5  4   ? 122.685 200.187 142.091 1.00 109.78 ? -70 DG  I N9    1 
ATOM   6249  C  C8    . DG  I 5  4   ? 122.175 199.273 141.211 1.00 109.78 ? -70 DG  I C8    1 
ATOM   6250  N  N7    . DG  I 5  4   ? 122.204 198.049 141.661 1.00 109.78 ? -70 DG  I N7    1 
ATOM   6251  C  C5    . DG  I 5  4   ? 122.781 198.166 142.911 1.00 109.78 ? -70 DG  I C5    1 
ATOM   6252  C  C6    . DG  I 5  4   ? 123.085 197.181 143.870 1.00 109.78 ? -70 DG  I C6    1 
ATOM   6253  O  O6    . DG  I 5  4   ? 122.900 195.959 143.806 1.00 109.78 ? -70 DG  I O6    1 
ATOM   6254  N  N1    . DG  I 5  4   ? 123.669 197.736 145.002 1.00 109.78 ? -70 DG  I N1    1 
ATOM   6255  C  C2    . DG  I 5  4   ? 123.922 199.074 145.179 1.00 109.78 ? -70 DG  I C2    1 
ATOM   6256  N  N2    . DG  I 5  4   ? 124.489 199.429 146.335 1.00 109.78 ? -70 DG  I N2    1 
ATOM   6257  N  N3    . DG  I 5  4   ? 123.643 200.001 144.289 1.00 109.78 ? -70 DG  I N3    1 
ATOM   6258  C  C4    . DG  I 5  4   ? 123.077 199.479 143.188 1.00 109.78 ? -70 DG  I C4    1 
ATOM   6259  P  P     . DG  I 5  5   ? 124.513 205.240 140.354 1.00 104.13 ? -69 DG  I P     1 
ATOM   6260  O  OP1   . DG  I 5  5   ? 123.976 206.620 140.333 1.00 104.13 ? -69 DG  I OP1   1 
ATOM   6261  O  OP2   . DG  I 5  5   ? 124.781 204.543 139.078 1.00 104.13 ? -69 DG  I OP2   1 
ATOM   6262  O  "O5'" . DG  I 5  5   ? 125.848 205.214 141.240 1.00 104.13 ? -69 DG  I "O5'" 1 
ATOM   6263  C  "C5'" . DG  I 5  5   ? 126.067 206.220 142.223 1.00 104.13 ? -69 DG  I "C5'" 1 
ATOM   6264  C  "C4'" . DG  I 5  5   ? 126.889 205.694 143.389 1.00 104.13 ? -69 DG  I "C4'" 1 
ATOM   6265  O  "O4'" . DG  I 5  5   ? 126.487 204.334 143.704 1.00 104.13 ? -69 DG  I "O4'" 1 
ATOM   6266  C  "C3'" . DG  I 5  5   ? 128.394 205.639 143.164 1.00 104.13 ? -69 DG  I "C3'" 1 
ATOM   6267  O  "O3'" . DG  I 5  5   ? 129.053 205.895 144.406 1.00 104.13 ? -69 DG  I "O3'" 1 
ATOM   6268  C  "C2'" . DG  I 5  5   ? 128.597 204.198 142.698 1.00 104.13 ? -69 DG  I "C2'" 1 
ATOM   6269  C  "C1'" . DG  I 5  5   ? 127.590 203.459 143.564 1.00 104.13 ? -69 DG  I "C1'" 1 
ATOM   6270  N  N9    . DG  I 5  5   ? 127.097 202.202 142.991 1.00 104.13 ? -69 DG  I N9    1 
ATOM   6271  C  C8    . DG  I 5  5   ? 126.367 202.056 141.840 1.00 104.13 ? -69 DG  I C8    1 
ATOM   6272  N  N7    . DG  I 5  5   ? 126.044 200.821 141.580 1.00 104.13 ? -69 DG  I N7    1 
ATOM   6273  C  C5    . DG  I 5  5   ? 126.576 200.098 142.635 1.00 104.13 ? -69 DG  I C5    1 
ATOM   6274  C  C6    . DG  I 5  5   ? 126.535 198.710 142.898 1.00 104.13 ? -69 DG  I C6    1 
ATOM   6275  O  O6    . DG  I 5  5   ? 126.012 197.815 142.222 1.00 104.13 ? -69 DG  I O6    1 
ATOM   6276  N  N1    . DG  I 5  5   ? 127.208 198.389 144.066 1.00 104.13 ? -69 DG  I N1    1 
ATOM   6277  C  C2    . DG  I 5  5   ? 127.830 199.296 144.886 1.00 104.13 ? -69 DG  I C2    1 
ATOM   6278  N  N2    . DG  I 5  5   ? 128.423 198.798 145.980 1.00 104.13 ? -69 DG  I N2    1 
ATOM   6279  N  N3    . DG  I 5  5   ? 127.871 200.602 144.657 1.00 104.13 ? -69 DG  I N3    1 
ATOM   6280  C  C4    . DG  I 5  5   ? 127.227 200.931 143.517 1.00 104.13 ? -69 DG  I C4    1 
ATOM   6281  P  P     . DA  I 5  6   ? 130.606 206.320 144.472 1.00 102.03 ? -68 DA  I P     1 
ATOM   6282  O  OP1   . DA  I 5  6   ? 130.671 207.686 145.031 1.00 102.03 ? -68 DA  I OP1   1 
ATOM   6283  O  OP2   . DA  I 5  6   ? 131.264 206.042 143.178 1.00 102.03 ? -68 DA  I OP2   1 
ATOM   6284  O  "O5'" . DA  I 5  6   ? 131.213 205.313 145.557 1.00 102.03 ? -68 DA  I "O5'" 1 
ATOM   6285  C  "C5'" . DA  I 5  6   ? 130.540 204.083 145.835 1.00 102.03 ? -68 DA  I "C5'" 1 
ATOM   6286  C  "C4'" . DA  I 5  6   ? 131.395 202.895 145.441 1.00 102.03 ? -68 DA  I "C4'" 1 
ATOM   6287  O  "O4'" . DA  I 5  6   ? 130.605 201.905 144.722 1.00 102.03 ? -68 DA  I "O4'" 1 
ATOM   6288  C  "C3'" . DA  I 5  6   ? 132.581 203.224 144.517 1.00 102.03 ? -68 DA  I "C3'" 1 
ATOM   6289  O  "O3'" . DA  I 5  6   ? 133.720 202.480 144.910 1.00 102.03 ? -68 DA  I "O3'" 1 
ATOM   6290  C  "C2'" . DA  I 5  6   ? 132.076 202.711 143.174 1.00 102.03 ? -68 DA  I "C2'" 1 
ATOM   6291  C  "C1'" . DA  I 5  6   ? 131.406 201.454 143.669 1.00 102.03 ? -68 DA  I "C1'" 1 
ATOM   6292  N  N9    . DA  I 5  6   ? 130.612 200.741 142.676 1.00 102.03 ? -68 DA  I N9    1 
ATOM   6293  C  C8    . DA  I 5  6   ? 130.003 201.255 141.571 1.00 102.03 ? -68 DA  I C8    1 
ATOM   6294  N  N7    . DA  I 5  6   ? 129.372 200.361 140.849 1.00 102.03 ? -68 DA  I N7    1 
ATOM   6295  C  C5    . DA  I 5  6   ? 129.598 199.176 141.520 1.00 102.03 ? -68 DA  I C5    1 
ATOM   6296  C  C6    . DA  I 5  6   ? 129.203 197.852 141.264 1.00 102.03 ? -68 DA  I C6    1 
ATOM   6297  N  N6    . DA  I 5  6   ? 128.452 197.502 140.223 1.00 102.03 ? -68 DA  I N6    1 
ATOM   6298  N  N1    . DA  I 5  6   ? 129.587 196.902 142.140 1.00 102.03 ? -68 DA  I N1    1 
ATOM   6299  C  C2    . DA  I 5  6   ? 130.334 197.257 143.190 1.00 102.03 ? -68 DA  I C2    1 
ATOM   6300  N  N3    . DA  I 5  6   ? 130.775 198.467 143.528 1.00 102.03 ? -68 DA  I N3    1 
ATOM   6301  C  C4    . DA  I 5  6   ? 130.365 199.389 142.644 1.00 102.03 ? -68 DA  I C4    1 
ATOM   6302  P  P     . DT  I 5  7   ? 134.606 202.853 146.202 1.00 97.31  ? -67 DT  I P     1 
ATOM   6303  O  OP1   . DT  I 5  7   ? 133.966 203.823 147.114 1.00 97.31  ? -67 DT  I OP1   1 
ATOM   6304  O  OP2   . DT  I 5  7   ? 135.946 203.168 145.679 1.00 97.31  ? -67 DT  I OP2   1 
ATOM   6305  O  "O5'" . DT  I 5  7   ? 134.737 201.435 146.920 1.00 97.31  ? -67 DT  I "O5'" 1 
ATOM   6306  C  "C5'" . DT  I 5  7   ? 133.862 200.367 146.527 1.00 97.31  ? -67 DT  I "C5'" 1 
ATOM   6307  C  "C4'" . DT  I 5  7   ? 134.608 199.291 145.757 1.00 97.31  ? -67 DT  I "C4'" 1 
ATOM   6308  O  "O4'" . DT  I 5  7   ? 133.821 198.849 144.601 1.00 97.31  ? -67 DT  I "O4'" 1 
ATOM   6309  C  "C3'" . DT  I 5  7   ? 135.959 199.723 145.181 1.00 97.31  ? -67 DT  I "C3'" 1 
ATOM   6310  O  "O3'" . DT  I 5  7   ? 136.869 198.665 145.287 1.00 97.31  ? -67 DT  I "O3'" 1 
ATOM   6311  C  "C2'" . DT  I 5  7   ? 135.601 199.991 143.732 1.00 97.31  ? -67 DT  I "C2'" 1 
ATOM   6312  C  "C1'" . DT  I 5  7   ? 134.698 198.799 143.505 1.00 97.31  ? -67 DT  I "C1'" 1 
ATOM   6313  N  N1    . DT  I 5  7   ? 133.942 198.804 142.217 1.00 97.31  ? -67 DT  I N1    1 
ATOM   6314  C  C2    . DT  I 5  7   ? 133.450 197.623 141.727 1.00 97.31  ? -67 DT  I C2    1 
ATOM   6315  O  O2    . DT  I 5  7   ? 133.583 196.560 142.297 1.00 97.31  ? -67 DT  I O2    1 
ATOM   6316  N  N3    . DT  I 5  7   ? 132.787 197.735 140.538 1.00 97.31  ? -67 DT  I N3    1 
ATOM   6317  C  C4    . DT  I 5  7   ? 132.575 198.877 139.802 1.00 97.31  ? -67 DT  I C4    1 
ATOM   6318  O  O4    . DT  I 5  7   ? 131.960 198.870 138.741 1.00 97.31  ? -67 DT  I O4    1 
ATOM   6319  C  C5    . DT  I 5  7   ? 133.128 200.079 140.367 1.00 97.31  ? -67 DT  I C5    1 
ATOM   6320  C  C7    . DT  I 5  7   ? 132.968 201.389 139.658 1.00 97.31  ? -67 DT  I C7    1 
ATOM   6321  C  C6    . DT  I 5  7   ? 133.790 199.982 141.524 1.00 97.31  ? -67 DT  I C6    1 
ATOM   6322  P  P     . DG  I 5  8   ? 137.921 198.635 146.492 1.00 90.52  ? -66 DG  I P     1 
ATOM   6323  O  OP1   . DG  I 5  8   ? 137.167 198.335 147.725 1.00 90.52  ? -66 DG  I OP1   1 
ATOM   6324  O  OP2   . DG  I 5  8   ? 138.743 199.861 146.409 1.00 90.52  ? -66 DG  I OP2   1 
ATOM   6325  O  "O5'" . DG  I 5  8   ? 138.836 197.372 146.154 1.00 90.52  ? -66 DG  I "O5'" 1 
ATOM   6326  C  "C5'" . DG  I 5  8   ? 138.491 196.102 146.673 1.00 90.52  ? -66 DG  I "C5'" 1 
ATOM   6327  C  "C4'" . DG  I 5  8   ? 138.177 195.125 145.560 1.00 90.52  ? -66 DG  I "C4'" 1 
ATOM   6328  O  "O4'" . DG  I 5  8   ? 137.380 195.773 144.547 1.00 90.52  ? -66 DG  I "O4'" 1 
ATOM   6329  C  "C3'" . DG  I 5  8   ? 139.393 194.535 144.848 1.00 90.52  ? -66 DG  I "C3'" 1 
ATOM   6330  O  "O3'" . DG  I 5  8   ? 139.339 193.116 144.947 1.00 90.52  ? -66 DG  I "O3'" 1 
ATOM   6331  C  "C2'" . DG  I 5  8   ? 139.256 195.027 143.396 1.00 90.52  ? -66 DG  I "C2'" 1 
ATOM   6332  C  "C1'" . DG  I 5  8   ? 137.770 195.318 143.281 1.00 90.52  ? -66 DG  I "C1'" 1 
ATOM   6333  N  N9    . DG  I 5  8   ? 137.454 196.376 142.338 1.00 90.52  ? -66 DG  I N9    1 
ATOM   6334  C  C8    . DG  I 5  8   ? 137.823 197.686 142.442 1.00 90.52  ? -66 DG  I C8    1 
ATOM   6335  N  N7    . DG  I 5  8   ? 137.394 198.427 141.462 1.00 90.52  ? -66 DG  I N7    1 
ATOM   6336  C  C5    . DG  I 5  8   ? 136.667 197.558 140.671 1.00 90.52  ? -66 DG  I C5    1 
ATOM   6337  C  C6    . DG  I 5  8   ? 135.966 197.802 139.473 1.00 90.52  ? -66 DG  I C6    1 
ATOM   6338  O  O6    . DG  I 5  8   ? 135.839 198.869 138.864 1.00 90.52  ? -66 DG  I O6    1 
ATOM   6339  N  N1    . DG  I 5  8   ? 135.377 196.652 138.978 1.00 90.52  ? -66 DG  I N1    1 
ATOM   6340  C  C2    . DG  I 5  8   ? 135.447 195.422 139.573 1.00 90.52  ? -66 DG  I C2    1 
ATOM   6341  N  N2    . DG  I 5  8   ? 134.824 194.426 138.935 1.00 90.52  ? -66 DG  I N2    1 
ATOM   6342  N  N3    . DG  I 5  8   ? 136.108 195.173 140.698 1.00 90.52  ? -66 DG  I N3    1 
ATOM   6343  C  C4    . DG  I 5  8   ? 136.687 196.289 141.193 1.00 90.52  ? -66 DG  I C4    1 
ATOM   6344  P  P     . DT  I 5  9   ? 140.579 192.201 144.500 1.00 90.25  ? -65 DT  I P     1 
ATOM   6345  O  OP1   . DT  I 5  9   ? 140.704 191.088 145.462 1.00 90.25  ? -65 DT  I OP1   1 
ATOM   6346  O  OP2   . DT  I 5  9   ? 141.754 193.065 144.272 1.00 90.25  ? -65 DT  I OP2   1 
ATOM   6347  O  "O5'" . DT  I 5  9   ? 140.093 191.607 143.102 1.00 90.25  ? -65 DT  I "O5'" 1 
ATOM   6348  C  "C5'" . DT  I 5  9   ? 138.705 191.400 142.876 1.00 90.25  ? -65 DT  I "C5'" 1 
ATOM   6349  C  "C4'" . DT  I 5  9   ? 138.434 191.039 141.430 1.00 90.25  ? -65 DT  I "C4'" 1 
ATOM   6350  O  "O4'" . DT  I 5  9   ? 137.941 192.207 140.707 1.00 90.25  ? -65 DT  I "O4'" 1 
ATOM   6351  C  "C3'" . DT  I 5  9   ? 139.648 190.542 140.638 1.00 90.25  ? -65 DT  I "C3'" 1 
ATOM   6352  O  "O3'" . DT  I 5  9   ? 139.234 189.496 139.763 1.00 90.25  ? -65 DT  I "O3'" 1 
ATOM   6353  C  "C2'" . DT  I 5  9   ? 140.041 191.786 139.854 1.00 90.25  ? -65 DT  I "C2'" 1 
ATOM   6354  C  "C1'" . DT  I 5  9   ? 138.664 192.315 139.506 1.00 90.25  ? -65 DT  I "C1'" 1 
ATOM   6355  N  N1    . DT  I 5  9   ? 138.662 193.725 139.046 1.00 90.25  ? -65 DT  I N1    1 
ATOM   6356  C  C2    . DT  I 5  9   ? 137.939 194.070 137.926 1.00 90.25  ? -65 DT  I C2    1 
ATOM   6357  O  O2    . DT  I 5  9   ? 137.293 193.272 137.277 1.00 90.25  ? -65 DT  I O2    1 
ATOM   6358  N  N3    . DT  I 5  9   ? 138.019 195.392 137.584 1.00 90.25  ? -65 DT  I N3    1 
ATOM   6359  C  C4    . DT  I 5  9   ? 138.723 196.376 138.239 1.00 90.25  ? -65 DT  I C4    1 
ATOM   6360  O  O4    . DT  I 5  9   ? 138.730 197.541 137.863 1.00 90.25  ? -65 DT  I O4    1 
ATOM   6361  C  C5    . DT  I 5  9   ? 139.457 195.941 139.398 1.00 90.25  ? -65 DT  I C5    1 
ATOM   6362  C  C7    . DT  I 5  9   ? 140.267 196.921 140.182 1.00 90.25  ? -65 DT  I C7    1 
ATOM   6363  C  C6    . DT  I 5  9   ? 139.393 194.654 139.738 1.00 90.25  ? -65 DT  I C6    1 
ATOM   6364  P  P     . DA  I 5  10  ? 140.297 188.494 139.091 1.00 89.13  ? -64 DA  I P     1 
ATOM   6365  O  OP1   . DA  I 5  10  ? 139.987 187.149 139.620 1.00 89.13  ? -64 DA  I OP1   1 
ATOM   6366  O  OP2   . DA  I 5  10  ? 141.661 189.042 139.256 1.00 89.13  ? -64 DA  I OP2   1 
ATOM   6367  O  "O5'" . DA  I 5  10  ? 139.919 188.517 137.531 1.00 89.13  ? -64 DA  I "O5'" 1 
ATOM   6368  C  "C5'" . DA  I 5  10  ? 138.780 187.791 137.057 1.00 89.13  ? -64 DA  I "C5'" 1 
ATOM   6369  C  "C4'" . DA  I 5  10  ? 138.311 188.290 135.695 1.00 89.13  ? -64 DA  I "C4'" 1 
ATOM   6370  O  "O4'" . DA  I 5  10  ? 138.162 189.733 135.725 1.00 89.13  ? -64 DA  I "O4'" 1 
ATOM   6371  C  "C3'" . DA  I 5  10  ? 139.244 187.998 134.515 1.00 89.13  ? -64 DA  I "C3'" 1 
ATOM   6372  O  "O3'" . DA  I 5  10  ? 138.480 187.746 133.335 1.00 89.13  ? -64 DA  I "O3'" 1 
ATOM   6373  C  "C2'" . DA  I 5  10  ? 140.021 189.295 134.383 1.00 89.13  ? -64 DA  I "C2'" 1 
ATOM   6374  C  "C1'" . DA  I 5  10  ? 138.940 190.314 134.700 1.00 89.13  ? -64 DA  I "C1'" 1 
ATOM   6375  N  N9    . DA  I 5  10  ? 139.477 191.556 135.206 1.00 89.13  ? -64 DA  I N9    1 
ATOM   6376  C  C8    . DA  I 5  10  ? 140.100 191.728 136.392 1.00 89.13  ? -64 DA  I C8    1 
ATOM   6377  N  N7    . DA  I 5  10  ? 140.501 192.945 136.609 1.00 89.13  ? -64 DA  I N7    1 
ATOM   6378  C  C5    . DA  I 5  10  ? 140.109 193.622 135.479 1.00 89.13  ? -64 DA  I C5    1 
ATOM   6379  C  C6    . DA  I 5  10  ? 140.245 194.957 135.096 1.00 89.13  ? -64 DA  I C6    1 
ATOM   6380  N  N6    . DA  I 5  10  ? 140.833 195.877 135.862 1.00 89.13  ? -64 DA  I N6    1 
ATOM   6381  N  N1    . DA  I 5  10  ? 139.753 195.317 133.894 1.00 89.13  ? -64 DA  I N1    1 
ATOM   6382  C  C2    . DA  I 5  10  ? 139.176 194.385 133.126 1.00 89.13  ? -64 DA  I C2    1 
ATOM   6383  N  N3    . DA  I 5  10  ? 138.980 193.093 133.393 1.00 89.13  ? -64 DA  I N3    1 
ATOM   6384  C  C4    . DA  I 5  10  ? 139.470 192.781 134.600 1.00 89.13  ? -64 DA  I C4    1 
ATOM   6385  P  P     . DT  I 5  11  ? 139.213 187.364 131.961 1.00 86.43  ? -63 DT  I P     1 
ATOM   6386  O  OP1   . DT  I 5  11  ? 138.275 186.535 131.187 1.00 86.43  ? -63 DT  I OP1   1 
ATOM   6387  O  OP2   . DT  I 5  11  ? 140.542 186.823 132.300 1.00 86.43  ? -63 DT  I OP2   1 
ATOM   6388  O  "O5'" . DT  I 5  11  ? 139.415 188.762 131.200 1.00 86.43  ? -63 DT  I "O5'" 1 
ATOM   6389  C  "C5'" . DT  I 5  11  ? 138.317 189.368 130.524 1.00 86.43  ? -63 DT  I "C5'" 1 
ATOM   6390  C  "C4'" . DT  I 5  11  ? 138.778 190.343 129.445 1.00 86.43  ? -63 DT  I "C4'" 1 
ATOM   6391  O  "O4'" . DT  I 5  11  ? 139.226 191.582 130.051 1.00 86.43  ? -63 DT  I "O4'" 1 
ATOM   6392  C  "C3'" . DT  I 5  11  ? 139.922 189.866 128.549 1.00 86.43  ? -63 DT  I "C3'" 1 
ATOM   6393  O  "O3'" . DT  I 5  11  ? 139.634 190.201 127.195 1.00 86.43  ? -63 DT  I "O3'" 1 
ATOM   6394  C  "C2'" . DT  I 5  11  ? 141.125 190.650 129.078 1.00 86.43  ? -63 DT  I "C2'" 1 
ATOM   6395  C  "C1'" . DT  I 5  11  ? 140.474 191.952 129.512 1.00 86.43  ? -63 DT  I "C1'" 1 
ATOM   6396  N  N1    . DT  I 5  11  ? 141.228 192.683 130.567 1.00 86.43  ? -63 DT  I N1    1 
ATOM   6397  C  C2    . DT  I 5  11  ? 141.515 194.016 130.397 1.00 86.43  ? -63 DT  I C2    1 
ATOM   6398  O  O2    . DT  I 5  11  ? 141.200 194.643 129.405 1.00 86.43  ? -63 DT  I O2    1 
ATOM   6399  N  N3    . DT  I 5  11  ? 142.196 194.591 131.434 1.00 86.43  ? -63 DT  I N3    1 
ATOM   6400  C  C4    . DT  I 5  11  ? 142.606 193.975 132.602 1.00 86.43  ? -63 DT  I C4    1 
ATOM   6401  O  O4    . DT  I 5  11  ? 143.216 194.567 133.481 1.00 86.43  ? -63 DT  I O4    1 
ATOM   6402  C  C5    . DT  I 5  11  ? 142.272 192.583 132.718 1.00 86.43  ? -63 DT  I C5    1 
ATOM   6403  C  C7    . DT  I 5  11  ? 142.687 191.811 133.936 1.00 86.43  ? -63 DT  I C7    1 
ATOM   6404  C  C6    . DT  I 5  11  ? 141.603 192.010 131.709 1.00 86.43  ? -63 DT  I C6    1 
ATOM   6405  P  P     . DA  I 5  12  ? 140.599 189.723 126.004 1.00 86.37  ? -62 DA  I P     1 
ATOM   6406  O  OP1   . DA  I 5  12  ? 139.788 189.612 124.773 1.00 86.37  ? -62 DA  I OP1   1 
ATOM   6407  O  OP2   . DA  I 5  12  ? 141.345 188.544 126.488 1.00 86.37  ? -62 DA  I OP2   1 
ATOM   6408  O  "O5'" . DA  I 5  12  ? 141.617 190.942 125.822 1.00 86.37  ? -62 DA  I "O5'" 1 
ATOM   6409  C  "C5'" . DA  I 5  12  ? 142.391 191.062 124.631 1.00 86.37  ? -62 DA  I "C5'" 1 
ATOM   6410  C  "C4'" . DA  I 5  12  ? 142.315 192.474 124.080 1.00 86.37  ? -62 DA  I "C4'" 1 
ATOM   6411  O  "O4'" . DA  I 5  12  ? 142.238 193.409 125.179 1.00 86.37  ? -62 DA  I "O4'" 1 
ATOM   6412  C  "C3'" . DA  I 5  12  ? 143.525 192.917 123.282 1.00 86.37  ? -62 DA  I "C3'" 1 
ATOM   6413  O  "O3'" . DA  I 5  12  ? 143.181 193.984 122.416 1.00 86.37  ? -62 DA  I "O3'" 1 
ATOM   6414  C  "C2'" . DA  I 5  12  ? 144.455 193.384 124.383 1.00 86.37  ? -62 DA  I "C2'" 1 
ATOM   6415  C  "C1'" . DA  I 5  12  ? 143.484 194.058 125.341 1.00 86.37  ? -62 DA  I "C1'" 1 
ATOM   6416  N  N9    . DA  I 5  12  ? 143.871 193.931 126.730 1.00 86.37  ? -62 DA  I N9    1 
ATOM   6417  C  C8    . DA  I 5  12  ? 143.656 192.858 127.544 1.00 86.37  ? -62 DA  I C8    1 
ATOM   6418  N  N7    . DA  I 5  12  ? 144.118 193.021 128.758 1.00 86.37  ? -62 DA  I N7    1 
ATOM   6419  C  C5    . DA  I 5  12  ? 144.655 194.295 128.738 1.00 86.37  ? -62 DA  I C5    1 
ATOM   6420  C  C6    . DA  I 5  12  ? 145.295 195.068 129.721 1.00 86.37  ? -62 DA  I C6    1 
ATOM   6421  N  N6    . DA  I 5  12  ? 145.499 194.637 130.961 1.00 86.37  ? -62 DA  I N6    1 
ATOM   6422  N  N1    . DA  I 5  12  ? 145.714 196.298 129.377 1.00 86.37  ? -62 DA  I N1    1 
ATOM   6423  C  C2    . DA  I 5  12  ? 145.510 196.725 128.125 1.00 86.37  ? -62 DA  I C2    1 
ATOM   6424  N  N3    . DA  I 5  12  ? 144.919 196.089 127.115 1.00 86.37  ? -62 DA  I N3    1 
ATOM   6425  C  C4    . DA  I 5  12  ? 144.510 194.870 127.496 1.00 86.37  ? -62 DA  I C4    1 
ATOM   6426  P  P     . DT  I 5  13  ? 144.084 194.289 121.122 1.00 87.54  ? -61 DT  I P     1 
ATOM   6427  O  OP1   . DT  I 5  13  ? 143.304 195.145 120.207 1.00 87.54  ? -61 DT  I OP1   1 
ATOM   6428  O  OP2   . DT  I 5  13  ? 144.607 192.999 120.637 1.00 87.54  ? -61 DT  I OP2   1 
ATOM   6429  O  "O5'" . DT  I 5  13  ? 145.322 195.122 121.698 1.00 87.54  ? -61 DT  I "O5'" 1 
ATOM   6430  C  "C5'" . DT  I 5  13  ? 145.097 196.368 122.333 1.00 87.54  ? -61 DT  I "C5'" 1 
ATOM   6431  C  "C4'" . DT  I 5  13  ? 146.402 197.051 122.685 1.00 87.54  ? -61 DT  I "C4'" 1 
ATOM   6432  O  "O4'" . DT  I 5  13  ? 146.630 196.960 124.118 1.00 87.54  ? -61 DT  I "O4'" 1 
ATOM   6433  C  "C3'" . DT  I 5  13  ? 147.650 196.464 122.018 1.00 87.54  ? -61 DT  I "C3'" 1 
ATOM   6434  O  "O3'" . DT  I 5  13  ? 148.503 197.516 121.573 1.00 87.54  ? -61 DT  I "O3'" 1 
ATOM   6435  C  "C2'" . DT  I 5  13  ? 148.291 195.684 123.153 1.00 87.54  ? -61 DT  I "C2'" 1 
ATOM   6436  C  "C1'" . DT  I 5  13  ? 147.959 196.570 124.333 1.00 87.54  ? -61 DT  I "C1'" 1 
ATOM   6437  N  N1    . DT  I 5  13  ? 148.037 195.857 125.612 1.00 87.54  ? -61 DT  I N1    1 
ATOM   6438  C  C2    . DT  I 5  13  ? 148.615 196.469 126.697 1.00 87.54  ? -61 DT  I C2    1 
ATOM   6439  O  O2    . DT  I 5  13  ? 149.075 197.594 126.670 1.00 87.54  ? -61 DT  I O2    1 
ATOM   6440  N  N3    . DT  I 5  13  ? 148.645 195.701 127.821 1.00 87.54  ? -61 DT  I N3    1 
ATOM   6441  C  C4    . DT  I 5  13  ? 148.158 194.415 127.966 1.00 87.54  ? -61 DT  I C4    1 
ATOM   6442  O  O4    . DT  I 5  13  ? 148.227 193.799 129.017 1.00 87.54  ? -61 DT  I O4    1 
ATOM   6443  C  C5    . DT  I 5  13  ? 147.581 193.840 126.792 1.00 87.54  ? -61 DT  I C5    1 
ATOM   6444  C  C7    . DT  I 5  13  ? 147.035 192.451 126.835 1.00 87.54  ? -61 DT  I C7    1 
ATOM   6445  C  C6    . DT  I 5  13  ? 147.548 194.579 125.685 1.00 87.54  ? -61 DT  I C6    1 
ATOM   6446  P  P     . DA  I 5  14  ? 149.776 197.215 120.632 1.00 88.40  ? -60 DA  I P     1 
ATOM   6447  O  OP1   . DA  I 5  14  ? 149.642 198.100 119.459 1.00 88.40  ? -60 DA  I OP1   1 
ATOM   6448  O  OP2   . DA  I 5  14  ? 149.957 195.765 120.409 1.00 88.40  ? -60 DA  I OP2   1 
ATOM   6449  O  "O5'" . DA  I 5  14  ? 151.008 197.746 121.496 1.00 88.40  ? -60 DA  I "O5'" 1 
ATOM   6450  C  "C5'" . DA  I 5  14  ? 151.332 199.131 121.473 1.00 88.40  ? -60 DA  I "C5'" 1 
ATOM   6451  C  "C4'" . DA  I 5  14  ? 152.073 199.552 122.729 1.00 88.40  ? -60 DA  I "C4'" 1 
ATOM   6452  O  "O4'" . DA  I 5  14  ? 151.573 198.802 123.869 1.00 88.40  ? -60 DA  I "O4'" 1 
ATOM   6453  C  "C3'" . DA  I 5  14  ? 153.578 199.307 122.714 1.00 88.40  ? -60 DA  I "C3'" 1 
ATOM   6454  O  "O3'" . DA  I 5  14  ? 154.208 200.303 123.483 1.00 88.40  ? -60 DA  I "O3'" 1 
ATOM   6455  C  "C2'" . DA  I 5  14  ? 153.675 197.962 123.405 1.00 88.40  ? -60 DA  I "C2'" 1 
ATOM   6456  C  "C1'" . DA  I 5  14  ? 152.660 198.170 124.507 1.00 88.40  ? -60 DA  I "C1'" 1 
ATOM   6457  N  N9    . DA  I 5  14  ? 152.188 196.952 125.168 1.00 88.40  ? -60 DA  I N9    1 
ATOM   6458  C  C8    . DA  I 5  14  ? 151.432 195.951 124.634 1.00 88.40  ? -60 DA  I C8    1 
ATOM   6459  N  N7    . DA  I 5  14  ? 151.144 194.993 125.483 1.00 88.40  ? -60 DA  I N7    1 
ATOM   6460  C  C5    . DA  I 5  14  ? 151.737 195.411 126.656 1.00 88.40  ? -60 DA  I C5    1 
ATOM   6461  C  C6    . DA  I 5  14  ? 151.796 194.853 127.947 1.00 88.40  ? -60 DA  I C6    1 
ATOM   6462  N  N6    . DA  I 5  14  ? 151.226 193.690 128.276 1.00 88.40  ? -60 DA  I N6    1 
ATOM   6463  N  N1    . DA  I 5  14  ? 152.472 195.537 128.897 1.00 88.40  ? -60 DA  I N1    1 
ATOM   6464  C  C2    . DA  I 5  14  ? 153.038 196.700 128.567 1.00 88.40  ? -60 DA  I C2    1 
ATOM   6465  N  N3    . DA  I 5  14  ? 153.048 197.319 127.392 1.00 88.40  ? -60 DA  I N3    1 
ATOM   6466  C  C4    . DA  I 5  14  ? 152.374 196.618 126.477 1.00 88.40  ? -60 DA  I C4    1 
ATOM   6467  P  P     . DT  I 5  15  ? 155.621 200.911 123.033 1.00 90.82  ? -59 DT  I P     1 
ATOM   6468  O  OP1   . DT  I 5  15  ? 155.333 202.151 122.278 1.00 90.82  ? -59 DT  I OP1   1 
ATOM   6469  O  OP2   . DT  I 5  15  ? 156.392 199.827 122.385 1.00 90.82  ? -59 DT  I OP2   1 
ATOM   6470  O  "O5'" . DT  I 5  15  ? 156.327 201.304 124.419 1.00 90.82  ? -59 DT  I "O5'" 1 
ATOM   6471  C  "C5'" . DT  I 5  15  ? 155.937 200.659 125.634 1.00 90.82  ? -59 DT  I "C5'" 1 
ATOM   6472  C  "C4'" . DT  I 5  15  ? 157.135 200.024 126.316 1.00 90.82  ? -59 DT  I "C4'" 1 
ATOM   6473  O  "O4'" . DT  I 5  15  ? 156.703 198.822 127.014 1.00 90.82  ? -59 DT  I "O4'" 1 
ATOM   6474  C  "C3'" . DT  I 5  15  ? 158.210 199.529 125.358 1.00 90.82  ? -59 DT  I "C3'" 1 
ATOM   6475  O  "O3'" . DT  I 5  15  ? 159.392 199.291 126.068 1.00 90.82  ? -59 DT  I "O3'" 1 
ATOM   6476  C  "C2'" . DT  I 5  15  ? 157.615 198.202 124.980 1.00 90.82  ? -59 DT  I "C2'" 1 
ATOM   6477  C  "C1'" . DT  I 5  15  ? 157.324 197.722 126.389 1.00 90.82  ? -59 DT  I "C1'" 1 
ATOM   6478  N  N1    . DT  I 5  15  ? 156.474 196.531 126.471 1.00 90.82  ? -59 DT  I N1    1 
ATOM   6479  C  C2    . DT  I 5  15  ? 156.331 195.907 127.679 1.00 90.82  ? -59 DT  I C2    1 
ATOM   6480  O  O2    . DT  I 5  15  ? 156.854 196.308 128.700 1.00 90.82  ? -59 DT  I O2    1 
ATOM   6481  N  N3    . DT  I 5  15  ? 155.542 194.795 127.651 1.00 90.82  ? -59 DT  I N3    1 
ATOM   6482  C  C4    . DT  I 5  15  ? 154.904 194.257 126.560 1.00 90.82  ? -59 DT  I C4    1 
ATOM   6483  O  O4    . DT  I 5  15  ? 154.214 193.253 126.637 1.00 90.82  ? -59 DT  I O4    1 
ATOM   6484  C  C5    . DT  I 5  15  ? 155.112 194.956 125.319 1.00 90.82  ? -59 DT  I C5    1 
ATOM   6485  C  C7    . DT  I 5  15  ? 154.483 194.454 124.057 1.00 90.82  ? -59 DT  I C7    1 
ATOM   6486  C  C6    . DT  I 5  15  ? 155.888 196.036 125.334 1.00 90.82  ? -59 DT  I C6    1 
ATOM   6487  P  P     . DC  I 5  16  ? 160.509 200.420 126.232 1.00 89.22  ? -58 DC  I P     1 
ATOM   6488  O  OP1   . DC  I 5  16  ? 159.945 201.717 125.804 1.00 89.22  ? -58 DC  I OP1   1 
ATOM   6489  O  OP2   . DC  I 5  16  ? 161.742 199.889 125.608 1.00 89.22  ? -58 DC  I OP2   1 
ATOM   6490  O  "O5'" . DC  I 5  16  ? 160.763 200.427 127.805 1.00 89.22  ? -58 DC  I "O5'" 1 
ATOM   6491  C  "C5'" . DC  I 5  16  ? 162.055 200.209 128.292 1.00 89.22  ? -58 DC  I "C5'" 1 
ATOM   6492  C  "C4'" . DC  I 5  16  ? 162.225 198.802 128.837 1.00 89.22  ? -58 DC  I "C4'" 1 
ATOM   6493  O  "O4'" . DC  I 5  16  ? 161.133 197.919 128.422 1.00 89.22  ? -58 DC  I "O4'" 1 
ATOM   6494  C  "C3'" . DC  I 5  16  ? 163.507 198.100 128.384 1.00 89.22  ? -58 DC  I "C3'" 1 
ATOM   6495  O  "O3'" . DC  I 5  16  ? 164.047 197.388 129.462 1.00 89.22  ? -58 DC  I "O3'" 1 
ATOM   6496  C  "C2'" . DC  I 5  16  ? 162.966 197.127 127.350 1.00 89.22  ? -58 DC  I "C2'" 1 
ATOM   6497  C  "C1'" . DC  I 5  16  ? 161.727 196.689 128.088 1.00 89.22  ? -58 DC  I "C1'" 1 
ATOM   6498  N  N1    . DC  I 5  16  ? 160.787 195.830 127.294 1.00 89.22  ? -58 DC  I N1    1 
ATOM   6499  C  C2    . DC  I 5  16  ? 160.182 194.709 127.891 1.00 89.22  ? -58 DC  I C2    1 
ATOM   6500  O  O2    . DC  I 5  16  ? 160.411 194.453 129.078 1.00 89.22  ? -58 DC  I O2    1 
ATOM   6501  N  N3    . DC  I 5  16  ? 159.349 193.941 127.149 1.00 89.22  ? -58 DC  I N3    1 
ATOM   6502  C  C4    . DC  I 5  16  ? 159.124 194.253 125.873 1.00 89.22  ? -58 DC  I C4    1 
ATOM   6503  N  N4    . DC  I 5  16  ? 158.293 193.477 125.176 1.00 89.22  ? -58 DC  I N4    1 
ATOM   6504  C  C5    . DC  I 5  16  ? 159.743 195.367 125.249 1.00 89.22  ? -58 DC  I C5    1 
ATOM   6505  C  C6    . DC  I 5  16  ? 160.554 196.121 125.989 1.00 89.22  ? -58 DC  I C6    1 
ATOM   6506  P  P     . DT  I 5  17  ? 165.147 198.032 130.436 1.00 89.59  ? -57 DT  I P     1 
ATOM   6507  O  OP1   . DT  I 5  17  ? 164.654 199.318 130.967 1.00 89.59  ? -57 DT  I OP1   1 
ATOM   6508  O  OP2   . DT  I 5  17  ? 166.449 197.989 129.743 1.00 89.59  ? -57 DT  I OP2   1 
ATOM   6509  O  "O5'" . DT  I 5  17  ? 165.175 196.972 131.624 1.00 89.59  ? -57 DT  I "O5'" 1 
ATOM   6510  C  "C5'" . DT  I 5  17  ? 164.049 196.108 131.805 1.00 89.59  ? -57 DT  I "C5'" 1 
ATOM   6511  C  "C4'" . DT  I 5  17  ? 164.433 194.665 131.548 1.00 89.59  ? -57 DT  I "C4'" 1 
ATOM   6512  O  "O4'" . DT  I 5  17  ? 163.531 194.057 130.573 1.00 89.59  ? -57 DT  I "O4'" 1 
ATOM   6513  C  "C3'" . DT  I 5  17  ? 165.838 194.472 130.968 1.00 89.59  ? -57 DT  I "C3'" 1 
ATOM   6514  O  "O3'" . DT  I 5  17  ? 166.415 193.316 131.526 1.00 89.59  ? -57 DT  I "O3'" 1 
ATOM   6515  C  "C2'" . DT  I 5  17  ? 165.532 194.249 129.499 1.00 89.59  ? -57 DT  I "C2'" 1 
ATOM   6516  C  "C1'" . DT  I 5  17  ? 164.339 193.348 129.673 1.00 89.59  ? -57 DT  I "C1'" 1 
ATOM   6517  N  N1    . DT  I 5  17  ? 163.608 193.022 128.426 1.00 89.59  ? -57 DT  I N1    1 
ATOM   6518  C  C2    . DT  I 5  17  ? 162.752 191.954 128.425 1.00 89.59  ? -57 DT  I C2    1 
ATOM   6519  O  O2    . DT  I 5  17  ? 162.542 191.273 129.409 1.00 89.59  ? -57 DT  I O2    1 
ATOM   6520  N  N3    . DT  I 5  17  ? 162.138 191.713 127.228 1.00 89.59  ? -57 DT  I N3    1 
ATOM   6521  C  C4    . DT  I 5  17  ? 162.301 192.416 126.057 1.00 89.59  ? -57 DT  I C4    1 
ATOM   6522  O  O4    . DT  I 5  17  ? 161.703 192.128 125.032 1.00 89.59  ? -57 DT  I O4    1 
ATOM   6523  C  C5    . DT  I 5  17  ? 163.226 193.513 126.124 1.00 89.59  ? -57 DT  I C5    1 
ATOM   6524  C  C7    . DT  I 5  17  ? 163.488 194.345 124.906 1.00 89.59  ? -57 DT  I C7    1 
ATOM   6525  C  C6    . DT  I 5  17  ? 163.843 193.747 127.287 1.00 89.59  ? -57 DT  I C6    1 
ATOM   6526  P  P     . DG  I 5  18  ? 167.431 193.437 132.759 1.00 89.56  ? -56 DG  I P     1 
ATOM   6527  O  OP1   . DG  I 5  18  ? 167.268 194.783 133.340 1.00 89.56  ? -56 DG  I OP1   1 
ATOM   6528  O  OP2   . DG  I 5  18  ? 168.752 192.996 132.275 1.00 89.56  ? -56 DG  I OP2   1 
ATOM   6529  O  "O5'" . DG  I 5  18  ? 166.898 192.340 133.789 1.00 89.56  ? -56 DG  I "O5'" 1 
ATOM   6530  C  "C5'" . DG  I 5  18  ? 165.588 191.814 133.638 1.00 89.56  ? -56 DG  I "C5'" 1 
ATOM   6531  C  "C4'" . DG  I 5  18  ? 165.620 190.411 133.051 1.00 89.56  ? -56 DG  I "C4'" 1 
ATOM   6532  O  "O4'" . DG  I 5  18  ? 165.208 190.427 131.653 1.00 89.56  ? -56 DG  I "O4'" 1 
ATOM   6533  C  "C3'" . DG  I 5  18  ? 166.982 189.727 133.067 1.00 89.56  ? -56 DG  I "C3'" 1 
ATOM   6534  O  "O3'" . DG  I 5  18  ? 166.794 188.362 133.328 1.00 89.56  ? -56 DG  I "O3'" 1 
ATOM   6535  C  "C2'" . DG  I 5  18  ? 167.453 189.933 131.626 1.00 89.56  ? -56 DG  I "C2'" 1 
ATOM   6536  C  "C1'" . DG  I 5  18  ? 166.147 189.689 130.905 1.00 89.56  ? -56 DG  I "C1'" 1 
ATOM   6537  N  N9    . DG  I 5  18  ? 166.114 190.160 129.531 1.00 89.56  ? -56 DG  I N9    1 
ATOM   6538  C  C8    . DG  I 5  18  ? 166.884 191.147 128.978 1.00 89.56  ? -56 DG  I C8    1 
ATOM   6539  N  N7    . DG  I 5  18  ? 166.602 191.382 127.725 1.00 89.56  ? -56 DG  I N7    1 
ATOM   6540  C  C5    . DG  I 5  18  ? 165.600 190.466 127.422 1.00 89.56  ? -56 DG  I C5    1 
ATOM   6541  C  C6    . DG  I 5  18  ? 164.911 190.226 126.206 1.00 89.56  ? -56 DG  I C6    1 
ATOM   6542  O  O6    . DG  I 5  18  ? 165.043 190.796 125.121 1.00 89.56  ? -56 DG  I O6    1 
ATOM   6543  N  N1    . DG  I 5  18  ? 163.980 189.210 126.335 1.00 89.56  ? -56 DG  I N1    1 
ATOM   6544  C  C2    . DG  I 5  18  ? 163.737 188.512 127.489 1.00 89.56  ? -56 DG  I C2    1 
ATOM   6545  N  N2    . DG  I 5  18  ? 162.802 187.563 127.419 1.00 89.56  ? -56 DG  I N2    1 
ATOM   6546  N  N3    . DG  I 5  18  ? 164.373 188.721 128.633 1.00 89.56  ? -56 DG  I N3    1 
ATOM   6547  C  C4    . DG  I 5  18  ? 165.289 189.709 128.525 1.00 89.56  ? -56 DG  I C4    1 
ATOM   6548  P  P     . DA  I 5  19  ? 166.957 187.765 134.804 1.00 83.84  ? -55 DA  I P     1 
ATOM   6549  O  OP1   . DA  I 5  19  ? 166.436 188.747 135.776 1.00 83.84  ? -55 DA  I OP1   1 
ATOM   6550  O  OP2   . DA  I 5  19  ? 168.345 187.285 134.930 1.00 83.84  ? -55 DA  I OP2   1 
ATOM   6551  O  "O5'" . DA  I 5  19  ? 166.012 186.474 134.774 1.00 83.84  ? -55 DA  I "O5'" 1 
ATOM   6552  C  "C5'" . DA  I 5  19  ? 164.944 186.417 133.839 1.00 83.84  ? -55 DA  I "C5'" 1 
ATOM   6553  C  "C4'" . DA  I 5  19  ? 164.543 184.986 133.493 1.00 83.84  ? -55 DA  I "C4'" 1 
ATOM   6554  O  "O4'" . DA  I 5  19  ? 164.706 184.768 132.078 1.00 83.84  ? -55 DA  I "O4'" 1 
ATOM   6555  C  "C3'" . DA  I 5  19  ? 165.347 183.874 134.133 1.00 83.84  ? -55 DA  I "C3'" 1 
ATOM   6556  O  "O3'" . DA  I 5  19  ? 164.503 182.688 134.207 1.00 83.84  ? -55 DA  I "O3'" 1 
ATOM   6557  C  "C2'" . DA  I 5  19  ? 166.532 183.724 133.171 1.00 83.84  ? -55 DA  I "C2'" 1 
ATOM   6558  C  "C1'" . DA  I 5  19  ? 165.976 184.190 131.827 1.00 83.84  ? -55 DA  I "C1'" 1 
ATOM   6559  N  N9    . DA  I 5  19  ? 166.803 185.210 131.219 1.00 83.84  ? -55 DA  I N9    1 
ATOM   6560  C  C8    . DA  I 5  19  ? 167.802 185.902 131.826 1.00 83.84  ? -55 DA  I C8    1 
ATOM   6561  N  N7    . DA  I 5  19  ? 168.357 186.802 131.067 1.00 83.84  ? -55 DA  I N7    1 
ATOM   6562  C  C5    . DA  I 5  19  ? 167.675 186.696 129.880 1.00 83.84  ? -55 DA  I C5    1 
ATOM   6563  C  C6    . DA  I 5  19  ? 167.790 187.381 128.677 1.00 83.84  ? -55 DA  I C6    1 
ATOM   6564  N  N6    . DA  I 5  19  ? 168.682 188.351 128.472 1.00 83.84  ? -55 DA  I N6    1 
ATOM   6565  N  N1    . DA  I 5  19  ? 166.958 187.034 127.683 1.00 83.84  ? -55 DA  I N1    1 
ATOM   6566  C  C2    . DA  I 5  19  ? 166.070 186.058 127.891 1.00 83.84  ? -55 DA  I C2    1 
ATOM   6567  N  N3    . DA  I 5  19  ? 165.863 185.347 128.988 1.00 83.84  ? -55 DA  I N3    1 
ATOM   6568  C  C4    . DA  I 5  19  ? 166.707 185.719 129.954 1.00 83.84  ? -55 DA  I C4    1 
ATOM   6569  P  P     . DC  I 5  20  ? 165.020 181.180 133.960 1.00 81.79  ? -54 DC  I P     1 
ATOM   6570  O  OP1   . DC  I 5  20  ? 163.910 180.354 134.468 1.00 81.79  ? -54 DC  I OP1   1 
ATOM   6571  O  OP2   . DC  I 5  20  ? 166.372 180.873 134.472 1.00 81.79  ? -54 DC  I OP2   1 
ATOM   6572  O  "O5'" . DC  I 5  20  ? 164.986 181.006 132.380 1.00 81.79  ? -54 DC  I "O5'" 1 
ATOM   6573  C  "C5'" . DC  I 5  20  ? 163.741 180.824 131.718 1.00 81.79  ? -54 DC  I "C5'" 1 
ATOM   6574  C  "C4'" . DC  I 5  20  ? 163.909 180.459 130.244 1.00 81.79  ? -54 DC  I "C4'" 1 
ATOM   6575  O  "O4'" . DC  I 5  20  ? 164.823 181.377 129.583 1.00 81.79  ? -54 DC  I "O4'" 1 
ATOM   6576  C  "C3'" . DC  I 5  20  ? 164.466 179.081 129.961 1.00 81.79  ? -54 DC  I "C3'" 1 
ATOM   6577  O  "O3'" . DC  I 5  20  ? 163.982 178.652 128.727 1.00 81.79  ? -54 DC  I "O3'" 1 
ATOM   6578  C  "C2'" . DC  I 5  20  ? 165.956 179.353 129.876 1.00 81.79  ? -54 DC  I "C2'" 1 
ATOM   6579  C  "C1'" . DC  I 5  20  ? 165.959 180.670 129.114 1.00 81.79  ? -54 DC  I "C1'" 1 
ATOM   6580  N  N1    . DC  I 5  20  ? 167.138 181.519 129.391 1.00 81.79  ? -54 DC  I N1    1 
ATOM   6581  C  C2    . DC  I 5  20  ? 167.570 182.437 128.438 1.00 81.79  ? -54 DC  I C2    1 
ATOM   6582  O  O2    . DC  I 5  20  ? 166.994 182.494 127.353 1.00 81.79  ? -54 DC  I O2    1 
ATOM   6583  N  N3    . DC  I 5  20  ? 168.628 183.227 128.724 1.00 81.79  ? -54 DC  I N3    1 
ATOM   6584  C  C4    . DC  I 5  20  ? 169.232 183.134 129.900 1.00 81.79  ? -54 DC  I C4    1 
ATOM   6585  N  N4    . DC  I 5  20  ? 170.275 183.937 130.138 1.00 81.79  ? -54 DC  I N4    1 
ATOM   6586  C  C5    . DC  I 5  20  ? 168.803 182.209 130.888 1.00 81.79  ? -54 DC  I C5    1 
ATOM   6587  C  C6    . DC  I 5  20  ? 167.760 181.431 130.594 1.00 81.79  ? -54 DC  I C6    1 
ATOM   6588  P  P     . DA  I 5  21  ? 163.294 177.217 128.588 1.00 81.10  ? -53 DA  I P     1 
ATOM   6589  O  OP1   . DA  I 5  21  ? 161.835 177.446 128.605 1.00 81.10  ? -53 DA  I OP1   1 
ATOM   6590  O  OP2   . DA  I 5  21  ? 163.920 176.339 129.603 1.00 81.10  ? -53 DA  I OP2   1 
ATOM   6591  O  "O5'" . DA  I 5  21  ? 163.728 176.743 127.122 1.00 81.10  ? -53 DA  I "O5'" 1 
ATOM   6592  C  "C5'" . DA  I 5  21  ? 163.237 177.439 125.995 1.00 81.10  ? -53 DA  I "C5'" 1 
ATOM   6593  C  "C4'" . DA  I 5  21  ? 164.311 177.626 124.940 1.00 81.10  ? -53 DA  I "C4'" 1 
ATOM   6594  O  "O4'" . DA  I 5  21  ? 165.366 178.471 125.449 1.00 81.10  ? -53 DA  I "O4'" 1 
ATOM   6595  C  "C3'" . DA  I 5  21  ? 164.987 176.351 124.447 1.00 81.10  ? -53 DA  I "C3'" 1 
ATOM   6596  O  "O3'" . DA  I 5  21  ? 165.004 176.367 123.029 1.00 81.10  ? -53 DA  I "O3'" 1 
ATOM   6597  C  "C2'" . DA  I 5  21  ? 166.394 176.442 125.048 1.00 81.10  ? -53 DA  I "C2'" 1 
ATOM   6598  C  "C1'" . DA  I 5  21  ? 166.608 177.939 125.058 1.00 81.10  ? -53 DA  I "C1'" 1 
ATOM   6599  N  N9    . DA  I 5  21  ? 167.599 178.394 126.018 1.00 81.10  ? -53 DA  I N9    1 
ATOM   6600  C  C8    . DA  I 5  21  ? 167.701 178.016 127.317 1.00 81.10  ? -53 DA  I C8    1 
ATOM   6601  N  N7    . DA  I 5  21  ? 168.661 178.614 127.974 1.00 81.10  ? -53 DA  I N7    1 
ATOM   6602  C  C5    . DA  I 5  21  ? 169.237 179.440 127.036 1.00 81.10  ? -53 DA  I C5    1 
ATOM   6603  C  C6    . DA  I 5  21  ? 170.322 180.328 127.102 1.00 81.10  ? -53 DA  I C6    1 
ATOM   6604  N  N6    . DA  I 5  21  ? 171.033 180.532 128.210 1.00 81.10  ? -53 DA  I N6    1 
ATOM   6605  N  N1    . DA  I 5  21  ? 170.654 180.994 125.977 1.00 81.10  ? -53 DA  I N1    1 
ATOM   6606  C  C2    . DA  I 5  21  ? 169.944 180.767 124.862 1.00 81.10  ? -53 DA  I C2    1 
ATOM   6607  N  N3    . DA  I 5  21  ? 168.893 179.969 124.684 1.00 81.10  ? -53 DA  I N3    1 
ATOM   6608  C  C4    . DA  I 5  21  ? 168.595 179.320 125.820 1.00 81.10  ? -53 DA  I C4    1 
ATOM   6609  P  P     . DC  I 5  22  ? 165.762 175.236 122.174 1.00 80.60  ? -52 DC  I P     1 
ATOM   6610  O  OP1   . DC  I 5  22  ? 165.065 175.174 120.873 1.00 80.60  ? -52 DC  I OP1   1 
ATOM   6611  O  OP2   . DC  I 5  22  ? 165.930 174.000 122.965 1.00 80.60  ? -52 DC  I OP2   1 
ATOM   6612  O  "O5'" . DC  I 5  22  ? 167.190 175.879 121.900 1.00 80.60  ? -52 DC  I "O5'" 1 
ATOM   6613  C  "C5'" . DC  I 5  22  ? 167.267 177.208 121.427 1.00 80.60  ? -52 DC  I "C5'" 1 
ATOM   6614  C  "C4'" . DC  I 5  22  ? 168.699 177.597 121.155 1.00 80.60  ? -52 DC  I "C4'" 1 
ATOM   6615  O  "O4'" . DC  I 5  22  ? 169.330 178.070 122.372 1.00 80.60  ? -52 DC  I "O4'" 1 
ATOM   6616  C  "C3'" . DC  I 5  22  ? 169.588 176.457 120.645 1.00 80.60  ? -52 DC  I "C3'" 1 
ATOM   6617  O  "O3'" . DC  I 5  22  ? 170.349 176.919 119.553 1.00 80.60  ? -52 DC  I "O3'" 1 
ATOM   6618  C  "C2'" . DC  I 5  22  ? 170.480 176.169 121.844 1.00 80.60  ? -52 DC  I "C2'" 1 
ATOM   6619  C  "C1'" . DC  I 5  22  ? 170.633 177.570 122.375 1.00 80.60  ? -52 DC  I "C1'" 1 
ATOM   6620  N  N1    . DC  I 5  22  ? 171.190 177.647 123.721 1.00 80.60  ? -52 DC  I N1    1 
ATOM   6621  C  C2    . DC  I 5  22  ? 172.263 178.504 123.961 1.00 80.60  ? -52 DC  I C2    1 
ATOM   6622  O  O2    . DC  I 5  22  ? 172.699 179.195 123.035 1.00 80.60  ? -52 DC  I O2    1 
ATOM   6623  N  N3    . DC  I 5  22  ? 172.777 178.574 125.199 1.00 80.60  ? -52 DC  I N3    1 
ATOM   6624  C  C4    . DC  I 5  22  ? 172.279 177.817 126.159 1.00 80.60  ? -52 DC  I C4    1 
ATOM   6625  N  N4    . DC  I 5  22  ? 172.826 177.922 127.369 1.00 80.60  ? -52 DC  I N4    1 
ATOM   6626  C  C5    . DC  I 5  22  ? 171.193 176.925 125.934 1.00 80.60  ? -52 DC  I C5    1 
ATOM   6627  C  C6    . DC  I 5  22  ? 170.686 176.870 124.706 1.00 80.60  ? -52 DC  I C6    1 
ATOM   6628  P  P     . DG  I 5  23  ? 170.746 175.925 118.357 1.00 83.16  ? -51 DG  I P     1 
ATOM   6629  O  OP1   . DG  I 5  23  ? 169.952 176.334 117.176 1.00 83.16  ? -51 DG  I OP1   1 
ATOM   6630  O  OP2   . DG  I 5  23  ? 170.633 174.538 118.857 1.00 83.16  ? -51 DG  I OP2   1 
ATOM   6631  O  "O5'" . DG  I 5  23  ? 172.291 176.247 118.099 1.00 83.16  ? -51 DG  I "O5'" 1 
ATOM   6632  C  "C5'" . DG  I 5  23  ? 172.669 177.485 117.507 1.00 83.16  ? -51 DG  I "C5'" 1 
ATOM   6633  C  "C4'" . DG  I 5  23  ? 174.090 177.874 117.887 1.00 83.16  ? -51 DG  I "C4'" 1 
ATOM   6634  O  "O4'" . DG  I 5  23  ? 174.190 178.021 119.327 1.00 83.16  ? -51 DG  I "O4'" 1 
ATOM   6635  C  "C3'" . DG  I 5  23  ? 175.184 176.881 117.484 1.00 83.16  ? -51 DG  I "C3'" 1 
ATOM   6636  O  "O3'" . DG  I 5  23  ? 176.326 177.588 117.005 1.00 83.16  ? -51 DG  I "O3'" 1 
ATOM   6637  C  "C2'" . DG  I 5  23  ? 175.487 176.175 118.790 1.00 83.16  ? -51 DG  I "C2'" 1 
ATOM   6638  C  "C1'" . DG  I 5  23  ? 175.297 177.291 119.794 1.00 83.16  ? -51 DG  I "C1'" 1 
ATOM   6639  N  N9    . DG  I 5  23  ? 174.977 176.804 121.120 1.00 83.16  ? -51 DG  I N9    1 
ATOM   6640  C  C8    . DG  I 5  23  ? 173.927 175.998 121.453 1.00 83.16  ? -51 DG  I C8    1 
ATOM   6641  N  N7    . DG  I 5  23  ? 173.870 175.716 122.718 1.00 83.16  ? -51 DG  I N7    1 
ATOM   6642  C  C5    . DG  I 5  23  ? 174.958 176.375 123.261 1.00 83.16  ? -51 DG  I C5    1 
ATOM   6643  C  C6    . DG  I 5  23  ? 175.396 176.434 124.590 1.00 83.16  ? -51 DG  I C6    1 
ATOM   6644  O  O6    . DG  I 5  23  ? 174.893 175.894 125.577 1.00 83.16  ? -51 DG  I O6    1 
ATOM   6645  N  N1    . DG  I 5  23  ? 176.536 177.209 124.724 1.00 83.16  ? -51 DG  I N1    1 
ATOM   6646  C  C2    . DG  I 5  23  ? 177.173 177.850 123.695 1.00 83.16  ? -51 DG  I C2    1 
ATOM   6647  N  N2    . DG  I 5  23  ? 178.261 178.558 124.017 1.00 83.16  ? -51 DG  I N2    1 
ATOM   6648  N  N3    . DG  I 5  23  ? 176.767 177.807 122.434 1.00 83.16  ? -51 DG  I N3    1 
ATOM   6649  C  C4    . DG  I 5  23  ? 175.651 177.055 122.294 1.00 83.16  ? -51 DG  I C4    1 
ATOM   6650  P  P     . DT  I 5  24  ? 177.665 176.810 116.560 1.00 81.88  ? -50 DT  I P     1 
ATOM   6651  O  OP1   . DT  I 5  24  ? 178.249 177.609 115.463 1.00 81.88  ? -50 DT  I OP1   1 
ATOM   6652  O  OP2   . DT  I 5  24  ? 177.375 175.378 116.323 1.00 81.88  ? -50 DT  I OP2   1 
ATOM   6653  O  "O5'" . DT  I 5  24  ? 178.635 176.938 117.826 1.00 81.88  ? -50 DT  I "O5'" 1 
ATOM   6654  C  "C5'" . DT  I 5  24  ? 179.375 178.139 118.030 1.00 81.88  ? -50 DT  I "C5'" 1 
ATOM   6655  C  "C4'" . DT  I 5  24  ? 180.618 177.907 118.886 1.00 81.88  ? -50 DT  I "C4'" 1 
ATOM   6656  O  "O4'" . DT  I 5  24  ? 180.235 177.623 120.257 1.00 81.88  ? -50 DT  I "O4'" 1 
ATOM   6657  C  "C3'" . DT  I 5  24  ? 181.531 176.758 118.455 1.00 81.88  ? -50 DT  I "C3'" 1 
ATOM   6658  O  "O3'" . DT  I 5  24  ? 182.894 177.166 118.585 1.00 81.88  ? -50 DT  I "O3'" 1 
ATOM   6659  C  "C2'" . DT  I 5  24  ? 181.175 175.647 119.442 1.00 81.88  ? -50 DT  I "C2'" 1 
ATOM   6660  C  "C1'" . DT  I 5  24  ? 180.864 176.439 120.698 1.00 81.88  ? -50 DT  I "C1'" 1 
ATOM   6661  N  N1    . DT  I 5  24  ? 179.926 175.760 121.609 1.00 81.88  ? -50 DT  I N1    1 
ATOM   6662  C  C2    . DT  I 5  24  ? 180.174 175.772 122.956 1.00 81.88  ? -50 DT  I C2    1 
ATOM   6663  O  O2    . DT  I 5  24  ? 181.148 176.299 123.449 1.00 81.88  ? -50 DT  I O2    1 
ATOM   6664  N  N3    . DT  I 5  24  ? 179.234 175.134 123.709 1.00 81.88  ? -50 DT  I N3    1 
ATOM   6665  C  C4    . DT  I 5  24  ? 178.092 174.512 123.259 1.00 81.88  ? -50 DT  I C4    1 
ATOM   6666  O  O4    . DT  I 5  24  ? 177.301 173.963 124.005 1.00 81.88  ? -50 DT  I O4    1 
ATOM   6667  C  C5    . DT  I 5  24  ? 177.892 174.538 121.848 1.00 81.88  ? -50 DT  I C5    1 
ATOM   6668  C  C7    . DT  I 5  24  ? 176.693 173.866 121.269 1.00 81.88  ? -50 DT  I C7    1 
ATOM   6669  C  C6    . DT  I 5  24  ? 178.803 175.157 121.094 1.00 81.88  ? -50 DT  I C6    1 
ATOM   6670  P  P     . DG  I 5  25  ? 184.104 176.155 118.267 1.00 78.22  ? -49 DG  I P     1 
ATOM   6671  O  OP1   . DG  I 5  25  ? 185.244 176.981 117.819 1.00 78.22  ? -49 DG  I OP1   1 
ATOM   6672  O  OP2   . DG  I 5  25  ? 183.614 175.083 117.371 1.00 78.22  ? -49 DG  I OP2   1 
ATOM   6673  O  "O5'" . DG  I 5  25  ? 184.468 175.529 119.699 1.00 78.22  ? -49 DG  I "O5'" 1 
ATOM   6674  C  "C5'" . DG  I 5  25  ? 184.703 176.397 120.813 1.00 78.22  ? -49 DG  I "C5'" 1 
ATOM   6675  C  "C4'" . DG  I 5  25  ? 185.221 175.660 122.056 1.00 78.22  ? -49 DG  I "C4'" 1 
ATOM   6676  O  "O4'" . DG  I 5  25  ? 184.128 175.107 122.823 1.00 78.22  ? -49 DG  I "O4'" 1 
ATOM   6677  C  "C3'" . DG  I 5  25  ? 186.187 174.511 121.841 1.00 78.22  ? -49 DG  I "C3'" 1 
ATOM   6678  O  "O3'" . DG  I 5  25  ? 187.066 174.477 122.950 1.00 78.22  ? -49 DG  I "O3'" 1 
ATOM   6679  C  "C2'" . DG  I 5  25  ? 185.254 173.300 121.844 1.00 78.22  ? -49 DG  I "C2'" 1 
ATOM   6680  C  "C1'" . DG  I 5  25  ? 184.264 173.701 122.925 1.00 78.22  ? -49 DG  I "C1'" 1 
ATOM   6681  N  N9    . DG  I 5  25  ? 182.925 173.157 122.770 1.00 78.22  ? -49 DG  I N9    1 
ATOM   6682  C  C8    . DG  I 5  25  ? 182.174 173.118 121.625 1.00 78.22  ? -49 DG  I C8    1 
ATOM   6683  N  N7    . DG  I 5  25  ? 180.975 172.644 121.809 1.00 78.22  ? -49 DG  I N7    1 
ATOM   6684  C  C5    . DG  I 5  25  ? 180.924 172.373 123.168 1.00 78.22  ? -49 DG  I C5    1 
ATOM   6685  C  C6    . DG  I 5  25  ? 179.882 171.841 123.951 1.00 78.22  ? -49 DG  I C6    1 
ATOM   6686  O  O6    . DG  I 5  25  ? 178.756 171.491 123.592 1.00 78.22  ? -49 DG  I O6    1 
ATOM   6687  N  N1    . DG  I 5  25  ? 180.246 171.727 125.278 1.00 78.22  ? -49 DG  I N1    1 
ATOM   6688  C  C2    . DG  I 5  25  ? 181.467 172.079 125.791 1.00 78.22  ? -49 DG  I C2    1 
ATOM   6689  N  N2    . DG  I 5  25  ? 181.635 171.901 127.109 1.00 78.22  ? -49 DG  I N2    1 
ATOM   6690  N  N3    . DG  I 5  25  ? 182.449 172.582 125.070 1.00 78.22  ? -49 DG  I N3    1 
ATOM   6691  C  C4    . DG  I 5  25  ? 182.110 172.701 123.772 1.00 78.22  ? -49 DG  I C4    1 
ATOM   6692  P  P     . DC  I 5  26  ? 188.472 173.712 122.882 1.00 73.50  ? -48 DC  I P     1 
ATOM   6693  O  OP1   . DC  I 5  26  ? 189.511 174.689 123.260 1.00 73.50  ? -48 DC  I OP1   1 
ATOM   6694  O  OP2   . DC  I 5  26  ? 188.562 173.004 121.591 1.00 73.50  ? -48 DC  I OP2   1 
ATOM   6695  O  "O5'" . DC  I 5  26  ? 188.361 172.624 124.050 1.00 73.50  ? -48 DC  I "O5'" 1 
ATOM   6696  C  "C5'" . DC  I 5  26  ? 188.110 173.046 125.397 1.00 73.50  ? -48 DC  I "C5'" 1 
ATOM   6697  C  "C4'" . DC  I 5  26  ? 187.612 171.898 126.272 1.00 73.50  ? -48 DC  I "C4'" 1 
ATOM   6698  O  "O4'" . DC  I 5  26  ? 186.240 171.578 125.940 1.00 73.50  ? -48 DC  I "O4'" 1 
ATOM   6699  C  "C3'" . DC  I 5  26  ? 188.384 170.585 126.151 1.00 73.50  ? -48 DC  I "C3'" 1 
ATOM   6700  O  "O3'" . DC  I 5  26  ? 188.455 169.965 127.423 1.00 73.50  ? -48 DC  I "O3'" 1 
ATOM   6701  C  "C2'" . DC  I 5  26  ? 187.494 169.776 125.214 1.00 73.50  ? -48 DC  I "C2'" 1 
ATOM   6702  C  "C1'" . DC  I 5  26  ? 186.132 170.191 125.717 1.00 73.50  ? -48 DC  I "C1'" 1 
ATOM   6703  N  N1    . DC  I 5  26  ? 185.024 169.970 124.760 1.00 73.50  ? -48 DC  I N1    1 
ATOM   6704  C  C2    . DC  I 5  26  ? 183.757 169.644 125.243 1.00 73.50  ? -48 DC  I C2    1 
ATOM   6705  O  O2    . DC  I 5  26  ? 183.591 169.499 126.454 1.00 73.50  ? -48 DC  I O2    1 
ATOM   6706  N  N3    . DC  I 5  26  ? 182.747 169.454 124.369 1.00 73.50  ? -48 DC  I N3    1 
ATOM   6707  C  C4    . DC  I 5  26  ? 182.959 169.598 123.067 1.00 73.50  ? -48 DC  I C4    1 
ATOM   6708  N  N4    . DC  I 5  26  ? 181.922 169.411 122.244 1.00 73.50  ? -48 DC  I N4    1 
ATOM   6709  C  C5    . DC  I 5  26  ? 184.239 169.949 122.552 1.00 73.50  ? -48 DC  I C5    1 
ATOM   6710  C  C6    . DC  I 5  26  ? 185.234 170.124 123.429 1.00 73.50  ? -48 DC  I C6    1 
ATOM   6711  P  P     . DC  I 5  27  ? 189.747 170.144 128.361 1.00 64.71  ? -47 DC  I P     1 
ATOM   6712  O  OP1   . DC  I 5  27  ? 189.947 171.583 128.637 1.00 64.71  ? -47 DC  I OP1   1 
ATOM   6713  O  OP2   . DC  I 5  27  ? 190.837 169.356 127.754 1.00 64.71  ? -47 DC  I OP2   1 
ATOM   6714  O  "O5'" . DC  I 5  27  ? 189.315 169.423 129.720 1.00 64.71  ? -47 DC  I "O5'" 1 
ATOM   6715  C  "C5'" . DC  I 5  27  ? 187.931 169.226 130.001 1.00 64.71  ? -47 DC  I "C5'" 1 
ATOM   6716  C  "C4'" . DC  I 5  27  ? 187.621 167.768 130.286 1.00 64.71  ? -47 DC  I "C4'" 1 
ATOM   6717  O  "O4'" . DC  I 5  27  ? 186.743 167.239 129.263 1.00 64.71  ? -47 DC  I "O4'" 1 
ATOM   6718  C  "C3'" . DC  I 5  27  ? 188.820 166.835 130.302 1.00 64.71  ? -47 DC  I "C3'" 1 
ATOM   6719  O  "O3'" . DC  I 5  27  ? 188.556 165.757 131.185 1.00 64.71  ? -47 DC  I "O3'" 1 
ATOM   6720  C  "C2'" . DC  I 5  27  ? 188.840 166.345 128.858 1.00 64.71  ? -47 DC  I "C2'" 1 
ATOM   6721  C  "C1'" . DC  I 5  27  ? 187.357 166.120 128.652 1.00 64.71  ? -47 DC  I "C1'" 1 
ATOM   6722  N  N1    . DC  I 5  27  ? 186.922 166.083 127.238 1.00 64.71  ? -47 DC  I N1    1 
ATOM   6723  C  C2    . DC  I 5  27  ? 185.579 165.850 126.959 1.00 64.71  ? -47 DC  I C2    1 
ATOM   6724  O  O2    . DC  I 5  27  ? 184.793 165.655 127.892 1.00 64.71  ? -47 DC  I O2    1 
ATOM   6725  N  N3    . DC  I 5  27  ? 185.168 165.829 125.677 1.00 64.71  ? -47 DC  I N3    1 
ATOM   6726  C  C4    . DC  I 5  27  ? 186.036 166.045 124.698 1.00 64.71  ? -47 DC  I C4    1 
ATOM   6727  N  N4    . DC  I 5  27  ? 185.575 166.012 123.446 1.00 64.71  ? -47 DC  I N4    1 
ATOM   6728  C  C5    . DC  I 5  27  ? 187.415 166.280 124.958 1.00 64.71  ? -47 DC  I C5    1 
ATOM   6729  C  C6    . DC  I 5  27  ? 187.810 166.303 126.234 1.00 64.71  ? -47 DC  I C6    1 
ATOM   6730  P  P     . DT  I 5  28  ? 188.883 165.855 132.757 1.00 61.09  ? -46 DT  I P     1 
ATOM   6731  O  OP1   . DT  I 5  28  ? 188.921 167.262 133.208 1.00 61.09  ? -46 DT  I OP1   1 
ATOM   6732  O  OP2   . DT  I 5  28  ? 190.054 164.986 132.986 1.00 61.09  ? -46 DT  I OP2   1 
ATOM   6733  O  "O5'" . DT  I 5  28  ? 187.613 165.165 133.430 1.00 61.09  ? -46 DT  I "O5'" 1 
ATOM   6734  C  "C5'" . DT  I 5  28  ? 186.359 165.223 132.764 1.00 61.09  ? -46 DT  I "C5'" 1 
ATOM   6735  C  "C4'" . DT  I 5  28  ? 185.615 163.899 132.821 1.00 61.09  ? -46 DT  I "C4'" 1 
ATOM   6736  O  "O4'" . DT  I 5  28  ? 185.396 163.394 131.480 1.00 61.09  ? -46 DT  I "O4'" 1 
ATOM   6737  C  "C3'" . DT  I 5  28  ? 186.325 162.781 133.551 1.00 61.09  ? -46 DT  I "C3'" 1 
ATOM   6738  O  "O3'" . DT  I 5  28  ? 185.367 161.869 134.045 1.00 61.09  ? -46 DT  I "O3'" 1 
ATOM   6739  C  "C2'" . DT  I 5  28  ? 187.154 162.155 132.435 1.00 61.09  ? -46 DT  I "C2'" 1 
ATOM   6740  C  "C1'" . DT  I 5  28  ? 186.192 162.245 131.257 1.00 61.09  ? -46 DT  I "C1'" 1 
ATOM   6741  N  N1    . DT  I 5  28  ? 186.856 162.410 129.953 1.00 61.09  ? -46 DT  I N1    1 
ATOM   6742  C  C2    . DT  I 5  28  ? 186.096 162.384 128.824 1.00 61.09  ? -46 DT  I C2    1 
ATOM   6743  O  O2    . DT  I 5  28  ? 184.898 162.202 128.841 1.00 61.09  ? -46 DT  I O2    1 
ATOM   6744  N  N3    . DT  I 5  28  ? 186.783 162.577 127.668 1.00 61.09  ? -46 DT  I N3    1 
ATOM   6745  C  C4    . DT  I 5  28  ? 188.132 162.783 127.528 1.00 61.09  ? -46 DT  I C4    1 
ATOM   6746  O  O4    . DT  I 5  28  ? 188.658 162.942 126.436 1.00 61.09  ? -46 DT  I O4    1 
ATOM   6747  C  C5    . DT  I 5  28  ? 188.880 162.807 128.756 1.00 61.09  ? -46 DT  I C5    1 
ATOM   6748  C  C7    . DT  I 5  28  ? 190.363 163.021 128.737 1.00 61.09  ? -46 DT  I C7    1 
ATOM   6749  C  C6    . DT  I 5  28  ? 188.211 162.627 129.898 1.00 61.09  ? -46 DT  I C6    1 
ATOM   6750  P  P     . DG  I 5  29  ? 184.903 161.923 135.578 1.00 60.33  ? -45 DG  I P     1 
ATOM   6751  O  OP1   . DG  I 5  29  ? 184.785 163.343 135.968 1.00 60.33  ? -45 DG  I OP1   1 
ATOM   6752  O  OP2   . DG  I 5  29  ? 185.781 161.009 136.333 1.00 60.33  ? -45 DG  I OP2   1 
ATOM   6753  O  "O5'" . DG  I 5  29  ? 183.443 161.286 135.551 1.00 60.33  ? -45 DG  I "O5'" 1 
ATOM   6754  C  "C5'" . DG  I 5  29  ? 182.433 161.874 134.755 1.00 60.33  ? -45 DG  I "C5'" 1 
ATOM   6755  C  "C4'" . DG  I 5  29  ? 181.911 160.911 133.699 1.00 60.33  ? -45 DG  I "C4'" 1 
ATOM   6756  O  "O4'" . DG  I 5  29  ? 182.897 160.728 132.659 1.00 60.33  ? -45 DG  I "O4'" 1 
ATOM   6757  C  "C3'" . DG  I 5  29  ? 181.568 159.503 134.186 1.00 60.33  ? -45 DG  I "C3'" 1 
ATOM   6758  O  "O3'" . DG  I 5  29  ? 180.437 159.054 133.494 1.00 60.33  ? -45 DG  I "O3'" 1 
ATOM   6759  C  "C2'" . DG  I 5  29  ? 182.796 158.706 133.763 1.00 60.33  ? -45 DG  I "C2'" 1 
ATOM   6760  C  "C1'" . DG  I 5  29  ? 183.059 159.351 132.428 1.00 60.33  ? -45 DG  I "C1'" 1 
ATOM   6761  N  N9    . DG  I 5  29  ? 184.398 159.130 131.908 1.00 60.33  ? -45 DG  I N9    1 
ATOM   6762  C  C8    . DG  I 5  29  ? 185.569 159.072 132.613 1.00 60.33  ? -45 DG  I C8    1 
ATOM   6763  N  N7    . DG  I 5  29  ? 186.614 158.892 131.857 1.00 60.33  ? -45 DG  I N7    1 
ATOM   6764  C  C5    . DG  I 5  29  ? 186.091 158.817 130.580 1.00 60.33  ? -45 DG  I C5    1 
ATOM   6765  C  C6    . DG  I 5  29  ? 186.737 158.629 129.350 1.00 60.33  ? -45 DG  I C6    1 
ATOM   6766  O  O6    . DG  I 5  29  ? 187.941 158.474 129.130 1.00 60.33  ? -45 DG  I O6    1 
ATOM   6767  N  N1    . DG  I 5  29  ? 185.836 158.610 128.300 1.00 60.33  ? -45 DG  I N1    1 
ATOM   6768  C  C2    . DG  I 5  29  ? 184.484 158.772 128.425 1.00 60.33  ? -45 DG  I C2    1 
ATOM   6769  N  N2    . DG  I 5  29  ? 183.773 158.729 127.302 1.00 60.33  ? -45 DG  I N2    1 
ATOM   6770  N  N3    . DG  I 5  29  ? 183.871 158.957 129.570 1.00 60.33  ? -45 DG  I N3    1 
ATOM   6771  C  C4    . DG  I 5  29  ? 184.734 158.972 130.601 1.00 60.33  ? -45 DG  I C4    1 
ATOM   6772  P  P     . DG  I 5  30  ? 179.497 157.910 134.115 1.00 62.42  ? -44 DG  I P     1 
ATOM   6773  O  OP1   . DG  I 5  30  ? 178.350 158.609 134.737 1.00 62.42  ? -44 DG  I OP1   1 
ATOM   6774  O  OP2   . DG  I 5  30  ? 180.309 156.979 134.928 1.00 62.42  ? -44 DG  I OP2   1 
ATOM   6775  O  "O5'" . DG  I 5  30  ? 178.997 157.110 132.824 1.00 62.42  ? -44 DG  I "O5'" 1 
ATOM   6776  C  "C5'" . DG  I 5  30  ? 178.127 157.745 131.893 1.00 62.42  ? -44 DG  I "C5'" 1 
ATOM   6777  C  "C4'" . DG  I 5  30  ? 178.296 157.172 130.502 1.00 62.42  ? -44 DG  I "C4'" 1 
ATOM   6778  O  "O4'" . DG  I 5  30  ? 179.673 157.313 130.091 1.00 62.42  ? -44 DG  I "O4'" 1 
ATOM   6779  C  "C3'" . DG  I 5  30  ? 177.954 155.694 130.362 1.00 62.42  ? -44 DG  I "C3'" 1 
ATOM   6780  O  "O3'" . DG  I 5  30  ? 177.247 155.476 129.150 1.00 62.42  ? -44 DG  I "O3'" 1 
ATOM   6781  C  "C2'" . DG  I 5  30  ? 179.318 155.019 130.346 1.00 62.42  ? -44 DG  I "C2'" 1 
ATOM   6782  C  "C1'" . DG  I 5  30  ? 180.182 156.069 129.683 1.00 62.42  ? -44 DG  I "C1'" 1 
ATOM   6783  N  N9    . DG  I 5  30  ? 181.573 156.014 130.086 1.00 62.42  ? -44 DG  I N9    1 
ATOM   6784  C  C8    . DG  I 5  30  ? 182.068 156.159 131.347 1.00 62.42  ? -44 DG  I C8    1 
ATOM   6785  N  N7    . DG  I 5  30  ? 183.365 156.079 131.409 1.00 62.42  ? -44 DG  I N7    1 
ATOM   6786  C  C5    . DG  I 5  30  ? 183.747 155.858 130.100 1.00 62.42  ? -44 DG  I C5    1 
ATOM   6787  C  C6    . DG  I 5  30  ? 185.028 155.700 129.547 1.00 62.42  ? -44 DG  I C6    1 
ATOM   6788  O  O6    . DG  I 5  30  ? 186.115 155.695 130.127 1.00 62.42  ? -44 DG  I O6    1 
ATOM   6789  N  N1    . DG  I 5  30  ? 184.974 155.505 128.179 1.00 62.42  ? -44 DG  I N1    1 
ATOM   6790  C  C2    . DG  I 5  30  ? 183.829 155.484 127.437 1.00 62.42  ? -44 DG  I C2    1 
ATOM   6791  N  N2    . DG  I 5  30  ? 183.967 155.280 126.128 1.00 62.42  ? -44 DG  I N2    1 
ATOM   6792  N  N3    . DG  I 5  30  ? 182.620 155.640 127.943 1.00 62.42  ? -44 DG  I N3    1 
ATOM   6793  C  C4    . DG  I 5  30  ? 182.658 155.831 129.275 1.00 62.42  ? -44 DG  I C4    1 
ATOM   6794  P  P     . DA  I 5  31  ? 176.542 154.063 128.855 1.00 63.52  ? -43 DA  I P     1 
ATOM   6795  O  OP1   . DA  I 5  31  ? 175.385 154.308 127.975 1.00 63.52  ? -43 DA  I OP1   1 
ATOM   6796  O  OP2   . DA  I 5  31  ? 176.403 153.308 130.106 1.00 63.52  ? -43 DA  I OP2   1 
ATOM   6797  O  "O5'" . DA  I 5  31  ? 177.613 153.285 127.994 1.00 63.52  ? -43 DA  I "O5'" 1 
ATOM   6798  C  "C5'" . DA  I 5  31  ? 178.113 153.875 126.838 1.00 63.52  ? -43 DA  I "C5'" 1 
ATOM   6799  C  "C4'" . DA  I 5  31  ? 179.320 153.121 126.346 1.00 63.52  ? -43 DA  I "C4'" 1 
ATOM   6800  O  "O4'" . DA  I 5  31  ? 180.462 153.409 127.182 1.00 63.52  ? -43 DA  I "O4'" 1 
ATOM   6801  C  "C3'" . DA  I 5  31  ? 179.183 151.595 126.358 1.00 63.52  ? -43 DA  I "C3'" 1 
ATOM   6802  O  "O3'" . DA  I 5  31  ? 179.687 151.095 125.148 1.00 63.52  ? -43 DA  I "O3'" 1 
ATOM   6803  C  "C2'" . DA  I 5  31  ? 180.080 151.190 127.526 1.00 63.52  ? -43 DA  I "C2'" 1 
ATOM   6804  C  "C1'" . DA  I 5  31  ? 181.165 152.215 127.349 1.00 63.52  ? -43 DA  I "C1'" 1 
ATOM   6805  N  N9    . DA  I 5  31  ? 182.074 152.359 128.461 1.00 63.52  ? -43 DA  I N9    1 
ATOM   6806  C  C8    . DA  I 5  31  ? 181.767 152.678 129.748 1.00 63.52  ? -43 DA  I C8    1 
ATOM   6807  N  N7    . DA  I 5  31  ? 182.813 152.773 130.529 1.00 63.52  ? -43 DA  I N7    1 
ATOM   6808  C  C5    . DA  I 5  31  ? 183.875 152.493 129.689 1.00 63.52  ? -43 DA  I C5    1 
ATOM   6809  C  C6    . DA  I 5  31  ? 185.259 152.423 129.903 1.00 63.52  ? -43 DA  I C6    1 
ATOM   6810  N  N6    . DA  I 5  31  ? 185.820 152.646 131.086 1.00 63.52  ? -43 DA  I N6    1 
ATOM   6811  N  N1    . DA  I 5  31  ? 186.047 152.127 128.846 1.00 63.52  ? -43 DA  I N1    1 
ATOM   6812  C  C2    . DA  I 5  31  ? 185.476 151.910 127.658 1.00 63.52  ? -43 DA  I C2    1 
ATOM   6813  N  N3    . DA  I 5  31  ? 184.185 151.943 127.339 1.00 63.52  ? -43 DA  I N3    1 
ATOM   6814  C  C4    . DA  I 5  31  ? 183.436 152.246 128.411 1.00 63.52  ? -43 DA  I C4    1 
ATOM   6815  P  P     . DG  I 5  32  ? 178.934 149.920 124.368 1.00 65.86  ? -42 DG  I P     1 
ATOM   6816  O  OP1   . DG  I 5  32  ? 177.701 150.458 123.753 1.00 65.86  ? -42 DG  I OP1   1 
ATOM   6817  O  OP2   . DG  I 5  32  ? 178.850 148.760 125.271 1.00 65.86  ? -42 DG  I OP2   1 
ATOM   6818  O  "O5'" . DG  I 5  32  ? 179.960 149.550 123.216 1.00 65.86  ? -42 DG  I "O5'" 1 
ATOM   6819  C  "C5'" . DG  I 5  32  ? 181.236 150.159 123.206 1.00 65.86  ? -42 DG  I "C5'" 1 
ATOM   6820  C  "C4'" . DG  I 5  32  ? 182.331 149.111 123.159 1.00 65.86  ? -42 DG  I "C4'" 1 
ATOM   6821  O  "O4'" . DG  I 5  32  ? 183.230 149.287 124.286 1.00 65.86  ? -42 DG  I "O4'" 1 
ATOM   6822  C  "C3'" . DG  I 5  32  ? 181.844 147.669 123.237 1.00 65.86  ? -42 DG  I "C3'" 1 
ATOM   6823  O  "O3'" . DG  I 5  32  ? 182.649 146.867 122.415 1.00 65.86  ? -42 DG  I "O3'" 1 
ATOM   6824  C  "C2'" . DG  I 5  32  ? 182.048 147.332 124.706 1.00 65.86  ? -42 DG  I "C2'" 1 
ATOM   6825  C  "C1'" . DG  I 5  32  ? 183.336 148.076 124.994 1.00 65.86  ? -42 DG  I "C1'" 1 
ATOM   6826  N  N9    . DG  I 5  32  ? 183.509 148.390 126.395 1.00 65.86  ? -42 DG  I N9    1 
ATOM   6827  C  C8    . DG  I 5  32  ? 182.530 148.748 127.275 1.00 65.86  ? -42 DG  I C8    1 
ATOM   6828  N  N7    . DG  I 5  32  ? 182.970 148.983 128.472 1.00 65.86  ? -42 DG  I N7    1 
ATOM   6829  C  C5    . DG  I 5  32  ? 184.327 148.763 128.379 1.00 65.86  ? -42 DG  I C5    1 
ATOM   6830  C  C6    . DG  I 5  32  ? 185.326 148.871 129.364 1.00 65.86  ? -42 DG  I C6    1 
ATOM   6831  O  O6    . DG  I 5  32  ? 185.198 149.179 130.549 1.00 65.86  ? -42 DG  I O6    1 
ATOM   6832  N  N1    . DG  I 5  32  ? 186.581 148.564 128.860 1.00 65.86  ? -42 DG  I N1    1 
ATOM   6833  C  C2    . DG  I 5  32  ? 186.840 148.203 127.565 1.00 65.86  ? -42 DG  I C2    1 
ATOM   6834  N  N2    . DG  I 5  32  ? 188.121 147.953 127.269 1.00 65.86  ? -42 DG  I N2    1 
ATOM   6835  N  N3    . DG  I 5  32  ? 185.909 148.105 126.622 1.00 65.86  ? -42 DG  I N3    1 
ATOM   6836  C  C4    . DG  I 5  32  ? 184.678 148.402 127.105 1.00 65.86  ? -42 DG  I C4    1 
ATOM   6837  P  P     . DA  I 5  33  ? 182.087 145.491 121.815 1.00 66.41  ? -41 DA  I P     1 
ATOM   6838  O  OP1   . DA  I 5  33  ? 181.811 145.738 120.384 1.00 66.41  ? -41 DA  I OP1   1 
ATOM   6839  O  OP2   . DA  I 5  33  ? 181.006 144.986 122.689 1.00 66.41  ? -41 DA  I OP2   1 
ATOM   6840  O  "O5'" . DA  I 5  33  ? 183.329 144.505 121.968 1.00 66.41  ? -41 DA  I "O5'" 1 
ATOM   6841  C  "C5'" . DA  I 5  33  ? 184.634 144.996 121.731 1.00 66.41  ? -41 DA  I "C5'" 1 
ATOM   6842  C  "C4'" . DA  I 5  33  ? 185.636 144.379 122.684 1.00 66.41  ? -41 DA  I "C4'" 1 
ATOM   6843  O  "O4'" . DA  I 5  33  ? 185.582 145.048 123.973 1.00 66.41  ? -41 DA  I "O4'" 1 
ATOM   6844  C  "C3'" . DA  I 5  33  ? 185.429 142.887 122.981 1.00 66.41  ? -41 DA  I "C3'" 1 
ATOM   6845  O  "O3'" . DA  I 5  33  ? 186.679 142.212 122.909 1.00 66.41  ? -41 DA  I "O3'" 1 
ATOM   6846  C  "C2'" . DA  I 5  33  ? 184.895 142.908 124.406 1.00 66.41  ? -41 DA  I "C2'" 1 
ATOM   6847  C  "C1'" . DA  I 5  33  ? 185.686 144.065 124.963 1.00 66.41  ? -41 DA  I "C1'" 1 
ATOM   6848  N  N9    . DA  I 5  33  ? 185.162 144.571 126.212 1.00 66.41  ? -41 DA  I N9    1 
ATOM   6849  C  C8    . DA  I 5  33  ? 183.874 144.918 126.480 1.00 66.41  ? -41 DA  I C8    1 
ATOM   6850  N  N7    . DA  I 5  33  ? 183.683 145.333 127.701 1.00 66.41  ? -41 DA  I N7    1 
ATOM   6851  C  C5    . DA  I 5  33  ? 184.937 145.246 128.276 1.00 66.41  ? -41 DA  I C5    1 
ATOM   6852  C  C6    . DA  I 5  33  ? 185.402 145.526 129.566 1.00 66.41  ? -41 DA  I C6    1 
ATOM   6853  N  N6    . DA  I 5  33  ? 184.612 145.987 130.533 1.00 66.41  ? -41 DA  I N6    1 
ATOM   6854  N  N1    . DA  I 5  33  ? 186.710 145.318 129.830 1.00 66.41  ? -41 DA  I N1    1 
ATOM   6855  C  C2    . DA  I 5  33  ? 187.499 144.859 128.853 1.00 66.41  ? -41 DA  I C2    1 
ATOM   6856  N  N3    . DA  I 5  33  ? 187.170 144.545 127.601 1.00 66.41  ? -41 DA  I N3    1 
ATOM   6857  C  C4    . DA  I 5  33  ? 185.859 144.766 127.378 1.00 66.41  ? -41 DA  I C4    1 
ATOM   6858  P  P     . DC  I 5  34  ? 186.755 140.628 122.655 1.00 64.05  ? -40 DC  I P     1 
ATOM   6859  O  OP1   . DC  I 5  34  ? 188.187 140.283 122.548 1.00 64.05  ? -40 DC  I OP1   1 
ATOM   6860  O  OP2   . DC  I 5  34  ? 185.846 140.307 121.534 1.00 64.05  ? -40 DC  I OP2   1 
ATOM   6861  O  "O5'" . DC  I 5  34  ? 186.153 139.984 123.993 1.00 64.05  ? -40 DC  I "O5'" 1 
ATOM   6862  C  "C5'" . DC  I 5  34  ? 186.800 138.887 124.617 1.00 64.05  ? -40 DC  I "C5'" 1 
ATOM   6863  C  "C4'" . DC  I 5  34  ? 187.706 139.360 125.736 1.00 64.05  ? -40 DC  I "C4'" 1 
ATOM   6864  O  "O4'" . DC  I 5  34  ? 187.174 140.569 126.293 1.00 64.05  ? -40 DC  I "O4'" 1 
ATOM   6865  C  "C3'" . DC  I 5  34  ? 187.835 138.395 126.901 1.00 64.05  ? -40 DC  I "C3'" 1 
ATOM   6866  O  "O3'" . DC  I 5  34  ? 188.986 137.573 126.719 1.00 64.05  ? -40 DC  I "O3'" 1 
ATOM   6867  C  "C2'" . DC  I 5  34  ? 188.003 139.303 128.120 1.00 64.05  ? -40 DC  I "C2'" 1 
ATOM   6868  C  "C1'" . DC  I 5  34  ? 187.570 140.692 127.637 1.00 64.05  ? -40 DC  I "C1'" 1 
ATOM   6869  N  N1    . DC  I 5  34  ? 186.417 141.285 128.387 1.00 64.05  ? -40 DC  I N1    1 
ATOM   6870  C  C2    . DC  I 5  34  ? 186.556 141.704 129.724 1.00 64.05  ? -40 DC  I C2    1 
ATOM   6871  O  O2    . DC  I 5  34  ? 187.636 141.581 130.307 1.00 64.05  ? -40 DC  I O2    1 
ATOM   6872  N  N3    . DC  I 5  34  ? 185.482 142.249 130.344 1.00 64.05  ? -40 DC  I N3    1 
ATOM   6873  C  C4    . DC  I 5  34  ? 184.324 142.373 129.696 1.00 64.05  ? -40 DC  I C4    1 
ATOM   6874  N  N4    . DC  I 5  34  ? 183.296 142.916 130.347 1.00 64.05  ? -40 DC  I N4    1 
ATOM   6875  C  C5    . DC  I 5  34  ? 184.170 141.966 128.344 1.00 64.05  ? -40 DC  I C5    1 
ATOM   6876  C  C6    . DC  I 5  34  ? 185.233 141.442 127.737 1.00 64.05  ? -40 DC  I C6    1 
ATOM   6877  P  P     . DT  I 5  35  ? 189.041 136.089 127.338 1.00 60.87  ? -39 DT  I P     1 
ATOM   6878  O  OP1   . DT  I 5  35  ? 190.280 135.455 126.839 1.00 60.87  ? -39 DT  I OP1   1 
ATOM   6879  O  OP2   . DT  I 5  35  ? 187.741 135.436 127.080 1.00 60.87  ? -39 DT  I OP2   1 
ATOM   6880  O  "O5'" . DT  I 5  35  ? 189.179 136.320 128.918 1.00 60.87  ? -39 DT  I "O5'" 1 
ATOM   6881  C  "C5'" . DT  I 5  35  ? 190.413 136.772 129.454 1.00 60.87  ? -39 DT  I "C5'" 1 
ATOM   6882  C  "C4'" . DT  I 5  35  ? 190.309 137.055 130.945 1.00 60.87  ? -39 DT  I "C4'" 1 
ATOM   6883  O  "O4'" . DT  I 5  35  ? 189.280 138.045 131.198 1.00 60.87  ? -39 DT  I "O4'" 1 
ATOM   6884  C  "C3'" . DT  I 5  35  ? 189.966 135.854 131.828 1.00 60.87  ? -39 DT  I "C3'" 1 
ATOM   6885  O  "O3'" . DT  I 5  35  ? 190.808 135.864 132.964 1.00 60.87  ? -39 DT  I "O3'" 1 
ATOM   6886  C  "C2'" . DT  I 5  35  ? 188.516 136.125 132.218 1.00 60.87  ? -39 DT  I "C2'" 1 
ATOM   6887  C  "C1'" . DT  I 5  35  ? 188.532 137.631 132.313 1.00 60.87  ? -39 DT  I "C1'" 1 
ATOM   6888  N  N1    . DT  I 5  35  ? 187.204 138.224 132.218 1.00 60.87  ? -39 DT  I N1    1 
ATOM   6889  C  C2    . DT  I 5  35  ? 186.681 138.877 133.295 1.00 60.87  ? -39 DT  I C2    1 
ATOM   6890  O  O2    . DT  I 5  35  ? 187.272 139.000 134.346 1.00 60.87  ? -39 DT  I O2    1 
ATOM   6891  N  N3    . DT  I 5  35  ? 185.439 139.391 133.099 1.00 60.87  ? -39 DT  I N3    1 
ATOM   6892  C  C4    . DT  I 5  35  ? 184.686 139.311 131.950 1.00 60.87  ? -39 DT  I C4    1 
ATOM   6893  O  O4    . DT  I 5  35  ? 183.578 139.804 131.859 1.00 60.87  ? -39 DT  I O4    1 
ATOM   6894  C  C5    . DT  I 5  35  ? 185.298 138.609 130.863 1.00 60.87  ? -39 DT  I C5    1 
ATOM   6895  C  C7    . DT  I 5  35  ? 184.573 138.453 129.565 1.00 60.87  ? -39 DT  I C7    1 
ATOM   6896  C  C6    . DT  I 5  35  ? 186.507 138.097 131.053 1.00 60.87  ? -39 DT  I C6    1 
ATOM   6897  P  P     . DA  I 5  36  ? 191.028 134.544 133.854 1.00 63.77  ? -38 DA  I P     1 
ATOM   6898  O  OP1   . DA  I 5  36  ? 192.424 134.096 133.663 1.00 63.77  ? -38 DA  I OP1   1 
ATOM   6899  O  OP2   . DA  I 5  36  ? 189.924 133.586 133.638 1.00 63.77  ? -38 DA  I OP2   1 
ATOM   6900  O  "O5'" . DA  I 5  36  ? 190.897 135.099 135.338 1.00 63.77  ? -38 DA  I "O5'" 1 
ATOM   6901  C  "C5'" . DA  I 5  36  ? 189.878 136.027 135.653 1.00 63.77  ? -38 DA  I "C5'" 1 
ATOM   6902  C  "C4'" . DA  I 5  36  ? 189.425 135.834 137.080 1.00 63.77  ? -38 DA  I "C4'" 1 
ATOM   6903  O  "O4'" . DA  I 5  36  ? 188.030 136.173 137.175 1.00 63.77  ? -38 DA  I "O4'" 1 
ATOM   6904  C  "C3'" . DA  I 5  36  ? 189.475 134.402 137.548 1.00 63.77  ? -38 DA  I "C3'" 1 
ATOM   6905  O  "O3'" . DA  I 5  36  ? 189.343 134.355 138.939 1.00 63.77  ? -38 DA  I "O3'" 1 
ATOM   6906  C  "C2'" . DA  I 5  36  ? 188.240 133.845 136.870 1.00 63.77  ? -38 DA  I "C2'" 1 
ATOM   6907  C  "C1'" . DA  I 5  36  ? 187.260 134.999 137.058 1.00 63.77  ? -38 DA  I "C1'" 1 
ATOM   6908  N  N9    . DA  I 5  36  ? 186.358 135.164 135.935 1.00 63.77  ? -38 DA  I N9    1 
ATOM   6909  C  C8    . DA  I 5  36  ? 186.448 134.567 134.712 1.00 63.77  ? -38 DA  I C8    1 
ATOM   6910  N  N7    . DA  I 5  36  ? 185.490 134.907 133.888 1.00 63.77  ? -38 DA  I N7    1 
ATOM   6911  C  C5    . DA  I 5  36  ? 184.723 135.788 134.625 1.00 63.77  ? -38 DA  I C5    1 
ATOM   6912  C  C6    . DA  I 5  36  ? 183.563 136.508 134.324 1.00 63.77  ? -38 DA  I C6    1 
ATOM   6913  N  N6    . DA  I 5  36  ? 182.944 136.443 133.144 1.00 63.77  ? -38 DA  I N6    1 
ATOM   6914  N  N1    . DA  I 5  36  ? 183.053 137.298 135.287 1.00 63.77  ? -38 DA  I N1    1 
ATOM   6915  C  C2    . DA  I 5  36  ? 183.671 137.363 136.469 1.00 63.77  ? -38 DA  I C2    1 
ATOM   6916  N  N3    . DA  I 5  36  ? 184.768 136.732 136.866 1.00 63.77  ? -38 DA  I N3    1 
ATOM   6917  C  C4    . DA  I 5  36  ? 185.247 135.954 135.889 1.00 63.77  ? -38 DA  I C4    1 
ATOM   6918  P  P     . DG  I 5  37  ? 190.048 133.173 139.756 1.00 64.91  ? -37 DG  I P     1 
ATOM   6919  O  OP1   . DG  I 5  37  ? 191.498 133.471 139.821 1.00 64.91  ? -37 DG  I OP1   1 
ATOM   6920  O  OP2   . DG  I 5  37  ? 189.572 131.906 139.163 1.00 64.91  ? -37 DG  I OP2   1 
ATOM   6921  O  "O5'" . DG  I 5  37  ? 189.405 133.269 141.215 1.00 64.91  ? -37 DG  I "O5'" 1 
ATOM   6922  C  "C5'" . DG  I 5  37  ? 189.238 134.534 141.847 1.00 64.91  ? -37 DG  I "C5'" 1 
ATOM   6923  C  "C4'" . DG  I 5  37  ? 187.789 134.778 142.233 1.00 64.91  ? -37 DG  I "C4'" 1 
ATOM   6924  O  "O4'" . DG  I 5  37  ? 186.957 134.770 141.044 1.00 64.91  ? -37 DG  I "O4'" 1 
ATOM   6925  C  "C3'" . DG  I 5  37  ? 187.168 133.754 143.180 1.00 64.91  ? -37 DG  I "C3'" 1 
ATOM   6926  O  "O3'" . DG  I 5  37  ? 186.290 134.432 144.054 1.00 64.91  ? -37 DG  I "O3'" 1 
ATOM   6927  C  "C2'" . DG  I 5  37  ? 186.394 132.863 142.223 1.00 64.91  ? -37 DG  I "C2'" 1 
ATOM   6928  C  "C1'" . DG  I 5  37  ? 185.877 133.899 141.251 1.00 64.91  ? -37 DG  I "C1'" 1 
ATOM   6929  N  N9    . DG  I 5  37  ? 185.484 133.355 139.971 1.00 64.91  ? -37 DG  I N9    1 
ATOM   6930  C  C8    . DG  I 5  37  ? 186.144 132.407 139.248 1.00 64.91  ? -37 DG  I C8    1 
ATOM   6931  N  N7    . DG  I 5  37  ? 185.561 132.113 138.121 1.00 64.91  ? -37 DG  I N7    1 
ATOM   6932  C  C5    . DG  I 5  37  ? 184.440 132.921 138.100 1.00 64.91  ? -37 DG  I C5    1 
ATOM   6933  C  C6    . DG  I 5  37  ? 183.425 133.040 137.128 1.00 64.91  ? -37 DG  I C6    1 
ATOM   6934  O  O6    . DG  I 5  37  ? 183.311 132.432 136.059 1.00 64.91  ? -37 DG  I O6    1 
ATOM   6935  N  N1    . DG  I 5  37  ? 182.472 133.975 137.496 1.00 64.91  ? -37 DG  I N1    1 
ATOM   6936  C  C2    . DG  I 5  37  ? 182.497 134.702 138.660 1.00 64.91  ? -37 DG  I C2    1 
ATOM   6937  N  N2    . DG  I 5  37  ? 181.488 135.557 138.845 1.00 64.91  ? -37 DG  I N2    1 
ATOM   6938  N  N3    . DG  I 5  37  ? 183.444 134.598 139.580 1.00 64.91  ? -37 DG  I N3    1 
ATOM   6939  C  C4    . DG  I 5  37  ? 184.379 133.693 139.234 1.00 64.91  ? -37 DG  I C4    1 
ATOM   6940  P  P     . DG  I 5  38  ? 185.851 133.803 145.465 1.00 61.00  ? -36 DG  I P     1 
ATOM   6941  O  OP1   . DG  I 5  38  ? 186.971 134.019 146.401 1.00 61.00  ? -36 DG  I OP1   1 
ATOM   6942  O  OP2   . DG  I 5  38  ? 185.310 132.444 145.257 1.00 61.00  ? -36 DG  I OP2   1 
ATOM   6943  O  "O5'" . DG  I 5  38  ? 184.630 134.733 145.904 1.00 61.00  ? -36 DG  I "O5'" 1 
ATOM   6944  C  "C5'" . DG  I 5  38  ? 184.031 135.607 144.947 1.00 61.00  ? -36 DG  I "C5'" 1 
ATOM   6945  C  "C4'" . DG  I 5  38  ? 182.549 135.323 144.783 1.00 61.00  ? -36 DG  I "C4'" 1 
ATOM   6946  O  "O4'" . DG  I 5  38  ? 182.288 134.784 143.456 1.00 61.00  ? -36 DG  I "O4'" 1 
ATOM   6947  C  "C3'" . DG  I 5  38  ? 181.971 134.305 145.752 1.00 61.00  ? -36 DG  I "C3'" 1 
ATOM   6948  O  "O3'" . DG  I 5  38  ? 180.636 134.618 145.987 1.00 61.00  ? -36 DG  I "O3'" 1 
ATOM   6949  C  "C2'" . DG  I 5  38  ? 182.053 133.025 144.940 1.00 61.00  ? -36 DG  I "C2'" 1 
ATOM   6950  C  "C1'" . DG  I 5  38  ? 181.622 133.550 143.587 1.00 61.00  ? -36 DG  I "C1'" 1 
ATOM   6951  N  N9    . DG  I 5  38  ? 182.012 132.688 142.483 1.00 61.00  ? -36 DG  I N9    1 
ATOM   6952  C  C8    . DG  I 5  38  ? 183.127 131.902 142.418 1.00 61.00  ? -36 DG  I C8    1 
ATOM   6953  N  N7    . DG  I 5  38  ? 183.233 131.234 141.308 1.00 61.00  ? -36 DG  I N7    1 
ATOM   6954  C  C5    . DG  I 5  38  ? 182.104 131.585 140.595 1.00 61.00  ? -36 DG  I C5    1 
ATOM   6955  C  C6    . DG  I 5  38  ? 181.675 131.167 139.323 1.00 61.00  ? -36 DG  I C6    1 
ATOM   6956  O  O6    . DG  I 5  38  ? 182.229 130.381 138.547 1.00 61.00  ? -36 DG  I O6    1 
ATOM   6957  N  N1    . DG  I 5  38  ? 180.479 131.770 138.964 1.00 61.00  ? -36 DG  I N1    1 
ATOM   6958  C  C2    . DG  I 5  38  ? 179.787 132.663 139.740 1.00 61.00  ? -36 DG  I C2    1 
ATOM   6959  N  N2    . DG  I 5  38  ? 178.653 133.146 139.220 1.00 61.00  ? -36 DG  I N2    1 
ATOM   6960  N  N3    . DG  I 5  38  ? 180.175 133.059 140.942 1.00 61.00  ? -36 DG  I N3    1 
ATOM   6961  C  C4    . DG  I 5  38  ? 181.337 132.482 141.304 1.00 61.00  ? -36 DG  I C4    1 
ATOM   6962  P  P     . DG  I 5  39  ? 180.182 135.436 147.286 1.00 58.50  ? -35 DG  I P     1 
ATOM   6963  O  OP1   . DG  I 5  39  ? 181.184 136.483 147.561 1.00 58.50  ? -35 DG  I OP1   1 
ATOM   6964  O  OP2   . DG  I 5  39  ? 179.855 134.465 148.347 1.00 58.50  ? -35 DG  I OP2   1 
ATOM   6965  O  "O5'" . DG  I 5  39  ? 178.833 136.124 146.784 1.00 58.50  ? -35 DG  I "O5'" 1 
ATOM   6966  C  "C5'" . DG  I 5  39  ? 178.786 136.664 145.471 1.00 58.50  ? -35 DG  I "C5'" 1 
ATOM   6967  C  "C4'" . DG  I 5  39  ? 177.417 136.485 144.835 1.00 58.50  ? -35 DG  I "C4'" 1 
ATOM   6968  O  "O4'" . DG  I 5  39  ? 177.443 135.415 143.863 1.00 58.50  ? -35 DG  I "O4'" 1 
ATOM   6969  C  "C3'" . DG  I 5  39  ? 176.278 136.178 145.781 1.00 58.50  ? -35 DG  I "C3'" 1 
ATOM   6970  O  "O3'" . DG  I 5  39  ? 175.137 136.885 145.336 1.00 58.50  ? -35 DG  I "O3'" 1 
ATOM   6971  C  "C2'" . DG  I 5  39  ? 176.122 134.656 145.678 1.00 58.50  ? -35 DG  I "C2'" 1 
ATOM   6972  C  "C1'" . DG  I 5  39  ? 176.646 134.329 144.284 1.00 58.50  ? -35 DG  I "C1'" 1 
ATOM   6973  N  N9    . DG  I 5  39  ? 177.489 133.138 144.238 1.00 58.50  ? -35 DG  I N9    1 
ATOM   6974  C  C8    . DG  I 5  39  ? 178.375 132.725 145.194 1.00 58.50  ? -35 DG  I C8    1 
ATOM   6975  N  N7    . DG  I 5  39  ? 179.020 131.644 144.873 1.00 58.50  ? -35 DG  I N7    1 
ATOM   6976  C  C5    . DG  I 5  39  ? 178.544 131.324 143.614 1.00 58.50  ? -35 DG  I C5    1 
ATOM   6977  C  C6    . DG  I 5  39  ? 178.896 130.259 142.754 1.00 58.50  ? -35 DG  I C6    1 
ATOM   6978  O  O6    . DG  I 5  39  ? 179.698 129.341 142.956 1.00 58.50  ? -35 DG  I O6    1 
ATOM   6979  N  N1    . DG  I 5  39  ? 178.166 130.290 141.572 1.00 58.50  ? -35 DG  I N1    1 
ATOM   6980  C  C2    . DG  I 5  39  ? 177.237 131.243 141.255 1.00 58.50  ? -35 DG  I C2    1 
ATOM   6981  N  N2    . DG  I 5  39  ? 176.639 131.120 140.058 1.00 58.50  ? -35 DG  I N2    1 
ATOM   6982  N  N3    . DG  I 5  39  ? 176.915 132.260 142.043 1.00 58.50  ? -35 DG  I N3    1 
ATOM   6983  C  C4    . DG  I 5  39  ? 177.606 132.237 143.203 1.00 58.50  ? -35 DG  I C4    1 
ATOM   6984  P  P     . DA  I 5  40  ? 173.706 136.707 146.033 1.00 59.75  ? -34 DA  I P     1 
ATOM   6985  O  OP1   . DA  I 5  40  ? 172.983 137.981 145.862 1.00 59.75  ? -34 DA  I OP1   1 
ATOM   6986  O  OP2   . DA  I 5  40  ? 173.868 136.175 147.401 1.00 59.75  ? -34 DA  I OP2   1 
ATOM   6987  O  "O5'" . DA  I 5  40  ? 172.996 135.646 145.088 1.00 59.75  ? -34 DA  I "O5'" 1 
ATOM   6988  C  "C5'" . DA  I 5  40  ? 173.163 135.764 143.683 1.00 59.75  ? -34 DA  I "C5'" 1 
ATOM   6989  C  "C4'" . DA  I 5  40  ? 172.674 134.528 142.961 1.00 59.75  ? -34 DA  I "C4'" 1 
ATOM   6990  O  "O4'" . DA  I 5  40  ? 173.722 133.518 142.924 1.00 59.75  ? -34 DA  I "O4'" 1 
ATOM   6991  C  "C3'" . DA  I 5  40  ? 171.461 133.847 143.596 1.00 59.75  ? -34 DA  I "C3'" 1 
ATOM   6992  O  "O3'" . DA  I 5  40  ? 170.555 133.436 142.578 1.00 59.75  ? -34 DA  I "O3'" 1 
ATOM   6993  C  "C2'" . DA  I 5  40  ? 172.094 132.649 144.281 1.00 59.75  ? -34 DA  I "C2'" 1 
ATOM   6994  C  "C1'" . DA  I 5  40  ? 173.145 132.290 143.255 1.00 59.75  ? -34 DA  I "C1'" 1 
ATOM   6995  N  N9    . DA  I 5  40  ? 174.168 131.394 143.760 1.00 59.75  ? -34 DA  I N9    1 
ATOM   6996  C  C8    . DA  I 5  40  ? 174.788 131.462 144.965 1.00 59.75  ? -34 DA  I C8    1 
ATOM   6997  N  N7    . DA  I 5  40  ? 175.667 130.518 145.160 1.00 59.75  ? -34 DA  I N7    1 
ATOM   6998  C  C5    . DA  I 5  40  ? 175.600 129.764 144.014 1.00 59.75  ? -34 DA  I C5    1 
ATOM   6999  C  C6    . DA  I 5  40  ? 176.273 128.614 143.619 1.00 59.75  ? -34 DA  I C6    1 
ATOM   7000  N  N6    . DA  I 5  40  ? 177.194 128.030 144.378 1.00 59.75  ? -34 DA  I N6    1 
ATOM   7001  N  N1    . DA  I 5  40  ? 175.998 128.107 142.406 1.00 59.75  ? -34 DA  I N1    1 
ATOM   7002  C  C2    . DA  I 5  40  ? 175.075 128.709 141.653 1.00 59.75  ? -34 DA  I C2    1 
ATOM   7003  N  N3    . DA  I 5  40  ? 174.366 129.801 141.927 1.00 59.75  ? -34 DA  I N3    1 
ATOM   7004  C  C4    . DA  I 5  40  ? 174.678 130.279 143.138 1.00 59.75  ? -34 DA  I C4    1 
ATOM   7005  P  P     . DG  I 5  41  ? 168.976 133.373 142.863 1.00 65.49  ? -33 DG  I P     1 
ATOM   7006  O  OP1   . DG  I 5  41  ? 168.424 134.718 142.614 1.00 65.49  ? -33 DG  I OP1   1 
ATOM   7007  O  OP2   . DG  I 5  41  ? 168.782 132.717 144.169 1.00 65.49  ? -33 DG  I OP2   1 
ATOM   7008  O  "O5'" . DG  I 5  41  ? 168.420 132.384 141.742 1.00 65.49  ? -33 DG  I "O5'" 1 
ATOM   7009  C  "C5'" . DG  I 5  41  ? 168.630 132.677 140.368 1.00 65.49  ? -33 DG  I "C5'" 1 
ATOM   7010  C  "C4'" . DG  I 5  41  ? 168.856 131.412 139.546 1.00 65.49  ? -33 DG  I "C4'" 1 
ATOM   7011  O  "O4'" . DG  I 5  41  ? 170.048 130.718 139.997 1.00 65.49  ? -33 DG  I "O4'" 1 
ATOM   7012  C  "C3'" . DG  I 5  41  ? 167.736 130.385 139.575 1.00 65.49  ? -33 DG  I "C3'" 1 
ATOM   7013  O  "O3'" . DG  I 5  41  ? 167.612 129.798 138.292 1.00 65.49  ? -33 DG  I "O3'" 1 
ATOM   7014  C  "C2'" . DG  I 5  41  ? 168.219 129.373 140.612 1.00 65.49  ? -33 DG  I "C2'" 1 
ATOM   7015  C  "C1'" . DG  I 5  41  ? 169.730 129.407 140.420 1.00 65.49  ? -33 DG  I "C1'" 1 
ATOM   7016  N  N9    . DG  I 5  41  ? 170.483 129.158 141.645 1.00 65.49  ? -33 DG  I N9    1 
ATOM   7017  C  C8    . DG  I 5  41  ? 170.502 129.947 142.755 1.00 65.49  ? -33 DG  I C8    1 
ATOM   7018  N  N7    . DG  I 5  41  ? 171.269 129.497 143.699 1.00 65.49  ? -33 DG  I N7    1 
ATOM   7019  C  C5    . DG  I 5  41  ? 171.812 128.352 143.177 1.00 65.49  ? -33 DG  I C5    1 
ATOM   7020  C  C6    . DG  I 5  41  ? 172.723 127.452 143.752 1.00 65.49  ? -33 DG  I C6    1 
ATOM   7021  O  O6    . DG  I 5  41  ? 173.247 127.501 144.869 1.00 65.49  ? -33 DG  I O6    1 
ATOM   7022  N  N1    . DG  I 5  41  ? 173.023 126.412 142.895 1.00 65.49  ? -33 DG  I N1    1 
ATOM   7023  C  C2    . DG  I 5  41  ? 172.499 126.262 141.637 1.00 65.49  ? -33 DG  I C2    1 
ATOM   7024  N  N2    . DG  I 5  41  ? 172.908 125.188 140.950 1.00 65.49  ? -33 DG  I N2    1 
ATOM   7025  N  N3    . DG  I 5  41  ? 171.640 127.107 141.084 1.00 65.49  ? -33 DG  I N3    1 
ATOM   7026  C  C4    . DG  I 5  41  ? 171.344 128.124 141.909 1.00 65.49  ? -33 DG  I C4    1 
ATOM   7027  P  P     . DT  I 5  42  ? 166.310 128.942 137.909 1.00 73.91  ? -32 DT  I P     1 
ATOM   7028  O  OP1   . DT  I 5  42  ? 166.192 128.908 136.438 1.00 73.91  ? -32 DT  I OP1   1 
ATOM   7029  O  OP2   . DT  I 5  42  ? 165.187 129.446 138.728 1.00 73.91  ? -32 DT  I OP2   1 
ATOM   7030  O  "O5'" . DT  I 5  42  ? 166.695 127.468 138.378 1.00 73.91  ? -32 DT  I "O5'" 1 
ATOM   7031  C  "C5'" . DT  I 5  42  ? 167.906 126.902 137.931 1.00 73.91  ? -32 DT  I "C5'" 1 
ATOM   7032  C  "C4'" . DT  I 5  42  ? 168.144 125.560 138.585 1.00 73.91  ? -32 DT  I "C4'" 1 
ATOM   7033  O  "O4'" . DT  I 5  42  ? 168.934 125.714 139.791 1.00 73.91  ? -32 DT  I "O4'" 1 
ATOM   7034  C  "C3'" . DT  I 5  42  ? 166.882 124.808 139.002 1.00 73.91  ? -32 DT  I "C3'" 1 
ATOM   7035  O  "O3'" . DT  I 5  42  ? 166.992 123.484 138.544 1.00 73.91  ? -32 DT  I "O3'" 1 
ATOM   7036  C  "C2'" . DT  I 5  42  ? 166.934 124.875 140.533 1.00 73.91  ? -32 DT  I "C2'" 1 
ATOM   7037  C  "C1'" . DT  I 5  42  ? 168.426 124.826 140.753 1.00 73.91  ? -32 DT  I "C1'" 1 
ATOM   7038  N  N1    . DT  I 5  42  ? 168.854 125.282 142.083 1.00 73.91  ? -32 DT  I N1    1 
ATOM   7039  C  C2    . DT  I 5  42  ? 169.806 124.570 142.769 1.00 73.91  ? -32 DT  I C2    1 
ATOM   7040  O  O2    . DT  I 5  42  ? 170.324 123.559 142.337 1.00 73.91  ? -32 DT  I O2    1 
ATOM   7041  N  N3    . DT  I 5  42  ? 170.137 125.089 143.983 1.00 73.91  ? -32 DT  I N3    1 
ATOM   7042  C  C4    . DT  I 5  42  ? 169.617 126.222 144.566 1.00 73.91  ? -32 DT  I C4    1 
ATOM   7043  O  O4    . DT  I 5  42  ? 169.974 126.619 145.663 1.00 73.91  ? -32 DT  I O4    1 
ATOM   7044  C  C5    . DT  I 5  42  ? 168.629 126.915 143.795 1.00 73.91  ? -32 DT  I C5    1 
ATOM   7045  C  C7    . DT  I 5  42  ? 167.990 128.158 144.336 1.00 73.91  ? -32 DT  I C7    1 
ATOM   7046  C  C6    . DT  I 5  42  ? 168.298 126.416 142.604 1.00 73.91  ? -32 DT  I C6    1 
ATOM   7047  P  P     . DA  I 5  43  ? 165.705 122.535 138.417 1.00 85.13  ? -31 DA  I P     1 
ATOM   7048  O  OP1   . DA  I 5  43  ? 165.502 122.316 136.970 1.00 85.13  ? -31 DA  I OP1   1 
ATOM   7049  O  OP2   . DA  I 5  43  ? 164.597 123.054 139.244 1.00 85.13  ? -31 DA  I OP2   1 
ATOM   7050  O  "O5'" . DA  I 5  43  ? 166.209 121.180 139.092 1.00 85.13  ? -31 DA  I "O5'" 1 
ATOM   7051  C  "C5'" . DA  I 5  43  ? 167.239 121.231 140.058 1.00 85.13  ? -31 DA  I "C5'" 1 
ATOM   7052  C  "C4'" . DA  I 5  43  ? 167.648 119.841 140.471 1.00 85.13  ? -31 DA  I "C4'" 1 
ATOM   7053  O  "O4'" . DA  I 5  43  ? 168.412 119.911 141.697 1.00 85.13  ? -31 DA  I "O4'" 1 
ATOM   7054  C  "C3'" . DA  I 5  43  ? 166.498 118.926 140.793 1.00 85.13  ? -31 DA  I "C3'" 1 
ATOM   7055  O  "O3'" . DA  I 5  43  ? 166.920 117.588 140.673 1.00 85.13  ? -31 DA  I "O3'" 1 
ATOM   7056  C  "C2'" . DA  I 5  43  ? 166.194 119.300 142.241 1.00 85.13  ? -31 DA  I "C2'" 1 
ATOM   7057  C  "C1'" . DA  I 5  43  ? 167.578 119.624 142.802 1.00 85.13  ? -31 DA  I "C1'" 1 
ATOM   7058  N  N9    . DA  I 5  43  ? 167.598 120.784 143.687 1.00 85.13  ? -31 DA  I N9    1 
ATOM   7059  C  C8    . DA  I 5  43  ? 166.981 121.976 143.477 1.00 85.13  ? -31 DA  I C8    1 
ATOM   7060  N  N7    . DA  I 5  43  ? 167.183 122.851 144.427 1.00 85.13  ? -31 DA  I N7    1 
ATOM   7061  C  C5    . DA  I 5  43  ? 167.981 122.185 145.330 1.00 85.13  ? -31 DA  I C5    1 
ATOM   7062  C  C6    . DA  I 5  43  ? 168.548 122.572 146.559 1.00 85.13  ? -31 DA  I C6    1 
ATOM   7063  N  N6    . DA  I 5  43  ? 168.363 123.773 147.100 1.00 85.13  ? -31 DA  I N6    1 
ATOM   7064  N  N1    . DA  I 5  43  ? 169.307 121.671 147.216 1.00 85.13  ? -31 DA  I N1    1 
ATOM   7065  C  C2    . DA  I 5  43  ? 169.492 120.469 146.666 1.00 85.13  ? -31 DA  I C2    1 
ATOM   7066  N  N3    . DA  I 5  43  ? 169.006 119.991 145.517 1.00 85.13  ? -31 DA  I N3    1 
ATOM   7067  C  C4    . DA  I 5  43  ? 168.258 120.911 144.889 1.00 85.13  ? -31 DA  I C4    1 
ATOM   7068  P  P     . DA  I 5  44  ? 165.859 116.396 140.803 1.00 87.88  ? -30 DA  I P     1 
ATOM   7069  O  OP1   . DA  I 5  44  ? 166.349 115.264 139.988 1.00 87.88  ? -30 DA  I OP1   1 
ATOM   7070  O  OP2   . DA  I 5  44  ? 164.521 116.967 140.545 1.00 87.88  ? -30 DA  I OP2   1 
ATOM   7071  O  "O5'" . DA  I 5  44  ? 165.958 115.983 142.340 1.00 87.88  ? -30 DA  I "O5'" 1 
ATOM   7072  C  "C5'" . DA  I 5  44  ? 167.185 115.514 142.847 1.00 87.88  ? -30 DA  I "C5'" 1 
ATOM   7073  C  "C4'" . DA  I 5  44  ? 167.211 115.575 144.357 1.00 87.88  ? -30 DA  I "C4'" 1 
ATOM   7074  O  "O4'" . DA  I 5  44  ? 167.173 116.940 144.789 1.00 87.88  ? -30 DA  I "O4'" 1 
ATOM   7075  C  "C3'" . DA  I 5  44  ? 166.039 114.887 145.066 1.00 87.88  ? -30 DA  I "C3'" 1 
ATOM   7076  O  "O3'" . DA  I 5  44  ? 166.505 113.691 145.692 1.00 87.88  ? -30 DA  I "O3'" 1 
ATOM   7077  C  "C2'" . DA  I 5  44  ? 165.554 115.929 146.094 1.00 87.88  ? -30 DA  I "C2'" 1 
ATOM   7078  C  "C1'" . DA  I 5  44  ? 166.677 116.948 146.094 1.00 87.88  ? -30 DA  I "C1'" 1 
ATOM   7079  N  N9    . DA  I 5  44  ? 166.251 118.299 146.399 1.00 87.88  ? -30 DA  I N9    1 
ATOM   7080  C  C8    . DA  I 5  44  ? 165.476 119.107 145.630 1.00 87.88  ? -30 DA  I C8    1 
ATOM   7081  N  N7    . DA  I 5  44  ? 165.264 120.287 146.151 1.00 87.88  ? -30 DA  I N7    1 
ATOM   7082  C  C5    . DA  I 5  44  ? 165.961 120.252 147.338 1.00 87.88  ? -30 DA  I C5    1 
ATOM   7083  C  C6    . DA  I 5  44  ? 166.134 121.196 148.359 1.00 87.88  ? -30 DA  I C6    1 
ATOM   7084  N  N6    . DA  I 5  44  ? 165.594 122.413 148.326 1.00 87.88  ? -30 DA  I N6    1 
ATOM   7085  N  N1    . DA  I 5  44  ? 166.893 120.848 149.416 1.00 87.88  ? -30 DA  I N1    1 
ATOM   7086  C  C2    . DA  I 5  44  ? 167.438 119.627 149.441 1.00 87.88  ? -30 DA  I C2    1 
ATOM   7087  N  N3    . DA  I 5  44  ? 167.336 118.652 148.540 1.00 87.88  ? -30 DA  I N3    1 
ATOM   7088  C  C4    . DA  I 5  44  ? 166.575 119.033 147.508 1.00 87.88  ? -30 DA  I C4    1 
ATOM   7089  P  P     . DT  I 5  45  ? 165.509 112.734 146.511 1.00 90.01  ? -29 DT  I P     1 
ATOM   7090  O  OP1   . DT  I 5  45  ? 166.050 111.363 146.405 1.00 90.01  ? -29 DT  I OP1   1 
ATOM   7091  O  OP2   . DT  I 5  45  ? 164.116 113.003 146.097 1.00 90.01  ? -29 DT  I OP2   1 
ATOM   7092  O  "O5'" . DT  I 5  45  ? 165.695 113.213 148.018 1.00 90.01  ? -29 DT  I "O5'" 1 
ATOM   7093  C  "C5'" . DT  I 5  45  ? 167.003 113.397 148.523 1.00 90.01  ? -29 DT  I "C5'" 1 
ATOM   7094  C  "C4'" . DT  I 5  45  ? 166.990 114.017 149.910 1.00 90.01  ? -29 DT  I "C4'" 1 
ATOM   7095  O  "O4'" . DT  I 5  45  ? 166.687 115.437 149.834 1.00 90.01  ? -29 DT  I "O4'" 1 
ATOM   7096  C  "C3'" . DT  I 5  45  ? 165.975 113.428 150.894 1.00 90.01  ? -29 DT  I "C3'" 1 
ATOM   7097  O  "O3'" . DT  I 5  45  ? 166.590 113.342 152.159 1.00 90.01  ? -29 DT  I "O3'" 1 
ATOM   7098  C  "C2'" . DT  I 5  45  ? 164.890 114.494 150.895 1.00 90.01  ? -29 DT  I "C2'" 1 
ATOM   7099  C  "C1'" . DT  I 5  45  ? 165.757 115.729 150.842 1.00 90.01  ? -29 DT  I "C1'" 1 
ATOM   7100  N  N1    . DT  I 5  45  ? 165.035 116.964 150.490 1.00 90.01  ? -29 DT  I N1    1 
ATOM   7101  C  C2    . DT  I 5  45  ? 165.101 118.043 151.341 1.00 90.01  ? -29 DT  I C2    1 
ATOM   7102  O  O2    . DT  I 5  45  ? 165.721 118.035 152.383 1.00 90.01  ? -29 DT  I O2    1 
ATOM   7103  N  N3    . DT  I 5  45  ? 164.401 119.135 150.925 1.00 90.01  ? -29 DT  I N3    1 
ATOM   7104  C  C4    . DT  I 5  45  ? 163.665 119.253 149.773 1.00 90.01  ? -29 DT  I C4    1 
ATOM   7105  O  O4    . DT  I 5  45  ? 163.069 120.277 149.484 1.00 90.01  ? -29 DT  I O4    1 
ATOM   7106  C  C5    . DT  I 5  45  ? 163.638 118.087 148.931 1.00 90.01  ? -29 DT  I C5    1 
ATOM   7107  C  C7    . DT  I 5  45  ? 162.860 118.100 147.655 1.00 90.01  ? -29 DT  I C7    1 
ATOM   7108  C  C6    . DT  I 5  45  ? 164.317 117.009 149.326 1.00 90.01  ? -29 DT  I C6    1 
ATOM   7109  P  P     . DC  I 5  46  ? 166.015 112.396 153.322 1.00 86.26  ? -28 DC  I P     1 
ATOM   7110  O  OP1   . DC  I 5  46  ? 166.608 111.055 153.146 1.00 86.26  ? -28 DC  I OP1   1 
ATOM   7111  O  OP2   . DC  I 5  46  ? 164.550 112.554 153.437 1.00 86.26  ? -28 DC  I OP2   1 
ATOM   7112  O  "O5'" . DC  I 5  46  ? 166.647 113.056 154.623 1.00 86.26  ? -28 DC  I "O5'" 1 
ATOM   7113  C  "C5'" . DC  I 5  46  ? 167.008 114.431 154.584 1.00 86.26  ? -28 DC  I "C5'" 1 
ATOM   7114  C  "C4'" . DC  I 5  46  ? 166.712 115.105 155.905 1.00 86.26  ? -28 DC  I "C4'" 1 
ATOM   7115  O  "O4'" . DC  I 5  46  ? 165.972 116.331 155.668 1.00 86.26  ? -28 DC  I "O4'" 1 
ATOM   7116  C  "C3'" . DC  I 5  46  ? 165.849 114.300 156.850 1.00 86.26  ? -28 DC  I "C3'" 1 
ATOM   7117  O  "O3'" . DC  I 5  46  ? 166.116 114.703 158.177 1.00 86.26  ? -28 DC  I "O3'" 1 
ATOM   7118  C  "C2'" . DC  I 5  46  ? 164.443 114.696 156.402 1.00 86.26  ? -28 DC  I "C2'" 1 
ATOM   7119  C  "C1'" . DC  I 5  46  ? 164.624 116.175 156.080 1.00 86.26  ? -28 DC  I "C1'" 1 
ATOM   7120  N  N1    . DC  I 5  46  ? 163.748 116.674 154.976 1.00 86.26  ? -28 DC  I N1    1 
ATOM   7121  C  C2    . DC  I 5  46  ? 163.263 117.982 155.020 1.00 86.26  ? -28 DC  I C2    1 
ATOM   7122  O  O2    . DC  I 5  46  ? 163.554 118.694 155.981 1.00 86.26  ? -28 DC  I O2    1 
ATOM   7123  N  N3    . DC  I 5  46  ? 162.488 118.428 154.006 1.00 86.26  ? -28 DC  I N3    1 
ATOM   7124  C  C4    . DC  I 5  46  ? 162.201 117.625 152.989 1.00 86.26  ? -28 DC  I C4    1 
ATOM   7125  N  N4    . DC  I 5  46  ? 161.433 118.105 152.006 1.00 86.26  ? -28 DC  I N4    1 
ATOM   7126  C  C5    . DC  I 5  46  ? 162.683 116.293 152.932 1.00 86.26  ? -28 DC  I C5    1 
ATOM   7127  C  C6    . DC  I 5  46  ? 163.457 115.867 153.927 1.00 86.26  ? -28 DC  I C6    1 
ATOM   7128  P  P     . DC  I 5  47  ? 165.519 113.883 159.419 1.00 74.41  ? -27 DC  I P     1 
ATOM   7129  O  OP1   . DC  I 5  47  ? 166.582 113.794 160.440 1.00 74.41  ? -27 DC  I OP1   1 
ATOM   7130  O  OP2   . DC  I 5  47  ? 164.874 112.651 158.918 1.00 74.41  ? -27 DC  I OP2   1 
ATOM   7131  O  "O5'" . DC  I 5  47  ? 164.366 114.837 159.963 1.00 74.41  ? -27 DC  I "O5'" 1 
ATOM   7132  C  "C5'" . DC  I 5  47  ? 164.603 116.229 160.057 1.00 74.41  ? -27 DC  I "C5'" 1 
ATOM   7133  C  "C4'" . DC  I 5  47  ? 163.305 117.009 160.171 1.00 74.41  ? -27 DC  I "C4'" 1 
ATOM   7134  O  "O4'" . DC  I 5  47  ? 162.732 117.213 158.859 1.00 74.41  ? -27 DC  I "O4'" 1 
ATOM   7135  C  "C3'" . DC  I 5  47  ? 162.203 116.355 161.015 1.00 74.41  ? -27 DC  I "C3'" 1 
ATOM   7136  O  "O3'" . DC  I 5  47  ? 161.539 117.352 161.787 1.00 74.41  ? -27 DC  I "O3'" 1 
ATOM   7137  C  "C2'" . DC  I 5  47  ? 161.272 115.809 159.941 1.00 74.41  ? -27 DC  I "C2'" 1 
ATOM   7138  C  "C1'" . DC  I 5  47  ? 161.361 116.940 158.942 1.00 74.41  ? -27 DC  I "C1'" 1 
ATOM   7139  N  N1    . DC  I 5  47  ? 160.868 116.622 157.592 1.00 74.41  ? -27 DC  I N1    1 
ATOM   7140  C  C2    . DC  I 5  47  ? 160.221 117.610 156.856 1.00 74.41  ? -27 DC  I C2    1 
ATOM   7141  O  O2    . DC  I 5  47  ? 160.063 118.721 157.365 1.00 74.41  ? -27 DC  I O2    1 
ATOM   7142  N  N3    . DC  I 5  47  ? 159.781 117.320 155.613 1.00 74.41  ? -27 DC  I N3    1 
ATOM   7143  C  C4    . DC  I 5  47  ? 159.978 116.105 155.109 1.00 74.41  ? -27 DC  I C4    1 
ATOM   7144  N  N4    . DC  I 5  47  ? 159.528 115.858 153.877 1.00 74.41  ? -27 DC  I N4    1 
ATOM   7145  C  C5    . DC  I 5  47  ? 160.640 115.087 155.844 1.00 74.41  ? -27 DC  I C5    1 
ATOM   7146  C  C6    . DC  I 5  47  ? 161.064 115.388 157.072 1.00 74.41  ? -27 DC  I C6    1 
ATOM   7147  P  P     . DC  I 5  48  ? 162.103 117.816 163.217 1.00 60.87  ? -26 DC  I P     1 
ATOM   7148  O  OP1   . DC  I 5  48  ? 163.459 117.273 163.434 1.00 60.87  ? -26 DC  I OP1   1 
ATOM   7149  O  OP2   . DC  I 5  48  ? 161.045 117.525 164.202 1.00 60.87  ? -26 DC  I OP2   1 
ATOM   7150  O  "O5'" . DC  I 5  48  ? 162.177 119.411 163.093 1.00 60.87  ? -26 DC  I "O5'" 1 
ATOM   7151  C  "C5'" . DC  I 5  48  ? 161.979 120.034 161.818 1.00 60.87  ? -26 DC  I "C5'" 1 
ATOM   7152  C  "C4'" . DC  I 5  48  ? 160.761 120.941 161.811 1.00 60.87  ? -26 DC  I "C4'" 1 
ATOM   7153  O  "O4'" . DC  I 5  48  ? 159.890 120.570 160.707 1.00 60.87  ? -26 DC  I "O4'" 1 
ATOM   7154  C  "C3'" . DC  I 5  48  ? 159.875 120.850 163.040 1.00 60.87  ? -26 DC  I "C3'" 1 
ATOM   7155  O  "O3'" . DC  I 5  48  ? 159.075 122.032 163.134 1.00 60.87  ? -26 DC  I "O3'" 1 
ATOM   7156  C  "C2'" . DC  I 5  48  ? 159.008 119.671 162.650 1.00 60.87  ? -26 DC  I "C2'" 1 
ATOM   7157  C  "C1'" . DC  I 5  48  ? 158.668 120.092 161.234 1.00 60.87  ? -26 DC  I "C1'" 1 
ATOM   7158  N  N1    . DC  I 5  48  ? 158.178 119.005 160.355 1.00 60.87  ? -26 DC  I N1    1 
ATOM   7159  C  C2    . DC  I 5  48  ? 157.608 119.332 159.128 1.00 60.87  ? -26 DC  I C2    1 
ATOM   7160  O  O2    . DC  I 5  48  ? 157.504 120.517 158.804 1.00 60.87  ? -26 DC  I O2    1 
ATOM   7161  N  N3    . DC  I 5  48  ? 157.183 118.344 158.318 1.00 60.87  ? -26 DC  I N3    1 
ATOM   7162  C  C4    . DC  I 5  48  ? 157.304 117.078 158.689 1.00 60.87  ? -26 DC  I C4    1 
ATOM   7163  N  N4    . DC  I 5  48  ? 156.873 116.144 157.839 1.00 60.87  ? -26 DC  I N4    1 
ATOM   7164  C  C5    . DC  I 5  48  ? 157.875 116.718 159.940 1.00 60.87  ? -26 DC  I C5    1 
ATOM   7165  C  C6    . DC  I 5  48  ? 158.303 117.705 160.734 1.00 60.87  ? -26 DC  I C6    1 
ATOM   7166  P  P     . DC  I 5  49  ? 159.540 123.297 164.009 1.00 52.34  ? -25 DC  I P     1 
ATOM   7167  O  OP1   . DC  I 5  49  ? 161.009 123.398 163.994 1.00 52.34  ? -25 DC  I OP1   1 
ATOM   7168  O  OP2   . DC  I 5  49  ? 158.822 123.248 165.294 1.00 52.34  ? -25 DC  I OP2   1 
ATOM   7169  O  "O5'" . DC  I 5  49  ? 158.941 124.538 163.209 1.00 52.34  ? -25 DC  I "O5'" 1 
ATOM   7170  C  "C5'" . DC  I 5  49  ? 158.831 124.464 161.798 1.00 52.34  ? -25 DC  I "C5'" 1 
ATOM   7171  C  "C4'" . DC  I 5  49  ? 157.381 124.530 161.348 1.00 52.34  ? -25 DC  I "C4'" 1 
ATOM   7172  O  "O4'" . DC  I 5  49  ? 156.896 123.199 160.983 1.00 52.34  ? -25 DC  I "O4'" 1 
ATOM   7173  C  "C3'" . DC  I 5  49  ? 156.398 125.049 162.391 1.00 52.34  ? -25 DC  I "C3'" 1 
ATOM   7174  O  "O3'" . DC  I 5  49  ? 155.384 125.792 161.737 1.00 52.34  ? -25 DC  I "O3'" 1 
ATOM   7175  C  "C2'" . DC  I 5  49  ? 155.839 123.752 162.942 1.00 52.34  ? -25 DC  I "C2'" 1 
ATOM   7176  C  "C1'" . DC  I 5  49  ? 155.674 122.982 161.651 1.00 52.34  ? -25 DC  I "C1'" 1 
ATOM   7177  N  N1    . DC  I 5  49  ? 155.470 121.513 161.816 1.00 52.34  ? -25 DC  I N1    1 
ATOM   7178  C  C2    . DC  I 5  49  ? 155.018 120.759 160.737 1.00 52.34  ? -25 DC  I C2    1 
ATOM   7179  O  O2    . DC  I 5  49  ? 154.787 121.323 159.672 1.00 52.34  ? -25 DC  I O2    1 
ATOM   7180  N  N3    . DC  I 5  49  ? 154.848 119.430 160.885 1.00 52.34  ? -25 DC  I N3    1 
ATOM   7181  C  C4    . DC  I 5  49  ? 155.107 118.852 162.048 1.00 52.34  ? -25 DC  I C4    1 
ATOM   7182  N  N4    . DC  I 5  49  ? 154.919 117.532 162.148 1.00 52.34  ? -25 DC  I N4    1 
ATOM   7183  C  C5    . DC  I 5  49  ? 155.554 119.601 163.171 1.00 52.34  ? -25 DC  I C5    1 
ATOM   7184  C  C6    . DC  I 5  49  ? 155.722 120.917 163.013 1.00 52.34  ? -25 DC  I C6    1 
ATOM   7185  P  P     . DT  I 5  50  ? 154.548 126.920 162.515 1.00 46.45  ? -24 DT  I P     1 
ATOM   7186  O  OP1   . DT  I 5  50  ? 155.382 128.137 162.527 1.00 46.45  ? -24 DT  I OP1   1 
ATOM   7187  O  OP2   . DT  I 5  50  ? 154.041 126.354 163.779 1.00 46.45  ? -24 DT  I OP2   1 
ATOM   7188  O  "O5'" . DT  I 5  50  ? 153.292 127.170 161.561 1.00 46.45  ? -24 DT  I "O5'" 1 
ATOM   7189  C  "C5'" . DT  I 5  50  ? 153.501 127.507 160.200 1.00 46.45  ? -24 DT  I "C5'" 1 
ATOM   7190  C  "C4'" . DT  I 5  50  ? 152.515 126.787 159.307 1.00 46.45  ? -24 DT  I "C4'" 1 
ATOM   7191  O  "O4'" . DT  I 5  50  ? 152.704 125.353 159.439 1.00 46.45  ? -24 DT  I "O4'" 1 
ATOM   7192  C  "C3'" . DT  I 5  50  ? 151.052 127.056 159.640 1.00 46.45  ? -24 DT  I "C3'" 1 
ATOM   7193  O  "O3'" . DT  I 5  50  ? 150.345 127.468 158.493 1.00 46.45  ? -24 DT  I "O3'" 1 
ATOM   7194  C  "C2'" . DT  I 5  50  ? 150.537 125.721 160.150 1.00 46.45  ? -24 DT  I "C2'" 1 
ATOM   7195  C  "C1'" . DT  I 5  50  ? 151.451 124.726 159.470 1.00 46.45  ? -24 DT  I "C1'" 1 
ATOM   7196  N  N1    . DT  I 5  50  ? 151.568 123.439 160.241 1.00 46.45  ? -24 DT  I N1    1 
ATOM   7197  C  C2    . DT  I 5  50  ? 151.196 122.242 159.662 1.00 46.45  ? -24 DT  I C2    1 
ATOM   7198  O  O2    . DT  I 5  50  ? 150.792 122.145 158.525 1.00 46.45  ? -24 DT  I O2    1 
ATOM   7199  N  N3    . DT  I 5  50  ? 151.339 121.153 160.472 1.00 46.45  ? -24 DT  I N3    1 
ATOM   7200  C  C4    . DT  I 5  50  ? 151.784 121.137 161.767 1.00 46.45  ? -24 DT  I C4    1 
ATOM   7201  O  O4    . DT  I 5  50  ? 151.879 120.115 162.419 1.00 46.45  ? -24 DT  I O4    1 
ATOM   7202  C  C5    . DT  I 5  50  ? 152.137 122.409 162.312 1.00 46.45  ? -24 DT  I C5    1 
ATOM   7203  C  C7    . DT  I 5  50  ? 152.608 122.498 163.726 1.00 46.45  ? -24 DT  I C7    1 
ATOM   7204  C  C6    . DT  I 5  50  ? 152.035 123.486 161.530 1.00 46.45  ? -24 DT  I C6    1 
ATOM   7205  P  P     . DT  I 5  51  ? 148.834 127.997 158.636 1.00 55.97  ? -23 DT  I P     1 
ATOM   7206  O  OP1   . DT  I 5  51  ? 148.587 128.964 157.555 1.00 55.97  ? -23 DT  I OP1   1 
ATOM   7207  O  OP2   . DT  I 5  51  ? 148.603 128.388 160.038 1.00 55.97  ? -23 DT  I OP2   1 
ATOM   7208  O  "O5'" . DT  I 5  51  ? 147.945 126.714 158.344 1.00 55.97  ? -23 DT  I "O5'" 1 
ATOM   7209  C  "C5'" . DT  I 5  51  ? 147.907 126.195 157.049 1.00 55.97  ? -23 DT  I "C5'" 1 
ATOM   7210  C  "C4'" . DT  I 5  51  ? 147.266 124.830 157.041 1.00 55.97  ? -23 DT  I "C4'" 1 
ATOM   7211  O  "O4'" . DT  I 5  51  ? 147.922 123.980 158.009 1.00 55.97  ? -23 DT  I "O4'" 1 
ATOM   7212  C  "C3'" . DT  I 5  51  ? 145.781 124.812 157.406 1.00 55.97  ? -23 DT  I "C3'" 1 
ATOM   7213  O  "O3'" . DT  I 5  51  ? 145.060 124.118 156.411 1.00 55.97  ? -23 DT  I "O3'" 1 
ATOM   7214  C  "C2'" . DT  I 5  51  ? 145.751 124.063 158.738 1.00 55.97  ? -23 DT  I "C2'" 1 
ATOM   7215  C  "C1'" . DT  I 5  51  ? 146.944 123.160 158.573 1.00 55.97  ? -23 DT  I "C1'" 1 
ATOM   7216  N  N1    . DT  I 5  51  ? 147.455 122.602 159.823 1.00 55.97  ? -23 DT  I N1    1 
ATOM   7217  C  C2    . DT  I 5  51  ? 147.445 121.252 159.983 1.00 55.97  ? -23 DT  I C2    1 
ATOM   7218  O  O2    . DT  I 5  51  ? 146.999 120.489 159.150 1.00 55.97  ? -23 DT  I O2    1 
ATOM   7219  N  N3    . DT  I 5  51  ? 147.933 120.814 161.179 1.00 55.97  ? -23 DT  I N3    1 
ATOM   7220  C  C4    . DT  I 5  51  ? 148.448 121.580 162.196 1.00 55.97  ? -23 DT  I C4    1 
ATOM   7221  O  O4    . DT  I 5  51  ? 148.875 121.091 163.231 1.00 55.97  ? -23 DT  I O4    1 
ATOM   7222  C  C5    . DT  I 5  51  ? 148.447 122.997 161.956 1.00 55.97  ? -23 DT  I C5    1 
ATOM   7223  C  C7    . DT  I 5  51  ? 148.958 123.934 163.009 1.00 55.97  ? -23 DT  I C7    1 
ATOM   7224  C  C6    . DT  I 5  51  ? 147.949 123.435 160.792 1.00 55.97  ? -23 DT  I C6    1 
ATOM   7225  P  P     . DG  I 5  52  ? 143.481 124.349 156.257 1.00 62.03  ? -22 DG  I P     1 
ATOM   7226  O  OP1   . DG  I 5  52  ? 143.161 124.327 154.816 1.00 62.03  ? -22 DG  I OP1   1 
ATOM   7227  O  OP2   . DG  I 5  52  ? 143.131 125.517 157.088 1.00 62.03  ? -22 DG  I OP2   1 
ATOM   7228  O  "O5'" . DG  I 5  52  ? 142.836 123.057 156.935 1.00 62.03  ? -22 DG  I "O5'" 1 
ATOM   7229  C  "C5'" . DG  I 5  52  ? 143.096 121.771 156.392 1.00 62.03  ? -22 DG  I "C5'" 1 
ATOM   7230  C  "C4'" . DG  I 5  52  ? 142.513 120.677 157.273 1.00 62.03  ? -22 DG  I "C4'" 1 
ATOM   7231  O  "O4'" . DG  I 5  52  ? 143.455 120.334 158.322 1.00 62.03  ? -22 DG  I "O4'" 1 
ATOM   7232  C  "C3'" . DG  I 5  52  ? 141.210 121.041 157.985 1.00 62.03  ? -22 DG  I "C3'" 1 
ATOM   7233  O  "O3'" . DG  I 5  52  ? 140.311 119.951 157.914 1.00 62.03  ? -22 DG  I "O3'" 1 
ATOM   7234  C  "C2'" . DG  I 5  52  ? 141.663 121.281 159.420 1.00 62.03  ? -22 DG  I "C2'" 1 
ATOM   7235  C  "C1'" . DG  I 5  52  ? 142.757 120.246 159.535 1.00 62.03  ? -22 DG  I "C1'" 1 
ATOM   7236  N  N9    . DG  I 5  52  ? 143.682 120.480 160.635 1.00 62.03  ? -22 DG  I N9    1 
ATOM   7237  C  C8    . DG  I 5  52  ? 144.324 121.646 160.951 1.00 62.03  ? -22 DG  I C8    1 
ATOM   7238  N  N7    . DG  I 5  52  ? 145.092 121.545 161.998 1.00 62.03  ? -22 DG  I N7    1 
ATOM   7239  C  C5    . DG  I 5  52  ? 144.950 120.227 162.394 1.00 62.03  ? -22 DG  I C5    1 
ATOM   7240  C  C6    . DG  I 5  52  ? 145.538 119.528 163.471 1.00 62.03  ? -22 DG  I C6    1 
ATOM   7241  O  O6    . DG  I 5  52  ? 146.337 119.943 164.318 1.00 62.03  ? -22 DG  I O6    1 
ATOM   7242  N  N1    . DG  I 5  52  ? 145.112 118.205 163.515 1.00 62.03  ? -22 DG  I N1    1 
ATOM   7243  C  C2    . DG  I 5  52  ? 144.234 117.637 162.630 1.00 62.03  ? -22 DG  I C2    1 
ATOM   7244  N  N2    . DG  I 5  52  ? 143.936 116.347 162.824 1.00 62.03  ? -22 DG  I N2    1 
ATOM   7245  N  N3    . DG  I 5  52  ? 143.677 118.283 161.625 1.00 62.03  ? -22 DG  I N3    1 
ATOM   7246  C  C4    . DG  I 5  52  ? 144.086 119.563 161.564 1.00 62.03  ? -22 DG  I C4    1 
ATOM   7247  P  P     . DG  I 5  53  ? 138.726 120.208 157.846 1.00 69.68  ? -21 DG  I P     1 
ATOM   7248  O  OP1   . DG  I 5  53  ? 138.325 120.219 156.423 1.00 69.68  ? -21 DG  I OP1   1 
ATOM   7249  O  OP2   . DG  I 5  53  ? 138.409 121.360 158.714 1.00 69.68  ? -21 DG  I OP2   1 
ATOM   7250  O  "O5'" . DG  I 5  53  ? 138.111 118.912 158.540 1.00 69.68  ? -21 DG  I "O5'" 1 
ATOM   7251  C  "C5'" . DG  I 5  53  ? 138.885 117.730 158.625 1.00 69.68  ? -21 DG  I "C5'" 1 
ATOM   7252  C  "C4'" . DG  I 5  53  ? 138.719 117.076 159.981 1.00 69.68  ? -21 DG  I "C4'" 1 
ATOM   7253  O  "O4'" . DG  I 5  53  ? 139.851 117.401 160.833 1.00 69.68  ? -21 DG  I "O4'" 1 
ATOM   7254  C  "C3'" . DG  I 5  53  ? 137.477 117.515 160.754 1.00 69.68  ? -21 DG  I "C3'" 1 
ATOM   7255  O  "O3'" . DG  I 5  53  ? 136.889 116.399 161.363 1.00 69.68  ? -21 DG  I "O3'" 1 
ATOM   7256  C  "C2'" . DG  I 5  53  ? 138.050 118.460 161.797 1.00 69.68  ? -21 DG  I "C2'" 1 
ATOM   7257  C  "C1'" . DG  I 5  53  ? 139.357 117.763 162.094 1.00 69.68  ? -21 DG  I "C1'" 1 
ATOM   7258  N  N9    . DG  I 5  53  ? 140.331 118.604 162.775 1.00 69.68  ? -21 DG  I N9    1 
ATOM   7259  C  C8    . DG  I 5  53  ? 140.722 119.868 162.429 1.00 69.68  ? -21 DG  I C8    1 
ATOM   7260  N  N7    . DG  I 5  53  ? 141.599 120.380 163.240 1.00 69.68  ? -21 DG  I N7    1 
ATOM   7261  C  C5    . DG  I 5  53  ? 141.802 119.386 164.180 1.00 69.68  ? -21 DG  I C5    1 
ATOM   7262  C  C6    . DG  I 5  53  ? 142.651 119.360 165.306 1.00 69.68  ? -21 DG  I C6    1 
ATOM   7263  O  O6    . DG  I 5  53  ? 143.414 120.239 165.712 1.00 69.68  ? -21 DG  I O6    1 
ATOM   7264  N  N1    . DG  I 5  53  ? 142.548 118.160 165.998 1.00 69.68  ? -21 DG  I N1    1 
ATOM   7265  C  C2    . DG  I 5  53  ? 141.729 117.122 165.650 1.00 69.68  ? -21 DG  I C2    1 
ATOM   7266  N  N2    . DG  I 5  53  ? 141.768 116.040 166.437 1.00 69.68  ? -21 DG  I N2    1 
ATOM   7267  N  N3    . DG  I 5  53  ? 140.936 117.132 164.596 1.00 69.68  ? -21 DG  I N3    1 
ATOM   7268  C  C4    . DG  I 5  53  ? 141.031 118.288 163.908 1.00 69.68  ? -21 DG  I C4    1 
ATOM   7269  P  P     . DC  I 5  54  ? 135.310 116.360 161.635 1.00 76.47  ? -20 DC  I P     1 
ATOM   7270  O  OP1   . DC  I 5  54  ? 134.624 116.122 160.348 1.00 76.47  ? -20 DC  I OP1   1 
ATOM   7271  O  OP2   . DC  I 5  54  ? 134.956 117.543 162.441 1.00 76.47  ? -20 DC  I OP2   1 
ATOM   7272  O  "O5'" . DC  I 5  54  ? 135.135 115.067 162.548 1.00 76.47  ? -20 DC  I "O5'" 1 
ATOM   7273  C  "C5'" . DC  I 5  54  ? 136.269 114.504 163.185 1.00 76.47  ? -20 DC  I "C5'" 1 
ATOM   7274  C  "C4'" . DC  I 5  54  ? 136.156 114.638 164.686 1.00 76.47  ? -20 DC  I "C4'" 1 
ATOM   7275  O  "O4'" . DC  I 5  54  ? 137.249 115.457 165.192 1.00 76.47  ? -20 DC  I "O4'" 1 
ATOM   7276  C  "C3'" . DC  I 5  54  ? 134.869 115.316 165.166 1.00 76.47  ? -20 DC  I "C3'" 1 
ATOM   7277  O  "O3'" . DC  I 5  54  ? 134.344 114.622 166.278 1.00 76.47  ? -20 DC  I "O3'" 1 
ATOM   7278  C  "C2'" . DC  I 5  54  ? 135.350 116.701 165.563 1.00 76.47  ? -20 DC  I "C2'" 1 
ATOM   7279  C  "C1'" . DC  I 5  54  ? 136.716 116.367 166.116 1.00 76.47  ? -20 DC  I "C1'" 1 
ATOM   7280  N  N1    . DC  I 5  54  ? 137.609 117.549 166.242 1.00 76.47  ? -20 DC  I N1    1 
ATOM   7281  C  C2    . DC  I 5  54  ? 138.453 117.661 167.346 1.00 76.47  ? -20 DC  I C2    1 
ATOM   7282  O  O2    . DC  I 5  54  ? 138.460 116.760 168.190 1.00 76.47  ? -20 DC  I O2    1 
ATOM   7283  N  N3    . DC  I 5  54  ? 139.246 118.750 167.453 1.00 76.47  ? -20 DC  I N3    1 
ATOM   7284  C  C4    . DC  I 5  54  ? 139.207 119.697 166.519 1.00 76.47  ? -20 DC  I C4    1 
ATOM   7285  N  N4    . DC  I 5  54  ? 140.007 120.752 166.673 1.00 76.47  ? -20 DC  I N4    1 
ATOM   7286  C  C5    . DC  I 5  54  ? 138.339 119.611 165.398 1.00 76.47  ? -20 DC  I C5    1 
ATOM   7287  C  C6    . DC  I 5  54  ? 137.564 118.530 165.302 1.00 76.47  ? -20 DC  I C6    1 
ATOM   7288  P  P     . DG  I 5  55  ? 132.768 114.650 166.586 1.00 81.16  ? -19 DG  I P     1 
ATOM   7289  O  OP1   . DG  I 5  55  ? 132.177 113.444 165.966 1.00 81.16  ? -19 DG  I OP1   1 
ATOM   7290  O  OP2   . DG  I 5  55  ? 132.232 115.985 166.243 1.00 81.16  ? -19 DG  I OP2   1 
ATOM   7291  O  "O5'" . DG  I 5  55  ? 132.698 114.510 168.172 1.00 81.16  ? -19 DG  I "O5'" 1 
ATOM   7292  C  "C5'" . DG  I 5  55  ? 133.561 113.605 168.836 1.00 81.16  ? -19 DG  I "C5'" 1 
ATOM   7293  C  "C4'" . DG  I 5  55  ? 134.016 114.173 170.167 1.00 81.16  ? -19 DG  I "C4'" 1 
ATOM   7294  O  "O4'" . DG  I 5  55  ? 135.054 115.165 169.948 1.00 81.16  ? -19 DG  I "O4'" 1 
ATOM   7295  C  "C3'" . DG  I 5  55  ? 132.925 114.868 170.978 1.00 81.16  ? -19 DG  I "C3'" 1 
ATOM   7296  O  "O3'" . DG  I 5  55  ? 133.021 114.471 172.326 1.00 81.16  ? -19 DG  I "O3'" 1 
ATOM   7297  C  "C2'" . DG  I 5  55  ? 133.258 116.349 170.811 1.00 81.16  ? -19 DG  I "C2'" 1 
ATOM   7298  C  "C1'" . DG  I 5  55  ? 134.770 116.312 170.711 1.00 81.16  ? -19 DG  I "C1'" 1 
ATOM   7299  N  N9    . DG  I 5  55  ? 135.326 117.473 170.026 1.00 81.16  ? -19 DG  I N9    1 
ATOM   7300  C  C8    . DG  I 5  55  ? 135.006 117.905 168.771 1.00 81.16  ? -19 DG  I C8    1 
ATOM   7301  N  N7    . DG  I 5  55  ? 135.658 118.967 168.402 1.00 81.16  ? -19 DG  I N7    1 
ATOM   7302  C  C5    . DG  I 5  55  ? 136.446 119.274 169.494 1.00 81.16  ? -19 DG  I C5    1 
ATOM   7303  C  C6    . DG  I 5  55  ? 137.370 120.316 169.674 1.00 81.16  ? -19 DG  I C6    1 
ATOM   7304  O  O6    . DG  I 5  55  ? 137.658 121.218 168.886 1.00 81.16  ? -19 DG  I O6    1 
ATOM   7305  N  N1    . DG  I 5  55  ? 137.962 120.273 170.930 1.00 81.16  ? -19 DG  I N1    1 
ATOM   7306  C  C2    . DG  I 5  55  ? 137.709 119.325 171.885 1.00 81.16  ? -19 DG  I C2    1 
ATOM   7307  N  N2    . DG  I 5  55  ? 138.383 119.442 173.036 1.00 81.16  ? -19 DG  I N2    1 
ATOM   7308  N  N3    . DG  I 5  55  ? 136.848 118.329 171.726 1.00 81.16  ? -19 DG  I N3    1 
ATOM   7309  C  C4    . DG  I 5  55  ? 136.259 118.364 170.504 1.00 81.16  ? -19 DG  I C4    1 
ATOM   7310  P  P     . DG  I 5  56  ? 131.749 114.546 173.306 1.00 83.24  ? -18 DG  I P     1 
ATOM   7311  O  OP1   . DG  I 5  56  ? 131.204 113.179 173.431 1.00 83.24  ? -18 DG  I OP1   1 
ATOM   7312  O  OP2   . DG  I 5  56  ? 130.855 115.648 172.894 1.00 83.24  ? -18 DG  I OP2   1 
ATOM   7313  O  "O5'" . DG  I 5  56  ? 132.405 114.957 174.697 1.00 83.24  ? -18 DG  I "O5'" 1 
ATOM   7314  C  "C5'" . DG  I 5  56  ? 133.766 115.378 174.724 1.00 83.24  ? -18 DG  I "C5'" 1 
ATOM   7315  C  "C4'" . DG  I 5  56  ? 134.009 116.345 175.862 1.00 83.24  ? -18 DG  I "C4'" 1 
ATOM   7316  O  "O4'" . DG  I 5  56  ? 134.759 117.487 175.365 1.00 83.24  ? -18 DG  I "O4'" 1 
ATOM   7317  C  "C3'" . DG  I 5  56  ? 132.749 116.931 176.478 1.00 83.24  ? -18 DG  I "C3'" 1 
ATOM   7318  O  "O3'" . DG  I 5  56  ? 133.010 117.313 177.835 1.00 83.24  ? -18 DG  I "O3'" 1 
ATOM   7319  C  "C2'" . DG  I 5  56  ? 132.518 118.136 175.580 1.00 83.24  ? -18 DG  I "C2'" 1 
ATOM   7320  C  "C1'" . DG  I 5  56  ? 133.941 118.636 175.383 1.00 83.24  ? -18 DG  I "C1'" 1 
ATOM   7321  N  N9    . DG  I 5  56  ? 134.131 119.353 174.134 1.00 83.24  ? -18 DG  I N9    1 
ATOM   7322  C  C8    . DG  I 5  56  ? 133.546 119.066 172.933 1.00 83.24  ? -18 DG  I C8    1 
ATOM   7323  N  N7    . DG  I 5  56  ? 133.894 119.874 171.979 1.00 83.24  ? -18 DG  I N7    1 
ATOM   7324  C  C5    . DG  I 5  56  ? 134.773 120.754 172.587 1.00 83.24  ? -18 DG  I C5    1 
ATOM   7325  C  C6    . DG  I 5  56  ? 135.461 121.859 172.050 1.00 83.24  ? -18 DG  I C6    1 
ATOM   7326  O  O6    . DG  I 5  56  ? 135.439 122.279 170.890 1.00 83.24  ? -18 DG  I O6    1 
ATOM   7327  N  N1    . DG  I 5  56  ? 136.243 122.497 173.004 1.00 83.24  ? -18 DG  I N1    1 
ATOM   7328  C  C2    . DG  I 5  56  ? 136.341 122.121 174.319 1.00 83.24  ? -18 DG  I C2    1 
ATOM   7329  N  N2    . DG  I 5  56  ? 137.144 122.866 175.090 1.00 83.24  ? -18 DG  I N2    1 
ATOM   7330  N  N3    . DG  I 5  56  ? 135.688 121.089 174.843 1.00 83.24  ? -18 DG  I N3    1 
ATOM   7331  C  C4    . DG  I 5  56  ? 134.926 120.453 173.917 1.00 83.24  ? -18 DG  I C4    1 
ATOM   7332  P  P     . DT  I 5  57  ? 131.816 117.596 178.878 1.00 82.19  ? -17 DT  I P     1 
ATOM   7333  O  OP1   . DT  I 5  57  ? 131.866 116.537 179.905 1.00 82.19  ? -17 DT  I OP1   1 
ATOM   7334  O  OP2   . DT  I 5  57  ? 130.553 117.820 178.147 1.00 82.19  ? -17 DT  I OP2   1 
ATOM   7335  O  "O5'" . DT  I 5  57  ? 132.249 118.982 179.540 1.00 82.19  ? -17 DT  I "O5'" 1 
ATOM   7336  C  "C5'" . DT  I 5  57  ? 132.958 119.895 178.744 1.00 82.19  ? -17 DT  I "C5'" 1 
ATOM   7337  C  "C4'" . DT  I 5  57  ? 133.516 121.049 179.533 1.00 82.19  ? -17 DT  I "C4'" 1 
ATOM   7338  O  "O4'" . DT  I 5  57  ? 134.152 121.968 178.612 1.00 82.19  ? -17 DT  I "O4'" 1 
ATOM   7339  C  "C3'" . DT  I 5  57  ? 132.492 121.896 180.232 1.00 82.19  ? -17 DT  I "C3'" 1 
ATOM   7340  O  "O3'" . DT  I 5  57  ? 133.156 122.678 181.201 1.00 82.19  ? -17 DT  I "O3'" 1 
ATOM   7341  C  "C2'" . DT  I 5  57  ? 131.970 122.742 179.070 1.00 82.19  ? -17 DT  I "C2'" 1 
ATOM   7342  C  "C1'" . DT  I 5  57  ? 133.246 123.005 178.274 1.00 82.19  ? -17 DT  I "C1'" 1 
ATOM   7343  N  N1    . DT  I 5  57  ? 133.070 123.001 176.787 1.00 82.19  ? -17 DT  I N1    1 
ATOM   7344  C  C2    . DT  I 5  57  ? 133.866 123.813 176.023 1.00 82.19  ? -17 DT  I C2    1 
ATOM   7345  O  O2    . DT  I 5  57  ? 134.688 124.563 176.500 1.00 82.19  ? -17 DT  I O2    1 
ATOM   7346  N  N3    . DT  I 5  57  ? 133.647 123.735 174.675 1.00 82.19  ? -17 DT  I N3    1 
ATOM   7347  C  C4    . DT  I 5  57  ? 132.739 122.930 174.030 1.00 82.19  ? -17 DT  I C4    1 
ATOM   7348  O  O4    . DT  I 5  57  ? 132.618 122.921 172.815 1.00 82.19  ? -17 DT  I O4    1 
ATOM   7349  C  C5    . DT  I 5  57  ? 131.945 122.090 174.884 1.00 82.19  ? -17 DT  I C5    1 
ATOM   7350  C  C7    . DT  I 5  57  ? 130.923 121.173 174.289 1.00 82.19  ? -17 DT  I C7    1 
ATOM   7351  C  C6    . DT  I 5  57  ? 132.142 122.167 176.206 1.00 82.19  ? -17 DT  I C6    1 
ATOM   7352  P  P     . DT  I 5  58  ? 132.347 123.692 182.142 1.00 78.77  ? -16 DT  I P     1 
ATOM   7353  O  OP1   . DT  I 5  58  ? 133.091 123.790 183.416 1.00 78.77  ? -16 DT  I OP1   1 
ATOM   7354  O  OP2   . DT  I 5  58  ? 130.918 123.317 182.140 1.00 78.77  ? -16 DT  I OP2   1 
ATOM   7355  O  "O5'" . DT  I 5  58  ? 132.485 125.073 181.382 1.00 78.77  ? -16 DT  I "O5'" 1 
ATOM   7356  C  "C5'" . DT  I 5  58  ? 133.753 125.512 180.948 1.00 78.77  ? -16 DT  I "C5'" 1 
ATOM   7357  C  "C4'" . DT  I 5  58  ? 133.649 126.859 180.264 1.00 78.77  ? -16 DT  I "C4'" 1 
ATOM   7358  O  "O4'" . DT  I 5  58  ? 133.259 126.686 178.884 1.00 78.77  ? -16 DT  I "O4'" 1 
ATOM   7359  C  "C3'" . DT  I 5  58  ? 132.649 127.814 180.885 1.00 78.77  ? -16 DT  I "C3'" 1 
ATOM   7360  O  "O3'" . DT  I 5  58  ? 133.198 129.101 180.907 1.00 78.77  ? -16 DT  I "O3'" 1 
ATOM   7361  C  "C2'" . DT  I 5  58  ? 131.426 127.726 179.964 1.00 78.77  ? -16 DT  I "C2'" 1 
ATOM   7362  C  "C1'" . DT  I 5  58  ? 132.024 127.320 178.623 1.00 78.77  ? -16 DT  I "C1'" 1 
ATOM   7363  N  N1    . DT  I 5  58  ? 131.195 126.352 177.867 1.00 78.77  ? -16 DT  I N1    1 
ATOM   7364  C  C2    . DT  I 5  58  ? 131.529 126.068 176.569 1.00 78.77  ? -16 DT  I C2    1 
ATOM   7365  O  O2    . DT  I 5  58  ? 132.466 126.587 175.996 1.00 78.77  ? -16 DT  I O2    1 
ATOM   7366  N  N3    . DT  I 5  58  ? 130.728 125.147 175.957 1.00 78.77  ? -16 DT  I N3    1 
ATOM   7367  C  C4    . DT  I 5  58  ? 129.642 124.494 176.503 1.00 78.77  ? -16 DT  I C4    1 
ATOM   7368  O  O4    . DT  I 5  58  ? 128.980 123.679 175.869 1.00 78.77  ? -16 DT  I O4    1 
ATOM   7369  C  C5    . DT  I 5  58  ? 129.348 124.833 177.871 1.00 78.77  ? -16 DT  I C5    1 
ATOM   7370  C  C7    . DT  I 5  58  ? 128.192 124.188 178.571 1.00 78.77  ? -16 DT  I C7    1 
ATOM   7371  C  C6    . DT  I 5  58  ? 130.129 125.736 178.482 1.00 78.77  ? -16 DT  I C6    1 
ATOM   7372  P  P     . DA  I 5  59  ? 133.694 129.745 182.290 1.00 78.93  ? -15 DA  I P     1 
ATOM   7373  O  OP1   . DA  I 5  59  ? 134.734 128.859 182.843 1.00 78.93  ? -15 DA  I OP1   1 
ATOM   7374  O  OP2   . DA  I 5  59  ? 132.490 130.040 183.089 1.00 78.93  ? -15 DA  I OP2   1 
ATOM   7375  O  "O5'" . DA  I 5  59  ? 134.351 131.141 181.849 1.00 78.93  ? -15 DA  I "O5'" 1 
ATOM   7376  C  "C5'" . DA  I 5  59  ? 135.601 131.162 181.142 1.00 78.93  ? -15 DA  I "C5'" 1 
ATOM   7377  C  "C4'" . DA  I 5  59  ? 135.626 132.200 180.011 1.00 78.93  ? -15 DA  I "C4'" 1 
ATOM   7378  O  "O4'" . DA  I 5  59  ? 134.678 131.854 178.974 1.00 78.93  ? -15 DA  I "O4'" 1 
ATOM   7379  C  "C3'" . DA  I 5  59  ? 135.324 133.639 180.393 1.00 78.93  ? -15 DA  I "C3'" 1 
ATOM   7380  O  "O3'" . DA  I 5  59  ? 136.149 134.505 179.607 1.00 78.93  ? -15 DA  I "O3'" 1 
ATOM   7381  C  "C2'" . DA  I 5  59  ? 133.836 133.786 180.061 1.00 78.93  ? -15 DA  I "C2'" 1 
ATOM   7382  C  "C1'" . DA  I 5  59  ? 133.624 132.801 178.918 1.00 78.93  ? -15 DA  I "C1'" 1 
ATOM   7383  N  N9    . DA  I 5  59  ? 132.385 132.050 179.042 1.00 78.93  ? -15 DA  I N9    1 
ATOM   7384  C  C8    . DA  I 5  59  ? 131.793 131.664 180.200 1.00 78.93  ? -15 DA  I C8    1 
ATOM   7385  N  N7    . DA  I 5  59  ? 130.720 130.953 180.032 1.00 78.93  ? -15 DA  I N7    1 
ATOM   7386  C  C5    . DA  I 5  59  ? 130.590 130.868 178.667 1.00 78.93  ? -15 DA  I C5    1 
ATOM   7387  C  C6    . DA  I 5  59  ? 129.641 130.246 177.853 1.00 78.93  ? -15 DA  I C6    1 
ATOM   7388  N  N6    . DA  I 5  59  ? 128.598 129.572 178.336 1.00 78.93  ? -15 DA  I N6    1 
ATOM   7389  N  N1    . DA  I 5  59  ? 129.788 130.357 176.525 1.00 78.93  ? -15 DA  I N1    1 
ATOM   7390  C  C2    . DA  I 5  59  ? 130.834 131.036 176.047 1.00 78.93  ? -15 DA  I C2    1 
ATOM   7391  N  N3    . DA  I 5  59  ? 131.794 131.665 176.719 1.00 78.93  ? -15 DA  I N3    1 
ATOM   7392  C  C4    . DA  I 5  59  ? 131.611 131.537 178.036 1.00 78.93  ? -15 DA  I C4    1 
ATOM   7393  P  P     . DA  I 5  60  ? 135.880 136.088 179.500 1.00 75.51  ? -14 DA  I P     1 
ATOM   7394  O  OP1   . DA  I 5  60  ? 137.193 136.690 179.195 1.00 75.51  ? -14 DA  I OP1   1 
ATOM   7395  O  OP2   . DA  I 5  60  ? 135.126 136.623 180.656 1.00 75.51  ? -14 DA  I OP2   1 
ATOM   7396  O  "O5'" . DA  I 5  60  ? 134.990 136.215 178.188 1.00 75.51  ? -14 DA  I "O5'" 1 
ATOM   7397  C  "C5'" . DA  I 5  60  ? 135.403 135.558 177.002 1.00 75.51  ? -14 DA  I "C5'" 1 
ATOM   7398  C  "C4'" . DA  I 5  60  ? 134.398 135.752 175.885 1.00 75.51  ? -14 DA  I "C4'" 1 
ATOM   7399  O  "O4'" . DA  I 5  60  ? 133.237 134.908 176.099 1.00 75.51  ? -14 DA  I "O4'" 1 
ATOM   7400  C  "C3'" . DA  I 5  60  ? 133.866 137.166 175.721 1.00 75.51  ? -14 DA  I "C3'" 1 
ATOM   7401  O  "O3'" . DA  I 5  60  ? 133.785 137.453 174.352 1.00 75.51  ? -14 DA  I "O3'" 1 
ATOM   7402  C  "C2'" . DA  I 5  60  ? 132.479 137.090 176.368 1.00 75.51  ? -14 DA  I "C2'" 1 
ATOM   7403  C  "C1'" . DA  I 5  60  ? 132.059 135.679 176.013 1.00 75.51  ? -14 DA  I "C1'" 1 
ATOM   7404  N  N9    . DA  I 5  60  ? 131.099 135.101 176.939 1.00 75.51  ? -14 DA  I N9    1 
ATOM   7405  C  C8    . DA  I 5  60  ? 131.162 135.133 178.293 1.00 75.51  ? -14 DA  I C8    1 
ATOM   7406  N  N7    . DA  I 5  60  ? 130.193 134.488 178.884 1.00 75.51  ? -14 DA  I N7    1 
ATOM   7407  C  C5    . DA  I 5  60  ? 129.433 134.012 177.843 1.00 75.51  ? -14 DA  I C5    1 
ATOM   7408  C  C6    . DA  I 5  60  ? 128.260 133.253 177.807 1.00 75.51  ? -14 DA  I C6    1 
ATOM   7409  N  N6    . DA  I 5  60  ? 127.626 132.842 178.902 1.00 75.51  ? -14 DA  I N6    1 
ATOM   7410  N  N1    . DA  I 5  60  ? 127.754 132.940 176.606 1.00 75.51  ? -14 DA  I N1    1 
ATOM   7411  C  C2    . DA  I 5  60  ? 128.387 133.358 175.511 1.00 75.51  ? -14 DA  I C2    1 
ATOM   7412  N  N3    . DA  I 5  60  ? 129.506 134.074 175.421 1.00 75.51  ? -14 DA  I N3    1 
ATOM   7413  C  C4    . DA  I 5  60  ? 129.984 134.364 176.634 1.00 75.51  ? -14 DA  I C4    1 
ATOM   7414  P  P     . DA  I 5  61  ? 133.669 138.961 173.825 1.00 68.44  ? -13 DA  I P     1 
ATOM   7415  O  OP1   . DA  I 5  61  ? 134.923 139.235 173.095 1.00 68.44  ? -13 DA  I OP1   1 
ATOM   7416  O  OP2   . DA  I 5  61  ? 133.250 139.874 174.911 1.00 68.44  ? -13 DA  I OP2   1 
ATOM   7417  O  "O5'" . DA  I 5  61  ? 132.465 138.872 172.787 1.00 68.44  ? -13 DA  I "O5'" 1 
ATOM   7418  C  "C5'" . DA  I 5  61  ? 132.286 137.695 172.027 1.00 68.44  ? -13 DA  I "C5'" 1 
ATOM   7419  C  "C4'" . DA  I 5  61  ? 130.837 137.533 171.626 1.00 68.44  ? -13 DA  I "C4'" 1 
ATOM   7420  O  "O4'" . DA  I 5  61  ? 130.109 136.846 172.666 1.00 68.44  ? -13 DA  I "O4'" 1 
ATOM   7421  C  "C3'" . DA  I 5  61  ? 130.090 138.831 171.366 1.00 68.44  ? -13 DA  I "C3'" 1 
ATOM   7422  O  "O3'" . DA  I 5  61  ? 129.464 138.743 170.108 1.00 68.44  ? -13 DA  I "O3'" 1 
ATOM   7423  C  "C2'" . DA  I 5  61  ? 129.078 138.915 172.519 1.00 68.44  ? -13 DA  I "C2'" 1 
ATOM   7424  C  "C1'" . DA  I 5  61  ? 128.858 137.463 172.863 1.00 68.44  ? -13 DA  I "C1'" 1 
ATOM   7425  N  N9    . DA  I 5  61  ? 128.501 137.237 174.249 1.00 68.44  ? -13 DA  I N9    1 
ATOM   7426  C  C8    . DA  I 5  61  ? 129.218 137.619 175.328 1.00 68.44  ? -13 DA  I C8    1 
ATOM   7427  N  N7    . DA  I 5  61  ? 128.700 137.258 176.469 1.00 68.44  ? -13 DA  I N7    1 
ATOM   7428  C  C5    . DA  I 5  61  ? 127.559 136.586 176.113 1.00 68.44  ? -13 DA  I C5    1 
ATOM   7429  C  C6    . DA  I 5  61  ? 126.565 135.951 176.871 1.00 68.44  ? -13 DA  I C6    1 
ATOM   7430  N  N6    . DA  I 5  61  ? 126.577 135.912 178.201 1.00 68.44  ? -13 DA  I N6    1 
ATOM   7431  N  N1    . DA  I 5  61  ? 125.551 135.365 176.211 1.00 68.44  ? -13 DA  I N1    1 
ATOM   7432  C  C2    . DA  I 5  61  ? 125.544 135.414 174.875 1.00 68.44  ? -13 DA  I C2    1 
ATOM   7433  N  N3    . DA  I 5  61  ? 126.429 135.979 174.053 1.00 68.44  ? -13 DA  I N3    1 
ATOM   7434  C  C4    . DA  I 5  61  ? 127.419 136.553 174.743 1.00 68.44  ? -13 DA  I C4    1 
ATOM   7435  P  P     . DA  I 5  62  ? 128.577 139.946 169.529 1.00 64.84  ? -12 DA  I P     1 
ATOM   7436  O  OP1   . DA  I 5  62  ? 128.746 139.912 168.064 1.00 64.84  ? -12 DA  I OP1   1 
ATOM   7437  O  OP2   . DA  I 5  62  ? 128.872 141.199 170.250 1.00 64.84  ? -12 DA  I OP2   1 
ATOM   7438  O  "O5'" . DA  I 5  62  ? 127.097 139.490 169.882 1.00 64.84  ? -12 DA  I "O5'" 1 
ATOM   7439  C  "C5'" . DA  I 5  62  ? 126.753 138.115 169.783 1.00 64.84  ? -12 DA  I "C5'" 1 
ATOM   7440  C  "C4'" . DA  I 5  62  ? 125.259 137.910 169.890 1.00 64.84  ? -12 DA  I "C4'" 1 
ATOM   7441  O  "O4'" . DA  I 5  62  ? 124.902 137.531 171.236 1.00 64.84  ? -12 DA  I "O4'" 1 
ATOM   7442  C  "C3'" . DA  I 5  62  ? 124.409 139.113 169.548 1.00 64.84  ? -12 DA  I "C3'" 1 
ATOM   7443  O  "O3'" . DA  I 5  62  ? 123.255 138.673 168.875 1.00 64.84  ? -12 DA  I "O3'" 1 
ATOM   7444  C  "C2'" . DA  I 5  62  ? 124.077 139.718 170.917 1.00 64.84  ? -12 DA  I "C2'" 1 
ATOM   7445  C  "C1'" . DA  I 5  62  ? 124.047 138.494 171.820 1.00 64.84  ? -12 DA  I "C1'" 1 
ATOM   7446  N  N9    . DA  I 5  62  ? 124.542 138.744 173.166 1.00 64.84  ? -12 DA  I N9    1 
ATOM   7447  C  C8    . DA  I 5  62  ? 125.701 139.364 173.510 1.00 64.84  ? -12 DA  I C8    1 
ATOM   7448  N  N7    . DA  I 5  62  ? 125.911 139.417 174.800 1.00 64.84  ? -12 DA  I N7    1 
ATOM   7449  C  C5    . DA  I 5  62  ? 124.820 138.773 175.334 1.00 64.84  ? -12 DA  I C5    1 
ATOM   7450  C  C6    . DA  I 5  62  ? 124.442 138.502 176.650 1.00 64.84  ? -12 DA  I C6    1 
ATOM   7451  N  N6    . DA  I 5  62  ? 125.169 138.854 177.706 1.00 64.84  ? -12 DA  I N6    1 
ATOM   7452  N  N1    . DA  I 5  62  ? 123.291 137.836 176.844 1.00 64.84  ? -12 DA  I N1    1 
ATOM   7453  C  C2    . DA  I 5  62  ? 122.567 137.484 175.783 1.00 64.84  ? -12 DA  I C2    1 
ATOM   7454  N  N3    . DA  I 5  62  ? 122.818 137.691 174.497 1.00 64.84  ? -12 DA  I N3    1 
ATOM   7455  C  C4    . DA  I 5  62  ? 123.967 138.349 174.342 1.00 64.84  ? -12 DA  I C4    1 
ATOM   7456  P  P     . DC  I 5  63  ? 122.233 139.726 168.235 1.00 66.41  ? -11 DC  I P     1 
ATOM   7457  O  OP1   . DC  I 5  63  ? 121.685 139.090 167.018 1.00 66.41  ? -11 DC  I OP1   1 
ATOM   7458  O  OP2   . DC  I 5  63  ? 122.920 141.032 168.121 1.00 66.41  ? -11 DC  I OP2   1 
ATOM   7459  O  "O5'" . DC  I 5  63  ? 121.089 139.852 169.346 1.00 66.41  ? -11 DC  I "O5'" 1 
ATOM   7460  C  "C5'" . DC  I 5  63  ? 120.645 138.686 170.033 1.00 66.41  ? -11 DC  I "C5'" 1 
ATOM   7461  C  "C4'" . DC  I 5  63  ? 119.722 139.048 171.180 1.00 66.41  ? -11 DC  I "C4'" 1 
ATOM   7462  O  "O4'" . DC  I 5  63  ? 120.470 139.150 172.417 1.00 66.41  ? -11 DC  I "O4'" 1 
ATOM   7463  C  "C3'" . DC  I 5  63  ? 118.985 140.379 171.026 1.00 66.41  ? -11 DC  I "C3'" 1 
ATOM   7464  O  "O3'" . DC  I 5  63  ? 117.628 140.189 171.351 1.00 66.41  ? -11 DC  I "O3'" 1 
ATOM   7465  C  "C2'" . DC  I 5  63  ? 119.677 141.269 172.052 1.00 66.41  ? -11 DC  I "C2'" 1 
ATOM   7466  C  "C1'" . DC  I 5  63  ? 119.992 140.258 173.128 1.00 66.41  ? -11 DC  I "C1'" 1 
ATOM   7467  N  N1    . DC  I 5  63  ? 121.035 140.704 174.067 1.00 66.41  ? -11 DC  I N1    1 
ATOM   7468  C  C2    . DC  I 5  63  ? 120.843 140.554 175.443 1.00 66.41  ? -11 DC  I C2    1 
ATOM   7469  O  O2    . DC  I 5  63  ? 119.791 140.053 175.855 1.00 66.41  ? -11 DC  I O2    1 
ATOM   7470  N  N3    . DC  I 5  63  ? 121.820 140.970 176.285 1.00 66.41  ? -11 DC  I N3    1 
ATOM   7471  C  C4    . DC  I 5  63  ? 122.937 141.504 175.796 1.00 66.41  ? -11 DC  I C4    1 
ATOM   7472  N  N4    . DC  I 5  63  ? 123.874 141.895 176.658 1.00 66.41  ? -11 DC  I N4    1 
ATOM   7473  C  C5    . DC  I 5  63  ? 123.145 141.665 174.401 1.00 66.41  ? -11 DC  I C5    1 
ATOM   7474  C  C6    . DC  I 5  63  ? 122.178 141.255 173.581 1.00 66.41  ? -11 DC  I C6    1 
ATOM   7475  P  P     . DG  I 5  64  ? 116.503 141.211 170.836 1.00 74.87  ? -10 DG  I P     1 
ATOM   7476  O  OP1   . DG  I 5  64  ? 115.663 140.476 169.869 1.00 74.87  ? -10 DG  I OP1   1 
ATOM   7477  O  OP2   . DG  I 5  64  ? 117.137 142.477 170.418 1.00 74.87  ? -10 DG  I OP2   1 
ATOM   7478  O  "O5'" . DG  I 5  64  ? 115.644 141.494 172.148 1.00 74.87  ? -10 DG  I "O5'" 1 
ATOM   7479  C  "C5'" . DG  I 5  64  ? 115.218 140.404 172.952 1.00 74.87  ? -10 DG  I "C5'" 1 
ATOM   7480  C  "C4'" . DG  I 5  64  ? 114.773 140.874 174.326 1.00 74.87  ? -10 DG  I "C4'" 1 
ATOM   7481  O  "O4'" . DG  I 5  64  ? 115.922 141.013 175.198 1.00 74.87  ? -10 DG  I "O4'" 1 
ATOM   7482  C  "C3'" . DG  I 5  64  ? 114.038 142.206 174.346 1.00 74.87  ? -10 DG  I "C3'" 1 
ATOM   7483  O  "O3'" . DG  I 5  64  ? 112.894 142.105 175.172 1.00 74.87  ? -10 DG  I "O3'" 1 
ATOM   7484  C  "C2'" . DG  I 5  64  ? 115.070 143.183 174.911 1.00 74.87  ? -10 DG  I "C2'" 1 
ATOM   7485  C  "C1'" . DG  I 5  64  ? 115.958 142.299 175.774 1.00 74.87  ? -10 DG  I "C1'" 1 
ATOM   7486  N  N9    . DG  I 5  64  ? 117.346 142.737 175.779 1.00 74.87  ? -10 DG  I N9    1 
ATOM   7487  C  C8    . DG  I 5  64  ? 118.131 142.927 174.675 1.00 74.87  ? -10 DG  I C8    1 
ATOM   7488  N  N7    . DG  I 5  64  ? 119.336 143.317 174.952 1.00 74.87  ? -10 DG  I N7    1 
ATOM   7489  C  C5    . DG  I 5  64  ? 119.360 143.392 176.332 1.00 74.87  ? -10 DG  I C5    1 
ATOM   7490  C  C6    . DG  I 5  64  ? 120.408 143.766 177.193 1.00 74.87  ? -10 DG  I C6    1 
ATOM   7491  O  O6    . DG  I 5  64  ? 121.552 144.112 176.890 1.00 74.87  ? -10 DG  I O6    1 
ATOM   7492  N  N1    . DG  I 5  64  ? 120.026 143.715 178.521 1.00 74.87  ? -10 DG  I N1    1 
ATOM   7493  C  C2    . DG  I 5  64  ? 118.785 143.349 178.966 1.00 74.87  ? -10 DG  I C2    1 
ATOM   7494  N  N2    . DG  I 5  64  ? 118.608 143.360 180.292 1.00 74.87  ? -10 DG  I N2    1 
ATOM   7495  N  N3    . DG  I 5  64  ? 117.781 142.997 178.167 1.00 74.87  ? -10 DG  I N3    1 
ATOM   7496  C  C4    . DG  I 5  64  ? 118.147 143.026 176.865 1.00 74.87  ? -10 DG  I C4    1 
ATOM   7497  P  P     . DC  I 5  65  ? 111.876 143.340 175.321 1.00 79.71  ? -9  DC  I P     1 
ATOM   7498  O  OP1   . DC  I 5  65  ? 110.534 142.776 175.568 1.00 79.71  ? -9  DC  I OP1   1 
ATOM   7499  O  OP2   . DC  I 5  65  ? 112.075 144.275 174.195 1.00 79.71  ? -9  DC  I OP2   1 
ATOM   7500  O  "O5'" . DC  I 5  65  ? 112.365 144.060 176.656 1.00 79.71  ? -9  DC  I "O5'" 1 
ATOM   7501  C  "C5'" . DC  I 5  65  ? 112.697 143.283 177.798 1.00 79.71  ? -9  DC  I "C5'" 1 
ATOM   7502  C  "C4'" . DC  I 5  65  ? 113.186 144.164 178.927 1.00 79.71  ? -9  DC  I "C4'" 1 
ATOM   7503  O  "O4'" . DC  I 5  65  ? 114.624 144.348 178.827 1.00 79.71  ? -9  DC  I "O4'" 1 
ATOM   7504  C  "C3'" . DC  I 5  65  ? 112.586 145.566 178.951 1.00 79.71  ? -9  DC  I "C3'" 1 
ATOM   7505  O  "O3'" . DC  I 5  65  ? 112.279 145.921 180.279 1.00 79.71  ? -9  DC  I "O3'" 1 
ATOM   7506  C  "C2'" . DC  I 5  65  ? 113.716 146.426 178.398 1.00 79.71  ? -9  DC  I "C2'" 1 
ATOM   7507  C  "C1'" . DC  I 5  65  ? 114.918 145.713 178.975 1.00 79.71  ? -9  DC  I "C1'" 1 
ATOM   7508  N  N1    . DC  I 5  65  ? 116.167 145.994 178.252 1.00 79.71  ? -9  DC  I N1    1 
ATOM   7509  C  C2    . DC  I 5  65  ? 117.313 146.364 178.958 1.00 79.71  ? -9  DC  I C2    1 
ATOM   7510  O  O2    . DC  I 5  65  ? 117.265 146.461 180.184 1.00 79.71  ? -9  DC  I O2    1 
ATOM   7511  N  N3    . DC  I 5  65  ? 118.444 146.614 178.273 1.00 79.71  ? -9  DC  I N3    1 
ATOM   7512  C  C4    . DC  I 5  65  ? 118.453 146.509 176.947 1.00 79.71  ? -9  DC  I C4    1 
ATOM   7513  N  N4    . DC  I 5  65  ? 119.591 146.765 176.309 1.00 79.71  ? -9  DC  I N4    1 
ATOM   7514  C  C5    . DC  I 5  65  ? 117.295 146.144 176.211 1.00 79.71  ? -9  DC  I C5    1 
ATOM   7515  C  C6    . DC  I 5  65  ? 116.189 145.888 176.902 1.00 79.71  ? -9  DC  I C6    1 
ATOM   7516  P  P     . DG  I 5  66  ? 111.269 147.129 180.579 1.00 79.77  ? -8  DG  I P     1 
ATOM   7517  O  OP1   . DG  I 5  66  ? 110.772 146.945 181.960 1.00 79.77  ? -8  DG  I OP1   1 
ATOM   7518  O  OP2   . DG  I 5  66  ? 110.318 147.215 179.449 1.00 79.77  ? -8  DG  I OP2   1 
ATOM   7519  O  "O5'" . DG  I 5  66  ? 112.193 148.426 180.501 1.00 79.77  ? -8  DG  I "O5'" 1 
ATOM   7520  C  "C5'" . DG  I 5  66  ? 111.902 149.547 181.295 1.00 79.77  ? -8  DG  I "C5'" 1 
ATOM   7521  C  "C4'" . DG  I 5  66  ? 112.738 149.531 182.553 1.00 79.77  ? -8  DG  I "C4'" 1 
ATOM   7522  O  "O4'" . DG  I 5  66  ? 113.993 148.878 182.273 1.00 79.77  ? -8  DG  I "O4'" 1 
ATOM   7523  C  "C3'" . DG  I 5  66  ? 113.100 150.902 183.082 1.00 79.77  ? -8  DG  I "C3'" 1 
ATOM   7524  O  "O3'" . DG  I 5  66  ? 113.251 150.879 184.486 1.00 79.77  ? -8  DG  I "O3'" 1 
ATOM   7525  C  "C2'" . DG  I 5  66  ? 114.417 151.202 182.386 1.00 79.77  ? -8  DG  I "C2'" 1 
ATOM   7526  C  "C1'" . DG  I 5  66  ? 115.028 149.831 182.157 1.00 79.77  ? -8  DG  I "C1'" 1 
ATOM   7527  N  N9    . DG  I 5  66  ? 115.646 149.693 180.842 1.00 79.77  ? -8  DG  I N9    1 
ATOM   7528  C  C8    . DG  I 5  66  ? 115.030 149.346 179.671 1.00 79.77  ? -8  DG  I C8    1 
ATOM   7529  N  N7    . DG  I 5  66  ? 115.838 149.288 178.653 1.00 79.77  ? -8  DG  I N7    1 
ATOM   7530  C  C5    . DG  I 5  66  ? 117.065 149.637 179.181 1.00 79.77  ? -8  DG  I C5    1 
ATOM   7531  C  C6    . DG  I 5  66  ? 118.314 149.753 178.556 1.00 79.77  ? -8  DG  I C6    1 
ATOM   7532  O  O6    . DG  I 5  66  ? 118.590 149.563 177.373 1.00 79.77  ? -8  DG  I O6    1 
ATOM   7533  N  N1    . DG  I 5  66  ? 119.306 150.123 179.451 1.00 79.77  ? -8  DG  I N1    1 
ATOM   7534  C  C2    . DG  I 5  66  ? 119.109 150.359 180.784 1.00 79.77  ? -8  DG  I C2    1 
ATOM   7535  N  N2    . DG  I 5  66  ? 120.185 150.704 181.498 1.00 79.77  ? -8  DG  I N2    1 
ATOM   7536  N  N3    . DG  I 5  66  ? 117.936 150.250 181.387 1.00 79.77  ? -8  DG  I N3    1 
ATOM   7537  C  C4    . DG  I 5  66  ? 116.965 149.887 180.527 1.00 79.77  ? -8  DG  I C4    1 
ATOM   7538  P  P     . DG  I 5  67  ? 112.824 152.168 185.339 1.00 76.82  ? -7  DG  I P     1 
ATOM   7539  O  OP1   . DG  I 5  67  ? 112.986 151.860 186.776 1.00 76.82  ? -7  DG  I OP1   1 
ATOM   7540  O  OP2   . DG  I 5  67  ? 111.520 152.598 184.798 1.00 76.82  ? -7  DG  I OP2   1 
ATOM   7541  O  "O5'" . DG  I 5  67  ? 113.895 153.284 184.935 1.00 76.82  ? -7  DG  I "O5'" 1 
ATOM   7542  C  "C5'" . DG  I 5  67  ? 115.229 153.194 185.413 1.00 76.82  ? -7  DG  I "C5'" 1 
ATOM   7543  C  "C4'" . DG  I 5  67  ? 116.132 154.172 184.687 1.00 76.82  ? -7  DG  I "C4'" 1 
ATOM   7544  O  "O4'" . DG  I 5  67  ? 116.462 153.667 183.360 1.00 76.82  ? -7  DG  I "O4'" 1 
ATOM   7545  C  "C3'" . DG  I 5  67  ? 115.540 155.571 184.476 1.00 76.82  ? -7  DG  I "C3'" 1 
ATOM   7546  O  "O3'" . DG  I 5  67  ? 116.502 156.548 184.811 1.00 76.82  ? -7  DG  I "O3'" 1 
ATOM   7547  C  "C2'" . DG  I 5  67  ? 115.246 155.586 182.977 1.00 76.82  ? -7  DG  I "C2'" 1 
ATOM   7548  C  "C1'" . DG  I 5  67  ? 116.389 154.734 182.454 1.00 76.82  ? -7  DG  I "C1'" 1 
ATOM   7549  N  N9    . DG  I 5  67  ? 116.174 154.218 181.101 1.00 76.82  ? -7  DG  I N9    1 
ATOM   7550  C  C8    . DG  I 5  67  ? 114.974 153.944 180.502 1.00 76.82  ? -7  DG  I C8    1 
ATOM   7551  N  N7    . DG  I 5  67  ? 115.083 153.496 179.287 1.00 76.82  ? -7  DG  I N7    1 
ATOM   7552  C  C5    . DG  I 5  67  ? 116.442 153.504 179.048 1.00 76.82  ? -7  DG  I C5    1 
ATOM   7553  C  C6    . DG  I 5  67  ? 117.161 153.137 177.888 1.00 76.82  ? -7  DG  I C6    1 
ATOM   7554  O  O6    . DG  I 5  67  ? 116.723 152.723 176.809 1.00 76.82  ? -7  DG  I O6    1 
ATOM   7555  N  N1    . DG  I 5  67  ? 118.530 153.295 178.064 1.00 76.82  ? -7  DG  I N1    1 
ATOM   7556  C  C2    . DG  I 5  67  ? 119.126 153.748 179.212 1.00 76.82  ? -7  DG  I C2    1 
ATOM   7557  N  N2    . DG  I 5  67  ? 120.461 153.827 179.184 1.00 76.82  ? -7  DG  I N2    1 
ATOM   7558  N  N3    . DG  I 5  67  ? 118.465 154.098 180.308 1.00 76.82  ? -7  DG  I N3    1 
ATOM   7559  C  C4    . DG  I 5  67  ? 117.131 153.951 180.155 1.00 76.82  ? -7  DG  I C4    1 
ATOM   7560  P  P     . DG  I 5  68  ? 116.485 157.249 186.255 1.00 72.72  ? -6  DG  I P     1 
ATOM   7561  O  OP1   . DG  I 5  68  ? 116.569 156.192 187.281 1.00 72.72  ? -6  DG  I OP1   1 
ATOM   7562  O  OP2   . DG  I 5  68  ? 115.366 158.213 186.271 1.00 72.72  ? -6  DG  I OP2   1 
ATOM   7563  O  "O5'" . DG  I 5  68  ? 117.849 158.076 186.288 1.00 72.72  ? -6  DG  I "O5'" 1 
ATOM   7564  C  "C5'" . DG  I 5  68  ? 119.074 157.451 185.896 1.00 72.72  ? -6  DG  I "C5'" 1 
ATOM   7565  C  "C4'" . DG  I 5  68  ? 119.788 158.235 184.797 1.00 72.72  ? -6  DG  I "C4'" 1 
ATOM   7566  O  "O4'" . DG  I 5  68  ? 119.339 157.792 183.487 1.00 72.72  ? -6  DG  I "O4'" 1 
ATOM   7567  C  "C3'" . DG  I 5  68  ? 119.568 159.749 184.810 1.00 72.72  ? -6  DG  I "C3'" 1 
ATOM   7568  O  "O3'" . DG  I 5  68  ? 120.763 160.398 184.421 1.00 72.72  ? -6  DG  I "O3'" 1 
ATOM   7569  C  "C2'" . DG  I 5  68  ? 118.503 159.920 183.740 1.00 72.72  ? -6  DG  I "C2'" 1 
ATOM   7570  C  "C1'" . DG  I 5  68  ? 119.020 158.929 182.727 1.00 72.72  ? -6  DG  I "C1'" 1 
ATOM   7571  N  N9    . DG  I 5  68  ? 118.052 158.574 181.713 1.00 72.72  ? -6  DG  I N9    1 
ATOM   7572  C  C8    . DG  I 5  68  ? 116.695 158.500 181.855 1.00 72.72  ? -6  DG  I C8    1 
ATOM   7573  N  N7    . DG  I 5  68  ? 116.077 158.158 180.760 1.00 72.72  ? -6  DG  I N7    1 
ATOM   7574  C  C5    . DG  I 5  68  ? 117.095 158.015 179.832 1.00 72.72  ? -6  DG  I C5    1 
ATOM   7575  C  C6    . DG  I 5  68  ? 117.043 157.671 178.465 1.00 72.72  ? -6  DG  I C6    1 
ATOM   7576  O  O6    . DG  I 5  68  ? 116.060 157.396 177.774 1.00 72.72  ? -6  DG  I O6    1 
ATOM   7577  N  N1    . DG  I 5  68  ? 118.307 157.640 177.894 1.00 72.72  ? -6  DG  I N1    1 
ATOM   7578  C  C2    . DG  I 5  68  ? 119.477 157.911 178.557 1.00 72.72  ? -6  DG  I C2    1 
ATOM   7579  N  N2    . DG  I 5  68  ? 120.607 157.829 177.834 1.00 72.72  ? -6  DG  I N2    1 
ATOM   7580  N  N3    . DG  I 5  68  ? 119.541 158.240 179.840 1.00 72.72  ? -6  DG  I N3    1 
ATOM   7581  C  C4    . DG  I 5  68  ? 118.315 158.273 180.409 1.00 72.72  ? -6  DG  I C4    1 
ATOM   7582  P  P     . DG  I 5  69  ? 121.711 161.078 185.521 1.00 66.23  ? -5  DG  I P     1 
ATOM   7583  O  OP1   . DG  I 5  69  ? 121.611 160.282 186.762 1.00 66.23  ? -5  DG  I OP1   1 
ATOM   7584  O  OP2   . DG  I 5  69  ? 121.400 162.521 185.524 1.00 66.23  ? -5  DG  I OP2   1 
ATOM   7585  O  "O5'" . DG  I 5  69  ? 123.187 160.946 184.912 1.00 66.23  ? -5  DG  I "O5'" 1 
ATOM   7586  C  "C5'" . DG  I 5  69  ? 123.476 159.973 183.912 1.00 66.23  ? -5  DG  I "C5'" 1 
ATOM   7587  C  "C4'" . DG  I 5  69  ? 123.708 160.599 182.530 1.00 66.23  ? -5  DG  I "C4'" 1 
ATOM   7588  O  "O4'" . DG  I 5  69  ? 122.469 160.642 181.779 1.00 66.23  ? -5  DG  I "O4'" 1 
ATOM   7589  C  "C3'" . DG  I 5  69  ? 124.236 162.034 182.494 1.00 66.23  ? -5  DG  I "C3'" 1 
ATOM   7590  O  "O3'" . DG  I 5  69  ? 125.008 162.200 181.328 1.00 66.23  ? -5  DG  I "O3'" 1 
ATOM   7591  C  "C2'" . DG  I 5  69  ? 122.947 162.828 182.351 1.00 66.23  ? -5  DG  I "C2'" 1 
ATOM   7592  C  "C1'" . DG  I 5  69  ? 122.276 161.961 181.320 1.00 66.23  ? -5  DG  I "C1'" 1 
ATOM   7593  N  N9    . DG  I 5  69  ? 120.859 162.175 181.165 1.00 66.23  ? -5  DG  I N9    1 
ATOM   7594  C  C8    . DG  I 5  69  ? 119.955 162.539 182.119 1.00 66.23  ? -5  DG  I C8    1 
ATOM   7595  N  N7    . DG  I 5  69  ? 118.735 162.611 181.665 1.00 66.23  ? -5  DG  I N7    1 
ATOM   7596  C  C5    . DG  I 5  69  ? 118.862 162.279 180.328 1.00 66.23  ? -5  DG  I C5    1 
ATOM   7597  C  C6    . DG  I 5  69  ? 117.895 162.198 179.311 1.00 66.23  ? -5  DG  I C6    1 
ATOM   7598  O  O6    . DG  I 5  69  ? 116.680 162.382 179.389 1.00 66.23  ? -5  DG  I O6    1 
ATOM   7599  N  N1    . DG  I 5  69  ? 118.456 161.820 178.097 1.00 66.23  ? -5  DG  I N1    1 
ATOM   7600  C  C2    . DG  I 5  69  ? 119.787 161.577 177.901 1.00 66.23  ? -5  DG  I C2    1 
ATOM   7601  N  N2    . DG  I 5  69  ? 120.146 161.223 176.669 1.00 66.23  ? -5  DG  I N2    1 
ATOM   7602  N  N3    . DG  I 5  69  ? 120.694 161.649 178.843 1.00 66.23  ? -5  DG  I N3    1 
ATOM   7603  C  C4    . DG  I 5  69  ? 120.164 162.006 180.020 1.00 66.23  ? -5  DG  I C4    1 
ATOM   7604  P  P     . DG  I 5  70  ? 126.589 161.948 181.340 1.00 66.02  ? -4  DG  I P     1 
ATOM   7605  O  OP1   . DG  I 5  70  ? 126.808 160.494 181.445 1.00 66.02  ? -4  DG  I OP1   1 
ATOM   7606  O  OP2   . DG  I 5  70  ? 127.209 162.855 182.326 1.00 66.02  ? -4  DG  I OP2   1 
ATOM   7607  O  "O5'" . DG  I 5  70  ? 127.033 162.394 179.880 1.00 66.02  ? -4  DG  I "O5'" 1 
ATOM   7608  C  "C5'" . DG  I 5  70  ? 126.855 161.508 178.792 1.00 66.02  ? -4  DG  I "C5'" 1 
ATOM   7609  C  "C4'" . DG  I 5  70  ? 126.345 162.226 177.555 1.00 66.02  ? -4  DG  I "C4'" 1 
ATOM   7610  O  "O4'" . DG  I 5  70  ? 124.933 162.511 177.701 1.00 66.02  ? -4  DG  I "O4'" 1 
ATOM   7611  C  "C3'" . DG  I 5  70  ? 127.003 163.565 177.221 1.00 66.02  ? -4  DG  I "C3'" 1 
ATOM   7612  O  "O3'" . DG  I 5  70  ? 127.084 163.667 175.832 1.00 66.02  ? -4  DG  I "O3'" 1 
ATOM   7613  C  "C2'" . DG  I 5  70  ? 125.990 164.562 177.759 1.00 66.02  ? -4  DG  I "C2'" 1 
ATOM   7614  C  "C1'" . DG  I 5  70  ? 124.710 163.861 177.376 1.00 66.02  ? -4  DG  I "C1'" 1 
ATOM   7615  N  N9    . DG  I 5  70  ? 123.537 164.321 178.106 1.00 66.02  ? -4  DG  I N9    1 
ATOM   7616  C  C8    . DG  I 5  70  ? 123.474 164.687 179.426 1.00 66.02  ? -4  DG  I C8    1 
ATOM   7617  N  N7    . DG  I 5  70  ? 122.282 165.040 179.809 1.00 66.02  ? -4  DG  I N7    1 
ATOM   7618  C  C5    . DG  I 5  70  ? 121.509 164.903 178.671 1.00 66.02  ? -4  DG  I C5    1 
ATOM   7619  C  C6    . DG  I 5  70  ? 120.133 165.145 178.474 1.00 66.02  ? -4  DG  I C6    1 
ATOM   7620  O  O6    . DG  I 5  70  ? 119.297 165.540 179.292 1.00 66.02  ? -4  DG  I O6    1 
ATOM   7621  N  N1    . DG  I 5  70  ? 119.749 164.880 177.168 1.00 66.02  ? -4  DG  I N1    1 
ATOM   7622  C  C2    . DG  I 5  70  ? 120.588 164.437 176.179 1.00 66.02  ? -4  DG  I C2    1 
ATOM   7623  N  N2    . DG  I 5  70  ? 120.036 164.239 174.980 1.00 66.02  ? -4  DG  I N2    1 
ATOM   7624  N  N3    . DG  I 5  70  ? 121.880 164.205 176.350 1.00 66.02  ? -4  DG  I N3    1 
ATOM   7625  C  C4    . DG  I 5  70  ? 122.268 164.459 177.616 1.00 66.02  ? -4  DG  I C4    1 
ATOM   7626  P  P     . DA  I 5  71  ? 128.180 164.596 175.127 1.00 69.61  ? -3  DA  I P     1 
ATOM   7627  O  OP1   . DA  I 5  71  ? 129.408 163.799 174.974 1.00 69.61  ? -3  DA  I OP1   1 
ATOM   7628  O  OP2   . DA  I 5  71  ? 128.247 165.876 175.848 1.00 69.61  ? -3  DA  I OP2   1 
ATOM   7629  O  "O5'" . DA  I 5  71  ? 127.541 164.859 173.695 1.00 69.61  ? -3  DA  I "O5'" 1 
ATOM   7630  C  "C5'" . DA  I 5  71  ? 126.805 163.817 173.066 1.00 69.61  ? -3  DA  I "C5'" 1 
ATOM   7631  C  "C4'" . DA  I 5  71  ? 125.682 164.356 172.191 1.00 69.61  ? -3  DA  I "C4'" 1 
ATOM   7632  O  "O4'" . DA  I 5  71  ? 124.524 164.678 172.995 1.00 69.61  ? -3  DA  I "O4'" 1 
ATOM   7633  C  "C3'" . DA  I 5  71  ? 126.008 165.607 171.399 1.00 69.61  ? -3  DA  I "C3'" 1 
ATOM   7634  O  "O3'" . DA  I 5  71  ? 125.446 165.493 170.128 1.00 69.61  ? -3  DA  I "O3'" 1 
ATOM   7635  C  "C2'" . DA  I 5  71  ? 125.348 166.720 172.207 1.00 69.61  ? -3  DA  I "C2'" 1 
ATOM   7636  C  "C1'" . DA  I 5  71  ? 124.128 166.014 172.767 1.00 69.61  ? -3  DA  I "C1'" 1 
ATOM   7637  N  N9    . DA  I 5  71  ? 123.668 166.543 174.043 1.00 69.61  ? -3  DA  I N9    1 
ATOM   7638  C  C8    . DA  I 5  71  ? 124.404 166.683 175.176 1.00 69.61  ? -3  DA  I C8    1 
ATOM   7639  N  N7    . DA  I 5  71  ? 123.731 167.145 176.195 1.00 69.61  ? -3  DA  I N7    1 
ATOM   7640  C  C5    . DA  I 5  71  ? 122.455 167.298 175.700 1.00 69.61  ? -3  DA  I C5    1 
ATOM   7641  C  C6    . DA  I 5  71  ? 121.273 167.764 176.284 1.00 69.61  ? -3  DA  I C6    1 
ATOM   7642  N  N6    . DA  I 5  71  ? 121.199 168.158 177.555 1.00 69.61  ? -3  DA  I N6    1 
ATOM   7643  N  N1    . DA  I 5  71  ? 120.163 167.804 175.520 1.00 69.61  ? -3  DA  I N1    1 
ATOM   7644  C  C2    . DA  I 5  71  ? 120.243 167.411 174.245 1.00 69.61  ? -3  DA  I C2    1 
ATOM   7645  N  N3    . DA  I 5  71  ? 121.308 166.959 173.582 1.00 69.61  ? -3  DA  I N3    1 
ATOM   7646  C  C4    . DA  I 5  71  ? 122.392 166.931 174.375 1.00 69.61  ? -3  DA  I C4    1 
ATOM   7647  P  P     . DC  I 5  72  ? 125.860 166.519 168.974 1.00 73.45  ? -2  DC  I P     1 
ATOM   7648  O  OP1   . DC  I 5  72  ? 125.802 165.806 167.684 1.00 73.45  ? -2  DC  I OP1   1 
ATOM   7649  O  OP2   . DC  I 5  72  ? 127.109 167.179 169.406 1.00 73.45  ? -2  DC  I OP2   1 
ATOM   7650  O  "O5'" . DC  I 5  72  ? 124.692 167.596 169.009 1.00 73.45  ? -2  DC  I "O5'" 1 
ATOM   7651  C  "C5'" . DC  I 5  72  ? 123.337 167.171 169.094 1.00 73.45  ? -2  DC  I "C5'" 1 
ATOM   7652  C  "C4'" . DC  I 5  72  ? 122.406 168.355 169.257 1.00 73.45  ? -2  DC  I "C4'" 1 
ATOM   7653  O  "O4'" . DC  I 5  72  ? 122.108 168.559 170.663 1.00 73.45  ? -2  DC  I "O4'" 1 
ATOM   7654  C  "C3'" . DC  I 5  72  ? 122.955 169.693 168.754 1.00 73.45  ? -2  DC  I "C3'" 1 
ATOM   7655  O  "O3'" . DC  I 5  72  ? 121.903 170.423 168.154 1.00 73.45  ? -2  DC  I "O3'" 1 
ATOM   7656  C  "C2'" . DC  I 5  72  ? 123.401 170.366 170.048 1.00 73.45  ? -2  DC  I "C2'" 1 
ATOM   7657  C  "C1'" . DC  I 5  72  ? 122.273 169.923 170.947 1.00 73.45  ? -2  DC  I "C1'" 1 
ATOM   7658  N  N1    . DC  I 5  72  ? 122.524 170.099 172.387 1.00 73.45  ? -2  DC  I N1    1 
ATOM   7659  C  C2    . DC  I 5  72  ? 121.479 170.513 173.201 1.00 73.45  ? -2  DC  I C2    1 
ATOM   7660  O  O2    . DC  I 5  72  ? 120.382 170.718 172.688 1.00 73.45  ? -2  DC  I O2    1 
ATOM   7661  N  N3    . DC  I 5  72  ? 121.699 170.677 174.520 1.00 73.45  ? -2  DC  I N3    1 
ATOM   7662  C  C4    . DC  I 5  72  ? 122.904 170.450 175.021 1.00 73.45  ? -2  DC  I C4    1 
ATOM   7663  N  N4    . DC  I 5  72  ? 123.077 170.613 176.330 1.00 73.45  ? -2  DC  I N4    1 
ATOM   7664  C  C5    . DC  I 5  72  ? 123.986 170.018 174.205 1.00 73.45  ? -2  DC  I C5    1 
ATOM   7665  C  C6    . DC  I 5  72  ? 123.753 169.865 172.903 1.00 73.45  ? -2  DC  I C6    1 
ATOM   7666  P  P     . DA  I 5  73  ? 122.024 170.964 166.650 1.00 83.32  ? -1  DA  I P     1 
ATOM   7667  O  OP1   . DA  I 5  73  ? 121.787 169.808 165.763 1.00 83.32  ? -1  DA  I OP1   1 
ATOM   7668  O  OP2   . DA  I 5  73  ? 123.281 171.723 166.515 1.00 83.32  ? -1  DA  I OP2   1 
ATOM   7669  O  "O5'" . DA  I 5  73  ? 120.811 172.001 166.532 1.00 83.32  ? -1  DA  I "O5'" 1 
ATOM   7670  C  "C5'" . DA  I 5  73  ? 119.475 171.560 166.772 1.00 83.32  ? -1  DA  I "C5'" 1 
ATOM   7671  C  "C4'" . DA  I 5  73  ? 118.697 172.552 167.625 1.00 83.32  ? -1  DA  I "C4'" 1 
ATOM   7672  O  "O4'" . DA  I 5  73  ? 119.118 172.455 169.005 1.00 83.32  ? -1  DA  I "O4'" 1 
ATOM   7673  C  "C3'" . DA  I 5  73  ? 118.846 174.022 167.230 1.00 83.32  ? -1  DA  I "C3'" 1 
ATOM   7674  O  "O3'" . DA  I 5  73  ? 117.562 174.610 167.094 1.00 83.32  ? -1  DA  I "O3'" 1 
ATOM   7675  C  "C2'" . DA  I 5  73  ? 119.623 174.637 168.393 1.00 83.32  ? -1  DA  I "C2'" 1 
ATOM   7676  C  "C1'" . DA  I 5  73  ? 119.226 173.745 169.550 1.00 83.32  ? -1  DA  I "C1'" 1 
ATOM   7677  N  N9    . DA  I 5  73  ? 120.226 173.701 170.589 1.00 83.32  ? -1  DA  I N9    1 
ATOM   7678  C  C8    . DA  I 5  73  ? 121.508 173.282 170.460 1.00 83.32  ? -1  DA  I C8    1 
ATOM   7679  N  N7    . DA  I 5  73  ? 122.200 173.339 171.566 1.00 83.32  ? -1  DA  I N7    1 
ATOM   7680  C  C5    . DA  I 5  73  ? 121.305 173.842 172.480 1.00 83.32  ? -1  DA  I C5    1 
ATOM   7681  C  C6    . DA  I 5  73  ? 121.421 174.141 173.840 1.00 83.32  ? -1  DA  I C6    1 
ATOM   7682  N  N6    . DA  I 5  73  ? 122.544 173.969 174.531 1.00 83.32  ? -1  DA  I N6    1 
ATOM   7683  N  N1    . DA  I 5  73  ? 120.336 174.634 174.466 1.00 83.32  ? -1  DA  I N1    1 
ATOM   7684  C  C2    . DA  I 5  73  ? 119.205 174.799 173.773 1.00 83.32  ? -1  DA  I C2    1 
ATOM   7685  N  N3    . DA  I 5  73  ? 118.980 174.555 172.486 1.00 83.32  ? -1  DA  I N3    1 
ATOM   7686  C  C4    . DA  I 5  73  ? 120.078 174.060 171.898 1.00 83.32  ? -1  DA  I C4    1 
ATOM   7687  P  P     . DG  I 5  74  ? 117.407 176.125 166.583 1.00 93.79  ? 0   DG  I P     1 
ATOM   7688  O  OP1   . DG  I 5  74  ? 116.148 176.184 165.814 1.00 93.79  ? 0   DG  I OP1   1 
ATOM   7689  O  OP2   . DG  I 5  74  ? 118.667 176.550 165.938 1.00 93.79  ? 0   DG  I OP2   1 
ATOM   7690  O  "O5'" . DG  I 5  74  ? 117.201 176.959 167.928 1.00 93.79  ? 0   DG  I "O5'" 1 
ATOM   7691  C  "C5'" . DG  I 5  74  ? 115.976 176.854 168.622 1.00 93.79  ? 0   DG  I "C5'" 1 
ATOM   7692  C  "C4'" . DG  I 5  74  ? 116.002 177.634 169.922 1.00 93.79  ? 0   DG  I "C4'" 1 
ATOM   7693  O  "O4'" . DG  I 5  74  ? 117.077 177.152 170.766 1.00 93.79  ? 0   DG  I "O4'" 1 
ATOM   7694  C  "C3'" . DG  I 5  74  ? 116.224 179.146 169.791 1.00 93.79  ? 0   DG  I "C3'" 1 
ATOM   7695  O  "O3'" . DG  I 5  74  ? 115.401 179.807 170.749 1.00 93.79  ? 0   DG  I "O3'" 1 
ATOM   7696  C  "C2'" . DG  I 5  74  ? 117.696 179.280 170.152 1.00 93.79  ? 0   DG  I "C2'" 1 
ATOM   7697  C  "C1'" . DG  I 5  74  ? 117.774 178.261 171.262 1.00 93.79  ? 0   DG  I "C1'" 1 
ATOM   7698  N  N9    . DG  I 5  74  ? 119.119 177.850 171.604 1.00 93.79  ? 0   DG  I N9    1 
ATOM   7699  C  C8    . DG  I 5  74  ? 120.012 177.192 170.804 1.00 93.79  ? 0   DG  I C8    1 
ATOM   7700  N  N7    . DG  I 5  74  ? 121.145 176.940 171.395 1.00 93.79  ? 0   DG  I N7    1 
ATOM   7701  C  C5    . DG  I 5  74  ? 120.980 177.453 172.671 1.00 93.79  ? 0   DG  I C5    1 
ATOM   7702  C  C6    . DG  I 5  74  ? 121.872 177.477 173.763 1.00 93.79  ? 0   DG  I C6    1 
ATOM   7703  O  O6    . DG  I 5  74  ? 123.013 177.026 173.829 1.00 93.79  ? 0   DG  I O6    1 
ATOM   7704  N  N1    . DG  I 5  74  ? 121.315 178.102 174.866 1.00 93.79  ? 0   DG  I N1    1 
ATOM   7705  C  C2    . DG  I 5  74  ? 120.053 178.637 174.909 1.00 93.79  ? 0   DG  I C2    1 
ATOM   7706  N  N2    . DG  I 5  74  ? 119.688 179.200 176.066 1.00 93.79  ? 0   DG  I N2    1 
ATOM   7707  N  N3    . DG  I 5  74  ? 119.210 178.624 173.891 1.00 93.79  ? 0   DG  I N3    1 
ATOM   7708  C  C4    . DG  I 5  74  ? 119.739 178.018 172.810 1.00 93.79  ? 0   DG  I C4    1 
ATOM   7709  P  P     . DC  I 5  75  ? 115.095 181.382 170.671 1.00 96.35  ? 1   DC  I P     1 
ATOM   7710  O  OP1   . DC  I 5  75  ? 113.698 181.513 170.214 1.00 96.35  ? 1   DC  I OP1   1 
ATOM   7711  O  OP2   . DC  I 5  75  ? 116.171 182.122 169.974 1.00 96.35  ? 1   DC  I OP2   1 
ATOM   7712  O  "O5'" . DC  I 5  75  ? 115.142 181.821 172.195 1.00 96.35  ? 1   DC  I "O5'" 1 
ATOM   7713  C  "C5'" . DC  I 5  75  ? 116.041 181.180 173.074 1.00 96.35  ? 1   DC  I "C5'" 1 
ATOM   7714  C  "C4'" . DC  I 5  75  ? 116.880 182.200 173.813 1.00 96.35  ? 1   DC  I "C4'" 1 
ATOM   7715  O  "O4'" . DC  I 5  75  ? 118.210 181.664 174.004 1.00 96.35  ? 1   DC  I "O4'" 1 
ATOM   7716  C  "C3'" . DC  I 5  75  ? 117.084 183.520 173.067 1.00 96.35  ? 1   DC  I "C3'" 1 
ATOM   7717  O  "O3'" . DC  I 5  75  ? 117.312 184.558 174.000 1.00 96.35  ? 1   DC  I "O3'" 1 
ATOM   7718  C  "C2'" . DC  I 5  75  ? 118.341 183.224 172.278 1.00 96.35  ? 1   DC  I "C2'" 1 
ATOM   7719  C  "C1'" . DC  I 5  75  ? 119.126 182.508 173.357 1.00 96.35  ? 1   DC  I "C1'" 1 
ATOM   7720  N  N1    . DC  I 5  75  ? 120.270 181.720 172.871 1.00 96.35  ? 1   DC  I N1    1 
ATOM   7721  C  C2    . DC  I 5  75  ? 121.328 181.525 173.726 1.00 96.35  ? 1   DC  I C2    1 
ATOM   7722  O  O2    . DC  I 5  75  ? 121.268 182.008 174.856 1.00 96.35  ? 1   DC  I O2    1 
ATOM   7723  N  N3    . DC  I 5  75  ? 122.391 180.820 173.310 1.00 96.35  ? 1   DC  I N3    1 
ATOM   7724  C  C4    . DC  I 5  75  ? 122.416 180.332 172.075 1.00 96.35  ? 1   DC  I C4    1 
ATOM   7725  N  N4    . DC  I 5  75  ? 123.493 179.632 171.713 1.00 96.35  ? 1   DC  I N4    1 
ATOM   7726  C  C5    . DC  I 5  75  ? 121.335 180.515 171.172 1.00 96.35  ? 1   DC  I C5    1 
ATOM   7727  C  C6    . DC  I 5  75  ? 120.291 181.218 171.609 1.00 96.35  ? 1   DC  I C6    1 
ATOM   7728  P  P     . DG  I 5  76  ? 116.430 185.903 173.973 1.00 91.67  ? 2   DG  I P     1 
ATOM   7729  O  OP1   . DG  I 5  76  ? 115.072 185.587 174.457 1.00 91.67  ? 2   DG  I OP1   1 
ATOM   7730  O  OP2   . DG  I 5  76  ? 116.606 186.556 172.660 1.00 91.67  ? 2   DG  I OP2   1 
ATOM   7731  O  "O5'" . DG  I 5  76  ? 117.142 186.824 175.060 1.00 91.67  ? 2   DG  I "O5'" 1 
ATOM   7732  C  "C5'" . DG  I 5  76  ? 117.387 186.310 176.363 1.00 91.67  ? 2   DG  I "C5'" 1 
ATOM   7733  C  "C4'" . DG  I 5  76  ? 118.816 186.573 176.817 1.00 91.67  ? 2   DG  I "C4'" 1 
ATOM   7734  O  "O4'" . DG  I 5  76  ? 119.729 185.662 176.157 1.00 91.67  ? 2   DG  I "O4'" 1 
ATOM   7735  C  "C3'" . DG  I 5  76  ? 119.362 187.975 176.546 1.00 91.67  ? 2   DG  I "C3'" 1 
ATOM   7736  O  "O3'" . DG  I 5  76  ? 120.153 188.362 177.640 1.00 91.67  ? 2   DG  I "O3'" 1 
ATOM   7737  C  "C2'" . DG  I 5  76  ? 120.229 187.753 175.313 1.00 91.67  ? 2   DG  I "C2'" 1 
ATOM   7738  C  "C1'" . DG  I 5  76  ? 120.816 186.402 175.657 1.00 91.67  ? 2   DG  I "C1'" 1 
ATOM   7739  N  N9    . DG  I 5  76  ? 121.385 185.678 174.531 1.00 91.67  ? 2   DG  I N9    1 
ATOM   7740  C  C8    . DG  I 5  76  ? 120.834 185.516 173.287 1.00 91.67  ? 2   DG  I C8    1 
ATOM   7741  N  N7    . DG  I 5  76  ? 121.564 184.792 172.488 1.00 91.67  ? 2   DG  I N7    1 
ATOM   7742  C  C5    . DG  I 5  76  ? 122.670 184.464 173.251 1.00 91.67  ? 2   DG  I C5    1 
ATOM   7743  C  C6    . DG  I 5  76  ? 123.807 183.704 172.917 1.00 91.67  ? 2   DG  I C6    1 
ATOM   7744  O  O6    . DG  I 5  76  ? 124.065 183.150 171.845 1.00 91.67  ? 2   DG  I O6    1 
ATOM   7745  N  N1    . DG  I 5  76  ? 124.693 183.613 173.980 1.00 91.67  ? 2   DG  I N1    1 
ATOM   7746  C  C2    . DG  I 5  76  ? 124.499 184.185 175.213 1.00 91.67  ? 2   DG  I C2    1 
ATOM   7747  N  N2    . DG  I 5  76  ? 125.462 183.993 176.122 1.00 91.67  ? 2   DG  I N2    1 
ATOM   7748  N  N3    . DG  I 5  76  ? 123.442 184.901 175.536 1.00 91.67  ? 2   DG  I N3    1 
ATOM   7749  C  C4    . DG  I 5  76  ? 122.571 184.994 174.511 1.00 91.67  ? 2   DG  I C4    1 
ATOM   7750  P  P     . DC  I 5  77  ? 120.039 189.836 178.262 1.00 87.00  ? 3   DC  I P     1 
ATOM   7751  O  OP1   . DC  I 5  77  ? 119.299 189.717 179.534 1.00 87.00  ? 3   DC  I OP1   1 
ATOM   7752  O  OP2   . DC  I 5  77  ? 119.572 190.760 177.209 1.00 87.00  ? 3   DC  I OP2   1 
ATOM   7753  O  "O5'" . DC  I 5  77  ? 121.550 190.201 178.598 1.00 87.00  ? 3   DC  I "O5'" 1 
ATOM   7754  C  "C5'" . DC  I 5  77  ? 122.356 189.257 179.285 1.00 87.00  ? 3   DC  I "C5'" 1 
ATOM   7755  C  "C4'" . DC  I 5  77  ? 123.796 189.337 178.822 1.00 87.00  ? 3   DC  I "C4'" 1 
ATOM   7756  O  "O4'" . DC  I 5  77  ? 124.005 188.430 177.707 1.00 87.00  ? 3   DC  I "O4'" 1 
ATOM   7757  C  "C3'" . DC  I 5  77  ? 124.247 190.714 178.328 1.00 87.00  ? 3   DC  I "C3'" 1 
ATOM   7758  O  "O3'" . DC  I 5  77  ? 125.540 190.985 178.816 1.00 87.00  ? 3   DC  I "O3'" 1 
ATOM   7759  C  "C2'" . DC  I 5  77  ? 124.270 190.528 176.818 1.00 87.00  ? 3   DC  I "C2'" 1 
ATOM   7760  C  "C1'" . DC  I 5  77  ? 124.779 189.107 176.759 1.00 87.00  ? 3   DC  I "C1'" 1 
ATOM   7761  N  N1    . DC  I 5  77  ? 124.637 188.464 175.443 1.00 87.00  ? 3   DC  I N1    1 
ATOM   7762  C  C2    . DC  I 5  77  ? 125.645 187.623 174.989 1.00 87.00  ? 3   DC  I C2    1 
ATOM   7763  O  O2    . DC  I 5  77  ? 126.629 187.435 175.708 1.00 87.00  ? 3   DC  I O2    1 
ATOM   7764  N  N3    . DC  I 5  77  ? 125.525 187.050 173.770 1.00 87.00  ? 3   DC  I N3    1 
ATOM   7765  C  C4    . DC  I 5  77  ? 124.452 187.296 173.027 1.00 87.00  ? 3   DC  I C4    1 
ATOM   7766  N  N4    . DC  I 5  77  ? 124.373 186.710 171.831 1.00 87.00  ? 3   DC  I N4    1 
ATOM   7767  C  C5    . DC  I 5  77  ? 123.409 188.151 173.477 1.00 87.00  ? 3   DC  I C5    1 
ATOM   7768  C  C6    . DC  I 5  77  ? 123.549 188.717 174.677 1.00 87.00  ? 3   DC  I C6    1 
ATOM   7769  P  P     . DG  I 5  78  ? 125.982 192.488 179.150 1.00 80.00  ? 4   DG  I P     1 
ATOM   7770  O  OP1   . DG  I 5  78  ? 125.343 192.858 180.428 1.00 80.00  ? 4   DG  I OP1   1 
ATOM   7771  O  OP2   . DG  I 5  78  ? 125.755 193.302 177.940 1.00 80.00  ? 4   DG  I OP2   1 
ATOM   7772  O  "O5'" . DG  I 5  78  ? 127.563 192.384 179.345 1.00 80.00  ? 4   DG  I "O5'" 1 
ATOM   7773  C  "C5'" . DG  I 5  78  ? 128.136 191.232 179.955 1.00 80.00  ? 4   DG  I "C5'" 1 
ATOM   7774  C  "C4'" . DG  I 5  78  ? 129.310 190.688 179.145 1.00 80.00  ? 4   DG  I "C4'" 1 
ATOM   7775  O  "O4'" . DG  I 5  78  ? 128.821 190.017 177.954 1.00 80.00  ? 4   DG  I "O4'" 1 
ATOM   7776  C  "C3'" . DG  I 5  78  ? 130.315 191.727 178.652 1.00 80.00  ? 4   DG  I "C3'" 1 
ATOM   7777  O  "O3'" . DG  I 5  78  ? 131.629 191.202 178.741 1.00 80.00  ? 4   DG  I "O3'" 1 
ATOM   7778  C  "C2'" . DG  I 5  78  ? 129.904 191.920 177.200 1.00 80.00  ? 4   DG  I "C2'" 1 
ATOM   7779  C  "C1'" . DG  I 5  78  ? 129.492 190.526 176.823 1.00 80.00  ? 4   DG  I "C1'" 1 
ATOM   7780  N  N9    . DG  I 5  78  ? 128.583 190.461 175.692 1.00 80.00  ? 4   DG  I N9    1 
ATOM   7781  C  C8    . DG  I 5  78  ? 127.408 191.147 175.523 1.00 80.00  ? 4   DG  I C8    1 
ATOM   7782  N  N7    . DG  I 5  78  ? 126.792 190.851 174.412 1.00 80.00  ? 4   DG  I N7    1 
ATOM   7783  C  C5    . DG  I 5  78  ? 127.625 189.920 173.809 1.00 80.00  ? 4   DG  I C5    1 
ATOM   7784  C  C6    . DG  I 5  78  ? 127.487 189.224 172.592 1.00 80.00  ? 4   DG  I C6    1 
ATOM   7785  O  O6    . DG  I 5  78  ? 126.583 189.309 171.761 1.00 80.00  ? 4   DG  I O6    1 
ATOM   7786  N  N1    . DG  I 5  78  ? 128.555 188.360 172.364 1.00 80.00  ? 4   DG  I N1    1 
ATOM   7787  C  C2    . DG  I 5  78  ? 129.611 188.183 173.215 1.00 80.00  ? 4   DG  I C2    1 
ATOM   7788  N  N2    . DG  I 5  78  ? 130.548 187.303 172.834 1.00 80.00  ? 4   DG  I N2    1 
ATOM   7789  N  N3    . DG  I 5  78  ? 129.748 188.822 174.360 1.00 80.00  ? 4   DG  I N3    1 
ATOM   7790  C  C4    . DG  I 5  78  ? 128.721 189.666 174.593 1.00 80.00  ? 4   DG  I C4    1 
ATOM   7791  P  P     . DT  I 5  79  ? 132.904 192.173 178.848 1.00 79.22  ? 5   DT  I P     1 
ATOM   7792  O  OP1   . DT  I 5  79  ? 133.130 192.440 180.283 1.00 79.22  ? 5   DT  I OP1   1 
ATOM   7793  O  OP2   . DT  I 5  79  ? 132.737 193.314 177.921 1.00 79.22  ? 5   DT  I OP2   1 
ATOM   7794  O  "O5'" . DT  I 5  79  ? 134.098 191.259 178.304 1.00 79.22  ? 5   DT  I "O5'" 1 
ATOM   7795  C  "C5'" . DT  I 5  79  ? 133.807 190.215 177.368 1.00 79.22  ? 5   DT  I "C5'" 1 
ATOM   7796  C  "C4'" . DT  I 5  79  ? 134.716 190.263 176.144 1.00 79.22  ? 5   DT  I "C4'" 1 
ATOM   7797  O  "O4'" . DT  I 5  79  ? 133.905 190.382 174.947 1.00 79.22  ? 5   DT  I "O4'" 1 
ATOM   7798  C  "C3'" . DT  I 5  79  ? 135.685 191.431 176.069 1.00 79.22  ? 5   DT  I "C3'" 1 
ATOM   7799  O  "O3'" . DT  I 5  79  ? 136.746 191.102 175.176 1.00 79.22  ? 5   DT  I "O3'" 1 
ATOM   7800  C  "C2'" . DT  I 5  79  ? 134.796 192.499 175.451 1.00 79.22  ? 5   DT  I "C2'" 1 
ATOM   7801  C  "C1'" . DT  I 5  79  ? 134.081 191.670 174.389 1.00 79.22  ? 5   DT  I "C1'" 1 
ATOM   7802  N  N1    . DT  I 5  79  ? 132.740 192.199 173.971 1.00 79.22  ? 5   DT  I N1    1 
ATOM   7803  C  C2    . DT  I 5  79  ? 132.134 191.646 172.873 1.00 79.22  ? 5   DT  I C2    1 
ATOM   7804  O  O2    . DT  I 5  79  ? 132.640 190.760 172.215 1.00 79.22  ? 5   DT  I O2    1 
ATOM   7805  N  N3    . DT  I 5  79  ? 130.919 192.176 172.558 1.00 79.22  ? 5   DT  I N3    1 
ATOM   7806  C  C4    . DT  I 5  79  ? 130.246 193.177 173.221 1.00 79.22  ? 5   DT  I C4    1 
ATOM   7807  O  O4    . DT  I 5  79  ? 129.148 193.578 172.854 1.00 79.22  ? 5   DT  I O4    1 
ATOM   7808  C  C5    . DT  I 5  79  ? 130.926 193.723 174.371 1.00 79.22  ? 5   DT  I C5    1 
ATOM   7809  C  C7    . DT  I 5  79  ? 130.291 194.835 175.159 1.00 79.22  ? 5   DT  I C7    1 
ATOM   7810  C  C6    . DT  I 5  79  ? 132.131 193.214 174.692 1.00 79.22  ? 5   DT  I C6    1 
ATOM   7811  P  P     . DA  I 5  80  ? 138.102 190.399 175.684 1.00 76.06  ? 6   DA  I P     1 
ATOM   7812  O  OP1   . DA  I 5  80  ? 137.824 189.518 176.837 1.00 76.06  ? 6   DA  I OP1   1 
ATOM   7813  O  OP2   . DA  I 5  80  ? 139.111 191.465 175.832 1.00 76.06  ? 6   DA  I OP2   1 
ATOM   7814  O  "O5'" . DA  I 5  80  ? 138.546 189.510 174.427 1.00 76.06  ? 6   DA  I "O5'" 1 
ATOM   7815  C  "C5'" . DA  I 5  80  ? 137.555 189.060 173.497 1.00 76.06  ? 6   DA  I "C5'" 1 
ATOM   7816  C  "C4'" . DA  I 5  80  ? 137.901 189.436 172.060 1.00 76.06  ? 6   DA  I "C4'" 1 
ATOM   7817  O  "O4'" . DA  I 5  80  ? 136.867 190.299 171.510 1.00 76.06  ? 6   DA  I "O4'" 1 
ATOM   7818  C  "C3'" . DA  I 5  80  ? 139.184 190.213 171.862 1.00 76.06  ? 6   DA  I "C3'" 1 
ATOM   7819  O  "O3'" . DA  I 5  80  ? 139.609 190.018 170.547 1.00 76.06  ? 6   DA  I "O3'" 1 
ATOM   7820  C  "C2'" . DA  I 5  80  ? 138.695 191.637 172.037 1.00 76.06  ? 6   DA  I "C2'" 1 
ATOM   7821  C  "C1'" . DA  I 5  80  ? 137.419 191.572 171.219 1.00 76.06  ? 6   DA  I "C1'" 1 
ATOM   7822  N  N9    . DA  I 5  80  ? 136.439 192.582 171.583 1.00 76.06  ? 6   DA  I N9    1 
ATOM   7823  C  C8    . DA  I 5  80  ? 136.535 193.492 172.594 1.00 76.06  ? 6   DA  I C8    1 
ATOM   7824  N  N7    . DA  I 5  80  ? 135.485 194.267 172.709 1.00 76.06  ? 6   DA  I N7    1 
ATOM   7825  C  C5    . DA  I 5  80  ? 134.641 193.833 171.703 1.00 76.06  ? 6   DA  I C5    1 
ATOM   7826  C  C6    . DA  I 5  80  ? 133.361 194.251 171.293 1.00 76.06  ? 6   DA  I C6    1 
ATOM   7827  N  N6    . DA  I 5  80  ? 132.689 195.238 171.885 1.00 76.06  ? 6   DA  I N6    1 
ATOM   7828  N  N1    . DA  I 5  80  ? 132.795 193.604 170.253 1.00 76.06  ? 6   DA  I N1    1 
ATOM   7829  C  C2    . DA  I 5  80  ? 133.473 192.613 169.664 1.00 76.06  ? 6   DA  I C2    1 
ATOM   7830  N  N3    . DA  I 5  80  ? 134.682 192.134 169.960 1.00 76.06  ? 6   DA  I N3    1 
ATOM   7831  C  C4    . DA  I 5  80  ? 135.213 192.792 171.000 1.00 76.06  ? 6   DA  I C4    1 
ATOM   7832  P  P     . DC  I 5  81  ? 140.875 189.091 170.235 1.00 68.29  ? 7   DC  I P     1 
ATOM   7833  O  OP1   . DC  I 5  81  ? 140.714 187.828 170.986 1.00 68.29  ? 7   DC  I OP1   1 
ATOM   7834  O  OP2   . DC  I 5  81  ? 142.064 189.952 170.385 1.00 68.29  ? 7   DC  I OP2   1 
ATOM   7835  O  "O5'" . DC  I 5  81  ? 140.725 188.759 168.691 1.00 68.29  ? 7   DC  I "O5'" 1 
ATOM   7836  C  "C5'" . DC  I 5  81  ? 139.448 188.503 168.169 1.00 68.29  ? 7   DC  I "C5'" 1 
ATOM   7837  C  "C4'" . DC  I 5  81  ? 139.092 189.510 167.104 1.00 68.29  ? 7   DC  I "C4'" 1 
ATOM   7838  O  "O4'" . DC  I 5  81  ? 138.412 190.644 167.697 1.00 68.29  ? 7   DC  I "O4'" 1 
ATOM   7839  C  "C3'" . DC  I 5  81  ? 140.262 190.081 166.315 1.00 68.29  ? 7   DC  I "C3'" 1 
ATOM   7840  O  "O3'" . DC  I 5  81  ? 139.881 190.148 164.963 1.00 68.29  ? 7   DC  I "O3'" 1 
ATOM   7841  C  "C2'" . DC  I 5  81  ? 140.407 191.477 166.920 1.00 68.29  ? 7   DC  I "C2'" 1 
ATOM   7842  C  "C1'" . DC  I 5  81  ? 138.947 191.815 167.142 1.00 68.29  ? 7   DC  I "C1'" 1 
ATOM   7843  N  N1    . DC  I 5  81  ? 138.686 192.946 168.080 1.00 68.29  ? 7   DC  I N1    1 
ATOM   7844  C  C2    . DC  I 5  81  ? 137.466 193.619 168.007 1.00 68.29  ? 7   DC  I C2    1 
ATOM   7845  O  O2    . DC  I 5  81  ? 136.647 193.296 167.149 1.00 68.29  ? 7   DC  I O2    1 
ATOM   7846  N  N3    . DC  I 5  81  ? 137.222 194.641 168.853 1.00 68.29  ? 7   DC  I N3    1 
ATOM   7847  C  C4    . DC  I 5  81  ? 138.130 194.983 169.760 1.00 68.29  ? 7   DC  I C4    1 
ATOM   7848  N  N4    . DC  I 5  81  ? 137.837 195.999 170.580 1.00 68.29  ? 7   DC  I N4    1 
ATOM   7849  C  C5    . DC  I 5  81  ? 139.384 194.311 169.855 1.00 68.29  ? 7   DC  I C5    1 
ATOM   7850  C  C6    . DC  I 5  81  ? 139.617 193.304 169.003 1.00 68.29  ? 7   DC  I C6    1 
ATOM   7851  P  P     . DG  I 5  82  ? 140.825 189.562 163.809 1.00 60.89  ? 8   DG  I P     1 
ATOM   7852  O  OP1   . DG  I 5  82  ? 140.811 188.095 163.892 1.00 60.89  ? 8   DG  I OP1   1 
ATOM   7853  O  OP2   . DG  I 5  82  ? 142.098 190.308 163.824 1.00 60.89  ? 8   DG  I OP2   1 
ATOM   7854  O  "O5'" . DG  I 5  82  ? 140.051 189.937 162.475 1.00 60.89  ? 8   DG  I "O5'" 1 
ATOM   7855  C  "C5'" . DG  I 5  82  ? 138.677 189.645 162.364 1.00 60.89  ? 8   DG  I "C5'" 1 
ATOM   7856  C  "C4'" . DG  I 5  82  ? 137.920 190.766 161.665 1.00 60.89  ? 8   DG  I "C4'" 1 
ATOM   7857  O  "O4'" . DG  I 5  82  ? 137.682 191.850 162.587 1.00 60.89  ? 8   DG  I "O4'" 1 
ATOM   7858  C  "C3'" . DG  I 5  82  ? 138.595 191.390 160.448 1.00 60.89  ? 8   DG  I "C3'" 1 
ATOM   7859  O  "O3'" . DG  I 5  82  ? 137.594 191.693 159.485 1.00 60.89  ? 8   DG  I "O3'" 1 
ATOM   7860  C  "C2'" . DG  I 5  82  ? 139.232 192.659 161.018 1.00 60.89  ? 8   DG  I "C2'" 1 
ATOM   7861  C  "C1'" . DG  I 5  82  ? 138.223 193.053 162.082 1.00 60.89  ? 8   DG  I "C1'" 1 
ATOM   7862  N  N9    . DG  I 5  82  ? 138.793 193.758 163.213 1.00 60.89  ? 8   DG  I N9    1 
ATOM   7863  C  C8    . DG  I 5  82  ? 139.838 193.354 163.992 1.00 60.89  ? 8   DG  I C8    1 
ATOM   7864  N  N7    . DG  I 5  82  ? 140.107 194.177 164.961 1.00 60.89  ? 8   DG  I N7    1 
ATOM   7865  C  C5    . DG  I 5  82  ? 139.164 195.169 164.828 1.00 60.89  ? 8   DG  I C5    1 
ATOM   7866  C  C6    . DG  I 5  82  ? 138.962 196.325 165.588 1.00 60.89  ? 8   DG  I C6    1 
ATOM   7867  O  O6    . DG  I 5  82  ? 139.595 196.710 166.575 1.00 60.89  ? 8   DG  I O6    1 
ATOM   7868  N  N1    . DG  I 5  82  ? 137.906 197.076 165.108 1.00 60.89  ? 8   DG  I N1    1 
ATOM   7869  C  C2    . DG  I 5  82  ? 137.150 196.751 164.016 1.00 60.89  ? 8   DG  I C2    1 
ATOM   7870  N  N2    . DG  I 5  82  ? 136.160 197.591 163.707 1.00 60.89  ? 8   DG  I N2    1 
ATOM   7871  N  N3    . DG  I 5  82  ? 137.320 195.660 163.301 1.00 60.89  ? 8   DG  I N3    1 
ATOM   7872  C  C4    . DG  I 5  82  ? 138.346 194.923 163.758 1.00 60.89  ? 8   DG  I C4    1 
ATOM   7873  P  P     . DT  I 5  83  ? 137.968 192.283 158.042 1.00 62.82  ? 9   DT  I P     1 
ATOM   7874  O  OP1   . DT  I 5  83  ? 136.863 191.915 157.136 1.00 62.82  ? 9   DT  I OP1   1 
ATOM   7875  O  OP2   . DT  I 5  83  ? 139.357 191.906 157.718 1.00 62.82  ? 9   DT  I OP2   1 
ATOM   7876  O  "O5'" . DT  I 5  83  ? 137.903 193.857 158.260 1.00 62.82  ? 9   DT  I "O5'" 1 
ATOM   7877  C  "C5'" . DT  I 5  83  ? 136.769 194.424 158.867 1.00 62.82  ? 9   DT  I "C5'" 1 
ATOM   7878  C  "C4'" . DT  I 5  83  ? 136.650 195.894 158.526 1.00 62.82  ? 9   DT  I "C4'" 1 
ATOM   7879  O  "O4'" . DT  I 5  83  ? 137.041 196.689 159.661 1.00 62.82  ? 9   DT  I "O4'" 1 
ATOM   7880  C  "C3'" . DT  I 5  83  ? 137.498 196.369 157.359 1.00 62.82  ? 9   DT  I "C3'" 1 
ATOM   7881  O  "O3'" . DT  I 5  83  ? 136.748 197.275 156.603 1.00 62.82  ? 9   DT  I "O3'" 1 
ATOM   7882  C  "C2'" . DT  I 5  83  ? 138.679 197.047 158.041 1.00 62.82  ? 9   DT  I "C2'" 1 
ATOM   7883  C  "C1'" . DT  I 5  83  ? 138.034 197.608 159.292 1.00 62.82  ? 9   DT  I "C1'" 1 
ATOM   7884  N  N1    . DT  I 5  83  ? 138.947 197.687 160.409 1.00 62.82  ? 9   DT  I N1    1 
ATOM   7885  C  C2    . DT  I 5  83  ? 138.878 198.751 161.261 1.00 62.82  ? 9   DT  I C2    1 
ATOM   7886  O  O2    . DT  I 5  83  ? 138.098 199.668 161.122 1.00 62.82  ? 9   DT  I O2    1 
ATOM   7887  N  N3    . DT  I 5  83  ? 139.772 198.707 162.288 1.00 62.82  ? 9   DT  I N3    1 
ATOM   7888  C  C4    . DT  I 5  83  ? 140.696 197.720 162.540 1.00 62.82  ? 9   DT  I C4    1 
ATOM   7889  O  O4    . DT  I 5  83  ? 141.463 197.764 163.488 1.00 62.82  ? 9   DT  I O4    1 
ATOM   7890  C  C5    . DT  I 5  83  ? 140.702 196.633 161.607 1.00 62.82  ? 9   DT  I C5    1 
ATOM   7891  C  C7    . DT  I 5  83  ? 141.666 195.502 161.778 1.00 62.82  ? 9   DT  I C7    1 
ATOM   7892  C  C6    . DT  I 5  83  ? 139.834 196.666 160.605 1.00 62.82  ? 9   DT  I C6    1 
ATOM   7893  P  P     . DG  I 5  84  ? 137.363 197.949 155.287 1.00 68.40  ? 10  DG  I P     1 
ATOM   7894  O  OP1   . DG  I 5  84  ? 136.220 198.289 154.422 1.00 68.40  ? 10  DG  I OP1   1 
ATOM   7895  O  OP2   . DG  I 5  84  ? 138.489 197.137 154.779 1.00 68.40  ? 10  DG  I OP2   1 
ATOM   7896  O  "O5'" . DG  I 5  84  ? 137.911 199.334 155.819 1.00 68.40  ? 10  DG  I "O5'" 1 
ATOM   7897  C  "C5'" . DG  I 5  84  ? 137.030 200.183 156.475 1.00 68.40  ? 10  DG  I "C5'" 1 
ATOM   7898  C  "C4'" . DG  I 5  84  ? 137.738 201.419 156.942 1.00 68.40  ? 10  DG  I "C4'" 1 
ATOM   7899  O  "O4'" . DG  I 5  84  ? 138.427 201.142 158.186 1.00 68.40  ? 10  DG  I "O4'" 1 
ATOM   7900  C  "C3'" . DG  I 5  84  ? 138.789 201.960 155.975 1.00 68.40  ? 10  DG  I "C3'" 1 
ATOM   7901  O  "O3'" . DG  I 5  84  ? 138.582 203.347 155.813 1.00 68.40  ? 10  DG  I "O3'" 1 
ATOM   7902  C  "C2'" . DG  I 5  84  ? 140.098 201.661 156.698 1.00 68.40  ? 10  DG  I "C2'" 1 
ATOM   7903  C  "C1'" . DG  I 5  84  ? 139.669 201.777 158.143 1.00 68.40  ? 10  DG  I "C1'" 1 
ATOM   7904  N  N9    . DG  I 5  84  ? 140.575 201.105 159.050 1.00 68.40  ? 10  DG  I N9    1 
ATOM   7905  C  C8    . DG  I 5  84  ? 141.140 199.876 158.868 1.00 68.40  ? 10  DG  I C8    1 
ATOM   7906  N  N7    . DG  I 5  84  ? 141.927 199.523 159.835 1.00 68.40  ? 10  DG  I N7    1 
ATOM   7907  C  C5    . DG  I 5  84  ? 141.887 200.589 160.708 1.00 68.40  ? 10  DG  I C5    1 
ATOM   7908  C  C6    . DG  I 5  84  ? 142.545 200.762 161.933 1.00 68.40  ? 10  DG  I C6    1 
ATOM   7909  O  O6    . DG  I 5  84  ? 143.303 199.976 162.493 1.00 68.40  ? 10  DG  I O6    1 
ATOM   7910  N  N1    . DG  I 5  84  ? 142.248 201.982 162.514 1.00 68.40  ? 10  DG  I N1    1 
ATOM   7911  C  C2    . DG  I 5  84  ? 141.407 202.919 161.978 1.00 68.40  ? 10  DG  I C2    1 
ATOM   7912  N  N2    . DG  I 5  84  ? 141.239 204.039 162.695 1.00 68.40  ? 10  DG  I N2    1 
ATOM   7913  N  N3    . DG  I 5  84  ? 140.775 202.769 160.817 1.00 68.40  ? 10  DG  I N3    1 
ATOM   7914  C  C4    . DG  I 5  84  ? 141.064 201.575 160.242 1.00 68.40  ? 10  DG  I C4    1 
ATOM   7915  P  P     . DC  I 5  85  ? 139.427 204.232 154.773 1.00 70.25  ? 11  DC  I P     1 
ATOM   7916  O  OP1   . DC  I 5  85  ? 138.421 204.934 153.957 1.00 70.25  ? 11  DC  I OP1   1 
ATOM   7917  O  OP2   . DC  I 5  85  ? 140.478 203.455 154.084 1.00 70.25  ? 11  DC  I OP2   1 
ATOM   7918  O  "O5'" . DC  I 5  85  ? 140.128 205.302 155.719 1.00 70.25  ? 11  DC  I "O5'" 1 
ATOM   7919  C  "C5'" . DC  I 5  85  ? 139.320 206.085 156.572 1.00 70.25  ? 11  DC  I "C5'" 1 
ATOM   7920  C  "C4'" . DC  I 5  85  ? 140.130 206.705 157.690 1.00 70.25  ? 11  DC  I "C4'" 1 
ATOM   7921  O  "O4'" . DC  I 5  85  ? 140.765 205.666 158.478 1.00 70.25  ? 11  DC  I "O4'" 1 
ATOM   7922  C  "C3'" . DC  I 5  85  ? 141.249 207.645 157.249 1.00 70.25  ? 11  DC  I "C3'" 1 
ATOM   7923  O  "O3'" . DC  I 5  85  ? 141.268 208.786 158.102 1.00 70.25  ? 11  DC  I "O3'" 1 
ATOM   7924  C  "C2'" . DC  I 5  85  ? 142.500 206.791 157.432 1.00 70.25  ? 11  DC  I "C2'" 1 
ATOM   7925  C  "C1'" . DC  I 5  85  ? 142.124 205.984 158.659 1.00 70.25  ? 11  DC  I "C1'" 1 
ATOM   7926  N  N1    . DC  I 5  85  ? 142.869 204.717 158.789 1.00 70.25  ? 11  DC  I N1    1 
ATOM   7927  C  C2    . DC  I 5  85  ? 143.697 204.489 159.898 1.00 70.25  ? 11  DC  I C2    1 
ATOM   7928  O  O2    . DC  I 5  85  ? 143.814 205.359 160.761 1.00 70.25  ? 11  DC  I O2    1 
ATOM   7929  N  N3    . DC  I 5  85  ? 144.353 203.311 159.988 1.00 70.25  ? 11  DC  I N3    1 
ATOM   7930  C  C4    . DC  I 5  85  ? 144.199 202.393 159.038 1.00 70.25  ? 11  DC  I C4    1 
ATOM   7931  N  N4    . DC  I 5  85  ? 144.868 201.245 159.159 1.00 70.25  ? 11  DC  I N4    1 
ATOM   7932  C  C5    . DC  I 5  85  ? 143.363 202.608 157.912 1.00 70.25  ? 11  DC  I C5    1 
ATOM   7933  C  C6    . DC  I 5  85  ? 142.725 203.771 157.832 1.00 70.25  ? 11  DC  I C6    1 
ATOM   7934  P  P     . DG  I 5  86  ? 141.876 210.184 157.594 1.00 76.60  ? 12  DG  I P     1 
ATOM   7935  O  OP1   . DG  I 5  86  ? 141.055 211.256 158.189 1.00 76.60  ? 12  DG  I OP1   1 
ATOM   7936  O  OP2   . DG  I 5  86  ? 142.023 210.114 156.128 1.00 76.60  ? 12  DG  I OP2   1 
ATOM   7937  O  "O5'" . DG  I 5  86  ? 143.330 210.226 158.252 1.00 76.60  ? 12  DG  I "O5'" 1 
ATOM   7938  C  "C5'" . DG  I 5  86  ? 143.769 211.397 158.919 1.00 76.60  ? 12  DG  I "C5'" 1 
ATOM   7939  C  "C4'" . DG  I 5  86  ? 144.766 211.057 160.012 1.00 76.60  ? 12  DG  I "C4'" 1 
ATOM   7940  O  "O4'" . DG  I 5  86  ? 144.836 209.619 160.166 1.00 76.60  ? 12  DG  I "O4'" 1 
ATOM   7941  C  "C3'" . DG  I 5  86  ? 146.199 211.526 159.751 1.00 76.60  ? 12  DG  I "C3'" 1 
ATOM   7942  O  "O3'" . DG  I 5  86  ? 146.754 212.089 160.930 1.00 76.60  ? 12  DG  I "O3'" 1 
ATOM   7943  C  "C2'" . DG  I 5  86  ? 146.912 210.246 159.365 1.00 76.60  ? 12  DG  I "C2'" 1 
ATOM   7944  C  "C1'" . DG  I 5  86  ? 146.180 209.227 160.208 1.00 76.60  ? 12  DG  I "C1'" 1 
ATOM   7945  N  N9    . DG  I 5  86  ? 146.279 207.872 159.687 1.00 76.60  ? 12  DG  I N9    1 
ATOM   7946  C  C8    . DG  I 5  86  ? 145.705 207.394 158.540 1.00 76.60  ? 12  DG  I C8    1 
ATOM   7947  N  N7    . DG  I 5  86  ? 145.960 206.135 158.320 1.00 76.60  ? 12  DG  I N7    1 
ATOM   7948  C  C5    . DG  I 5  86  ? 146.759 205.756 159.391 1.00 76.60  ? 12  DG  I C5    1 
ATOM   7949  C  C6    . DG  I 5  86  ? 147.343 204.504 159.689 1.00 76.60  ? 12  DG  I C6    1 
ATOM   7950  O  O6    . DG  I 5  86  ? 147.267 203.458 159.044 1.00 76.60  ? 12  DG  I O6    1 
ATOM   7951  N  N1    . DG  I 5  86  ? 148.079 204.543 160.866 1.00 76.60  ? 12  DG  I N1    1 
ATOM   7952  C  C2    . DG  I 5  86  ? 148.227 205.653 161.662 1.00 76.60  ? 12  DG  I C2    1 
ATOM   7953  N  N2    . DG  I 5  86  ? 148.973 205.501 162.767 1.00 76.60  ? 12  DG  I N2    1 
ATOM   7954  N  N3    . DG  I 5  86  ? 147.685 206.835 161.392 1.00 76.60  ? 12  DG  I N3    1 
ATOM   7955  C  C4    . DG  I 5  86  ? 146.961 206.810 160.245 1.00 76.60  ? 12  DG  I C4    1 
ATOM   7956  P  P     . DT  I 5  87  ? 148.221 212.750 160.904 1.00 81.88  ? 13  DT  I P     1 
ATOM   7957  O  OP1   . DT  I 5  87  ? 148.235 213.837 161.903 1.00 81.88  ? 13  DT  I OP1   1 
ATOM   7958  O  OP2   . DT  I 5  87  ? 148.616 213.034 159.509 1.00 81.88  ? 13  DT  I OP2   1 
ATOM   7959  O  "O5'" . DT  I 5  87  ? 149.171 211.591 161.439 1.00 81.88  ? 13  DT  I "O5'" 1 
ATOM   7960  C  "C5'" . DT  I 5  87  ? 149.080 211.178 162.789 1.00 81.88  ? 13  DT  I "C5'" 1 
ATOM   7961  C  "C4'" . DT  I 5  87  ? 150.262 210.307 163.169 1.00 81.88  ? 13  DT  I "C4'" 1 
ATOM   7962  O  "O4'" . DT  I 5  87  ? 150.122 208.991 162.575 1.00 81.88  ? 13  DT  I "O4'" 1 
ATOM   7963  C  "C3'" . DT  I 5  87  ? 151.624 210.831 162.728 1.00 81.88  ? 13  DT  I "C3'" 1 
ATOM   7964  O  "O3'" . DT  I 5  87  ? 152.531 210.690 163.808 1.00 81.88  ? 13  DT  I "O3'" 1 
ATOM   7965  C  "C2'" . DT  I 5  87  ? 151.984 209.928 161.538 1.00 81.88  ? 13  DT  I "C2'" 1 
ATOM   7966  C  "C1'" . DT  I 5  87  ? 151.322 208.624 161.936 1.00 81.88  ? 13  DT  I "C1'" 1 
ATOM   7967  N  N1    . DT  I 5  87  ? 150.966 207.720 160.809 1.00 81.88  ? 13  DT  I N1    1 
ATOM   7968  C  C2    . DT  I 5  87  ? 151.345 206.406 160.876 1.00 81.88  ? 13  DT  I C2    1 
ATOM   7969  O  O2    . DT  I 5  87  ? 151.983 205.946 161.802 1.00 81.88  ? 13  DT  I O2    1 
ATOM   7970  N  N3    . DT  I 5  87  ? 150.932 205.635 159.826 1.00 81.88  ? 13  DT  I N3    1 
ATOM   7971  C  C4    . DT  I 5  87  ? 150.196 206.042 158.736 1.00 81.88  ? 13  DT  I C4    1 
ATOM   7972  O  O4    . DT  I 5  87  ? 149.880 205.285 157.833 1.00 81.88  ? 13  DT  I O4    1 
ATOM   7973  C  C5    . DT  I 5  87  ? 149.832 207.422 158.725 1.00 81.88  ? 13  DT  I C5    1 
ATOM   7974  C  C7    . DT  I 5  87  ? 149.041 207.953 157.575 1.00 81.88  ? 13  DT  I C7    1 
ATOM   7975  C  C6    . DT  I 5  87  ? 150.212 208.192 159.757 1.00 81.88  ? 13  DT  I C6    1 
ATOM   7976  P  P     . DT  I 5  88  ? 154.060 211.149 163.674 1.00 84.35  ? 14  DT  I P     1 
ATOM   7977  O  OP1   . DT  I 5  88  ? 154.479 211.615 165.010 1.00 84.35  ? 14  DT  I OP1   1 
ATOM   7978  O  OP2   . DT  I 5  88  ? 154.230 212.047 162.510 1.00 84.35  ? 14  DT  I OP2   1 
ATOM   7979  O  "O5'" . DT  I 5  88  ? 154.821 209.785 163.377 1.00 84.35  ? 14  DT  I "O5'" 1 
ATOM   7980  C  "C5'" . DT  I 5  88  ? 154.899 208.779 164.385 1.00 84.35  ? 14  DT  I "C5'" 1 
ATOM   7981  C  "C4'" . DT  I 5  88  ? 155.610 207.520 163.892 1.00 84.35  ? 14  DT  I "C4'" 1 
ATOM   7982  O  "O4'" . DT  I 5  88  ? 154.873 206.912 162.801 1.00 84.35  ? 14  DT  I "O4'" 1 
ATOM   7983  C  "C3'" . DT  I 5  88  ? 157.033 207.713 163.353 1.00 84.35  ? 14  DT  I "C3'" 1 
ATOM   7984  O  "O3'" . DT  I 5  88  ? 157.770 206.538 163.574 1.00 84.35  ? 14  DT  I "O3'" 1 
ATOM   7985  C  "C2'" . DT  I 5  88  ? 156.762 207.831 161.870 1.00 84.35  ? 14  DT  I "C2'" 1 
ATOM   7986  C  "C1'" . DT  I 5  88  ? 155.771 206.695 161.741 1.00 84.35  ? 14  DT  I "C1'" 1 
ATOM   7987  N  N1    . DT  I 5  88  ? 155.004 206.646 160.477 1.00 84.35  ? 14  DT  I N1    1 
ATOM   7988  C  C2    . DT  I 5  88  ? 154.759 205.427 159.906 1.00 84.35  ? 14  DT  I C2    1 
ATOM   7989  O  O2    . DT  I 5  88  ? 155.169 204.383 160.370 1.00 84.35  ? 14  DT  I O2    1 
ATOM   7990  N  N3    . DT  I 5  88  ? 154.022 205.468 158.761 1.00 84.35  ? 14  DT  I N3    1 
ATOM   7991  C  C4    . DT  I 5  88  ? 153.509 206.584 158.145 1.00 84.35  ? 14  DT  I C4    1 
ATOM   7992  O  O4    . DT  I 5  88  ? 152.857 206.520 157.112 1.00 84.35  ? 14  DT  I O4    1 
ATOM   7993  C  C5    . DT  I 5  88  ? 153.788 207.834 158.798 1.00 84.35  ? 14  DT  I C5    1 
ATOM   7994  C  C7    . DT  I 5  88  ? 153.285 209.114 158.209 1.00 84.35  ? 14  DT  I C7    1 
ATOM   7995  C  C6    . DT  I 5  88  ? 154.510 207.806 159.926 1.00 84.35  ? 14  DT  I C6    1 
ATOM   7996  P  P     . DT  I 5  89  ? 158.591 206.268 164.928 1.00 82.82  ? 15  DT  I P     1 
ATOM   7997  O  OP1   . DT  I 5  89  ? 157.741 206.465 166.120 1.00 82.82  ? 15  DT  I OP1   1 
ATOM   7998  O  OP2   . DT  I 5  89  ? 159.868 206.997 164.813 1.00 82.82  ? 15  DT  I OP2   1 
ATOM   7999  O  "O5'" . DT  I 5  89  ? 158.904 204.710 164.808 1.00 82.82  ? 15  DT  I "O5'" 1 
ATOM   8000  C  "C5'" . DT  I 5  89  ? 158.135 203.911 163.904 1.00 82.82  ? 15  DT  I "C5'" 1 
ATOM   8001  C  "C4'" . DT  I 5  89  ? 159.001 203.378 162.776 1.00 82.82  ? 15  DT  I "C4'" 1 
ATOM   8002  O  "O4'" . DT  I 5  89  ? 158.315 203.516 161.498 1.00 82.82  ? 15  DT  I "O4'" 1 
ATOM   8003  C  "C3'" . DT  I 5  89  ? 160.343 204.095 162.609 1.00 82.82  ? 15  DT  I "C3'" 1 
ATOM   8004  O  "O3'" . DT  I 5  89  ? 161.362 203.154 162.354 1.00 82.82  ? 15  DT  I "O3'" 1 
ATOM   8005  C  "C2'" . DT  I 5  89  ? 160.095 204.981 161.390 1.00 82.82  ? 15  DT  I "C2'" 1 
ATOM   8006  C  "C1'" . DT  I 5  89  ? 159.219 204.060 160.563 1.00 82.82  ? 15  DT  I "C1'" 1 
ATOM   8007  N  N1    . DT  I 5  89  ? 158.446 204.740 159.479 1.00 82.82  ? 15  DT  I N1    1 
ATOM   8008  C  C2    . DT  I 5  89  ? 157.748 203.978 158.580 1.00 82.82  ? 15  DT  I C2    1 
ATOM   8009  O  O2    . DT  I 5  89  ? 157.737 202.770 158.604 1.00 82.82  ? 15  DT  I O2    1 
ATOM   8010  N  N3    . DT  I 5  89  ? 157.066 204.689 157.635 1.00 82.82  ? 15  DT  I N3    1 
ATOM   8011  C  C4    . DT  I 5  89  ? 157.011 206.062 157.502 1.00 82.82  ? 15  DT  I C4    1 
ATOM   8012  O  O4    . DT  I 5  89  ? 156.366 206.614 156.625 1.00 82.82  ? 15  DT  I O4    1 
ATOM   8013  C  C5    . DT  I 5  89  ? 157.758 206.803 158.475 1.00 82.82  ? 15  DT  I C5    1 
ATOM   8014  C  C7    . DT  I 5  89  ? 157.774 208.305 158.421 1.00 82.82  ? 15  DT  I C7    1 
ATOM   8015  C  C6    . DT  I 5  89  ? 158.449 206.112 159.394 1.00 82.82  ? 15  DT  I C6    1 
ATOM   8016  P  P     . DA  I 5  90  ? 161.870 202.144 163.494 1.00 75.58  ? 16  DA  I P     1 
ATOM   8017  O  OP1   . DA  I 5  90  ? 161.420 202.599 164.826 1.00 75.58  ? 16  DA  I OP1   1 
ATOM   8018  O  OP2   . DA  I 5  90  ? 163.311 201.933 163.255 1.00 75.58  ? 16  DA  I OP2   1 
ATOM   8019  O  "O5'" . DA  I 5  90  ? 161.152 200.775 163.115 1.00 75.58  ? 16  DA  I "O5'" 1 
ATOM   8020  C  "C5'" . DA  I 5  90  ? 161.934 199.658 162.750 1.00 75.58  ? 16  DA  I "C5'" 1 
ATOM   8021  C  "C4'" . DA  I 5  90  ? 162.038 199.527 161.243 1.00 75.58  ? 16  DA  I "C4'" 1 
ATOM   8022  O  "O4'" . DA  I 5  90  ? 161.582 200.742 160.592 1.00 75.58  ? 16  DA  I "O4'" 1 
ATOM   8023  C  "C3'" . DA  I 5  90  ? 163.453 199.277 160.716 1.00 75.58  ? 16  DA  I "C3'" 1 
ATOM   8024  O  "O3'" . DA  I 5  90  ? 163.417 198.277 159.723 1.00 75.58  ? 16  DA  I "O3'" 1 
ATOM   8025  C  "C2'" . DA  I 5  90  ? 163.829 200.628 160.112 1.00 75.58  ? 16  DA  I "C2'" 1 
ATOM   8026  C  "C1'" . DA  I 5  90  ? 162.486 201.046 159.563 1.00 75.58  ? 16  DA  I "C1'" 1 
ATOM   8027  N  N9    . DA  I 5  90  ? 162.376 202.458 159.227 1.00 75.58  ? 16  DA  I N9    1 
ATOM   8028  C  C8    . DA  I 5  90  ? 162.989 203.504 159.844 1.00 75.58  ? 16  DA  I C8    1 
ATOM   8029  N  N7    . DA  I 5  90  ? 162.689 204.667 159.330 1.00 75.58  ? 16  DA  I N7    1 
ATOM   8030  C  C5    . DA  I 5  90  ? 161.835 204.359 158.298 1.00 75.58  ? 16  DA  I C5    1 
ATOM   8031  C  C6    . DA  I 5  90  ? 161.159 205.156 157.368 1.00 75.58  ? 16  DA  I C6    1 
ATOM   8032  N  N6    . DA  I 5  90  ? 161.269 206.482 157.333 1.00 75.58  ? 16  DA  I N6    1 
ATOM   8033  N  N1    . DA  I 5  90  ? 160.377 204.538 156.460 1.00 75.58  ? 16  DA  I N1    1 
ATOM   8034  C  C2    . DA  I 5  90  ? 160.275 203.209 156.509 1.00 75.58  ? 16  DA  I C2    1 
ATOM   8035  N  N3    . DA  I 5  90  ? 160.860 202.355 157.341 1.00 75.58  ? 16  DA  I N3    1 
ATOM   8036  C  C4    . DA  I 5  90  ? 161.628 203.003 158.222 1.00 75.58  ? 16  DA  I C4    1 
ATOM   8037  P  P     . DA  I 5  91  ? 163.790 196.756 160.073 1.00 71.50  ? 17  DA  I P     1 
ATOM   8038  O  OP1   . DA  I 5  91  ? 163.137 196.405 161.352 1.00 71.50  ? 17  DA  I OP1   1 
ATOM   8039  O  OP2   . DA  I 5  91  ? 165.254 196.606 159.946 1.00 71.50  ? 17  DA  I OP2   1 
ATOM   8040  O  "O5'" . DA  I 5  91  ? 163.117 195.934 158.880 1.00 71.50  ? 17  DA  I "O5'" 1 
ATOM   8041  C  "C5'" . DA  I 5  91  ? 161.797 196.255 158.464 1.00 71.50  ? 17  DA  I "C5'" 1 
ATOM   8042  C  "C4'" . DA  I 5  91  ? 161.575 195.995 156.979 1.00 71.50  ? 17  DA  I "C4'" 1 
ATOM   8043  O  "O4'" . DA  I 5  91  ? 161.473 197.253 156.272 1.00 71.50  ? 17  DA  I "O4'" 1 
ATOM   8044  C  "C3'" . DA  I 5  91  ? 162.648 195.210 156.249 1.00 71.50  ? 17  DA  I "C3'" 1 
ATOM   8045  O  "O3'" . DA  I 5  91  ? 162.040 194.497 155.168 1.00 71.50  ? 17  DA  I "O3'" 1 
ATOM   8046  C  "C2'" . DA  I 5  91  ? 163.572 196.316 155.742 1.00 71.50  ? 17  DA  I "C2'" 1 
ATOM   8047  C  "C1'" . DA  I 5  91  ? 162.593 197.439 155.424 1.00 71.50  ? 17  DA  I "C1'" 1 
ATOM   8048  N  N9    . DA  I 5  91  ? 163.122 198.779 155.682 1.00 71.50  ? 17  DA  I N9    1 
ATOM   8049  C  C8    . DA  I 5  91  ? 163.800 199.181 156.788 1.00 71.50  ? 17  DA  I C8    1 
ATOM   8050  N  N7    . DA  I 5  91  ? 164.141 200.441 156.772 1.00 71.50  ? 17  DA  I N7    1 
ATOM   8051  C  C5    . DA  I 5  91  ? 163.631 200.911 155.589 1.00 71.50  ? 17  DA  I C5    1 
ATOM   8052  C  C6    . DA  I 5  91  ? 163.654 202.180 154.998 1.00 71.50  ? 17  DA  I C6    1 
ATOM   8053  N  N6    . DA  I 5  91  ? 164.237 203.232 155.566 1.00 71.50  ? 17  DA  I N6    1 
ATOM   8054  N  N1    . DA  I 5  91  ? 163.071 202.326 153.793 1.00 71.50  ? 17  DA  I N1    1 
ATOM   8055  C  C2    . DA  I 5  91  ? 162.488 201.259 153.238 1.00 71.50  ? 17  DA  I C2    1 
ATOM   8056  N  N3    . DA  I 5  91  ? 162.406 200.011 153.703 1.00 71.50  ? 17  DA  I N3    1 
ATOM   8057  C  C4    . DA  I 5  91  ? 162.995 199.907 154.897 1.00 71.50  ? 17  DA  I C4    1 
ATOM   8058  P  P     . DG  I 5  92  ? 162.910 193.585 154.167 1.00 74.64  ? 18  DG  I P     1 
ATOM   8059  O  OP1   . DG  I 5  92  ? 162.045 192.471 153.726 1.00 74.64  ? 18  DG  I OP1   1 
ATOM   8060  O  OP2   . DG  I 5  92  ? 164.219 193.270 154.770 1.00 74.64  ? 18  DG  I OP2   1 
ATOM   8061  O  "O5'" . DG  I 5  92  ? 163.120 194.519 152.898 1.00 74.64  ? 18  DG  I "O5'" 1 
ATOM   8062  C  "C5'" . DG  I 5  92  ? 162.052 194.699 152.007 1.00 74.64  ? 18  DG  I "C5'" 1 
ATOM   8063  C  "C4'" . DG  I 5  92  ? 162.424 195.642 150.884 1.00 74.64  ? 18  DG  I "C4'" 1 
ATOM   8064  O  "O4'" . DG  I 5  92  ? 162.799 196.934 151.423 1.00 74.64  ? 18  DG  I "O4'" 1 
ATOM   8065  C  "C3'" . DG  I 5  92  ? 163.579 195.183 150.010 1.00 74.64  ? 18  DG  I "C3'" 1 
ATOM   8066  O  "O3'" . DG  I 5  92  ? 163.210 195.324 148.654 1.00 74.64  ? 18  DG  I "O3'" 1 
ATOM   8067  C  "C2'" . DG  I 5  92  ? 164.725 196.124 150.400 1.00 74.64  ? 18  DG  I "C2'" 1 
ATOM   8068  C  "C1'" . DG  I 5  92  ? 163.981 197.385 150.809 1.00 74.64  ? 18  DG  I "C1'" 1 
ATOM   8069  N  N9    . DG  I 5  92  ? 164.686 198.203 151.788 1.00 74.64  ? 18  DG  I N9    1 
ATOM   8070  C  C8    . DG  I 5  92  ? 165.095 197.810 153.028 1.00 74.64  ? 18  DG  I C8    1 
ATOM   8071  N  N7    . DG  I 5  92  ? 165.676 198.747 153.714 1.00 74.64  ? 18  DG  I N7    1 
ATOM   8072  C  C5    . DG  I 5  92  ? 165.644 199.842 152.877 1.00 74.64  ? 18  DG  I C5    1 
ATOM   8073  C  C6    . DG  I 5  92  ? 166.141 201.145 153.082 1.00 74.64  ? 18  DG  I C6    1 
ATOM   8074  O  O6    . DG  I 5  92  ? 166.711 201.595 154.083 1.00 74.64  ? 18  DG  I O6    1 
ATOM   8075  N  N1    . DG  I 5  92  ? 165.915 201.963 151.980 1.00 74.64  ? 18  DG  I N1    1 
ATOM   8076  C  C2    . DG  I 5  92  ? 165.293 201.560 150.818 1.00 74.64  ? 18  DG  I C2    1 
ATOM   8077  N  N2    . DG  I 5  92  ? 165.168 202.487 149.856 1.00 74.64  ? 18  DG  I N2    1 
ATOM   8078  N  N3    . DG  I 5  92  ? 164.827 200.330 150.615 1.00 74.64  ? 18  DG  I N3    1 
ATOM   8079  C  C4    . DG  I 5  92  ? 165.030 199.532 151.687 1.00 74.64  ? 18  DG  I C4    1 
ATOM   8080  P  P     . DC  I 5  93  ? 164.153 194.762 147.488 1.00 80.08  ? 19  DC  I P     1 
ATOM   8081  O  OP1   . DC  I 5  93  ? 163.273 194.321 146.386 1.00 80.08  ? 19  DC  I OP1   1 
ATOM   8082  O  OP2   . DC  I 5  93  ? 165.103 193.799 148.084 1.00 80.08  ? 19  DC  I OP2   1 
ATOM   8083  O  "O5'" . DC  I 5  93  ? 164.961 196.056 147.019 1.00 80.08  ? 19  DC  I "O5'" 1 
ATOM   8084  C  "C5'" . DC  I 5  93  ? 164.276 197.293 146.880 1.00 80.08  ? 19  DC  I "C5'" 1 
ATOM   8085  C  "C4'" . DC  I 5  93  ? 165.231 198.443 146.598 1.00 80.08  ? 19  DC  I "C4'" 1 
ATOM   8086  O  "O4'" . DC  I 5  93  ? 165.706 199.030 147.841 1.00 80.08  ? 19  DC  I "O4'" 1 
ATOM   8087  C  "C3'" . DC  I 5  93  ? 166.489 198.086 145.809 1.00 80.08  ? 19  DC  I "C3'" 1 
ATOM   8088  O  "O3'" . DC  I 5  93  ? 166.760 199.126 144.917 1.00 80.08  ? 19  DC  I "O3'" 1 
ATOM   8089  C  "C2'" . DC  I 5  93  ? 167.551 198.037 146.901 1.00 80.08  ? 19  DC  I "C2'" 1 
ATOM   8090  C  "C1'" . DC  I 5  93  ? 167.094 199.210 147.732 1.00 80.08  ? 19  DC  I "C1'" 1 
ATOM   8091  N  N1    . DC  I 5  93  ? 167.654 199.266 149.078 1.00 80.08  ? 19  DC  I N1    1 
ATOM   8092  C  C2    . DC  I 5  93  ? 168.226 200.451 149.526 1.00 80.08  ? 19  DC  I C2    1 
ATOM   8093  O  O2    . DC  I 5  93  ? 168.264 201.422 148.764 1.00 80.08  ? 19  DC  I O2    1 
ATOM   8094  N  N3    . DC  I 5  93  ? 168.723 200.507 150.779 1.00 80.08  ? 19  DC  I N3    1 
ATOM   8095  C  C4    . DC  I 5  93  ? 168.659 199.436 151.564 1.00 80.08  ? 19  DC  I C4    1 
ATOM   8096  N  N4    . DC  I 5  93  ? 169.157 199.539 152.800 1.00 80.08  ? 19  DC  I N4    1 
ATOM   8097  C  C5    . DC  I 5  93  ? 168.076 198.215 151.121 1.00 80.08  ? 19  DC  I C5    1 
ATOM   8098  C  C6    . DC  I 5  93  ? 167.587 198.179 149.883 1.00 80.08  ? 19  DC  I C6    1 
ATOM   8099  P  P     . DG  I 5  94  ? 166.838 198.840 143.347 1.00 86.67  ? 20  DG  I P     1 
ATOM   8100  O  OP1   . DG  I 5  94  ? 165.528 199.218 142.771 1.00 86.67  ? 20  DG  I OP1   1 
ATOM   8101  O  OP2   . DG  I 5  94  ? 167.363 197.466 143.183 1.00 86.67  ? 20  DG  I OP2   1 
ATOM   8102  O  "O5'" . DG  I 5  94  ? 167.962 199.860 142.842 1.00 86.67  ? 20  DG  I "O5'" 1 
ATOM   8103  C  "C5'" . DG  I 5  94  ? 168.427 200.885 143.710 1.00 86.67  ? 20  DG  I "C5'" 1 
ATOM   8104  C  "C4'" . DG  I 5  94  ? 169.902 200.706 144.017 1.00 86.67  ? 20  DG  I "C4'" 1 
ATOM   8105  O  "O4'" . DG  I 5  94  ? 170.109 200.787 145.434 1.00 86.67  ? 20  DG  I "O4'" 1 
ATOM   8106  C  "C3'" . DG  I 5  94  ? 170.473 199.345 143.637 1.00 86.67  ? 20  DG  I "C3'" 1 
ATOM   8107  O  "O3'" . DG  I 5  94  ? 171.072 199.319 142.300 1.00 86.67  ? 20  DG  I "O3'" 1 
ATOM   8108  C  "C2'" . DG  I 5  94  ? 171.480 199.019 144.747 1.00 86.67  ? 20  DG  I "C2'" 1 
ATOM   8109  C  "C1'" . DG  I 5  94  ? 171.341 200.191 145.714 1.00 86.67  ? 20  DG  I "C1'" 1 
ATOM   8110  N  N9    . DG  I 5  94  ? 171.366 199.743 147.088 1.00 86.67  ? 20  DG  I N9    1 
ATOM   8111  C  C8    . DG  I 5  94  ? 170.884 198.554 147.554 1.00 86.67  ? 20  DG  I C8    1 
ATOM   8112  N  N7    . DG  I 5  94  ? 171.056 198.384 148.826 1.00 86.67  ? 20  DG  I N7    1 
ATOM   8113  C  C5    . DG  I 5  94  ? 171.727 199.524 149.228 1.00 86.67  ? 20  DG  I C5    1 
ATOM   8114  C  C6    . DG  I 5  94  ? 172.178 199.892 150.501 1.00 86.67  ? 20  DG  I C6    1 
ATOM   8115  O  O6    . DG  I 5  94  ? 172.083 199.254 151.554 1.00 86.67  ? 20  DG  I O6    1 
ATOM   8116  N  N1    . DG  I 5  94  ? 172.817 201.119 150.482 1.00 86.67  ? 20  DG  I N1    1 
ATOM   8117  C  C2    . DG  I 5  94  ? 172.980 201.909 149.373 1.00 86.67  ? 20  DG  I C2    1 
ATOM   8118  N  N2    . DG  I 5  94  ? 173.615 203.070 149.565 1.00 86.67  ? 20  DG  I N2    1 
ATOM   8119  N  N3    . DG  I 5  94  ? 172.554 201.578 148.163 1.00 86.67  ? 20  DG  I N3    1 
ATOM   8120  C  C4    . DG  I 5  94  ? 171.936 200.372 148.168 1.00 86.67  ? 20  DG  I C4    1 
ATOM   8121  P  P     . DG  I 5  95  ? 171.959 200.508 141.658 1.00 87.78  ? 21  DG  I P     1 
ATOM   8122  O  OP1   . DG  I 5  95  ? 171.090 201.594 141.161 1.00 87.78  ? 21  DG  I OP1   1 
ATOM   8123  O  OP2   . DG  I 5  95  ? 172.813 199.812 140.677 1.00 87.78  ? 21  DG  I OP2   1 
ATOM   8124  O  "O5'" . DG  I 5  95  ? 172.967 201.016 142.797 1.00 87.78  ? 21  DG  I "O5'" 1 
ATOM   8125  C  "C5'" . DG  I 5  95  ? 174.347 201.213 142.475 1.00 87.78  ? 21  DG  I "C5'" 1 
ATOM   8126  C  "C4'" . DG  I 5  95  ? 175.117 201.828 143.632 1.00 87.78  ? 21  DG  I "C4'" 1 
ATOM   8127  O  "O4'" . DG  I 5  95  ? 174.582 201.340 144.884 1.00 87.78  ? 21  DG  I "O4'" 1 
ATOM   8128  C  "C3'" . DG  I 5  95  ? 176.615 201.494 143.643 1.00 87.78  ? 21  DG  I "C3'" 1 
ATOM   8129  O  "O3'" . DG  I 5  95  ? 177.402 202.671 143.585 1.00 87.78  ? 21  DG  I "O3'" 1 
ATOM   8130  C  "C2'" . DG  I 5  95  ? 176.833 200.740 144.953 1.00 87.78  ? 21  DG  I "C2'" 1 
ATOM   8131  C  "C1'" . DG  I 5  95  ? 175.637 201.150 145.791 1.00 87.78  ? 21  DG  I "C1'" 1 
ATOM   8132  N  N9    . DG  I 5  95  ? 175.243 200.122 146.752 1.00 87.78  ? 21  DG  I N9    1 
ATOM   8133  C  C8    . DG  I 5  95  ? 174.498 199.001 146.501 1.00 87.78  ? 21  DG  I C8    1 
ATOM   8134  N  N7    . DG  I 5  95  ? 174.310 198.254 147.549 1.00 87.78  ? 21  DG  I N7    1 
ATOM   8135  C  C5    . DG  I 5  95  ? 174.978 198.921 148.559 1.00 87.78  ? 21  DG  I C5    1 
ATOM   8136  C  C6    . DG  I 5  95  ? 175.124 198.587 149.919 1.00 87.78  ? 21  DG  I C6    1 
ATOM   8137  O  O6    . DG  I 5  95  ? 174.676 197.608 150.518 1.00 87.78  ? 21  DG  I O6    1 
ATOM   8138  N  N1    . DG  I 5  95  ? 175.875 199.535 150.604 1.00 87.78  ? 21  DG  I N1    1 
ATOM   8139  C  C2    . DG  I 5  95  ? 176.421 200.658 150.039 1.00 87.78  ? 21  DG  I C2    1 
ATOM   8140  N  N2    . DG  I 5  95  ? 177.118 201.459 150.851 1.00 87.78  ? 21  DG  I N2    1 
ATOM   8141  N  N3    . DG  I 5  95  ? 176.291 200.981 148.762 1.00 87.78  ? 21  DG  I N3    1 
ATOM   8142  C  C4    . DG  I 5  95  ? 175.559 200.071 148.086 1.00 87.78  ? 21  DG  I C4    1 
ATOM   8143  P  P     . DT  I 5  96  ? 178.968 202.569 143.227 1.00 87.62  ? 22  DT  I P     1 
ATOM   8144  O  OP1   . DT  I 5  96  ? 179.393 203.855 142.643 1.00 87.62  ? 22  DT  I OP1   1 
ATOM   8145  O  OP2   . DT  I 5  96  ? 179.167 201.325 142.458 1.00 87.62  ? 22  DT  I OP2   1 
ATOM   8146  O  "O5'" . DT  I 5  96  ? 179.685 202.363 144.643 1.00 87.62  ? 22  DT  I "O5'" 1 
ATOM   8147  C  "C5'" . DT  I 5  96  ? 179.556 203.349 145.656 1.00 87.62  ? 22  DT  I "C5'" 1 
ATOM   8148  C  "C4'" . DT  I 5  96  ? 180.274 202.924 146.925 1.00 87.62  ? 22  DT  I "C4'" 1 
ATOM   8149  O  "O4'" . DT  I 5  96  ? 179.461 201.971 147.662 1.00 87.62  ? 22  DT  I "O4'" 1 
ATOM   8150  C  "C3'" . DT  I 5  96  ? 181.634 202.246 146.712 1.00 87.62  ? 22  DT  I "C3'" 1 
ATOM   8151  O  "O3'" . DT  I 5  96  ? 182.608 202.850 147.544 1.00 87.62  ? 22  DT  I "O3'" 1 
ATOM   8152  C  "C2'" . DT  I 5  96  ? 181.377 200.797 147.124 1.00 87.62  ? 22  DT  I "C2'" 1 
ATOM   8153  C  "C1'" . DT  I 5  96  ? 180.307 200.977 148.181 1.00 87.62  ? 22  DT  I "C1'" 1 
ATOM   8154  N  N1    . DT  I 5  96  ? 179.522 199.750 148.425 1.00 87.62  ? 22  DT  I N1    1 
ATOM   8155  C  C2    . DT  I 5  96  ? 179.459 199.242 149.691 1.00 87.62  ? 22  DT  I C2    1 
ATOM   8156  O  O2    . DT  I 5  96  ? 180.003 199.760 150.645 1.00 87.62  ? 22  DT  I O2    1 
ATOM   8157  N  N3    . DT  I 5  96  ? 178.719 198.106 149.809 1.00 87.62  ? 22  DT  I N3    1 
ATOM   8158  C  C4    . DT  I 5  96  ? 178.061 197.435 148.809 1.00 87.62  ? 22  DT  I C4    1 
ATOM   8159  O  O4    . DT  I 5  96  ? 177.420 196.411 149.021 1.00 87.62  ? 22  DT  I O4    1 
ATOM   8160  C  C5    . DT  I 5  96  ? 178.174 198.014 147.504 1.00 87.62  ? 22  DT  I C5    1 
ATOM   8161  C  C7    . DT  I 5  96  ? 177.505 197.365 146.336 1.00 87.62  ? 22  DT  I C7    1 
ATOM   8162  C  C6    . DT  I 5  96  ? 178.895 199.129 147.374 1.00 87.62  ? 22  DT  I C6    1 
ATOM   8163  P  P     . DG  I 5  97  ? 184.135 202.355 147.503 1.00 83.74  ? 23  DG  I P     1 
ATOM   8164  O  OP1   . DG  I 5  97  ? 184.966 203.513 147.880 1.00 83.74  ? 23  DG  I OP1   1 
ATOM   8165  O  OP2   . DG  I 5  97  ? 184.388 201.642 146.232 1.00 83.74  ? 23  DG  I OP2   1 
ATOM   8166  O  "O5'" . DG  I 5  97  ? 184.228 201.303 148.697 1.00 83.74  ? 23  DG  I "O5'" 1 
ATOM   8167  C  "C5'" . DG  I 5  97  ? 184.462 201.766 150.007 1.00 83.74  ? 23  DG  I "C5'" 1 
ATOM   8168  C  "C4'" . DG  I 5  97  ? 184.817 200.625 150.942 1.00 83.74  ? 23  DG  I "C4'" 1 
ATOM   8169  O  "O4'" . DG  I 5  97  ? 183.768 199.627 150.937 1.00 83.74  ? 23  DG  I "O4'" 1 
ATOM   8170  C  "C3'" . DG  I 5  97  ? 186.102 199.861 150.614 1.00 83.74  ? 23  DG  I "C3'" 1 
ATOM   8171  O  "O3'" . DG  I 5  97  ? 186.712 199.505 151.831 1.00 83.74  ? 23  DG  I "O3'" 1 
ATOM   8172  C  "C2'" . DG  I 5  97  ? 185.566 198.619 149.905 1.00 83.74  ? 23  DG  I "C2'" 1 
ATOM   8173  C  "C1'" . DG  I 5  97  ? 184.355 198.361 150.768 1.00 83.74  ? 23  DG  I "C1'" 1 
ATOM   8174  N  N9    . DG  I 5  97  ? 183.363 197.467 150.201 1.00 83.74  ? 23  DG  I N9    1 
ATOM   8175  C  C8    . DG  I 5  97  ? 182.835 197.490 148.935 1.00 83.74  ? 23  DG  I C8    1 
ATOM   8176  N  N7    . DG  I 5  97  ? 181.929 196.575 148.741 1.00 83.74  ? 23  DG  I N7    1 
ATOM   8177  C  C5    . DG  I 5  97  ? 181.851 195.915 149.959 1.00 83.74  ? 23  DG  I C5    1 
ATOM   8178  C  C6    . DG  I 5  97  ? 181.049 194.826 150.358 1.00 83.74  ? 23  DG  I C6    1 
ATOM   8179  O  O6    . DG  I 5  97  ? 180.208 194.206 149.697 1.00 83.74  ? 23  DG  I O6    1 
ATOM   8180  N  N1    . DG  I 5  97  ? 181.298 194.463 151.677 1.00 83.74  ? 23  DG  I N1    1 
ATOM   8181  C  C2    . DG  I 5  97  ? 182.189 195.094 152.513 1.00 83.74  ? 23  DG  I C2    1 
ATOM   8182  N  N2    . DG  I 5  97  ? 182.292 194.612 153.758 1.00 83.74  ? 23  DG  I N2    1 
ATOM   8183  N  N3    . DG  I 5  97  ? 182.949 196.105 152.146 1.00 83.74  ? 23  DG  I N3    1 
ATOM   8184  C  C4    . DG  I 5  97  ? 182.721 196.465 150.865 1.00 83.74  ? 23  DG  I C4    1 
ATOM   8185  P  P     . DC  I 5  98  ? 188.282 199.202 151.927 1.00 84.24  ? 24  DC  I P     1 
ATOM   8186  O  OP1   . DC  I 5  98  ? 188.969 200.508 151.995 1.00 84.24  ? 24  DC  I OP1   1 
ATOM   8187  O  OP2   . DC  I 5  98  ? 188.659 198.218 150.889 1.00 84.24  ? 24  DC  I OP2   1 
ATOM   8188  O  "O5'" . DC  I 5  98  ? 188.413 198.486 153.346 1.00 84.24  ? 24  DC  I "O5'" 1 
ATOM   8189  C  "C5'" . DC  I 5  98  ? 187.234 198.033 154.010 1.00 84.24  ? 24  DC  I "C5'" 1 
ATOM   8190  C  "C4'" . DC  I 5  98  ? 187.372 196.582 154.421 1.00 84.24  ? 24  DC  I "C4'" 1 
ATOM   8191  O  "O4'" . DC  I 5  98  ? 186.302 195.793 153.825 1.00 84.24  ? 24  DC  I "O4'" 1 
ATOM   8192  C  "C3'" . DC  I 5  98  ? 188.666 195.921 153.973 1.00 84.24  ? 24  DC  I "C3'" 1 
ATOM   8193  O  "O3'" . DC  I 5  98  ? 189.048 194.982 154.932 1.00 84.24  ? 24  DC  I "O3'" 1 
ATOM   8194  C  "C2'" . DC  I 5  98  ? 188.234 195.239 152.689 1.00 84.24  ? 24  DC  I "C2'" 1 
ATOM   8195  C  "C1'" . DC  I 5  98  ? 186.875 194.723 153.105 1.00 84.24  ? 24  DC  I "C1'" 1 
ATOM   8196  N  N1    . DC  I 5  98  ? 185.984 194.367 151.961 1.00 84.24  ? 24  DC  I N1    1 
ATOM   8197  C  C2    . DC  I 5  98  ? 185.014 193.374 152.120 1.00 84.24  ? 24  DC  I C2    1 
ATOM   8198  O  O2    . DC  I 5  98  ? 184.897 192.810 153.208 1.00 84.24  ? 24  DC  I O2    1 
ATOM   8199  N  N3    . DC  I 5  98  ? 184.218 193.060 151.072 1.00 84.24  ? 24  DC  I N3    1 
ATOM   8200  C  C4    . DC  I 5  98  ? 184.372 193.690 149.910 1.00 84.24  ? 24  DC  I C4    1 
ATOM   8201  N  N4    . DC  I 5  98  ? 183.565 193.352 148.904 1.00 84.24  ? 24  DC  I N4    1 
ATOM   8202  C  C5    . DC  I 5  98  ? 185.360 194.697 149.727 1.00 84.24  ? 24  DC  I C5    1 
ATOM   8203  C  C6    . DC  I 5  98  ? 186.134 195.000 150.768 1.00 84.24  ? 24  DC  I C6    1 
ATOM   8204  P  P     . DT  I 5  99  ? 190.572 194.499 155.064 1.00 80.98  ? 25  DT  I P     1 
ATOM   8205  O  OP1   . DT  I 5  99  ? 191.324 195.577 155.740 1.00 80.98  ? 25  DT  I OP1   1 
ATOM   8206  O  OP2   . DT  I 5  99  ? 191.042 193.986 153.760 1.00 80.98  ? 25  DT  I OP2   1 
ATOM   8207  O  "O5'" . DT  I 5  99  ? 190.443 193.255 156.050 1.00 80.98  ? 25  DT  I "O5'" 1 
ATOM   8208  C  "C5'" . DT  I 5  99  ? 189.155 192.894 156.538 1.00 80.98  ? 25  DT  I "C5'" 1 
ATOM   8209  C  "C4'" . DT  I 5  99  ? 188.780 191.500 156.088 1.00 80.98  ? 25  DT  I "C4'" 1 
ATOM   8210  O  "O4'" . DT  I 5  99  ? 188.023 191.549 154.850 1.00 80.98  ? 25  DT  I "O4'" 1 
ATOM   8211  C  "C3'" . DT  I 5  99  ? 189.966 190.582 155.818 1.00 80.98  ? 25  DT  I "C3'" 1 
ATOM   8212  O  "O3'" . DT  I 5  99  ? 189.715 189.331 156.404 1.00 80.98  ? 25  DT  I "O3'" 1 
ATOM   8213  C  "C2'" . DT  I 5  99  ? 189.967 190.478 154.289 1.00 80.98  ? 25  DT  I "C2'" 1 
ATOM   8214  C  "C1'" . DT  I 5  99  ? 188.480 190.516 154.023 1.00 80.98  ? 25  DT  I "C1'" 1 
ATOM   8215  N  N1    . DT  I 5  99  ? 188.098 190.821 152.615 1.00 80.98  ? 25  DT  I N1    1 
ATOM   8216  C  C2    . DT  I 5  99  ? 187.044 190.148 152.052 1.00 80.98  ? 25  DT  I C2    1 
ATOM   8217  O  O2    . DT  I 5  99  ? 186.406 189.301 152.644 1.00 80.98  ? 25  DT  I O2    1 
ATOM   8218  N  N3    . DT  I 5  99  ? 186.758 190.502 150.766 1.00 80.98  ? 25  DT  I N3    1 
ATOM   8219  C  C4    . DT  I 5  99  ? 187.404 191.438 150.000 1.00 80.98  ? 25  DT  I C4    1 
ATOM   8220  O  O4    . DT  I 5  99  ? 187.074 191.686 148.849 1.00 80.98  ? 25  DT  I O4    1 
ATOM   8221  C  C5    . DT  I 5  99  ? 188.497 192.111 150.646 1.00 80.98  ? 25  DT  I C5    1 
ATOM   8222  C  C7    . DT  I 5  99  ? 189.277 193.148 149.897 1.00 80.98  ? 25  DT  I C7    1 
ATOM   8223  C  C6    . DT  I 5  99  ? 188.790 191.774 151.911 1.00 80.98  ? 25  DT  I C6    1 
ATOM   8224  P  P     . DA  I 5  100 ? 190.115 188.997 157.925 1.00 80.06  ? 26  DA  I P     1 
ATOM   8225  O  OP1   . DA  I 5  100 ? 190.286 190.241 158.702 1.00 80.06  ? 26  DA  I OP1   1 
ATOM   8226  O  OP2   . DA  I 5  100 ? 191.235 188.037 157.867 1.00 80.06  ? 26  DA  I OP2   1 
ATOM   8227  O  "O5'" . DA  I 5  100 ? 188.832 188.200 158.460 1.00 80.06  ? 26  DA  I "O5'" 1 
ATOM   8228  C  "C5'" . DA  I 5  100 ? 187.612 188.265 157.720 1.00 80.06  ? 26  DA  I "C5'" 1 
ATOM   8229  C  "C4'" . DA  I 5  100 ? 186.767 187.007 157.883 1.00 80.06  ? 26  DA  I "C4'" 1 
ATOM   8230  O  "O4'" . DA  I 5  100 ? 186.378 186.499 156.589 1.00 80.06  ? 26  DA  I "O4'" 1 
ATOM   8231  C  "C3'" . DA  I 5  100 ? 187.429 185.822 158.541 1.00 80.06  ? 26  DA  I "C3'" 1 
ATOM   8232  O  "O3'" . DA  I 5  100 ? 186.398 184.961 159.028 1.00 80.06  ? 26  DA  I "O3'" 1 
ATOM   8233  C  "C2'" . DA  I 5  100 ? 188.193 185.200 157.370 1.00 80.06  ? 26  DA  I "C2'" 1 
ATOM   8234  C  "C1'" . DA  I 5  100 ? 187.298 185.503 156.169 1.00 80.06  ? 26  DA  I "C1'" 1 
ATOM   8235  N  N9    . DA  I 5  100 ? 188.020 186.066 155.049 1.00 80.06  ? 26  DA  I N9    1 
ATOM   8236  C  C8    . DA  I 5  100 ? 189.220 186.691 155.094 1.00 80.06  ? 26  DA  I C8    1 
ATOM   8237  N  N7    . DA  I 5  100 ? 189.614 187.173 153.950 1.00 80.06  ? 26  DA  I N7    1 
ATOM   8238  C  C5    . DA  I 5  100 ? 188.596 186.838 153.089 1.00 80.06  ? 26  DA  I C5    1 
ATOM   8239  C  C6    . DA  I 5  100 ? 188.421 187.046 151.720 1.00 80.06  ? 26  DA  I C6    1 
ATOM   8240  N  N6    . DA  I 5  100 ? 189.309 187.690 150.962 1.00 80.06  ? 26  DA  I N6    1 
ATOM   8241  N  N1    . DA  I 5  100 ? 187.299 186.578 151.157 1.00 80.06  ? 26  DA  I N1    1 
ATOM   8242  C  C2    . DA  I 5  100 ? 186.408 185.937 151.922 1.00 80.06  ? 26  DA  I C2    1 
ATOM   8243  N  N3    . DA  I 5  100 ? 186.470 185.670 153.222 1.00 80.06  ? 26  DA  I N3    1 
ATOM   8244  C  C4    . DA  I 5  100 ? 187.601 186.154 153.748 1.00 80.06  ? 26  DA  I C4    1 
ATOM   8245  P  P     . DG  I 5  101 ? 186.684 183.461 159.531 1.00 80.22  ? 27  DG  I P     1 
ATOM   8246  O  OP1   . DG  I 5  101 ? 185.614 183.176 160.505 1.00 80.22  ? 27  DG  I OP1   1 
ATOM   8247  O  OP2   . DG  I 5  101 ? 188.092 183.288 159.948 1.00 80.22  ? 27  DG  I OP2   1 
ATOM   8248  O  "O5'" . DG  I 5  101 ? 186.403 182.568 158.237 1.00 80.22  ? 27  DG  I "O5'" 1 
ATOM   8249  C  "C5'" . DG  I 5  101 ? 185.087 182.484 157.725 1.00 80.22  ? 27  DG  I "C5'" 1 
ATOM   8250  C  "C4'" . DG  I 5  101 ? 185.048 181.810 156.365 1.00 80.22  ? 27  DG  I "C4'" 1 
ATOM   8251  O  "O4'" . DG  I 5  101 ? 185.871 182.534 155.409 1.00 80.22  ? 27  DG  I "O4'" 1 
ATOM   8252  C  "C3'" . DG  I 5  101 ? 185.536 180.372 156.329 1.00 80.22  ? 27  DG  I "C3'" 1 
ATOM   8253  O  "O3'" . DG  I 5  101 ? 184.729 179.657 155.430 1.00 80.22  ? 27  DG  I "O3'" 1 
ATOM   8254  C  "C2'" . DG  I 5  101 ? 186.953 180.528 155.780 1.00 80.22  ? 27  DG  I "C2'" 1 
ATOM   8255  C  "C1'" . DG  I 5  101 ? 186.725 181.621 154.753 1.00 80.22  ? 27  DG  I "C1'" 1 
ATOM   8256  N  N9    . DG  I 5  101 ? 187.936 182.340 154.356 1.00 80.22  ? 27  DG  I N9    1 
ATOM   8257  C  C8    . DG  I 5  101 ? 188.974 182.693 155.168 1.00 80.22  ? 27  DG  I C8    1 
ATOM   8258  N  N7    . DG  I 5  101 ? 189.901 183.376 154.568 1.00 80.22  ? 27  DG  I N7    1 
ATOM   8259  C  C5    . DG  I 5  101 ? 189.472 183.460 153.263 1.00 80.22  ? 27  DG  I C5    1 
ATOM   8260  C  C6    . DG  I 5  101 ? 190.087 184.065 152.155 1.00 80.22  ? 27  DG  I C6    1 
ATOM   8261  O  O6    . DG  I 5  101 ? 191.163 184.668 152.114 1.00 80.22  ? 27  DG  I O6    1 
ATOM   8262  N  N1    . DG  I 5  101 ? 189.324 183.935 151.010 1.00 80.22  ? 27  DG  I N1    1 
ATOM   8263  C  C2    . DG  I 5  101 ? 188.123 183.286 150.938 1.00 80.22  ? 27  DG  I C2    1 
ATOM   8264  N  N2    . DG  I 5  101 ? 187.537 183.269 149.737 1.00 80.22  ? 27  DG  I N2    1 
ATOM   8265  N  N3    . DG  I 5  101 ? 187.525 182.715 151.977 1.00 80.22  ? 27  DG  I N3    1 
ATOM   8266  C  C4    . DG  I 5  101 ? 188.257 182.841 153.105 1.00 80.22  ? 27  DG  I C4    1 
ATOM   8267  P  P     . DA  I 5  102 ? 184.361 178.121 155.691 1.00 76.89  ? 28  DA  I P     1 
ATOM   8268  O  OP1   . DA  I 5  102 ? 183.239 178.079 156.653 1.00 76.89  ? 28  DA  I OP1   1 
ATOM   8269  O  OP2   . DA  I 5  102 ? 185.610 177.407 156.011 1.00 76.89  ? 28  DA  I OP2   1 
ATOM   8270  O  "O5'" . DA  I 5  102 ? 183.841 177.628 154.260 1.00 76.89  ? 28  DA  I "O5'" 1 
ATOM   8271  C  "C5'" . DA  I 5  102 ? 182.851 178.397 153.564 1.00 76.89  ? 28  DA  I "C5'" 1 
ATOM   8272  C  "C4'" . DA  I 5  102 ? 182.834 178.138 152.056 1.00 76.89  ? 28  DA  I "C4'" 1 
ATOM   8273  O  "O4'" . DA  I 5  102 ? 183.880 178.881 151.401 1.00 76.89  ? 28  DA  I "O4'" 1 
ATOM   8274  C  "C3'" . DA  I 5  102 ? 183.002 176.706 151.594 1.00 76.89  ? 28  DA  I "C3'" 1 
ATOM   8275  O  "O3'" . DA  I 5  102 ? 182.272 176.529 150.391 1.00 76.89  ? 28  DA  I "O3'" 1 
ATOM   8276  C  "C2'" . DA  I 5  102 ? 184.507 176.602 151.352 1.00 76.89  ? 28  DA  I "C2'" 1 
ATOM   8277  C  "C1'" . DA  I 5  102 ? 184.876 178.011 150.905 1.00 76.89  ? 28  DA  I "C1'" 1 
ATOM   8278  N  N9    . DA  I 5  102 ? 186.122 178.484 151.453 1.00 76.89  ? 28  DA  I N9    1 
ATOM   8279  C  C8    . DA  I 5  102 ? 186.496 178.424 152.749 1.00 76.89  ? 28  DA  I C8    1 
ATOM   8280  N  N7    . DA  I 5  102 ? 187.659 178.958 152.985 1.00 76.89  ? 28  DA  I N7    1 
ATOM   8281  C  C5    . DA  I 5  102 ? 188.058 179.443 151.771 1.00 76.89  ? 28  DA  I C5    1 
ATOM   8282  C  C6    . DA  I 5  102 ? 189.208 180.117 151.375 1.00 76.89  ? 28  DA  I C6    1 
ATOM   8283  N  N6    . DA  I 5  102 ? 190.179 180.443 152.223 1.00 76.89  ? 28  DA  I N6    1 
ATOM   8284  N  N1    . DA  I 5  102 ? 189.318 180.455 150.080 1.00 76.89  ? 28  DA  I N1    1 
ATOM   8285  C  C2    . DA  I 5  102 ? 188.332 180.121 149.238 1.00 76.89  ? 28  DA  I C2    1 
ATOM   8286  N  N3    . DA  I 5  102 ? 187.198 179.479 149.503 1.00 76.89  ? 28  DA  I N3    1 
ATOM   8287  C  C4    . DA  I 5  102 ? 187.124 179.167 150.804 1.00 76.89  ? 28  DA  I C4    1 
ATOM   8288  P  P     . DG  I 5  103 ? 182.174 175.089 149.684 1.00 75.77  ? 29  DG  I P     1 
ATOM   8289  O  OP1   . DG  I 5  103 ? 180.917 175.070 148.916 1.00 75.77  ? 29  DG  I OP1   1 
ATOM   8290  O  OP2   . DG  I 5  103 ? 182.437 174.036 150.682 1.00 75.77  ? 29  DG  I OP2   1 
ATOM   8291  O  "O5'" . DG  I 5  103 ? 183.406 175.078 148.673 1.00 75.77  ? 29  DG  I "O5'" 1 
ATOM   8292  C  "C5'" . DG  I 5  103 ? 183.623 176.171 147.802 1.00 75.77  ? 29  DG  I "C5'" 1 
ATOM   8293  C  "C4'" . DG  I 5  103 ? 184.914 175.978 147.039 1.00 75.77  ? 29  DG  I "C4'" 1 
ATOM   8294  O  "O4'" . DG  I 5  103 ? 186.005 176.592 147.757 1.00 75.77  ? 29  DG  I "O4'" 1 
ATOM   8295  C  "C3'" . DG  I 5  103 ? 185.304 174.522 146.821 1.00 75.77  ? 29  DG  I "C3'" 1 
ATOM   8296  O  "O3'" . DG  I 5  103 ? 185.489 174.305 145.428 1.00 75.77  ? 29  DG  I "O3'" 1 
ATOM   8297  C  "C2'" . DG  I 5  103 ? 186.597 174.359 147.631 1.00 75.77  ? 29  DG  I "C2'" 1 
ATOM   8298  C  "C1'" . DG  I 5  103 ? 187.136 175.769 147.680 1.00 75.77  ? 29  DG  I "C1'" 1 
ATOM   8299  N  N9    . DG  I 5  103 ? 187.946 176.033 148.857 1.00 75.77  ? 29  DG  I N9    1 
ATOM   8300  C  C8    . DG  I 5  103 ? 187.615 175.753 150.150 1.00 75.77  ? 29  DG  I C8    1 
ATOM   8301  N  N7    . DG  I 5  103 ? 188.511 176.120 151.010 1.00 75.77  ? 29  DG  I N7    1 
ATOM   8302  C  C5    . DG  I 5  103 ? 189.507 176.686 150.236 1.00 75.77  ? 29  DG  I C5    1 
ATOM   8303  C  C6    . DG  I 5  103 ? 190.741 177.246 150.618 1.00 75.77  ? 29  DG  I C6    1 
ATOM   8304  O  O6    . DG  I 5  103 ? 191.203 177.371 151.755 1.00 75.77  ? 29  DG  I O6    1 
ATOM   8305  N  N1    . DG  I 5  103 ? 191.459 177.700 149.524 1.00 75.77  ? 29  DG  I N1    1 
ATOM   8306  C  C2    . DG  I 5  103 ? 191.041 177.612 148.224 1.00 75.77  ? 29  DG  I C2    1 
ATOM   8307  N  N2    . DG  I 5  103 ? 191.867 178.104 147.297 1.00 75.77  ? 29  DG  I N2    1 
ATOM   8308  N  N3    . DG  I 5  103 ? 189.888 177.082 147.852 1.00 75.77  ? 29  DG  I N3    1 
ATOM   8309  C  C4    . DG  I 5  103 ? 189.170 176.652 148.910 1.00 75.77  ? 29  DG  I C4    1 
ATOM   8310  P  P     . DC  I 5  104 ? 186.108 172.940 144.849 1.00 79.78  ? 30  DC  I P     1 
ATOM   8311  O  OP1   . DC  I 5  104 ? 185.558 172.782 143.498 1.00 79.78  ? 30  DC  I OP1   1 
ATOM   8312  O  OP2   . DC  I 5  104 ? 185.941 171.819 145.802 1.00 79.78  ? 30  DC  I OP2   1 
ATOM   8313  O  "O5'" . DC  I 5  104 ? 187.644 173.310 144.655 1.00 79.78  ? 30  DC  I "O5'" 1 
ATOM   8314  C  "C5'" . DC  I 5  104 ? 187.981 174.611 144.213 1.00 79.78  ? 30  DC  I "C5'" 1 
ATOM   8315  C  "C4'" . DC  I 5  104 ? 189.351 174.642 143.586 1.00 79.78  ? 30  DC  I "C4'" 1 
ATOM   8316  O  "O4'" . DC  I 5  104 ? 190.306 175.164 144.526 1.00 79.78  ? 30  DC  I "O4'" 1 
ATOM   8317  C  "C3'" . DC  I 5  104 ? 189.881 173.305 143.126 1.00 79.78  ? 30  DC  I "C3'" 1 
ATOM   8318  O  "O3'" . DC  I 5  104 ? 190.569 173.484 141.910 1.00 79.78  ? 30  DC  I "O3'" 1 
ATOM   8319  C  "C2'" . DC  I 5  104 ? 190.816 172.866 144.256 1.00 79.78  ? 30  DC  I "C2'" 1 
ATOM   8320  C  "C1'" . DC  I 5  104 ? 191.219 174.173 144.925 1.00 79.78  ? 30  DC  I "C1'" 1 
ATOM   8321  N  N1    . DC  I 5  104 ? 191.192 174.112 146.404 1.00 79.78  ? 30  DC  I N1    1 
ATOM   8322  C  C2    . DC  I 5  104 ? 192.261 174.626 147.139 1.00 79.78  ? 30  DC  I C2    1 
ATOM   8323  O  O2    . DC  I 5  104 ? 193.217 175.117 146.537 1.00 79.78  ? 30  DC  I O2    1 
ATOM   8324  N  N3    . DC  I 5  104 ? 192.215 174.576 148.486 1.00 79.78  ? 30  DC  I N3    1 
ATOM   8325  C  C4    . DC  I 5  104 ? 191.161 174.035 149.093 1.00 79.78  ? 30  DC  I C4    1 
ATOM   8326  N  N4    . DC  I 5  104 ? 191.161 174.000 150.427 1.00 79.78  ? 30  DC  I N4    1 
ATOM   8327  C  C5    . DC  I 5  104 ? 190.063 173.503 148.363 1.00 79.78  ? 30  DC  I C5    1 
ATOM   8328  C  C6    . DC  I 5  104 ? 190.113 173.581 147.033 1.00 79.78  ? 30  DC  I C6    1 
ATOM   8329  P  P     . DT  I 5  105 ? 190.971 172.226 140.999 1.00 80.73  ? 31  DT  I P     1 
ATOM   8330  O  OP1   . DT  I 5  105 ? 190.959 172.693 139.599 1.00 80.73  ? 31  DT  I OP1   1 
ATOM   8331  O  OP2   . DT  I 5  105 ? 190.122 171.072 141.357 1.00 80.73  ? 31  DT  I OP2   1 
ATOM   8332  O  "O5'" . DT  I 5  105 ? 192.479 171.938 141.445 1.00 80.73  ? 31  DT  I "O5'" 1 
ATOM   8333  C  "C5'" . DT  I 5  105 ? 193.399 173.021 141.533 1.00 80.73  ? 31  DT  I "C5'" 1 
ATOM   8334  C  "C4'" . DT  I 5  105 ? 194.658 172.601 142.259 1.00 80.73  ? 31  DT  I "C4'" 1 
ATOM   8335  O  "O4'" . DT  I 5  105 ? 194.491 172.787 143.680 1.00 80.73  ? 31  DT  I "O4'" 1 
ATOM   8336  C  "C3'" . DT  I 5  105 ? 195.048 171.138 142.066 1.00 80.73  ? 31  DT  I "C3'" 1 
ATOM   8337  O  "O3'" . DT  I 5  105 ? 196.310 171.079 141.401 1.00 80.73  ? 31  DT  I "O3'" 1 
ATOM   8338  C  "C2'" . DT  I 5  105 ? 195.105 170.579 143.493 1.00 80.73  ? 31  DT  I "C2'" 1 
ATOM   8339  C  "C1'" . DT  I 5  105 ? 195.257 171.826 144.341 1.00 80.73  ? 31  DT  I "C1'" 1 
ATOM   8340  N  N1    . DT  I 5  105 ? 194.720 171.660 145.723 1.00 80.73  ? 31  DT  I N1    1 
ATOM   8341  C  C2    . DT  I 5  105 ? 195.485 172.029 146.813 1.00 80.73  ? 31  DT  I C2    1 
ATOM   8342  O  O2    . DT  I 5  105 ? 196.605 172.494 146.716 1.00 80.73  ? 31  DT  I O2    1 
ATOM   8343  N  N3    . DT  I 5  105 ? 194.882 171.825 148.029 1.00 80.73  ? 31  DT  I N3    1 
ATOM   8344  C  C4    . DT  I 5  105 ? 193.628 171.307 148.250 1.00 80.73  ? 31  DT  I C4    1 
ATOM   8345  O  O4    . DT  I 5  105 ? 193.167 171.160 149.372 1.00 80.73  ? 31  DT  I O4    1 
ATOM   8346  C  C5    . DT  I 5  105 ? 192.890 170.948 147.067 1.00 80.73  ? 31  DT  I C5    1 
ATOM   8347  C  C7    . DT  I 5  105 ? 191.518 170.363 147.185 1.00 80.73  ? 31  DT  I C7    1 
ATOM   8348  C  C6    . DT  I 5  105 ? 193.467 171.139 145.880 1.00 80.73  ? 31  DT  I C6    1 
ATOM   8349  P  P     . DG  I 5  106 ? 197.117 169.700 141.203 1.00 88.46  ? 32  DG  I P     1 
ATOM   8350  O  OP1   . DG  I 5  106 ? 197.873 169.870 139.947 1.00 88.46  ? 32  DG  I OP1   1 
ATOM   8351  O  OP2   . DG  I 5  106 ? 196.233 168.520 141.312 1.00 88.46  ? 32  DG  I OP2   1 
ATOM   8352  O  "O5'" . DG  I 5  106 ? 198.155 169.708 142.422 1.00 88.46  ? 32  DG  I "O5'" 1 
ATOM   8353  C  "C5'" . DG  I 5  106 ? 198.978 170.860 142.623 1.00 88.46  ? 32  DG  I "C5'" 1 
ATOM   8354  C  "C4'" . DG  I 5  106 ? 199.735 170.812 143.942 1.00 88.46  ? 32  DG  I "C4'" 1 
ATOM   8355  O  "O4'" . DG  I 5  106 ? 198.814 170.849 145.061 1.00 88.46  ? 32  DG  I "O4'" 1 
ATOM   8356  C  "C3'" . DG  I 5  106 ? 200.612 169.583 144.166 1.00 88.46  ? 32  DG  I "C3'" 1 
ATOM   8357  O  "O3'" . DG  I 5  106 ? 201.791 169.990 144.831 1.00 88.46  ? 32  DG  I "O3'" 1 
ATOM   8358  C  "C2'" . DG  I 5  106 ? 199.741 168.732 145.082 1.00 88.46  ? 32  DG  I "C2'" 1 
ATOM   8359  C  "C1'" . DG  I 5  106 ? 199.142 169.807 145.958 1.00 88.46  ? 32  DG  I "C1'" 1 
ATOM   8360  N  N9    . DG  I 5  106 ? 197.923 169.415 146.657 1.00 88.46  ? 32  DG  I N9    1 
ATOM   8361  C  C8    . DG  I 5  106 ? 196.737 169.052 146.087 1.00 88.46  ? 32  DG  I C8    1 
ATOM   8362  N  N7    . DG  I 5  106 ? 195.804 168.791 146.948 1.00 88.46  ? 32  DG  I N7    1 
ATOM   8363  C  C5    . DG  I 5  106 ? 196.411 168.989 148.172 1.00 88.46  ? 32  DG  I C5    1 
ATOM   8364  C  C6    . DG  I 5  106 ? 195.883 168.856 149.464 1.00 88.46  ? 32  DG  I C6    1 
ATOM   8365  O  O6    . DG  I 5  106 ? 194.742 168.511 149.787 1.00 88.46  ? 32  DG  I O6    1 
ATOM   8366  N  N1    . DG  I 5  106 ? 196.830 169.148 150.436 1.00 88.46  ? 32  DG  I N1    1 
ATOM   8367  C  C2    . DG  I 5  106 ? 198.121 169.534 150.183 1.00 88.46  ? 32  DG  I C2    1 
ATOM   8368  N  N2    . DG  I 5  106 ? 198.886 169.779 151.252 1.00 88.46  ? 32  DG  I N2    1 
ATOM   8369  N  N3    . DG  I 5  106 ? 198.626 169.671 148.968 1.00 88.46  ? 32  DG  I N3    1 
ATOM   8370  C  C4    . DG  I 5  106 ? 197.715 169.382 148.016 1.00 88.46  ? 32  DG  I C4    1 
ATOM   8371  P  P     . DT  I 5  107 ? 203.088 169.050 144.887 1.00 95.07  ? 33  DT  I P     1 
ATOM   8372  O  OP1   . DT  I 5  107 ? 204.131 169.734 144.098 1.00 95.07  ? 33  DT  I OP1   1 
ATOM   8373  O  OP2   . DT  I 5  107 ? 202.736 167.649 144.567 1.00 95.07  ? 33  DT  I OP2   1 
ATOM   8374  O  "O5'" . DT  I 5  107 ? 203.527 169.118 146.418 1.00 95.07  ? 33  DT  I "O5'" 1 
ATOM   8375  C  "C5'" . DT  I 5  107 ? 202.557 169.009 147.451 1.00 95.07  ? 33  DT  I "C5'" 1 
ATOM   8376  C  "C4'" . DT  I 5  107 ? 203.239 168.727 148.770 1.00 95.07  ? 33  DT  I "C4'" 1 
ATOM   8377  O  "O4'" . DT  I 5  107 ? 202.251 168.438 149.787 1.00 95.07  ? 33  DT  I "O4'" 1 
ATOM   8378  C  "C3'" . DT  I 5  107 ? 204.112 167.504 148.758 1.00 95.07  ? 33  DT  I "C3'" 1 
ATOM   8379  O  "O3'" . DT  I 5  107 ? 204.981 167.559 149.858 1.00 95.07  ? 33  DT  I "O3'" 1 
ATOM   8380  C  "C2'" . DT  I 5  107 ? 203.062 166.411 148.917 1.00 95.07  ? 33  DT  I "C2'" 1 
ATOM   8381  C  "C1'" . DT  I 5  107 ? 202.143 167.032 149.965 1.00 95.07  ? 33  DT  I "C1'" 1 
ATOM   8382  N  N1    . DT  I 5  107 ? 200.695 166.687 149.820 1.00 95.07  ? 33  DT  I N1    1 
ATOM   8383  C  C2    . DT  I 5  107 ? 199.895 166.660 150.941 1.00 95.07  ? 33  DT  I C2    1 
ATOM   8384  O  O2    . DT  I 5  107 ? 200.312 166.855 152.062 1.00 95.07  ? 33  DT  I O2    1 
ATOM   8385  N  N3    . DT  I 5  107 ? 198.584 166.384 150.702 1.00 95.07  ? 33  DT  I N3    1 
ATOM   8386  C  C4    . DT  I 5  107 ? 198.002 166.151 149.483 1.00 95.07  ? 33  DT  I C4    1 
ATOM   8387  O  O4    . DT  I 5  107 ? 196.811 165.904 149.364 1.00 95.07  ? 33  DT  I O4    1 
ATOM   8388  C  C5    . DT  I 5  107 ? 198.885 166.210 148.351 1.00 95.07  ? 33  DT  I C5    1 
ATOM   8389  C  C7    . DT  I 5  107 ? 198.354 165.966 146.982 1.00 95.07  ? 33  DT  I C7    1 
ATOM   8390  C  C6    . DT  I 5  107 ? 200.171 166.480 148.567 1.00 95.07  ? 33  DT  I C6    1 
ATOM   8391  P  P     . DC  I 5  108 ? 206.226 166.559 149.942 1.00 99.52  ? 34  DC  I P     1 
ATOM   8392  O  OP1   . DC  I 5  108 ? 207.392 167.346 150.398 1.00 99.52  ? 34  DC  I OP1   1 
ATOM   8393  O  OP2   . DC  I 5  108 ? 206.287 165.832 148.657 1.00 99.52  ? 34  DC  I OP2   1 
ATOM   8394  O  "O5'" . DC  I 5  108 ? 205.799 165.529 151.087 1.00 99.52  ? 34  DC  I "O5'" 1 
ATOM   8395  C  "C5'" . DC  I 5  108 ? 205.573 166.002 152.410 1.00 99.52  ? 34  DC  I "C5'" 1 
ATOM   8396  C  "C4'" . DC  I 5  108 ? 204.747 165.024 153.232 1.00 99.52  ? 34  DC  I "C4'" 1 
ATOM   8397  O  "O4'" . DC  I 5  108 ? 203.405 164.915 152.688 1.00 99.52  ? 34  DC  I "O4'" 1 
ATOM   8398  C  "C3'" . DC  I 5  108 ? 205.279 163.594 153.305 1.00 99.52  ? 34  DC  I "C3'" 1 
ATOM   8399  O  "O3'" . DC  I 5  108 ? 205.070 163.101 154.606 1.00 99.52  ? 34  DC  I "O3'" 1 
ATOM   8400  C  "C2'" . DC  I 5  108 ? 204.387 162.871 152.309 1.00 99.52  ? 34  DC  I "C2'" 1 
ATOM   8401  C  "C1'" . DC  I 5  108 ? 203.072 163.552 152.607 1.00 99.52  ? 34  DC  I "C1'" 1 
ATOM   8402  N  N1    . DC  I 5  108 ? 202.049 163.386 151.559 1.00 99.52  ? 34  DC  I N1    1 
ATOM   8403  C  C2    . DC  I 5  108 ? 200.699 163.381 151.908 1.00 99.52  ? 34  DC  I C2    1 
ATOM   8404  O  O2    . DC  I 5  108 ? 200.386 163.495 153.095 1.00 99.52  ? 34  DC  I O2    1 
ATOM   8405  N  N3    . DC  I 5  108 ? 199.770 163.245 150.937 1.00 99.52  ? 34  DC  I N3    1 
ATOM   8406  C  C4    . DC  I 5  108 ? 200.150 163.122 149.668 1.00 99.52  ? 34  DC  I C4    1 
ATOM   8407  N  N4    . DC  I 5  108 ? 199.203 162.989 148.738 1.00 99.52  ? 34  DC  I N4    1 
ATOM   8408  C  C5    . DC  I 5  108 ? 201.521 163.126 149.292 1.00 99.52  ? 34  DC  I C5    1 
ATOM   8409  C  C6    . DC  I 5  108 ? 202.426 163.253 150.264 1.00 99.52  ? 34  DC  I C6    1 
ATOM   8410  P  P     . DT  I 5  109 ? 205.871 161.817 155.136 1.00 97.01  ? 35  DT  I P     1 
ATOM   8411  O  OP1   . DT  I 5  109 ? 207.305 162.168 155.103 1.00 97.01  ? 35  DT  I OP1   1 
ATOM   8412  O  OP2   . DT  I 5  109 ? 205.387 160.612 154.427 1.00 97.01  ? 35  DT  I OP2   1 
ATOM   8413  O  "O5'" . DT  I 5  109 ? 205.399 161.699 156.655 1.00 97.01  ? 35  DT  I "O5'" 1 
ATOM   8414  C  "C5'" . DT  I 5  109 ? 204.259 162.415 157.089 1.00 97.01  ? 35  DT  I "C5'" 1 
ATOM   8415  C  "C4'" . DT  I 5  109 ? 203.031 161.530 157.072 1.00 97.01  ? 35  DT  I "C4'" 1 
ATOM   8416  O  "O4'" . DT  I 5  109 ? 202.362 161.620 155.791 1.00 97.01  ? 35  DT  I "O4'" 1 
ATOM   8417  C  "C3'" . DT  I 5  109 ? 203.303 160.037 157.293 1.00 97.01  ? 35  DT  I "C3'" 1 
ATOM   8418  O  "O3'" . DT  I 5  109 ? 202.608 159.592 158.438 1.00 97.01  ? 35  DT  I "O3'" 1 
ATOM   8419  C  "C2'" . DT  I 5  109 ? 202.765 159.373 156.023 1.00 97.01  ? 35  DT  I "C2'" 1 
ATOM   8420  C  "C1'" . DT  I 5  109 ? 201.740 160.389 155.571 1.00 97.01  ? 35  DT  I "C1'" 1 
ATOM   8421  N  N1    . DT  I 5  109 ? 201.356 160.252 154.151 1.00 97.01  ? 35  DT  I N1    1 
ATOM   8422  C  C2    . DT  I 5  109 ? 200.028 160.263 153.823 1.00 97.01  ? 35  DT  I C2    1 
ATOM   8423  O  O2    . DT  I 5  109 ? 199.143 160.417 154.640 1.00 97.01  ? 35  DT  I O2    1 
ATOM   8424  N  N3    . DT  I 5  109 ? 199.764 160.109 152.495 1.00 97.01  ? 35  DT  I N3    1 
ATOM   8425  C  C4    . DT  I 5  109 ? 200.682 159.933 151.483 1.00 97.01  ? 35  DT  I C4    1 
ATOM   8426  O  O4    . DT  I 5  109 ? 200.347 159.796 150.314 1.00 97.01  ? 35  DT  I O4    1 
ATOM   8427  C  C5    . DT  I 5  109 ? 202.060 159.915 151.896 1.00 97.01  ? 35  DT  I C5    1 
ATOM   8428  C  C7    . DT  I 5  109 ? 203.142 159.720 150.881 1.00 97.01  ? 35  DT  I C7    1 
ATOM   8429  C  C6    . DT  I 5  109 ? 202.328 160.063 153.200 1.00 97.01  ? 35  DT  I C6    1 
ATOM   8430  P  P     . DA  I 5  110 ? 203.418 159.267 159.783 1.00 83.51  ? 36  DA  I P     1 
ATOM   8431  O  OP1   . DA  I 5  110 ? 203.817 160.564 160.366 1.00 83.51  ? 36  DA  I OP1   1 
ATOM   8432  O  OP2   . DA  I 5  110 ? 204.448 158.257 159.460 1.00 83.51  ? 36  DA  I OP2   1 
ATOM   8433  O  "O5'" . DA  I 5  110 ? 202.337 158.578 160.729 1.00 83.51  ? 36  DA  I "O5'" 1 
ATOM   8434  C  "C5'" . DA  I 5  110 ? 201.279 159.341 161.247 1.00 83.51  ? 36  DA  I "C5'" 1 
ATOM   8435  C  "C4'" . DA  I 5  110 ? 199.943 158.787 160.793 1.00 83.51  ? 36  DA  I "C4'" 1 
ATOM   8436  O  "O4'" . DA  I 5  110 ? 199.979 158.510 159.374 1.00 83.51  ? 36  DA  I "O4'" 1 
ATOM   8437  C  "C3'" . DA  I 5  110 ? 199.511 157.486 161.460 1.00 83.51  ? 36  DA  I "C3'" 1 
ATOM   8438  O  "O3'" . DA  I 5  110 ? 198.121 157.546 161.703 1.00 83.51  ? 36  DA  I "O3'" 1 
ATOM   8439  C  "C2'" . DA  I 5  110 ? 199.858 156.432 160.405 1.00 83.51  ? 36  DA  I "C2'" 1 
ATOM   8440  C  "C1'" . DA  I 5  110 ? 199.539 157.189 159.139 1.00 83.51  ? 36  DA  I "C1'" 1 
ATOM   8441  N  N9    . DA  I 5  110 ? 200.234 156.707 157.963 1.00 83.51  ? 36  DA  I N9    1 
ATOM   8442  C  C8    . DA  I 5  110 ? 201.579 156.591 157.797 1.00 83.51  ? 36  DA  I C8    1 
ATOM   8443  N  N7    . DA  I 5  110 ? 201.927 156.162 156.610 1.00 83.51  ? 36  DA  I N7    1 
ATOM   8444  C  C5    . DA  I 5  110 ? 200.724 156.001 155.955 1.00 83.51  ? 36  DA  I C5    1 
ATOM   8445  C  C6    . DA  I 5  110 ? 200.405 155.571 154.658 1.00 83.51  ? 36  DA  I C6    1 
ATOM   8446  N  N6    . DA  I 5  110 ? 201.324 155.209 153.768 1.00 83.51  ? 36  DA  I N6    1 
ATOM   8447  N  N1    . DA  I 5  110 ? 199.098 155.524 154.312 1.00 83.51  ? 36  DA  I N1    1 
ATOM   8448  C  C2    . DA  I 5  110 ? 198.186 155.883 155.221 1.00 83.51  ? 36  DA  I C2    1 
ATOM   8449  N  N3    . DA  I 5  110 ? 198.371 156.307 156.469 1.00 83.51  ? 36  DA  I N3    1 
ATOM   8450  C  C4    . DA  I 5  110 ? 199.673 156.345 156.772 1.00 83.51  ? 36  DA  I C4    1 
ATOM   8451  P  P     . DC  I 5  111 ? 197.381 156.396 162.534 1.00 74.23  ? 37  DC  I P     1 
ATOM   8452  O  OP1   . DC  I 5  111 ? 196.399 157.096 163.384 1.00 74.23  ? 37  DC  I OP1   1 
ATOM   8453  O  OP2   . DC  I 5  111 ? 198.384 155.498 163.144 1.00 74.23  ? 37  DC  I OP2   1 
ATOM   8454  O  "O5'" . DC  I 5  111 ? 196.597 155.571 161.414 1.00 74.23  ? 37  DC  I "O5'" 1 
ATOM   8455  C  "C5'" . DC  I 5  111 ? 195.559 156.203 160.672 1.00 74.23  ? 37  DC  I "C5'" 1 
ATOM   8456  C  "C4'" . DC  I 5  111 ? 194.895 155.246 159.694 1.00 74.23  ? 37  DC  I "C4'" 1 
ATOM   8457  O  "O4'" . DC  I 5  111 ? 195.796 154.935 158.609 1.00 74.23  ? 37  DC  I "O4'" 1 
ATOM   8458  C  "C3'" . DC  I 5  111 ? 194.464 153.902 160.266 1.00 74.23  ? 37  DC  I "C3'" 1 
ATOM   8459  O  "O3'" . DC  I 5  111 ? 193.236 153.541 159.692 1.00 74.23  ? 37  DC  I "O3'" 1 
ATOM   8460  C  "C2'" . DC  I 5  111 ? 195.581 152.959 159.813 1.00 74.23  ? 37  DC  I "C2'" 1 
ATOM   8461  C  "C1'" . DC  I 5  111 ? 195.878 153.535 158.454 1.00 74.23  ? 37  DC  I "C1'" 1 
ATOM   8462  N  N1    . DC  I 5  111 ? 197.210 153.249 157.944 1.00 74.23  ? 37  DC  I N1    1 
ATOM   8463  C  C2    . DC  I 5  111 ? 197.341 152.775 156.649 1.00 74.23  ? 37  DC  I C2    1 
ATOM   8464  O  O2    . DC  I 5  111 ? 196.324 152.559 155.994 1.00 74.23  ? 37  DC  I O2    1 
ATOM   8465  N  N3    . DC  I 5  111 ? 198.568 152.553 156.152 1.00 74.23  ? 37  DC  I N3    1 
ATOM   8466  C  C4    . DC  I 5  111 ? 199.641 152.801 156.904 1.00 74.23  ? 37  DC  I C4    1 
ATOM   8467  N  N4    . DC  I 5  111 ? 200.836 152.565 156.363 1.00 74.23  ? 37  DC  I N4    1 
ATOM   8468  C  C5    . DC  I 5  111 ? 199.533 153.299 158.232 1.00 74.23  ? 37  DC  I C5    1 
ATOM   8469  C  C6    . DC  I 5  111 ? 198.305 153.521 158.704 1.00 74.23  ? 37  DC  I C6    1 
ATOM   8470  P  P     . DG  I 5  112 ? 192.142 152.791 160.585 1.00 64.34  ? 38  DG  I P     1 
ATOM   8471  O  OP1   . DG  I 5  112 ? 191.168 153.803 161.048 1.00 64.34  ? 38  DG  I OP1   1 
ATOM   8472  O  OP2   . DG  I 5  112 ? 192.903 151.964 161.542 1.00 64.34  ? 38  DG  I OP2   1 
ATOM   8473  O  "O5'" . DG  I 5  112 ? 191.431 151.792 159.571 1.00 64.34  ? 38  DG  I "O5'" 1 
ATOM   8474  C  "C5'" . DG  I 5  112 ? 190.566 152.291 158.583 1.00 64.34  ? 38  DG  I "C5'" 1 
ATOM   8475  C  "C4'" . DG  I 5  112 ? 190.613 151.436 157.332 1.00 64.34  ? 38  DG  I "C4'" 1 
ATOM   8476  O  "O4'" . DG  I 5  112 ? 191.990 151.204 156.956 1.00 64.34  ? 38  DG  I "O4'" 1 
ATOM   8477  C  "C3'" . DG  I 5  112 ? 189.980 150.053 157.441 1.00 64.34  ? 38  DG  I "C3'" 1 
ATOM   8478  O  "O3'" . DG  I 5  112 ? 189.378 149.724 156.204 1.00 64.34  ? 38  DG  I "O3'" 1 
ATOM   8479  C  "C2'" . DG  I 5  112 ? 191.174 149.161 157.743 1.00 64.34  ? 38  DG  I "C2'" 1 
ATOM   8480  C  "C1'" . DG  I 5  112 ? 192.242 149.818 156.901 1.00 64.34  ? 38  DG  I "C1'" 1 
ATOM   8481  N  N9    . DG  I 5  112 ? 193.586 149.596 157.384 1.00 64.34  ? 38  DG  I N9    1 
ATOM   8482  C  C8    . DG  I 5  112 ? 194.100 149.968 158.597 1.00 64.34  ? 38  DG  I C8    1 
ATOM   8483  N  N7    . DG  I 5  112 ? 195.352 149.657 158.738 1.00 64.34  ? 38  DG  I N7    1 
ATOM   8484  C  C5    . DG  I 5  112 ? 195.684 149.045 157.538 1.00 64.34  ? 38  DG  I C5    1 
ATOM   8485  C  C6    . DG  I 5  112 ? 196.906 148.487 157.106 1.00 64.34  ? 38  DG  I C6    1 
ATOM   8486  O  O6    . DG  I 5  112 ? 197.981 148.433 157.715 1.00 64.34  ? 38  DG  I O6    1 
ATOM   8487  N  N1    . DG  I 5  112 ? 196.812 147.973 155.817 1.00 64.34  ? 38  DG  I N1    1 
ATOM   8488  C  C2    . DG  I 5  112 ? 195.676 147.992 155.054 1.00 64.34  ? 38  DG  I C2    1 
ATOM   8489  N  N2    . DG  I 5  112 ? 195.770 147.459 153.832 1.00 64.34  ? 38  DG  I N2    1 
ATOM   8490  N  N3    . DG  I 5  112 ? 194.530 148.504 155.452 1.00 64.34  ? 38  DG  I N3    1 
ATOM   8491  C  C4    . DG  I 5  112 ? 194.607 149.008 156.699 1.00 64.34  ? 38  DG  I C4    1 
ATOM   8492  P  P     . DA  I 5  113 ? 188.440 148.431 156.059 1.00 63.75  ? 39  DA  I P     1 
ATOM   8493  O  OP1   . DA  I 5  113 ? 187.227 148.824 155.329 1.00 63.75  ? 39  DA  I OP1   1 
ATOM   8494  O  OP2   . DA  I 5  113 ? 188.276 147.794 157.377 1.00 63.75  ? 39  DA  I OP2   1 
ATOM   8495  O  "O5'" . DA  I 5  113 ? 189.281 147.476 155.107 1.00 63.75  ? 39  DA  I "O5'" 1 
ATOM   8496  C  "C5'" . DA  I 5  113 ? 188.657 146.867 153.996 1.00 63.75  ? 39  DA  I "C5'" 1 
ATOM   8497  C  "C4'" . DA  I 5  113 ? 189.694 146.306 153.052 1.00 63.75  ? 39  DA  I "C4'" 1 
ATOM   8498  O  "O4'" . DA  I 5  113 ? 191.015 146.589 153.575 1.00 63.75  ? 39  DA  I "O4'" 1 
ATOM   8499  C  "C3'" . DA  I 5  113 ? 189.653 144.798 152.861 1.00 63.75  ? 39  DA  I "C3'" 1 
ATOM   8500  O  "O3'" . DA  I 5  113 ? 190.127 144.497 151.558 1.00 63.75  ? 39  DA  I "O3'" 1 
ATOM   8501  C  "C2'" . DA  I 5  113 ? 190.606 144.318 153.946 1.00 63.75  ? 39  DA  I "C2'" 1 
ATOM   8502  C  "C1'" . DA  I 5  113 ? 191.678 145.383 153.884 1.00 63.75  ? 39  DA  I "C1'" 1 
ATOM   8503  N  N9    . DA  I 5  113 ? 192.382 145.565 155.139 1.00 63.75  ? 39  DA  I N9    1 
ATOM   8504  C  C8    . DA  I 5  113 ? 191.882 146.099 156.285 1.00 63.75  ? 39  DA  I C8    1 
ATOM   8505  N  N7    . DA  I 5  113 ? 192.750 146.160 157.263 1.00 63.75  ? 39  DA  I N7    1 
ATOM   8506  C  C5    . DA  I 5  113 ? 193.894 145.621 156.716 1.00 63.75  ? 39  DA  I C5    1 
ATOM   8507  C  C6    . DA  I 5  113 ? 195.176 145.398 157.236 1.00 63.75  ? 39  DA  I C6    1 
ATOM   8508  N  N6    . DA  I 5  113 ? 195.517 145.697 158.488 1.00 63.75  ? 39  DA  I N6    1 
ATOM   8509  N  N1    . DA  I 5  113 ? 196.091 144.842 156.426 1.00 63.75  ? 39  DA  I N1    1 
ATOM   8510  C  C2    . DA  I 5  113 ? 195.746 144.541 155.173 1.00 63.75  ? 39  DA  I C2    1 
ATOM   8511  N  N3    . DA  I 5  113 ? 194.574 144.705 154.571 1.00 63.75  ? 39  DA  I N3    1 
ATOM   8512  C  C4    . DA  I 5  113 ? 193.689 145.266 155.403 1.00 63.75  ? 39  DA  I C4    1 
ATOM   8513  P  P     . DC  I 5  114 ? 190.498 143.004 151.093 1.00 67.38  ? 40  DC  I P     1 
ATOM   8514  O  OP1   . DC  I 5  114 ? 190.196 142.983 149.650 1.00 67.38  ? 40  DC  I OP1   1 
ATOM   8515  O  OP2   . DC  I 5  114 ? 189.899 141.948 151.939 1.00 67.38  ? 40  DC  I OP2   1 
ATOM   8516  O  "O5'" . DC  I 5  114 ? 192.086 142.950 151.256 1.00 67.38  ? 40  DC  I "O5'" 1 
ATOM   8517  C  "C5'" . DC  I 5  114 ? 192.895 142.471 150.185 1.00 67.38  ? 40  DC  I "C5'" 1 
ATOM   8518  C  "C4'" . DC  I 5  114 ? 193.588 141.181 150.579 1.00 67.38  ? 40  DC  I "C4'" 1 
ATOM   8519  O  "O4'" . DC  I 5  114 ? 194.363 141.421 151.777 1.00 67.38  ? 40  DC  I "O4'" 1 
ATOM   8520  C  "C3'" . DC  I 5  114 ? 192.638 140.022 150.884 1.00 67.38  ? 40  DC  I "C3'" 1 
ATOM   8521  O  "O3'" . DC  I 5  114 ? 192.915 138.919 150.040 1.00 67.38  ? 40  DC  I "O3'" 1 
ATOM   8522  C  "C2'" . DC  I 5  114 ? 192.869 139.700 152.357 1.00 67.38  ? 40  DC  I "C2'" 1 
ATOM   8523  C  "C1'" . DC  I 5  114 ? 194.168 140.396 152.712 1.00 67.38  ? 40  DC  I "C1'" 1 
ATOM   8524  N  N1    . DC  I 5  114 ? 194.101 140.997 154.068 1.00 67.38  ? 40  DC  I N1    1 
ATOM   8525  C  C2    . DC  I 5  114 ? 195.208 140.950 154.922 1.00 67.38  ? 40  DC  I C2    1 
ATOM   8526  O  O2    . DC  I 5  114 ? 196.260 140.430 154.534 1.00 67.38  ? 40  DC  I O2    1 
ATOM   8527  N  N3    . DC  I 5  114 ? 195.102 141.498 156.155 1.00 67.38  ? 40  DC  I N3    1 
ATOM   8528  C  C4    . DC  I 5  114 ? 193.960 142.051 156.538 1.00 67.38  ? 40  DC  I C4    1 
ATOM   8529  N  N4    . DC  I 5  114 ? 193.898 142.563 157.760 1.00 67.38  ? 40  DC  I N4    1 
ATOM   8530  C  C5    . DC  I 5  114 ? 192.821 142.084 155.697 1.00 67.38  ? 40  DC  I C5    1 
ATOM   8531  C  C6    . DC  I 5  114 ? 192.938 141.564 154.480 1.00 67.38  ? 40  DC  I C6    1 
ATOM   8532  P  P     . DC  I 5  115 ? 192.188 137.497 150.255 1.00 70.41  ? 41  DC  I P     1 
ATOM   8533  O  OP1   . DC  I 5  115 ? 192.201 136.833 148.937 1.00 70.41  ? 41  DC  I OP1   1 
ATOM   8534  O  OP2   . DC  I 5  115 ? 190.882 137.647 150.933 1.00 70.41  ? 41  DC  I OP2   1 
ATOM   8535  O  "O5'" . DC  I 5  115 ? 193.213 136.710 151.193 1.00 70.41  ? 41  DC  I "O5'" 1 
ATOM   8536  C  "C5'" . DC  I 5  115 ? 194.593 136.759 150.867 1.00 70.41  ? 41  DC  I "C5'" 1 
ATOM   8537  C  "C4'" . DC  I 5  115 ? 195.478 136.421 152.051 1.00 70.41  ? 41  DC  I "C4'" 1 
ATOM   8538  O  "O4'" . DC  I 5  115 ? 195.274 137.348 153.138 1.00 70.41  ? 41  DC  I "O4'" 1 
ATOM   8539  C  "C3'" . DC  I 5  115 ? 195.285 135.031 152.639 1.00 70.41  ? 41  DC  I "C3'" 1 
ATOM   8540  O  "O3'" . DC  I 5  115 ? 196.502 134.338 152.524 1.00 70.41  ? 41  DC  I "O3'" 1 
ATOM   8541  C  "C2'" . DC  I 5  115 ? 194.928 135.308 154.108 1.00 70.41  ? 41  DC  I "C2'" 1 
ATOM   8542  C  "C1'" . DC  I 5  115 ? 195.548 136.670 154.324 1.00 70.41  ? 41  DC  I "C1'" 1 
ATOM   8543  N  N1    . DC  I 5  115 ? 194.949 137.434 155.426 1.00 70.41  ? 41  DC  I N1    1 
ATOM   8544  C  C2    . DC  I 5  115 ? 195.681 137.677 156.599 1.00 70.41  ? 41  DC  I C2    1 
ATOM   8545  O  O2    . DC  I 5  115 ? 196.828 137.238 156.712 1.00 70.41  ? 41  DC  I O2    1 
ATOM   8546  N  N3    . DC  I 5  115 ? 195.098 138.395 157.591 1.00 70.41  ? 41  DC  I N3    1 
ATOM   8547  C  C4    . DC  I 5  115 ? 193.855 138.853 157.438 1.00 70.41  ? 41  DC  I C4    1 
ATOM   8548  N  N4    . DC  I 5  115 ? 193.319 139.556 158.439 1.00 70.41  ? 41  DC  I N4    1 
ATOM   8549  C  C5    . DC  I 5  115 ? 193.110 138.613 156.253 1.00 70.41  ? 41  DC  I C5    1 
ATOM   8550  C  C6    . DC  I 5  115 ? 193.693 137.911 155.288 1.00 70.41  ? 41  DC  I C6    1 
ATOM   8551  P  P     . DA  I 5  116 ? 196.549 132.735 152.550 1.00 75.38  ? 42  DA  I P     1 
ATOM   8552  O  OP1   . DA  I 5  116 ? 197.003 132.288 151.215 1.00 75.38  ? 42  DA  I OP1   1 
ATOM   8553  O  OP2   . DA  I 5  116 ? 195.274 132.221 153.093 1.00 75.38  ? 42  DA  I OP2   1 
ATOM   8554  O  "O5'" . DA  I 5  116 ? 197.696 132.434 153.618 1.00 75.38  ? 42  DA  I "O5'" 1 
ATOM   8555  C  "C5'" . DA  I 5  116 ? 198.075 133.446 154.549 1.00 75.38  ? 42  DA  I "C5'" 1 
ATOM   8556  C  "C4'" . DA  I 5  116 ? 197.793 133.001 155.966 1.00 75.38  ? 42  DA  I "C4'" 1 
ATOM   8557  O  "O4'" . DA  I 5  116 ? 197.163 134.079 156.714 1.00 75.38  ? 42  DA  I "O4'" 1 
ATOM   8558  C  "C3'" . DA  I 5  116 ? 196.840 131.798 156.094 1.00 75.38  ? 42  DA  I "C3'" 1 
ATOM   8559  O  "O3'" . DA  I 5  116 ? 197.361 130.882 157.035 1.00 75.38  ? 42  DA  I "O3'" 1 
ATOM   8560  C  "C2'" . DA  I 5  116 ? 195.571 132.444 156.619 1.00 75.38  ? 42  DA  I "C2'" 1 
ATOM   8561  C  "C1'" . DA  I 5  116 ? 196.193 133.478 157.515 1.00 75.38  ? 42  DA  I "C1'" 1 
ATOM   8562  N  N9    . DA  I 5  116 ? 195.247 134.450 158.029 1.00 75.38  ? 42  DA  I N9    1 
ATOM   8563  C  C8    . DA  I 5  116 ? 194.101 134.883 157.430 1.00 75.38  ? 42  DA  I C8    1 
ATOM   8564  N  N7    . DA  I 5  116 ? 193.425 135.738 158.149 1.00 75.38  ? 42  DA  I N7    1 
ATOM   8565  C  C5    . DA  I 5  116 ? 194.163 135.842 159.307 1.00 75.38  ? 42  DA  I C5    1 
ATOM   8566  C  C6    . DA  I 5  116 ? 193.982 136.593 160.467 1.00 75.38  ? 42  DA  I C6    1 
ATOM   8567  N  N6    . DA  I 5  116 ? 192.945 137.401 160.648 1.00 75.38  ? 42  DA  I N6    1 
ATOM   8568  N  N1    . DA  I 5  116 ? 194.901 136.469 161.445 1.00 75.38  ? 42  DA  I N1    1 
ATOM   8569  C  C2    . DA  I 5  116 ? 195.944 135.657 161.255 1.00 75.38  ? 42  DA  I C2    1 
ATOM   8570  N  N3    . DA  I 5  116 ? 196.221 134.898 160.201 1.00 75.38  ? 42  DA  I N3    1 
ATOM   8571  C  C4    . DA  I 5  116 ? 195.284 135.048 159.253 1.00 75.38  ? 42  DA  I C4    1 
ATOM   8572  P  P     . DA  I 5  117 ? 196.930 129.333 157.008 1.00 78.33  ? 43  DA  I P     1 
ATOM   8573  O  OP1   . DA  I 5  117 ? 197.750 128.661 155.975 1.00 78.33  ? 43  DA  I OP1   1 
ATOM   8574  O  OP2   . DA  I 5  117 ? 195.457 129.229 156.952 1.00 78.33  ? 43  DA  I OP2   1 
ATOM   8575  O  "O5'" . DA  I 5  117 ? 197.395 128.800 158.442 1.00 78.33  ? 43  DA  I "O5'" 1 
ATOM   8576  C  "C5'" . DA  I 5  117 ? 198.743 128.972 158.854 1.00 78.33  ? 43  DA  I "C5'" 1 
ATOM   8577  C  "C4'" . DA  I 5  117 ? 198.812 129.537 160.258 1.00 78.33  ? 43  DA  I "C4'" 1 
ATOM   8578  O  "O4'" . DA  I 5  117 ? 197.995 130.737 160.338 1.00 78.33  ? 43  DA  I "O4'" 1 
ATOM   8579  C  "C3'" . DA  I 5  117 ? 198.303 128.605 161.356 1.00 78.33  ? 43  DA  I "C3'" 1 
ATOM   8580  O  "O3'" . DA  I 5  117 ? 199.160 128.673 162.482 1.00 78.33  ? 43  DA  I "O3'" 1 
ATOM   8581  C  "C2'" . DA  I 5  117 ? 196.919 129.163 161.673 1.00 78.33  ? 43  DA  I "C2'" 1 
ATOM   8582  C  "C1'" . DA  I 5  117 ? 197.134 130.649 161.450 1.00 78.33  ? 43  DA  I "C1'" 1 
ATOM   8583  N  N9    . DA  I 5  117 ? 195.907 131.369 161.134 1.00 78.33  ? 43  DA  I N9    1 
ATOM   8584  C  C8    . DA  I 5  117 ? 195.203 131.293 159.977 1.00 78.33  ? 43  DA  I C8    1 
ATOM   8585  N  N7    . DA  I 5  117 ? 194.137 132.052 159.953 1.00 78.33  ? 43  DA  I N7    1 
ATOM   8586  C  C5    . DA  I 5  117 ? 194.132 132.657 161.191 1.00 78.33  ? 43  DA  I C5    1 
ATOM   8587  C  C6    . DA  I 5  117 ? 193.257 133.580 161.787 1.00 78.33  ? 43  DA  I C6    1 
ATOM   8588  N  N6    . DA  I 5  117 ? 192.173 134.057 161.176 1.00 78.33  ? 43  DA  I N6    1 
ATOM   8589  N  N1    . DA  I 5  117 ? 193.542 133.997 163.037 1.00 78.33  ? 43  DA  I N1    1 
ATOM   8590  C  C2    . DA  I 5  117 ? 194.635 133.510 163.644 1.00 78.33  ? 43  DA  I C2    1 
ATOM   8591  N  N3    . DA  I 5  117 ? 195.534 132.644 163.178 1.00 78.33  ? 43  DA  I N3    1 
ATOM   8592  C  C4    . DA  I 5  117 ? 195.225 132.257 161.935 1.00 78.33  ? 43  DA  I C4    1 
ATOM   8593  P  P     . DT  I 5  118 ? 198.950 127.670 163.717 1.00 75.18  ? 44  DT  I P     1 
ATOM   8594  O  OP1   . DT  I 5  118 ? 200.270 127.474 164.353 1.00 75.18  ? 44  DT  I OP1   1 
ATOM   8595  O  OP2   . DT  I 5  118 ? 198.185 126.505 163.223 1.00 75.18  ? 44  DT  I OP2   1 
ATOM   8596  O  "O5'" . DT  I 5  118 ? 198.007 128.482 164.722 1.00 75.18  ? 44  DT  I "O5'" 1 
ATOM   8597  C  "C5'" . DT  I 5  118 ? 198.477 129.682 165.314 1.00 75.18  ? 44  DT  I "C5'" 1 
ATOM   8598  C  "C4'" . DT  I 5  118 ? 197.551 130.150 166.427 1.00 75.18  ? 44  DT  I "C4'" 1 
ATOM   8599  O  "O4'" . DT  I 5  118 ? 196.410 130.846 165.865 1.00 75.18  ? 44  DT  I "O4'" 1 
ATOM   8600  C  "C3'" . DT  I 5  118 ? 196.973 129.051 167.323 1.00 75.18  ? 44  DT  I "C3'" 1 
ATOM   8601  O  "O3'" . DT  I 5  118 ? 197.033 129.479 168.675 1.00 75.18  ? 44  DT  I "O3'" 1 
ATOM   8602  C  "C2'" . DT  I 5  118 ? 195.530 128.939 166.832 1.00 75.18  ? 44  DT  I "C2'" 1 
ATOM   8603  C  "C1'" . DT  I 5  118 ? 195.239 130.379 166.486 1.00 75.18  ? 44  DT  I "C1'" 1 
ATOM   8604  N  N1    . DT  I 5  118 ? 194.126 130.573 165.543 1.00 75.18  ? 44  DT  I N1    1 
ATOM   8605  C  C2    . DT  I 5  118 ? 193.118 131.428 165.880 1.00 75.18  ? 44  DT  I C2    1 
ATOM   8606  O  O2    . DT  I 5  118 ? 193.077 132.019 166.936 1.00 75.18  ? 44  DT  I O2    1 
ATOM   8607  N  N3    . DT  I 5  118 ? 192.147 131.572 164.938 1.00 75.18  ? 44  DT  I N3    1 
ATOM   8608  C  C4    . DT  I 5  118 ? 192.092 130.961 163.711 1.00 75.18  ? 44  DT  I C4    1 
ATOM   8609  O  O4    . DT  I 5  118 ? 191.175 131.153 162.931 1.00 75.18  ? 44  DT  I O4    1 
ATOM   8610  C  C5    . DT  I 5  118 ? 193.185 130.077 163.412 1.00 75.18  ? 44  DT  I C5    1 
ATOM   8611  C  C7    . DT  I 5  118 ? 193.224 129.347 162.105 1.00 75.18  ? 44  DT  I C7    1 
ATOM   8612  C  C6    . DT  I 5  118 ? 194.144 129.931 164.332 1.00 75.18  ? 44  DT  I C6    1 
ATOM   8613  P  P     . DT  I 5  119 ? 196.489 128.541 169.862 1.00 71.66  ? 45  DT  I P     1 
ATOM   8614  O  OP1   . DT  I 5  119 ? 197.324 128.851 171.041 1.00 71.66  ? 45  DT  I OP1   1 
ATOM   8615  O  OP2   . DT  I 5  119 ? 196.400 127.146 169.382 1.00 71.66  ? 45  DT  I OP2   1 
ATOM   8616  O  "O5'" . DT  I 5  119 ? 195.011 129.088 170.144 1.00 71.66  ? 45  DT  I "O5'" 1 
ATOM   8617  C  "C5'" . DT  I 5  119 ? 194.831 130.231 170.984 1.00 71.66  ? 45  DT  I "C5'" 1 
ATOM   8618  C  "C4'" . DT  I 5  119 ? 193.369 130.434 171.350 1.00 71.66  ? 45  DT  I "C4'" 1 
ATOM   8619  O  "O4'" . DT  I 5  119 ? 192.584 130.573 170.146 1.00 71.66  ? 45  DT  I "O4'" 1 
ATOM   8620  C  "C3'" . DT  I 5  119 ? 192.727 129.296 172.141 1.00 71.66  ? 45  DT  I "C3'" 1 
ATOM   8621  O  "O3'" . DT  I 5  119 ? 191.879 129.832 173.156 1.00 71.66  ? 45  DT  I "O3'" 1 
ATOM   8622  C  "C2'" . DT  I 5  119 ? 191.929 128.554 171.075 1.00 71.66  ? 45  DT  I "C2'" 1 
ATOM   8623  C  "C1'" . DT  I 5  119 ? 191.481 129.711 170.213 1.00 71.66  ? 45  DT  I "C1'" 1 
ATOM   8624  N  N1    . DT  I 5  119 ? 191.108 129.337 168.840 1.00 71.66  ? 45  DT  I N1    1 
ATOM   8625  C  C2    . DT  I 5  119 ? 190.000 129.907 168.288 1.00 71.66  ? 45  DT  I C2    1 
ATOM   8626  O  O2    . DT  I 5  119 ? 189.307 130.708 168.873 1.00 71.66  ? 45  DT  I O2    1 
ATOM   8627  N  N3    . DT  I 5  119 ? 189.736 129.526 167.015 1.00 71.66  ? 45  DT  I N3    1 
ATOM   8628  C  C4    . DT  I 5  119 ? 190.449 128.637 166.253 1.00 71.66  ? 45  DT  I C4    1 
ATOM   8629  O  O4    . DT  I 5  119 ? 190.126 128.353 165.112 1.00 71.66  ? 45  DT  I O4    1 
ATOM   8630  C  C5    . DT  I 5  119 ? 191.602 128.070 166.885 1.00 71.66  ? 45  DT  I C5    1 
ATOM   8631  C  C7    . DT  I 5  119 ? 192.451 127.085 166.140 1.00 71.66  ? 45  DT  I C7    1 
ATOM   8632  C  C6    . DT  I 5  119 ? 191.881 128.444 168.139 1.00 71.66  ? 45  DT  I C6    1 
ATOM   8633  P  P     . DG  I 5  120 ? 192.307 129.695 174.699 1.00 72.70  ? 46  DG  I P     1 
ATOM   8634  O  OP1   . DG  I 5  120 ? 193.673 130.243 174.824 1.00 72.70  ? 46  DG  I OP1   1 
ATOM   8635  O  OP2   . DG  I 5  120 ? 192.018 128.307 175.116 1.00 72.70  ? 46  DG  I OP2   1 
ATOM   8636  O  "O5'" . DG  I 5  120 ? 191.289 130.635 175.500 1.00 72.70  ? 46  DG  I "O5'" 1 
ATOM   8637  C  "C5'" . DG  I 5  120 ? 191.039 131.989 175.088 1.00 72.70  ? 46  DG  I "C5'" 1 
ATOM   8638  C  "C4'" . DG  I 5  120 ? 189.572 132.216 174.693 1.00 72.70  ? 46  DG  I "C4'" 1 
ATOM   8639  O  "O4'" . DG  I 5  120 ? 189.272 131.475 173.491 1.00 72.70  ? 46  DG  I "O4'" 1 
ATOM   8640  C  "C3'" . DG  I 5  120 ? 188.499 131.794 175.710 1.00 72.70  ? 46  DG  I "C3'" 1 
ATOM   8641  O  "O3'" . DG  I 5  120 ? 187.353 132.607 175.547 1.00 72.70  ? 46  DG  I "O3'" 1 
ATOM   8642  C  "C2'" . DG  I 5  120 ? 188.171 130.388 175.232 1.00 72.70  ? 46  DG  I "C2'" 1 
ATOM   8643  C  "C1'" . DG  I 5  120 ? 188.167 130.644 173.741 1.00 72.70  ? 46  DG  I "C1'" 1 
ATOM   8644  N  N9    . DG  I 5  120 ? 188.305 129.469 172.918 1.00 72.70  ? 46  DG  I N9    1 
ATOM   8645  C  C8    . DG  I 5  120 ? 189.032 128.340 173.174 1.00 72.70  ? 46  DG  I C8    1 
ATOM   8646  N  N7    . DG  I 5  120 ? 188.969 127.462 172.212 1.00 72.70  ? 46  DG  I N7    1 
ATOM   8647  C  C5    . DG  I 5  120 ? 188.167 128.070 171.260 1.00 72.70  ? 46  DG  I C5    1 
ATOM   8648  C  C6    . DG  I 5  120 ? 187.738 127.611 169.998 1.00 72.70  ? 46  DG  I C6    1 
ATOM   8649  O  O6    . DG  I 5  120 ? 188.005 126.547 169.441 1.00 72.70  ? 46  DG  I O6    1 
ATOM   8650  N  N1    . DG  I 5  120 ? 186.933 128.545 169.362 1.00 72.70  ? 46  DG  I N1    1 
ATOM   8651  C  C2    . DG  I 5  120 ? 186.581 129.761 169.889 1.00 72.70  ? 46  DG  I C2    1 
ATOM   8652  N  N2    . DG  I 5  120 ? 185.800 130.537 169.135 1.00 72.70  ? 46  DG  I N2    1 
ATOM   8653  N  N3    . DG  I 5  120 ? 186.976 130.197 171.061 1.00 72.70  ? 46  DG  I N3    1 
ATOM   8654  C  C4    . DG  I 5  120 ? 187.760 129.303 171.688 1.00 72.70  ? 46  DG  I C4    1 
ATOM   8655  P  P     . DA  I 5  121 ? 187.158 133.985 176.346 1.00 74.62  ? 47  DA  I P     1 
ATOM   8656  O  OP1   . DA  I 5  121 ? 188.474 134.576 176.669 1.00 74.62  ? 47  DA  I OP1   1 
ATOM   8657  O  OP2   . DA  I 5  121 ? 186.195 133.729 177.432 1.00 74.62  ? 47  DA  I OP2   1 
ATOM   8658  O  "O5'" . DA  I 5  121 ? 186.410 134.899 175.274 1.00 74.62  ? 47  DA  I "O5'" 1 
ATOM   8659  C  "C5'" . DA  I 5  121 ? 186.238 134.407 173.945 1.00 74.62  ? 47  DA  I "C5'" 1 
ATOM   8660  C  "C4'" . DA  I 5  121 ? 184.784 134.488 173.509 1.00 74.62  ? 47  DA  I "C4'" 1 
ATOM   8661  O  "O4'" . DA  I 5  121 ? 184.412 133.264 172.807 1.00 74.62  ? 47  DA  I "O4'" 1 
ATOM   8662  C  "C3'" . DA  I 5  121 ? 183.787 134.583 174.637 1.00 74.62  ? 47  DA  I "C3'" 1 
ATOM   8663  O  "O3'" . DA  I 5  121 ? 182.567 135.066 174.124 1.00 74.62  ? 47  DA  I "O3'" 1 
ATOM   8664  C  "C2'" . DA  I 5  121 ? 183.671 133.121 175.017 1.00 74.62  ? 47  DA  I "C2'" 1 
ATOM   8665  C  "C1'" . DA  I 5  121 ? 183.567 132.482 173.637 1.00 74.62  ? 47  DA  I "C1'" 1 
ATOM   8666  N  N9    . DA  I 5  121 ? 184.050 131.106 173.608 1.00 74.62  ? 47  DA  I N9    1 
ATOM   8667  C  C8    . DA  I 5  121 ? 184.781 130.491 174.570 1.00 74.62  ? 47  DA  I C8    1 
ATOM   8668  N  N7    . DA  I 5  121 ? 185.110 129.257 174.282 1.00 74.62  ? 47  DA  I N7    1 
ATOM   8669  C  C5    . DA  I 5  121 ? 184.546 129.044 173.044 1.00 74.62  ? 47  DA  I C5    1 
ATOM   8670  C  C6    . DA  I 5  121 ? 184.525 127.922 172.192 1.00 74.62  ? 47  DA  I C6    1 
ATOM   8671  N  N6    . DA  I 5  121 ? 185.126 126.762 172.482 1.00 74.62  ? 47  DA  I N6    1 
ATOM   8672  N  N1    . DA  I 5  121 ? 183.870 128.035 171.026 1.00 74.62  ? 47  DA  I N1    1 
ATOM   8673  C  C2    . DA  I 5  121 ? 183.281 129.197 170.726 1.00 74.62  ? 47  DA  I C2    1 
ATOM   8674  N  N3    . DA  I 5  121 ? 183.225 130.318 171.449 1.00 74.62  ? 47  DA  I N3    1 
ATOM   8675  C  C4    . DA  I 5  121 ? 183.888 130.174 172.605 1.00 74.62  ? 47  DA  I C4    1 
ATOM   8676  P  P     . DG  I 5  122 ? 181.562 135.907 175.046 1.00 74.00  ? 48  DG  I P     1 
ATOM   8677  O  OP1   . DG  I 5  122 ? 181.930 137.335 174.954 1.00 74.00  ? 48  DG  I OP1   1 
ATOM   8678  O  OP2   . DG  I 5  122 ? 181.480 135.257 176.367 1.00 74.00  ? 48  DG  I OP2   1 
ATOM   8679  O  "O5'" . DG  I 5  122 ? 180.164 135.694 174.321 1.00 74.00  ? 48  DG  I "O5'" 1 
ATOM   8680  C  "C5'" . DG  I 5  122 ? 180.043 135.980 172.941 1.00 74.00  ? 48  DG  I "C5'" 1 
ATOM   8681  C  "C4'" . DG  I 5  122 ? 179.211 134.934 172.212 1.00 74.00  ? 48  DG  I "C4'" 1 
ATOM   8682  O  "O4'" . DG  I 5  122 ? 179.841 133.638 172.312 1.00 74.00  ? 48  DG  I "O4'" 1 
ATOM   8683  C  "C3'" . DG  I 5  122 ? 177.780 134.744 172.705 1.00 74.00  ? 48  DG  I "C3'" 1 
ATOM   8684  O  "O3'" . DG  I 5  122 ? 176.963 134.453 171.602 1.00 74.00  ? 48  DG  I "O3'" 1 
ATOM   8685  C  "C2'" . DG  I 5  122 ? 177.907 133.537 173.632 1.00 74.00  ? 48  DG  I "C2'" 1 
ATOM   8686  C  "C1'" . DG  I 5  122 ? 178.960 132.714 172.917 1.00 74.00  ? 48  DG  I "C1'" 1 
ATOM   8687  N  N9    . DG  I 5  122 ? 179.764 131.900 173.800 1.00 74.00  ? 48  DG  I N9    1 
ATOM   8688  C  C8    . DG  I 5  122 ? 180.281 132.267 175.009 1.00 74.00  ? 48  DG  I C8    1 
ATOM   8689  N  N7    . DG  I 5  122 ? 180.995 131.336 175.568 1.00 74.00  ? 48  DG  I N7    1 
ATOM   8690  C  C5    . DG  I 5  122 ? 180.972 130.303 174.657 1.00 74.00  ? 48  DG  I C5    1 
ATOM   8691  C  C6    . DG  I 5  122 ? 181.573 129.038 174.715 1.00 74.00  ? 48  DG  I C6    1 
ATOM   8692  O  O6    . DG  I 5  122 ? 182.283 128.565 175.609 1.00 74.00  ? 48  DG  I O6    1 
ATOM   8693  N  N1    . DG  I 5  122 ? 181.288 128.289 173.583 1.00 74.00  ? 48  DG  I N1    1 
ATOM   8694  C  C2    . DG  I 5  122 ? 180.505 128.715 172.537 1.00 74.00  ? 48  DG  I C2    1 
ATOM   8695  N  N2    . DG  I 5  122 ? 180.344 127.857 171.525 1.00 74.00  ? 48  DG  I N2    1 
ATOM   8696  N  N3    . DG  I 5  122 ? 179.940 129.902 172.475 1.00 74.00  ? 48  DG  I N3    1 
ATOM   8697  C  C4    . DG  I 5  122 ? 180.221 130.642 173.560 1.00 74.00  ? 48  DG  I C4    1 
ATOM   8698  P  P     . DC  I 5  123 ? 175.365 134.573 171.685 1.00 76.13  ? 49  DC  I P     1 
ATOM   8699  O  OP1   . DC  I 5  123 ? 174.992 135.713 170.831 1.00 76.13  ? 49  DC  I OP1   1 
ATOM   8700  O  OP2   . DC  I 5  123 ? 174.894 134.530 173.086 1.00 76.13  ? 49  DC  I OP2   1 
ATOM   8701  O  "O5'" . DC  I 5  123 ? 174.882 133.232 170.968 1.00 76.13  ? 49  DC  I "O5'" 1 
ATOM   8702  C  "C5'" . DC  I 5  123 ? 175.761 132.563 170.067 1.00 76.13  ? 49  DC  I "C5'" 1 
ATOM   8703  C  "C4'" . DC  I 5  123 ? 175.429 131.090 169.964 1.00 76.13  ? 49  DC  I "C4'" 1 
ATOM   8704  O  "O4'" . DC  I 5  123 ? 176.364 130.317 170.761 1.00 76.13  ? 49  DC  I "O4'" 1 
ATOM   8705  C  "C3'" . DC  I 5  123 ? 174.040 130.710 170.459 1.00 76.13  ? 49  DC  I "C3'" 1 
ATOM   8706  O  "O3'" . DC  I 5  123 ? 173.498 129.700 169.639 1.00 76.13  ? 49  DC  I "O3'" 1 
ATOM   8707  C  "C2'" . DC  I 5  123 ? 174.321 130.187 171.853 1.00 76.13  ? 49  DC  I "C2'" 1 
ATOM   8708  C  "C1'" . DC  I 5  123 ? 175.642 129.477 171.633 1.00 76.13  ? 49  DC  I "C1'" 1 
ATOM   8709  N  N1    . DC  I 5  123 ? 176.436 129.295 172.880 1.00 76.13  ? 49  DC  I N1    1 
ATOM   8710  C  C2    . DC  I 5  123 ? 177.126 128.105 173.103 1.00 76.13  ? 49  DC  I C2    1 
ATOM   8711  O  O2    . DC  I 5  123 ? 177.070 127.204 172.265 1.00 76.13  ? 49  DC  I O2    1 
ATOM   8712  N  N3    . DC  I 5  123 ? 177.839 127.971 174.243 1.00 76.13  ? 49  DC  I N3    1 
ATOM   8713  C  C4    . DC  I 5  123 ? 177.867 128.959 175.128 1.00 76.13  ? 49  DC  I C4    1 
ATOM   8714  N  N4    . DC  I 5  123 ? 178.585 128.786 176.238 1.00 76.13  ? 49  DC  I N4    1 
ATOM   8715  C  C5    . DC  I 5  123 ? 177.168 130.171 174.917 1.00 76.13  ? 49  DC  I C5    1 
ATOM   8716  C  C6    . DC  I 5  123 ? 176.472 130.290 173.793 1.00 76.13  ? 49  DC  I C6    1 
ATOM   8717  P  P     . DG  I 5  124 ? 171.908 129.580 169.463 1.00 87.08  ? 50  DG  I P     1 
ATOM   8718  O  OP1   . DG  I 5  124 ? 171.579 129.885 168.057 1.00 87.08  ? 50  DG  I OP1   1 
ATOM   8719  O  OP2   . DG  I 5  124 ? 171.287 130.356 170.552 1.00 87.08  ? 50  DG  I OP2   1 
ATOM   8720  O  "O5'" . DG  I 5  124 ? 171.607 128.036 169.726 1.00 87.08  ? 50  DG  I "O5'" 1 
ATOM   8721  C  "C5'" . DG  I 5  124 ? 172.029 127.071 168.776 1.00 87.08  ? 50  DG  I "C5'" 1 
ATOM   8722  C  "C4'" . DG  I 5  124 ? 172.079 125.672 169.369 1.00 87.08  ? 50  DG  I "C4'" 1 
ATOM   8723  O  "O4'" . DG  I 5  124 ? 173.136 125.587 170.362 1.00 87.08  ? 50  DG  I "O4'" 1 
ATOM   8724  C  "C3'" . DG  I 5  124 ? 170.806 125.193 170.051 1.00 87.08  ? 50  DG  I "C3'" 1 
ATOM   8725  O  "O3'" . DG  I 5  124 ? 170.604 123.817 169.744 1.00 87.08  ? 50  DG  I "O3'" 1 
ATOM   8726  C  "C2'" . DG  I 5  124 ? 171.122 125.404 171.524 1.00 87.08  ? 50  DG  I "C2'" 1 
ATOM   8727  C  "C1'" . DG  I 5  124 ? 172.613 125.109 171.579 1.00 87.08  ? 50  DG  I "C1'" 1 
ATOM   8728  N  N9    . DG  I 5  124 ? 173.280 125.816 172.667 1.00 87.08  ? 50  DG  I N9    1 
ATOM   8729  C  C8    . DG  I 5  124 ? 173.216 127.154 172.912 1.00 87.08  ? 50  DG  I C8    1 
ATOM   8730  N  N7    . DG  I 5  124 ? 173.899 127.532 173.948 1.00 87.08  ? 50  DG  I N7    1 
ATOM   8731  C  C5    . DG  I 5  124 ? 174.434 126.365 174.437 1.00 87.08  ? 50  DG  I C5    1 
ATOM   8732  C  C6    . DG  I 5  124 ? 175.256 126.167 175.547 1.00 87.08  ? 50  DG  I C6    1 
ATOM   8733  O  O6    . DG  I 5  124 ? 175.674 127.012 176.336 1.00 87.08  ? 50  DG  I O6    1 
ATOM   8734  N  N1    . DG  I 5  124 ? 175.589 124.836 175.706 1.00 87.08  ? 50  DG  I N1    1 
ATOM   8735  C  C2    . DG  I 5  124 ? 175.172 123.820 174.890 1.00 87.08  ? 50  DG  I C2    1 
ATOM   8736  N  N2    . DG  I 5  124 ? 175.604 122.593 175.201 1.00 87.08  ? 50  DG  I N2    1 
ATOM   8737  N  N3    . DG  I 5  124 ? 174.399 123.995 173.826 1.00 87.08  ? 50  DG  I N3    1 
ATOM   8738  C  C4    . DG  I 5  124 ? 174.073 125.293 173.663 1.00 87.08  ? 50  DG  I C4    1 
ATOM   8739  P  P     . DG  I 5  125 ? 169.230 123.047 170.090 1.00 95.91  ? 51  DG  I P     1 
ATOM   8740  O  OP1   . DG  I 5  125 ? 168.640 122.643 168.798 1.00 95.91  ? 51  DG  I OP1   1 
ATOM   8741  O  OP2   . DG  I 5  125 ? 168.380 123.800 171.036 1.00 95.91  ? 51  DG  I OP2   1 
ATOM   8742  O  "O5'" . DG  I 5  125 ? 169.751 121.740 170.851 1.00 95.91  ? 51  DG  I "O5'" 1 
ATOM   8743  C  "C5'" . DG  I 5  125 ? 171.126 121.670 171.245 1.00 95.91  ? 51  DG  I "C5'" 1 
ATOM   8744  C  "C4'" . DG  I 5  125 ? 171.427 120.438 172.078 1.00 95.91  ? 51  DG  I "C4'" 1 
ATOM   8745  O  "O4'" . DG  I 5  125 ? 172.218 120.823 173.224 1.00 95.91  ? 51  DG  I "O4'" 1 
ATOM   8746  C  "C3'" . DG  I 5  125 ? 170.233 119.739 172.680 1.00 95.91  ? 51  DG  I "C3'" 1 
ATOM   8747  O  "O3'" . DG  I 5  125 ? 170.627 118.439 173.071 1.00 95.91  ? 51  DG  I "O3'" 1 
ATOM   8748  C  "C2'" . DG  I 5  125 ? 169.959 120.611 173.895 1.00 95.91  ? 51  DG  I "C2'" 1 
ATOM   8749  C  "C1'" . DG  I 5  125 ? 171.378 120.939 174.361 1.00 95.91  ? 51  DG  I "C1'" 1 
ATOM   8750  N  N9    . DG  I 5  125 ? 171.509 122.290 174.858 1.00 95.91  ? 51  DG  I N9    1 
ATOM   8751  C  C8    . DG  I 5  125 ? 170.998 123.414 174.287 1.00 95.91  ? 51  DG  I C8    1 
ATOM   8752  N  N7    . DG  I 5  125 ? 171.278 124.502 174.932 1.00 95.91  ? 51  DG  I N7    1 
ATOM   8753  C  C5    . DG  I 5  125 ? 172.027 124.070 176.005 1.00 95.91  ? 51  DG  I C5    1 
ATOM   8754  C  C6    . DG  I 5  125 ? 172.601 124.804 177.051 1.00 95.91  ? 51  DG  I C6    1 
ATOM   8755  O  O6    . DG  I 5  125 ? 172.564 126.021 177.231 1.00 95.91  ? 51  DG  I O6    1 
ATOM   8756  N  N1    . DG  I 5  125 ? 173.275 123.984 177.942 1.00 95.91  ? 51  DG  I N1    1 
ATOM   8757  C  C2    . DG  I 5  125 ? 173.378 122.622 177.835 1.00 95.91  ? 51  DG  I C2    1 
ATOM   8758  N  N2    . DG  I 5  125 ? 174.069 121.997 178.792 1.00 95.91  ? 51  DG  I N2    1 
ATOM   8759  N  N3    . DG  I 5  125 ? 172.838 121.916 176.853 1.00 95.91  ? 51  DG  I N3    1 
ATOM   8760  C  C4    . DG  I 5  125 ? 172.178 122.706 175.979 1.00 95.91  ? 51  DG  I C4    1 
ATOM   8761  P  P     . DC  I 5  126 ? 169.552 117.406 173.658 1.00 96.42  ? 52  DC  I P     1 
ATOM   8762  O  OP1   . DC  I 5  126 ? 170.050 116.046 173.352 1.00 96.42  ? 52  DC  I OP1   1 
ATOM   8763  O  OP2   . DC  I 5  126 ? 168.218 117.850 173.193 1.00 96.42  ? 52  DC  I OP2   1 
ATOM   8764  O  "O5'" . DC  I 5  126 ? 169.614 117.635 175.239 1.00 96.42  ? 52  DC  I "O5'" 1 
ATOM   8765  C  "C5'" . DC  I 5  126 ? 170.851 117.523 175.925 1.00 96.42  ? 52  DC  I "C5'" 1 
ATOM   8766  C  "C4'" . DC  I 5  126 ? 170.670 117.894 177.382 1.00 96.42  ? 52  DC  I "C4'" 1 
ATOM   8767  O  "O4'" . DC  I 5  126 ? 170.893 119.310 177.543 1.00 96.42  ? 52  DC  I "O4'" 1 
ATOM   8768  C  "C3'" . DC  I 5  126 ? 169.270 117.626 177.917 1.00 96.42  ? 52  DC  I "C3'" 1 
ATOM   8769  O  "O3'" . DC  I 5  126 ? 169.247 116.458 178.807 1.00 96.42  ? 52  DC  I "O3'" 1 
ATOM   8770  C  "C2'" . DC  I 5  126 ? 168.827 118.940 178.574 1.00 96.42  ? 52  DC  I "C2'" 1 
ATOM   8771  C  "C1'" . DC  I 5  126 ? 170.090 119.788 178.589 1.00 96.42  ? 52  DC  I "C1'" 1 
ATOM   8772  N  N1    . DC  I 5  126 ? 169.832 121.227 178.348 1.00 96.42  ? 52  DC  I N1    1 
ATOM   8773  C  C2    . DC  I 5  126 ? 170.315 122.183 179.245 1.00 96.42  ? 52  DC  I C2    1 
ATOM   8774  O  O2    . DC  I 5  126 ? 170.946 121.815 180.238 1.00 96.42  ? 52  DC  I O2    1 
ATOM   8775  N  N3    . DC  I 5  126 ? 170.063 123.491 178.999 1.00 96.42  ? 52  DC  I N3    1 
ATOM   8776  C  C4    . DC  I 5  126 ? 169.368 123.844 177.920 1.00 96.42  ? 52  DC  I C4    1 
ATOM   8777  N  N4    . DC  I 5  126 ? 169.149 125.142 177.712 1.00 96.42  ? 52  DC  I N4    1 
ATOM   8778  C  C5    . DC  I 5  126 ? 168.879 122.885 176.997 1.00 96.42  ? 52  DC  I C5    1 
ATOM   8779  C  C6    . DC  I 5  126 ? 169.129 121.603 177.250 1.00 96.42  ? 52  DC  I C6    1 
ATOM   8780  P  P     . DC  I 5  127 ? 169.646 116.500 180.374 1.00 96.03  ? 53  DC  I P     1 
ATOM   8781  O  OP1   . DC  I 5  127 ? 170.833 117.346 180.619 1.00 96.03  ? 53  DC  I OP1   1 
ATOM   8782  O  OP2   . DC  I 5  127 ? 169.724 115.080 180.776 1.00 96.03  ? 53  DC  I OP2   1 
ATOM   8783  O  "O5'" . DC  I 5  127 ? 168.350 117.091 181.111 1.00 96.03  ? 53  DC  I "O5'" 1 
ATOM   8784  C  "C5'" . DC  I 5  127 ? 168.117 116.833 182.491 1.00 96.03  ? 53  DC  I "C5'" 1 
ATOM   8785  C  "C4'" . DC  I 5  127 ? 169.012 117.686 183.373 1.00 96.03  ? 53  DC  I "C4'" 1 
ATOM   8786  O  "O4'" . DC  I 5  127 ? 169.348 118.927 182.690 1.00 96.03  ? 53  DC  I "O4'" 1 
ATOM   8787  C  "C3'" . DC  I 5  127 ? 168.387 118.094 184.698 1.00 96.03  ? 53  DC  I "C3'" 1 
ATOM   8788  O  "O3'" . DC  I 5  127 ? 169.372 118.115 185.719 1.00 96.03  ? 53  DC  I "O3'" 1 
ATOM   8789  C  "C2'" . DC  I 5  127 ? 167.867 119.486 184.395 1.00 96.03  ? 53  DC  I "C2'" 1 
ATOM   8790  C  "C1'" . DC  I 5  127 ? 168.939 120.028 183.474 1.00 96.03  ? 53  DC  I "C1'" 1 
ATOM   8791  N  N1    . DC  I 5  127 ? 168.429 121.082 182.562 1.00 96.03  ? 53  DC  I N1    1 
ATOM   8792  C  C2    . DC  I 5  127 ? 168.601 122.438 182.876 1.00 96.03  ? 53  DC  I C2    1 
ATOM   8793  O  O2    . DC  I 5  127 ? 169.194 122.754 183.912 1.00 96.03  ? 53  DC  I O2    1 
ATOM   8794  N  N3    . DC  I 5  127 ? 168.115 123.372 182.020 1.00 96.03  ? 53  DC  I N3    1 
ATOM   8795  C  C4    . DC  I 5  127 ? 167.479 122.990 180.913 1.00 96.03  ? 53  DC  I C4    1 
ATOM   8796  N  N4    . DC  I 5  127 ? 167.014 123.938 180.099 1.00 96.03  ? 53  DC  I N4    1 
ATOM   8797  C  C5    . DC  I 5  127 ? 167.287 121.620 180.589 1.00 96.03  ? 53  DC  I C5    1 
ATOM   8798  C  C6    . DC  I 5  127 ? 167.770 120.714 181.435 1.00 96.03  ? 53  DC  I C6    1 
ATOM   8799  P  P     . DT  I 5  128 ? 168.970 118.488 187.229 1.00 100.09 ? 54  DT  I P     1 
ATOM   8800  O  OP1   . DT  I 5  128 ? 169.952 117.869 188.140 1.00 100.09 ? 54  DT  I OP1   1 
ATOM   8801  O  OP2   . DT  I 5  128 ? 167.533 118.177 187.394 1.00 100.09 ? 54  DT  I OP2   1 
ATOM   8802  O  "O5'" . DT  I 5  128 ? 169.168 120.071 187.293 1.00 100.09 ? 54  DT  I "O5'" 1 
ATOM   8803  C  "C5'" . DT  I 5  128 ? 169.573 120.692 188.494 1.00 100.09 ? 54  DT  I "C5'" 1 
ATOM   8804  C  "C4'" . DT  I 5  128 ? 168.522 121.669 188.982 1.00 100.09 ? 54  DT  I "C4'" 1 
ATOM   8805  O  "O4'" . DT  I 5  128 ? 167.975 122.417 187.857 1.00 100.09 ? 54  DT  I "O4'" 1 
ATOM   8806  C  "C3'" . DT  I 5  128 ? 167.313 121.025 189.663 1.00 100.09 ? 54  DT  I "C3'" 1 
ATOM   8807  O  "O3'" . DT  I 5  128 ? 166.857 121.870 190.699 1.00 100.09 ? 54  DT  I "O3'" 1 
ATOM   8808  C  "C2'" . DT  I 5  128 ? 166.312 120.991 188.530 1.00 100.09 ? 54  DT  I "C2'" 1 
ATOM   8809  C  "C1'" . DT  I 5  128 ? 166.574 122.363 187.957 1.00 100.09 ? 54  DT  I "C1'" 1 
ATOM   8810  N  N1    . DT  I 5  128 ? 165.939 122.626 186.626 1.00 100.09 ? 54  DT  I N1    1 
ATOM   8811  C  C2    . DT  I 5  128 ? 165.793 123.922 186.208 1.00 100.09 ? 54  DT  I C2    1 
ATOM   8812  O  O2    . DT  I 5  128 ? 166.175 124.878 186.853 1.00 100.09 ? 54  DT  I O2    1 
ATOM   8813  N  N3    . DT  I 5  128 ? 165.195 124.065 184.993 1.00 100.09 ? 54  DT  I N3    1 
ATOM   8814  C  C4    . DT  I 5  128 ? 164.724 123.065 184.171 1.00 100.09 ? 54  DT  I C4    1 
ATOM   8815  O  O4    . DT  I 5  128 ? 164.201 123.298 183.096 1.00 100.09 ? 54  DT  I O4    1 
ATOM   8816  C  C5    . DT  I 5  128 ? 164.888 121.731 184.669 1.00 100.09 ? 54  DT  I C5    1 
ATOM   8817  C  C7    . DT  I 5  128 ? 164.405 120.569 183.860 1.00 100.09 ? 54  DT  I C7    1 
ATOM   8818  C  C6    . DT  I 5  128 ? 165.470 121.576 185.868 1.00 100.09 ? 54  DT  I C6    1 
ATOM   8819  P  P     . DC  I 5  129 ? 166.437 121.266 192.128 1.00 105.56 ? 55  DC  I P     1 
ATOM   8820  O  OP1   . DC  I 5  129 ? 167.468 120.290 192.537 1.00 105.56 ? 55  DC  I OP1   1 
ATOM   8821  O  OP2   . DC  I 5  129 ? 165.020 120.855 192.058 1.00 105.56 ? 55  DC  I OP2   1 
ATOM   8822  O  "O5'" . DC  I 5  129 ? 166.512 122.531 193.095 1.00 105.56 ? 55  DC  I "O5'" 1 
ATOM   8823  C  "C5'" . DC  I 5  129 ? 167.184 123.704 192.658 1.00 105.56 ? 55  DC  I "C5'" 1 
ATOM   8824  C  "C4'" . DC  I 5  129 ? 166.204 124.798 192.250 1.00 105.56 ? 55  DC  I "C4'" 1 
ATOM   8825  O  "O4'" . DC  I 5  129 ? 165.646 124.538 190.936 1.00 105.56 ? 55  DC  I "O4'" 1 
ATOM   8826  C  "C3'" . DC  I 5  129 ? 164.997 124.995 193.169 1.00 105.56 ? 55  DC  I "C3'" 1 
ATOM   8827  O  "O3'" . DC  I 5  129 ? 164.696 126.392 193.271 1.00 105.56 ? 55  DC  I "O3'" 1 
ATOM   8828  C  "C2'" . DC  I 5  129 ? 163.898 124.279 192.390 1.00 105.56 ? 55  DC  I "C2'" 1 
ATOM   8829  C  "C1'" . DC  I 5  129 ? 164.258 124.762 191.009 1.00 105.56 ? 55  DC  I "C1'" 1 
ATOM   8830  N  N1    . DC  I 5  129 ? 163.611 124.049 189.899 1.00 105.56 ? 55  DC  I N1    1 
ATOM   8831  C  C2    . DC  I 5  129 ? 163.093 124.783 188.840 1.00 105.56 ? 55  DC  I C2    1 
ATOM   8832  O  O2    . DC  I 5  129 ? 163.165 126.011 188.877 1.00 105.56 ? 55  DC  I O2    1 
ATOM   8833  N  N3    . DC  I 5  129 ? 162.523 124.127 187.809 1.00 105.56 ? 55  DC  I N3    1 
ATOM   8834  C  C4    . DC  I 5  129 ? 162.481 122.802 187.808 1.00 105.56 ? 55  DC  I C4    1 
ATOM   8835  N  N4    . DC  I 5  129 ? 161.902 122.197 186.773 1.00 105.56 ? 55  DC  I N4    1 
ATOM   8836  C  C5    . DC  I 5  129 ? 162.995 122.036 188.884 1.00 105.56 ? 55  DC  I C5    1 
ATOM   8837  C  C6    . DC  I 5  129 ? 163.554 122.697 189.899 1.00 105.56 ? 55  DC  I C6    1 
ATOM   8838  P  P     . DG  I 5  130 ? 165.830 127.489 193.595 1.00 109.71 ? 56  DG  I P     1 
ATOM   8839  O  OP1   . DG  I 5  130 ? 166.381 128.026 192.332 1.00 109.71 ? 56  DG  I OP1   1 
ATOM   8840  O  OP2   . DG  I 5  130 ? 166.730 126.966 194.648 1.00 109.71 ? 56  DG  I OP2   1 
ATOM   8841  O  "O5'" . DG  I 5  130 ? 165.000 128.696 194.224 1.00 109.71 ? 56  DG  I "O5'" 1 
ATOM   8842  C  "C5'" . DG  I 5  130 ? 165.237 130.026 193.776 1.00 109.71 ? 56  DG  I "C5'" 1 
ATOM   8843  C  "C4'" . DG  I 5  130 ? 163.953 130.698 193.311 1.00 109.71 ? 56  DG  I "C4'" 1 
ATOM   8844  O  "O4'" . DG  I 5  130 ? 163.167 129.774 192.519 1.00 109.71 ? 56  DG  I "O4'" 1 
ATOM   8845  C  "C3'" . DG  I 5  130 ? 163.024 131.180 194.417 1.00 109.71 ? 56  DG  I "C3'" 1 
ATOM   8846  O  "O3'" . DG  I 5  130 ? 162.316 132.324 193.966 1.00 109.71 ? 56  DG  I "O3'" 1 
ATOM   8847  C  "C2'" . DG  I 5  130 ? 162.085 129.991 194.578 1.00 109.71 ? 56  DG  I "C2'" 1 
ATOM   8848  C  "C1'" . DG  I 5  130 ? 161.906 129.586 193.122 1.00 109.71 ? 56  DG  I "C1'" 1 
ATOM   8849  N  N9    . DG  I 5  130 ? 161.537 128.198 192.931 1.00 109.71 ? 56  DG  I N9    1 
ATOM   8850  C  C8    . DG  I 5  130 ? 161.716 127.161 193.809 1.00 109.71 ? 56  DG  I C8    1 
ATOM   8851  N  N7    . DG  I 5  130 ? 161.300 126.020 193.347 1.00 109.71 ? 56  DG  I N7    1 
ATOM   8852  C  C5    . DG  I 5  130 ? 160.840 126.315 192.072 1.00 109.71 ? 56  DG  I C5    1 
ATOM   8853  C  C6    . DG  I 5  130 ? 160.277 125.474 191.084 1.00 109.71 ? 56  DG  I C6    1 
ATOM   8854  O  O6    . DG  I 5  130 ? 160.074 124.256 191.133 1.00 109.71 ? 56  DG  I O6    1 
ATOM   8855  N  N1    . DG  I 5  130 ? 159.934 126.182 189.942 1.00 109.71 ? 56  DG  I N1    1 
ATOM   8856  C  C2    . DG  I 5  130 ? 160.115 127.529 189.769 1.00 109.71 ? 56  DG  I C2    1 
ATOM   8857  N  N2    . DG  I 5  130 ? 159.727 128.034 188.594 1.00 109.71 ? 56  DG  I N2    1 
ATOM   8858  N  N3    . DG  I 5  130 ? 160.640 128.329 190.684 1.00 109.71 ? 56  DG  I N3    1 
ATOM   8859  C  C4    . DG  I 5  130 ? 160.979 127.652 191.804 1.00 109.71 ? 56  DG  I C4    1 
ATOM   8860  P  P     . DG  I 5  131 ? 162.836 133.808 194.290 1.00 112.70 ? 57  DG  I P     1 
ATOM   8861  O  OP1   . DG  I 5  131 ? 164.284 133.883 194.025 1.00 112.70 ? 57  DG  I OP1   1 
ATOM   8862  O  OP2   . DG  I 5  131 ? 162.316 134.194 195.618 1.00 112.70 ? 57  DG  I OP2   1 
ATOM   8863  O  "O5'" . DG  I 5  131 ? 162.091 134.697 193.194 1.00 112.70 ? 57  DG  I "O5'" 1 
ATOM   8864  C  "C5'" . DG  I 5  131 ? 162.193 134.338 191.822 1.00 112.70 ? 57  DG  I "C5'" 1 
ATOM   8865  C  "C4'" . DG  I 5  131 ? 160.862 134.462 191.089 1.00 112.70 ? 57  DG  I "C4'" 1 
ATOM   8866  O  "O4'" . DG  I 5  131 ? 160.180 133.182 191.032 1.00 112.70 ? 57  DG  I "O4'" 1 
ATOM   8867  C  "C3'" . DG  I 5  131 ? 159.851 135.441 191.652 1.00 112.70 ? 57  DG  I "C3'" 1 
ATOM   8868  O  "O3'" . DG  I 5  131 ? 159.126 135.982 190.572 1.00 112.70 ? 57  DG  I "O3'" 1 
ATOM   8869  C  "C2'" . DG  I 5  131 ? 158.965 134.530 192.502 1.00 112.70 ? 57  DG  I "C2'" 1 
ATOM   8870  C  "C1'" . DG  I 5  131 ? 158.901 133.285 191.634 1.00 112.70 ? 57  DG  I "C1'" 1 
ATOM   8871  N  N9    . DG  I 5  131 ? 158.697 132.056 192.378 1.00 112.70 ? 57  DG  I N9    1 
ATOM   8872  C  C8    . DG  I 5  131 ? 159.108 131.795 193.653 1.00 112.70 ? 57  DG  I C8    1 
ATOM   8873  N  N7    . DG  I 5  131 ? 158.833 130.587 194.046 1.00 112.70 ? 57  DG  I N7    1 
ATOM   8874  C  C5    . DG  I 5  131 ? 158.231 130.001 192.950 1.00 112.70 ? 57  DG  I C5    1 
ATOM   8875  C  C6    . DG  I 5  131 ? 157.724 128.694 192.784 1.00 112.70 ? 57  DG  I C6    1 
ATOM   8876  O  O6    . DG  I 5  131 ? 157.712 127.764 193.597 1.00 112.70 ? 57  DG  I O6    1 
ATOM   8877  N  N1    . DG  I 5  131 ? 157.180 128.509 191.524 1.00 112.70 ? 57  DG  I N1    1 
ATOM   8878  C  C2    . DG  I 5  131 ? 157.138 129.462 190.543 1.00 112.70 ? 57  DG  I C2    1 
ATOM   8879  N  N2    . DG  I 5  131 ? 156.578 129.095 189.387 1.00 112.70 ? 57  DG  I N2    1 
ATOM   8880  N  N3    . DG  I 5  131 ? 157.611 130.696 190.685 1.00 112.70 ? 57  DG  I N3    1 
ATOM   8881  C  C4    . DG  I 5  131 ? 158.146 130.889 191.909 1.00 112.70 ? 57  DG  I C4    1 
ATOM   8882  P  P     . DC  I 5  132 ? 158.377 137.394 190.696 1.00 117.50 ? 58  DC  I P     1 
ATOM   8883  O  OP1   . DC  I 5  132 ? 159.214 138.385 189.987 1.00 117.50 ? 58  DC  I OP1   1 
ATOM   8884  O  OP2   . DC  I 5  132 ? 158.018 137.632 192.108 1.00 117.50 ? 58  DC  I OP2   1 
ATOM   8885  O  "O5'" . DC  I 5  132 ? 157.023 137.158 189.880 1.00 117.50 ? 58  DC  I "O5'" 1 
ATOM   8886  C  "C5'" . DC  I 5  132 ? 157.075 136.589 188.575 1.00 117.50 ? 58  DC  I "C5'" 1 
ATOM   8887  C  "C4'" . DC  I 5  132 ? 155.826 135.773 188.267 1.00 117.50 ? 58  DC  I "C4'" 1 
ATOM   8888  O  "O4'" . DC  I 5  132 ? 155.866 134.512 188.990 1.00 117.50 ? 58  DC  I "O4'" 1 
ATOM   8889  C  "C3'" . DC  I 5  132 ? 154.504 136.437 188.637 1.00 117.50 ? 58  DC  I "C3'" 1 
ATOM   8890  O  "O3'" . DC  I 5  132 ? 153.561 136.230 187.597 1.00 117.50 ? 58  DC  I "O3'" 1 
ATOM   8891  C  "C2'" . DC  I 5  132 ? 154.107 135.701 189.911 1.00 117.50 ? 58  DC  I "C2'" 1 
ATOM   8892  C  "C1'" . DC  I 5  132 ? 154.637 134.307 189.640 1.00 117.50 ? 58  DC  I "C1'" 1 
ATOM   8893  N  N1    . DC  I 5  132 ? 154.890 133.525 190.885 1.00 117.50 ? 58  DC  I N1    1 
ATOM   8894  C  C2    . DC  I 5  132 ? 154.584 132.155 190.942 1.00 117.50 ? 58  DC  I C2    1 
ATOM   8895  O  O2    . DC  I 5  132 ? 154.095 131.596 189.959 1.00 117.50 ? 58  DC  I O2    1 
ATOM   8896  N  N3    . DC  I 5  132 ? 154.830 131.482 192.096 1.00 117.50 ? 58  DC  I N3    1 
ATOM   8897  C  C4    . DC  I 5  132 ? 155.350 132.118 193.142 1.00 117.50 ? 58  DC  I C4    1 
ATOM   8898  N  N4    . DC  I 5  132 ? 155.583 131.421 194.259 1.00 117.50 ? 58  DC  I N4    1 
ATOM   8899  C  C5    . DC  I 5  132 ? 155.655 133.503 193.097 1.00 117.50 ? 58  DC  I C5    1 
ATOM   8900  C  C6    . DC  I 5  132 ? 155.418 134.156 191.961 1.00 117.50 ? 58  DC  I C6    1 
ATOM   8901  P  P     . DA  I 5  133 ? 152.170 137.036 187.573 1.00 117.73 ? 59  DA  I P     1 
ATOM   8902  O  OP1   . DA  I 5  133 ? 152.064 137.614 186.217 1.00 117.73 ? 59  DA  I OP1   1 
ATOM   8903  O  OP2   . DA  I 5  133 ? 152.058 137.930 188.740 1.00 117.73 ? 59  DA  I OP2   1 
ATOM   8904  O  "O5'" . DA  I 5  133 ? 151.065 135.890 187.728 1.00 117.73 ? 59  DA  I "O5'" 1 
ATOM   8905  C  "C5'" . DA  I 5  133 ? 150.840 135.008 186.652 1.00 117.73 ? 59  DA  I "C5'" 1 
ATOM   8906  C  "C4'" . DA  I 5  133 ? 150.455 133.620 187.128 1.00 117.73 ? 59  DA  I "C4'" 1 
ATOM   8907  O  "O4'" . DA  I 5  133 ? 151.200 133.244 188.318 1.00 117.73 ? 59  DA  I "O4'" 1 
ATOM   8908  C  "C3'" . DA  I 5  133 ? 148.992 133.434 187.490 1.00 117.73 ? 59  DA  I "C3'" 1 
ATOM   8909  O  "O3'" . DA  I 5  133 ? 148.610 132.170 187.028 1.00 117.73 ? 59  DA  I "O3'" 1 
ATOM   8910  C  "C2'" . DA  I 5  133 ? 149.029 133.466 189.017 1.00 117.73 ? 59  DA  I "C2'" 1 
ATOM   8911  C  "C1'" . DA  I 5  133 ? 150.299 132.690 189.246 1.00 117.73 ? 59  DA  I "C1'" 1 
ATOM   8912  N  N9    . DA  I 5  133 ? 150.890 132.794 190.579 1.00 117.73 ? 59  DA  I N9    1 
ATOM   8913  C  C8    . DA  I 5  133 ? 151.495 133.880 191.131 1.00 117.73 ? 59  DA  I C8    1 
ATOM   8914  N  N7    . DA  I 5  133 ? 151.997 133.668 192.322 1.00 117.73 ? 59  DA  I N7    1 
ATOM   8915  C  C5    . DA  I 5  133 ? 151.699 132.344 192.569 1.00 117.73 ? 59  DA  I C5    1 
ATOM   8916  C  C6    . DA  I 5  133 ? 151.942 131.504 193.669 1.00 117.73 ? 59  DA  I C6    1 
ATOM   8917  N  N6    . DA  I 5  133 ? 152.576 131.900 194.772 1.00 117.73 ? 59  DA  I N6    1 
ATOM   8918  N  N1    . DA  I 5  133 ? 151.507 130.239 193.593 1.00 117.73 ? 59  DA  I N1    1 
ATOM   8919  C  C2    . DA  I 5  133 ? 150.861 129.842 192.496 1.00 117.73 ? 59  DA  I C2    1 
ATOM   8920  N  N3    . DA  I 5  133 ? 150.577 130.532 191.400 1.00 117.73 ? 59  DA  I N3    1 
ATOM   8921  C  C4    . DA  I 5  133 ? 151.024 131.788 191.502 1.00 117.73 ? 59  DA  I C4    1 
ATOM   8922  P  P     . DC  I 5  134 ? 147.152 131.894 186.424 1.00 117.84 ? 60  DC  I P     1 
ATOM   8923  O  OP1   . DC  I 5  134 ? 147.323 131.555 184.995 1.00 117.84 ? 60  DC  I OP1   1 
ATOM   8924  O  OP2   . DC  I 5  134 ? 146.243 133.000 186.803 1.00 117.84 ? 60  DC  I OP2   1 
ATOM   8925  O  "O5'" . DC  I 5  134 ? 146.720 130.579 187.215 1.00 117.84 ? 60  DC  I "O5'" 1 
ATOM   8926  C  "C5'" . DC  I 5  134 ? 147.552 130.102 188.278 1.00 117.84 ? 60  DC  I "C5'" 1 
ATOM   8927  C  "C4'" . DC  I 5  134 ? 146.770 130.047 189.570 1.00 117.84 ? 60  DC  I "C4'" 1 
ATOM   8928  O  "O4'" . DC  I 5  134 ? 147.612 130.411 190.701 1.00 117.84 ? 60  DC  I "O4'" 1 
ATOM   8929  C  "C3'" . DC  I 5  134 ? 145.574 131.002 189.626 1.00 117.84 ? 60  DC  I "C3'" 1 
ATOM   8930  O  "O3'" . DC  I 5  134 ? 144.459 130.303 190.084 1.00 117.84 ? 60  DC  I "O3'" 1 
ATOM   8931  C  "C2'" . DC  I 5  134 ? 146.021 132.041 190.644 1.00 117.84 ? 60  DC  I "C2'" 1 
ATOM   8932  C  "C1'" . DC  I 5  134 ? 146.802 131.145 191.571 1.00 117.84 ? 60  DC  I "C1'" 1 
ATOM   8933  N  N1    . DC  I 5  134 ? 147.626 131.848 192.600 1.00 117.84 ? 60  DC  I N1    1 
ATOM   8934  C  C2    . DC  I 5  134 ? 147.945 131.186 193.785 1.00 117.84 ? 60  DC  I C2    1 
ATOM   8935  O  O2    . DC  I 5  134 ? 147.554 130.028 193.940 1.00 117.84 ? 60  DC  I O2    1 
ATOM   8936  N  N3    . DC  I 5  134 ? 148.677 131.829 194.722 1.00 117.84 ? 60  DC  I N3    1 
ATOM   8937  C  C4    . DC  I 5  134 ? 149.073 133.079 194.510 1.00 117.84 ? 60  DC  I C4    1 
ATOM   8938  N  N4    . DC  I 5  134 ? 149.798 133.676 195.461 1.00 117.84 ? 60  DC  I N4    1 
ATOM   8939  C  C5    . DC  I 5  134 ? 148.743 133.778 193.313 1.00 117.84 ? 60  DC  I C5    1 
ATOM   8940  C  C6    . DC  I 5  134 ? 148.017 133.132 192.400 1.00 117.84 ? 60  DC  I C6    1 
ATOM   8941  P  P     . DC  I 5  135 ? 143.015 130.599 189.462 1.00 120.92 ? 61  DC  I P     1 
ATOM   8942  O  OP1   . DC  I 5  135 ? 142.674 129.455 188.587 1.00 120.92 ? 61  DC  I OP1   1 
ATOM   8943  O  OP2   . DC  I 5  135 ? 143.057 131.963 188.891 1.00 120.92 ? 61  DC  I OP2   1 
ATOM   8944  O  "O5'" . DC  I 5  135 ? 142.055 130.615 190.744 1.00 120.92 ? 61  DC  I "O5'" 1 
ATOM   8945  C  "C5'" . DC  I 5  135 ? 141.354 129.439 191.126 1.00 120.92 ? 61  DC  I "C5'" 1 
ATOM   8946  C  "C4'" . DC  I 5  135 ? 142.016 128.761 192.310 1.00 120.92 ? 61  DC  I "C4'" 1 
ATOM   8947  O  "O4'" . DC  I 5  135 ? 143.215 129.492 192.704 1.00 120.92 ? 61  DC  I "O4'" 1 
ATOM   8948  C  "C3'" . DC  I 5  135 ? 141.153 128.694 193.565 1.00 120.92 ? 61  DC  I "C3'" 1 
ATOM   8949  O  "O3'" . DC  I 5  135 ? 141.404 127.472 194.254 1.00 120.92 ? 61  DC  I "O3'" 1 
ATOM   8950  C  "C2'" . DC  I 5  135 ? 141.674 129.882 194.358 1.00 120.92 ? 61  DC  I "C2'" 1 
ATOM   8951  C  "C1'" . DC  I 5  135 ? 143.151 129.723 194.088 1.00 120.92 ? 61  DC  I "C1'" 1 
ATOM   8952  N  N1    . DC  I 5  135 ? 143.951 130.916 194.410 1.00 120.92 ? 61  DC  I N1    1 
ATOM   8953  C  C2    . DC  I 5  135 ? 144.692 130.967 195.602 1.00 120.92 ? 61  DC  I C2    1 
ATOM   8954  O  O2    . DC  I 5  135 ? 144.640 130.018 196.389 1.00 120.92 ? 61  DC  I O2    1 
ATOM   8955  N  N3    . DC  I 5  135 ? 145.412 132.081 195.877 1.00 120.92 ? 61  DC  I N3    1 
ATOM   8956  C  C4    . DC  I 5  135 ? 145.430 133.087 195.013 1.00 120.92 ? 61  DC  I C4    1 
ATOM   8957  N  N4    . DC  I 5  135 ? 146.155 134.163 195.316 1.00 120.92 ? 61  DC  I N4    1 
ATOM   8958  C  C5    . DC  I 5  135 ? 144.689 133.046 193.799 1.00 120.92 ? 61  DC  I C5    1 
ATOM   8959  C  C6    . DC  I 5  135 ? 143.969 131.953 193.545 1.00 120.92 ? 61  DC  I C6    1 
ATOM   8960  P  P     . DG  I 5  136 ? 140.241 126.752 195.102 1.00 126.07 ? 62  DG  I P     1 
ATOM   8961  O  OP1   . DG  I 5  136 ? 140.040 125.413 194.514 1.00 126.07 ? 62  DG  I OP1   1 
ATOM   8962  O  OP2   . DG  I 5  136 ? 139.103 127.690 195.212 1.00 126.07 ? 62  DG  I OP2   1 
ATOM   8963  O  "O5'" . DG  I 5  136 ? 140.865 126.577 196.567 1.00 126.07 ? 62  DG  I "O5'" 1 
ATOM   8964  C  "C5'" . DG  I 5  136 ? 141.942 127.399 196.986 1.00 126.07 ? 62  DG  I "C5'" 1 
ATOM   8965  C  "C4'" . DG  I 5  136 ? 141.565 128.220 198.207 1.00 126.07 ? 62  DG  I "C4'" 1 
ATOM   8966  O  "O4'" . DG  I 5  136 ? 142.420 129.388 198.282 1.00 126.07 ? 62  DG  I "O4'" 1 
ATOM   8967  C  "C3'" . DG  I 5  136 ? 140.122 128.738 198.240 1.00 126.07 ? 62  DG  I "C3'" 1 
ATOM   8968  O  "O3'" . DG  I 5  136 ? 139.484 128.300 199.459 1.00 126.07 ? 62  DG  I "O3'" 1 
ATOM   8969  C  "C2'" . DG  I 5  136 ? 140.276 130.258 198.157 1.00 126.07 ? 62  DG  I "C2'" 1 
ATOM   8970  C  "C1'" . DG  I 5  136 ? 141.664 130.488 198.708 1.00 126.07 ? 62  DG  I "C1'" 1 
ATOM   8971  N  N9    . DG  I 5  136 ? 142.270 131.691 198.171 1.00 126.07 ? 62  DG  I N9    1 
ATOM   8972  C  C8    . DG  I 5  136 ? 142.056 132.228 196.929 1.00 126.07 ? 62  DG  I C8    1 
ATOM   8973  N  N7    . DG  I 5  136 ? 142.734 133.313 196.708 1.00 126.07 ? 62  DG  I N7    1 
ATOM   8974  C  C5    . DG  I 5  136 ? 143.416 133.530 197.893 1.00 126.07 ? 62  DG  I C5    1 
ATOM   8975  C  C6    . DG  I 5  136 ? 144.307 134.557 198.245 1.00 126.07 ? 62  DG  I C6    1 
ATOM   8976  O  O6    . DG  I 5  136 ? 144.662 135.525 197.567 1.00 126.07 ? 62  DG  I O6    1 
ATOM   8977  N  N1    . DG  I 5  136 ? 144.768 134.414 199.544 1.00 126.07 ? 62  DG  I N1    1 
ATOM   8978  C  C2    . DG  I 5  136 ? 144.430 133.388 200.391 1.00 126.07 ? 62  DG  I C2    1 
ATOM   8979  N  N2    . DG  I 5  136 ? 144.988 133.412 201.607 1.00 126.07 ? 62  DG  I N2    1 
ATOM   8980  N  N3    . DG  I 5  136 ? 143.600 132.406 200.068 1.00 126.07 ? 62  DG  I N3    1 
ATOM   8981  C  C4    . DG  I 5  136 ? 143.137 132.541 198.806 1.00 126.07 ? 62  DG  I C4    1 
ATOM   8982  P  P     . DG  I 5  137 ? 138.167 129.006 200.074 1.00 121.05 ? 63  DG  I P     1 
ATOM   8983  O  OP1   . DG  I 5  137 ? 137.511 127.936 200.850 1.00 121.05 ? 63  DG  I OP1   1 
ATOM   8984  O  OP2   . DG  I 5  137 ? 137.320 129.715 199.087 1.00 121.05 ? 63  DG  I OP2   1 
ATOM   8985  O  "O5'" . DG  I 5  137 ? 138.773 130.021 201.143 1.00 121.05 ? 63  DG  I "O5'" 1 
ATOM   8986  C  "C5'" . DG  I 5  137 ? 139.554 129.496 202.213 1.00 121.05 ? 63  DG  I "C5'" 1 
ATOM   8987  C  "C4'" . DG  I 5  137 ? 140.088 130.591 203.114 1.00 121.05 ? 63  DG  I "C4'" 1 
ATOM   8988  O  "O4'" . DG  I 5  137 ? 140.878 131.523 202.334 1.00 121.05 ? 63  DG  I "O4'" 1 
ATOM   8989  C  "C3'" . DG  I 5  137 ? 139.030 131.430 203.831 1.00 121.05 ? 63  DG  I "C3'" 1 
ATOM   8990  O  "O3'" . DG  I 5  137 ? 139.441 131.662 205.169 1.00 121.05 ? 63  DG  I "O3'" 1 
ATOM   8991  C  "C2'" . DG  I 5  137 ? 139.021 132.722 203.024 1.00 121.05 ? 63  DG  I "C2'" 1 
ATOM   8992  C  "C1'" . DG  I 5  137 ? 140.486 132.832 202.656 1.00 121.05 ? 63  DG  I "C1'" 1 
ATOM   8993  N  N9    . DG  I 5  137 ? 140.726 133.672 201.505 1.00 121.05 ? 63  DG  I N9    1 
ATOM   8994  C  C8    . DG  I 5  137 ? 140.205 133.510 200.252 1.00 121.05 ? 63  DG  I C8    1 
ATOM   8995  N  N7    . DG  I 5  137 ? 140.591 134.420 199.412 1.00 121.05 ? 63  DG  I N7    1 
ATOM   8996  C  C5    . DG  I 5  137 ? 141.421 135.237 200.160 1.00 121.05 ? 63  DG  I C5    1 
ATOM   8997  C  C6    . DG  I 5  137 ? 142.126 136.390 199.779 1.00 121.05 ? 63  DG  I C6    1 
ATOM   8998  O  O6    . DG  I 5  137 ? 142.161 136.925 198.665 1.00 121.05 ? 63  DG  I O6    1 
ATOM   8999  N  N1    . DG  I 5  137 ? 142.853 136.922 200.836 1.00 121.05 ? 63  DG  I N1    1 
ATOM   9000  C  C2    . DG  I 5  137 ? 142.886 136.405 202.107 1.00 121.05 ? 63  DG  I C2    1 
ATOM   9001  N  N2    . DG  I 5  137 ? 143.642 137.060 202.998 1.00 121.05 ? 63  DG  I N2    1 
ATOM   9002  N  N3    . DG  I 5  137 ? 142.222 135.318 202.477 1.00 121.05 ? 63  DG  I N3    1 
ATOM   9003  C  C4    . DG  I 5  137 ? 141.513 134.789 201.451 1.00 121.05 ? 63  DG  I C4    1 
ATOM   9004  P  P     . DG  I 5  138 ? 138.482 132.444 206.194 1.00 111.50 ? 64  DG  I P     1 
ATOM   9005  O  OP1   . DG  I 5  138 ? 138.829 131.971 207.550 1.00 111.50 ? 64  DG  I OP1   1 
ATOM   9006  O  OP2   . DG  I 5  138 ? 137.091 132.321 205.707 1.00 111.50 ? 64  DG  I OP2   1 
ATOM   9007  O  "O5'" . DG  I 5  138 ? 138.933 133.975 206.062 1.00 111.50 ? 64  DG  I "O5'" 1 
ATOM   9008  C  "C5'" . DG  I 5  138 ? 140.279 134.336 206.326 1.00 111.50 ? 64  DG  I "C5'" 1 
ATOM   9009  C  "C4'" . DG  I 5  138 ? 140.480 135.843 206.277 1.00 111.50 ? 64  DG  I "C4'" 1 
ATOM   9010  O  "O4'" . DG  I 5  138 ? 140.668 136.285 204.909 1.00 111.50 ? 64  DG  I "O4'" 1 
ATOM   9011  C  "C3'" . DG  I 5  138 ? 139.338 136.702 206.835 1.00 111.50 ? 64  DG  I "C3'" 1 
ATOM   9012  O  "O3'" . DG  I 5  138 ? 139.902 137.781 207.569 1.00 111.50 ? 64  DG  I "O3'" 1 
ATOM   9013  C  "C2'" . DG  I 5  138 ? 138.660 137.208 205.566 1.00 111.50 ? 64  DG  I "C2'" 1 
ATOM   9014  C  "C1'" . DG  I 5  138 ? 139.877 137.428 204.700 1.00 111.50 ? 64  DG  I "C1'" 1 
ATOM   9015  N  N9    . DG  I 5  138 ? 139.604 137.536 203.284 1.00 111.50 ? 64  DG  I N9    1 
ATOM   9016  C  C8    . DG  I 5  138 ? 138.759 136.756 202.538 1.00 111.50 ? 64  DG  I C8    1 
ATOM   9017  N  N7    . DG  I 5  138 ? 138.741 137.081 201.278 1.00 111.50 ? 64  DG  I N7    1 
ATOM   9018  C  C5    . DG  I 5  138 ? 139.633 138.137 201.190 1.00 111.50 ? 64  DG  I C5    1 
ATOM   9019  C  C6    . DG  I 5  138 ? 140.023 138.900 200.078 1.00 111.50 ? 64  DG  I C6    1 
ATOM   9020  O  O6    . DG  I 5  138 ? 139.652 138.784 198.908 1.00 111.50 ? 64  DG  I O6    1 
ATOM   9021  N  N1    . DG  I 5  138 ? 140.961 139.869 200.422 1.00 111.50 ? 64  DG  I N1    1 
ATOM   9022  C  C2    . DG  I 5  138 ? 141.446 140.078 201.690 1.00 111.50 ? 64  DG  I C2    1 
ATOM   9023  N  N2    . DG  I 5  138 ? 142.333 141.075 201.830 1.00 111.50 ? 64  DG  I N2    1 
ATOM   9024  N  N3    . DG  I 5  138 ? 141.081 139.371 202.743 1.00 111.50 ? 64  DG  I N3    1 
ATOM   9025  C  C4    . DG  I 5  138 ? 140.176 138.419 202.417 1.00 111.50 ? 64  DG  I C4    1 
ATOM   9026  P  P     . DA  I 5  139 ? 139.060 138.546 208.703 1.00 98.45  ? 65  DA  I P     1 
ATOM   9027  O  OP1   . DA  I 5  139 ? 139.630 138.123 209.999 1.00 98.45  ? 65  DA  I OP1   1 
ATOM   9028  O  OP2   . DA  I 5  139 ? 137.615 138.373 208.441 1.00 98.45  ? 65  DA  I OP2   1 
ATOM   9029  O  "O5'" . DA  I 5  139 ? 139.404 140.089 208.460 1.00 98.45  ? 65  DA  I "O5'" 1 
ATOM   9030  C  "C5'" . DA  I 5  139 ? 140.587 140.652 209.017 1.00 98.45  ? 65  DA  I "C5'" 1 
ATOM   9031  C  "C4'" . DA  I 5  139 ? 140.995 141.913 208.273 1.00 98.45  ? 65  DA  I "C4'" 1 
ATOM   9032  O  "O4'" . DA  I 5  139 ? 140.795 141.718 206.848 1.00 98.45  ? 65  DA  I "O4'" 1 
ATOM   9033  C  "C3'" . DA  I 5  139 ? 140.212 143.176 208.633 1.00 98.45  ? 65  DA  I "C3'" 1 
ATOM   9034  O  "O3'" . DA  I 5  139 ? 141.083 144.309 208.560 1.00 98.45  ? 65  DA  I "O3'" 1 
ATOM   9035  C  "C2'" . DA  I 5  139 ? 139.151 143.211 207.548 1.00 98.45  ? 65  DA  I "C2'" 1 
ATOM   9036  C  "C1'" . DA  I 5  139 ? 139.945 142.730 206.352 1.00 98.45  ? 65  DA  I "C1'" 1 
ATOM   9037  N  N9    . DA  I 5  139 ? 139.133 142.167 205.282 1.00 98.45  ? 65  DA  I N9    1 
ATOM   9038  C  C8    . DA  I 5  139 ? 138.146 141.228 205.398 1.00 98.45  ? 65  DA  I C8    1 
ATOM   9039  N  N7    . DA  I 5  139 ? 137.594 140.899 204.256 1.00 98.45  ? 65  DA  I N7    1 
ATOM   9040  C  C5    . DA  I 5  139 ? 138.271 141.669 203.329 1.00 98.45  ? 65  DA  I C5    1 
ATOM   9041  C  C6    . DA  I 5  139 ? 138.163 141.785 201.932 1.00 98.45  ? 65  DA  I C6    1 
ATOM   9042  N  N6    . DA  I 5  139 ? 137.291 141.087 201.211 1.00 98.45  ? 65  DA  I N6    1 
ATOM   9043  N  N1    . DA  I 5  139 ? 138.990 142.650 201.306 1.00 98.45  ? 65  DA  I N1    1 
ATOM   9044  C  C2    . DA  I 5  139 ? 139.865 143.345 202.039 1.00 98.45  ? 65  DA  I C2    1 
ATOM   9045  N  N3    . DA  I 5  139 ? 140.059 143.320 203.354 1.00 98.45  ? 65  DA  I N3    1 
ATOM   9046  C  C4    . DA  I 5  139 ? 139.223 142.453 203.944 1.00 98.45  ? 65  DA  I C4    1 
ATOM   9047  P  P     . DT  I 5  140 ? 140.556 145.811 208.801 1.00 97.42  ? 66  DT  I P     1 
ATOM   9048  O  OP1   . DT  I 5  140 ? 141.641 146.506 209.522 1.00 97.42  ? 66  DT  I OP1   1 
ATOM   9049  O  OP2   . DT  I 5  140 ? 139.212 145.815 209.412 1.00 97.42  ? 66  DT  I OP2   1 
ATOM   9050  O  "O5'" . DT  I 5  140 ? 140.462 146.424 207.323 1.00 97.42  ? 66  DT  I "O5'" 1 
ATOM   9051  C  "C5'" . DT  I 5  140 ? 141.468 146.093 206.361 1.00 97.42  ? 66  DT  I "C5'" 1 
ATOM   9052  C  "C4'" . DT  I 5  140 ? 141.598 147.130 205.249 1.00 97.42  ? 66  DT  I "C4'" 1 
ATOM   9053  O  "O4'" . DT  I 5  140 ? 140.964 146.659 204.034 1.00 97.42  ? 66  DT  I "O4'" 1 
ATOM   9054  C  "C3'" . DT  I 5  140 ? 141.013 148.499 205.516 1.00 97.42  ? 66  DT  I "C3'" 1 
ATOM   9055  O  "O3'" . DT  I 5  140 ? 141.821 149.462 204.860 1.00 97.42  ? 66  DT  I "O3'" 1 
ATOM   9056  C  "C2'" . DT  I 5  140 ? 139.623 148.396 204.887 1.00 97.42  ? 66  DT  I "C2'" 1 
ATOM   9057  C  "C1'" . DT  I 5  140 ? 139.860 147.476 203.699 1.00 97.42  ? 66  DT  I "C1'" 1 
ATOM   9058  N  N1    . DT  I 5  140 ? 138.726 146.563 203.415 1.00 97.42  ? 66  DT  I N1    1 
ATOM   9059  C  C2    . DT  I 5  140 ? 138.340 146.342 202.109 1.00 97.42  ? 66  DT  I C2    1 
ATOM   9060  O  O2    . DT  I 5  140 ? 138.870 146.878 201.157 1.00 97.42  ? 66  DT  I O2    1 
ATOM   9061  N  N3    . DT  I 5  140 ? 137.307 145.450 201.965 1.00 97.42  ? 66  DT  I N3    1 
ATOM   9062  C  C4    . DT  I 5  140 ? 136.639 144.781 202.972 1.00 97.42  ? 66  DT  I C4    1 
ATOM   9063  O  O4    . DT  I 5  140 ? 135.719 144.005 202.755 1.00 97.42  ? 66  DT  I O4    1 
ATOM   9064  C  C5    . DT  I 5  140 ? 137.097 145.056 204.305 1.00 97.42  ? 66  DT  I C5    1 
ATOM   9065  C  C7    . DT  I 5  140 ? 136.435 144.389 205.462 1.00 97.42  ? 66  DT  I C7    1 
ATOM   9066  C  C6    . DT  I 5  140 ? 138.110 145.917 204.464 1.00 97.42  ? 66  DT  I C6    1 
ATOM   9067  P  P     . DT  I 5  141 ? 141.454 151.022 204.898 1.00 102.10 ? 67  DT  I P     1 
ATOM   9068  O  OP1   . DT  I 5  141 ? 142.717 151.783 204.765 1.00 102.10 ? 67  DT  I OP1   1 
ATOM   9069  O  OP2   . DT  I 5  141 ? 140.569 151.283 206.052 1.00 102.10 ? 67  DT  I OP2   1 
ATOM   9070  O  "O5'" . DT  I 5  141 ? 140.623 151.234 203.556 1.00 102.10 ? 67  DT  I "O5'" 1 
ATOM   9071  C  "C5'" . DT  I 5  141 ? 141.154 150.777 202.313 1.00 102.10 ? 67  DT  I "C5'" 1 
ATOM   9072  C  "C4'" . DT  I 5  141 ? 140.241 151.110 201.131 1.00 102.10 ? 67  DT  I "C4'" 1 
ATOM   9073  O  "O4'" . DT  I 5  141 ? 139.124 150.187 201.062 1.00 102.10 ? 67  DT  I "O4'" 1 
ATOM   9074  C  "C3'" . DT  I 5  141 ? 139.613 152.493 201.118 1.00 102.10 ? 67  DT  I "C3'" 1 
ATOM   9075  O  "O3'" . DT  I 5  141 ? 139.468 152.890 199.767 1.00 102.10 ? 67  DT  I "O3'" 1 
ATOM   9076  C  "C2'" . DT  I 5  141 ? 138.250 152.223 201.754 1.00 102.10 ? 67  DT  I "C2'" 1 
ATOM   9077  C  "C1'" . DT  I 5  141 ? 137.907 150.913 201.074 1.00 102.10 ? 67  DT  I "C1'" 1 
ATOM   9078  N  N1    . DT  I 5  141 ? 136.912 150.050 201.760 1.00 102.10 ? 67  DT  I N1    1 
ATOM   9079  C  C2    . DT  I 5  141 ? 136.094 149.257 200.992 1.00 102.10 ? 67  DT  I C2    1 
ATOM   9080  O  O2    . DT  I 5  141 ? 136.083 149.291 199.779 1.00 102.10 ? 67  DT  I O2    1 
ATOM   9081  N  N3    . DT  I 5  141 ? 135.254 148.446 201.694 1.00 102.10 ? 67  DT  I N3    1 
ATOM   9082  C  C4    . DT  I 5  141 ? 135.171 148.318 203.062 1.00 102.10 ? 67  DT  I C4    1 
ATOM   9083  O  O4    . DT  I 5  141 ? 134.379 147.558 203.602 1.00 102.10 ? 67  DT  I O4    1 
ATOM   9084  C  C5    . DT  I 5  141 ? 136.073 149.156 203.816 1.00 102.10 ? 67  DT  I C5    1 
ATOM   9085  C  C7    . DT  I 5  141 ? 136.060 149.106 205.315 1.00 102.10 ? 67  DT  I C7    1 
ATOM   9086  C  C6    . DT  I 5  141 ? 136.902 149.966 203.135 1.00 102.10 ? 67  DT  I C6    1 
ATOM   9087  P  P     . DC  I 5  142 ? 139.596 154.430 199.332 1.00 103.18 ? 68  DC  I P     1 
ATOM   9088  O  OP1   . DC  I 5  142 ? 140.850 154.553 198.558 1.00 103.18 ? 68  DC  I OP1   1 
ATOM   9089  O  OP2   . DC  I 5  142 ? 139.361 155.287 200.513 1.00 103.18 ? 68  DC  I OP2   1 
ATOM   9090  O  "O5'" . DC  I 5  142 ? 138.370 154.621 198.332 1.00 103.18 ? 68  DC  I "O5'" 1 
ATOM   9091  C  "C5'" . DC  I 5  142 ? 138.219 153.729 197.245 1.00 103.18 ? 68  DC  I "C5'" 1 
ATOM   9092  C  "C4'" . DC  I 5  142 ? 136.755 153.509 196.906 1.00 103.18 ? 68  DC  I "C4'" 1 
ATOM   9093  O  "O4'" . DC  I 5  142 ? 136.144 152.596 197.856 1.00 103.18 ? 68  DC  I "O4'" 1 
ATOM   9094  C  "C3'" . DC  I 5  142 ? 135.881 154.761 196.907 1.00 103.18 ? 68  DC  I "C3'" 1 
ATOM   9095  O  "O3'" . DC  I 5  142 ? 135.017 154.689 195.812 1.00 103.18 ? 68  DC  I "O3'" 1 
ATOM   9096  C  "C2'" . DC  I 5  142 ? 135.103 154.620 198.209 1.00 103.18 ? 68  DC  I "C2'" 1 
ATOM   9097  C  "C1'" . DC  I 5  142 ? 134.898 153.121 198.236 1.00 103.18 ? 68  DC  I "C1'" 1 
ATOM   9098  N  N1    . DC  I 5  142 ? 134.558 152.588 199.563 1.00 103.18 ? 68  DC  I N1    1 
ATOM   9099  C  C2    . DC  I 5  142 ? 133.719 151.486 199.663 1.00 103.18 ? 68  DC  I C2    1 
ATOM   9100  O  O2    . DC  I 5  142 ? 133.251 150.990 198.642 1.00 103.18 ? 68  DC  I O2    1 
ATOM   9101  N  N3    . DC  I 5  142 ? 133.416 151.004 200.887 1.00 103.18 ? 68  DC  I N3    1 
ATOM   9102  C  C4    . DC  I 5  142 ? 133.929 151.574 201.972 1.00 103.18 ? 68  DC  I C4    1 
ATOM   9103  N  N4    . DC  I 5  142 ? 133.602 151.067 203.159 1.00 103.18 ? 68  DC  I N4    1 
ATOM   9104  C  C5    . DC  I 5  142 ? 134.786 152.701 201.890 1.00 103.18 ? 68  DC  I C5    1 
ATOM   9105  C  C6    . DC  I 5  142 ? 135.071 153.168 200.675 1.00 103.18 ? 68  DC  I C6    1 
ATOM   9106  P  P     . DT  I 5  143 ? 134.359 156.004 195.179 1.00 100.23 ? 69  DT  I P     1 
ATOM   9107  O  OP1   . DT  I 5  143 ? 135.442 156.772 194.531 1.00 100.23 ? 69  DT  I OP1   1 
ATOM   9108  O  OP2   . DT  I 5  143 ? 133.494 156.653 196.189 1.00 100.23 ? 69  DT  I OP2   1 
ATOM   9109  O  "O5'" . DT  I 5  143 ? 133.404 155.399 194.060 1.00 100.23 ? 69  DT  I "O5'" 1 
ATOM   9110  C  "C5'" . DT  I 5  143 ? 133.196 153.996 194.026 1.00 100.23 ? 69  DT  I "C5'" 1 
ATOM   9111  C  "C4'" . DT  I 5  143 ? 131.742 153.657 194.284 1.00 100.23 ? 69  DT  I "C4'" 1 
ATOM   9112  O  "O4'" . DT  I 5  143 ? 131.568 153.157 195.641 1.00 100.23 ? 69  DT  I "O4'" 1 
ATOM   9113  C  "C3'" . DT  I 5  143 ? 130.767 154.818 194.153 1.00 100.23 ? 69  DT  I "C3'" 1 
ATOM   9114  O  "O3'" . DT  I 5  143 ? 129.604 154.327 193.559 1.00 100.23 ? 69  DT  I "O3'" 1 
ATOM   9115  C  "C2'" . DT  I 5  143 ? 130.516 155.186 195.611 1.00 100.23 ? 69  DT  I "C2'" 1 
ATOM   9116  C  "C1'" . DT  I 5  143 ? 130.443 153.798 196.191 1.00 100.23 ? 69  DT  I "C1'" 1 
ATOM   9117  N  N1    . DT  I 5  143 ? 130.513 153.712 197.677 1.00 100.23 ? 69  DT  I N1    1 
ATOM   9118  C  C2    . DT  I 5  143 ? 129.765 152.756 198.312 1.00 100.23 ? 69  DT  I C2    1 
ATOM   9119  O  O2    . DT  I 5  143 ? 129.043 151.978 197.721 1.00 100.23 ? 69  DT  I O2    1 
ATOM   9120  N  N3    . DT  I 5  143 ? 129.902 152.721 199.672 1.00 100.23 ? 69  DT  I N3    1 
ATOM   9121  C  C4    . DT  I 5  143 ? 130.690 153.545 200.445 1.00 100.23 ? 69  DT  I C4    1 
ATOM   9122  O  O4    . DT  I 5  143 ? 130.744 153.443 201.663 1.00 100.23 ? 69  DT  I O4    1 
ATOM   9123  C  C5    . DT  I 5  143 ? 131.448 154.532 199.719 1.00 100.23 ? 69  DT  I C5    1 
ATOM   9124  C  C7    . DT  I 5  143 ? 132.335 155.484 200.459 1.00 100.23 ? 69  DT  I C7    1 
ATOM   9125  C  C6    . DT  I 5  143 ? 131.327 154.569 198.381 1.00 100.23 ? 69  DT  I C6    1 
ATOM   9126  P  P     . DC  I 5  144 ? 128.626 155.277 192.721 1.00 102.59 ? 70  DC  I P     1 
ATOM   9127  O  OP1   . DC  I 5  144 ? 129.205 155.484 191.382 1.00 102.59 ? 70  DC  I OP1   1 
ATOM   9128  O  OP2   . DC  I 5  144 ? 128.287 156.446 193.553 1.00 102.59 ? 70  DC  I OP2   1 
ATOM   9129  O  "O5'" . DC  I 5  144 ? 127.323 154.377 192.599 1.00 102.59 ? 70  DC  I "O5'" 1 
ATOM   9130  C  "C5'" . DC  I 5  144 ? 127.235 153.196 193.385 1.00 102.59 ? 70  DC  I "C5'" 1 
ATOM   9131  C  "C4'" . DC  I 5  144 ? 126.019 153.213 194.287 1.00 102.59 ? 70  DC  I "C4'" 1 
ATOM   9132  O  "O4'" . DC  I 5  144 ? 126.431 153.314 195.680 1.00 102.59 ? 70  DC  I "O4'" 1 
ATOM   9133  C  "C3'" . DC  I 5  144 ? 125.068 154.374 194.052 1.00 102.59 ? 70  DC  I "C3'" 1 
ATOM   9134  O  "O3'" . DC  I 5  144 ? 123.762 153.940 194.276 1.00 102.59 ? 70  DC  I "O3'" 1 
ATOM   9135  C  "C2'" . DC  I 5  144 ? 125.506 155.358 195.119 1.00 102.59 ? 70  DC  I "C2'" 1 
ATOM   9136  C  "C1'" . DC  I 5  144 ? 125.760 154.403 196.268 1.00 102.59 ? 70  DC  I "C1'" 1 
ATOM   9137  N  N1    . DC  I 5  144 ? 126.606 154.973 197.351 1.00 102.59 ? 70  DC  I N1    1 
ATOM   9138  C  C2    . DC  I 5  144 ? 126.531 154.442 198.638 1.00 102.59 ? 70  DC  I C2    1 
ATOM   9139  O  O2    . DC  I 5  144 ? 125.766 153.500 198.854 1.00 102.59 ? 70  DC  I O2    1 
ATOM   9140  N  N3    . DC  I 5  144 ? 127.308 154.970 199.612 1.00 102.59 ? 70  DC  I N3    1 
ATOM   9141  C  C4    . DC  I 5  144 ? 128.121 155.985 199.335 1.00 102.59 ? 70  DC  I C4    1 
ATOM   9142  N  N4    . DC  I 5  144 ? 128.871 156.475 200.323 1.00 102.59 ? 70  DC  I N4    1 
ATOM   9143  C  C5    . DC  I 5  144 ? 128.205 156.544 198.031 1.00 102.59 ? 70  DC  I C5    1 
ATOM   9144  C  C6    . DC  I 5  144 ? 127.432 156.019 197.083 1.00 102.59 ? 70  DC  I C6    1 
ATOM   9145  P  P     . DG  I 5  145 ? 122.540 154.640 193.515 1.00 107.50 ? 71  DG  I P     1 
ATOM   9146  O  OP1   . DG  I 5  145 ? 122.151 153.733 192.410 1.00 107.50 ? 71  DG  I OP1   1 
ATOM   9147  O  OP2   . DG  I 5  145 ? 122.938 156.036 193.224 1.00 107.50 ? 71  DG  I OP2   1 
ATOM   9148  O  "O5'" . DG  I 5  145 ? 121.372 154.639 194.607 1.00 107.50 ? 71  DG  I "O5'" 1 
ATOM   9149  C  "C5'" . DG  I 5  145 ? 120.892 153.400 195.112 1.00 107.50 ? 71  DG  I "C5'" 1 
ATOM   9150  C  "C4'" . DG  I 5  145 ? 120.769 153.423 196.628 1.00 107.50 ? 71  DG  I "C4'" 1 
ATOM   9151  O  "O4'" . DG  I 5  145 ? 121.998 153.933 197.232 1.00 107.50 ? 71  DG  I "O4'" 1 
ATOM   9152  C  "C3'" . DG  I 5  145 ? 119.646 154.311 197.175 1.00 107.50 ? 71  DG  I "C3'" 1 
ATOM   9153  O  "O3'" . DG  I 5  145 ? 119.024 153.666 198.286 1.00 107.50 ? 71  DG  I "O3'" 1 
ATOM   9154  C  "C2'" . DG  I 5  145 ? 120.417 155.535 197.626 1.00 107.50 ? 71  DG  I "C2'" 1 
ATOM   9155  C  "C1'" . DG  I 5  145 ? 121.635 154.865 198.213 1.00 107.50 ? 71  DG  I "C1'" 1 
ATOM   9156  N  N9    . DG  I 5  145 ? 122.653 155.738 198.461 1.00 20.00  ? 71  DG  I N9    1 
ATOM   9157  C  C8    . DG  I 5  145 ? 123.231 156.614 197.572 1.00 20.00  ? 71  DG  I C8    1 
ATOM   9158  N  N7    . DG  I 5  145 ? 124.174 157.354 198.099 1.00 20.00  ? 71  DG  I N7    1 
ATOM   9159  C  C5    . DG  I 5  145 ? 124.236 156.950 199.429 1.00 20.00  ? 71  DG  I C5    1 
ATOM   9160  C  C6    . DG  I 5  145 ? 125.056 157.381 200.498 1.00 20.00  ? 71  DG  I C6    1 
ATOM   9161  O  O6    . DG  I 5  145 ? 125.939 158.250 200.486 1.00 20.00  ? 71  DG  I O6    1 
ATOM   9162  N  N1    . DG  I 5  145 ? 124.773 156.692 201.678 1.00 20.00  ? 71  DG  I N1    1 
ATOM   9163  C  C2    . DG  I 5  145 ? 123.818 155.709 201.812 1.00 20.00  ? 71  DG  I C2    1 
ATOM   9164  N  N2    . DG  I 5  145 ? 123.683 155.153 203.029 1.00 20.00  ? 71  DG  I N2    1 
ATOM   9165  N  N3    . DG  I 5  145 ? 123.044 155.297 200.818 1.00 20.00  ? 71  DG  I N3    1 
ATOM   9166  C  C4    . DG  I 5  145 ? 123.304 155.955 199.661 1.00 20.00  ? 71  DG  I C4    1 
ATOM   9167  P  P     . DA  I 5  146 ? 117.541 154.075 198.753 1.00 107.89 ? 72  DA  I P     1 
ATOM   9168  O  OP1   . DA  I 5  146 ? 117.174 153.166 199.857 1.00 107.89 ? 72  DA  I OP1   1 
ATOM   9169  O  OP2   . DA  I 5  146 ? 116.691 154.133 197.546 1.00 107.89 ? 72  DA  I OP2   1 
ATOM   9170  O  "O5'" . DA  I 5  146 ? 117.697 155.569 199.309 1.00 107.89 ? 72  DA  I "O5'" 1 
ATOM   9171  C  "C5'" . DA  I 5  146 ? 116.859 156.047 200.350 1.00 107.89 ? 72  DA  I "C5'" 1 
ATOM   9172  C  "C4'" . DA  I 5  146 ? 117.537 155.882 201.694 1.00 107.89 ? 72  DA  I "C4'" 1 
ATOM   9173  O  "O4'" . DA  I 5  146 ? 118.935 155.550 201.485 1.00 107.89 ? 72  DA  I "O4'" 1 
ATOM   9174  C  "C3'" . DA  I 5  146 ? 117.567 157.125 202.564 1.00 107.89 ? 72  DA  I "C3'" 1 
ATOM   9175  O  "O3'" . DA  I 5  146 ? 116.390 157.216 203.328 1.00 107.89 ? 72  DA  I "O3'" 1 
ATOM   9176  C  "C2'" . DA  I 5  146 ? 118.776 156.836 203.432 1.00 107.89 ? 72  DA  I "C2'" 1 
ATOM   9177  C  "C1'" . DA  I 5  146 ? 119.732 156.295 202.385 1.00 107.89 ? 72  DA  I "C1'" 1 
ATOM   9178  N  N9    . DA  I 5  146 ? 120.405 157.348 201.637 1.00 107.89 ? 72  DA  I N9    1 
ATOM   9179  C  C8    . DA  I 5  146 ? 120.249 157.652 200.316 1.00 107.89 ? 72  DA  I C8    1 
ATOM   9180  N  N7    . DA  I 5  146 ? 120.982 158.657 199.912 1.00 107.89 ? 72  DA  I N7    1 
ATOM   9181  C  C5    . DA  I 5  146 ? 121.659 159.041 201.048 1.00 107.89 ? 72  DA  I C5    1 
ATOM   9182  C  C6    . DA  I 5  146 ? 122.593 160.056 201.288 1.00 107.89 ? 72  DA  I C6    1 
ATOM   9183  N  N6    . DA  I 5  146 ? 123.016 160.897 200.347 1.00 107.89 ? 72  DA  I N6    1 
ATOM   9184  N  N1    . DA  I 5  146 ? 123.079 160.172 202.540 1.00 107.89 ? 72  DA  I N1    1 
ATOM   9185  C  C2    . DA  I 5  146 ? 122.655 159.327 203.481 1.00 107.89 ? 72  DA  I C2    1 
ATOM   9186  N  N3    . DA  I 5  146 ? 121.780 158.336 203.374 1.00 107.89 ? 72  DA  I N3    1 
ATOM   9187  C  C4    . DA  I 5  146 ? 121.315 158.247 202.121 1.00 107.89 ? 72  DA  I C4    1 
ATOM   9188  P  P     . DT  I 5  147 ? 115.734 158.653 203.605 1.00 110.35 ? 73  DT  I P     1 
ATOM   9189  O  OP1   . DT  I 5  147 ? 114.287 158.459 203.842 1.00 110.35 ? 73  DT  I OP1   1 
ATOM   9190  O  OP2   . DT  I 5  147 ? 116.197 159.545 202.520 1.00 110.35 ? 73  DT  I OP2   1 
ATOM   9191  O  "O5'" . DT  I 5  147 ? 116.429 159.139 204.959 1.00 110.35 ? 73  DT  I "O5'" 1 
ATOM   9192  C  "C5'" . DT  I 5  147 ? 116.483 158.273 206.084 1.00 110.35 ? 73  DT  I "C5'" 1 
ATOM   9193  C  "C4'" . DT  I 5  147 ? 117.701 158.575 206.944 1.00 110.35 ? 73  DT  I "C4'" 1 
ATOM   9194  O  "O4'" . DT  I 5  147 ? 118.855 158.788 206.092 1.00 110.35 ? 73  DT  I "O4'" 1 
ATOM   9195  C  "C3'" . DT  I 5  147 ? 117.586 159.811 207.828 1.00 110.35 ? 73  DT  I "C3'" 1 
ATOM   9196  O  "O3'" . DT  I 5  147 ? 118.223 159.578 209.076 1.00 110.35 ? 73  DT  I "O3'" 1 
ATOM   9197  C  "C2'" . DT  I 5  147 ? 118.309 160.888 207.026 1.00 110.35 ? 73  DT  I "C2'" 1 
ATOM   9198  C  "C1'" . DT  I 5  147 ? 119.366 160.092 206.270 1.00 110.35 ? 73  DT  I "C1'" 1 
ATOM   9199  N  N1    . DT  I 5  147 ? 119.653 160.677 204.882 1.00 20.00  ? 73  DT  I N1    1 
ATOM   9200  C  C2    . DT  I 5  147 ? 120.558 161.722 204.763 1.00 20.00  ? 73  DT  I C2    1 
ATOM   9201  O  O2    . DT  I 5  147 ? 121.169 162.210 205.717 1.00 20.00  ? 73  DT  I O2    1 
ATOM   9202  N  N3    . DT  I 5  147 ? 120.726 162.180 203.479 1.00 20.00  ? 73  DT  I N3    1 
ATOM   9203  C  C4    . DT  I 5  147 ? 120.109 161.731 202.339 1.00 20.00  ? 73  DT  I C4    1 
ATOM   9204  O  O4    . DT  I 5  147 ? 120.384 162.247 201.257 1.00 20.00  ? 73  DT  I O4    1 
ATOM   9205  C  C5    . DT  I 5  147 ? 119.163 160.650 202.535 1.00 20.00  ? 73  DT  I C5    1 
ATOM   9206  C  C7    . DT  I 5  147 ? 118.440 160.097 201.350 1.00 20.00  ? 73  DT  I C7    1 
ATOM   9207  C  C6    . DT  I 5  147 ? 118.979 160.189 203.784 1.00 20.00  ? 73  DT  I C6    1 
ATOM   9208  P  P     . DA  J 6  1   ? 126.502 168.539 200.628 1.00 116.41 ? -73 DA  J P     1 
ATOM   9209  O  OP1   . DA  J 6  1   ? 127.895 168.057 200.757 1.00 116.41 ? -73 DA  J OP1   1 
ATOM   9210  O  OP2   . DA  J 6  1   ? 125.557 167.825 199.738 1.00 116.41 ? -73 DA  J OP2   1 
ATOM   9211  O  "O5'" . DA  J 6  1   ? 125.846 168.629 202.087 1.00 116.41 ? -73 DA  J "O5'" 1 
ATOM   9212  C  "C5'" . DA  J 6  1   ? 126.102 169.756 202.926 1.00 116.41 ? -73 DA  J "C5'" 1 
ATOM   9213  C  "C4'" . DA  J 6  1   ? 125.606 169.495 204.337 1.00 116.41 ? -73 DA  J "C4'" 1 
ATOM   9214  O  "O4'" . DA  J 6  1   ? 124.154 169.574 204.359 1.00 116.41 ? -73 DA  J "O4'" 1 
ATOM   9215  C  "C3'" . DA  J 6  1   ? 125.987 168.130 204.895 1.00 116.41 ? -73 DA  J "C3'" 1 
ATOM   9216  O  "O3'" . DA  J 6  1   ? 127.121 168.259 205.763 1.00 116.41 ? -73 DA  J "O3'" 1 
ATOM   9217  C  "C2'" . DA  J 6  1   ? 124.752 167.690 205.675 1.00 116.41 ? -73 DA  J "C2'" 1 
ATOM   9218  C  "C1'" . DA  J 6  1   ? 123.592 168.457 205.018 1.00 116.41 ? -73 DA  J "C1'" 1 
ATOM   9219  N  N9    . DA  J 6  1   ? 122.801 167.701 204.071 1.00 20.00  ? -73 DA  J N9    1 
ATOM   9220  C  C8    . DA  J 6  1   ? 122.648 167.994 202.738 1.00 20.00  ? -73 DA  J C8    1 
ATOM   9221  N  N7    . DA  J 6  1   ? 121.868 167.159 202.102 1.00 20.00  ? -73 DA  J N7    1 
ATOM   9222  C  C5    . DA  J 6  1   ? 121.478 166.245 203.073 1.00 20.00  ? -73 DA  J C5    1 
ATOM   9223  C  C6    . DA  J 6  1   ? 120.633 165.105 203.029 1.00 20.00  ? -73 DA  J C6    1 
ATOM   9224  N  N6    . DA  J 6  1   ? 120.003 164.694 201.921 1.00 20.00  ? -73 DA  J N6    1 
ATOM   9225  N  N1    . DA  J 6  1   ? 120.449 164.408 204.172 1.00 20.00  ? -73 DA  J N1    1 
ATOM   9226  C  C2    . DA  J 6  1   ? 121.068 164.829 205.283 1.00 20.00  ? -73 DA  J C2    1 
ATOM   9227  N  N3    . DA  J 6  1   ? 121.879 165.890 205.452 1.00 20.00  ? -73 DA  J N3    1 
ATOM   9228  C  C4    . DA  J 6  1   ? 122.046 166.562 204.293 1.00 20.00  ? -73 DA  J C4    1 
ATOM   9229  P  P     . DT  J 6  2   ? 128.348 167.221 205.679 1.00 113.17 ? -72 DT  J P     1 
ATOM   9230  O  OP1   . DT  J 6  2   ? 129.465 167.773 206.476 1.00 113.17 ? -72 DT  J OP1   1 
ATOM   9231  O  OP2   . DT  J 6  2   ? 128.555 166.899 204.252 1.00 113.17 ? -72 DT  J OP2   1 
ATOM   9232  O  "O5'" . DT  J 6  2   ? 127.803 165.896 206.393 1.00 113.17 ? -72 DT  J "O5'" 1 
ATOM   9233  C  "C5'" . DT  J 6  2   ? 127.692 165.820 207.812 1.00 113.17 ? -72 DT  J "C5'" 1 
ATOM   9234  C  "C4'" . DT  J 6  2   ? 127.029 164.515 208.234 1.00 113.17 ? -72 DT  J "C4'" 1 
ATOM   9235  O  "O4'" . DT  J 6  2   ? 125.968 164.193 207.296 1.00 113.17 ? -72 DT  J "O4'" 1 
ATOM   9236  C  "C3'" . DT  J 6  2   ? 127.947 163.291 208.257 1.00 113.17 ? -72 DT  J "C3'" 1 
ATOM   9237  O  "O3'" . DT  J 6  2   ? 127.568 162.414 209.319 1.00 113.17 ? -72 DT  J "O3'" 1 
ATOM   9238  C  "C2'" . DT  J 6  2   ? 127.688 162.655 206.897 1.00 113.17 ? -72 DT  J "C2'" 1 
ATOM   9239  C  "C1'" . DT  J 6  2   ? 126.205 162.922 206.725 1.00 113.17 ? -72 DT  J "C1'" 1 
ATOM   9240  N  N1    . DT  J 6  2   ? 125.778 162.955 205.304 1.00 113.17 ? -72 DT  J N1    1 
ATOM   9241  C  C2    . DT  J 6  2   ? 125.052 161.910 204.801 1.00 113.17 ? -72 DT  J C2    1 
ATOM   9242  O  O2    . DT  J 6  2   ? 124.716 160.944 205.467 1.00 113.17 ? -72 DT  J O2    1 
ATOM   9243  N  N3    . DT  J 6  2   ? 124.713 162.039 203.486 1.00 113.17 ? -72 DT  J N3    1 
ATOM   9244  C  C4    . DT  J 6  2   ? 125.027 163.080 202.638 1.00 113.17 ? -72 DT  J C4    1 
ATOM   9245  O  O4    . DT  J 6  2   ? 124.676 163.100 201.466 1.00 113.17 ? -72 DT  J O4    1 
ATOM   9246  C  C5    . DT  J 6  2   ? 125.795 164.136 203.226 1.00 113.17 ? -72 DT  J C5    1 
ATOM   9247  C  C7    . DT  J 6  2   ? 126.197 165.317 202.402 1.00 113.17 ? -72 DT  J C7    1 
ATOM   9248  C  C6    . DT  J 6  2   ? 126.132 164.027 204.514 1.00 113.17 ? -72 DT  J C6    1 
ATOM   9249  P  P     . DC  J 6  3   ? 128.536 161.211 209.777 1.00 112.27 ? -71 DC  J P     1 
ATOM   9250  O  OP1   . DC  J 6  3   ? 128.661 161.298 211.246 1.00 112.27 ? -71 DC  J OP1   1 
ATOM   9251  O  OP2   . DC  J 6  3   ? 129.764 161.221 208.952 1.00 112.27 ? -71 DC  J OP2   1 
ATOM   9252  O  "O5'" . DC  J 6  3   ? 127.705 159.888 209.430 1.00 112.27 ? -71 DC  J "O5'" 1 
ATOM   9253  C  "C5'" . DC  J 6  3   ? 126.869 159.302 210.423 1.00 112.27 ? -71 DC  J "C5'" 1 
ATOM   9254  C  "C4'" . DC  J 6  3   ? 126.047 158.158 209.853 1.00 112.27 ? -71 DC  J "C4'" 1 
ATOM   9255  O  "O4'" . DC  J 6  3   ? 125.634 158.476 208.497 1.00 112.27 ? -71 DC  J "O4'" 1 
ATOM   9256  C  "C3'" . DC  J 6  3   ? 126.770 156.814 209.758 1.00 112.27 ? -71 DC  J "C3'" 1 
ATOM   9257  O  "O3'" . DC  J 6  3   ? 125.846 155.760 210.000 1.00 112.27 ? -71 DC  J "O3'" 1 
ATOM   9258  C  "C2'" . DC  J 6  3   ? 127.239 156.807 208.311 1.00 112.27 ? -71 DC  J "C2'" 1 
ATOM   9259  C  "C1'" . DC  J 6  3   ? 126.034 157.434 207.637 1.00 112.27 ? -71 DC  J "C1'" 1 
ATOM   9260  N  N1    . DC  J 6  3   ? 126.344 158.051 206.267 1.00 20.00  ? -71 DC  J N1    1 
ATOM   9261  C  C2    . DC  J 6  3   ? 125.728 157.552 205.122 1.00 20.00  ? -71 DC  J C2    1 
ATOM   9262  O  O2    . DC  J 6  3   ? 124.949 156.597 205.228 1.00 20.00  ? -71 DC  J O2    1 
ATOM   9263  N  N3    . DC  J 6  3   ? 126.013 158.127 203.926 1.00 20.00  ? -71 DC  J N3    1 
ATOM   9264  C  C4    . DC  J 6  3   ? 126.862 159.158 203.844 1.00 20.00  ? -71 DC  J C4    1 
ATOM   9265  N  N4    . DC  J 6  3   ? 127.099 159.684 202.652 1.00 20.00  ? -71 DC  J N4    1 
ATOM   9266  C  C5    . DC  J 6  3   ? 127.508 159.686 205.005 1.00 20.00  ? -71 DC  J C5    1 
ATOM   9267  C  C6    . DC  J 6  3   ? 127.206 159.098 206.194 1.00 20.00  ? -71 DC  J C6    1 
ATOM   9268  P  P     . DG  J 6  4   ? 126.339 154.376 210.652 1.00 104.31 ? -70 DG  J P     1 
ATOM   9269  O  OP1   . DG  J 6  4   ? 126.271 154.532 212.121 1.00 104.31 ? -70 DG  J OP1   1 
ATOM   9270  O  OP2   . DG  J 6  4   ? 127.606 153.980 210.001 1.00 104.31 ? -70 DG  J OP2   1 
ATOM   9271  O  "O5'" . DG  J 6  4   ? 125.230 153.323 210.201 1.00 104.31 ? -70 DG  J "O5'" 1 
ATOM   9272  C  "C5'" . DG  J 6  4   ? 125.587 151.965 209.995 1.00 104.31 ? -70 DG  J "C5'" 1 
ATOM   9273  C  "C4'" . DG  J 6  4   ? 124.839 151.396 208.807 1.00 104.31 ? -70 DG  J "C4'" 1 
ATOM   9274  O  "O4'" . DG  J 6  4   ? 124.856 152.365 207.726 1.00 104.31 ? -70 DG  J "O4'" 1 
ATOM   9275  C  "C3'" . DG  J 6  4   ? 125.439 150.130 208.209 1.00 104.31 ? -70 DG  J "C3'" 1 
ATOM   9276  O  "O3'" . DG  J 6  4   ? 124.423 149.395 207.542 1.00 104.31 ? -70 DG  J "O3'" 1 
ATOM   9277  C  "C2'" . DG  J 6  4   ? 126.419 150.714 207.215 1.00 104.31 ? -70 DG  J "C2'" 1 
ATOM   9278  C  "C1'" . DG  J 6  4   ? 125.564 151.821 206.630 1.00 104.31 ? -70 DG  J "C1'" 1 
ATOM   9279  N  N9    . DG  J 6  4   ? 126.334 152.880 206.006 1.00 104.31 ? -70 DG  J N9    1 
ATOM   9280  C  C8    . DG  J 6  4   ? 127.208 153.739 206.620 1.00 104.31 ? -70 DG  J C8    1 
ATOM   9281  N  N7    . DG  J 6  4   ? 127.763 154.585 205.801 1.00 104.31 ? -70 DG  J N7    1 
ATOM   9282  C  C5    . DG  J 6  4   ? 127.223 154.261 204.569 1.00 104.31 ? -70 DG  J C5    1 
ATOM   9283  C  C6    . DG  J 6  4   ? 127.454 154.830 203.306 1.00 104.31 ? -70 DG  J C6    1 
ATOM   9284  O  O6    . DG  J 6  4   ? 128.199 155.772 203.019 1.00 104.31 ? -70 DG  J O6    1 
ATOM   9285  N  N1    . DG  J 6  4   ? 126.704 154.206 202.316 1.00 104.31 ? -70 DG  J N1    1 
ATOM   9286  C  C2    . DG  J 6  4   ? 125.844 153.157 202.527 1.00 104.31 ? -70 DG  J C2    1 
ATOM   9287  N  N2    . DG  J 6  4   ? 125.206 152.680 201.453 1.00 104.31 ? -70 DG  J N2    1 
ATOM   9288  N  N3    . DG  J 6  4   ? 125.622 152.611 203.711 1.00 104.31 ? -70 DG  J N3    1 
ATOM   9289  C  C4    . DG  J 6  4   ? 126.343 153.213 204.681 1.00 104.31 ? -70 DG  J C4    1 
ATOM   9290  P  P     . DA  J 6  5   ? 124.537 147.801 207.384 1.00 94.29  ? -69 DA  J P     1 
ATOM   9291  O  OP1   . DA  J 6  5   ? 123.667 147.193 208.413 1.00 94.29  ? -69 DA  J OP1   1 
ATOM   9292  O  OP2   . DA  J 6  5   ? 125.973 147.454 207.333 1.00 94.29  ? -69 DA  J OP2   1 
ATOM   9293  O  "O5'" . DA  J 6  5   ? 123.914 147.505 205.938 1.00 94.29  ? -69 DA  J "O5'" 1 
ATOM   9294  C  "C5'" . DA  J 6  5   ? 123.792 146.163 205.480 1.00 94.29  ? -69 DA  J "C5'" 1 
ATOM   9295  C  "C4'" . DA  J 6  5   ? 123.407 146.119 204.014 1.00 94.29  ? -69 DA  J "C4'" 1 
ATOM   9296  O  "O4'" . DA  J 6  5   ? 123.860 147.336 203.373 1.00 94.29  ? -69 DA  J "O4'" 1 
ATOM   9297  C  "C3'" . DA  J 6  5   ? 124.079 145.018 203.227 1.00 94.29  ? -69 DA  J "C3'" 1 
ATOM   9298  O  "O3'" . DA  J 6  5   ? 123.396 144.826 201.985 1.00 94.29  ? -69 DA  J "O3'" 1 
ATOM   9299  C  "C2'" . DA  J 6  5   ? 125.447 145.639 203.014 1.00 94.29  ? -69 DA  J "C2'" 1 
ATOM   9300  C  "C1'" . DA  J 6  5   ? 125.065 147.074 202.667 1.00 94.29  ? -69 DA  J "C1'" 1 
ATOM   9301  N  N9    . DA  J 6  5   ? 126.054 148.083 203.057 1.00 94.29  ? -69 DA  J N9    1 
ATOM   9302  C  C8    . DA  J 6  5   ? 126.540 148.312 204.311 1.00 94.29  ? -69 DA  J C8    1 
ATOM   9303  N  N7    . DA  J 6  5   ? 127.405 149.295 204.369 1.00 94.29  ? -69 DA  J N7    1 
ATOM   9304  C  C5    . DA  J 6  5   ? 127.479 149.757 203.070 1.00 94.29  ? -69 DA  J C5    1 
ATOM   9305  C  C6    . DA  J 6  5   ? 128.218 150.796 202.475 1.00 94.29  ? -69 DA  J C6    1 
ATOM   9306  N  N6    . DA  J 6  5   ? 129.062 151.577 203.153 1.00 94.29  ? -69 DA  J N6    1 
ATOM   9307  N  N1    . DA  J 6  5   ? 128.073 150.990 201.150 1.00 94.29  ? -69 DA  J N1    1 
ATOM   9308  C  C2    . DA  J 6  5   ? 127.229 150.201 200.471 1.00 94.29  ? -69 DA  J C2    1 
ATOM   9309  N  N3    . DA  J 6  5   ? 126.478 149.197 200.924 1.00 94.29  ? -69 DA  J N3    1 
ATOM   9310  C  C4    . DA  J 6  5   ? 126.652 149.023 202.242 1.00 94.29  ? -69 DA  J C4    1 
ATOM   9311  P  P     . DG  J 6  6   ? 123.558 143.458 201.149 1.00 89.12  ? -68 DG  J P     1 
ATOM   9312  O  OP1   . DG  J 6  6   ? 122.226 142.825 201.082 1.00 89.12  ? -68 DG  J OP1   1 
ATOM   9313  O  OP2   . DG  J 6  6   ? 124.694 142.686 201.697 1.00 89.12  ? -68 DG  J OP2   1 
ATOM   9314  O  "O5'" . DG  J 6  6   ? 123.964 143.945 199.676 1.00 89.12  ? -68 DG  J "O5'" 1 
ATOM   9315  C  "C5'" . DG  J 6  6   ? 124.477 145.264 199.467 1.00 89.12  ? -68 DG  J "C5'" 1 
ATOM   9316  C  "C4'" . DG  J 6  6   ? 125.923 145.223 199.001 1.00 89.12  ? -68 DG  J "C4'" 1 
ATOM   9317  O  "O4'" . DG  J 6  6   ? 126.718 146.203 199.731 1.00 89.12  ? -68 DG  J "O4'" 1 
ATOM   9318  C  "C3'" . DG  J 6  6   ? 126.637 143.880 199.210 1.00 89.12  ? -68 DG  J "C3'" 1 
ATOM   9319  O  "O3'" . DG  J 6  6   ? 127.355 143.542 198.044 1.00 89.12  ? -68 DG  J "O3'" 1 
ATOM   9320  C  "C2'" . DG  J 6  6   ? 127.584 144.178 200.368 1.00 89.12  ? -68 DG  J "C2'" 1 
ATOM   9321  C  "C1'" . DG  J 6  6   ? 127.949 145.596 200.008 1.00 89.12  ? -68 DG  J "C1'" 1 
ATOM   9322  N  N9    . DG  J 6  6   ? 128.674 146.321 201.045 1.00 89.12  ? -68 DG  J N9    1 
ATOM   9323  C  C8    . DG  J 6  6   ? 128.766 146.011 202.376 1.00 89.12  ? -68 DG  J C8    1 
ATOM   9324  N  N7    . DG  J 6  6   ? 129.506 146.841 203.054 1.00 89.12  ? -68 DG  J N7    1 
ATOM   9325  C  C5    . DG  J 6  6   ? 129.957 147.739 202.103 1.00 89.12  ? -68 DG  J C5    1 
ATOM   9326  C  C6    . DG  J 6  6   ? 130.806 148.856 202.239 1.00 89.12  ? -68 DG  J C6    1 
ATOM   9327  O  O6    . DG  J 6  6   ? 131.337 149.295 203.259 1.00 89.12  ? -68 DG  J O6    1 
ATOM   9328  N  N1    . DG  J 6  6   ? 130.999 149.501 201.031 1.00 89.12  ? -68 DG  J N1    1 
ATOM   9329  C  C2    . DG  J 6  6   ? 130.448 149.111 199.838 1.00 89.12  ? -68 DG  J C2    1 
ATOM   9330  N  N2    . DG  J 6  6   ? 130.776 149.839 198.774 1.00 89.12  ? -68 DG  J N2    1 
ATOM   9331  N  N3    . DG  J 6  6   ? 129.669 148.057 199.691 1.00 89.12  ? -68 DG  J N3    1 
ATOM   9332  C  C4    . DG  J 6  6   ? 129.460 147.428 200.862 1.00 89.12  ? -68 DG  J C4    1 
ATOM   9333  P  P     . DA  J 6  7   ? 126.737 142.500 196.992 1.00 83.47  ? -67 DA  J P     1 
ATOM   9334  O  OP1   . DA  J 6  7   ? 125.264 142.511 197.129 1.00 83.47  ? -67 DA  J OP1   1 
ATOM   9335  O  OP2   . DA  J 6  7   ? 127.485 141.230 197.132 1.00 83.47  ? -67 DA  J OP2   1 
ATOM   9336  O  "O5'" . DA  J 6  7   ? 127.112 143.140 195.589 1.00 83.47  ? -67 DA  J "O5'" 1 
ATOM   9337  C  "C5'" . DA  J 6  7   ? 127.245 144.534 195.486 1.00 83.47  ? -67 DA  J "C5'" 1 
ATOM   9338  C  "C4'" . DA  J 6  7   ? 128.679 144.921 195.184 1.00 83.47  ? -67 DA  J "C4'" 1 
ATOM   9339  O  "O4'" . DA  J 6  7   ? 129.341 145.394 196.383 1.00 83.47  ? -67 DA  J "O4'" 1 
ATOM   9340  C  "C3'" . DA  J 6  7   ? 129.567 143.811 194.633 1.00 83.47  ? -67 DA  J "C3'" 1 
ATOM   9341  O  "O3'" . DA  J 6  7   ? 130.365 144.351 193.629 1.00 83.47  ? -67 DA  J "O3'" 1 
ATOM   9342  C  "C2'" . DA  J 6  7   ? 130.414 143.429 195.839 1.00 83.47  ? -67 DA  J "C2'" 1 
ATOM   9343  C  "C1'" . DA  J 6  7   ? 130.612 144.795 196.460 1.00 83.47  ? -67 DA  J "C1'" 1 
ATOM   9344  N  N9    . DA  J 6  7   ? 131.018 144.775 197.859 1.00 83.47  ? -67 DA  J N9    1 
ATOM   9345  C  C8    . DA  J 6  7   ? 130.653 143.866 198.804 1.00 83.47  ? -67 DA  J C8    1 
ATOM   9346  N  N7    . DA  J 6  7   ? 131.133 144.118 199.995 1.00 83.47  ? -67 DA  J N7    1 
ATOM   9347  C  C5    . DA  J 6  7   ? 131.886 145.261 199.813 1.00 83.47  ? -67 DA  J C5    1 
ATOM   9348  C  C6    . DA  J 6  7   ? 132.664 146.030 200.693 1.00 83.47  ? -67 DA  J C6    1 
ATOM   9349  N  N6    . DA  J 6  7   ? 132.820 145.731 201.984 1.00 83.47  ? -67 DA  J N6    1 
ATOM   9350  N  N1    . DA  J 6  7   ? 133.294 147.108 200.192 1.00 83.47  ? -67 DA  J N1    1 
ATOM   9351  C  C2    . DA  J 6  7   ? 133.148 147.400 198.896 1.00 83.47  ? -67 DA  J C2    1 
ATOM   9352  N  N3    . DA  J 6  7   ? 132.437 146.756 197.976 1.00 83.47  ? -67 DA  J N3    1 
ATOM   9353  C  C4    . DA  J 6  7   ? 131.824 145.688 198.505 1.00 83.47  ? -67 DA  J C4    1 
ATOM   9354  P  P     . DA  J 6  8   ? 130.848 143.446 192.406 1.00 78.90  ? -66 DA  J P     1 
ATOM   9355  O  OP1   . DA  J 6  8   ? 130.049 143.877 191.242 1.00 78.90  ? -66 DA  J OP1   1 
ATOM   9356  O  OP2   . DA  J 6  8   ? 130.833 142.028 192.824 1.00 78.90  ? -66 DA  J OP2   1 
ATOM   9357  O  "O5'" . DA  J 6  8   ? 132.362 143.904 192.196 1.00 78.90  ? -66 DA  J "O5'" 1 
ATOM   9358  C  "C5'" . DA  J 6  8   ? 132.632 145.213 191.735 1.00 78.90  ? -66 DA  J "C5'" 1 
ATOM   9359  C  "C4'" . DA  J 6  8   ? 133.857 145.790 192.413 1.00 78.90  ? -66 DA  J "C4'" 1 
ATOM   9360  O  "O4'" . DA  J 6  8   ? 133.725 145.679 193.848 1.00 78.90  ? -66 DA  J "O4'" 1 
ATOM   9361  C  "C3'" . DA  J 6  8   ? 135.186 145.130 192.049 1.00 78.90  ? -66 DA  J "C3'" 1 
ATOM   9362  O  "O3'" . DA  J 6  8   ? 136.109 146.149 191.683 1.00 78.90  ? -66 DA  J "O3'" 1 
ATOM   9363  C  "C2'" . DA  J 6  8   ? 135.596 144.421 193.349 1.00 78.90  ? -66 DA  J "C2'" 1 
ATOM   9364  C  "C1'" . DA  J 6  8   ? 134.969 145.325 194.388 1.00 78.90  ? -66 DA  J "C1'" 1 
ATOM   9365  N  N9    . DA  J 6  8   ? 134.726 144.689 195.671 1.00 78.90  ? -66 DA  J N9    1 
ATOM   9366  C  C8    . DA  J 6  8   ? 133.920 143.618 195.913 1.00 78.90  ? -66 DA  J C8    1 
ATOM   9367  N  N7    . DA  J 6  8   ? 133.868 143.269 197.173 1.00 78.90  ? -66 DA  J N7    1 
ATOM   9368  C  C5    . DA  J 6  8   ? 134.686 144.185 197.803 1.00 78.90  ? -66 DA  J C5    1 
ATOM   9369  C  C6    . DA  J 6  8   ? 135.051 144.355 199.146 1.00 78.90  ? -66 DA  J C6    1 
ATOM   9370  N  N6    . DA  J 6  8   ? 134.608 143.567 200.122 1.00 78.90  ? -66 DA  J N6    1 
ATOM   9371  N  N1    . DA  J 6  8   ? 135.884 145.372 199.450 1.00 78.90  ? -66 DA  J N1    1 
ATOM   9372  C  C2    . DA  J 6  8   ? 136.322 146.160 198.464 1.00 78.90  ? -66 DA  J C2    1 
ATOM   9373  N  N3    . DA  J 6  8   ? 136.047 146.093 197.160 1.00 78.90  ? -66 DA  J N3    1 
ATOM   9374  C  C4    . DA  J 6  8   ? 135.215 145.075 196.896 1.00 78.90  ? -66 DA  J C4    1 
ATOM   9375  P  P     . DT  J 6  9   ? 137.485 145.804 190.927 1.00 78.17  ? -65 DT  J P     1 
ATOM   9376  O  OP1   . DT  J 6  9   ? 137.609 146.685 189.751 1.00 78.17  ? -65 DT  J OP1   1 
ATOM   9377  O  OP2   . DT  J 6  9   ? 137.566 144.345 190.719 1.00 78.17  ? -65 DT  J OP2   1 
ATOM   9378  O  "O5'" . DT  J 6  9   ? 138.592 146.236 191.989 1.00 78.17  ? -65 DT  J "O5'" 1 
ATOM   9379  C  "C5'" . DT  J 6  9   ? 138.223 147.007 193.133 1.00 78.17  ? -65 DT  J "C5'" 1 
ATOM   9380  C  "C4'" . DT  J 6  9   ? 139.383 147.129 194.102 1.00 78.17  ? -65 DT  J "C4'" 1 
ATOM   9381  O  "O4'" . DT  J 6  9   ? 139.000 146.596 195.408 1.00 78.17  ? -65 DT  J "O4'" 1 
ATOM   9382  C  "C3'" . DT  J 6  9   ? 140.631 146.349 193.708 1.00 78.17  ? -65 DT  J "C3'" 1 
ATOM   9383  O  "O3'" . DT  J 6  9   ? 141.771 146.995 194.262 1.00 78.17  ? -65 DT  J "O3'" 1 
ATOM   9384  C  "C2'" . DT  J 6  9   ? 140.370 145.023 194.396 1.00 78.17  ? -65 DT  J "C2'" 1 
ATOM   9385  C  "C1'" . DT  J 6  9   ? 139.862 145.522 195.736 1.00 78.17  ? -65 DT  J "C1'" 1 
ATOM   9386  N  N1    . DT  J 6  9   ? 139.093 144.501 196.512 1.00 78.17  ? -65 DT  J N1    1 
ATOM   9387  C  C2    . DT  J 6  9   ? 139.167 144.493 197.890 1.00 78.17  ? -65 DT  J C2    1 
ATOM   9388  O  O2    . DT  J 6  9   ? 139.819 145.294 198.529 1.00 78.17  ? -65 DT  J O2    1 
ATOM   9389  N  N3    . DT  J 6  9   ? 138.400 143.525 198.498 1.00 78.17  ? -65 DT  J N3    1 
ATOM   9390  C  C4    . DT  J 6  9   ? 137.619 142.577 197.872 1.00 78.17  ? -65 DT  J C4    1 
ATOM   9391  O  O4    . DT  J 6  9   ? 136.970 141.744 198.489 1.00 78.17  ? -65 DT  J O4    1 
ATOM   9392  C  C5    . DT  J 6  9   ? 137.603 142.642 196.433 1.00 78.17  ? -65 DT  J C5    1 
ATOM   9393  C  C7    . DT  J 6  9   ? 136.790 141.664 195.648 1.00 78.17  ? -65 DT  J C7    1 
ATOM   9394  C  C6    . DT  J 6  9   ? 138.332 143.584 195.833 1.00 78.17  ? -65 DT  J C6    1 
ATOM   9395  P  P     . DC  J 6  10  ? 143.258 146.646 193.768 1.00 78.75  ? -64 DC  J P     1 
ATOM   9396  O  OP1   . DC  J 6  10  ? 143.788 147.884 193.156 1.00 78.75  ? -64 DC  J OP1   1 
ATOM   9397  O  OP2   . DC  J 6  10  ? 143.250 145.395 192.978 1.00 78.75  ? -64 DC  J OP2   1 
ATOM   9398  O  "O5'" . DC  J 6  10  ? 144.053 146.387 195.135 1.00 78.75  ? -64 DC  J "O5'" 1 
ATOM   9399  C  "C5'" . DC  J 6  10  ? 144.115 147.414 196.121 1.00 78.75  ? -64 DC  J "C5'" 1 
ATOM   9400  C  "C4'" . DC  J 6  10  ? 144.320 146.839 197.514 1.00 78.75  ? -64 DC  J "C4'" 1 
ATOM   9401  O  "O4'" . DC  J 6  10  ? 143.219 145.954 197.848 1.00 78.75  ? -64 DC  J "O4'" 1 
ATOM   9402  C  "C3'" . DC  J 6  10  ? 145.598 146.018 197.707 1.00 78.75  ? -64 DC  J "C3'" 1 
ATOM   9403  O  "O3'" . DC  J 6  10  ? 146.193 146.339 198.962 1.00 78.75  ? -64 DC  J "O3'" 1 
ATOM   9404  C  "C2'" . DC  J 6  10  ? 145.090 144.579 197.684 1.00 78.75  ? -64 DC  J "C2'" 1 
ATOM   9405  C  "C1'" . DC  J 6  10  ? 143.726 144.732 198.331 1.00 78.75  ? -64 DC  J "C1'" 1 
ATOM   9406  N  N1    . DC  J 6  10  ? 142.786 143.675 197.951 1.00 78.75  ? -64 DC  J N1    1 
ATOM   9407  C  C2    . DC  J 6  10  ? 142.080 142.994 198.929 1.00 78.75  ? -64 DC  J C2    1 
ATOM   9408  O  O2    . DC  J 6  10  ? 142.294 143.242 200.106 1.00 78.75  ? -64 DC  J O2    1 
ATOM   9409  N  N3    . DC  J 6  10  ? 141.230 142.014 198.558 1.00 78.75  ? -64 DC  J N3    1 
ATOM   9410  C  C4    . DC  J 6  10  ? 141.054 141.740 197.273 1.00 78.75  ? -64 DC  J C4    1 
ATOM   9411  N  N4    . DC  J 6  10  ? 140.193 140.777 196.944 1.00 78.75  ? -64 DC  J N4    1 
ATOM   9412  C  C5    . DC  J 6  10  ? 141.761 142.431 196.263 1.00 78.75  ? -64 DC  J C5    1 
ATOM   9413  C  C6    . DC  J 6  10  ? 142.606 143.385 196.644 1.00 78.75  ? -64 DC  J C6    1 
ATOM   9414  P  P     . DC  J 6  11  ? 147.673 145.822 199.317 1.00 79.65  ? -63 DC  J P     1 
ATOM   9415  O  OP1   . DC  J 6  11  ? 148.356 146.932 200.007 1.00 79.65  ? -63 DC  J OP1   1 
ATOM   9416  O  OP2   . DC  J 6  11  ? 148.273 145.248 198.098 1.00 79.65  ? -63 DC  J OP2   1 
ATOM   9417  O  "O5'" . DC  J 6  11  ? 147.435 144.648 200.380 1.00 79.65  ? -63 DC  J "O5'" 1 
ATOM   9418  C  "C5'" . DC  J 6  11  ? 147.363 144.958 201.769 1.00 79.65  ? -63 DC  J "C5'" 1 
ATOM   9419  C  "C4'" . DC  J 6  11  ? 147.365 143.703 202.630 1.00 79.65  ? -63 DC  J "C4'" 1 
ATOM   9420  O  "O4'" . DC  J 6  11  ? 146.224 142.876 202.292 1.00 79.65  ? -63 DC  J "O4'" 1 
ATOM   9421  C  "C3'" . DC  J 6  11  ? 148.600 142.809 202.499 1.00 79.65  ? -63 DC  J "C3'" 1 
ATOM   9422  O  "O3'" . DC  J 6  11  ? 148.993 142.342 203.777 1.00 79.65  ? -63 DC  J "O3'" 1 
ATOM   9423  C  "C2'" . DC  J 6  11  ? 148.104 141.661 201.627 1.00 79.65  ? -63 DC  J "C2'" 1 
ATOM   9424  C  "C1'" . DC  J 6  11  ? 146.649 141.555 202.050 1.00 79.65  ? -63 DC  J "C1'" 1 
ATOM   9425  N  N1    . DC  J 6  11  ? 145.788 140.986 200.997 1.00 79.65  ? -63 DC  J N1    1 
ATOM   9426  C  C2    . DC  J 6  11  ? 145.158 139.756 201.197 1.00 79.65  ? -63 DC  J C2    1 
ATOM   9427  O  O2    . DC  J 6  11  ? 145.330 139.156 202.260 1.00 79.65  ? -63 DC  J O2    1 
ATOM   9428  N  N3    . DC  J 6  11  ? 144.380 139.257 200.211 1.00 79.65  ? -63 DC  J N3    1 
ATOM   9429  C  C4    . DC  J 6  11  ? 144.225 139.937 199.077 1.00 79.65  ? -63 DC  J C4    1 
ATOM   9430  N  N4    . DC  J 6  11  ? 143.449 139.411 198.127 1.00 79.65  ? -63 DC  J N4    1 
ATOM   9431  C  C5    . DC  J 6  11  ? 144.865 141.182 198.857 1.00 79.65  ? -63 DC  J C5    1 
ATOM   9432  C  C6    . DC  J 6  11  ? 145.622 141.668 199.836 1.00 79.65  ? -63 DC  J C6    1 
ATOM   9433  P  P     . DC  J 6  12  ? 150.524 141.958 204.070 1.00 81.17  ? -62 DC  J P     1 
ATOM   9434  O  OP1   . DC  J 6  12  ? 151.048 142.949 205.034 1.00 81.17  ? -62 DC  J OP1   1 
ATOM   9435  O  OP2   . DC  J 6  12  ? 151.209 141.767 202.777 1.00 81.17  ? -62 DC  J OP2   1 
ATOM   9436  O  "O5'" . DC  J 6  12  ? 150.432 140.541 204.808 1.00 81.17  ? -62 DC  J "O5'" 1 
ATOM   9437  C  "C5'" . DC  J 6  12  ? 150.686 139.337 204.089 1.00 81.17  ? -62 DC  J "C5'" 1 
ATOM   9438  C  "C4'" . DC  J 6  12  ? 150.003 138.161 204.764 1.00 81.17  ? -62 DC  J "C4'" 1 
ATOM   9439  O  "O4'" . DC  J 6  12  ? 148.741 137.900 204.102 1.00 81.17  ? -62 DC  J "O4'" 1 
ATOM   9440  C  "C3'" . DC  J 6  12  ? 150.757 136.845 204.683 1.00 81.17  ? -62 DC  J "C3'" 1 
ATOM   9441  O  "O3'" . DC  J 6  12  ? 150.322 135.987 205.723 1.00 81.17  ? -62 DC  J "O3'" 1 
ATOM   9442  C  "C2'" . DC  J 6  12  ? 150.302 136.331 203.331 1.00 81.17  ? -62 DC  J "C2'" 1 
ATOM   9443  C  "C1'" . DC  J 6  12  ? 148.826 136.686 203.382 1.00 81.17  ? -62 DC  J "C1'" 1 
ATOM   9444  N  N1    . DC  J 6  12  ? 148.241 136.903 202.061 1.00 81.17  ? -62 DC  J N1    1 
ATOM   9445  C  C2    . DC  J 6  12  ? 147.408 135.935 201.511 1.00 81.17  ? -62 DC  J C2    1 
ATOM   9446  O  O2    . DC  J 6  12  ? 147.189 134.901 202.145 1.00 81.17  ? -62 DC  J O2    1 
ATOM   9447  N  N3    . DC  J 6  12  ? 146.879 136.145 200.286 1.00 81.17  ? -62 DC  J N3    1 
ATOM   9448  C  C4    . DC  J 6  12  ? 147.144 137.273 199.635 1.00 81.17  ? -62 DC  J C4    1 
ATOM   9449  N  N4    . DC  J 6  12  ? 146.597 137.444 198.432 1.00 81.17  ? -62 DC  J N4    1 
ATOM   9450  C  C5    . DC  J 6  12  ? 147.993 138.277 200.182 1.00 81.17  ? -62 DC  J C5    1 
ATOM   9451  C  C6    . DC  J 6  12  ? 148.508 138.054 201.391 1.00 81.17  ? -62 DC  J C6    1 
ATOM   9452  P  P     . DG  J 6  13  ? 151.336 134.924 206.375 1.00 82.48  ? -61 DG  J P     1 
ATOM   9453  O  OP1   . DG  J 6  13  ? 151.057 134.868 207.826 1.00 82.48  ? -61 DG  J OP1   1 
ATOM   9454  O  OP2   . DG  J 6  13  ? 152.694 135.263 205.904 1.00 82.48  ? -61 DG  J OP2   1 
ATOM   9455  O  "O5'" . DG  J 6  13  ? 150.926 133.534 205.703 1.00 82.48  ? -61 DG  J "O5'" 1 
ATOM   9456  C  "C5'" . DG  J 6  13  ? 149.587 133.313 205.286 1.00 82.48  ? -61 DG  J "C5'" 1 
ATOM   9457  C  "C4'" . DG  J 6  13  ? 149.377 131.877 204.842 1.00 82.48  ? -61 DG  J "C4'" 1 
ATOM   9458  O  "O4'" . DG  J 6  13  ? 148.646 131.867 203.589 1.00 82.48  ? -61 DG  J "O4'" 1 
ATOM   9459  C  "C3'" . DG  J 6  13  ? 150.646 131.096 204.552 1.00 82.48  ? -61 DG  J "C3'" 1 
ATOM   9460  O  "O3'" . DG  J 6  13  ? 150.371 129.707 204.651 1.00 82.48  ? -61 DG  J "O3'" 1 
ATOM   9461  C  "C2'" . DG  J 6  13  ? 150.906 131.496 203.114 1.00 82.48  ? -61 DG  J "C2'" 1 
ATOM   9462  C  "C1'" . DG  J 6  13  ? 149.497 131.415 202.553 1.00 82.48  ? -61 DG  J "C1'" 1 
ATOM   9463  N  N9    . DG  J 6  13  ? 149.289 132.264 201.398 1.00 82.48  ? -61 DG  J N9    1 
ATOM   9464  C  C8    . DG  J 6  13  ? 149.784 133.526 201.211 1.00 82.48  ? -61 DG  J C8    1 
ATOM   9465  N  N7    . DG  J 6  13  ? 149.433 134.054 200.079 1.00 82.48  ? -61 DG  J N7    1 
ATOM   9466  C  C5    . DG  J 6  13  ? 148.642 133.085 199.484 1.00 82.48  ? -61 DG  J C5    1 
ATOM   9467  C  C6    . DG  J 6  13  ? 147.985 133.096 198.239 1.00 82.48  ? -61 DG  J C6    1 
ATOM   9468  O  O6    . DG  J 6  13  ? 147.968 134.000 197.398 1.00 82.48  ? -61 DG  J O6    1 
ATOM   9469  N  N1    . DG  J 6  13  ? 147.307 131.908 198.002 1.00 82.48  ? -61 DG  J N1    1 
ATOM   9470  C  C2    . DG  J 6  13  ? 147.263 130.843 198.864 1.00 82.48  ? -61 DG  J C2    1 
ATOM   9471  N  N2    . DG  J 6  13  ? 146.550 129.784 198.462 1.00 82.48  ? -61 DG  J N2    1 
ATOM   9472  N  N3    . DG  J 6  13  ? 147.882 130.817 200.039 1.00 82.48  ? -61 DG  J N3    1 
ATOM   9473  C  C4    . DG  J 6  13  ? 148.549 131.974 200.279 1.00 82.48  ? -61 DG  J C4    1 
ATOM   9474  P  P     . DG  J 6  14  ? 151.562 128.637 204.777 1.00 82.08  ? -60 DG  J P     1 
ATOM   9475  O  OP1   . DG  J 6  14  ? 151.340 127.904 206.042 1.00 82.08  ? -60 DG  J OP1   1 
ATOM   9476  O  OP2   . DG  J 6  14  ? 152.859 129.311 204.541 1.00 82.08  ? -60 DG  J OP2   1 
ATOM   9477  O  "O5'" . DG  J 6  14  ? 151.310 127.637 203.556 1.00 82.08  ? -60 DG  J "O5'" 1 
ATOM   9478  C  "C5'" . DG  J 6  14  ? 150.856 126.311 203.806 1.00 82.08  ? -60 DG  J "C5'" 1 
ATOM   9479  C  "C4'" . DG  J 6  14  ? 150.171 125.724 202.585 1.00 82.08  ? -60 DG  J "C4'" 1 
ATOM   9480  O  "O4'" . DG  J 6  14  ? 149.732 126.795 201.709 1.00 82.08  ? -60 DG  J "O4'" 1 
ATOM   9481  C  "C3'" . DG  J 6  14  ? 151.050 124.845 201.707 1.00 82.08  ? -60 DG  J "C3'" 1 
ATOM   9482  O  "O3'" . DG  J 6  14  ? 150.220 123.956 200.982 1.00 82.08  ? -60 DG  J "O3'" 1 
ATOM   9483  C  "C2'" . DG  J 6  14  ? 151.666 125.881 200.787 1.00 82.08  ? -60 DG  J "C2'" 1 
ATOM   9484  C  "C1'" . DG  J 6  14  ? 150.443 126.724 200.488 1.00 82.08  ? -60 DG  J "C1'" 1 
ATOM   9485  N  N9    . DG  J 6  14  ? 150.733 128.083 200.041 1.00 82.08  ? -60 DG  J N9    1 
ATOM   9486  C  C8    . DG  J 6  14  ? 151.463 129.039 200.696 1.00 82.08  ? -60 DG  J C8    1 
ATOM   9487  N  N7    . DG  J 6  14  ? 151.531 130.173 200.054 1.00 82.08  ? -60 DG  J N7    1 
ATOM   9488  C  C5    . DG  J 6  14  ? 150.793 129.952 198.907 1.00 82.08  ? -60 DG  J C5    1 
ATOM   9489  C  C6    . DG  J 6  14  ? 150.502 130.818 197.832 1.00 82.08  ? -60 DG  J C6    1 
ATOM   9490  O  O6    . DG  J 6  14  ? 150.863 131.987 197.668 1.00 82.08  ? -60 DG  J O6    1 
ATOM   9491  N  N1    . DG  J 6  14  ? 149.718 130.195 196.872 1.00 82.08  ? -60 DG  J N1    1 
ATOM   9492  C  C2    . DG  J 6  14  ? 149.262 128.904 196.952 1.00 82.08  ? -60 DG  J C2    1 
ATOM   9493  N  N2    . DG  J 6  14  ? 148.515 128.466 195.933 1.00 82.08  ? -60 DG  J N2    1 
ATOM   9494  N  N3    . DG  J 6  14  ? 149.531 128.087 197.952 1.00 82.08  ? -60 DG  J N3    1 
ATOM   9495  C  C4    . DG  J 6  14  ? 150.291 128.675 198.890 1.00 82.08  ? -60 DG  J C4    1 
ATOM   9496  P  P     . DT  J 6  15  ? 150.805 122.619 200.309 1.00 77.41  ? -59 DT  J P     1 
ATOM   9497  O  OP1   . DT  J 6  15  ? 150.390 121.492 201.168 1.00 77.41  ? -59 DT  J OP1   1 
ATOM   9498  O  OP2   . DT  J 6  15  ? 152.235 122.794 199.970 1.00 77.41  ? -59 DT  J OP2   1 
ATOM   9499  O  "O5'" . DT  J 6  15  ? 150.001 122.525 198.933 1.00 77.41  ? -59 DT  J "O5'" 1 
ATOM   9500  C  "C5'" . DT  J 6  15  ? 149.692 123.711 198.219 1.00 77.41  ? -59 DT  J "C5'" 1 
ATOM   9501  C  "C4'" . DT  J 6  15  ? 149.684 123.447 196.729 1.00 77.41  ? -59 DT  J "C4'" 1 
ATOM   9502  O  "O4'" . DT  J 6  15  ? 149.878 124.696 196.025 1.00 77.41  ? -59 DT  J "O4'" 1 
ATOM   9503  C  "C3'" . DT  J 6  15  ? 150.822 122.583 196.238 1.00 77.41  ? -59 DT  J "C3'" 1 
ATOM   9504  O  "O3'" . DT  J 6  15  ? 150.518 122.167 194.933 1.00 77.41  ? -59 DT  J "O3'" 1 
ATOM   9505  C  "C2'" . DT  J 6  15  ? 151.944 123.601 196.216 1.00 77.41  ? -59 DT  J "C2'" 1 
ATOM   9506  C  "C1'" . DT  J 6  15  ? 151.211 124.753 195.546 1.00 77.41  ? -59 DT  J "C1'" 1 
ATOM   9507  N  N1    . DT  J 6  15  ? 151.743 126.088 195.855 1.00 77.41  ? -59 DT  J N1    1 
ATOM   9508  C  C2    . DT  J 6  15  ? 151.421 127.114 195.018 1.00 77.41  ? -59 DT  J C2    1 
ATOM   9509  O  O2    . DT  J 6  15  ? 150.735 126.968 194.024 1.00 77.41  ? -59 DT  J O2    1 
ATOM   9510  N  N3    . DT  J 6  15  ? 151.934 128.321 195.368 1.00 77.41  ? -59 DT  J N3    1 
ATOM   9511  C  C4    . DT  J 6  15  ? 152.714 128.606 196.459 1.00 77.41  ? -59 DT  J C4    1 
ATOM   9512  O  O4    . DT  J 6  15  ? 153.132 129.733 196.683 1.00 77.41  ? -59 DT  J O4    1 
ATOM   9513  C  C5    . DT  J 6  15  ? 153.019 127.491 197.308 1.00 77.41  ? -59 DT  J C5    1 
ATOM   9514  C  C7    . DT  J 6  15  ? 153.875 127.689 198.518 1.00 77.41  ? -59 DT  J C7    1 
ATOM   9515  C  C6    . DT  J 6  15  ? 152.521 126.290 196.975 1.00 77.41  ? -59 DT  J C6    1 
ATOM   9516  P  P     . DG  J 6  16  ? 151.102 120.797 194.348 1.00 72.49  ? -58 DG  J P     1 
ATOM   9517  O  OP1   . DG  J 6  16  ? 150.358 119.697 194.996 1.00 72.49  ? -58 DG  J OP1   1 
ATOM   9518  O  OP2   . DG  J 6  16  ? 152.577 120.843 194.438 1.00 72.49  ? -58 DG  J OP2   1 
ATOM   9519  O  "O5'" . DG  J 6  16  ? 150.703 120.870 192.805 1.00 72.49  ? -58 DG  J "O5'" 1 
ATOM   9520  C  "C5'" . DG  J 6  16  ? 150.235 122.104 192.263 1.00 72.49  ? -58 DG  J "C5'" 1 
ATOM   9521  C  "C4'" . DG  J 6  16  ? 151.118 122.558 191.121 1.00 72.49  ? -58 DG  J "C4'" 1 
ATOM   9522  O  "O4'" . DG  J 6  16  ? 151.663 123.876 191.409 1.00 72.49  ? -58 DG  J "O4'" 1 
ATOM   9523  C  "C3'" . DG  J 6  16  ? 152.323 121.663 190.851 1.00 72.49  ? -58 DG  J "C3'" 1 
ATOM   9524  O  "O3'" . DG  J 6  16  ? 152.649 121.697 189.472 1.00 72.49  ? -58 DG  J "O3'" 1 
ATOM   9525  C  "C2'" . DG  J 6  16  ? 153.402 122.365 191.665 1.00 72.49  ? -58 DG  J "C2'" 1 
ATOM   9526  C  "C1'" . DG  J 6  16  ? 153.068 123.812 191.345 1.00 72.49  ? -58 DG  J "C1'" 1 
ATOM   9527  N  N9    . DG  J 6  16  ? 153.624 124.776 192.283 1.00 72.49  ? -58 DG  J N9    1 
ATOM   9528  C  C8    . DG  J 6  16  ? 154.190 124.514 193.502 1.00 72.49  ? -58 DG  J C8    1 
ATOM   9529  N  N7    . DG  J 6  16  ? 154.602 125.581 194.120 1.00 72.49  ? -58 DG  J N7    1 
ATOM   9530  C  C5    . DG  J 6  16  ? 154.290 126.617 193.252 1.00 72.49  ? -58 DG  J C5    1 
ATOM   9531  C  C6    . DG  J 6  16  ? 154.497 128.008 193.385 1.00 72.49  ? -58 DG  J C6    1 
ATOM   9532  O  O6    . DG  J 6  16  ? 155.014 128.617 194.327 1.00 72.49  ? -58 DG  J O6    1 
ATOM   9533  N  N1    . DG  J 6  16  ? 154.033 128.712 192.279 1.00 72.49  ? -58 DG  J N1    1 
ATOM   9534  C  C2    . DG  J 6  16  ? 153.444 128.140 191.182 1.00 72.49  ? -58 DG  J C2    1 
ATOM   9535  N  N2    . DG  J 6  16  ? 153.054 128.981 190.212 1.00 72.49  ? -58 DG  J N2    1 
ATOM   9536  N  N3    . DG  J 6  16  ? 153.238 126.834 191.048 1.00 72.49  ? -58 DG  J N3    1 
ATOM   9537  C  C4    . DG  J 6  16  ? 153.685 126.139 192.119 1.00 72.49  ? -58 DG  J C4    1 
ATOM   9538  P  P     . DC  J 6  17  ? 151.910 120.766 188.385 1.00 70.53  ? -57 DC  J P     1 
ATOM   9539  O  OP1   . DC  J 6  17  ? 150.536 120.414 188.796 1.00 70.53  ? -57 DC  J OP1   1 
ATOM   9540  O  OP2   . DC  J 6  17  ? 152.834 119.668 188.037 1.00 70.53  ? -57 DC  J OP2   1 
ATOM   9541  O  "O5'" . DC  J 6  17  ? 151.836 121.737 187.125 1.00 70.53  ? -57 DC  J "O5'" 1 
ATOM   9542  C  "C5'" . DC  J 6  17  ? 151.895 123.150 187.332 1.00 70.53  ? -57 DC  J "C5'" 1 
ATOM   9543  C  "C4'" . DC  J 6  17  ? 153.186 123.729 186.784 1.00 70.53  ? -57 DC  J "C4'" 1 
ATOM   9544  O  "O4'" . DC  J 6  17  ? 153.901 124.451 187.828 1.00 70.53  ? -57 DC  J "O4'" 1 
ATOM   9545  C  "C3'" . DC  J 6  17  ? 154.179 122.697 186.251 1.00 70.53  ? -57 DC  J "C3'" 1 
ATOM   9546  O  "O3'" . DC  J 6  17  ? 154.807 123.206 185.101 1.00 70.53  ? -57 DC  J "O3'" 1 
ATOM   9547  C  "C2'" . DC  J 6  17  ? 155.167 122.584 187.399 1.00 70.53  ? -57 DC  J "C2'" 1 
ATOM   9548  C  "C1'" . DC  J 6  17  ? 155.246 124.037 187.806 1.00 70.53  ? -57 DC  J "C1'" 1 
ATOM   9549  N  N1    . DC  J 6  17  ? 155.860 124.268 189.142 1.00 70.53  ? -57 DC  J N1    1 
ATOM   9550  C  C2    . DC  J 6  17  ? 155.970 125.568 189.637 1.00 70.53  ? -57 DC  J C2    1 
ATOM   9551  O  O2    . DC  J 6  17  ? 155.554 126.512 188.962 1.00 70.53  ? -57 DC  J O2    1 
ATOM   9552  N  N3    . DC  J 6  17  ? 156.535 125.764 190.849 1.00 70.53  ? -57 DC  J N3    1 
ATOM   9553  C  C4    . DC  J 6  17  ? 156.973 124.727 191.552 1.00 70.53  ? -57 DC  J C4    1 
ATOM   9554  N  N4    . DC  J 6  17  ? 157.520 124.969 192.746 1.00 70.53  ? -57 DC  J N4    1 
ATOM   9555  C  C5    . DC  J 6  17  ? 156.877 123.394 191.063 1.00 70.53  ? -57 DC  J C5    1 
ATOM   9556  C  C6    . DC  J 6  17  ? 156.329 123.215 189.861 1.00 70.53  ? -57 DC  J C6    1 
ATOM   9557  P  P     . DC  J 6  18  ? 154.326 122.728 183.650 1.00 64.52  ? -56 DC  J P     1 
ATOM   9558  O  OP1   . DC  J 6  18  ? 153.035 122.037 183.836 1.00 64.52  ? -56 DC  J OP1   1 
ATOM   9559  O  OP2   . DC  J 6  18  ? 155.460 122.023 183.022 1.00 64.52  ? -56 DC  J OP2   1 
ATOM   9560  O  "O5'" . DC  J 6  18  ? 154.097 124.092 182.845 1.00 64.52  ? -56 DC  J "O5'" 1 
ATOM   9561  C  "C5'" . DC  J 6  18  ? 153.977 125.321 183.547 1.00 64.52  ? -56 DC  J "C5'" 1 
ATOM   9562  C  "C4'" . DC  J 6  18  ? 155.291 126.086 183.540 1.00 64.52  ? -56 DC  J "C4'" 1 
ATOM   9563  O  "O4'" . DC  J 6  18  ? 156.009 125.867 184.788 1.00 64.52  ? -56 DC  J "O4'" 1 
ATOM   9564  C  "C3'" . DC  J 6  18  ? 156.255 125.691 182.431 1.00 64.52  ? -56 DC  J "C3'" 1 
ATOM   9565  O  "O3'" . DC  J 6  18  ? 156.829 126.845 181.883 1.00 64.52  ? -56 DC  J "O3'" 1 
ATOM   9566  C  "C2'" . DC  J 6  18  ? 157.291 124.848 183.164 1.00 64.52  ? -56 DC  J "C2'" 1 
ATOM   9567  C  "C1'" . DC  J 6  18  ? 157.354 125.578 184.486 1.00 64.52  ? -56 DC  J "C1'" 1 
ATOM   9568  N  N1    . DC  J 6  18  ? 157.931 124.782 185.593 1.00 64.52  ? -56 DC  J N1    1 
ATOM   9569  C  C2    . DC  J 6  18  ? 158.336 125.427 186.759 1.00 64.52  ? -56 DC  J C2    1 
ATOM   9570  O  O2    . DC  J 6  18  ? 158.214 126.646 186.845 1.00 64.52  ? -56 DC  J O2    1 
ATOM   9571  N  N3    . DC  J 6  18  ? 158.854 124.696 187.767 1.00 64.52  ? -56 DC  J N3    1 
ATOM   9572  C  C4    . DC  J 6  18  ? 158.975 123.376 187.639 1.00 64.52  ? -56 DC  J C4    1 
ATOM   9573  N  N4    . DC  J 6  18  ? 159.487 122.698 188.668 1.00 64.52  ? -56 DC  J N4    1 
ATOM   9574  C  C5    . DC  J 6  18  ? 158.573 122.696 186.455 1.00 64.52  ? -56 DC  J C5    1 
ATOM   9575  C  C6    . DC  J 6  18  ? 158.058 123.432 185.467 1.00 64.52  ? -56 DC  J C6    1 
ATOM   9576  P  P     . DG  J 6  19  ? 156.405 127.301 180.411 1.00 55.03  ? -55 DG  J P     1 
ATOM   9577  O  OP1   . DG  J 6  19  ? 154.938 127.486 180.414 1.00 55.03  ? -55 DG  J OP1   1 
ATOM   9578  O  OP2   . DG  J 6  19  ? 157.023 126.363 179.458 1.00 55.03  ? -55 DG  J OP2   1 
ATOM   9579  O  "O5'" . DG  J 6  19  ? 157.137 128.702 180.213 1.00 55.03  ? -55 DG  J "O5'" 1 
ATOM   9580  C  "C5'" . DG  J 6  19  ? 156.823 129.799 181.059 1.00 55.03  ? -55 DG  J "C5'" 1 
ATOM   9581  C  "C4'" . DG  J 6  19  ? 158.048 130.310 181.802 1.00 55.03  ? -55 DG  J "C4'" 1 
ATOM   9582  O  "O4'" . DG  J 6  19  ? 158.574 129.267 182.655 1.00 55.03  ? -55 DG  J "O4'" 1 
ATOM   9583  C  "C3'" . DG  J 6  19  ? 159.224 130.763 180.938 1.00 55.03  ? -55 DG  J "C3'" 1 
ATOM   9584  O  "O3'" . DG  J 6  19  ? 159.870 131.831 181.595 1.00 55.03  ? -55 DG  J "O3'" 1 
ATOM   9585  C  "C2'" . DG  J 6  19  ? 160.114 129.530 180.933 1.00 55.03  ? -55 DG  J "C2'" 1 
ATOM   9586  C  "C1'" . DG  J 6  19  ? 159.944 129.078 182.363 1.00 55.03  ? -55 DG  J "C1'" 1 
ATOM   9587  N  N9    . DG  J 6  19  ? 160.262 127.680 182.583 1.00 55.03  ? -55 DG  J N9    1 
ATOM   9588  C  C8    . DG  J 6  19  ? 159.991 126.627 181.750 1.00 55.03  ? -55 DG  J C8    1 
ATOM   9589  N  N7    . DG  J 6  19  ? 160.383 125.482 182.225 1.00 55.03  ? -55 DG  J N7    1 
ATOM   9590  C  C5    . DG  J 6  19  ? 160.916 125.800 183.461 1.00 55.03  ? -55 DG  J C5    1 
ATOM   9591  C  C6    . DG  J 6  19  ? 161.497 124.972 184.425 1.00 55.03  ? -55 DG  J C6    1 
ATOM   9592  O  O6    . DG  J 6  19  ? 161.641 123.751 184.392 1.00 55.03  ? -55 DG  J O6    1 
ATOM   9593  N  N1    . DG  J 6  19  ? 161.932 125.693 185.522 1.00 55.03  ? -55 DG  J N1    1 
ATOM   9594  C  C2    . DG  J 6  19  ? 161.815 127.047 185.666 1.00 55.03  ? -55 DG  J C2    1 
ATOM   9595  N  N2    . DG  J 6  19  ? 162.291 127.565 186.798 1.00 55.03  ? -55 DG  J N2    1 
ATOM   9596  N  N3    . DG  J 6  19  ? 161.280 127.837 184.762 1.00 55.03  ? -55 DG  J N3    1 
ATOM   9597  C  C4    . DG  J 6  19  ? 160.853 127.146 183.689 1.00 55.03  ? -55 DG  J C4    1 
ATOM   9598  P  P     . DA  J 6  20  ? 160.855 132.824 180.809 1.00 53.63  ? -54 DA  J P     1 
ATOM   9599  O  OP1   . DA  J 6  20  ? 160.098 134.064 180.558 1.00 53.63  ? -54 DA  J OP1   1 
ATOM   9600  O  OP2   . DA  J 6  20  ? 161.544 132.140 179.699 1.00 53.63  ? -54 DA  J OP2   1 
ATOM   9601  O  "O5'" . DA  J 6  20  ? 161.979 133.136 181.883 1.00 53.63  ? -54 DA  J "O5'" 1 
ATOM   9602  C  "C5'" . DA  J 6  20  ? 161.628 133.676 183.141 1.00 53.63  ? -54 DA  J "C5'" 1 
ATOM   9603  C  "C4'" . DA  J 6  20  ? 162.786 133.583 184.121 1.00 53.63  ? -54 DA  J "C4'" 1 
ATOM   9604  O  "O4'" . DA  J 6  20  ? 162.963 132.212 184.539 1.00 53.63  ? -54 DA  J "O4'" 1 
ATOM   9605  C  "C3'" . DA  J 6  20  ? 164.135 134.047 183.594 1.00 53.63  ? -54 DA  J "C3'" 1 
ATOM   9606  O  "O3'" . DA  J 6  20  ? 164.835 134.739 184.603 1.00 53.63  ? -54 DA  J "O3'" 1 
ATOM   9607  C  "C2'" . DA  J 6  20  ? 164.845 132.757 183.207 1.00 53.63  ? -54 DA  J "C2'" 1 
ATOM   9608  C  "C1'" . DA  J 6  20  ? 164.216 131.714 184.120 1.00 53.63  ? -54 DA  J "C1'" 1 
ATOM   9609  N  N9    . DA  J 6  20  ? 163.984 130.444 183.446 1.00 53.63  ? -54 DA  J N9    1 
ATOM   9610  C  C8    . DA  J 6  20  ? 163.346 130.259 182.256 1.00 53.63  ? -54 DA  J C8    1 
ATOM   9611  N  N7    . DA  J 6  20  ? 163.282 129.008 181.882 1.00 53.63  ? -54 DA  J N7    1 
ATOM   9612  C  C5    . DA  J 6  20  ? 163.907 128.327 182.899 1.00 53.63  ? -54 DA  J C5    1 
ATOM   9613  C  C6    . DA  J 6  20  ? 164.162 126.967 183.098 1.00 53.63  ? -54 DA  J C6    1 
ATOM   9614  N  N6    . DA  J 6  20  ? 163.797 126.022 182.232 1.00 53.63  ? -54 DA  J N6    1 
ATOM   9615  N  N1    . DA  J 6  20  ? 164.819 126.611 184.217 1.00 53.63  ? -54 DA  J N1    1 
ATOM   9616  C  C2    . DA  J 6  20  ? 165.189 127.562 185.082 1.00 53.63  ? -54 DA  J C2    1 
ATOM   9617  N  N3    . DA  J 6  20  ? 165.007 128.877 184.998 1.00 53.63  ? -54 DA  J N3    1 
ATOM   9618  C  C4    . DA  J 6  20  ? 164.350 129.195 183.874 1.00 53.63  ? -54 DA  J C4    1 
ATOM   9619  P  P     . DG  J 6  21  ? 166.261 135.396 184.282 1.00 53.85  ? -53 DG  J P     1 
ATOM   9620  O  OP1   . DG  J 6  21  ? 166.406 136.560 185.169 1.00 53.85  ? -53 DG  J OP1   1 
ATOM   9621  O  OP2   . DG  J 6  21  ? 166.391 135.580 182.820 1.00 53.85  ? -53 DG  J OP2   1 
ATOM   9622  O  "O5'" . DG  J 6  21  ? 167.301 134.300 184.768 1.00 53.85  ? -53 DG  J "O5'" 1 
ATOM   9623  C  "C5'" . DG  J 6  21  ? 167.241 133.836 186.093 1.00 53.85  ? -53 DG  J "C5'" 1 
ATOM   9624  C  "C4'" . DG  J 6  21  ? 168.142 132.643 186.271 1.00 53.85  ? -53 DG  J "C4'" 1 
ATOM   9625  O  "O4'" . DG  J 6  21  ? 167.577 131.497 185.591 1.00 53.85  ? -53 DG  J "O4'" 1 
ATOM   9626  C  "C3'" . DG  J 6  21  ? 169.550 132.826 185.709 1.00 53.85  ? -53 DG  J "C3'" 1 
ATOM   9627  O  "O3'" . DG  J 6  21  ? 170.488 132.559 186.730 1.00 53.85  ? -53 DG  J "O3'" 1 
ATOM   9628  C  "C2'" . DG  J 6  21  ? 169.634 131.797 184.573 1.00 53.85  ? -53 DG  J "C2'" 1 
ATOM   9629  C  "C1'" . DG  J 6  21  ? 168.618 130.759 185.011 1.00 53.85  ? -53 DG  J "C1'" 1 
ATOM   9630  N  N9    . DG  J 6  21  ? 168.061 129.972 183.912 1.00 53.85  ? -53 DG  J N9    1 
ATOM   9631  C  C8    . DG  J 6  21  ? 167.338 130.445 182.853 1.00 53.85  ? -53 DG  J C8    1 
ATOM   9632  N  N7    . DG  J 6  21  ? 166.949 129.521 182.029 1.00 53.85  ? -53 DG  J N7    1 
ATOM   9633  C  C5    . DG  J 6  21  ? 167.450 128.352 182.571 1.00 53.85  ? -53 DG  J C5    1 
ATOM   9634  C  C6    . DG  J 6  21  ? 167.346 127.024 182.108 1.00 53.85  ? -53 DG  J C6    1 
ATOM   9635  O  O6    . DG  J 6  21  ? 166.774 126.617 181.095 1.00 53.85  ? -53 DG  J O6    1 
ATOM   9636  N  N1    . DG  J 6  21  ? 167.996 126.130 182.951 1.00 53.85  ? -53 DG  J N1    1 
ATOM   9637  C  C2    . DG  J 6  21  ? 168.656 126.475 184.105 1.00 53.85  ? -53 DG  J C2    1 
ATOM   9638  N  N2    . DG  J 6  21  ? 169.227 125.470 184.790 1.00 53.85  ? -53 DG  J N2    1 
ATOM   9639  N  N3    . DG  J 6  21  ? 168.766 127.725 184.552 1.00 53.85  ? -53 DG  J N3    1 
ATOM   9640  C  C4    . DG  J 6  21  ? 168.137 128.608 183.735 1.00 53.85  ? -53 DG  J C4    1 
ATOM   9641  P  P     . DG  J 6  22  ? 172.038 132.933 186.544 1.00 53.20  ? -52 DG  J P     1 
ATOM   9642  O  OP1   . DG  J 6  22  ? 172.481 133.543 187.814 1.00 53.20  ? -52 DG  J OP1   1 
ATOM   9643  O  OP2   . DG  J 6  22  ? 172.211 133.672 185.277 1.00 53.20  ? -52 DG  J OP2   1 
ATOM   9644  O  "O5'" . DG  J 6  22  ? 172.744 131.511 186.389 1.00 53.20  ? -52 DG  J "O5'" 1 
ATOM   9645  C  "C5'" . DG  J 6  22  ? 172.560 130.538 187.393 1.00 53.20  ? -52 DG  J "C5'" 1 
ATOM   9646  C  "C4'" . DG  J 6  22  ? 172.924 129.160 186.885 1.00 53.20  ? -52 DG  J "C4'" 1 
ATOM   9647  O  "O4'" . DG  J 6  22  ? 172.001 128.748 185.848 1.00 53.20  ? -52 DG  J "O4'" 1 
ATOM   9648  C  "C3'" . DG  J 6  22  ? 174.322 129.036 186.278 1.00 53.20  ? -52 DG  J "C3'" 1 
ATOM   9649  O  "O3'" . DG  J 6  22  ? 174.960 127.917 186.846 1.00 53.20  ? -52 DG  J "O3'" 1 
ATOM   9650  C  "C2'" . DG  J 6  22  ? 174.039 128.819 184.791 1.00 53.20  ? -52 DG  J "C2'" 1 
ATOM   9651  C  "C1'" . DG  J 6  22  ? 172.727 128.077 184.860 1.00 53.20  ? -52 DG  J "C1'" 1 
ATOM   9652  N  N9    . DG  J 6  22  ? 171.963 128.114 183.631 1.00 53.20  ? -52 DG  J N9    1 
ATOM   9653  C  C8    . DG  J 6  22  ? 171.416 129.212 183.036 1.00 53.20  ? -52 DG  J C8    1 
ATOM   9654  N  N7    . DG  J 6  22  ? 170.768 128.938 181.945 1.00 53.20  ? -52 DG  J N7    1 
ATOM   9655  C  C5    . DG  J 6  22  ? 170.890 127.565 181.815 1.00 53.20  ? -52 DG  J C5    1 
ATOM   9656  C  C6    . DG  J 6  22  ? 170.395 126.701 180.819 1.00 53.20  ? -52 DG  J C6    1 
ATOM   9657  O  O6    . DG  J 6  22  ? 169.720 126.987 179.830 1.00 53.20  ? -52 DG  J O6    1 
ATOM   9658  N  N1    . DG  J 6  22  ? 170.738 125.381 181.063 1.00 53.20  ? -52 DG  J N1    1 
ATOM   9659  C  C2    . DG  J 6  22  ? 171.478 124.953 182.132 1.00 53.20  ? -52 DG  J C2    1 
ATOM   9660  N  N2    . DG  J 6  22  ? 171.718 123.636 182.205 1.00 53.20  ? -52 DG  J N2    1 
ATOM   9661  N  N3    . DG  J 6  22  ? 171.951 125.755 183.074 1.00 53.20  ? -52 DG  J N3    1 
ATOM   9662  C  C4    . DG  J 6  22  ? 171.619 127.045 182.847 1.00 53.20  ? -52 DG  J C4    1 
ATOM   9663  P  P     . DC  J 6  23  ? 176.560 127.831 186.932 1.00 57.42  ? -51 DC  J P     1 
ATOM   9664  O  OP1   . DC  J 6  23  ? 176.931 128.018 188.350 1.00 57.42  ? -51 DC  J OP1   1 
ATOM   9665  O  OP2   . DC  J 6  23  ? 177.136 128.721 185.901 1.00 57.42  ? -51 DC  J OP2   1 
ATOM   9666  O  "O5'" . DC  J 6  23  ? 176.850 126.319 186.513 1.00 57.42  ? -51 DC  J "O5'" 1 
ATOM   9667  C  "C5'" . DC  J 6  23  ? 175.780 125.523 186.034 1.00 57.42  ? -51 DC  J "C5'" 1 
ATOM   9668  C  "C4'" . DC  J 6  23  ? 176.273 124.219 185.447 1.00 57.42  ? -51 DC  J "C4'" 1 
ATOM   9669  O  "O4'" . DC  J 6  23  ? 175.514 123.933 184.250 1.00 57.42  ? -51 DC  J "O4'" 1 
ATOM   9670  C  "C3'" . DC  J 6  23  ? 177.717 124.213 184.981 1.00 57.42  ? -51 DC  J "C3'" 1 
ATOM   9671  O  "O3'" . DC  J 6  23  ? 178.145 122.859 184.836 1.00 57.42  ? -51 DC  J "O3'" 1 
ATOM   9672  C  "C2'" . DC  J 6  23  ? 177.572 124.883 183.630 1.00 57.42  ? -51 DC  J "C2'" 1 
ATOM   9673  C  "C1'" . DC  J 6  23  ? 176.318 124.194 183.114 1.00 57.42  ? -51 DC  J "C1'" 1 
ATOM   9674  N  N1    . DC  J 6  23  ? 175.547 125.023 182.188 1.00 57.42  ? -51 DC  J N1    1 
ATOM   9675  C  C2    . DC  J 6  23  ? 174.943 124.435 181.082 1.00 57.42  ? -51 DC  J C2    1 
ATOM   9676  O  O2    . DC  J 6  23  ? 175.089 123.226 180.899 1.00 57.42  ? -51 DC  J O2    1 
ATOM   9677  N  N3    . DC  J 6  23  ? 174.242 125.214 180.235 1.00 57.42  ? -51 DC  J N3    1 
ATOM   9678  C  C4    . DC  J 6  23  ? 174.124 126.518 180.476 1.00 57.42  ? -51 DC  J C4    1 
ATOM   9679  N  N4    . DC  J 6  23  ? 173.414 127.252 179.623 1.00 57.42  ? -51 DC  J N4    1 
ATOM   9680  C  C5    . DC  J 6  23  ? 174.736 127.132 181.601 1.00 57.42  ? -51 DC  J C5    1 
ATOM   9681  C  C6    . DC  J 6  23  ? 175.425 126.354 182.425 1.00 57.42  ? -51 DC  J C6    1 
ATOM   9682  P  P     . DC  J 6  24  ? 179.695 122.465 184.665 1.00 60.19  ? -50 DC  J P     1 
ATOM   9683  O  OP1   . DC  J 6  24  ? 180.095 121.800 185.921 1.00 60.19  ? -50 DC  J OP1   1 
ATOM   9684  O  OP2   . DC  J 6  24  ? 180.479 123.625 184.191 1.00 60.19  ? -50 DC  J OP2   1 
ATOM   9685  O  "O5'" . DC  J 6  24  ? 179.668 121.374 183.493 1.00 60.19  ? -50 DC  J "O5'" 1 
ATOM   9686  C  "C5'" . DC  J 6  24  ? 178.461 121.152 182.766 1.00 60.19  ? -50 DC  J "C5'" 1 
ATOM   9687  C  "C4'" . DC  J 6  24  ? 178.672 120.192 181.605 1.00 60.19  ? -50 DC  J "C4'" 1 
ATOM   9688  O  "O4'" . DC  J 6  24  ? 177.939 120.655 180.445 1.00 60.19  ? -50 DC  J "O4'" 1 
ATOM   9689  C  "C3'" . DC  J 6  24  ? 180.094 120.050 181.116 1.00 60.19  ? -50 DC  J "C3'" 1 
ATOM   9690  O  "O3'" . DC  J 6  24  ? 180.217 118.786 180.452 1.00 60.19  ? -50 DC  J "O3'" 1 
ATOM   9691  C  "C2'" . DC  J 6  24  ? 180.214 121.237 180.155 1.00 60.19  ? -50 DC  J "C2'" 1 
ATOM   9692  C  "C1'" . DC  J 6  24  ? 178.821 121.298 179.535 1.00 60.19  ? -50 DC  J "C1'" 1 
ATOM   9693  N  N1    . DC  J 6  24  ? 178.320 122.680 179.339 1.00 60.19  ? -50 DC  J N1    1 
ATOM   9694  C  C2    . DC  J 6  24  ? 177.501 122.974 178.253 1.00 60.19  ? -50 DC  J C2    1 
ATOM   9695  O  O2    . DC  J 6  24  ? 177.228 122.080 177.446 1.00 60.19  ? -50 DC  J O2    1 
ATOM   9696  N  N3    . DC  J 6  24  ? 177.035 124.236 178.109 1.00 60.19  ? -50 DC  J N3    1 
ATOM   9697  C  C4    . DC  J 6  24  ? 177.361 125.169 178.998 1.00 60.19  ? -50 DC  J C4    1 
ATOM   9698  N  N4    . DC  J 6  24  ? 176.880 126.397 178.827 1.00 60.19  ? -50 DC  J N4    1 
ATOM   9699  C  C5    . DC  J 6  24  ? 178.187 124.886 180.112 1.00 60.19  ? -50 DC  J C5    1 
ATOM   9700  C  C6    . DC  J 6  24  ? 178.634 123.642 180.245 1.00 60.19  ? -50 DC  J C6    1 
ATOM   9701  P  P     . DG  J 6  25  ? 181.494 118.409 179.552 1.00 56.27  ? -49 DG  J P     1 
ATOM   9702  O  OP1   . DG  J 6  25  ? 181.560 116.933 179.526 1.00 56.27  ? -49 DG  J OP1   1 
ATOM   9703  O  OP2   . DG  J 6  25  ? 182.686 119.160 180.005 1.00 56.27  ? -49 DG  J OP2   1 
ATOM   9704  O  "O5'" . DG  J 6  25  ? 181.070 118.894 178.090 1.00 56.27  ? -49 DG  J "O5'" 1 
ATOM   9705  C  "C5'" . DG  J 6  25  ? 181.863 118.563 176.977 1.00 56.27  ? -49 DG  J "C5'" 1 
ATOM   9706  C  "C4'" . DG  J 6  25  ? 181.023 118.499 175.719 1.00 56.27  ? -49 DG  J "C4'" 1 
ATOM   9707  O  "O4'" . DG  J 6  25  ? 180.055 119.577 175.725 1.00 56.27  ? -49 DG  J "O4'" 1 
ATOM   9708  C  "C3'" . DG  J 6  25  ? 181.807 118.692 174.445 1.00 56.27  ? -49 DG  J "C3'" 1 
ATOM   9709  O  "O3'" . DG  J 6  25  ? 181.106 118.132 173.363 1.00 56.27  ? -49 DG  J "O3'" 1 
ATOM   9710  C  "C2'" . DG  J 6  25  ? 181.862 120.204 174.352 1.00 56.27  ? -49 DG  J "C2'" 1 
ATOM   9711  C  "C1'" . DG  J 6  25  ? 180.472 120.597 174.836 1.00 56.27  ? -49 DG  J "C1'" 1 
ATOM   9712  N  N9    . DG  J 6  25  ? 180.424 121.867 175.558 1.00 56.27  ? -49 DG  J N9    1 
ATOM   9713  C  C8    . DG  J 6  25  ? 181.046 122.173 176.741 1.00 56.27  ? -49 DG  J C8    1 
ATOM   9714  N  N7    . DG