data_6R7X
# 
_entry.id   6R7X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6R7X         
WWPDB D_1292101488 
EMDB  EMD-4746     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'CryoEM structure of calcium-bound human TMEM16K / Anoctamin 10 in detergent (2mM Ca2+, closed form)' 
_pdbx_database_related.db_id          EMD-4746 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6R7X 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-29 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pike, A.C.W.'                         1  0000-0001-9661-2607 
'Bushell, S.R.'                        2  ?                   
'Shintre, C.A.'                        3  ?                   
'Tessitore, A.'                        4  ?                   
'Baronina, A.'                         5  ?                   
'Chu, A.'                              6  ?                   
'Mukhopadhyay, S.'                     7  ?                   
'Shrestha, L.'                         8  ?                   
'Chalk, R.'                            9  ?                   
'Burgess-Brown, N.A.'                  10 ?                   
'Love, J.'                             11 ?                   
'Huiskonen, J.T.'                      12 ?                   
'Edwards, A.M.'                        13 ?                   
'Arrowsmith, C.H.'                     14 ?                   
'Bountra, C.'                          15 ?                   
'Carpenter, E.P.'                      16 0000-0001-9138-2937 
'Structural Genomics Consortium (SGC)' 17 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                3956 
_citation.page_last                 3956 
_citation.title                     
'The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-11753-1 
_citation.pdbx_database_id_PubMed   31477691 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bushell, S.R.'        1  0000-0001-5477-6777 
primary 'Pike, A.C.W.'         2  0000-0001-9661-2607 
primary 'Falzone, M.E.'        3  ?                   
primary 'Rorsman, N.J.G.'      4  ?                   
primary 'Ta, C.M.'             5  ?                   
primary 'Corey, R.A.'          6  ?                   
primary 'Newport, T.D.'        7  ?                   
primary 'Christianson, J.C.'   8  0000-0002-0474-1207 
primary 'Scofano, L.F.'        9  0000-0002-5670-7983 
primary 'Shintre, C.A.'        10 0000-0001-7225-7970 
primary 'Tessitore, A.'        11 ?                   
primary 'Chu, A.'              12 ?                   
primary 'Wang, Q.'             13 ?                   
primary 'Shrestha, L.'         14 ?                   
primary 'Mukhopadhyay, S.M.M.' 15 0000-0003-1430-5529 
primary 'Love, J.D.'           16 ?                   
primary 'Burgess-Brown, N.A.'  17 ?                   
primary 'Sitsapesan, R.'       18 ?                   
primary 'Stansfeld, P.J.'      19 0000-0001-8800-7669 
primary 'Huiskonen, J.T.'      20 0000-0002-0348-7323 
primary 'Tammaro, P.'          21 ?                   
primary 'Accardi, A.'          22 0000-0002-6584-0102 
primary 'Carpenter, E.P.'      23 0000-0001-9138-2937 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6R7X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6R7X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Anoctamin-10                           77276.016 2  ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'                          40.078    6  ? ? ? ? 
3 non-polymer syn 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 790.145   2  ? ? ? ? 
4 non-polymer syn UNDECYL-MALTOSIDE                      496.589   20 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Transmembrane protein 16K' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   LEU n 
1 6   SER n 
1 7   ALA n 
1 8   LEU n 
1 9   ASP n 
1 10  THR n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  SER n 
1 15  PHE n 
1 16  THR n 
1 17  PRO n 
1 18  LEU n 
1 19  VAL n 
1 20  VAL n 
1 21  ILE n 
1 22  GLU n 
1 23  LEU n 
1 24  ALA n 
1 25  GLN n 
1 26  ASP n 
1 27  VAL n 
1 28  LYS n 
1 29  GLU n 
1 30  GLU n 
1 31  THR n 
1 32  LYS n 
1 33  GLU n 
1 34  TRP n 
1 35  LEU n 
1 36  LYS n 
1 37  ASN n 
1 38  ARG n 
1 39  ILE n 
1 40  ILE n 
1 41  ALA n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  ASP n 
1 46  GLY n 
1 47  GLY n 
1 48  ALA n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  PHE n 
1 53  ARG n 
1 54  PRO n 
1 55  LEU n 
1 56  LEU n 
1 57  ASN n 
1 58  LYS n 
1 59  TYR n 
1 60  GLU n 
1 61  GLN n 
1 62  GLU n 
1 63  THR n 
1 64  LEU n 
1 65  GLU n 
1 66  ASN n 
1 67  GLN n 
1 68  ASN n 
1 69  LEU n 
1 70  TYR n 
1 71  LEU n 
1 72  VAL n 
1 73  GLY n 
1 74  ALA n 
1 75  SER n 
1 76  LYS n 
1 77  ILE n 
1 78  ARG n 
1 79  MET n 
1 80  LEU n 
1 81  LEU n 
1 82  GLY n 
1 83  ALA n 
1 84  GLU n 
1 85  ALA n 
1 86  VAL n 
1 87  GLY n 
1 88  LEU n 
1 89  VAL n 
1 90  LYS n 
1 91  GLU n 
1 92  CYS n 
1 93  ASN n 
1 94  ASP n 
1 95  ASN n 
1 96  THR n 
1 97  MET n 
1 98  ARG n 
1 99  ALA n 
1 100 PHE n 
1 101 THR n 
1 102 TYR n 
1 103 ARG n 
1 104 THR n 
1 105 ARG n 
1 106 GLN n 
1 107 ASN n 
1 108 PHE n 
1 109 LYS n 
1 110 GLY n 
1 111 PHE n 
1 112 ASP n 
1 113 ASP n 
1 114 ASN n 
1 115 ASN n 
1 116 ASP n 
1 117 ASP n 
1 118 PHE n 
1 119 LEU n 
1 120 THR n 
1 121 MET n 
1 122 ALA n 
1 123 GLU n 
1 124 CYS n 
1 125 GLN n 
1 126 PHE n 
1 127 ILE n 
1 128 ILE n 
1 129 LYS n 
1 130 HIS n 
1 131 GLU n 
1 132 LEU n 
1 133 GLU n 
1 134 ASN n 
1 135 LEU n 
1 136 ARG n 
1 137 ALA n 
1 138 LYS n 
1 139 ASP n 
1 140 GLU n 
1 141 LYS n 
1 142 MET n 
1 143 ILE n 
1 144 PRO n 
1 145 GLY n 
1 146 TYR n 
1 147 PRO n 
1 148 GLN n 
1 149 ALA n 
1 150 LYS n 
1 151 LEU n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 LYS n 
1 156 SER n 
1 157 LEU n 
1 158 LEU n 
1 159 ARG n 
1 160 ARG n 
1 161 LEU n 
1 162 LEU n 
1 163 THR n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 ILE n 
1 169 GLN n 
1 170 VAL n 
1 171 PHE n 
1 172 PRO n 
1 173 LEU n 
1 174 HIS n 
1 175 ASP n 
1 176 SER n 
1 177 GLU n 
1 178 ALA n 
1 179 LEU n 
1 180 LYS n 
1 181 LYS n 
1 182 LEU n 
1 183 GLU n 
1 184 ASP n 
1 185 THR n 
1 186 TRP n 
1 187 TYR n 
1 188 THR n 
1 189 ARG n 
1 190 PHE n 
1 191 ALA n 
1 192 LEU n 
1 193 LYS n 
1 194 TYR n 
1 195 GLN n 
1 196 PRO n 
1 197 ILE n 
1 198 ASP n 
1 199 SER n 
1 200 ILE n 
1 201 ARG n 
1 202 GLY n 
1 203 TYR n 
1 204 PHE n 
1 205 GLY n 
1 206 GLU n 
1 207 THR n 
1 208 ILE n 
1 209 ALA n 
1 210 LEU n 
1 211 TYR n 
1 212 PHE n 
1 213 GLY n 
1 214 PHE n 
1 215 LEU n 
1 216 GLU n 
1 217 TYR n 
1 218 PHE n 
1 219 THR n 
1 220 PHE n 
1 221 ALA n 
1 222 LEU n 
1 223 ILE n 
1 224 PRO n 
1 225 MET n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 GLY n 
1 230 LEU n 
1 231 PRO n 
1 232 TYR n 
1 233 TYR n 
1 234 LEU n 
1 235 PHE n 
1 236 VAL n 
1 237 TRP n 
1 238 GLU n 
1 239 ASP n 
1 240 TYR n 
1 241 ASP n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 ILE n 
1 246 PHE n 
1 247 ALA n 
1 248 SER n 
1 249 PHE n 
1 250 ASN n 
1 251 LEU n 
1 252 ILE n 
1 253 TRP n 
1 254 SER n 
1 255 THR n 
1 256 VAL n 
1 257 ILE n 
1 258 LEU n 
1 259 GLU n 
1 260 LEU n 
1 261 TRP n 
1 262 LYS n 
1 263 ARG n 
1 264 GLY n 
1 265 CYS n 
1 266 ALA n 
1 267 ASN n 
1 268 MET n 
1 269 THR n 
1 270 TYR n 
1 271 ARG n 
1 272 TRP n 
1 273 GLY n 
1 274 THR n 
1 275 LEU n 
1 276 LEU n 
1 277 MET n 
1 278 LYS n 
1 279 ARG n 
1 280 LYS n 
1 281 PHE n 
1 282 GLU n 
1 283 GLU n 
1 284 PRO n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 PHE n 
1 289 HIS n 
1 290 GLY n 
1 291 VAL n 
1 292 LEU n 
1 293 GLY n 
1 294 ILE n 
1 295 ASN n 
1 296 SER n 
1 297 ILE n 
1 298 THR n 
1 299 GLY n 
1 300 LYS n 
1 301 GLU n 
1 302 GLU n 
1 303 PRO n 
1 304 LEU n 
1 305 TYR n 
1 306 PRO n 
1 307 SER n 
1 308 TYR n 
1 309 LYS n 
1 310 ARG n 
1 311 GLN n 
1 312 LEU n 
1 313 ARG n 
1 314 ILE n 
1 315 TYR n 
1 316 LEU n 
1 317 VAL n 
1 318 SER n 
1 319 LEU n 
1 320 PRO n 
1 321 PHE n 
1 322 VAL n 
1 323 CYS n 
1 324 LEU n 
1 325 CYS n 
1 326 LEU n 
1 327 TYR n 
1 328 PHE n 
1 329 SER n 
1 330 LEU n 
1 331 TYR n 
1 332 VAL n 
1 333 MET n 
1 334 MET n 
1 335 ILE n 
1 336 TYR n 
1 337 PHE n 
1 338 ASP n 
1 339 MET n 
1 340 GLU n 
1 341 VAL n 
1 342 TRP n 
1 343 ALA n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 HIS n 
1 348 GLU n 
1 349 ASN n 
1 350 SER n 
1 351 GLY n 
1 352 SER n 
1 353 GLU n 
1 354 TRP n 
1 355 THR n 
1 356 SER n 
1 357 VAL n 
1 358 LEU n 
1 359 LEU n 
1 360 TYR n 
1 361 VAL n 
1 362 PRO n 
1 363 SER n 
1 364 ILE n 
1 365 ILE n 
1 366 TYR n 
1 367 ALA n 
1 368 ILE n 
1 369 VAL n 
1 370 ILE n 
1 371 GLU n 
1 372 ILE n 
1 373 MET n 
1 374 ASN n 
1 375 ARG n 
1 376 LEU n 
1 377 TYR n 
1 378 ARG n 
1 379 TYR n 
1 380 ALA n 
1 381 ALA n 
1 382 GLU n 
1 383 PHE n 
1 384 LEU n 
1 385 THR n 
1 386 SER n 
1 387 TRP n 
1 388 GLU n 
1 389 ASN n 
1 390 HIS n 
1 391 ARG n 
1 392 LEU n 
1 393 GLU n 
1 394 SER n 
1 395 ALA n 
1 396 TYR n 
1 397 GLN n 
1 398 ASN n 
1 399 HIS n 
1 400 LEU n 
1 401 ILE n 
1 402 LEU n 
1 403 LYS n 
1 404 VAL n 
1 405 LEU n 
1 406 VAL n 
1 407 PHE n 
1 408 ASN n 
1 409 PHE n 
1 410 LEU n 
1 411 ASN n 
1 412 CYS n 
1 413 PHE n 
1 414 ALA n 
1 415 SER n 
1 416 LEU n 
1 417 PHE n 
1 418 TYR n 
1 419 ILE n 
1 420 ALA n 
1 421 PHE n 
1 422 VAL n 
1 423 LEU n 
1 424 LYS n 
1 425 ASP n 
1 426 MET n 
1 427 LYS n 
1 428 LEU n 
1 429 LEU n 
1 430 ARG n 
1 431 GLN n 
1 432 SER n 
1 433 LEU n 
1 434 ALA n 
1 435 THR n 
1 436 LEU n 
1 437 LEU n 
1 438 ILE n 
1 439 THR n 
1 440 SER n 
1 441 GLN n 
1 442 ILE n 
1 443 LEU n 
1 444 ASN n 
1 445 GLN n 
1 446 ILE n 
1 447 MET n 
1 448 GLU n 
1 449 SER n 
1 450 PHE n 
1 451 LEU n 
1 452 PRO n 
1 453 TYR n 
1 454 TRP n 
1 455 LEU n 
1 456 GLN n 
1 457 ARG n 
1 458 LYS n 
1 459 HIS n 
1 460 GLY n 
1 461 VAL n 
1 462 ARG n 
1 463 VAL n 
1 464 LYS n 
1 465 ARG n 
1 466 LYS n 
1 467 VAL n 
1 468 GLN n 
1 469 ALA n 
1 470 LEU n 
1 471 LYS n 
1 472 ALA n 
1 473 ASP n 
1 474 ILE n 
1 475 ASP n 
1 476 ALA n 
1 477 THR n 
1 478 LEU n 
1 479 TYR n 
1 480 GLU n 
1 481 GLN n 
1 482 VAL n 
1 483 ILE n 
1 484 LEU n 
1 485 GLU n 
1 486 LYS n 
1 487 GLU n 
1 488 MET n 
1 489 GLY n 
1 490 THR n 
1 491 TYR n 
1 492 LEU n 
1 493 GLY n 
1 494 THR n 
1 495 PHE n 
1 496 ASP n 
1 497 ASP n 
1 498 TYR n 
1 499 LEU n 
1 500 GLU n 
1 501 LEU n 
1 502 PHE n 
1 503 LEU n 
1 504 GLN n 
1 505 PHE n 
1 506 GLY n 
1 507 TYR n 
1 508 VAL n 
1 509 SER n 
1 510 LEU n 
1 511 PHE n 
1 512 SER n 
1 513 CYS n 
1 514 VAL n 
1 515 TYR n 
1 516 PRO n 
1 517 LEU n 
1 518 ALA n 
1 519 ALA n 
1 520 ALA n 
1 521 PHE n 
1 522 ALA n 
1 523 VAL n 
1 524 LEU n 
1 525 ASN n 
1 526 ASN n 
1 527 PHE n 
1 528 THR n 
1 529 GLU n 
1 530 VAL n 
1 531 ASN n 
1 532 SER n 
1 533 ASP n 
1 534 ALA n 
1 535 LEU n 
1 536 LYS n 
1 537 MET n 
1 538 CYS n 
1 539 ARG n 
1 540 VAL n 
1 541 PHE n 
1 542 LYS n 
1 543 ARG n 
1 544 PRO n 
1 545 PHE n 
1 546 SER n 
1 547 GLU n 
1 548 PRO n 
1 549 SER n 
1 550 ALA n 
1 551 ASN n 
1 552 ILE n 
1 553 GLY n 
1 554 VAL n 
1 555 TRP n 
1 556 GLN n 
1 557 LEU n 
1 558 ALA n 
1 559 PHE n 
1 560 GLU n 
1 561 THR n 
1 562 MET n 
1 563 SER n 
1 564 VAL n 
1 565 ILE n 
1 566 SER n 
1 567 VAL n 
1 568 VAL n 
1 569 THR n 
1 570 ASN n 
1 571 CYS n 
1 572 ALA n 
1 573 LEU n 
1 574 ILE n 
1 575 GLY n 
1 576 MET n 
1 577 SER n 
1 578 PRO n 
1 579 GLN n 
1 580 VAL n 
1 581 ASN n 
1 582 ALA n 
1 583 VAL n 
1 584 PHE n 
1 585 PRO n 
1 586 GLU n 
1 587 SER n 
1 588 LYS n 
1 589 ALA n 
1 590 ASP n 
1 591 LEU n 
1 592 ILE n 
1 593 LEU n 
1 594 ILE n 
1 595 VAL n 
1 596 VAL n 
1 597 ALA n 
1 598 VAL n 
1 599 GLU n 
1 600 HIS n 
1 601 ALA n 
1 602 LEU n 
1 603 LEU n 
1 604 ALA n 
1 605 LEU n 
1 606 LYS n 
1 607 PHE n 
1 608 ILE n 
1 609 LEU n 
1 610 ALA n 
1 611 PHE n 
1 612 ALA n 
1 613 ILE n 
1 614 PRO n 
1 615 ASP n 
1 616 LYS n 
1 617 PRO n 
1 618 ARG n 
1 619 HIS n 
1 620 ILE n 
1 621 GLN n 
1 622 MET n 
1 623 LYS n 
1 624 LEU n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 GLU n 
1 629 PHE n 
1 630 GLU n 
1 631 SER n 
1 632 LEU n 
1 633 GLU n 
1 634 ALA n 
1 635 LEU n 
1 636 LYS n 
1 637 GLN n 
1 638 GLN n 
1 639 GLN n 
1 640 MET n 
1 641 LYS n 
1 642 LEU n 
1 643 VAL n 
1 644 THR n 
1 645 GLU n 
1 646 ASN n 
1 647 LEU n 
1 648 LYS n 
1 649 GLU n 
1 650 GLU n 
1 651 PRO n 
1 652 MET n 
1 653 GLU n 
1 654 SER n 
1 655 GLY n 
1 656 LYS n 
1 657 GLU n 
1 658 LYS n 
1 659 ALA n 
1 660 THR n 
1 661 ALA n 
1 662 GLU n 
1 663 ASN n 
1 664 LEU n 
1 665 TYR n 
1 666 PHE n 
1 667 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   667 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ANO10, TMEM16K' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PFB-CT10HF-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANO10_HUMAN 
_struct_ref.pdbx_db_accession          Q9NW15 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKAT
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6R7X A 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
2 1 6R7X B 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6R7X ALA A 661 ? UNP Q9NW15 ? ? 'expression tag' 661 1  
1 6R7X GLU A 662 ? UNP Q9NW15 ? ? 'expression tag' 662 2  
1 6R7X ASN A 663 ? UNP Q9NW15 ? ? 'expression tag' 663 3  
1 6R7X LEU A 664 ? UNP Q9NW15 ? ? 'expression tag' 664 4  
1 6R7X TYR A 665 ? UNP Q9NW15 ? ? 'expression tag' 665 5  
1 6R7X PHE A 666 ? UNP Q9NW15 ? ? 'expression tag' 666 6  
1 6R7X GLN A 667 ? UNP Q9NW15 ? ? 'expression tag' 667 7  
2 6R7X ALA B 661 ? UNP Q9NW15 ? ? 'expression tag' 661 8  
2 6R7X GLU B 662 ? UNP Q9NW15 ? ? 'expression tag' 662 9  
2 6R7X ASN B 663 ? UNP Q9NW15 ? ? 'expression tag' 663 10 
2 6R7X LEU B 664 ? UNP Q9NW15 ? ? 'expression tag' 664 11 
2 6R7X TYR B 665 ? UNP Q9NW15 ? ? 'expression tag' 665 12 
2 6R7X PHE B 666 ? UNP Q9NW15 ? ? 'expression tag' 666 13 
2 6R7X GLN B 667 ? UNP Q9NW15 ? ? 'expression tag' 667 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                              'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                               ?                              'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                              'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                              'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'                          ?                              'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE                               ?                              'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                              'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                              'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                ?                              'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                              'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                             ?                              'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                              'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                              'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                             ?                              'C5 H11 N O2 S'  149.211 
PC1 non-polymer         . 1,2-DIACYL-SN-GLYCERO-3-PHOSPHOCHOLINE 3-SN-PHOSPHATIDYLCHOLINE       'C44 H88 N O8 P' 790.145 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                              'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                ?                              'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                 ?                              'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                              ?                              'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                              'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                              'C9 H11 N O3'    181.189 
UMQ non-polymer         . UNDECYL-MALTOSIDE                      UNDECYL-BETA-D-MALTOPYRANOSIDE 'C23 H44 O11'    496.589 
VAL 'L-peptide linking' y VALINE                                 ?                              'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6R7X 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6R7X 
_struct.title                        
'CryoEM structure of calcium-bound human TMEM16K / Anoctamin 10 in detergent (2mM Ca2+, closed form)' 
_struct.pdbx_descriptor              Anoctamin-10 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6R7X 
_struct_keywords.text            
'MEMBRANE PROTEIN, CALCIUM ACTIVATION, TRANSPORT PROTEIN, LIPID TRANSPORT, Structural Genomics, Structural Genomics Consortium, SGC' 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 2 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 4 ? 
H  N N 4 ? 
I  N N 4 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 2 ? 
S  N N 2 ? 
T  N N 2 ? 
U  N N 3 ? 
V  N N 4 ? 
W  N N 4 ? 
X  N N 4 ? 
Y  N N 4 ? 
Z  N N 4 ? 
AA N N 4 ? 
BA N N 4 ? 
CA N N 4 ? 
DA N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 28  ? ALA A 41  ? LYS A 28  ALA A 41  1 ? 14 
HELX_P HELX_P2  AA2 GLU A 62  ? GLN A 67  ? GLU A 62  GLN A 67  5 ? 6  
HELX_P HELX_P3  AA3 SER A 75  ? GLY A 87  ? SER A 75  GLY A 87  1 ? 13 
HELX_P HELX_P4  AA4 THR A 104 ? PHE A 108 ? THR A 104 PHE A 108 5 ? 5  
HELX_P HELX_P5  AA5 THR A 120 ? ASN A 134 ? THR A 120 ASN A 134 1 ? 15 
HELX_P HELX_P6  AA6 LEU A 157 ? SER A 164 ? LEU A 157 SER A 164 1 ? 8  
HELX_P HELX_P7  AA7 LEU A 179 ? ASP A 184 ? LEU A 179 ASP A 184 1 ? 6  
HELX_P HELX_P8  AA8 PRO A 196 ? PHE A 220 ? PRO A 196 PHE A 220 1 ? 25 
HELX_P HELX_P9  AA9 LEU A 222 ? PHE A 235 ? LEU A 222 PHE A 235 1 ? 14 
HELX_P HELX_P10 AB1 TRP A 237 ? LYS A 242 ? TRP A 237 LYS A 242 1 ? 6  
HELX_P HELX_P11 AB2 VAL A 244 ? GLY A 273 ? VAL A 244 GLY A 273 1 ? 30 
HELX_P HELX_P12 AB3 PRO A 306 ? LEU A 316 ? PRO A 306 LEU A 316 1 ? 11 
HELX_P HELX_P13 AB4 VAL A 317 ? SER A 350 ? VAL A 317 SER A 350 1 ? 34 
HELX_P HELX_P14 AB5 TYR A 360 ? SER A 386 ? TYR A 360 SER A 386 1 ? 27 
HELX_P HELX_P15 AB6 LEU A 392 ? VAL A 422 ? LEU A 392 VAL A 422 1 ? 31 
HELX_P HELX_P16 AB7 ASP A 425 ? SER A 449 ? ASP A 425 SER A 449 1 ? 25 
HELX_P HELX_P17 AB8 SER A 449 ? ALA A 469 ? SER A 449 ALA A 469 1 ? 21 
HELX_P HELX_P18 AB9 ASP A 475 ? GLU A 487 ? ASP A 475 GLU A 487 1 ? 13 
HELX_P HELX_P19 AC1 PHE A 495 ? LEU A 510 ? PHE A 495 LEU A 510 1 ? 16 
HELX_P HELX_P20 AC2 PRO A 516 ? ARG A 539 ? PRO A 516 ARG A 539 1 ? 24 
HELX_P HELX_P21 AC3 VAL A 554 ? GLY A 575 ? VAL A 554 GLY A 575 1 ? 22 
HELX_P HELX_P22 AC4 SER A 587 ? ILE A 613 ? SER A 587 ILE A 613 1 ? 27 
HELX_P HELX_P23 AC5 PRO A 617 ? LYS A 641 ? PRO A 617 LYS A 641 1 ? 25 
HELX_P HELX_P24 AC6 LYS B 28  ? ALA B 41  ? LYS B 28  ALA B 41  1 ? 14 
HELX_P HELX_P25 AC7 GLU B 62  ? GLN B 67  ? GLU B 62  GLN B 67  5 ? 6  
HELX_P HELX_P26 AC8 SER B 75  ? GLY B 87  ? SER B 75  GLY B 87  1 ? 13 
HELX_P HELX_P27 AC9 THR B 104 ? PHE B 108 ? THR B 104 PHE B 108 5 ? 5  
HELX_P HELX_P28 AD1 THR B 120 ? ASN B 134 ? THR B 120 ASN B 134 1 ? 15 
HELX_P HELX_P29 AD2 LEU B 157 ? SER B 164 ? LEU B 157 SER B 164 1 ? 8  
HELX_P HELX_P30 AD3 LEU B 179 ? ASP B 184 ? LEU B 179 ASP B 184 1 ? 6  
HELX_P HELX_P31 AD4 PRO B 196 ? PHE B 220 ? PRO B 196 PHE B 220 1 ? 25 
HELX_P HELX_P32 AD5 LEU B 222 ? PHE B 235 ? LEU B 222 PHE B 235 1 ? 14 
HELX_P HELX_P33 AD6 TRP B 237 ? LYS B 242 ? TRP B 237 LYS B 242 1 ? 6  
HELX_P HELX_P34 AD7 VAL B 244 ? GLY B 273 ? VAL B 244 GLY B 273 1 ? 30 
HELX_P HELX_P35 AD8 PRO B 306 ? LEU B 316 ? PRO B 306 LEU B 316 1 ? 11 
HELX_P HELX_P36 AD9 VAL B 317 ? SER B 350 ? VAL B 317 SER B 350 1 ? 34 
HELX_P HELX_P37 AE1 TYR B 360 ? SER B 386 ? TYR B 360 SER B 386 1 ? 27 
HELX_P HELX_P38 AE2 LEU B 392 ? VAL B 422 ? LEU B 392 VAL B 422 1 ? 31 
HELX_P HELX_P39 AE3 ASP B 425 ? SER B 449 ? ASP B 425 SER B 449 1 ? 25 
HELX_P HELX_P40 AE4 SER B 449 ? ALA B 469 ? SER B 449 ALA B 469 1 ? 21 
HELX_P HELX_P41 AE5 ASP B 475 ? GLU B 487 ? ASP B 475 GLU B 487 1 ? 13 
HELX_P HELX_P42 AE6 PHE B 495 ? LEU B 510 ? PHE B 495 LEU B 510 1 ? 16 
HELX_P HELX_P43 AE7 PRO B 516 ? ARG B 539 ? PRO B 516 ARG B 539 1 ? 24 
HELX_P HELX_P44 AE8 VAL B 554 ? GLY B 575 ? VAL B 554 GLY B 575 1 ? 22 
HELX_P HELX_P45 AE9 SER B 587 ? ILE B 613 ? SER B 587 ILE B 613 1 ? 27 
HELX_P HELX_P46 AF1 PRO B 617 ? LYS B 641 ? PRO B 617 LYS B 641 1 ? 25 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 259 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 259 A CA 703 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc2  metalc ? ? A ASN 444 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 444 A CA 701 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc3  metalc ? ? A GLN 445 OE1 ? ? ? 1_555 C CA . CA ? ? A GLN 445 A CA 701 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc4  metalc ? ? A GLU 448 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 448 A CA 701 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc5  metalc ? ? A GLU 448 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 448 A CA 702 1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc6  metalc ? ? A ASP 497 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 497 A CA 702 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc7  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 500 A CA 701 1_555 ? ? ? ? ? ? ? 2.882 ? 
metalc8  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 500 A CA 702 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc9  metalc ? ? A GLU 500 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 500 A CA 701 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc10 metalc ? ? A GLU 529 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 529 A CA 701 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc11 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 529 A CA 701 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc12 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 529 A CA 702 1_555 ? ? ? ? ? ? ? 2.540 ? 
metalc13 metalc ? ? A ASP 533 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 533 A CA 702 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc14 metalc ? ? A ASP 533 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 533 A CA 702 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc15 metalc ? ? A ALA 610 O   ? ? ? 1_555 E CA . CA ? ? A ALA 610 A CA 703 1_555 ? ? ? ? ? ? ? 2.437 ? 
metalc16 metalc ? ? A ILE 613 O   ? ? ? 1_555 E CA . CA ? ? A ILE 613 A CA 703 1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc17 metalc ? ? A ASP 615 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 615 A CA 703 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc18 metalc ? ? B GLU 259 OE2 ? ? ? 1_555 T CA . CA ? ? B GLU 259 B CA 904 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc19 metalc ? ? B ASN 444 OD1 ? ? ? 1_555 R CA . CA ? ? B ASN 444 B CA 902 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc20 metalc ? ? B GLN 445 OE1 ? ? ? 1_555 R CA . CA ? ? B GLN 445 B CA 902 1_555 ? ? ? ? ? ? ? 2.736 ? 
metalc21 metalc ? ? B GLU 448 OE1 ? ? ? 1_555 R CA . CA ? ? B GLU 448 B CA 902 1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc22 metalc ? ? B GLU 448 OE2 ? ? ? 1_555 S CA . CA ? ? B GLU 448 B CA 903 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc23 metalc ? ? B ASP 497 OD1 ? ? ? 1_555 S CA . CA ? ? B ASP 497 B CA 903 1_555 ? ? ? ? ? ? ? 2.739 ? 
metalc24 metalc ? ? B GLU 500 OE1 ? ? ? 1_555 R CA . CA ? ? B GLU 500 B CA 902 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc25 metalc ? ? B GLU 500 OE1 ? ? ? 1_555 S CA . CA ? ? B GLU 500 B CA 903 1_555 ? ? ? ? ? ? ? 2.994 ? 
metalc26 metalc ? ? B GLU 500 OE2 ? ? ? 1_555 R CA . CA ? ? B GLU 500 B CA 902 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc27 metalc ? ? B GLU 529 OE1 ? ? ? 1_555 R CA . CA ? ? B GLU 529 B CA 902 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc28 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 R CA . CA ? ? B GLU 529 B CA 902 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc29 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 S CA . CA ? ? B GLU 529 B CA 903 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc30 metalc ? ? B ASP 533 OD1 ? ? ? 1_555 S CA . CA ? ? B ASP 533 B CA 903 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc31 metalc ? ? B ASP 533 OD2 ? ? ? 1_555 S CA . CA ? ? B ASP 533 B CA 903 1_555 ? ? ? ? ? ? ? 2.549 ? 
metalc32 metalc ? ? B ALA 610 O   ? ? ? 1_555 T CA . CA ? ? B ALA 610 B CA 904 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc33 metalc ? ? B ILE 613 O   ? ? ? 1_555 T CA . CA ? ? B ILE 613 B CA 904 1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc34 metalc ? ? B ASP 615 OD1 ? ? ? 1_555 T CA . CA ? ? B ASP 615 B CA 904 1_555 ? ? ? ? ? ? ? 2.517 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 51  ? PRO A 54  ? LEU A 51  PRO A 54  
AA1 2 LEU A 69  ? GLY A 73  ? LEU A 69  GLY A 73  
AA1 3 VAL A 19  ? LEU A 23  ? VAL A 19  LEU A 23  
AA1 4 VAL A 167 ? PRO A 172 ? VAL A 167 PRO A 172 
AA2 1 VAL A 89  ? GLU A 91  ? VAL A 89  GLU A 91  
AA2 2 MET A 97  ? ALA A 99  ? MET A 97  ALA A 99  
AA3 1 ARG A 136 ? ALA A 137 ? ARG A 136 ALA A 137 
AA3 2 LYS A 155 ? SER A 156 ? LYS A 155 SER A 156 
AA4 1 VAL A 291 ? ILE A 294 ? VAL A 291 ILE A 294 
AA4 2 GLU A 301 ? LEU A 304 ? GLU A 301 LEU A 304 
AA5 1 LEU B 51  ? PRO B 54  ? LEU B 51  PRO B 54  
AA5 2 LEU B 69  ? GLY B 73  ? LEU B 69  GLY B 73  
AA5 3 VAL B 19  ? LEU B 23  ? VAL B 19  LEU B 23  
AA5 4 VAL B 167 ? PRO B 172 ? VAL B 167 PRO B 172 
AA6 1 VAL B 89  ? GLU B 91  ? VAL B 89  GLU B 91  
AA6 2 MET B 97  ? ALA B 99  ? MET B 97  ALA B 99  
AA7 1 ARG B 136 ? ALA B 137 ? ARG B 136 ALA B 137 
AA7 2 LYS B 155 ? SER B 156 ? LYS B 155 SER B 156 
AA8 1 VAL B 291 ? ILE B 294 ? VAL B 291 ILE B 294 
AA8 2 GLU B 301 ? LEU B 304 ? GLU B 301 LEU B 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 53  ? N ARG A 53  O LEU A 71  ? O LEU A 71  
AA1 2 3 O TYR A 70  ? O TYR A 70  N ILE A 21  ? N ILE A 21  
AA1 3 4 N GLU A 22  ? N GLU A 22  O ILE A 168 ? O ILE A 168 
AA2 1 2 N LYS A 90  ? N LYS A 90  O ARG A 98  ? O ARG A 98  
AA3 1 2 N ALA A 137 ? N ALA A 137 O LYS A 155 ? O LYS A 155 
AA4 1 2 N VAL A 291 ? N VAL A 291 O LEU A 304 ? O LEU A 304 
AA5 1 2 N ARG B 53  ? N ARG B 53  O LEU B 71  ? O LEU B 71  
AA5 2 3 O TYR B 70  ? O TYR B 70  N ILE B 21  ? N ILE B 21  
AA5 3 4 N GLU B 22  ? N GLU B 22  O ILE B 168 ? O ILE B 168 
AA6 1 2 N LYS B 90  ? N LYS B 90  O ARG B 98  ? O ARG B 98  
AA7 1 2 N ALA B 137 ? N ALA B 137 O LYS B 155 ? O LYS B 155 
AA8 1 2 N VAL B 291 ? N VAL B 291 O LEU B 304 ? O LEU B 304 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA  701 ? 5 'binding site for residue CA A 701'  
AC2 Software A CA  702 ? 6 'binding site for residue CA A 702'  
AC3 Software A CA  703 ? 4 'binding site for residue CA A 703'  
AC4 Software A PC1 704 ? 7 'binding site for residue PC1 A 704' 
AC5 Software A UMQ 705 ? 6 'binding site for residue UMQ A 705' 
AC6 Software A UMQ 706 ? 2 'binding site for residue UMQ A 706' 
AC7 Software A UMQ 707 ? 5 'binding site for residue UMQ A 707' 
AC8 Software A UMQ 708 ? 1 'binding site for residue UMQ A 708' 
AC9 Software A UMQ 709 ? 3 'binding site for residue UMQ A 709' 
AD1 Software A UMQ 710 ? 1 'binding site for residue UMQ A 710' 
AD2 Software A UMQ 711 ? 1 'binding site for residue UMQ A 711' 
AD3 Software A UMQ 714 ? 7 'binding site for residue UMQ A 714' 
AD4 Software B UMQ 901 ? 7 'binding site for residue UMQ B 901' 
AD5 Software B CA  902 ? 5 'binding site for residue CA B 902'  
AD6 Software B CA  903 ? 6 'binding site for residue CA B 903'  
AD7 Software B CA  904 ? 4 'binding site for residue CA B 904'  
AD8 Software B PC1 905 ? 7 'binding site for residue PC1 B 905' 
AD9 Software B UMQ 906 ? 6 'binding site for residue UMQ B 906' 
AE1 Software B UMQ 907 ? 2 'binding site for residue UMQ B 907' 
AE2 Software B UMQ 908 ? 5 'binding site for residue UMQ B 908' 
AE3 Software B UMQ 909 ? 1 'binding site for residue UMQ B 909' 
AE4 Software B UMQ 910 ? 3 'binding site for residue UMQ B 910' 
AE5 Software B UMQ 911 ? 1 'binding site for residue UMQ B 911' 
AE6 Software B UMQ 912 ? 1 'binding site for residue UMQ B 912' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN A 444 ? ASN A 444 . ? 1_555 ? 
2  AC1 5 GLN A 445 ? GLN A 445 . ? 1_555 ? 
3  AC1 5 GLU A 448 ? GLU A 448 . ? 1_555 ? 
4  AC1 5 GLU A 500 ? GLU A 500 . ? 1_555 ? 
5  AC1 5 GLU A 529 ? GLU A 529 . ? 1_555 ? 
6  AC2 6 TYR A 211 ? TYR A 211 . ? 1_555 ? 
7  AC2 6 GLU A 448 ? GLU A 448 . ? 1_555 ? 
8  AC2 6 ASP A 497 ? ASP A 497 . ? 1_555 ? 
9  AC2 6 GLU A 500 ? GLU A 500 . ? 1_555 ? 
10 AC2 6 GLU A 529 ? GLU A 529 . ? 1_555 ? 
11 AC2 6 ASP A 533 ? ASP A 533 . ? 1_555 ? 
12 AC3 4 GLU A 259 ? GLU A 259 . ? 1_555 ? 
13 AC3 4 ALA A 610 ? ALA A 610 . ? 1_555 ? 
14 AC3 4 ILE A 613 ? ILE A 613 . ? 1_555 ? 
15 AC3 4 ASP A 615 ? ASP A 615 . ? 1_555 ? 
16 AC4 7 TYR A 315 ? TYR A 315 . ? 1_555 ? 
17 AC4 7 ASN A 398 ? ASN A 398 . ? 1_555 ? 
18 AC4 7 HIS A 399 ? HIS A 399 . ? 1_555 ? 
19 AC4 7 LEU A 402 ? LEU A 402 . ? 1_555 ? 
20 AC4 7 PHE A 409 ? PHE A 409 . ? 1_555 ? 
21 AC4 7 VAL A 554 ? VAL A 554 . ? 1_555 ? 
22 AC4 7 PHE B 611 ? PHE B 611 . ? 1_555 ? 
23 AC5 6 GLY A 575 ? GLY A 575 . ? 1_555 ? 
24 AC5 6 MET A 576 ? MET A 576 . ? 1_555 ? 
25 AC5 6 PRO A 578 ? PRO A 578 . ? 1_555 ? 
26 AC5 6 ASN A 581 ? ASN A 581 . ? 1_555 ? 
27 AC5 6 LYS A 588 ? LYS A 588 . ? 1_555 ? 
28 AC5 6 UMQ Q .   ? UMQ B 901 . ? 1_555 ? 
29 AC6 2 ARG A 263 ? ARG A 263 . ? 1_555 ? 
30 AC6 2 UMQ J .   ? UMQ A 708 . ? 1_555 ? 
31 AC7 5 LYS A 180 ? LYS A 180 . ? 1_555 ? 
32 AC7 5 GLU A 183 ? GLU A 183 . ? 1_555 ? 
33 AC7 5 PHE A 450 ? PHE A 450 . ? 1_555 ? 
34 AC7 5 TYR A 453 ? TYR A 453 . ? 1_555 ? 
35 AC7 5 ARG A 539 ? ARG A 539 . ? 1_555 ? 
36 AC8 1 UMQ H .   ? UMQ A 706 . ? 1_555 ? 
37 AC9 3 VAL A 422 ? VAL A 422 . ? 1_555 ? 
38 AC9 3 LYS A 424 ? LYS A 424 . ? 1_555 ? 
39 AC9 3 UMQ Q .   ? UMQ B 901 . ? 1_555 ? 
40 AD1 1 PHE A 417 ? PHE A 417 . ? 1_555 ? 
41 AD2 1 GLU A 560 ? GLU A 560 . ? 1_555 ? 
42 AD3 7 SER A 587 ? SER A 587 . ? 1_555 ? 
43 AD3 7 ALA A 589 ? ALA A 589 . ? 1_555 ? 
44 AD3 7 LEU A 593 ? LEU A 593 . ? 1_555 ? 
45 AD3 7 LYS B 424 ? LYS B 424 . ? 1_555 ? 
46 AD3 7 ILE B 592 ? ILE B 592 . ? 1_555 ? 
47 AD3 7 UMQ V .   ? UMQ B 906 . ? 1_555 ? 
48 AD3 7 UMQ Z .   ? UMQ B 910 . ? 1_555 ? 
49 AD4 7 LYS A 424 ? LYS A 424 . ? 1_555 ? 
50 AD4 7 ILE A 592 ? ILE A 592 . ? 1_555 ? 
51 AD4 7 UMQ G .   ? UMQ A 705 . ? 1_555 ? 
52 AD4 7 UMQ K .   ? UMQ A 709 . ? 1_555 ? 
53 AD4 7 SER B 587 ? SER B 587 . ? 1_555 ? 
54 AD4 7 ALA B 589 ? ALA B 589 . ? 1_555 ? 
55 AD4 7 LEU B 593 ? LEU B 593 . ? 1_555 ? 
56 AD5 5 ASN B 444 ? ASN B 444 . ? 1_555 ? 
57 AD5 5 GLN B 445 ? GLN B 445 . ? 1_555 ? 
58 AD5 5 GLU B 448 ? GLU B 448 . ? 1_555 ? 
59 AD5 5 GLU B 500 ? GLU B 500 . ? 1_555 ? 
60 AD5 5 GLU B 529 ? GLU B 529 . ? 1_555 ? 
61 AD6 6 TYR B 211 ? TYR B 211 . ? 1_555 ? 
62 AD6 6 GLU B 448 ? GLU B 448 . ? 1_555 ? 
63 AD6 6 ASP B 497 ? ASP B 497 . ? 1_555 ? 
64 AD6 6 GLU B 500 ? GLU B 500 . ? 1_555 ? 
65 AD6 6 GLU B 529 ? GLU B 529 . ? 1_555 ? 
66 AD6 6 ASP B 533 ? ASP B 533 . ? 1_555 ? 
67 AD7 4 GLU B 259 ? GLU B 259 . ? 1_555 ? 
68 AD7 4 ALA B 610 ? ALA B 610 . ? 1_555 ? 
69 AD7 4 ILE B 613 ? ILE B 613 . ? 1_555 ? 
70 AD7 4 ASP B 615 ? ASP B 615 . ? 1_555 ? 
71 AD8 7 PHE A 611 ? PHE A 611 . ? 1_555 ? 
72 AD8 7 TYR B 315 ? TYR B 315 . ? 1_555 ? 
73 AD8 7 ASN B 398 ? ASN B 398 . ? 1_555 ? 
74 AD8 7 HIS B 399 ? HIS B 399 . ? 1_555 ? 
75 AD8 7 LEU B 402 ? LEU B 402 . ? 1_555 ? 
76 AD8 7 PHE B 409 ? PHE B 409 . ? 1_555 ? 
77 AD8 7 VAL B 554 ? VAL B 554 . ? 1_555 ? 
78 AD9 6 UMQ P .   ? UMQ A 714 . ? 1_555 ? 
79 AD9 6 GLY B 575 ? GLY B 575 . ? 1_555 ? 
80 AD9 6 MET B 576 ? MET B 576 . ? 1_555 ? 
81 AD9 6 PRO B 578 ? PRO B 578 . ? 1_555 ? 
82 AD9 6 ASN B 581 ? ASN B 581 . ? 1_555 ? 
83 AD9 6 LYS B 588 ? LYS B 588 . ? 1_555 ? 
84 AE1 2 ARG B 263 ? ARG B 263 . ? 1_555 ? 
85 AE1 2 UMQ Y .   ? UMQ B 909 . ? 1_555 ? 
86 AE2 5 LYS B 180 ? LYS B 180 . ? 1_555 ? 
87 AE2 5 GLU B 183 ? GLU B 183 . ? 1_555 ? 
88 AE2 5 PHE B 450 ? PHE B 450 . ? 1_555 ? 
89 AE2 5 TYR B 453 ? TYR B 453 . ? 1_555 ? 
90 AE2 5 ARG B 539 ? ARG B 539 . ? 1_555 ? 
91 AE3 1 UMQ W .   ? UMQ B 907 . ? 1_555 ? 
92 AE4 3 UMQ P .   ? UMQ A 714 . ? 1_555 ? 
93 AE4 3 VAL B 422 ? VAL B 422 . ? 1_555 ? 
94 AE4 3 LYS B 424 ? LYS B 424 . ? 1_555 ? 
95 AE5 1 PHE B 417 ? PHE B 417 . ? 1_555 ? 
96 AE6 1 GLU B 560 ? GLU B 560 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6R7X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A  1 13  ? 122.905 118.317 134.822 1.00 65.04 ? 13  SER A N     1 
ATOM   2     C  CA    . SER A  1 13  ? 123.650 119.292 134.034 1.00 65.04 ? 13  SER A CA    1 
ATOM   3     C  C     . SER A  1 13  ? 124.862 118.647 133.370 1.00 65.04 ? 13  SER A C     1 
ATOM   4     O  O     . SER A  1 13  ? 125.647 119.318 132.702 1.00 65.04 ? 13  SER A O     1 
ATOM   5     C  CB    . SER A  1 13  ? 124.091 120.466 134.908 1.00 65.04 ? 13  SER A CB    1 
ATOM   6     N  N     . SER A  1 14  ? 125.009 117.334 133.564 1.00 63.00 ? 14  SER A N     1 
ATOM   7     C  CA    . SER A  1 14  ? 126.097 116.575 132.959 1.00 63.00 ? 14  SER A CA    1 
ATOM   8     C  C     . SER A  1 14  ? 125.574 115.399 132.142 1.00 63.00 ? 14  SER A C     1 
ATOM   9     O  O     . SER A  1 14  ? 126.304 114.427 131.928 1.00 63.00 ? 14  SER A O     1 
ATOM   10    C  CB    . SER A  1 14  ? 127.075 116.078 134.027 1.00 63.00 ? 14  SER A CB    1 
ATOM   11    O  OG    . SER A  1 14  ? 126.662 114.829 134.554 1.00 63.00 ? 14  SER A OG    1 
ATOM   12    N  N     . PHE A  1 15  ? 124.328 115.469 131.683 1.00 54.21 ? 15  PHE A N     1 
ATOM   13    C  CA    . PHE A  1 15  ? 123.713 114.380 130.943 1.00 54.21 ? 15  PHE A CA    1 
ATOM   14    C  C     . PHE A  1 15  ? 124.174 114.398 129.487 1.00 54.21 ? 15  PHE A C     1 
ATOM   15    O  O     . PHE A  1 15  ? 124.986 115.227 129.067 1.00 54.21 ? 15  PHE A O     1 
ATOM   16    C  CB    . PHE A  1 15  ? 122.188 114.454 131.050 1.00 54.21 ? 15  PHE A CB    1 
ATOM   17    C  CG    . PHE A  1 15  ? 121.577 115.683 130.419 1.00 54.21 ? 15  PHE A CG    1 
ATOM   18    C  CD1   . PHE A  1 15  ? 121.491 116.876 131.122 1.00 54.21 ? 15  PHE A CD1   1 
ATOM   19    C  CD2   . PHE A  1 15  ? 121.058 115.635 129.134 1.00 54.21 ? 15  PHE A CD2   1 
ATOM   20    C  CE1   . PHE A  1 15  ? 120.928 117.998 130.548 1.00 54.21 ? 15  PHE A CE1   1 
ATOM   21    C  CE2   . PHE A  1 15  ? 120.494 116.755 128.556 1.00 54.21 ? 15  PHE A CE2   1 
ATOM   22    C  CZ    . PHE A  1 15  ? 120.428 117.936 129.266 1.00 54.21 ? 15  PHE A CZ    1 
ATOM   23    N  N     . THR A  1 16  ? 123.637 113.465 128.701 1.00 46.85 ? 16  THR A N     1 
ATOM   24    C  CA    . THR A  1 16  ? 123.942 113.386 127.282 1.00 46.85 ? 16  THR A CA    1 
ATOM   25    C  C     . THR A  1 16  ? 122.846 114.080 126.496 1.00 46.85 ? 16  THR A C     1 
ATOM   26    O  O     . THR A  1 16  ? 121.675 113.684 126.611 1.00 46.85 ? 16  THR A O     1 
ATOM   27    C  CB    . THR A  1 16  ? 124.065 111.934 126.840 1.00 46.85 ? 16  THR A CB    1 
ATOM   28    O  OG1   . THR A  1 16  ? 122.972 111.179 127.377 1.00 46.85 ? 16  THR A OG1   1 
ATOM   29    C  CG2   . THR A  1 16  ? 125.374 111.342 127.330 1.00 46.85 ? 16  THR A CG2   1 
ATOM   30    N  N     . PRO A  1 17  ? 123.158 115.105 125.704 1.00 43.52 ? 17  PRO A N     1 
ATOM   31    C  CA    . PRO A  1 17  ? 122.109 115.796 124.949 1.00 43.52 ? 17  PRO A CA    1 
ATOM   32    C  C     . PRO A  1 17  ? 121.625 114.949 123.786 1.00 43.52 ? 17  PRO A C     1 
ATOM   33    O  O     . PRO A  1 17  ? 122.418 114.353 123.055 1.00 43.52 ? 17  PRO A O     1 
ATOM   34    C  CB    . PRO A  1 17  ? 122.800 117.075 124.459 1.00 43.52 ? 17  PRO A CB    1 
ATOM   35    C  CG    . PRO A  1 17  ? 124.135 117.114 125.153 1.00 43.52 ? 17  PRO A CG    1 
ATOM   36    C  CD    . PRO A  1 17  ? 124.479 115.705 125.477 1.00 43.52 ? 17  PRO A CD    1 
ATOM   37    N  N     . LEU A  1 18  ? 120.311 114.896 123.623 1.00 38.51 ? 18  LEU A N     1 
ATOM   38    C  CA    . LEU A  1 18  ? 119.705 114.077 122.584 1.00 38.51 ? 18  LEU A CA    1 
ATOM   39    C  C     . LEU A  1 18  ? 118.902 114.876 121.574 1.00 38.51 ? 18  LEU A C     1 
ATOM   40    O  O     . LEU A  1 18  ? 118.966 114.579 120.380 1.00 38.51 ? 18  LEU A O     1 
ATOM   41    C  CB    . LEU A  1 18  ? 118.808 113.005 123.216 1.00 38.51 ? 18  LEU A CB    1 
ATOM   42    C  CG    . LEU A  1 18  ? 119.523 112.029 124.152 1.00 38.51 ? 18  LEU A CG    1 
ATOM   43    C  CD1   . LEU A  1 18  ? 118.589 110.932 124.609 1.00 38.51 ? 18  LEU A CD1   1 
ATOM   44    C  CD2   . LEU A  1 18  ? 120.741 111.432 123.480 1.00 38.51 ? 18  LEU A CD2   1 
ATOM   45    N  N     . VAL A  1 19  ? 118.147 115.880 122.008 1.00 32.50 ? 19  VAL A N     1 
ATOM   46    C  CA    . VAL A  1 19  ? 117.291 116.652 121.117 1.00 32.50 ? 19  VAL A CA    1 
ATOM   47    C  C     . VAL A  1 19  ? 117.576 118.132 121.333 1.00 32.50 ? 19  VAL A C     1 
ATOM   48    O  O     . VAL A  1 19  ? 117.644 118.595 122.474 1.00 32.50 ? 19  VAL A O     1 
ATOM   49    C  CB    . VAL A  1 19  ? 115.805 116.307 121.363 1.00 32.50 ? 19  VAL A CB    1 
ATOM   50    C  CG1   . VAL A  1 19  ? 114.882 117.412 120.919 1.00 32.50 ? 19  VAL A CG1   1 
ATOM   51    C  CG2   . VAL A  1 19  ? 115.448 115.023 120.649 1.00 32.50 ? 19  VAL A CG2   1 
ATOM   52    N  N     . VAL A  1 20  ? 117.761 118.879 120.248 1.00 33.89 ? 20  VAL A N     1 
ATOM   53    C  CA    . VAL A  1 20  ? 118.015 120.311 120.318 1.00 33.89 ? 20  VAL A CA    1 
ATOM   54    C  C     . VAL A  1 20  ? 116.757 121.044 119.884 1.00 33.89 ? 20  VAL A C     1 
ATOM   55    O  O     . VAL A  1 20  ? 116.196 120.756 118.819 1.00 33.89 ? 20  VAL A O     1 
ATOM   56    C  CB    . VAL A  1 20  ? 119.210 120.716 119.443 1.00 33.89 ? 20  VAL A CB    1 
ATOM   57    C  CG1   . VAL A  1 20  ? 119.519 122.186 119.619 1.00 33.89 ? 20  VAL A CG1   1 
ATOM   58    C  CG2   . VAL A  1 20  ? 120.411 119.882 119.791 1.00 33.89 ? 20  VAL A CG2   1 
ATOM   59    N  N     . ILE A  1 21  ? 116.315 121.985 120.713 1.00 40.32 ? 21  ILE A N     1 
ATOM   60    C  CA    . ILE A  1 21  ? 115.199 122.871 120.406 1.00 40.32 ? 21  ILE A CA    1 
ATOM   61    C  C     . ILE A  1 21  ? 115.770 124.263 120.185 1.00 40.32 ? 21  ILE A C     1 
ATOM   62    O  O     . ILE A  1 21  ? 116.444 124.807 121.067 1.00 40.32 ? 21  ILE A O     1 
ATOM   63    C  CB    . ILE A  1 21  ? 114.157 122.882 121.534 1.00 40.32 ? 21  ILE A CB    1 
ATOM   64    C  CG1   . ILE A  1 21  ? 113.572 121.488 121.735 1.00 40.32 ? 21  ILE A CG1   1 
ATOM   65    C  CG2   . ILE A  1 21  ? 113.058 123.878 121.231 1.00 40.32 ? 21  ILE A CG2   1 
ATOM   66    C  CD1   . ILE A  1 21  ? 112.570 121.409 122.858 1.00 40.32 ? 21  ILE A CD1   1 
ATOM   67    N  N     . GLU A  1 22  ? 115.513 124.844 119.018 1.00 50.32 ? 22  GLU A N     1 
ATOM   68    C  CA    . GLU A  1 22  ? 116.007 126.179 118.705 1.00 50.32 ? 22  GLU A CA    1 
ATOM   69    C  C     . GLU A  1 22  ? 114.842 127.155 118.780 1.00 50.32 ? 22  GLU A C     1 
ATOM   70    O  O     . GLU A  1 22  ? 113.901 127.067 117.986 1.00 50.32 ? 22  GLU A O     1 
ATOM   71    C  CB    . GLU A  1 22  ? 116.668 126.222 117.331 1.00 50.32 ? 22  GLU A CB    1 
ATOM   72    C  CG    . GLU A  1 22  ? 117.269 127.577 117.002 1.00 50.32 ? 22  GLU A CG    1 
ATOM   73    C  CD    . GLU A  1 22  ? 117.607 127.733 115.536 1.00 50.32 ? 22  GLU A CD    1 
ATOM   74    O  OE1   . GLU A  1 22  ? 117.299 126.813 114.752 1.00 50.32 ? 22  GLU A OE1   1 
ATOM   75    O  OE2   . GLU A  1 22  ? 118.181 128.778 115.165 1.00 50.32 ? 22  GLU A OE2   1 
ATOM   76    N  N     . LEU A  1 23  ? 114.902 128.076 119.737 1.00 57.60 ? 23  LEU A N     1 
ATOM   77    C  CA    . LEU A  1 23  ? 113.885 129.107 119.836 1.00 57.60 ? 23  LEU A CA    1 
ATOM   78    C  C     . LEU A  1 23  ? 114.154 130.214 118.820 1.00 57.60 ? 23  LEU A C     1 
ATOM   79    O  O     . LEU A  1 23  ? 115.197 130.256 118.162 1.00 57.60 ? 23  LEU A O     1 
ATOM   80    C  CB    . LEU A  1 23  ? 113.841 129.691 121.247 1.00 57.60 ? 23  LEU A CB    1 
ATOM   81    C  CG    . LEU A  1 23  ? 113.432 128.793 122.415 1.00 57.60 ? 23  LEU A CG    1 
ATOM   82    C  CD1   . LEU A  1 23  ? 112.989 129.647 123.583 1.00 57.60 ? 23  LEU A CD1   1 
ATOM   83    C  CD2   . LEU A  1 23  ? 112.331 127.836 122.024 1.00 57.60 ? 23  LEU A CD2   1 
ATOM   84    N  N     . ALA A  1 24  ? 113.194 131.125 118.697 1.00 65.25 ? 24  ALA A N     1 
ATOM   85    C  CA    . ALA A  1 24  ? 113.356 132.274 117.824 1.00 65.25 ? 24  ALA A CA    1 
ATOM   86    C  C     . ALA A  1 24  ? 114.177 133.352 118.528 1.00 65.25 ? 24  ALA A C     1 
ATOM   87    O  O     . ALA A  1 24  ? 114.583 133.211 119.684 1.00 65.25 ? 24  ALA A O     1 
ATOM   88    C  CB    . ALA A  1 24  ? 111.995 132.810 117.390 1.00 65.25 ? 24  ALA A CB    1 
ATOM   89    N  N     . GLN A  1 25  ? 114.429 134.451 117.819 1.00 74.14 ? 25  GLN A N     1 
ATOM   90    C  CA    . GLN A  1 25  ? 115.199 135.549 118.400 1.00 74.14 ? 25  GLN A CA    1 
ATOM   91    C  C     . GLN A  1 25  ? 114.336 136.372 119.353 1.00 74.14 ? 25  GLN A C     1 
ATOM   92    O  O     . GLN A  1 25  ? 114.649 136.502 120.540 1.00 74.14 ? 25  GLN A O     1 
ATOM   93    C  CB    . GLN A  1 25  ? 115.783 136.428 117.290 1.00 74.14 ? 25  GLN A CB    1 
ATOM   94    C  CG    . GLN A  1 25  ? 116.844 135.742 116.448 1.00 74.14 ? 25  GLN A CG    1 
ATOM   95    C  CD    . GLN A  1 25  ? 118.142 135.536 117.200 1.00 74.14 ? 25  GLN A CD    1 
ATOM   96    O  OE1   . GLN A  1 25  ? 118.465 136.283 118.122 1.00 74.14 ? 25  GLN A OE1   1 
ATOM   97    N  NE2   . GLN A  1 25  ? 118.895 134.516 116.809 1.00 74.14 ? 25  GLN A NE2   1 
ATOM   98    N  N     . ASP A  1 26  ? 113.236 136.928 118.844 1.00 78.69 ? 26  ASP A N     1 
ATOM   99    C  CA    . ASP A  1 26  ? 112.354 137.782 119.639 1.00 78.69 ? 26  ASP A CA    1 
ATOM   100   C  C     . ASP A  1 26  ? 111.394 136.900 120.433 1.00 78.69 ? 26  ASP A C     1 
ATOM   101   O  O     . ASP A  1 26  ? 110.213 136.749 120.109 1.00 78.69 ? 26  ASP A O     1 
ATOM   102   C  CB    . ASP A  1 26  ? 111.606 138.761 118.742 1.00 78.69 ? 26  ASP A CB    1 
ATOM   103   N  N     . VAL A  1 27  ? 111.921 136.306 121.499 1.00 76.84 ? 27  VAL A N     1 
ATOM   104   C  CA    . VAL A  1 27  ? 111.145 135.485 122.419 1.00 76.84 ? 27  VAL A CA    1 
ATOM   105   C  C     . VAL A  1 27  ? 111.349 136.052 123.816 1.00 76.84 ? 27  VAL A C     1 
ATOM   106   O  O     . VAL A  1 27  ? 112.490 136.178 124.278 1.00 76.84 ? 27  VAL A O     1 
ATOM   107   C  CB    . VAL A  1 27  ? 111.554 134.004 122.353 1.00 76.84 ? 27  VAL A CB    1 
ATOM   108   C  CG1   . VAL A  1 27  ? 110.989 133.232 123.533 1.00 76.84 ? 27  VAL A CG1   1 
ATOM   109   C  CG2   . VAL A  1 27  ? 111.082 133.387 121.049 1.00 76.84 ? 27  VAL A CG2   1 
ATOM   110   N  N     . LYS A  1 28  ? 110.250 136.406 124.478 1.00 80.70 ? 28  LYS A N     1 
ATOM   111   C  CA    . LYS A  1 28  ? 110.327 137.013 125.797 1.00 80.70 ? 28  LYS A CA    1 
ATOM   112   C  C     . LYS A  1 28  ? 110.733 135.983 126.848 1.00 80.70 ? 28  LYS A C     1 
ATOM   113   O  O     . LYS A  1 28  ? 110.713 134.771 126.615 1.00 80.70 ? 28  LYS A O     1 
ATOM   114   C  CB    . LYS A  1 28  ? 108.990 137.652 126.168 1.00 80.70 ? 28  LYS A CB    1 
ATOM   115   C  CG    . LYS A  1 28  ? 108.386 138.492 125.055 1.00 80.70 ? 28  LYS A CG    1 
ATOM   116   C  CD    . LYS A  1 28  ? 107.254 139.363 125.569 1.00 80.70 ? 28  LYS A CD    1 
ATOM   117   C  CE    . LYS A  1 28  ? 106.234 139.639 124.478 1.00 80.70 ? 28  LYS A CE    1 
ATOM   118   N  NZ    . LYS A  1 28  ? 106.827 140.381 123.333 1.00 80.70 ? 28  LYS A NZ    1 
ATOM   119   N  N     . GLU A  1 29  ? 111.114 136.489 128.023 1.00 80.74 ? 29  GLU A N     1 
ATOM   120   C  CA    . GLU A  1 29  ? 111.619 135.621 129.081 1.00 80.74 ? 29  GLU A CA    1 
ATOM   121   C  C     . GLU A  1 29  ? 110.513 134.788 129.715 1.00 80.74 ? 29  GLU A C     1 
ATOM   122   O  O     . GLU A  1 29  ? 110.771 133.663 130.161 1.00 80.74 ? 29  GLU A O     1 
ATOM   123   C  CB    . GLU A  1 29  ? 112.324 136.455 130.149 1.00 80.74 ? 29  GLU A CB    1 
ATOM   124   C  CG    . GLU A  1 29  ? 113.294 135.670 131.016 1.00 80.74 ? 29  GLU A CG    1 
ATOM   125   C  CD    . GLU A  1 29  ? 114.682 135.589 130.415 1.00 80.74 ? 29  GLU A CD    1 
ATOM   126   O  OE1   . GLU A  1 29  ? 115.380 134.583 130.661 1.00 80.74 ? 29  GLU A OE1   1 
ATOM   127   O  OE2   . GLU A  1 29  ? 115.077 136.534 129.702 1.00 80.74 ? 29  GLU A OE2   1 
ATOM   128   N  N     . GLU A  1 30  ? 109.285 135.319 129.759 1.00 79.23 ? 30  GLU A N     1 
ATOM   129   C  CA    . GLU A  1 30  ? 108.182 134.619 130.414 1.00 79.23 ? 30  GLU A CA    1 
ATOM   130   C  C     . GLU A  1 30  ? 107.802 133.350 129.663 1.00 79.23 ? 30  GLU A C     1 
ATOM   131   O  O     . GLU A  1 30  ? 107.515 132.320 130.285 1.00 79.23 ? 30  GLU A O     1 
ATOM   132   C  CB    . GLU A  1 30  ? 106.976 135.548 130.542 1.00 79.23 ? 30  GLU A CB    1 
ATOM   133   N  N     . THR A  1 31  ? 107.824 133.398 128.328 1.00 77.49 ? 31  THR A N     1 
ATOM   134   C  CA    . THR A  1 31  ? 107.572 132.204 127.528 1.00 77.49 ? 31  THR A CA    1 
ATOM   135   C  C     . THR A  1 31  ? 108.674 131.168 127.708 1.00 77.49 ? 31  THR A C     1 
ATOM   136   O  O     . THR A  1 31  ? 108.389 129.965 127.745 1.00 77.49 ? 31  THR A O     1 
ATOM   137   C  CB    . THR A  1 31  ? 107.434 132.583 126.053 1.00 77.49 ? 31  THR A CB    1 
ATOM   138   O  OG1   . THR A  1 31  ? 106.601 133.742 125.936 1.00 77.49 ? 31  THR A OG1   1 
ATOM   139   C  CG2   . THR A  1 31  ? 106.810 131.448 125.261 1.00 77.49 ? 31  THR A CG2   1 
ATOM   140   N  N     . LYS A  1 32  ? 109.923 131.618 127.868 1.00 74.46 ? 32  LYS A N     1 
ATOM   141   C  CA    . LYS A  1 32  ? 111.032 130.695 128.092 1.00 74.46 ? 32  LYS A CA    1 
ATOM   142   C  C     . LYS A  1 32  ? 110.913 129.995 129.438 1.00 74.46 ? 32  LYS A C     1 
ATOM   143   O  O     . LYS A  1 32  ? 111.095 128.774 129.523 1.00 74.46 ? 32  LYS A O     1 
ATOM   144   C  CB    . LYS A  1 32  ? 112.362 131.440 127.998 1.00 74.46 ? 32  LYS A CB    1 
ATOM   145   C  CG    . LYS A  1 32  ? 112.731 131.878 126.597 1.00 74.46 ? 32  LYS A CG    1 
ATOM   146   C  CD    . LYS A  1 32  ? 114.108 132.516 126.566 1.00 74.46 ? 32  LYS A CD    1 
ATOM   147   N  N     . GLU A  1 33  ? 110.589 130.744 130.498 1.00 76.60 ? 33  GLU A N     1 
ATOM   148   C  CA    . GLU A  1 33  ? 110.426 130.115 131.806 1.00 76.60 ? 33  GLU A CA    1 
ATOM   149   C  C     . GLU A  1 33  ? 109.176 129.246 131.866 1.00 76.60 ? 33  GLU A C     1 
ATOM   150   O  O     . GLU A  1 33  ? 109.176 128.225 132.560 1.00 76.60 ? 33  GLU A O     1 
ATOM   151   C  CB    . GLU A  1 33  ? 110.394 131.169 132.920 1.00 76.60 ? 33  GLU A CB    1 
ATOM   152   C  CG    . GLU A  1 33  ? 111.547 132.197 132.942 1.00 76.60 ? 33  GLU A CG    1 
ATOM   153   C  CD    . GLU A  1 33  ? 112.965 131.617 133.017 1.00 76.60 ? 33  GLU A CD    1 
ATOM   154   O  OE1   . GLU A  1 33  ? 113.159 130.455 133.438 1.00 76.60 ? 33  GLU A OE1   1 
ATOM   155   O  OE2   . GLU A  1 33  ? 113.906 132.348 132.640 1.00 76.60 ? 33  GLU A OE2   1 
ATOM   156   N  N     . TRP A  1 34  ? 108.127 129.599 131.119 1.00 72.14 ? 34  TRP A N     1 
ATOM   157   C  CA    . TRP A  1 34  ? 106.932 128.761 131.091 1.00 72.14 ? 34  TRP A CA    1 
ATOM   158   C  C     . TRP A  1 34  ? 107.181 127.458 130.340 1.00 72.14 ? 34  TRP A C     1 
ATOM   159   O  O     . TRP A  1 34  ? 106.714 126.394 130.765 1.00 72.14 ? 34  TRP A O     1 
ATOM   160   C  CB    . TRP A  1 34  ? 105.774 129.534 130.467 1.00 72.14 ? 34  TRP A CB    1 
ATOM   161   C  CG    . TRP A  1 34  ? 104.577 128.697 130.178 1.00 72.14 ? 34  TRP A CG    1 
ATOM   162   C  CD1   . TRP A  1 34  ? 103.624 128.292 131.064 1.00 72.14 ? 34  TRP A CD1   1 
ATOM   163   C  CD2   . TRP A  1 34  ? 104.198 128.165 128.908 1.00 72.14 ? 34  TRP A CD2   1 
ATOM   164   N  NE1   . TRP A  1 34  ? 102.673 127.537 130.423 1.00 72.14 ? 34  TRP A NE1   1 
ATOM   165   C  CE2   . TRP A  1 34  ? 103.003 127.444 129.097 1.00 72.14 ? 34  TRP A CE2   1 
ATOM   166   C  CE3   . TRP A  1 34  ? 104.754 128.226 127.628 1.00 72.14 ? 34  TRP A CE3   1 
ATOM   167   C  CZ2   . TRP A  1 34  ? 102.356 126.791 128.054 1.00 72.14 ? 34  TRP A CZ2   1 
ATOM   168   C  CZ3   . TRP A  1 34  ? 104.110 127.577 126.595 1.00 72.14 ? 34  TRP A CZ3   1 
ATOM   169   C  CH2   . TRP A  1 34  ? 102.924 126.871 126.813 1.00 72.14 ? 34  TRP A CH2   1 
ATOM   170   N  N     . LEU A  1 35  ? 107.936 127.512 129.238 1.00 66.19 ? 35  LEU A N     1 
ATOM   171   C  CA    . LEU A  1 35  ? 108.296 126.291 128.524 1.00 66.19 ? 35  LEU A CA    1 
ATOM   172   C  C     . LEU A  1 35  ? 109.239 125.423 129.351 1.00 66.19 ? 35  LEU A C     1 
ATOM   173   O  O     . LEU A  1 35  ? 109.098 124.192 129.379 1.00 66.19 ? 35  LEU A O     1 
ATOM   174   C  CB    . LEU A  1 35  ? 108.927 126.641 127.176 1.00 66.19 ? 35  LEU A CB    1 
ATOM   175   C  CG    . LEU A  1 35  ? 109.369 125.474 126.294 1.00 66.19 ? 35  LEU A CG    1 
ATOM   176   C  CD1   . LEU A  1 35  ? 108.167 124.668 125.834 1.00 66.19 ? 35  LEU A CD1   1 
ATOM   177   C  CD2   . LEU A  1 35  ? 110.172 125.969 125.104 1.00 66.19 ? 35  LEU A CD2   1 
ATOM   178   N  N     . LYS A  1 36  ? 110.192 126.050 130.049 1.00 64.06 ? 36  LYS A N     1 
ATOM   179   C  CA    . LYS A  1 36  ? 111.106 125.304 130.906 1.00 64.06 ? 36  LYS A CA    1 
ATOM   180   C  C     . LYS A  1 36  ? 110.386 124.688 132.099 1.00 64.06 ? 36  LYS A C     1 
ATOM   181   O  O     . LYS A  1 36  ? 110.761 123.603 132.554 1.00 64.06 ? 36  LYS A O     1 
ATOM   182   C  CB    . LYS A  1 36  ? 112.237 126.218 131.375 1.00 64.06 ? 36  LYS A CB    1 
ATOM   183   C  CG    . LYS A  1 36  ? 113.422 125.478 131.952 1.00 64.06 ? 36  LYS A CG    1 
ATOM   184   C  CD    . LYS A  1 36  ? 114.500 126.418 132.453 1.00 64.06 ? 36  LYS A CD    1 
ATOM   185   C  CE    . LYS A  1 36  ? 115.732 125.636 132.875 1.00 64.06 ? 36  LYS A CE    1 
ATOM   186   N  NZ    . LYS A  1 36  ? 116.935 126.500 133.009 1.00 64.06 ? 36  LYS A NZ    1 
ATOM   187   N  N     . ASN A  1 37  ? 109.348 125.346 132.608 1.00 67.87 ? 37  ASN A N     1 
ATOM   188   C  CA    . ASN A  1 37  ? 108.537 124.791 133.679 1.00 67.87 ? 37  ASN A CA    1 
ATOM   189   C  C     . ASN A  1 37  ? 107.554 123.740 133.182 1.00 67.87 ? 37  ASN A C     1 
ATOM   190   O  O     . ASN A  1 37  ? 107.103 122.910 133.976 1.00 67.87 ? 37  ASN A O     1 
ATOM   191   C  CB    . ASN A  1 37  ? 107.780 125.912 134.399 1.00 67.87 ? 37  ASN A CB    1 
ATOM   192   C  CG    . ASN A  1 37  ? 107.235 125.479 135.744 1.00 67.87 ? 37  ASN A CG    1 
ATOM   193   O  OD1   . ASN A  1 37  ? 106.075 125.733 136.069 1.00 67.87 ? 37  ASN A OD1   1 
ATOM   194   N  ND2   . ASN A  1 37  ? 108.071 124.818 136.534 1.00 67.87 ? 37  ASN A ND2   1 
ATOM   195   N  N     . ARG A  1 38  ? 107.208 123.753 131.896 1.00 65.33 ? 38  ARG A N     1 
ATOM   196   C  CA    . ARG A  1 38  ? 106.374 122.699 131.338 1.00 65.33 ? 38  ARG A CA    1 
ATOM   197   C  C     . ARG A  1 38  ? 107.171 121.516 130.812 1.00 65.33 ? 38  ARG A C     1 
ATOM   198   O  O     . ARG A  1 38  ? 106.573 120.486 130.485 1.00 65.33 ? 38  ARG A O     1 
ATOM   199   C  CB    . ARG A  1 38  ? 105.494 123.250 130.210 1.00 65.33 ? 38  ARG A CB    1 
ATOM   200   C  CG    . ARG A  1 38  ? 104.254 123.979 130.693 1.00 65.33 ? 38  ARG A CG    1 
ATOM   201   C  CD    . ARG A  1 38  ? 103.440 123.120 131.646 1.00 65.33 ? 38  ARG A CD    1 
ATOM   202   N  NE    . ARG A  1 38  ? 102.830 121.978 130.973 1.00 65.33 ? 38  ARG A NE    1 
ATOM   203   C  CZ    . ARG A  1 38  ? 101.642 122.008 130.379 1.00 65.33 ? 38  ARG A CZ    1 
ATOM   204   N  NH1   . ARG A  1 38  ? 100.931 123.126 130.370 1.00 65.33 ? 38  ARG A NH1   1 
ATOM   205   N  NH2   . ARG A  1 38  ? 101.164 120.921 129.792 1.00 65.33 ? 38  ARG A NH2   1 
ATOM   206   N  N     . ILE A  1 39  ? 108.492 121.633 130.720 1.00 60.63 ? 39  ILE A N     1 
ATOM   207   C  CA    . ILE A  1 39  ? 109.320 120.510 130.285 1.00 60.63 ? 39  ILE A CA    1 
ATOM   208   C  C     . ILE A  1 39  ? 109.856 119.715 131.474 1.00 60.63 ? 39  ILE A C     1 
ATOM   209   O  O     . ILE A  1 39  ? 109.764 118.484 131.500 1.00 60.63 ? 39  ILE A O     1 
ATOM   210   C  CB    . ILE A  1 39  ? 110.454 121.024 129.369 1.00 60.63 ? 39  ILE A CB    1 
ATOM   211   C  CG1   . ILE A  1 39  ? 109.914 121.272 127.961 1.00 60.63 ? 39  ILE A CG1   1 
ATOM   212   C  CG2   . ILE A  1 39  ? 111.612 120.043 129.302 1.00 60.63 ? 39  ILE A CG2   1 
ATOM   213   C  CD1   . ILE A  1 39  ? 110.942 121.805 126.995 1.00 60.63 ? 39  ILE A CD1   1 
ATOM   214   N  N     . ILE A  1 40  ? 110.391 120.394 132.494 1.00 60.57 ? 40  ILE A N     1 
ATOM   215   C  CA    . ILE A  1 40  ? 111.088 119.693 133.571 1.00 60.57 ? 40  ILE A CA    1 
ATOM   216   C  C     . ILE A  1 40  ? 110.093 119.056 134.542 1.00 60.57 ? 40  ILE A C     1 
ATOM   217   O  O     . ILE A  1 40  ? 110.396 118.039 135.182 1.00 60.57 ? 40  ILE A O     1 
ATOM   218   C  CB    . ILE A  1 40  ? 112.053 120.661 134.287 1.00 60.57 ? 40  ILE A CB    1 
ATOM   219   C  CG1   . ILE A  1 40  ? 113.008 121.300 133.290 1.00 60.57 ? 40  ILE A CG1   1 
ATOM   220   C  CG2   . ILE A  1 40  ? 112.934 119.951 135.308 1.00 60.57 ? 40  ILE A CG2   1 
ATOM   221   C  CD1   . ILE A  1 40  ? 113.855 122.390 133.905 1.00 60.57 ? 40  ILE A CD1   1 
ATOM   222   N  N     . ALA A  1 41  ? 108.881 119.607 134.632 1.00 66.07 ? 41  ALA A N     1 
ATOM   223   C  CA    . ALA A  1 41  ? 107.906 119.156 135.621 1.00 66.07 ? 41  ALA A CA    1 
ATOM   224   C  C     . ALA A  1 41  ? 107.415 117.743 135.322 1.00 66.07 ? 41  ALA A C     1 
ATOM   225   O  O     . ALA A  1 41  ? 107.423 117.286 134.176 1.00 66.07 ? 41  ALA A O     1 
ATOM   226   C  CB    . ALA A  1 41  ? 106.718 120.114 135.680 1.00 66.07 ? 41  ALA A CB    1 
ATOM   227   N  N     . LYS A  1 42  ? 106.989 117.052 136.378 1.00 68.70 ? 42  LYS A N     1 
ATOM   228   C  CA    . LYS A  1 42  ? 106.734 115.622 136.322 1.00 68.70 ? 42  LYS A CA    1 
ATOM   229   C  C     . LYS A  1 42  ? 105.456 115.318 135.542 1.00 68.70 ? 42  LYS A C     1 
ATOM   230   O  O     . LYS A  1 42  ? 104.703 116.210 135.143 1.00 68.70 ? 42  LYS A O     1 
ATOM   231   C  CB    . LYS A  1 42  ? 106.647 115.047 137.735 1.00 68.70 ? 42  LYS A CB    1 
ATOM   232   C  CG    . LYS A  1 42  ? 107.744 115.546 138.663 1.00 68.70 ? 42  LYS A CG    1 
ATOM   233   C  CD    . LYS A  1 42  ? 107.532 115.071 140.090 1.00 68.70 ? 42  LYS A CD    1 
ATOM   234   C  CE    . LYS A  1 42  ? 108.005 113.640 140.274 1.00 68.70 ? 42  LYS A CE    1 
ATOM   235   N  NZ    . LYS A  1 42  ? 109.490 113.537 140.242 1.00 68.70 ? 42  LYS A NZ    1 
ATOM   236   N  N     . LYS A  1 43  ? 105.219 114.021 135.329 1.00 66.86 ? 43  LYS A N     1 
ATOM   237   C  CA    . LYS A  1 43  ? 104.091 113.589 134.510 1.00 66.86 ? 43  LYS A CA    1 
ATOM   238   C  C     . LYS A  1 43  ? 102.762 113.770 135.232 1.00 66.86 ? 43  LYS A C     1 
ATOM   239   O  O     . LYS A  1 43  ? 101.719 113.902 134.582 1.00 66.86 ? 43  LYS A O     1 
ATOM   240   C  CB    . LYS A  1 43  ? 104.279 112.129 134.099 1.00 66.86 ? 43  LYS A CB    1 
ATOM   241   C  CG    . LYS A  1 43  ? 103.579 111.742 132.809 1.00 66.86 ? 43  LYS A CG    1 
ATOM   242   C  CD    . LYS A  1 43  ? 104.173 112.478 131.623 1.00 66.86 ? 43  LYS A CD    1 
ATOM   243   C  CE    . LYS A  1 43  ? 103.613 111.956 130.312 1.00 66.86 ? 43  LYS A CE    1 
ATOM   244   N  NZ    . LYS A  1 43  ? 103.933 110.517 130.111 1.00 66.86 ? 43  LYS A NZ    1 
ATOM   245   N  N     . LYS A  1 44  ? 102.776 113.780 136.566 1.00 71.68 ? 44  LYS A N     1 
ATOM   246   C  CA    . LYS A  1 44  ? 101.553 114.006 137.326 1.00 71.68 ? 44  LYS A CA    1 
ATOM   247   C  C     . LYS A  1 44  ? 101.198 115.482 137.438 1.00 71.68 ? 44  LYS A C     1 
ATOM   248   O  O     . LYS A  1 44  ? 100.038 115.807 137.714 1.00 71.68 ? 44  LYS A O     1 
ATOM   249   C  CB    . LYS A  1 44  ? 101.683 113.396 138.724 1.00 71.68 ? 44  LYS A CB    1 
ATOM   250   C  CG    . LYS A  1 44  ? 102.867 113.914 139.522 1.00 71.68 ? 44  LYS A CG    1 
ATOM   251   C  CD    . LYS A  1 44  ? 103.173 113.018 140.711 1.00 71.68 ? 44  LYS A CD    1 
ATOM   252   C  CE    . LYS A  1 44  ? 103.839 111.726 140.271 1.00 71.68 ? 44  LYS A CE    1 
ATOM   253   N  NZ    . LYS A  1 44  ? 104.255 110.893 141.432 1.00 71.68 ? 44  LYS A NZ    1 
ATOM   254   N  N     . ASP A  1 45  ? 102.162 116.379 137.231 1.00 72.55 ? 45  ASP A N     1 
ATOM   255   C  CA    . ASP A  1 45  ? 101.923 117.814 137.263 1.00 72.55 ? 45  ASP A CA    1 
ATOM   256   C  C     . ASP A  1 45  ? 101.648 118.393 135.880 1.00 72.55 ? 45  ASP A C     1 
ATOM   257   O  O     . ASP A  1 45  ? 101.695 119.617 135.709 1.00 72.55 ? 45  ASP A O     1 
ATOM   258   C  CB    . ASP A  1 45  ? 103.112 118.533 137.904 1.00 72.55 ? 45  ASP A CB    1 
ATOM   259   C  CG    . ASP A  1 45  ? 103.568 117.872 139.190 1.00 72.55 ? 45  ASP A CG    1 
ATOM   260   O  OD1   . ASP A  1 45  ? 102.728 117.239 139.862 1.00 72.55 ? 45  ASP A OD1   1 
ATOM   261   O  OD2   . ASP A  1 45  ? 104.765 117.987 139.528 1.00 72.55 ? 45  ASP A OD2   1 
ATOM   262   N  N     . GLY A  1 46  ? 101.367 117.545 134.893 1.00 70.22 ? 46  GLY A N     1 
ATOM   263   C  CA    . GLY A  1 46  ? 101.076 118.019 133.556 1.00 70.22 ? 46  GLY A CA    1 
ATOM   264   C  C     . GLY A  1 46  ? 102.282 118.397 132.732 1.00 70.22 ? 46  GLY A C     1 
ATOM   265   O  O     . GLY A  1 46  ? 102.158 119.217 131.817 1.00 70.22 ? 46  GLY A O     1 
ATOM   266   N  N     . GLY A  1 47  ? 103.448 117.829 133.024 1.00 65.64 ? 47  GLY A N     1 
ATOM   267   C  CA    . GLY A  1 47  ? 104.645 118.129 132.264 1.00 65.64 ? 47  GLY A CA    1 
ATOM   268   C  C     . GLY A  1 47  ? 105.114 116.972 131.408 1.00 65.64 ? 47  GLY A C     1 
ATOM   269   O  O     . GLY A  1 47  ? 104.300 116.189 130.909 1.00 65.64 ? 47  GLY A O     1 
ATOM   270   N  N     . ALA A  1 48  ? 106.428 116.853 131.230 1.00 60.68 ? 48  ALA A N     1 
ATOM   271   C  CA    . ALA A  1 48  ? 106.992 115.762 130.447 1.00 60.68 ? 48  ALA A CA    1 
ATOM   272   C  C     . ALA A  1 48  ? 108.156 115.054 131.120 1.00 60.68 ? 48  ALA A C     1 
ATOM   273   O  O     . ALA A  1 48  ? 108.544 113.984 130.640 1.00 60.68 ? 48  ALA A O     1 
ATOM   274   C  CB    . ALA A  1 48  ? 107.447 116.272 129.074 1.00 60.68 ? 48  ALA A CB    1 
ATOM   275   N  N     . GLN A  1 49  ? 108.725 115.618 132.196 1.00 58.47 ? 49  GLN A N     1 
ATOM   276   C  CA    . GLN A  1 49  ? 109.797 115.018 133.003 1.00 58.47 ? 49  GLN A CA    1 
ATOM   277   C  C     . GLN A  1 49  ? 111.046 114.736 132.169 1.00 58.47 ? 49  GLN A C     1 
ATOM   278   O  O     . GLN A  1 49  ? 111.617 113.646 132.209 1.00 58.47 ? 49  GLN A O     1 
ATOM   279   C  CB    . GLN A  1 49  ? 109.316 113.755 133.727 1.00 58.47 ? 49  GLN A CB    1 
ATOM   280   C  CG    . GLN A  1 49  ? 109.961 113.526 135.084 1.00 58.47 ? 49  GLN A CG    1 
ATOM   281   C  CD    . GLN A  1 49  ? 109.465 112.262 135.757 1.00 58.47 ? 49  GLN A CD    1 
ATOM   282   O  OE1   . GLN A  1 49  ? 108.273 111.957 135.729 1.00 58.47 ? 49  GLN A OE1   1 
ATOM   283   N  NE2   . GLN A  1 49  ? 110.381 111.517 136.365 1.00 58.47 ? 49  GLN A NE2   1 
ATOM   284   N  N     . LEU A  1 50  ? 111.469 115.737 131.404 1.00 51.63 ? 50  LEU A N     1 
ATOM   285   C  CA    . LEU A  1 50  ? 112.674 115.651 130.596 1.00 51.63 ? 50  LEU A CA    1 
ATOM   286   C  C     . LEU A  1 50  ? 113.737 116.584 131.156 1.00 51.63 ? 50  LEU A C     1 
ATOM   287   O  O     . LEU A  1 50  ? 113.431 117.694 131.599 1.00 51.63 ? 50  LEU A O     1 
ATOM   288   C  CB    . LEU A  1 50  ? 112.392 116.010 129.136 1.00 51.63 ? 50  LEU A CB    1 
ATOM   289   C  CG    . LEU A  1 50  ? 111.378 115.145 128.394 1.00 51.63 ? 50  LEU A CG    1 
ATOM   290   C  CD1   . LEU A  1 50  ? 110.945 115.835 127.120 1.00 51.63 ? 50  LEU A CD1   1 
ATOM   291   C  CD2   . LEU A  1 50  ? 111.962 113.781 128.091 1.00 51.63 ? 50  LEU A CD2   1 
ATOM   292   N  N     . LEU A  1 51  ? 114.982 116.121 131.140 1.00 49.27 ? 51  LEU A N     1 
ATOM   293   C  CA    . LEU A  1 51  ? 116.103 116.956 131.545 1.00 49.27 ? 51  LEU A CA    1 
ATOM   294   C  C     . LEU A  1 51  ? 116.337 118.049 130.512 1.00 49.27 ? 51  LEU A C     1 
ATOM   295   O  O     . LEU A  1 51  ? 116.495 117.771 129.320 1.00 49.27 ? 51  LEU A O     1 
ATOM   296   C  CB    . LEU A  1 51  ? 117.361 116.109 131.714 1.00 49.27 ? 51  LEU A CB    1 
ATOM   297   C  CG    . LEU A  1 51  ? 117.778 115.754 133.141 1.00 49.27 ? 51  LEU A CG    1 
ATOM   298   C  CD1   . LEU A  1 51  ? 116.670 115.010 133.869 1.00 49.27 ? 51  LEU A CD1   1 
ATOM   299   C  CD2   . LEU A  1 51  ? 119.055 114.935 133.126 1.00 49.27 ? 51  LEU A CD2   1 
ATOM   300   N  N     . PHE A  1 52  ? 116.372 119.291 130.978 1.00 52.06 ? 52  PHE A N     1 
ATOM   301   C  CA    . PHE A  1 52  ? 116.470 120.464 130.127 1.00 52.06 ? 52  PHE A CA    1 
ATOM   302   C  C     . PHE A  1 52  ? 117.734 121.227 130.486 1.00 52.06 ? 52  PHE A C     1 
ATOM   303   O  O     . PHE A  1 52  ? 118.136 121.271 131.651 1.00 52.06 ? 52  PHE A O     1 
ATOM   304   C  CB    . PHE A  1 52  ? 115.234 121.347 130.307 1.00 52.06 ? 52  PHE A CB    1 
ATOM   305   C  CG    . PHE A  1 52  ? 115.091 122.430 129.287 1.00 52.06 ? 52  PHE A CG    1 
ATOM   306   C  CD1   . PHE A  1 52  ? 114.448 122.187 128.086 1.00 52.06 ? 52  PHE A CD1   1 
ATOM   307   C  CD2   . PHE A  1 52  ? 115.558 123.708 129.548 1.00 52.06 ? 52  PHE A CD2   1 
ATOM   308   C  CE1   . PHE A  1 52  ? 114.299 123.192 127.150 1.00 52.06 ? 52  PHE A CE1   1 
ATOM   309   C  CE2   . PHE A  1 52  ? 115.411 124.717 128.617 1.00 52.06 ? 52  PHE A CE2   1 
ATOM   310   C  CZ    . PHE A  1 52  ? 114.776 124.459 127.420 1.00 52.06 ? 52  PHE A CZ    1 
ATOM   311   N  N     . ARG A  1 53  ? 118.361 121.833 129.481 1.00 53.88 ? 53  ARG A N     1 
ATOM   312   C  CA    . ARG A  1 53  ? 119.614 122.536 129.714 1.00 53.88 ? 53  ARG A CA    1 
ATOM   313   C  C     . ARG A  1 53  ? 119.771 123.610 128.654 1.00 53.88 ? 53  ARG A C     1 
ATOM   314   O  O     . ARG A  1 53  ? 119.317 123.424 127.522 1.00 53.88 ? 53  ARG A O     1 
ATOM   315   C  CB    . ARG A  1 53  ? 120.801 121.562 129.668 1.00 53.88 ? 53  ARG A CB    1 
ATOM   316   C  CG    . ARG A  1 53  ? 122.097 122.104 130.239 1.00 53.88 ? 53  ARG A CG    1 
ATOM   317   C  CD    . ARG A  1 53  ? 123.013 120.989 130.701 1.00 53.88 ? 53  ARG A CD    1 
ATOM   318   N  NE    . ARG A  1 53  ? 123.378 120.083 129.618 1.00 53.88 ? 53  ARG A NE    1 
ATOM   319   C  CZ    . ARG A  1 53  ? 124.428 120.256 128.823 1.00 53.88 ? 53  ARG A CZ    1 
ATOM   320   N  NH1   . ARG A  1 53  ? 125.217 121.308 128.984 1.00 53.88 ? 53  ARG A NH1   1 
ATOM   321   N  NH2   . ARG A  1 53  ? 124.688 119.377 127.867 1.00 53.88 ? 53  ARG A NH2   1 
ATOM   322   N  N     . PRO A  1 54  ? 120.377 124.746 128.985 1.00 57.41 ? 54  PRO A N     1 
ATOM   323   C  CA    . PRO A  1 54  ? 120.854 125.647 127.935 1.00 57.41 ? 54  PRO A CA    1 
ATOM   324   C  C     . PRO A  1 54  ? 122.060 125.052 127.228 1.00 57.41 ? 54  PRO A C     1 
ATOM   325   O  O     . PRO A  1 54  ? 122.688 124.102 127.698 1.00 57.41 ? 54  PRO A O     1 
ATOM   326   C  CB    . PRO A  1 54  ? 121.229 126.924 128.695 1.00 57.41 ? 54  PRO A CB    1 
ATOM   327   C  CG    . PRO A  1 54  ? 120.494 126.834 129.985 1.00 57.41 ? 54  PRO A CG    1 
ATOM   328   C  CD    . PRO A  1 54  ? 120.428 125.377 130.313 1.00 57.41 ? 54  PRO A CD    1 
ATOM   329   N  N     . LEU A  1 55  ? 122.379 125.626 126.067 1.00 60.64 ? 55  LEU A N     1 
ATOM   330   C  CA    . LEU A  1 55  ? 123.550 125.166 125.330 1.00 60.64 ? 55  LEU A CA    1 
ATOM   331   C  C     . LEU A  1 55  ? 124.834 125.570 126.040 1.00 60.64 ? 55  LEU A C     1 
ATOM   332   O  O     . LEU A  1 55  ? 125.813 124.815 126.046 1.00 60.64 ? 55  LEU A O     1 
ATOM   333   C  CB    . LEU A  1 55  ? 123.527 125.719 123.908 1.00 60.64 ? 55  LEU A CB    1 
ATOM   334   C  CG    . LEU A  1 55  ? 124.579 125.169 122.946 1.00 60.64 ? 55  LEU A CG    1 
ATOM   335   C  CD1   . LEU A  1 55  ? 124.549 123.654 122.928 1.00 60.64 ? 55  LEU A CD1   1 
ATOM   336   C  CD2   . LEU A  1 55  ? 124.354 125.724 121.559 1.00 60.64 ? 55  LEU A CD2   1 
ATOM   337   N  N     . LEU A  1 56  ? 124.844 126.750 126.652 1.00 71.88 ? 56  LEU A N     1 
ATOM   338   C  CA    . LEU A  1 56  ? 126.008 127.258 127.363 1.00 71.88 ? 56  LEU A CA    1 
ATOM   339   C  C     . LEU A  1 56  ? 125.544 127.929 128.646 1.00 71.88 ? 56  LEU A C     1 
ATOM   340   O  O     . LEU A  1 56  ? 124.615 128.741 128.620 1.00 71.88 ? 56  LEU A O     1 
ATOM   341   C  CB    . LEU A  1 56  ? 126.789 128.252 126.499 1.00 71.88 ? 56  LEU A CB    1 
ATOM   342   C  CG    . LEU A  1 56  ? 127.563 127.691 125.307 1.00 71.88 ? 56  LEU A CG    1 
ATOM   343   C  CD1   . LEU A  1 56  ? 127.988 128.816 124.386 1.00 71.88 ? 56  LEU A CD1   1 
ATOM   344   C  CD2   . LEU A  1 56  ? 128.763 126.889 125.781 1.00 71.88 ? 56  LEU A CD2   1 
ATOM   345   N  N     . ASN A  1 57  ? 126.188 127.586 129.764 1.00 74.74 ? 57  ASN A N     1 
ATOM   346   C  CA    . ASN A  1 57  ? 125.847 128.209 131.038 1.00 74.74 ? 57  ASN A CA    1 
ATOM   347   C  C     . ASN A  1 57  ? 126.285 129.667 131.112 1.00 74.74 ? 57  ASN A C     1 
ATOM   348   O  O     . ASN A  1 57  ? 125.691 130.444 131.866 1.00 74.74 ? 57  ASN A O     1 
ATOM   349   C  CB    . ASN A  1 57  ? 126.452 127.406 132.192 1.00 74.74 ? 57  ASN A CB    1 
ATOM   350   C  CG    . ASN A  1 57  ? 127.955 127.194 132.049 1.00 74.74 ? 57  ASN A CG    1 
ATOM   351   O  OD1   . ASN A  1 57  ? 128.587 127.674 131.107 1.00 74.74 ? 57  ASN A OD1   1 
ATOM   352   N  ND2   . ASN A  1 57  ? 128.535 126.467 132.999 1.00 74.74 ? 57  ASN A ND2   1 
ATOM   353   N  N     . LYS A  1 58  ? 127.307 130.048 130.350 1.00 78.14 ? 58  LYS A N     1 
ATOM   354   C  CA    . LYS A  1 58  ? 127.774 131.423 130.282 1.00 78.14 ? 58  LYS A CA    1 
ATOM   355   C  C     . LYS A  1 58  ? 127.760 131.883 128.832 1.00 78.14 ? 58  LYS A C     1 
ATOM   356   O  O     . LYS A  1 58  ? 127.779 131.075 127.902 1.00 78.14 ? 58  LYS A O     1 
ATOM   357   C  CB    . LYS A  1 58  ? 129.185 131.569 130.863 1.00 78.14 ? 58  LYS A CB    1 
ATOM   358   C  CG    . LYS A  1 58  ? 129.276 131.371 132.374 1.00 78.14 ? 58  LYS A CG    1 
ATOM   359   C  CD    . LYS A  1 58  ? 130.704 131.534 132.922 1.00 78.14 ? 58  LYS A CD    1 
ATOM   360   C  CE    . LYS A  1 58  ? 131.574 132.484 132.096 1.00 78.14 ? 58  LYS A CE    1 
ATOM   361   N  NZ    . LYS A  1 58  ? 132.773 132.945 132.844 1.00 78.14 ? 58  LYS A NZ    1 
ATOM   362   N  N     . TYR A  1 59  ? 127.731 133.199 128.646 1.00 83.65 ? 59  TYR A N     1 
ATOM   363   C  CA    . TYR A  1 59  ? 127.729 133.782 127.314 1.00 83.65 ? 59  TYR A CA    1 
ATOM   364   C  C     . TYR A  1 59  ? 128.650 134.992 127.287 1.00 83.65 ? 59  TYR A C     1 
ATOM   365   O  O     . TYR A  1 59  ? 128.736 135.749 128.257 1.00 83.65 ? 59  TYR A O     1 
ATOM   366   C  CB    . TYR A  1 59  ? 126.315 134.186 126.876 1.00 83.65 ? 59  TYR A CB    1 
ATOM   367   C  CG    . TYR A  1 59  ? 125.539 133.069 126.214 1.00 83.65 ? 59  TYR A CG    1 
ATOM   368   C  CD1   . TYR A  1 59  ? 124.811 132.158 126.971 1.00 83.65 ? 59  TYR A CD1   1 
ATOM   369   C  CD2   . TYR A  1 59  ? 125.537 132.924 124.832 1.00 83.65 ? 59  TYR A CD2   1 
ATOM   370   C  CE1   . TYR A  1 59  ? 124.100 131.132 126.366 1.00 83.65 ? 59  TYR A CE1   1 
ATOM   371   C  CE2   . TYR A  1 59  ? 124.831 131.903 124.219 1.00 83.65 ? 59  TYR A CE2   1 
ATOM   372   C  CZ    . TYR A  1 59  ? 124.115 131.012 124.991 1.00 83.65 ? 59  TYR A CZ    1 
ATOM   373   O  OH    . TYR A  1 59  ? 123.412 129.996 124.387 1.00 83.65 ? 59  TYR A OH    1 
ATOM   374   N  N     . GLU A  1 60  ? 129.338 135.163 126.166 1.00 92.62 ? 60  GLU A N     1 
ATOM   375   C  CA    . GLU A  1 60  ? 130.206 136.307 125.931 1.00 92.62 ? 60  GLU A CA    1 
ATOM   376   C  C     . GLU A  1 60  ? 129.611 137.152 124.807 1.00 92.62 ? 60  GLU A C     1 
ATOM   377   O  O     . GLU A  1 60  ? 128.559 136.827 124.253 1.00 92.62 ? 60  GLU A O     1 
ATOM   378   C  CB    . GLU A  1 60  ? 131.630 135.845 125.612 1.00 92.62 ? 60  GLU A CB    1 
ATOM   379   C  CG    . GLU A  1 60  ? 132.291 135.068 126.736 1.00 92.62 ? 60  GLU A CG    1 
ATOM   380   N  N     . GLN A  1 61  ? 130.304 138.239 124.460 1.00 95.55 ? 61  GLN A N     1 
ATOM   381   C  CA    . GLN A  1 61  ? 129.788 139.174 123.464 1.00 95.55 ? 61  GLN A CA    1 
ATOM   382   C  C     . GLN A  1 61  ? 129.822 138.614 122.047 1.00 95.55 ? 61  GLN A C     1 
ATOM   383   O  O     . GLN A  1 61  ? 129.144 139.155 121.168 1.00 95.55 ? 61  GLN A O     1 
ATOM   384   C  CB    . GLN A  1 61  ? 130.576 140.484 123.516 1.00 95.55 ? 61  GLN A CB    1 
ATOM   385   N  N     . GLU A  1 62  ? 130.587 137.550 121.804 1.00 96.56 ? 62  GLU A N     1 
ATOM   386   C  CA    . GLU A  1 62  ? 130.679 136.988 120.461 1.00 96.56 ? 62  GLU A CA    1 
ATOM   387   C  C     . GLU A  1 62  ? 129.519 136.042 120.167 1.00 96.56 ? 62  GLU A C     1 
ATOM   388   O  O     . GLU A  1 62  ? 128.961 136.058 119.064 1.00 96.56 ? 62  GLU A O     1 
ATOM   389   C  CB    . GLU A  1 62  ? 132.016 136.266 120.288 1.00 96.56 ? 62  GLU A CB    1 
ATOM   390   N  N     . THR A  1 63  ? 129.143 135.209 121.139 1.00 91.40 ? 63  THR A N     1 
ATOM   391   C  CA    . THR A  1 63  ? 128.140 134.170 120.934 1.00 91.40 ? 63  THR A CA    1 
ATOM   392   C  C     . THR A  1 63  ? 126.742 134.590 121.375 1.00 91.40 ? 63  THR A C     1 
ATOM   393   O  O     . THR A  1 63  ? 125.932 133.727 121.738 1.00 91.40 ? 63  THR A O     1 
ATOM   394   C  CB    . THR A  1 63  ? 128.557 132.890 121.658 1.00 91.40 ? 63  THR A CB    1 
ATOM   395   O  OG1   . THR A  1 63  ? 128.286 133.023 123.058 1.00 91.40 ? 63  THR A OG1   1 
ATOM   396   C  CG2   . THR A  1 63  ? 130.039 132.626 121.459 1.00 91.40 ? 63  THR A CG2   1 
ATOM   397   N  N     . LEU A  1 64  ? 126.429 135.887 121.350 1.00 90.10 ? 64  LEU A N     1 
ATOM   398   C  CA    . LEU A  1 64  ? 125.096 136.342 121.736 1.00 90.10 ? 64  LEU A CA    1 
ATOM   399   C  C     . LEU A  1 64  ? 124.036 136.063 120.679 1.00 90.10 ? 64  LEU A C     1 
ATOM   400   O  O     . LEU A  1 64  ? 122.846 136.087 121.006 1.00 90.10 ? 64  LEU A O     1 
ATOM   401   C  CB    . LEU A  1 64  ? 125.112 137.840 122.051 1.00 90.10 ? 64  LEU A CB    1 
ATOM   402   C  CG    . LEU A  1 64  ? 125.700 138.309 123.384 1.00 90.10 ? 64  LEU A CG    1 
ATOM   403   C  CD1   . LEU A  1 64  ? 125.219 139.714 123.707 1.00 90.10 ? 64  LEU A CD1   1 
ATOM   404   C  CD2   . LEU A  1 64  ? 125.316 137.357 124.509 1.00 90.10 ? 64  LEU A CD2   1 
ATOM   405   N  N     . GLU A  1 65  ? 124.429 135.799 119.434 1.00 84.99 ? 65  GLU A N     1 
ATOM   406   C  CA    . GLU A  1 65  ? 123.486 135.525 118.359 1.00 84.99 ? 65  GLU A CA    1 
ATOM   407   C  C     . GLU A  1 65  ? 123.057 134.064 118.312 1.00 84.99 ? 65  GLU A C     1 
ATOM   408   O  O     . GLU A  1 65  ? 122.266 133.689 117.442 1.00 84.99 ? 65  GLU A O     1 
ATOM   409   C  CB    . GLU A  1 65  ? 124.087 135.933 117.014 1.00 84.99 ? 65  GLU A CB    1 
ATOM   410   N  N     . ASN A  1 66  ? 123.569 133.235 119.216 1.00 78.61 ? 66  ASN A N     1 
ATOM   411   C  CA    . ASN A  1 66  ? 123.242 131.813 119.289 1.00 78.61 ? 66  ASN A CA    1 
ATOM   412   C  C     . ASN A  1 66  ? 122.734 131.482 120.687 1.00 78.61 ? 66  ASN A C     1 
ATOM   413   O  O     . ASN A  1 66  ? 123.104 130.474 121.290 1.00 78.61 ? 66  ASN A O     1 
ATOM   414   C  CB    . ASN A  1 66  ? 124.459 130.960 118.934 1.00 78.61 ? 66  ASN A CB    1 
ATOM   415   C  CG    . ASN A  1 66  ? 124.955 131.196 117.518 1.00 78.61 ? 66  ASN A CG    1 
ATOM   416   O  OD1   . ASN A  1 66  ? 126.123 130.955 117.215 1.00 78.61 ? 66  ASN A OD1   1 
ATOM   417   N  ND2   . ASN A  1 66  ? 124.057 131.604 116.630 1.00 78.61 ? 66  ASN A ND2   1 
ATOM   418   N  N     . GLN A  1 67  ? 121.875 132.348 121.220 1.00 77.47 ? 67  GLN A N     1 
ATOM   419   C  CA    . GLN A  1 67  ? 121.439 132.281 122.607 1.00 77.47 ? 67  GLN A CA    1 
ATOM   420   C  C     . GLN A  1 67  ? 120.115 131.539 122.771 1.00 77.47 ? 67  GLN A C     1 
ATOM   421   O  O     . GLN A  1 67  ? 119.564 131.502 123.875 1.00 77.47 ? 67  GLN A O     1 
ATOM   422   C  CB    . GLN A  1 67  ? 121.331 133.701 123.175 1.00 77.47 ? 67  GLN A CB    1 
ATOM   423   C  CG    . GLN A  1 67  ? 121.625 133.843 124.667 1.00 77.47 ? 67  GLN A CG    1 
ATOM   424   C  CD    . GLN A  1 67  ? 121.386 135.252 125.173 1.00 77.47 ? 67  GLN A CD    1 
ATOM   425   O  OE1   . GLN A  1 67  ? 121.525 136.222 124.428 1.00 77.47 ? 67  GLN A OE1   1 
ATOM   426   N  NE2   . GLN A  1 67  ? 121.027 135.372 126.445 1.00 77.47 ? 67  GLN A NE2   1 
ATOM   427   N  N     . ASN A  1 68  ? 119.601 130.930 121.705 1.00 62.70 ? 68  ASN A N     1 
ATOM   428   C  CA    . ASN A  1 68  ? 118.277 130.328 121.728 1.00 62.70 ? 68  ASN A CA    1 
ATOM   429   C  C     . ASN A  1 68  ? 118.290 128.811 121.612 1.00 62.70 ? 68  ASN A C     1 
ATOM   430   O  O     . ASN A  1 68  ? 117.219 128.198 121.626 1.00 62.70 ? 68  ASN A O     1 
ATOM   431   C  CB    . ASN A  1 68  ? 117.419 130.923 120.608 1.00 62.70 ? 68  ASN A CB    1 
ATOM   432   C  CG    . ASN A  1 68  ? 118.153 130.976 119.286 1.00 62.70 ? 68  ASN A CG    1 
ATOM   433   O  OD1   . ASN A  1 68  ? 119.309 130.564 119.190 1.00 62.70 ? 68  ASN A OD1   1 
ATOM   434   N  ND2   . ASN A  1 68  ? 117.486 131.485 118.257 1.00 62.70 ? 68  ASN A ND2   1 
ATOM   435   N  N     . LEU A  1 69  ? 119.458 128.189 121.496 1.00 54.17 ? 69  LEU A N     1 
ATOM   436   C  CA    . LEU A  1 69  ? 119.532 126.740 121.364 1.00 54.17 ? 69  LEU A CA    1 
ATOM   437   C  C     . LEU A  1 69  ? 119.520 126.082 122.737 1.00 54.17 ? 69  LEU A C     1 
ATOM   438   O  O     . LEU A  1 69  ? 120.280 126.472 123.626 1.00 54.17 ? 69  LEU A O     1 
ATOM   439   C  CB    . LEU A  1 69  ? 120.790 126.344 120.598 1.00 54.17 ? 69  LEU A CB    1 
ATOM   440   C  CG    . LEU A  1 69  ? 120.805 126.753 119.128 1.00 54.17 ? 69  LEU A CG    1 
ATOM   441   C  CD1   . LEU A  1 69  ? 122.191 127.197 118.719 1.00 54.17 ? 69  LEU A CD1   1 
ATOM   442   C  CD2   . LEU A  1 69  ? 120.331 125.607 118.257 1.00 54.17 ? 69  LEU A CD2   1 
ATOM   443   N  N     . TYR A  1 70  ? 118.667 125.074 122.902 1.00 50.43 ? 70  TYR A N     1 
ATOM   444   C  CA    . TYR A  1 70  ? 118.505 124.376 124.166 1.00 50.43 ? 70  TYR A CA    1 
ATOM   445   C  C     . TYR A  1 70  ? 118.600 122.876 123.938 1.00 50.43 ? 70  TYR A C     1 
ATOM   446   O  O     . TYR A  1 70  ? 118.212 122.371 122.882 1.00 50.43 ? 70  TYR A O     1 
ATOM   447   C  CB    . TYR A  1 70  ? 117.165 124.714 124.810 1.00 50.43 ? 70  TYR A CB    1 
ATOM   448   C  CG    . TYR A  1 70  ? 117.039 126.152 125.251 1.00 50.43 ? 70  TYR A CG    1 
ATOM   449   C  CD1   . TYR A  1 70  ? 118.075 126.786 125.921 1.00 50.43 ? 70  TYR A CD1   1 
ATOM   450   C  CD2   . TYR A  1 70  ? 115.883 126.876 124.997 1.00 50.43 ? 70  TYR A CD2   1 
ATOM   451   C  CE1   . TYR A  1 70  ? 117.968 128.101 126.326 1.00 50.43 ? 70  TYR A CE1   1 
ATOM   452   C  CE2   . TYR A  1 70  ? 115.765 128.192 125.398 1.00 50.43 ? 70  TYR A CE2   1 
ATOM   453   C  CZ    . TYR A  1 70  ? 116.811 128.799 126.062 1.00 50.43 ? 70  TYR A CZ    1 
ATOM   454   O  OH    . TYR A  1 70  ? 116.697 130.108 126.463 1.00 50.43 ? 70  TYR A OH    1 
ATOM   455   N  N     . LEU A  1 71  ? 119.110 122.165 124.939 1.00 44.97 ? 71  LEU A N     1 
ATOM   456   C  CA    . LEU A  1 71  ? 119.309 120.726 124.867 1.00 44.97 ? 71  LEU A CA    1 
ATOM   457   C  C     . LEU A  1 71  ? 118.325 120.010 125.780 1.00 44.97 ? 71  LEU A C     1 
ATOM   458   O  O     . LEU A  1 71  ? 118.055 120.458 126.899 1.00 44.97 ? 71  LEU A O     1 
ATOM   459   C  CB    . LEU A  1 71  ? 120.739 120.355 125.255 1.00 44.97 ? 71  LEU A CB    1 
ATOM   460   C  CG    . LEU A  1 71  ? 121.830 121.185 124.584 1.00 44.97 ? 71  LEU A CG    1 
ATOM   461   C  CD1   . LEU A  1 71  ? 123.186 120.771 125.093 1.00 44.97 ? 71  LEU A CD1   1 
ATOM   462   C  CD2   . LEU A  1 71  ? 121.768 121.031 123.085 1.00 44.97 ? 71  LEU A CD2   1 
ATOM   463   N  N     . VAL A  1 72  ? 117.791 118.894 125.289 1.00 39.07 ? 72  VAL A N     1 
ATOM   464   C  CA    . VAL A  1 72  ? 116.811 118.081 125.995 1.00 39.07 ? 72  VAL A CA    1 
ATOM   465   C  C     . VAL A  1 72  ? 117.301 116.641 125.982 1.00 39.07 ? 72  VAL A C     1 
ATOM   466   O  O     . VAL A  1 72  ? 117.560 116.078 124.910 1.00 39.07 ? 72  VAL A O     1 
ATOM   467   C  CB    . VAL A  1 72  ? 115.416 118.185 125.349 1.00 39.07 ? 72  VAL A CB    1 
ATOM   468   C  CG1   . VAL A  1 72  ? 114.466 117.188 125.975 1.00 39.07 ? 72  VAL A CG1   1 
ATOM   469   C  CG2   . VAL A  1 72  ? 114.859 119.589 125.479 1.00 39.07 ? 72  VAL A CG2   1 
ATOM   470   N  N     . GLY A  1 73  ? 117.444 116.059 127.169 1.00 45.00 ? 73  GLY A N     1 
ATOM   471   C  CA    . GLY A  1 73  ? 117.719 114.644 127.332 1.00 45.00 ? 73  GLY A CA    1 
ATOM   472   C  C     . GLY A  1 73  ? 116.834 114.104 128.434 1.00 45.00 ? 73  GLY A C     1 
ATOM   473   O  O     . GLY A  1 73  ? 115.858 114.770 128.783 1.00 45.00 ? 73  GLY A O     1 
ATOM   474   N  N     . ALA A  1 74  ? 117.140 112.927 128.982 1.00 50.97 ? 74  ALA A N     1 
ATOM   475   C  CA    . ALA A  1 74  ? 116.440 112.406 130.154 1.00 50.97 ? 74  ALA A CA    1 
ATOM   476   C  C     . ALA A  1 74  ? 117.302 111.334 130.810 1.00 50.97 ? 74  ALA A C     1 
ATOM   477   O  O     . ALA A  1 74  ? 118.420 111.051 130.373 1.00 50.97 ? 74  ALA A O     1 
ATOM   478   C  CB    . ALA A  1 74  ? 115.061 111.843 129.802 1.00 50.97 ? 74  ALA A CB    1 
ATOM   479   N  N     . SER A  1 75  ? 116.764 110.737 131.873 1.00 58.13 ? 75  SER A N     1 
ATOM   480   C  CA    . SER A  1 75  ? 117.416 109.662 132.602 1.00 58.13 ? 75  SER A CA    1 
ATOM   481   C  C     . SER A  1 75  ? 116.886 108.312 132.124 1.00 58.13 ? 75  SER A C     1 
ATOM   482   O  O     . SER A  1 75  ? 115.923 108.238 131.360 1.00 58.13 ? 75  SER A O     1 
ATOM   483   C  CB    . SER A  1 75  ? 117.207 109.840 134.105 1.00 58.13 ? 75  SER A CB    1 
ATOM   484   O  OG    . SER A  1 75  ? 115.878 110.244 134.386 1.00 58.13 ? 75  SER A OG    1 
ATOM   485   N  N     . LYS A  1 76  ? 117.500 107.231 132.618 1.00 62.88 ? 76  LYS A N     1 
ATOM   486   C  CA    . LYS A  1 76  ? 117.273 105.899 132.054 1.00 62.88 ? 76  LYS A CA    1 
ATOM   487   C  C     . LYS A  1 76  ? 115.880 105.368 132.369 1.00 62.88 ? 76  LYS A C     1 
ATOM   488   O  O     . LYS A  1 76  ? 115.228 104.773 131.500 1.00 62.88 ? 76  LYS A O     1 
ATOM   489   C  CB    . LYS A  1 76  ? 118.330 104.926 132.572 1.00 62.88 ? 76  LYS A CB    1 
ATOM   490   C  CG    . LYS A  1 76  ? 119.728 105.166 132.034 1.00 62.88 ? 76  LYS A CG    1 
ATOM   491   C  CD    . LYS A  1 76  ? 120.738 104.241 132.698 1.00 62.88 ? 76  LYS A CD    1 
ATOM   492   C  CE    . LYS A  1 76  ? 120.334 102.784 132.558 1.00 62.88 ? 76  LYS A CE    1 
ATOM   493   N  NZ    . LYS A  1 76  ? 121.330 101.879 133.188 1.00 62.88 ? 76  LYS A NZ    1 
ATOM   494   N  N     . ILE A  1 77  ? 115.413 105.561 133.607 1.00 56.08 ? 77  ILE A N     1 
ATOM   495   C  CA    . ILE A  1 77  ? 114.078 105.108 133.988 1.00 56.08 ? 77  ILE A CA    1 
ATOM   496   C  C     . ILE A  1 77  ? 113.018 105.905 133.241 1.00 56.08 ? 77  ILE A C     1 
ATOM   497   O  O     . ILE A  1 77  ? 111.964 105.366 132.872 1.00 56.08 ? 77  ILE A O     1 
ATOM   498   C  CB    . ILE A  1 77  ? 113.907 105.217 135.514 1.00 56.08 ? 77  ILE A CB    1 
ATOM   499   C  CG1   . ILE A  1 77  ? 115.116 104.610 136.223 1.00 56.08 ? 77  ILE A CG1   1 
ATOM   500   C  CG2   . ILE A  1 77  ? 112.639 104.513 135.971 1.00 56.08 ? 77  ILE A CG2   1 
ATOM   501   C  CD1   . ILE A  1 77  ? 115.514 105.342 137.484 1.00 56.08 ? 77  ILE A CD1   1 
ATOM   502   N  N     . ARG A  1 78  ? 113.306 107.178 132.959 1.00 54.20 ? 78  ARG A N     1 
ATOM   503   C  CA    . ARG A  1 78  ? 112.417 107.989 132.138 1.00 54.20 ? 78  ARG A CA    1 
ATOM   504   C  C     . ARG A  1 78  ? 112.343 107.463 130.711 1.00 54.20 ? 78  ARG A C     1 
ATOM   505   O  O     . ARG A  1 78  ? 111.260 107.434 130.118 1.00 54.20 ? 78  ARG A O     1 
ATOM   506   C  CB    . ARG A  1 78  ? 112.879 109.444 132.148 1.00 54.20 ? 78  ARG A CB    1 
ATOM   507   C  CG    . ARG A  1 78  ? 111.899 110.402 131.503 1.00 54.20 ? 78  ARG A CG    1 
ATOM   508   C  CD    . ARG A  1 78  ? 110.531 110.292 132.143 1.00 54.20 ? 78  ARG A CD    1 
ATOM   509   N  NE    . ARG A  1 78  ? 109.485 110.890 131.321 1.00 54.20 ? 78  ARG A NE    1 
ATOM   510   C  CZ    . ARG A  1 78  ? 108.757 110.221 130.434 1.00 54.20 ? 78  ARG A CZ    1 
ATOM   511   N  NH1   . ARG A  1 78  ? 108.960 108.926 130.248 1.00 54.20 ? 78  ARG A NH1   1 
ATOM   512   N  NH2   . ARG A  1 78  ? 107.824 110.848 129.734 1.00 54.20 ? 78  ARG A NH2   1 
ATOM   513   N  N     . MET A  1 79  ? 113.472 107.014 130.153 1.00 53.52 ? 79  MET A N     1 
ATOM   514   C  CA    . MET A  1 79  ? 113.442 106.489 128.792 1.00 53.52 ? 79  MET A CA    1 
ATOM   515   C  C     . MET A  1 79  ? 112.741 105.140 128.738 1.00 53.52 ? 79  MET A C     1 
ATOM   516   O  O     . MET A  1 79  ? 112.078 104.826 127.746 1.00 53.52 ? 79  MET A O     1 
ATOM   517   C  CB    . MET A  1 79  ? 114.850 106.380 128.208 1.00 53.52 ? 79  MET A CB    1 
ATOM   518   C  CG    . MET A  1 79  ? 115.604 107.688 128.189 1.00 53.52 ? 79  MET A CG    1 
ATOM   519   S  SD    . MET A  1 79  ? 114.624 109.051 127.559 1.00 53.52 ? 79  MET A SD    1 
ATOM   520   C  CE    . MET A  1 79  ? 114.475 108.617 125.847 1.00 53.52 ? 79  MET A CE    1 
ATOM   521   N  N     . LEU A  1 80  ? 112.854 104.336 129.798 1.00 53.57 ? 80  LEU A N     1 
ATOM   522   C  CA    . LEU A  1 80  ? 112.139 103.062 129.813 1.00 53.57 ? 80  LEU A CA    1 
ATOM   523   C  C     . LEU A  1 80  ? 110.634 103.269 129.959 1.00 53.57 ? 80  LEU A C     1 
ATOM   524   O  O     . LEU A  1 80  ? 109.841 102.574 129.308 1.00 53.57 ? 80  LEU A O     1 
ATOM   525   C  CB    . LEU A  1 80  ? 112.678 102.167 130.926 1.00 53.57 ? 80  LEU A CB    1 
ATOM   526   C  CG    . LEU A  1 80  ? 114.128 101.712 130.755 1.00 53.57 ? 80  LEU A CG    1 
ATOM   527   C  CD1   . LEU A  1 80  ? 114.530 100.773 131.876 1.00 53.57 ? 80  LEU A CD1   1 
ATOM   528   C  CD2   . LEU A  1 80  ? 114.337 101.056 129.404 1.00 53.57 ? 80  LEU A CD2   1 
ATOM   529   N  N     . LEU A  1 81  ? 110.219 104.236 130.784 1.00 53.65 ? 81  LEU A N     1 
ATOM   530   C  CA    . LEU A  1 81  ? 108.796 104.548 130.881 1.00 53.65 ? 81  LEU A CA    1 
ATOM   531   C  C     . LEU A  1 81  ? 108.268 105.176 129.595 1.00 53.65 ? 81  LEU A C     1 
ATOM   532   O  O     . LEU A  1 81  ? 107.127 104.911 129.199 1.00 53.65 ? 81  LEU A O     1 
ATOM   533   C  CB    . LEU A  1 81  ? 108.537 105.468 132.071 1.00 53.65 ? 81  LEU A CB    1 
ATOM   534   C  CG    . LEU A  1 81  ? 108.704 104.829 133.449 1.00 53.65 ? 81  LEU A CG    1 
ATOM   535   C  CD1   . LEU A  1 81  ? 108.535 105.869 134.542 1.00 53.65 ? 81  LEU A CD1   1 
ATOM   536   C  CD2   . LEU A  1 81  ? 107.719 103.688 133.634 1.00 53.65 ? 81  LEU A CD2   1 
ATOM   537   N  N     . GLY A  1 82  ? 109.090 105.975 128.910 1.00 51.81 ? 82  GLY A N     1 
ATOM   538   C  CA    . GLY A  1 82  ? 108.691 106.498 127.617 1.00 51.81 ? 82  GLY A CA    1 
ATOM   539   C  C     . GLY A  1 82  ? 108.624 105.435 126.539 1.00 51.81 ? 82  GLY A C     1 
ATOM   540   O  O     . GLY A  1 82  ? 107.806 105.532 125.623 1.00 51.81 ? 82  GLY A O     1 
ATOM   541   N  N     . ALA A  1 83  ? 109.477 104.412 126.630 1.00 50.78 ? 83  ALA A N     1 
ATOM   542   C  CA    . ALA A  1 83  ? 109.379 103.283 125.714 1.00 50.78 ? 83  ALA A CA    1 
ATOM   543   C  C     . ALA A  1 83  ? 108.141 102.447 125.997 1.00 50.78 ? 83  ALA A C     1 
ATOM   544   O  O     . ALA A  1 83  ? 107.577 101.849 125.075 1.00 50.78 ? 83  ALA A O     1 
ATOM   545   C  CB    . ALA A  1 83  ? 110.633 102.419 125.807 1.00 50.78 ? 83  ALA A CB    1 
ATOM   546   N  N     . GLU A  1 84  ? 107.722 102.375 127.262 1.00 54.75 ? 84  GLU A N     1 
ATOM   547   C  CA    . GLU A  1 84  ? 106.433 101.764 127.573 1.00 54.75 ? 84  GLU A CA    1 
ATOM   548   C  C     . GLU A  1 84  ? 105.285 102.587 127.000 1.00 54.75 ? 84  GLU A C     1 
ATOM   549   O  O     . GLU A  1 84  ? 104.301 102.030 126.501 1.00 54.75 ? 84  GLU A O     1 
ATOM   550   C  CB    . GLU A  1 84  ? 106.274 101.610 129.086 1.00 54.75 ? 84  GLU A CB    1 
ATOM   551   C  CG    . GLU A  1 84  ? 104.965 100.957 129.513 1.00 54.75 ? 84  GLU A CG    1 
ATOM   552   C  CD    . GLU A  1 84  ? 104.861 100.768 131.013 1.00 54.75 ? 84  GLU A CD    1 
ATOM   553   O  OE1   . GLU A  1 84  ? 105.283 99.704  131.512 1.00 54.75 ? 84  GLU A OE1   1 
ATOM   554   O  OE2   . GLU A  1 84  ? 104.352 101.683 131.693 1.00 54.75 ? 84  GLU A OE2   1 
ATOM   555   N  N     . ALA A  1 85  ? 105.406 103.916 127.052 1.00 51.97 ? 85  ALA A N     1 
ATOM   556   C  CA    . ALA A  1 85  ? 104.336 104.785 126.566 1.00 51.97 ? 85  ALA A CA    1 
ATOM   557   C  C     . ALA A  1 85  ? 104.237 104.767 125.044 1.00 51.97 ? 85  ALA A C     1 
ATOM   558   O  O     . ALA A  1 85  ? 103.136 104.850 124.489 1.00 51.97 ? 85  ALA A O     1 
ATOM   559   C  CB    . ALA A  1 85  ? 104.552 106.210 127.070 1.00 51.97 ? 85  ALA A CB    1 
ATOM   560   N  N     . VAL A  1 86  ? 105.374 104.672 124.354 1.00 46.53 ? 86  VAL A N     1 
ATOM   561   C  CA    . VAL A  1 86  ? 105.368 104.659 122.893 1.00 46.53 ? 86  VAL A CA    1 
ATOM   562   C  C     . VAL A  1 86  ? 104.867 103.316 122.378 1.00 46.53 ? 86  VAL A C     1 
ATOM   563   O  O     . VAL A  1 86  ? 103.985 103.251 121.514 1.00 46.53 ? 86  VAL A O     1 
ATOM   564   C  CB    . VAL A  1 86  ? 106.770 104.992 122.351 1.00 46.53 ? 86  VAL A CB    1 
ATOM   565   C  CG1   . VAL A  1 86  ? 106.915 104.566 120.902 1.00 46.53 ? 86  VAL A CG1   1 
ATOM   566   C  CG2   . VAL A  1 86  ? 107.047 106.474 122.486 1.00 46.53 ? 86  VAL A CG2   1 
ATOM   567   N  N     . GLY A  1 87  ? 105.396 102.226 122.924 1.00 47.85 ? 87  GLY A N     1 
ATOM   568   C  CA    . GLY A  1 87  ? 105.002 100.907 122.476 1.00 47.85 ? 87  GLY A CA    1 
ATOM   569   C  C     . GLY A  1 87  ? 106.036 100.240 121.596 1.00 47.85 ? 87  GLY A C     1 
ATOM   570   O  O     . GLY A  1 87  ? 105.694 99.683  120.549 1.00 47.85 ? 87  GLY A O     1 
ATOM   571   N  N     . LEU A  1 88  ? 107.303 100.317 121.995 1.00 46.01 ? 88  LEU A N     1 
ATOM   572   C  CA    . LEU A  1 88  ? 108.363 99.613  121.290 1.00 46.01 ? 88  LEU A CA    1 
ATOM   573   C  C     . LEU A  1 88  ? 108.180 98.108  121.419 1.00 46.01 ? 88  LEU A C     1 
ATOM   574   O  O     . LEU A  1 88  ? 107.749 97.598  122.455 1.00 46.01 ? 88  LEU A O     1 
ATOM   575   C  CB    . LEU A  1 88  ? 109.731 100.008 121.839 1.00 46.01 ? 88  LEU A CB    1 
ATOM   576   C  CG    . LEU A  1 88  ? 110.194 101.449 121.651 1.00 46.01 ? 88  LEU A CG    1 
ATOM   577   C  CD1   . LEU A  1 88  ? 111.592 101.613 122.208 1.00 46.01 ? 88  LEU A CD1   1 
ATOM   578   C  CD2   . LEU A  1 88  ? 110.155 101.839 120.189 1.00 46.01 ? 88  LEU A CD2   1 
ATOM   579   N  N     . VAL A  1 89  ? 108.512 97.394  120.347 1.00 45.68 ? 89  VAL A N     1 
ATOM   580   C  CA    . VAL A  1 89  ? 108.393 95.942  120.332 1.00 45.68 ? 89  VAL A CA    1 
ATOM   581   C  C     . VAL A  1 89  ? 109.787 95.336  120.334 1.00 45.68 ? 89  VAL A C     1 
ATOM   582   O  O     . VAL A  1 89  ? 110.500 95.383  119.327 1.00 45.68 ? 89  VAL A O     1 
ATOM   583   C  CB    . VAL A  1 89  ? 107.577 95.461  119.122 1.00 45.68 ? 89  VAL A CB    1 
ATOM   584   C  CG1   . VAL A  1 89  ? 107.500 93.951  119.106 1.00 45.68 ? 89  VAL A CG1   1 
ATOM   585   C  CG2   . VAL A  1 89  ? 106.187 96.057  119.165 1.00 45.68 ? 89  VAL A CG2   1 
ATOM   586   N  N     . LYS A  1 90  ? 110.186 94.772  121.467 1.00 50.37 ? 90  LYS A N     1 
ATOM   587   C  CA    . LYS A  1 90  ? 111.522 94.224  121.618 1.00 50.37 ? 90  LYS A CA    1 
ATOM   588   C  C     . LYS A  1 90  ? 111.477 92.703  121.719 1.00 50.37 ? 90  LYS A C     1 
ATOM   589   O  O     . LYS A  1 90  ? 110.422 92.089  121.908 1.00 50.37 ? 90  LYS A O     1 
ATOM   590   C  CB    . LYS A  1 90  ? 112.207 94.820  122.845 1.00 50.37 ? 90  LYS A CB    1 
ATOM   591   C  CG    . LYS A  1 90  ? 112.162 96.332  122.900 1.00 50.37 ? 90  LYS A CG    1 
ATOM   592   C  CD    . LYS A  1 90  ? 113.115 96.949  121.899 1.00 50.37 ? 90  LYS A CD    1 
ATOM   593   C  CE    . LYS A  1 90  ? 114.556 96.647  122.256 1.00 50.37 ? 90  LYS A CE    1 
ATOM   594   N  NZ    . LYS A  1 90  ? 115.507 97.298  121.315 1.00 50.37 ? 90  LYS A NZ    1 
ATOM   595   N  N     . GLU A  1 91  ? 112.657 92.097  121.612 1.00 57.45 ? 91  GLU A N     1 
ATOM   596   C  CA    . GLU A  1 91  ? 112.800 90.648  121.582 1.00 57.45 ? 91  GLU A CA    1 
ATOM   597   C  C     . GLU A  1 91  ? 112.889 90.103  123.001 1.00 57.45 ? 91  GLU A C     1 
ATOM   598   O  O     . GLU A  1 91  ? 113.786 90.483  123.761 1.00 57.45 ? 91  GLU A O     1 
ATOM   599   C  CB    . GLU A  1 91  ? 114.039 90.252  120.782 1.00 57.45 ? 91  GLU A CB    1 
ATOM   600   C  CG    . GLU A  1 91  ? 114.165 88.758  120.541 1.00 57.45 ? 91  GLU A CG    1 
ATOM   601   N  N     . CYS A  1 92  ? 111.967 89.212  123.354 1.00 62.18 ? 92  CYS A N     1 
ATOM   602   C  CA    . CYS A  1 92  ? 112.024 88.542  124.642 1.00 62.18 ? 92  CYS A CA    1 
ATOM   603   C  C     . CYS A  1 92  ? 113.100 87.457  124.641 1.00 62.18 ? 92  CYS A C     1 
ATOM   604   O  O     . CYS A  1 92  ? 113.743 87.171  123.628 1.00 62.18 ? 92  CYS A O     1 
ATOM   605   C  CB    . CYS A  1 92  ? 110.671 87.933  124.998 1.00 62.18 ? 92  CYS A CB    1 
ATOM   606   S  SG    . CYS A  1 92  ? 109.385 89.127  125.364 1.00 62.18 ? 92  CYS A SG    1 
ATOM   607   N  N     . ASN A  1 93  ? 113.286 86.844  125.812 1.00 63.36 ? 93  ASN A N     1 
ATOM   608   C  CA    . ASN A  1 93  ? 114.294 85.803  125.967 1.00 63.36 ? 93  ASN A CA    1 
ATOM   609   C  C     . ASN A  1 93  ? 113.909 84.506  125.267 1.00 63.36 ? 93  ASN A C     1 
ATOM   610   O  O     . ASN A  1 93  ? 114.792 83.693  124.974 1.00 63.36 ? 93  ASN A O     1 
ATOM   611   C  CB    . ASN A  1 93  ? 114.540 85.534  127.450 1.00 63.36 ? 93  ASN A CB    1 
ATOM   612   C  CG    . ASN A  1 93  ? 115.722 86.307  127.992 1.00 63.36 ? 93  ASN A CG    1 
ATOM   613   O  OD1   . ASN A  1 93  ? 116.434 86.976  127.245 1.00 63.36 ? 93  ASN A OD1   1 
ATOM   614   N  ND2   . ASN A  1 93  ? 115.934 86.225  129.301 1.00 63.36 ? 93  ASN A ND2   1 
ATOM   615   N  N     . ASP A  1 94  ? 112.619 84.291  124.995 1.00 63.83 ? 94  ASP A N     1 
ATOM   616   C  CA    . ASP A  1 94  ? 112.149 83.089  124.314 1.00 63.83 ? 94  ASP A CA    1 
ATOM   617   C  C     . ASP A  1 94  ? 111.969 83.289  122.811 1.00 63.83 ? 94  ASP A C     1 
ATOM   618   O  O     . ASP A  1 94  ? 111.096 82.644  122.210 1.00 63.83 ? 94  ASP A O     1 
ATOM   619   C  CB    . ASP A  1 94  ? 110.856 82.585  124.964 1.00 63.83 ? 94  ASP A CB    1 
ATOM   620   C  CG    . ASP A  1 94  ? 109.686 83.558  124.822 1.00 63.83 ? 94  ASP A CG    1 
ATOM   621   O  OD1   . ASP A  1 94  ? 109.901 84.746  124.503 1.00 63.83 ? 94  ASP A OD1   1 
ATOM   622   O  OD2   . ASP A  1 94  ? 108.535 83.122  125.036 1.00 63.83 ? 94  ASP A OD2   1 
ATOM   623   N  N     . ASN A  1 95  ? 112.775 84.175  122.207 1.00 59.49 ? 95  ASN A N     1 
ATOM   624   C  CA    . ASN A  1 95  ? 112.788 84.467  120.766 1.00 59.49 ? 95  ASN A CA    1 
ATOM   625   C  C     . ASN A  1 95  ? 111.432 84.955  120.259 1.00 59.49 ? 95  ASN A C     1 
ATOM   626   O  O     . ASN A  1 95  ? 110.973 84.548  119.190 1.00 59.49 ? 95  ASN A O     1 
ATOM   627   C  CB    . ASN A  1 95  ? 113.267 83.261  119.949 1.00 59.49 ? 95  ASN A CB    1 
ATOM   628   C  CG    . ASN A  1 95  ? 114.774 83.181  119.863 1.00 59.49 ? 95  ASN A CG    1 
ATOM   629   O  OD1   . ASN A  1 95  ? 115.472 83.328  120.865 1.00 59.49 ? 95  ASN A OD1   1 
ATOM   630   N  ND2   . ASN A  1 95  ? 115.287 82.948  118.660 1.00 59.49 ? 95  ASN A ND2   1 
ATOM   631   N  N     . THR A  1 96  ? 110.785 85.829  121.022 1.00 59.10 ? 96  THR A N     1 
ATOM   632   C  CA    . THR A  1 96  ? 109.475 86.358  120.685 1.00 59.10 ? 96  THR A CA    1 
ATOM   633   C  C     . THR A  1 96  ? 109.519 87.880  120.780 1.00 59.10 ? 96  THR A C     1 
ATOM   634   O  O     . THR A  1 96  ? 110.163 88.450  121.663 1.00 59.10 ? 96  THR A O     1 
ATOM   635   C  CB    . THR A  1 96  ? 108.408 85.769  121.622 1.00 59.10 ? 96  THR A CB    1 
ATOM   636   O  OG1   . THR A  1 96  ? 108.527 84.342  121.631 1.00 59.10 ? 96  THR A OG1   1 
ATOM   637   C  CG2   . THR A  1 96  ? 107.006 86.113  121.154 1.00 59.10 ? 96  THR A CG2   1 
ATOM   638   N  N     . MET A  1 97  ? 108.833 88.546  119.852 1.00 50.51 ? 97  MET A N     1 
ATOM   639   C  CA    . MET A  1 97  ? 108.790 90.004  119.789 1.00 50.51 ? 97  MET A CA    1 
ATOM   640   C  C     . MET A  1 97  ? 107.530 90.469  120.511 1.00 50.51 ? 97  MET A C     1 
ATOM   641   O  O     . MET A  1 97  ? 106.421 90.341  119.987 1.00 50.51 ? 97  MET A O     1 
ATOM   642   C  CB    . MET A  1 97  ? 108.809 90.491  118.343 1.00 50.51 ? 97  MET A CB    1 
ATOM   643   C  CG    . MET A  1 97  ? 109.911 89.892  117.494 1.00 50.51 ? 97  MET A CG    1 
ATOM   644   S  SD    . MET A  1 97  ? 111.559 90.350  118.049 1.00 50.51 ? 97  MET A SD    1 
ATOM   645   C  CE    . MET A  1 97  ? 111.547 92.107  117.719 1.00 50.51 ? 97  MET A CE    1 
ATOM   646   N  N     . ARG A  1 98  ? 107.705 91.009  121.712 1.00 52.76 ? 98  ARG A N     1 
ATOM   647   C  CA    . ARG A  1 98  ? 106.598 91.520  122.506 1.00 52.76 ? 98  ARG A CA    1 
ATOM   648   C  C     . ARG A  1 98  ? 106.784 93.004  122.786 1.00 52.76 ? 98  ARG A C     1 
ATOM   649   O  O     . ARG A  1 98  ? 107.891 93.540  122.704 1.00 52.76 ? 98  ARG A O     1 
ATOM   650   C  CB    . ARG A  1 98  ? 106.476 90.761  123.828 1.00 52.76 ? 98  ARG A CB    1 
ATOM   651   C  CG    . ARG A  1 98  ? 106.165 89.285  123.694 1.00 52.76 ? 98  ARG A CG    1 
ATOM   652   C  CD    . ARG A  1 98  ? 105.565 88.745  124.983 1.00 52.76 ? 98  ARG A CD    1 
ATOM   653   N  NE    . ARG A  1 98  ? 105.366 87.301  124.927 1.00 52.76 ? 98  ARG A NE    1 
ATOM   654   C  CZ    . ARG A  1 98  ? 104.280 86.714  124.437 1.00 52.76 ? 98  ARG A CZ    1 
ATOM   655   N  NH1   . ARG A  1 98  ? 103.282 87.448  123.969 1.00 52.76 ? 98  ARG A NH1   1 
ATOM   656   N  NH2   . ARG A  1 98  ? 104.189 85.391  124.424 1.00 52.76 ? 98  ARG A NH2   1 
ATOM   657   N  N     . ALA A  1 99  ? 105.679 93.662  123.126 1.00 49.65 ? 99  ALA A N     1 
ATOM   658   C  CA    . ALA A  1 99  ? 105.717 95.074  123.472 1.00 49.65 ? 99  ALA A CA    1 
ATOM   659   C  C     . ALA A  1 99  ? 106.457 95.282  124.790 1.00 49.65 ? 99  ALA A C     1 
ATOM   660   O  O     . ALA A  1 99  ? 106.421 94.446  125.695 1.00 49.65 ? 99  ALA A O     1 
ATOM   661   C  CB    . ALA A  1 99  ? 104.303 95.642  123.568 1.00 49.65 ? 99  ALA A CB    1 
ATOM   662   N  N     . PHE A  1 100 ? 107.144 96.416  124.886 1.00 51.94 ? 100 PHE A N     1 
ATOM   663   C  CA    . PHE A  1 100 ? 107.996 96.707  126.029 1.00 51.94 ? 100 PHE A CA    1 
ATOM   664   C  C     . PHE A  1 100 ? 107.174 97.363  127.130 1.00 51.94 ? 100 PHE A C     1 
ATOM   665   O  O     . PHE A  1 100 ? 106.506 98.375  126.895 1.00 51.94 ? 100 PHE A O     1 
ATOM   666   C  CB    . PHE A  1 100 ? 109.156 97.611  125.622 1.00 51.94 ? 100 PHE A CB    1 
ATOM   667   C  CG    . PHE A  1 100 ? 110.113 97.900  126.737 1.00 51.94 ? 100 PHE A CG    1 
ATOM   668   C  CD1   . PHE A  1 100 ? 111.011 96.938  127.157 1.00 51.94 ? 100 PHE A CD1   1 
ATOM   669   C  CD2   . PHE A  1 100 ? 110.116 99.133  127.365 1.00 51.94 ? 100 PHE A CD2   1 
ATOM   670   C  CE1   . PHE A  1 100 ? 111.889 97.194  128.186 1.00 51.94 ? 100 PHE A CE1   1 
ATOM   671   C  CE2   . PHE A  1 100 ? 110.997 99.397  128.393 1.00 51.94 ? 100 PHE A CE2   1 
ATOM   672   C  CZ    . PHE A  1 100 ? 111.884 98.425  128.802 1.00 51.94 ? 100 PHE A CZ    1 
ATOM   673   N  N     . THR A  1 101 ? 107.224 96.785  128.326 1.00 55.62 ? 101 THR A N     1 
ATOM   674   C  CA    . THR A  1 101 ? 106.619 97.362  129.515 1.00 55.62 ? 101 THR A CA    1 
ATOM   675   C  C     . THR A  1 101 ? 107.645 97.379  130.639 1.00 55.62 ? 101 THR A C     1 
ATOM   676   O  O     . THR A  1 101 ? 108.543 96.535  130.691 1.00 55.62 ? 101 THR A O     1 
ATOM   677   C  CB    . THR A  1 101 ? 105.377 96.580  129.956 1.00 55.62 ? 101 THR A CB    1 
ATOM   678   O  OG1   . THR A  1 101 ? 105.638 95.175  129.866 1.00 55.62 ? 101 THR A OG1   1 
ATOM   679   C  CG2   . THR A  1 101 ? 104.190 96.927  129.074 1.00 55.62 ? 101 THR A CG2   1 
ATOM   680   N  N     . TYR A  1 102 ? 107.509 98.351  131.542 1.00 60.94 ? 102 TYR A N     1 
ATOM   681   C  CA    . TYR A  1 102 ? 108.493 98.498  132.608 1.00 60.94 ? 102 TYR A CA    1 
ATOM   682   C  C     . TYR A  1 102 ? 108.327 97.451  133.702 1.00 60.94 ? 102 TYR A C     1 
ATOM   683   O  O     . TYR A  1 102 ? 109.309 97.096  134.363 1.00 60.94 ? 102 TYR A O     1 
ATOM   684   C  CB    . TYR A  1 102 ? 108.414 99.899  133.213 1.00 60.94 ? 102 TYR A CB    1 
ATOM   685   C  CG    . TYR A  1 102 ? 109.576 100.223 134.121 1.00 60.94 ? 102 TYR A CG    1 
ATOM   686   C  CD1   . TYR A  1 102 ? 110.838 100.472 133.600 1.00 60.94 ? 102 TYR A CD1   1 
ATOM   687   C  CD2   . TYR A  1 102 ? 109.413 100.271 135.499 1.00 60.94 ? 102 TYR A CD2   1 
ATOM   688   C  CE1   . TYR A  1 102 ? 111.906 100.767 134.425 1.00 60.94 ? 102 TYR A CE1   1 
ATOM   689   C  CE2   . TYR A  1 102 ? 110.477 100.565 136.334 1.00 60.94 ? 102 TYR A CE2   1 
ATOM   690   C  CZ    . TYR A  1 102 ? 111.720 100.811 135.790 1.00 60.94 ? 102 TYR A CZ    1 
ATOM   691   O  OH    . TYR A  1 102 ? 112.782 101.104 136.612 1.00 60.94 ? 102 TYR A OH    1 
ATOM   692   N  N     . ARG A  1 103 ? 107.108 96.950  133.913 1.00 63.42 ? 103 ARG A N     1 
ATOM   693   C  CA    . ARG A  1 103 ? 106.901 95.935  134.941 1.00 63.42 ? 103 ARG A CA    1 
ATOM   694   C  C     . ARG A  1 103 ? 107.441 94.579  134.511 1.00 63.42 ? 103 ARG A C     1 
ATOM   695   O  O     . ARG A  1 103 ? 107.866 93.785  135.358 1.00 63.42 ? 103 ARG A O     1 
ATOM   696   C  CB    . ARG A  1 103 ? 105.416 95.826  135.282 1.00 63.42 ? 103 ARG A CB    1 
ATOM   697   C  CG    . ARG A  1 103 ? 104.814 97.099  135.842 1.00 63.42 ? 103 ARG A CG    1 
ATOM   698   C  CD    . ARG A  1 103 ? 103.327 96.931  136.080 1.00 63.42 ? 103 ARG A CD    1 
ATOM   699   N  NE    . ARG A  1 103 ? 102.651 96.401  134.900 1.00 63.42 ? 103 ARG A NE    1 
ATOM   700   C  CZ    . ARG A  1 103 ? 101.336 96.251  134.798 1.00 63.42 ? 103 ARG A CZ    1 
ATOM   701   N  NH1   . ARG A  1 103 ? 100.548 96.592  135.807 1.00 63.42 ? 103 ARG A NH1   1 
ATOM   702   N  NH2   . ARG A  1 103 ? 100.807 95.761  133.685 1.00 63.42 ? 103 ARG A NH2   1 
ATOM   703   N  N     . THR A  1 104 ? 107.433 94.295  133.209 1.00 59.69 ? 104 THR A N     1 
ATOM   704   C  CA    . THR A  1 104 ? 107.920 93.034  132.665 1.00 59.69 ? 104 THR A CA    1 
ATOM   705   C  C     . THR A  1 104 ? 109.247 93.210  131.936 1.00 59.69 ? 104 THR A C     1 
ATOM   706   O  O     . THR A  1 104 ? 109.521 92.509  130.960 1.00 59.69 ? 104 THR A O     1 
ATOM   707   C  CB    . THR A  1 104 ? 106.884 92.421  131.725 1.00 59.69 ? 104 THR A CB    1 
ATOM   708   O  OG1   . THR A  1 104 ? 106.936 93.089  130.460 1.00 59.69 ? 104 THR A OG1   1 
ATOM   709   C  CG2   . THR A  1 104 ? 105.487 92.561  132.304 1.00 59.69 ? 104 THR A CG2   1 
ATOM   710   N  N     . ARG A  1 105 ? 110.080 94.138  132.403 1.00 61.42 ? 105 ARG A N     1 
ATOM   711   C  CA    . ARG A  1 105 ? 111.276 94.533  131.672 1.00 61.42 ? 105 ARG A CA    1 
ATOM   712   C  C     . ARG A  1 105 ? 112.402 93.510  131.737 1.00 61.42 ? 105 ARG A C     1 
ATOM   713   O  O     . ARG A  1 105 ? 113.325 93.587  130.922 1.00 61.42 ? 105 ARG A O     1 
ATOM   714   C  CB    . ARG A  1 105 ? 111.781 95.880  132.191 1.00 61.42 ? 105 ARG A CB    1 
ATOM   715   C  CG    . ARG A  1 105 ? 112.308 95.846  133.614 1.00 61.42 ? 105 ARG A CG    1 
ATOM   716   C  CD    . ARG A  1 105 ? 112.749 97.228  134.062 1.00 61.42 ? 105 ARG A CD    1 
ATOM   717   N  NE    . ARG A  1 105 ? 113.829 97.168  135.042 1.00 61.42 ? 105 ARG A NE    1 
ATOM   718   C  CZ    . ARG A  1 105 ? 113.658 97.315  136.351 1.00 61.42 ? 105 ARG A CZ    1 
ATOM   719   N  NH1   . ARG A  1 105 ? 112.447 97.534  136.843 1.00 61.42 ? 105 ARG A NH1   1 
ATOM   720   N  NH2   . ARG A  1 105 ? 114.699 97.245  137.169 1.00 61.42 ? 105 ARG A NH2   1 
ATOM   721   N  N     . GLN A  1 106 ? 112.352 92.554  132.664 1.00 62.57 ? 106 GLN A N     1 
ATOM   722   C  CA    . GLN A  1 106 ? 113.437 91.590  132.795 1.00 62.57 ? 106 GLN A CA    1 
ATOM   723   C  C     . GLN A  1 106 ? 113.350 90.444  131.796 1.00 62.57 ? 106 GLN A C     1 
ATOM   724   O  O     . GLN A  1 106 ? 114.297 89.657  131.703 1.00 62.57 ? 106 GLN A O     1 
ATOM   725   C  CB    . GLN A  1 106 ? 113.470 91.024  134.216 1.00 62.57 ? 106 GLN A CB    1 
ATOM   726   C  CG    . GLN A  1 106 ? 113.887 92.029  135.274 1.00 62.57 ? 106 GLN A CG    1 
ATOM   727   C  CD    . GLN A  1 106 ? 115.393 92.146  135.410 1.00 62.57 ? 106 GLN A CD    1 
ATOM   728   O  OE1   . GLN A  1 106 ? 116.147 91.434  134.747 1.00 62.57 ? 106 GLN A OE1   1 
ATOM   729   N  NE2   . GLN A  1 106 ? 115.839 93.048  136.276 1.00 62.57 ? 106 GLN A NE2   1 
ATOM   730   N  N     . ASN A  1 107 ? 112.251 90.331  131.051 1.00 61.81 ? 107 ASN A N     1 
ATOM   731   C  CA    . ASN A  1 107 ? 112.079 89.237  130.105 1.00 61.81 ? 107 ASN A CA    1 
ATOM   732   C  C     . ASN A  1 107 ? 112.803 89.462  128.785 1.00 61.81 ? 107 ASN A C     1 
ATOM   733   O  O     . ASN A  1 107 ? 112.869 88.533  127.972 1.00 61.81 ? 107 ASN A O     1 
ATOM   734   C  CB    . ASN A  1 107 ? 110.592 89.016  129.823 1.00 61.81 ? 107 ASN A CB    1 
ATOM   735   C  CG    . ASN A  1 107 ? 109.778 88.857  131.086 1.00 61.81 ? 107 ASN A CG    1 
ATOM   736   O  OD1   . ASN A  1 107 ? 110.319 88.858  132.191 1.00 61.81 ? 107 ASN A OD1   1 
ATOM   737   N  ND2   . ASN A  1 107 ? 108.466 88.720  130.931 1.00 61.81 ? 107 ASN A ND2   1 
ATOM   738   N  N     . PHE A  1 108 ? 113.348 90.651  128.554 1.00 57.04 ? 108 PHE A N     1 
ATOM   739   C  CA    . PHE A  1 108 ? 113.827 91.047  127.239 1.00 57.04 ? 108 PHE A CA    1 
ATOM   740   C  C     . PHE A  1 108 ? 115.324 90.805  127.098 1.00 57.04 ? 108 PHE A C     1 
ATOM   741   O  O     . PHE A  1 108 ? 116.074 90.822  128.077 1.00 57.04 ? 108 PHE A O     1 
ATOM   742   C  CB    . PHE A  1 108 ? 113.496 92.515  126.977 1.00 57.04 ? 108 PHE A CB    1 
ATOM   743   C  CG    . PHE A  1 108 ? 112.025 92.795  126.947 1.00 57.04 ? 108 PHE A CG    1 
ATOM   744   C  CD1   . PHE A  1 108 ? 111.250 92.367  125.886 1.00 57.04 ? 108 PHE A CD1   1 
ATOM   745   C  CD2   . PHE A  1 108 ? 111.411 93.451  127.997 1.00 57.04 ? 108 PHE A CD2   1 
ATOM   746   C  CE1   . PHE A  1 108 ? 109.892 92.614  125.860 1.00 57.04 ? 108 PHE A CE1   1 
ATOM   747   C  CE2   . PHE A  1 108 ? 110.051 93.693  127.978 1.00 57.04 ? 108 PHE A CE2   1 
ATOM   748   C  CZ    . PHE A  1 108 ? 109.293 93.276  126.908 1.00 57.04 ? 108 PHE A CZ    1 
ATOM   749   N  N     . LYS A  1 109 ? 115.747 90.584  125.856 1.00 61.11 ? 109 LYS A N     1 
ATOM   750   C  CA    . LYS A  1 109 ? 117.107 90.160  125.561 1.00 61.11 ? 109 LYS A CA    1 
ATOM   751   C  C     . LYS A  1 109 ? 118.073 91.333  125.662 1.00 61.11 ? 109 LYS A C     1 
ATOM   752   O  O     . LYS A  1 109 ? 117.792 92.426  125.163 1.00 61.11 ? 109 LYS A O     1 
ATOM   753   C  CB    . LYS A  1 109 ? 117.168 89.543  124.164 1.00 61.11 ? 109 LYS A CB    1 
ATOM   754   C  CG    . LYS A  1 109 ? 118.484 88.864  123.829 1.00 61.11 ? 109 LYS A CG    1 
ATOM   755   C  CD    . LYS A  1 109 ? 118.443 88.232  122.446 1.00 61.11 ? 109 LYS A CD    1 
ATOM   756   C  CE    . LYS A  1 109 ? 117.338 87.194  122.341 1.00 61.11 ? 109 LYS A CE    1 
ATOM   757   N  NZ    . LYS A  1 109 ? 117.226 86.634  120.966 1.00 61.11 ? 109 LYS A NZ    1 
ATOM   758   N  N     . GLY A  1 110 ? 119.212 91.100  126.309 1.00 67.95 ? 110 GLY A N     1 
ATOM   759   C  CA    . GLY A  1 110 ? 120.237 92.116  126.416 1.00 67.95 ? 110 GLY A CA    1 
ATOM   760   C  C     . GLY A  1 110 ? 119.937 93.232  127.386 1.00 67.95 ? 110 GLY A C     1 
ATOM   761   O  O     . GLY A  1 110 ? 120.555 94.296  127.296 1.00 67.95 ? 110 GLY A O     1 
ATOM   762   N  N     . PHE A  1 111 ? 119.013 93.025  128.317 1.00 69.14 ? 111 PHE A N     1 
ATOM   763   C  CA    . PHE A  1 111 ? 118.628 94.054  129.269 1.00 69.14 ? 111 PHE A CA    1 
ATOM   764   C  C     . PHE A  1 111 ? 119.210 93.758  130.643 1.00 69.14 ? 111 PHE A C     1 
ATOM   765   O  O     . PHE A  1 111 ? 119.039 92.661  131.180 1.00 69.14 ? 111 PHE A O     1 
ATOM   766   C  CB    . PHE A  1 111 ? 117.107 94.163  129.376 1.00 69.14 ? 111 PHE A CB    1 
ATOM   767   C  CG    . PHE A  1 111 ? 116.645 95.228  130.326 1.00 69.14 ? 111 PHE A CG    1 
ATOM   768   C  CD1   . PHE A  1 111 ? 116.705 96.562  129.966 1.00 69.14 ? 111 PHE A CD1   1 
ATOM   769   C  CD2   . PHE A  1 111 ? 116.155 94.898  131.579 1.00 69.14 ? 111 PHE A CD2   1 
ATOM   770   C  CE1   . PHE A  1 111 ? 116.283 97.549  130.834 1.00 69.14 ? 111 PHE A CE1   1 
ATOM   771   C  CE2   . PHE A  1 111 ? 115.733 95.879  132.452 1.00 69.14 ? 111 PHE A CE2   1 
ATOM   772   C  CZ    . PHE A  1 111 ? 115.796 97.206  132.078 1.00 69.14 ? 111 PHE A CZ    1 
ATOM   773   N  N     . ASP A  1 112 ? 119.899 94.748  131.206 1.00 79.05 ? 112 ASP A N     1 
ATOM   774   C  CA    . ASP A  1 112 ? 120.308 94.731  132.602 1.00 79.05 ? 112 ASP A CA    1 
ATOM   775   C  C     . ASP A  1 112 ? 119.630 95.893  133.311 1.00 79.05 ? 112 ASP A C     1 
ATOM   776   O  O     . ASP A  1 112 ? 118.944 96.712  132.693 1.00 79.05 ? 112 ASP A O     1 
ATOM   777   C  CB    . ASP A  1 112 ? 121.831 94.842  132.768 1.00 79.05 ? 112 ASP A CB    1 
ATOM   778   C  CG    . ASP A  1 112 ? 122.585 93.693  132.127 1.00 79.05 ? 112 ASP A CG    1 
ATOM   779   O  OD1   . ASP A  1 112 ? 121.945 92.747  131.629 1.00 79.05 ? 112 ASP A OD1   1 
ATOM   780   O  OD2   . ASP A  1 112 ? 123.832 93.740  132.120 1.00 79.05 ? 112 ASP A OD2   1 
ATOM   781   N  N     . ASP A  1 113 ? 119.825 95.960  134.623 1.00 84.07 ? 113 ASP A N     1 
ATOM   782   C  CA    . ASP A  1 113 ? 119.426 97.127  135.396 1.00 84.07 ? 113 ASP A CA    1 
ATOM   783   C  C     . ASP A  1 113 ? 120.461 98.240  135.334 1.00 84.07 ? 113 ASP A C     1 
ATOM   784   O  O     . ASP A  1 113 ? 120.164 99.371  135.732 1.00 84.07 ? 113 ASP A O     1 
ATOM   785   C  CB    . ASP A  1 113 ? 119.174 96.736  136.856 1.00 84.07 ? 113 ASP A CB    1 
ATOM   786   N  N     . ASN A  1 114 ? 121.664 97.944  134.840 1.00 86.81 ? 114 ASN A N     1 
ATOM   787   C  CA    . ASN A  1 114 ? 122.751 98.907  134.735 1.00 86.81 ? 114 ASN A CA    1 
ATOM   788   C  C     . ASN A  1 114 ? 123.313 98.971  133.317 1.00 86.81 ? 114 ASN A C     1 
ATOM   789   O  O     . ASN A  1 114 ? 124.527 99.076  133.129 1.00 86.81 ? 114 ASN A O     1 
ATOM   790   C  CB    . ASN A  1 114 ? 123.860 98.563  135.727 1.00 86.81 ? 114 ASN A CB    1 
ATOM   791   C  CG    . ASN A  1 114 ? 123.387 98.604  137.167 1.00 86.81 ? 114 ASN A CG    1 
ATOM   792   O  OD1   . ASN A  1 114 ? 123.343 97.578  137.845 1.00 86.81 ? 114 ASN A OD1   1 
ATOM   793   N  ND2   . ASN A  1 114 ? 123.035 99.792  137.642 1.00 86.81 ? 114 ASN A ND2   1 
ATOM   794   N  N     . ASN A  1 115 ? 122.444 98.902  132.312 1.00 79.91 ? 115 ASN A N     1 
ATOM   795   C  CA    . ASN A  1 115 ? 122.855 98.847  130.912 1.00 79.91 ? 115 ASN A CA    1 
ATOM   796   C  C     . ASN A  1 115 ? 122.272 100.043 130.173 1.00 79.91 ? 115 ASN A C     1 
ATOM   797   O  O     . ASN A  1 115 ? 121.051 100.151 130.020 1.00 79.91 ? 115 ASN A O     1 
ATOM   798   C  CB    . ASN A  1 115 ? 122.404 97.539  130.264 1.00 79.91 ? 115 ASN A CB    1 
ATOM   799   C  CG    . ASN A  1 115 ? 123.265 97.150  129.081 1.00 79.91 ? 115 ASN A CG    1 
ATOM   800   O  OD1   . ASN A  1 115 ? 124.369 97.663  128.907 1.00 79.91 ? 115 ASN A OD1   1 
ATOM   801   N  ND2   . ASN A  1 115 ? 122.762 96.236  128.259 1.00 79.91 ? 115 ASN A ND2   1 
ATOM   802   N  N     . ASP A  1 116 ? 123.144 100.936 129.714 1.00 76.54 ? 116 ASP A N     1 
ATOM   803   C  CA    . ASP A  1 116 ? 122.737 102.053 128.873 1.00 76.54 ? 116 ASP A CA    1 
ATOM   804   C  C     . ASP A  1 116 ? 122.758 101.724 127.385 1.00 76.54 ? 116 ASP A C     1 
ATOM   805   O  O     . ASP A  1 116 ? 122.590 102.633 126.566 1.00 76.54 ? 116 ASP A O     1 
ATOM   806   C  CB    . ASP A  1 116 ? 123.621 103.273 129.159 1.00 76.54 ? 116 ASP A CB    1 
ATOM   807   C  CG    . ASP A  1 116 ? 125.109 102.958 129.086 1.00 76.54 ? 116 ASP A CG    1 
ATOM   808   O  OD1   . ASP A  1 116 ? 125.916 103.877 129.340 1.00 76.54 ? 116 ASP A OD1   1 
ATOM   809   O  OD2   . ASP A  1 116 ? 125.479 101.794 128.824 1.00 76.54 ? 116 ASP A OD2   1 
ATOM   810   N  N     . ASP A  1 117 ? 122.961 100.461 127.018 1.00 72.86 ? 117 ASP A N     1 
ATOM   811   C  CA    . ASP A  1 117 ? 123.035 100.046 125.625 1.00 72.86 ? 117 ASP A CA    1 
ATOM   812   C  C     . ASP A  1 117 ? 121.770 99.349  125.148 1.00 72.86 ? 117 ASP A C     1 
ATOM   813   O  O     . ASP A  1 117 ? 121.758 98.807  124.039 1.00 72.86 ? 117 ASP A O     1 
ATOM   814   C  CB    . ASP A  1 117 ? 124.239 99.129  125.409 1.00 72.86 ? 117 ASP A CB    1 
ATOM   815   C  CG    . ASP A  1 117 ? 125.509 99.684  126.014 1.00 72.86 ? 117 ASP A CG    1 
ATOM   816   O  OD1   . ASP A  1 117 ? 126.347 98.883  126.476 1.00 72.86 ? 117 ASP A OD1   1 
ATOM   817   O  OD2   . ASP A  1 117 ? 125.671 100.923 126.024 1.00 72.86 ? 117 ASP A OD2   1 
ATOM   818   N  N     . PHE A  1 118 ? 120.712 99.338  125.957 1.00 61.52 ? 118 PHE A N     1 
ATOM   819   C  CA    . PHE A  1 118 ? 119.476 98.680  125.558 1.00 61.52 ? 118 PHE A CA    1 
ATOM   820   C  C     . PHE A  1 118 ? 118.736 99.514  124.523 1.00 61.52 ? 118 PHE A C     1 
ATOM   821   O  O     . PHE A  1 118 ? 118.517 99.063  123.395 1.00 61.52 ? 118 PHE A O     1 
ATOM   822   C  CB    . PHE A  1 118 ? 118.582 98.427  126.770 1.00 61.52 ? 118 PHE A CB    1 
ATOM   823   C  CG    . PHE A  1 118 ? 117.348 97.641  126.453 1.00 61.52 ? 118 PHE A CG    1 
ATOM   824   C  CD1   . PHE A  1 118 ? 117.432 96.457  125.740 1.00 61.52 ? 118 PHE A CD1   1 
ATOM   825   C  CD2   . PHE A  1 118 ? 116.104 98.087  126.861 1.00 61.52 ? 118 PHE A CD2   1 
ATOM   826   C  CE1   . PHE A  1 118 ? 116.297 95.729  125.445 1.00 61.52 ? 118 PHE A CE1   1 
ATOM   827   C  CE2   . PHE A  1 118 ? 114.968 97.364  126.568 1.00 61.52 ? 118 PHE A CE2   1 
ATOM   828   C  CZ    . PHE A  1 118 ? 115.064 96.184  125.860 1.00 61.52 ? 118 PHE A CZ    1 
ATOM   829   N  N     . LEU A  1 119 ? 118.347 100.730 124.895 1.00 53.06 ? 119 LEU A N     1 
ATOM   830   C  CA    . LEU A  1 119 ? 117.703 101.626 123.948 1.00 53.06 ? 119 LEU A CA    1 
ATOM   831   C  C     . LEU A  1 119 ? 118.758 102.430 123.201 1.00 53.06 ? 119 LEU A C     1 
ATOM   832   O  O     . LEU A  1 119 ? 119.550 103.152 123.813 1.00 53.06 ? 119 LEU A O     1 
ATOM   833   C  CB    . LEU A  1 119 ? 116.736 102.561 124.671 1.00 53.06 ? 119 LEU A CB    1 
ATOM   834   C  CG    . LEU A  1 119 ? 115.461 101.947 125.249 1.00 53.06 ? 119 LEU A CG    1 
ATOM   835   C  CD1   . LEU A  1 119 ? 114.502 103.038 125.677 1.00 53.06 ? 119 LEU A CD1   1 
ATOM   836   C  CD2   . LEU A  1 119 ? 114.794 101.026 124.247 1.00 53.06 ? 119 LEU A CD2   1 
ATOM   837   N  N     . THR A  1 120 ? 118.767 102.307 121.876 1.00 46.14 ? 120 THR A N     1 
ATOM   838   C  CA    . THR A  1 120 ? 119.732 103.023 121.059 1.00 46.14 ? 120 THR A CA    1 
ATOM   839   C  C     . THR A  1 120 ? 119.376 104.508 121.004 1.00 46.14 ? 120 THR A C     1 
ATOM   840   O  O     . THR A  1 120 ? 118.299 104.934 121.428 1.00 46.14 ? 120 THR A O     1 
ATOM   841   C  CB    . THR A  1 120 ? 119.788 102.419 119.660 1.00 46.14 ? 120 THR A CB    1 
ATOM   842   O  OG1   . THR A  1 120 ? 118.495 102.508 119.052 1.00 46.14 ? 120 THR A OG1   1 
ATOM   843   C  CG2   . THR A  1 120 ? 120.205 100.961 119.729 1.00 46.14 ? 120 THR A CG2   1 
ATOM   844   N  N     . MET A  1 121 ? 120.301 105.305 120.459 1.00 42.13 ? 121 MET A N     1 
ATOM   845   C  CA    . MET A  1 121 ? 120.131 106.755 120.427 1.00 42.13 ? 121 MET A CA    1 
ATOM   846   C  C     . MET A  1 121 ? 118.994 107.176 119.504 1.00 42.13 ? 121 MET A C     1 
ATOM   847   O  O     . MET A  1 121 ? 118.344 108.200 119.751 1.00 42.13 ? 121 MET A O     1 
ATOM   848   C  CB    . MET A  1 121 ? 121.435 107.415 119.989 1.00 42.13 ? 121 MET A CB    1 
ATOM   849   C  CG    . MET A  1 121 ? 121.687 108.789 120.575 1.00 42.13 ? 121 MET A CG    1 
ATOM   850   S  SD    . MET A  1 121 ? 123.067 109.589 119.739 1.00 42.13 ? 121 MET A SD    1 
ATOM   851   C  CE    . MET A  1 121 ? 123.322 111.026 120.771 1.00 42.13 ? 121 MET A CE    1 
ATOM   852   N  N     . ALA A  1 122 ? 118.729 106.389 118.458 1.00 39.21 ? 122 ALA A N     1 
ATOM   853   C  CA    . ALA A  1 122 ? 117.600 106.666 117.577 1.00 39.21 ? 122 ALA A CA    1 
ATOM   854   C  C     . ALA A  1 122 ? 116.275 106.453 118.297 1.00 39.21 ? 122 ALA A C     1 
ATOM   855   O  O     . ALA A  1 122 ? 115.364 107.284 118.189 1.00 39.21 ? 122 ALA A O     1 
ATOM   856   C  CB    . ALA A  1 122 ? 117.686 105.784 116.335 1.00 39.21 ? 122 ALA A CB    1 
ATOM   857   N  N     . GLU A  1 123 ? 116.159 105.355 119.050 1.00 42.55 ? 123 GLU A N     1 
ATOM   858   C  CA    . GLU A  1 123 ? 114.956 105.112 119.840 1.00 42.55 ? 123 GLU A CA    1 
ATOM   859   C  C     . GLU A  1 123 ? 114.799 106.128 120.961 1.00 42.55 ? 123 GLU A C     1 
ATOM   860   O  O     . GLU A  1 123 ? 113.673 106.532 121.265 1.00 42.55 ? 123 GLU A O     1 
ATOM   861   C  CB    . GLU A  1 123 ? 114.975 103.698 120.415 1.00 42.55 ? 123 GLU A CB    1 
ATOM   862   C  CG    . GLU A  1 123 ? 114.675 102.610 119.405 1.00 42.55 ? 123 GLU A CG    1 
ATOM   863   C  CD    . GLU A  1 123 ? 115.271 101.273 119.796 1.00 42.55 ? 123 GLU A CD    1 
ATOM   864   O  OE1   . GLU A  1 123 ? 116.297 101.265 120.507 1.00 42.55 ? 123 GLU A OE1   1 
ATOM   865   O  OE2   . GLU A  1 123 ? 114.715 100.231 119.391 1.00 42.55 ? 123 GLU A OE2   1 
ATOM   866   N  N     . CYS A  1 124 ? 115.906 106.572 121.563 1.00 40.95 ? 124 CYS A N     1 
ATOM   867   C  CA    . CYS A  1 124 ? 115.822 107.588 122.607 1.00 40.95 ? 124 CYS A CA    1 
ATOM   868   C  C     . CYS A  1 124 ? 115.369 108.931 122.050 1.00 40.95 ? 124 CYS A C     1 
ATOM   869   O  O     . CYS A  1 124 ? 114.551 109.622 122.672 1.00 40.95 ? 124 CYS A O     1 
ATOM   870   C  CB    . CYS A  1 124 ? 117.161 107.728 123.328 1.00 40.95 ? 124 CYS A CB    1 
ATOM   871   S  SG    . CYS A  1 124 ? 117.670 106.276 124.275 1.00 40.95 ? 124 CYS A SG    1 
ATOM   872   N  N     . GLN A  1 125 ? 115.865 109.308 120.871 1.00 35.67 ? 125 GLN A N     1 
ATOM   873   C  CA    . GLN A  1 125 ? 115.419 110.561 120.274 1.00 35.67 ? 125 GLN A CA    1 
ATOM   874   C  C     . GLN A  1 125 ? 113.978 110.469 119.786 1.00 35.67 ? 125 GLN A C     1 
ATOM   875   O  O     . GLN A  1 125 ? 113.243 111.462 119.853 1.00 35.67 ? 125 GLN A O     1 
ATOM   876   C  CB    . GLN A  1 125 ? 116.359 110.959 119.144 1.00 35.67 ? 125 GLN A CB    1 
ATOM   877   C  CG    . GLN A  1 125 ? 117.630 111.586 119.655 1.00 35.67 ? 125 GLN A CG    1 
ATOM   878   C  CD    . GLN A  1 125 ? 118.819 111.264 118.795 1.00 35.67 ? 125 GLN A CD    1 
ATOM   879   O  OE1   . GLN A  1 125 ? 118.719 110.492 117.845 1.00 35.67 ? 125 GLN A OE1   1 
ATOM   880   N  NE2   . GLN A  1 125 ? 119.959 111.853 119.121 1.00 35.67 ? 125 GLN A NE2   1 
ATOM   881   N  N     . PHE A  1 126 ? 113.543 109.283 119.347 1.00 33.87 ? 126 PHE A N     1 
ATOM   882   C  CA    . PHE A  1 126 ? 112.138 109.090 118.999 1.00 33.87 ? 126 PHE A CA    1 
ATOM   883   C  C     . PHE A  1 126 ? 111.240 109.190 120.228 1.00 33.87 ? 126 PHE A C     1 
ATOM   884   O  O     . PHE A  1 126 ? 110.150 109.768 120.156 1.00 33.87 ? 126 PHE A O     1 
ATOM   885   C  CB    . PHE A  1 126 ? 111.955 107.742 118.305 1.00 33.87 ? 126 PHE A CB    1 
ATOM   886   C  CG    . PHE A  1 126 ? 110.528 107.411 117.975 1.00 33.87 ? 126 PHE A CG    1 
ATOM   887   C  CD1   . PHE A  1 126 ? 109.706 108.335 117.347 1.00 33.87 ? 126 PHE A CD1   1 
ATOM   888   C  CD2   . PHE A  1 126 ? 110.012 106.166 118.283 1.00 33.87 ? 126 PHE A CD2   1 
ATOM   889   C  CE1   . PHE A  1 126 ? 108.396 108.025 117.046 1.00 33.87 ? 126 PHE A CE1   1 
ATOM   890   C  CE2   . PHE A  1 126 ? 108.704 105.849 117.982 1.00 33.87 ? 126 PHE A CE2   1 
ATOM   891   C  CZ    . PHE A  1 126 ? 107.895 106.780 117.363 1.00 33.87 ? 126 PHE A CZ    1 
ATOM   892   N  N     . ILE A  1 127 ? 111.687 108.654 121.366 1.00 38.56 ? 127 ILE A N     1 
ATOM   893   C  CA    . ILE A  1 127 ? 110.888 108.725 122.588 1.00 38.56 ? 127 ILE A CA    1 
ATOM   894   C  C     . ILE A  1 127 ? 110.809 110.161 123.096 1.00 38.56 ? 127 ILE A C     1 
ATOM   895   O  O     . ILE A  1 127 ? 109.745 110.620 123.532 1.00 38.56 ? 127 ILE A O     1 
ATOM   896   C  CB    . ILE A  1 127 ? 111.460 107.759 123.643 1.00 38.56 ? 127 ILE A CB    1 
ATOM   897   C  CG1   . ILE A  1 127 ? 111.114 106.321 123.276 1.00 38.56 ? 127 ILE A CG1   1 
ATOM   898   C  CG2   . ILE A  1 127 ? 110.901 108.029 125.021 1.00 38.56 ? 127 ILE A CG2   1 
ATOM   899   C  CD1   . ILE A  1 127 ? 112.042 105.316 123.888 1.00 38.56 ? 127 ILE A CD1   1 
ATOM   900   N  N     . ILE A  1 128 ? 111.911 110.911 122.997 1.00 36.30 ? 128 ILE A N     1 
ATOM   901   C  CA    . ILE A  1 128 ? 111.891 112.308 123.426 1.00 36.30 ? 128 ILE A CA    1 
ATOM   902   C  C     . ILE A  1 128 ? 111.029 113.159 122.492 1.00 36.30 ? 128 ILE A C     1 
ATOM   903   O  O     . ILE A  1 128 ? 110.290 114.040 122.954 1.00 36.30 ? 128 ILE A O     1 
ATOM   904   C  CB    . ILE A  1 128 ? 113.334 112.833 123.551 1.00 36.30 ? 128 ILE A CB    1 
ATOM   905   C  CG1   . ILE A  1 128 ? 114.007 112.183 124.759 1.00 36.30 ? 128 ILE A CG1   1 
ATOM   906   C  CG2   . ILE A  1 128 ? 113.380 114.344 123.700 1.00 36.30 ? 128 ILE A CG2   1 
ATOM   907   C  CD1   . ILE A  1 128 ? 115.371 112.733 125.082 1.00 36.30 ? 128 ILE A CD1   1 
ATOM   908   N  N     . LYS A  1 129 ? 111.046 112.874 121.185 1.00 36.91 ? 129 LYS A N     1 
ATOM   909   C  CA    . LYS A  1 129 ? 110.149 113.575 120.268 1.00 36.91 ? 129 LYS A CA    1 
ATOM   910   C  C     . LYS A  1 129 ? 108.689 113.216 120.517 1.00 36.91 ? 129 LYS A C     1 
ATOM   911   O  O     . LYS A  1 129 ? 107.814 114.081 120.402 1.00 36.91 ? 129 LYS A O     1 
ATOM   912   C  CB    . LYS A  1 129 ? 110.529 113.268 118.821 1.00 36.91 ? 129 LYS A CB    1 
ATOM   913   C  CG    . LYS A  1 129 ? 109.710 114.007 117.771 1.00 36.91 ? 129 LYS A CG    1 
ATOM   914   C  CD    . LYS A  1 129 ? 109.739 115.510 117.990 1.00 36.91 ? 129 LYS A CD    1 
ATOM   915   C  CE    . LYS A  1 129 ? 108.704 116.214 117.125 1.00 36.91 ? 129 LYS A CE    1 
ATOM   916   N  NZ    . LYS A  1 129 ? 108.880 115.920 115.677 1.00 36.91 ? 129 LYS A NZ    1 
ATOM   917   N  N     . HIS A  1 130 ? 108.409 111.967 120.893 1.00 40.51 ? 130 HIS A N     1 
ATOM   918   C  CA    . HIS A  1 130 ? 107.034 111.588 121.199 1.00 40.51 ? 130 HIS A CA    1 
ATOM   919   C  C     . HIS A  1 130 ? 106.557 112.192 122.512 1.00 40.51 ? 130 HIS A C     1 
ATOM   920   O  O     . HIS A  1 130 ? 105.363 112.470 122.665 1.00 40.51 ? 130 HIS A O     1 
ATOM   921   C  CB    . HIS A  1 130 ? 106.904 110.069 121.243 1.00 40.51 ? 130 HIS A CB    1 
ATOM   922   C  CG    . HIS A  1 130 ? 105.510 109.593 121.499 1.00 40.51 ? 130 HIS A CG    1 
ATOM   923   N  ND1   . HIS A  1 130 ? 104.602 109.373 120.487 1.00 40.51 ? 130 HIS A ND1   1 
ATOM   924   C  CD2   . HIS A  1 130 ? 104.865 109.303 122.654 1.00 40.51 ? 130 HIS A CD2   1 
ATOM   925   C  CE1   . HIS A  1 130 ? 103.459 108.963 121.007 1.00 40.51 ? 130 HIS A CE1   1 
ATOM   926   N  NE2   . HIS A  1 130 ? 103.592 108.913 122.320 1.00 40.51 ? 130 HIS A NE2   1 
ATOM   927   N  N     . GLU A  1 131 ? 107.461 112.402 123.469 1.00 44.15 ? 131 GLU A N     1 
ATOM   928   C  CA    . GLU A  1 131 ? 107.056 113.034 124.719 1.00 44.15 ? 131 GLU A CA    1 
ATOM   929   C  C     . GLU A  1 131 ? 106.932 114.544 124.577 1.00 44.15 ? 131 GLU A C     1 
ATOM   930   O  O     . GLU A  1 131 ? 106.144 115.164 125.298 1.00 44.15 ? 131 GLU A O     1 
ATOM   931   C  CB    . GLU A  1 131 ? 108.039 112.691 125.841 1.00 44.15 ? 131 GLU A CB    1 
ATOM   932   C  CG    . GLU A  1 131 ? 108.030 111.224 126.294 1.00 44.15 ? 131 GLU A CG    1 
ATOM   933   C  CD    . GLU A  1 131 ? 106.662 110.687 126.717 1.00 44.15 ? 131 GLU A CD    1 
ATOM   934   O  OE1   . GLU A  1 131 ? 105.821 111.458 127.232 1.00 44.15 ? 131 GLU A OE1   1 
ATOM   935   O  OE2   . GLU A  1 131 ? 106.427 109.475 126.527 1.00 44.15 ? 131 GLU A OE2   1 
ATOM   936   N  N     . LEU A  1 132 ? 107.696 115.151 123.669 1.00 41.27 ? 132 LEU A N     1 
ATOM   937   C  CA    . LEU A  1 132 ? 107.500 116.566 123.380 1.00 41.27 ? 132 LEU A CA    1 
ATOM   938   C  C     . LEU A  1 132 ? 106.253 116.794 122.538 1.00 41.27 ? 132 LEU A C     1 
ATOM   939   O  O     . LEU A  1 132 ? 105.624 117.850 122.642 1.00 41.27 ? 132 LEU A O     1 
ATOM   940   C  CB    . LEU A  1 132 ? 108.725 117.137 122.672 1.00 41.27 ? 132 LEU A CB    1 
ATOM   941   C  CG    . LEU A  1 132 ? 109.958 117.375 123.537 1.00 41.27 ? 132 LEU A CG    1 
ATOM   942   C  CD1   . LEU A  1 132 ? 111.104 117.885 122.690 1.00 41.27 ? 132 LEU A CD1   1 
ATOM   943   C  CD2   . LEU A  1 132 ? 109.634 118.357 124.640 1.00 41.27 ? 132 LEU A CD2   1 
ATOM   944   N  N     . GLU A  1 133 ? 105.891 115.825 121.696 1.00 44.06 ? 133 GLU A N     1 
ATOM   945   C  CA    . GLU A  1 133 ? 104.668 115.941 120.909 1.00 44.06 ? 133 GLU A CA    1 
ATOM   946   C  C     . GLU A  1 133 ? 103.437 115.794 121.791 1.00 44.06 ? 133 GLU A C     1 
ATOM   947   O  O     . GLU A  1 133 ? 102.468 116.549 121.653 1.00 44.06 ? 133 GLU A O     1 
ATOM   948   C  CB    . GLU A  1 133 ? 104.660 114.894 119.796 1.00 44.06 ? 133 GLU A CB    1 
ATOM   949   C  CG    . GLU A  1 133 ? 105.306 115.349 118.503 1.00 44.06 ? 133 GLU A CG    1 
ATOM   950   C  CD    . GLU A  1 133 ? 104.775 114.602 117.293 1.00 44.06 ? 133 GLU A CD    1 
ATOM   951   O  OE1   . GLU A  1 133 ? 104.567 115.244 116.242 1.00 44.06 ? 133 GLU A OE1   1 
ATOM   952   O  OE2   . GLU A  1 133 ? 104.566 113.375 117.392 1.00 44.06 ? 133 GLU A OE2   1 
ATOM   953   N  N     . ASN A  1 134 ? 103.456 114.827 122.711 1.00 46.64 ? 134 ASN A N     1 
ATOM   954   C  CA    . ASN A  1 134 ? 102.356 114.620 123.652 1.00 46.64 ? 134 ASN A CA    1 
ATOM   955   C  C     . ASN A  1 134 ? 102.554 115.475 124.906 1.00 46.64 ? 134 ASN A C     1 
ATOM   956   O  O     . ASN A  1 134 ? 102.660 114.988 126.031 1.00 46.64 ? 134 ASN A O     1 
ATOM   957   C  CB    . ASN A  1 134 ? 102.230 113.145 124.004 1.00 46.64 ? 134 ASN A CB    1 
ATOM   958   C  CG    . ASN A  1 134 ? 101.516 112.356 122.933 1.00 46.64 ? 134 ASN A CG    1 
ATOM   959   O  OD1   . ASN A  1 134 ? 101.863 112.434 121.756 1.00 46.64 ? 134 ASN A OD1   1 
ATOM   960   N  ND2   . ASN A  1 134 ? 100.510 111.589 123.334 1.00 46.64 ? 134 ASN A ND2   1 
ATOM   961   N  N     . LEU A  1 135 ? 102.604 116.783 124.682 1.00 52.59 ? 135 LEU A N     1 
ATOM   962   C  CA    . LEU A  1 135 ? 102.713 117.792 125.729 1.00 52.59 ? 135 LEU A CA    1 
ATOM   963   C  C     . LEU A  1 135 ? 101.563 118.759 125.477 1.00 52.59 ? 135 LEU A C     1 
ATOM   964   O  O     . LEU A  1 135 ? 101.700 119.717 124.715 1.00 52.59 ? 135 LEU A O     1 
ATOM   965   C  CB    . LEU A  1 135 ? 104.065 118.485 125.688 1.00 52.59 ? 135 LEU A CB    1 
ATOM   966   C  CG    . LEU A  1 135 ? 104.445 119.338 126.893 1.00 52.59 ? 135 LEU A CG    1 
ATOM   967   C  CD1   . LEU A  1 135 ? 104.433 118.494 128.148 1.00 52.59 ? 135 LEU A CD1   1 
ATOM   968   C  CD2   . LEU A  1 135 ? 105.809 119.962 126.679 1.00 52.59 ? 135 LEU A CD2   1 
ATOM   969   N  N     . ARG A  1 136 ? 100.424 118.495 126.105 1.00 58.39 ? 136 ARG A N     1 
ATOM   970   C  CA    . ARG A  1 136 ? 99.186  119.185 125.783 1.00 58.39 ? 136 ARG A CA    1 
ATOM   971   C  C     . ARG A  1 136 ? 98.866  120.255 126.817 1.00 58.39 ? 136 ARG A C     1 
ATOM   972   O  O     . ARG A  1 136 ? 99.302  120.188 127.969 1.00 58.39 ? 136 ARG A O     1 
ATOM   973   C  CB    . ARG A  1 136 ? 98.030  118.191 125.689 1.00 58.39 ? 136 ARG A CB    1 
ATOM   974   C  CG    . ARG A  1 136 ? 98.371  116.939 124.908 1.00 58.39 ? 136 ARG A CG    1 
ATOM   975   C  CD    . ARG A  1 136 ? 97.238  116.544 123.985 1.00 58.39 ? 136 ARG A CD    1 
ATOM   976   N  NE    . ARG A  1 136 ? 97.567  115.364 123.195 1.00 58.39 ? 136 ARG A NE    1 
ATOM   977   C  CZ    . ARG A  1 136 ? 98.186  115.401 122.020 1.00 58.39 ? 136 ARG A CZ    1 
ATOM   978   N  NH1   . ARG A  1 136 ? 98.544  116.562 121.495 1.00 58.39 ? 136 ARG A NH1   1 
ATOM   979   N  NH2   . ARG A  1 136 ? 98.445  114.276 121.369 1.00 58.39 ? 136 ARG A NH2   1 
ATOM   980   N  N     . ALA A  1 137 ? 98.096  121.249 126.387 1.00 71.41 ? 137 ALA A N     1 
ATOM   981   C  CA    . ALA A  1 137 ? 97.646  122.331 127.248 1.00 71.41 ? 137 ALA A CA    1 
ATOM   982   C  C     . ALA A  1 137 ? 96.263  122.010 127.796 1.00 71.41 ? 137 ALA A C     1 
ATOM   983   O  O     . ALA A  1 137 ? 95.386  121.548 127.062 1.00 71.41 ? 137 ALA A O     1 
ATOM   984   C  CB    . ALA A  1 137 ? 97.609  123.658 126.489 1.00 71.41 ? 137 ALA A CB    1 
ATOM   985   N  N     . LYS A  1 138 ? 96.077  122.252 129.094 1.00 80.40 ? 138 LYS A N     1 
ATOM   986   C  CA    . LYS A  1 138 ? 94.803  121.974 129.753 1.00 80.40 ? 138 LYS A CA    1 
ATOM   987   C  C     . LYS A  1 138 ? 94.147  123.257 130.247 1.00 80.40 ? 138 LYS A C     1 
ATOM   988   O  O     . LYS A  1 138 ? 92.991  123.517 129.908 1.00 80.40 ? 138 LYS A O     1 
ATOM   989   C  CB    . LYS A  1 138 ? 95.012  120.975 130.893 1.00 80.40 ? 138 LYS A CB    1 
ATOM   990   N  N     . ASP A  1 139 ? 94.849  124.072 131.037 1.00 85.38 ? 139 ASP A N     1 
ATOM   991   C  CA    . ASP A  1 139 ? 94.218  125.244 131.636 1.00 85.38 ? 139 ASP A CA    1 
ATOM   992   C  C     . ASP A  1 139 ? 94.435  126.493 130.792 1.00 85.38 ? 139 ASP A C     1 
ATOM   993   O  O     . ASP A  1 139 ? 93.572  127.378 130.754 1.00 85.38 ? 139 ASP A O     1 
ATOM   994   C  CB    . ASP A  1 139 ? 94.757  125.461 133.049 1.00 85.38 ? 139 ASP A CB    1 
ATOM   995   C  CG    . ASP A  1 139 ? 94.578  124.245 133.933 1.00 85.38 ? 139 ASP A CG    1 
ATOM   996   O  OD1   . ASP A  1 139 ? 95.433  124.020 134.815 1.00 85.38 ? 139 ASP A OD1   1 
ATOM   997   O  OD2   . ASP A  1 139 ? 93.583  123.515 133.747 1.00 85.38 ? 139 ASP A OD2   1 
ATOM   998   N  N     . GLU A  1 140 ? 95.578  126.585 130.116 1.00 82.05 ? 140 GLU A N     1 
ATOM   999   C  CA    . GLU A  1 140 ? 95.972  127.826 129.462 1.00 82.05 ? 140 GLU A CA    1 
ATOM   1000  C  C     . GLU A  1 140 ? 95.167  128.058 128.190 1.00 82.05 ? 140 GLU A C     1 
ATOM   1001  O  O     . GLU A  1 140 ? 95.052  127.169 127.341 1.00 82.05 ? 140 GLU A O     1 
ATOM   1002  C  CB    . GLU A  1 140 ? 97.465  127.799 129.141 1.00 82.05 ? 140 GLU A CB    1 
ATOM   1003  C  CG    . GLU A  1 140 ? 98.352  127.608 130.358 1.00 82.05 ? 140 GLU A CG    1 
ATOM   1004  C  CD    . GLU A  1 140 ? 99.120  126.303 130.319 1.00 82.05 ? 140 GLU A CD    1 
ATOM   1005  O  OE1   . GLU A  1 140 ? 100.350 126.329 130.533 1.00 82.05 ? 140 GLU A OE1   1 
ATOM   1006  O  OE2   . GLU A  1 140 ? 98.495  125.251 130.072 1.00 82.05 ? 140 GLU A OE2   1 
ATOM   1007  N  N     . LYS A  1 141 ? 94.608  129.261 128.064 1.00 79.02 ? 141 LYS A N     1 
ATOM   1008  C  CA    . LYS A  1 141 ? 93.899  129.658 126.856 1.00 79.02 ? 141 LYS A CA    1 
ATOM   1009  C  C     . LYS A  1 141 ? 94.824  130.279 125.821 1.00 79.02 ? 141 LYS A C     1 
ATOM   1010  O  O     . LYS A  1 141 ? 94.486  130.304 124.632 1.00 79.02 ? 141 LYS A O     1 
ATOM   1011  C  CB    . LYS A  1 141 ? 92.779  130.643 127.198 1.00 79.02 ? 141 LYS A CB    1 
ATOM   1012  C  CG    . LYS A  1 141 ? 91.679  130.055 128.065 1.00 79.02 ? 141 LYS A CG    1 
ATOM   1013  C  CD    . LYS A  1 141 ? 90.734  131.135 128.565 1.00 79.02 ? 141 LYS A CD    1 
ATOM   1014  C  CE    . LYS A  1 141 ? 89.934  131.744 127.427 1.00 79.02 ? 141 LYS A CE    1 
ATOM   1015  N  NZ    . LYS A  1 141 ? 88.955  130.780 126.856 1.00 79.02 ? 141 LYS A NZ    1 
ATOM   1016  N  N     . MET A  1 142 ? 95.977  130.787 126.245 1.00 81.26 ? 142 MET A N     1 
ATOM   1017  C  CA    . MET A  1 142 ? 96.964  131.332 125.329 1.00 81.26 ? 142 MET A CA    1 
ATOM   1018  C  C     . MET A  1 142 ? 98.356  131.040 125.866 1.00 81.26 ? 142 MET A C     1 
ATOM   1019  O  O     . MET A  1 142 ? 98.533  130.696 127.037 1.00 81.26 ? 142 MET A O     1 
ATOM   1020  C  CB    . MET A  1 142 ? 96.780  132.841 125.124 1.00 81.26 ? 142 MET A CB    1 
ATOM   1021  C  CG    . MET A  1 142 ? 97.236  133.690 126.298 1.00 81.26 ? 142 MET A CG    1 
ATOM   1022  N  N     . ILE A  1 143 ? 99.341  131.166 124.989 1.00 77.94 ? 143 ILE A N     1 
ATOM   1023  C  CA    . ILE A  1 143 ? 100.740 131.050 125.413 1.00 77.94 ? 143 ILE A CA    1 
ATOM   1024  C  C     . ILE A  1 143 ? 101.113 132.295 126.211 1.00 77.94 ? 143 ILE A C     1 
ATOM   1025  O  O     . ILE A  1 143 ? 100.833 133.419 125.757 1.00 77.94 ? 143 ILE A O     1 
ATOM   1026  C  CB    . ILE A  1 143 ? 101.649 130.869 124.194 1.00 77.94 ? 143 ILE A CB    1 
ATOM   1027  C  CG1   . ILE A  1 143 ? 101.526 129.441 123.660 1.00 77.94 ? 143 ILE A CG1   1 
ATOM   1028  C  CG2   . ILE A  1 143 ? 103.099 131.190 124.524 1.00 77.94 ? 143 ILE A CG2   1 
ATOM   1029  C  CD1   . ILE A  1 143 ? 102.400 129.150 122.466 1.00 77.94 ? 143 ILE A CD1   1 
ATOM   1030  N  N     . PRO A  1 144 ? 101.703 132.154 127.411 1.00 78.58 ? 144 PRO A N     1 
ATOM   1031  C  CA    . PRO A  1 144 ? 101.992 133.328 128.249 1.00 78.58 ? 144 PRO A CA    1 
ATOM   1032  C  C     . PRO A  1 144 ? 103.051 134.243 127.657 1.00 78.58 ? 144 PRO A C     1 
ATOM   1033  O  O     . PRO A  1 144 ? 104.229 133.883 127.571 1.00 78.58 ? 144 PRO A O     1 
ATOM   1034  C  CB    . PRO A  1 144 ? 102.473 132.709 129.569 1.00 78.58 ? 144 PRO A CB    1 
ATOM   1035  C  CG    . PRO A  1 144 ? 101.993 131.292 129.535 1.00 78.58 ? 144 PRO A CG    1 
ATOM   1036  C  CD    . PRO A  1 144 ? 102.023 130.894 128.099 1.00 78.58 ? 144 PRO A CD    1 
ATOM   1037  N  N     . GLY A  1 145 ? 102.627 135.435 127.246 1.00 80.20 ? 145 GLY A N     1 
ATOM   1038  C  CA    . GLY A  1 145 ? 103.484 136.391 126.577 1.00 80.20 ? 145 GLY A CA    1 
ATOM   1039  C  C     . GLY A  1 145 ? 103.137 136.627 125.124 1.00 80.20 ? 145 GLY A C     1 
ATOM   1040  O  O     . GLY A  1 145 ? 103.600 137.620 124.550 1.00 80.20 ? 145 GLY A O     1 
ATOM   1041  N  N     . TYR A  1 146 ? 102.339 135.755 124.510 1.00 80.73 ? 146 TYR A N     1 
ATOM   1042  C  CA    . TYR A  1 146 ? 101.967 135.893 123.110 1.00 80.73 ? 146 TYR A CA    1 
ATOM   1043  C  C     . TYR A  1 146 ? 100.448 135.899 123.003 1.00 80.73 ? 146 TYR A C     1 
ATOM   1044  O  O     . TYR A  1 146 ? 99.791  134.936 123.435 1.00 80.73 ? 146 TYR A O     1 
ATOM   1045  C  CB    . TYR A  1 146 ? 102.566 134.760 122.266 1.00 80.73 ? 146 TYR A CB    1 
ATOM   1046  C  CG    . TYR A  1 146 ? 103.992 135.012 121.832 1.00 80.73 ? 146 TYR A CG    1 
ATOM   1047  C  CD1   . TYR A  1 146 ? 105.032 135.007 122.755 1.00 80.73 ? 146 TYR A CD1   1 
ATOM   1048  C  CD2   . TYR A  1 146 ? 104.299 135.258 120.500 1.00 80.73 ? 146 TYR A CD2   1 
ATOM   1049  C  CE1   . TYR A  1 146 ? 106.336 135.240 122.364 1.00 80.73 ? 146 TYR A CE1   1 
ATOM   1050  C  CE2   . TYR A  1 146 ? 105.602 135.492 120.099 1.00 80.73 ? 146 TYR A CE2   1 
ATOM   1051  C  CZ    . TYR A  1 146 ? 106.614 135.481 121.035 1.00 80.73 ? 146 TYR A CZ    1 
ATOM   1052  O  OH    . TYR A  1 146 ? 107.912 135.713 120.642 1.00 80.73 ? 146 TYR A OH    1 
ATOM   1053  N  N     . PRO A  1 147 ? 99.847  136.957 122.450 1.00 80.63 ? 147 PRO A N     1 
ATOM   1054  C  CA    . PRO A  1 147 ? 98.381  137.044 122.417 1.00 80.63 ? 147 PRO A CA    1 
ATOM   1055  C  C     . PRO A  1 147 ? 97.731  136.133 121.387 1.00 80.63 ? 147 PRO A C     1 
ATOM   1056  O  O     . PRO A  1 147 ? 96.715  135.493 121.673 1.00 80.63 ? 147 PRO A O     1 
ATOM   1057  C  CB    . PRO A  1 147 ? 98.123  138.522 122.082 1.00 80.63 ? 147 PRO A CB    1 
ATOM   1058  C  CG    . PRO A  1 147 ? 99.456  139.215 122.220 1.00 80.63 ? 147 PRO A CG    1 
ATOM   1059  C  CD    . PRO A  1 147 ? 100.479 138.176 121.925 1.00 80.63 ? 147 PRO A CD    1 
ATOM   1060  N  N     . GLN A  1 148 ? 98.308  136.062 120.187 1.00 80.61 ? 148 GLN A N     1 
ATOM   1061  C  CA    . GLN A  1 148 ? 97.652  135.402 119.065 1.00 80.61 ? 148 GLN A CA    1 
ATOM   1062  C  C     . GLN A  1 148 ? 97.741  133.883 119.113 1.00 80.61 ? 148 GLN A C     1 
ATOM   1063  O  O     . GLN A  1 148 ? 97.082  133.219 118.305 1.00 80.61 ? 148 GLN A O     1 
ATOM   1064  C  CB    . GLN A  1 148 ? 98.242  135.898 117.744 1.00 80.61 ? 148 GLN A CB    1 
ATOM   1065  C  CG    . GLN A  1 148 ? 97.900  137.337 117.412 1.00 80.61 ? 148 GLN A CG    1 
ATOM   1066  C  CD    . GLN A  1 148 ? 98.577  137.809 116.144 1.00 80.61 ? 148 GLN A CD    1 
ATOM   1067  O  OE1   . GLN A  1 148 ? 99.584  137.244 115.720 1.00 80.61 ? 148 GLN A OE1   1 
ATOM   1068  N  NE2   . GLN A  1 148 ? 98.024  138.847 115.528 1.00 80.61 ? 148 GLN A NE2   1 
ATOM   1069  N  N     . ALA A  1 149 ? 98.531  133.316 120.024 1.00 79.34 ? 149 ALA A N     1 
ATOM   1070  C  CA    . ALA A  1 149 ? 98.674  131.865 120.127 1.00 79.34 ? 149 ALA A CA    1 
ATOM   1071  C  C     . ALA A  1 149 ? 97.427  131.297 120.799 1.00 79.34 ? 149 ALA A C     1 
ATOM   1072  O  O     . ALA A  1 149 ? 97.354  131.131 122.018 1.00 79.34 ? 149 ALA A O     1 
ATOM   1073  C  CB    . ALA A  1 149 ? 99.938  131.506 120.893 1.00 79.34 ? 149 ALA A CB    1 
ATOM   1074  N  N     . LYS A  1 150 ? 96.426  130.994 119.976 1.00 76.65 ? 150 LYS A N     1 
ATOM   1075  C  CA    . LYS A  1 150 ? 95.148  130.490 120.469 1.00 76.65 ? 150 LYS A CA    1 
ATOM   1076  C  C     . LYS A  1 150 ? 95.302  129.037 120.901 1.00 76.65 ? 150 LYS A C     1 
ATOM   1077  O  O     . LYS A  1 150 ? 95.509  128.152 120.067 1.00 76.65 ? 150 LYS A O     1 
ATOM   1078  C  CB    . LYS A  1 150 ? 94.079  130.626 119.389 1.00 76.65 ? 150 LYS A CB    1 
ATOM   1079  N  N     . LEU A  1 151 ? 95.198  128.790 122.204 1.00 77.72 ? 151 LEU A N     1 
ATOM   1080  C  CA    . LEU A  1 151 ? 95.364  127.459 122.775 1.00 77.72 ? 151 LEU A CA    1 
ATOM   1081  C  C     . LEU A  1 151 ? 94.033  126.974 123.333 1.00 77.72 ? 151 LEU A C     1 
ATOM   1082  O  O     . LEU A  1 151 ? 93.445  127.625 124.202 1.00 77.72 ? 151 LEU A O     1 
ATOM   1083  C  CB    . LEU A  1 151 ? 96.428  127.465 123.871 1.00 77.72 ? 151 LEU A CB    1 
ATOM   1084  C  CG    . LEU A  1 151 ? 97.880  127.285 123.431 1.00 77.72 ? 151 LEU A CG    1 
ATOM   1085  C  CD1   . LEU A  1 151 ? 98.770  127.112 124.645 1.00 77.72 ? 151 LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A  1 151 ? 98.018  126.100 122.493 1.00 77.72 ? 151 LEU A CD2   1 
ATOM   1087  N  N     . TYR A  1 152 ? 93.570  125.837 122.840 1.00 75.31 ? 152 TYR A N     1 
ATOM   1088  C  CA    . TYR A  1 152 ? 92.390  125.164 123.350 1.00 75.31 ? 152 TYR A CA    1 
ATOM   1089  C  C     . TYR A  1 152 ? 92.807  123.924 124.133 1.00 75.31 ? 152 TYR A C     1 
ATOM   1090  O  O     . TYR A  1 152 ? 93.906  123.398 123.926 1.00 75.31 ? 152 TYR A O     1 
ATOM   1091  C  CB    . TYR A  1 152 ? 91.437  124.781 122.203 1.00 75.31 ? 152 TYR A CB    1 
ATOM   1092  C  CG    . TYR A  1 152 ? 92.046  123.961 121.087 1.00 75.31 ? 152 TYR A CG    1 
ATOM   1093  C  CD1   . TYR A  1 152 ? 92.675  124.574 120.009 1.00 75.31 ? 152 TYR A CD1   1 
ATOM   1094  C  CD2   . TYR A  1 152 ? 91.960  122.574 121.094 1.00 75.31 ? 152 TYR A CD2   1 
ATOM   1095  C  CE1   . TYR A  1 152 ? 93.224  123.830 118.985 1.00 75.31 ? 152 TYR A CE1   1 
ATOM   1096  C  CE2   . TYR A  1 152 ? 92.505  121.821 120.074 1.00 75.31 ? 152 TYR A CE2   1 
ATOM   1097  C  CZ    . TYR A  1 152 ? 93.135  122.455 119.023 1.00 75.31 ? 152 TYR A CZ    1 
ATOM   1098  O  OH    . TYR A  1 152 ? 93.681  121.710 118.004 1.00 75.31 ? 152 TYR A OH    1 
ATOM   1099  N  N     . PRO A  1 153 ? 91.984  123.458 125.079 1.00 76.00 ? 153 PRO A N     1 
ATOM   1100  C  CA    . PRO A  1 153 ? 92.333  122.235 125.821 1.00 76.00 ? 153 PRO A CA    1 
ATOM   1101  C  C     . PRO A  1 153 ? 92.336  121.009 124.918 1.00 76.00 ? 153 PRO A C     1 
ATOM   1102  O  O     . PRO A  1 153 ? 91.357  120.724 124.225 1.00 76.00 ? 153 PRO A O     1 
ATOM   1103  C  CB    . PRO A  1 153 ? 91.241  122.143 126.896 1.00 76.00 ? 153 PRO A CB    1 
ATOM   1104  C  CG    . PRO A  1 153 ? 90.160  123.064 126.440 1.00 76.00 ? 153 PRO A CG    1 
ATOM   1105  C  CD    . PRO A  1 153 ? 90.859  124.161 125.717 1.00 76.00 ? 153 PRO A CD    1 
ATOM   1106  N  N     . GLY A  1 154 ? 93.454  120.289 124.933 1.00 72.05 ? 154 GLY A N     1 
ATOM   1107  C  CA    . GLY A  1 154 ? 93.679  119.178 124.035 1.00 72.05 ? 154 GLY A CA    1 
ATOM   1108  C  C     . GLY A  1 154 ? 94.611  119.472 122.879 1.00 72.05 ? 154 GLY A C     1 
ATOM   1109  O  O     . GLY A  1 154 ? 94.761  118.619 121.997 1.00 72.05 ? 154 GLY A O     1 
ATOM   1110  N  N     . LYS A  1 155 ? 95.238  120.643 122.853 1.00 68.09 ? 155 LYS A N     1 
ATOM   1111  C  CA    . LYS A  1 155 ? 96.126  121.049 121.775 1.00 68.09 ? 155 LYS A CA    1 
ATOM   1112  C  C     . LYS A  1 155 ? 97.573  120.866 122.209 1.00 68.09 ? 155 LYS A C     1 
ATOM   1113  O  O     . LYS A  1 155 ? 97.938  121.210 123.337 1.00 68.09 ? 155 LYS A O     1 
ATOM   1114  C  CB    . LYS A  1 155 ? 95.861  122.507 121.386 1.00 68.09 ? 155 LYS A CB    1 
ATOM   1115  C  CG    . LYS A  1 155 ? 96.883  123.139 120.457 1.00 68.09 ? 155 LYS A CG    1 
ATOM   1116  C  CD    . LYS A  1 155 ? 96.717  122.644 119.034 1.00 68.09 ? 155 LYS A CD    1 
ATOM   1117  C  CE    . LYS A  1 155 ? 97.603  123.419 118.077 1.00 68.09 ? 155 LYS A CE    1 
ATOM   1118  N  NZ    . LYS A  1 155 ? 97.648  122.784 116.733 1.00 68.09 ? 155 LYS A NZ    1 
ATOM   1119  N  N     . SER A  1 156 ? 98.383  120.298 121.317 1.00 60.31 ? 156 SER A N     1 
ATOM   1120  C  CA    . SER A  1 156 ? 99.799  120.099 121.592 1.00 60.31 ? 156 SER A CA    1 
ATOM   1121  C  C     . SER A  1 156 ? 100.522 121.434 121.710 1.00 60.31 ? 156 SER A C     1 
ATOM   1122  O  O     . SER A  1 156 ? 100.239 122.379 120.969 1.00 60.31 ? 156 SER A O     1 
ATOM   1123  C  CB    . SER A  1 156 ? 100.437 119.260 120.488 1.00 60.31 ? 156 SER A CB    1 
ATOM   1124  O  OG    . SER A  1 156 ? 101.827 119.112 120.705 1.00 60.31 ? 156 SER A OG    1 
ATOM   1125  N  N     . LEU A  1 157 ? 101.456 121.512 122.658 1.00 57.37 ? 157 LEU A N     1 
ATOM   1126  C  CA    . LEU A  1 157 ? 102.206 122.746 122.850 1.00 57.37 ? 157 LEU A CA    1 
ATOM   1127  C  C     . LEU A  1 157 ? 103.242 122.949 121.756 1.00 57.37 ? 157 LEU A C     1 
ATOM   1128  O  O     . LEU A  1 157 ? 103.421 124.072 121.273 1.00 57.37 ? 157 LEU A O     1 
ATOM   1129  C  CB    . LEU A  1 157 ? 102.888 122.749 124.216 1.00 57.37 ? 157 LEU A CB    1 
ATOM   1130  C  CG    . LEU A  1 157 ? 102.004 123.018 125.431 1.00 57.37 ? 157 LEU A CG    1 
ATOM   1131  C  CD1   . LEU A  1 157 ? 102.859 123.233 126.665 1.00 57.37 ? 157 LEU A CD1   1 
ATOM   1132  C  CD2   . LEU A  1 157 ? 101.110 124.214 125.183 1.00 57.37 ? 157 LEU A CD2   1 
ATOM   1133  N  N     . LEU A  1 158 ? 103.929 121.875 121.355 1.00 53.23 ? 158 LEU A N     1 
ATOM   1134  C  CA    . LEU A  1 158 ? 105.009 121.997 120.383 1.00 53.23 ? 158 LEU A CA    1 
ATOM   1135  C  C     . LEU A  1 158 ? 104.489 122.349 118.997 1.00 53.23 ? 158 LEU A C     1 
ATOM   1136  O  O     . LEU A  1 158 ? 105.157 123.079 118.258 1.00 53.23 ? 158 LEU A O     1 
ATOM   1137  C  CB    . LEU A  1 158 ? 105.817 120.704 120.329 1.00 53.23 ? 158 LEU A CB    1 
ATOM   1138  C  CG    . LEU A  1 158 ? 107.198 120.836 119.690 1.00 53.23 ? 158 LEU A CG    1 
ATOM   1139  C  CD1   . LEU A  1 158 ? 108.119 121.627 120.598 1.00 53.23 ? 158 LEU A CD1   1 
ATOM   1140  C  CD2   . LEU A  1 158 ? 107.781 119.471 119.381 1.00 53.23 ? 158 LEU A CD2   1 
ATOM   1141  N  N     . ARG A  1 159 ? 103.294 121.869 118.641 1.00 57.27 ? 159 ARG A N     1 
ATOM   1142  C  CA    . ARG A  1 159 ? 102.716 122.201 117.343 1.00 57.27 ? 159 ARG A CA    1 
ATOM   1143  C  C     . ARG A  1 159 ? 102.359 123.679 117.256 1.00 57.27 ? 159 ARG A C     1 
ATOM   1144  O  O     . ARG A  1 159 ? 102.636 124.333 116.243 1.00 57.27 ? 159 ARG A O     1 
ATOM   1145  C  CB    . ARG A  1 159 ? 101.485 121.337 117.087 1.00 57.27 ? 159 ARG A CB    1 
ATOM   1146  C  CG    . ARG A  1 159 ? 101.188 121.110 115.624 1.00 57.27 ? 159 ARG A CG    1 
ATOM   1147  C  CD    . ARG A  1 159 ? 102.103 120.049 115.050 1.00 57.27 ? 159 ARG A CD    1 
ATOM   1148  N  NE    . ARG A  1 159 ? 101.875 118.740 115.652 1.00 57.27 ? 159 ARG A NE    1 
ATOM   1149  C  CZ    . ARG A  1 159 ? 100.959 117.874 115.231 1.00 57.27 ? 159 ARG A CZ    1 
ATOM   1150  N  NH1   . ARG A  1 159 ? 100.179 118.178 114.205 1.00 57.27 ? 159 ARG A NH1   1 
ATOM   1151  N  NH2   . ARG A  1 159 ? 100.824 116.704 115.836 1.00 57.27 ? 159 ARG A NH2   1 
ATOM   1152  N  N     . ARG A  1 160 ? 101.769 124.229 118.319 1.00 65.91 ? 160 ARG A N     1 
ATOM   1153  C  CA    . ARG A  1 160 ? 101.440 125.648 118.325 1.00 65.91 ? 160 ARG A CA    1 
ATOM   1154  C  C     . ARG A  1 160 ? 102.682 126.513 118.480 1.00 65.91 ? 160 ARG A C     1 
ATOM   1155  O  O     . ARG A  1 160 ? 102.689 127.664 118.035 1.00 65.91 ? 160 ARG A O     1 
ATOM   1156  C  CB    . ARG A  1 160 ? 100.438 125.955 119.435 1.00 65.91 ? 160 ARG A CB    1 
ATOM   1157  C  CG    . ARG A  1 160 ? 99.529  127.131 119.129 1.00 65.91 ? 160 ARG A CG    1 
ATOM   1158  C  CD    . ARG A  1 160 ? 98.824  126.946 117.793 1.00 65.91 ? 160 ARG A CD    1 
ATOM   1159  N  NE    . ARG A  1 160 ? 97.694  127.856 117.634 1.00 65.91 ? 160 ARG A NE    1 
ATOM   1160  C  CZ    . ARG A  1 160 ? 97.795  129.104 117.189 1.00 65.91 ? 160 ARG A CZ    1 
ATOM   1161  N  NH1   . ARG A  1 160 ? 98.977  129.600 116.851 1.00 65.91 ? 160 ARG A NH1   1 
ATOM   1162  N  NH2   . ARG A  1 160 ? 96.710  129.857 117.079 1.00 65.91 ? 160 ARG A NH2   1 
ATOM   1163  N  N     . LEU A  1 161 ? 103.737 125.986 119.106 1.00 58.19 ? 161 LEU A N     1 
ATOM   1164  C  CA    . LEU A  1 161 ? 104.985 126.737 119.176 1.00 58.19 ? 161 LEU A CA    1 
ATOM   1165  C  C     . LEU A  1 161 ? 105.718 126.724 117.842 1.00 58.19 ? 161 LEU A C     1 
ATOM   1166  O  O     . LEU A  1 161 ? 106.458 127.665 117.533 1.00 58.19 ? 161 LEU A O     1 
ATOM   1167  C  CB    . LEU A  1 161 ? 105.877 126.174 120.279 1.00 58.19 ? 161 LEU A CB    1 
ATOM   1168  C  CG    . LEU A  1 161 ? 105.548 126.550 121.724 1.00 58.19 ? 161 LEU A CG    1 
ATOM   1169  C  CD1   . LEU A  1 161 ? 106.226 125.588 122.676 1.00 58.19 ? 161 LEU A CD1   1 
ATOM   1170  C  CD2   . LEU A  1 161 ? 105.964 127.969 122.029 1.00 58.19 ? 161 LEU A CD2   1 
ATOM   1171  N  N     . LEU A  1 162 ? 105.531 125.672 117.044 1.00 55.77 ? 162 LEU A N     1 
ATOM   1172  C  CA    . LEU A  1 162 ? 106.156 125.608 115.729 1.00 55.77 ? 162 LEU A CA    1 
ATOM   1173  C  C     . LEU A  1 162 ? 105.400 126.443 114.704 1.00 55.77 ? 162 LEU A C     1 
ATOM   1174  O  O     . LEU A  1 162 ? 106.020 127.103 113.863 1.00 55.77 ? 162 LEU A O     1 
ATOM   1175  C  CB    . LEU A  1 162 ? 106.244 124.155 115.260 1.00 55.77 ? 162 LEU A CB    1 
ATOM   1176  C  CG    . LEU A  1 162 ? 107.463 123.344 115.693 1.00 55.77 ? 162 LEU A CG    1 
ATOM   1177  C  CD1   . LEU A  1 162 ? 107.183 121.862 115.552 1.00 55.77 ? 162 LEU A CD1   1 
ATOM   1178  C  CD2   . LEU A  1 162 ? 108.670 123.731 114.868 1.00 55.77 ? 162 LEU A CD2   1 
ATOM   1179  N  N     . THR A  1 163 ? 104.065 126.423 114.752 1.00 62.26 ? 163 THR A N     1 
ATOM   1180  C  CA    . THR A  1 163 ? 103.287 127.129 113.738 1.00 62.26 ? 163 THR A CA    1 
ATOM   1181  C  C     . THR A  1 163 ? 103.291 128.635 113.970 1.00 62.26 ? 163 THR A C     1 
ATOM   1182  O  O     . THR A  1 163 ? 103.248 129.413 113.011 1.00 62.26 ? 163 THR A O     1 
ATOM   1183  C  CB    . THR A  1 163 ? 101.854 126.600 113.704 1.00 62.26 ? 163 THR A CB    1 
ATOM   1184  O  OG1   . THR A  1 163 ? 101.320 126.573 115.033 1.00 62.26 ? 163 THR A OG1   1 
ATOM   1185  C  CG2   . THR A  1 163 ? 101.817 125.200 113.111 1.00 62.26 ? 163 THR A CG2   1 
ATOM   1186  N  N     . SER A  1 164 ? 103.342 129.069 115.226 1.00 62.68 ? 164 SER A N     1 
ATOM   1187  C  CA    . SER A  1 164 ? 103.336 130.494 115.532 1.00 62.68 ? 164 SER A CA    1 
ATOM   1188  C  C     . SER A  1 164 ? 104.727 131.116 115.504 1.00 62.68 ? 164 SER A C     1 
ATOM   1189  O  O     . SER A  1 164 ? 104.857 132.312 115.782 1.00 62.68 ? 164 SER A O     1 
ATOM   1190  C  CB    . SER A  1 164 ? 102.687 130.743 116.895 1.00 62.68 ? 164 SER A CB    1 
ATOM   1191  O  OG    . SER A  1 164 ? 103.644 130.664 117.935 1.00 62.68 ? 164 SER A OG    1 
ATOM   1192  N  N     . GLY A  1 165 ? 105.758 130.343 115.182 1.00 60.05 ? 165 GLY A N     1 
ATOM   1193  C  CA    . GLY A  1 165 ? 107.089 130.900 115.020 1.00 60.05 ? 165 GLY A CA    1 
ATOM   1194  C  C     . GLY A  1 165 ? 107.811 131.245 116.304 1.00 60.05 ? 165 GLY A C     1 
ATOM   1195  O  O     . GLY A  1 165 ? 108.478 132.285 116.373 1.00 60.05 ? 165 GLY A O     1 
ATOM   1196  N  N     . ILE A  1 166 ? 107.700 130.402 117.324 1.00 61.62 ? 166 ILE A N     1 
ATOM   1197  C  CA    . ILE A  1 166 ? 108.451 130.555 118.562 1.00 61.62 ? 166 ILE A CA    1 
ATOM   1198  C  C     . ILE A  1 166 ? 109.540 129.496 118.679 1.00 61.62 ? 166 ILE A C     1 
ATOM   1199  O  O     . ILE A  1 166 ? 110.706 129.814 118.915 1.00 61.62 ? 166 ILE A O     1 
ATOM   1200  C  CB    . ILE A  1 166 ? 107.512 130.524 119.788 1.00 61.62 ? 166 ILE A CB    1 
ATOM   1201  C  CG1   . ILE A  1 166 ? 106.388 131.545 119.617 1.00 61.62 ? 166 ILE A CG1   1 
ATOM   1202  C  CG2   . ILE A  1 166 ? 108.293 130.796 121.060 1.00 61.62 ? 166 ILE A CG2   1 
ATOM   1203  C  CD1   . ILE A  1 166 ? 105.454 131.636 120.804 1.00 61.62 ? 166 ILE A CD1   1 
ATOM   1204  N  N     . VAL A  1 167 ? 109.177 128.229 118.513 1.00 54.02 ? 167 VAL A N     1 
ATOM   1205  C  CA    . VAL A  1 167 ? 110.150 127.153 118.364 1.00 54.02 ? 167 VAL A CA    1 
ATOM   1206  C  C     . VAL A  1 167 ? 110.451 127.037 116.876 1.00 54.02 ? 167 VAL A C     1 
ATOM   1207  O  O     . VAL A  1 167 ? 109.562 126.737 116.076 1.00 54.02 ? 167 VAL A O     1 
ATOM   1208  C  CB    . VAL A  1 167 ? 109.628 125.831 118.935 1.00 54.02 ? 167 VAL A CB    1 
ATOM   1209  C  CG1   . VAL A  1 167 ? 110.508 124.682 118.492 1.00 54.02 ? 167 VAL A CG1   1 
ATOM   1210  C  CG2   . VAL A  1 167 ? 109.577 125.892 120.445 1.00 54.02 ? 167 VAL A CG2   1 
ATOM   1211  N  N     . ILE A  1 168 ? 111.702 127.300 116.497 1.00 49.56 ? 168 ILE A N     1 
ATOM   1212  C  CA    . ILE A  1 168 ? 112.063 127.275 115.083 1.00 49.56 ? 168 ILE A CA    1 
ATOM   1213  C  C     . ILE A  1 168 ? 112.168 125.840 114.586 1.00 49.56 ? 168 ILE A C     1 
ATOM   1214  O  O     . ILE A  1 168 ? 111.511 125.456 113.612 1.00 49.56 ? 168 ILE A O     1 
ATOM   1215  C  CB    . ILE A  1 168 ? 113.368 128.054 114.846 1.00 49.56 ? 168 ILE A CB    1 
ATOM   1216  C  CG1   . ILE A  1 168 ? 113.182 129.524 115.227 1.00 49.56 ? 168 ILE A CG1   1 
ATOM   1217  C  CG2   . ILE A  1 168 ? 113.825 127.903 113.404 1.00 49.56 ? 168 ILE A CG2   1 
ATOM   1218  C  CD1   . ILE A  1 168 ? 112.358 130.322 114.238 1.00 49.56 ? 168 ILE A CD1   1 
ATOM   1219  N  N     . GLN A  1 169 ? 112.986 125.025 115.247 1.00 41.97 ? 169 GLN A N     1 
ATOM   1220  C  CA    . GLN A  1 169 ? 113.138 123.639 114.837 1.00 41.97 ? 169 GLN A CA    1 
ATOM   1221  C  C     . GLN A  1 169 ? 113.502 122.773 116.033 1.00 41.97 ? 169 GLN A C     1 
ATOM   1222  O  O     . GLN A  1 169 ? 114.168 123.216 116.973 1.00 41.97 ? 169 GLN A O     1 
ATOM   1223  C  CB    . GLN A  1 169 ? 114.196 123.486 113.739 1.00 41.97 ? 169 GLN A CB    1 
ATOM   1224  C  CG    . GLN A  1 169 ? 115.540 124.088 114.076 1.00 41.97 ? 169 GLN A CG    1 
ATOM   1225  C  CD    . GLN A  1 169 ? 116.401 124.292 112.851 1.00 41.97 ? 169 GLN A CD    1 
ATOM   1226  O  OE1   . GLN A  1 169 ? 116.177 123.672 111.813 1.00 41.97 ? 169 GLN A OE1   1 
ATOM   1227  N  NE2   . GLN A  1 169 ? 117.392 125.166 112.962 1.00 41.97 ? 169 GLN A NE2   1 
ATOM   1228  N  N     . VAL A  1 170 ? 113.052 121.525 115.974 1.00 34.15 ? 170 VAL A N     1 
ATOM   1229  C  CA    . VAL A  1 170 ? 113.371 120.499 116.955 1.00 34.15 ? 170 VAL A CA    1 
ATOM   1230  C  C     . VAL A  1 170 ? 114.077 119.389 116.193 1.00 34.15 ? 170 VAL A C     1 
ATOM   1231  O  O     . VAL A  1 170 ? 113.463 118.720 115.352 1.00 34.15 ? 170 VAL A O     1 
ATOM   1232  C  CB    . VAL A  1 170 ? 112.115 119.980 117.667 1.00 34.15 ? 170 VAL A CB    1 
ATOM   1233  C  CG1   . VAL A  1 170 ? 112.426 118.740 118.475 1.00 34.15 ? 170 VAL A CG1   1 
ATOM   1234  C  CG2   . VAL A  1 170 ? 111.536 121.055 118.556 1.00 34.15 ? 170 VAL A CG2   1 
ATOM   1235  N  N     . PHE A  1 171 ? 115.368 119.204 116.457 1.00 33.30 ? 171 PHE A N     1 
ATOM   1236  C  CA    . PHE A  1 171 ? 116.108 118.223 115.680 1.00 33.30 ? 171 PHE A CA    1 
ATOM   1237  C  C     . PHE A  1 171 ? 116.989 117.368 116.580 1.00 33.30 ? 171 PHE A C     1 
ATOM   1238  O  O     . PHE A  1 171 ? 117.543 117.868 117.561 1.00 33.30 ? 171 PHE A O     1 
ATOM   1239  C  CB    . PHE A  1 171 ? 116.965 118.896 114.589 1.00 33.30 ? 171 PHE A CB    1 
ATOM   1240  C  CG    . PHE A  1 171 ? 117.992 119.870 115.106 1.00 33.30 ? 171 PHE A CG    1 
ATOM   1241  C  CD1   . PHE A  1 171 ? 117.664 121.199 115.313 1.00 33.30 ? 171 PHE A CD1   1 
ATOM   1242  C  CD2   . PHE A  1 171 ? 119.300 119.469 115.326 1.00 33.30 ? 171 PHE A CD2   1 
ATOM   1243  C  CE1   . PHE A  1 171 ? 118.608 122.097 115.768 1.00 33.30 ? 171 PHE A CE1   1 
ATOM   1244  C  CE2   . PHE A  1 171 ? 120.245 120.361 115.782 1.00 33.30 ? 171 PHE A CE2   1 
ATOM   1245  C  CZ    . PHE A  1 171 ? 119.899 121.677 115.999 1.00 33.30 ? 171 PHE A CZ    1 
ATOM   1246  N  N     . PRO A  1 172 ? 117.136 116.085 116.279 1.00 31.46 ? 172 PRO A N     1 
ATOM   1247  C  CA    . PRO A  1 172 ? 118.036 115.241 117.064 1.00 31.46 ? 172 PRO A CA    1 
ATOM   1248  C  C     . PRO A  1 172 ? 119.487 115.475 116.668 1.00 31.46 ? 172 PRO A C     1 
ATOM   1249  O  O     . PRO A  1 172 ? 119.794 116.102 115.655 1.00 31.46 ? 172 PRO A O     1 
ATOM   1250  C  CB    . PRO A  1 172 ? 117.581 113.827 116.713 1.00 31.46 ? 172 PRO A CB    1 
ATOM   1251  C  CG    . PRO A  1 172 ? 117.019 113.946 115.373 1.00 31.46 ? 172 PRO A CG    1 
ATOM   1252  C  CD    . PRO A  1 172 ? 116.419 115.312 115.255 1.00 31.46 ? 172 PRO A CD    1 
ATOM   1253  N  N     . LEU A  1 173 ? 120.384 114.954 117.497 1.00 36.49 ? 173 LEU A N     1 
ATOM   1254  C  CA    . LEU A  1 173 ? 121.812 115.179 117.344 1.00 36.49 ? 173 LEU A CA    1 
ATOM   1255  C  C     . LEU A  1 173 ? 122.486 113.977 116.699 1.00 36.49 ? 173 LEU A C     1 
ATOM   1256  O  O     . LEU A  1 173 ? 122.172 112.828 117.021 1.00 36.49 ? 173 LEU A O     1 
ATOM   1257  C  CB    . LEU A  1 173 ? 122.465 115.460 118.697 1.00 36.49 ? 173 LEU A CB    1 
ATOM   1258  C  CG    . LEU A  1 173 ? 122.562 116.915 119.148 1.00 36.49 ? 173 LEU A CG    1 
ATOM   1259  C  CD1   . LEU A  1 173 ? 123.470 117.031 120.356 1.00 36.49 ? 173 LEU A CD1   1 
ATOM   1260  C  CD2   . LEU A  1 173 ? 123.058 117.802 118.024 1.00 36.49 ? 173 LEU A CD2   1 
ATOM   1261  N  N     . HIS A  1 174 ? 123.416 114.251 115.788 1.00 38.10 ? 174 HIS A N     1 
ATOM   1262  C  CA    . HIS A  1 174 ? 124.259 113.199 115.240 1.00 38.10 ? 174 HIS A CA    1 
ATOM   1263  C  C     . HIS A  1 174 ? 125.258 112.735 116.288 1.00 38.10 ? 174 HIS A C     1 
ATOM   1264  O  O     . HIS A  1 174 ? 125.719 113.521 117.120 1.00 38.10 ? 174 HIS A O     1 
ATOM   1265  C  CB    . HIS A  1 174 ? 125.009 113.696 114.007 1.00 38.10 ? 174 HIS A CB    1 
ATOM   1266  C  CG    . HIS A  1 174 ? 124.305 113.430 112.716 1.00 38.10 ? 174 HIS A CG    1 
ATOM   1267  N  ND1   . HIS A  1 174 ? 124.197 112.168 112.174 1.00 38.10 ? 174 HIS A ND1   1 
ATOM   1268  C  CD2   . HIS A  1 174 ? 123.692 114.266 111.846 1.00 38.10 ? 174 HIS A CD2   1 
ATOM   1269  C  CE1   . HIS A  1 174 ? 123.538 112.236 111.032 1.00 38.10 ? 174 HIS A CE1   1 
ATOM   1270  N  NE2   . HIS A  1 174 ? 123.220 113.499 110.810 1.00 38.10 ? 174 HIS A NE2   1 
ATOM   1271  N  N     . ASP A  1 175 ? 125.594 111.452 116.247 1.00 44.16 ? 175 ASP A N     1 
ATOM   1272  C  CA    . ASP A  1 175 ? 126.628 110.887 117.105 1.00 44.16 ? 175 ASP A CA    1 
ATOM   1273  C  C     . ASP A  1 175 ? 127.864 110.676 116.242 1.00 44.16 ? 175 ASP A C     1 
ATOM   1274  O  O     . ASP A  1 175 ? 127.902 109.758 115.418 1.00 44.16 ? 175 ASP A O     1 
ATOM   1275  C  CB    . ASP A  1 175 ? 126.160 109.583 117.745 1.00 44.16 ? 175 ASP A CB    1 
ATOM   1276  C  CG    . ASP A  1 175 ? 127.134 109.059 118.782 1.00 44.16 ? 175 ASP A CG    1 
ATOM   1277  O  OD1   . ASP A  1 175 ? 127.044 107.866 119.136 1.00 44.16 ? 175 ASP A OD1   1 
ATOM   1278  O  OD2   . ASP A  1 175 ? 127.985 109.842 119.254 1.00 44.16 ? 175 ASP A OD2   1 
ATOM   1279  N  N     . SER A  1 176 ? 128.874 111.520 116.438 1.00 49.40 ? 176 SER A N     1 
ATOM   1280  C  CA    . SER A  1 176 ? 130.042 111.556 115.567 1.00 49.40 ? 176 SER A CA    1 
ATOM   1281  C  C     . SER A  1 176 ? 130.977 110.365 115.744 1.00 49.40 ? 176 SER A C     1 
ATOM   1282  O  O     . SER A  1 176 ? 131.905 110.210 114.945 1.00 49.40 ? 176 SER A O     1 
ATOM   1283  C  CB    . SER A  1 176 ? 130.818 112.854 115.796 1.00 49.40 ? 176 SER A CB    1 
ATOM   1284  O  OG    . SER A  1 176 ? 131.354 112.903 117.106 1.00 49.40 ? 176 SER A OG    1 
ATOM   1285  N  N     . GLU A  1 177 ? 130.765 109.524 116.755 1.00 51.35 ? 177 GLU A N     1 
ATOM   1286  C  CA    . GLU A  1 177 ? 131.577 108.335 116.948 1.00 51.35 ? 177 GLU A CA    1 
ATOM   1287  C  C     . GLU A  1 177 ? 130.862 107.047 116.574 1.00 51.35 ? 177 GLU A C     1 
ATOM   1288  O  O     . GLU A  1 177 ? 131.525 106.015 116.433 1.00 51.35 ? 177 GLU A O     1 
ATOM   1289  C  CB    . GLU A  1 177 ? 132.054 108.240 118.404 1.00 51.35 ? 177 GLU A CB    1 
ATOM   1290  C  CG    . GLU A  1 177 ? 132.842 109.450 118.869 1.00 51.35 ? 177 GLU A CG    1 
ATOM   1291  C  CD    . GLU A  1 177 ? 132.721 109.683 120.359 1.00 51.35 ? 177 GLU A CD    1 
ATOM   1292  O  OE1   . GLU A  1 177 ? 131.664 109.342 120.929 1.00 51.35 ? 177 GLU A OE1   1 
ATOM   1293  O  OE2   . GLU A  1 177 ? 133.682 110.209 120.959 1.00 51.35 ? 177 GLU A OE2   1 
ATOM   1294  N  N     . ALA A  1 178 ? 129.539 107.069 116.421 1.00 43.72 ? 178 ALA A N     1 
ATOM   1295  C  CA    . ALA A  1 178 ? 128.812 105.929 115.885 1.00 43.72 ? 178 ALA A CA    1 
ATOM   1296  C  C     . ALA A  1 178 ? 128.456 106.098 114.419 1.00 43.72 ? 178 ALA A C     1 
ATOM   1297  O  O     . ALA A  1 178 ? 128.064 105.120 113.774 1.00 43.72 ? 178 ALA A O     1 
ATOM   1298  C  CB    . ALA A  1 178 ? 127.531 105.679 116.686 1.00 43.72 ? 178 ALA A CB    1 
ATOM   1299  N  N     . LEU A  1 179 ? 128.574 107.314 113.886 1.00 40.87 ? 179 LEU A N     1 
ATOM   1300  C  CA    . LEU A  1 179 ? 128.360 107.525 112.461 1.00 40.87 ? 179 LEU A CA    1 
ATOM   1301  C  C     . LEU A  1 179 ? 129.579 107.090 111.659 1.00 40.87 ? 179 LEU A C     1 
ATOM   1302  O  O     . LEU A  1 179 ? 129.447 106.620 110.524 1.00 40.87 ? 179 LEU A O     1 
ATOM   1303  C  CB    . LEU A  1 179 ? 128.029 108.992 112.199 1.00 40.87 ? 179 LEU A CB    1 
ATOM   1304  C  CG    . LEU A  1 179 ? 127.630 109.383 110.781 1.00 40.87 ? 179 LEU A CG    1 
ATOM   1305  C  CD1   . LEU A  1 179 ? 126.496 108.501 110.311 1.00 40.87 ? 179 LEU A CD1   1 
ATOM   1306  C  CD2   . LEU A  1 179 ? 127.233 110.843 110.733 1.00 40.87 ? 179 LEU A CD2   1 
ATOM   1307  N  N     . LYS A  1 180 ? 130.773 107.232 112.239 1.00 47.33 ? 180 LYS A N     1 
ATOM   1308  C  CA    . LYS A  1 180 ? 131.999 106.817 111.563 1.00 47.33 ? 180 LYS A CA    1 
ATOM   1309  C  C     . LYS A  1 180 ? 132.077 105.298 111.456 1.00 47.33 ? 180 LYS A C     1 
ATOM   1310  O  O     . LYS A  1 180 ? 132.473 104.758 110.414 1.00 47.33 ? 180 LYS A O     1 
ATOM   1311  C  CB    . LYS A  1 180 ? 133.205 107.373 112.322 1.00 47.33 ? 180 LYS A CB    1 
ATOM   1312  C  CG    . LYS A  1 180 ? 134.583 106.998 111.791 1.00 47.33 ? 180 LYS A CG    1 
ATOM   1313  C  CD    . LYS A  1 180 ? 134.743 107.248 110.301 1.00 47.33 ? 180 LYS A CD    1 
ATOM   1314  C  CE    . LYS A  1 180 ? 136.135 106.839 109.832 1.00 47.33 ? 180 LYS A CE    1 
ATOM   1315  N  NZ    . LYS A  1 180 ? 137.219 107.338 110.721 1.00 47.33 ? 180 LYS A NZ    1 
ATOM   1316  N  N     . LYS A  1 181 ? 131.672 104.594 112.511 1.00 45.89 ? 181 LYS A N     1 
ATOM   1317  C  CA    . LYS A  1 181 ? 131.648 103.139 112.493 1.00 45.89 ? 181 LYS A CA    1 
ATOM   1318  C  C     . LYS A  1 181 ? 130.519 102.579 111.643 1.00 45.89 ? 181 LYS A C     1 
ATOM   1319  O  O     . LYS A  1 181 ? 130.552 101.392 111.305 1.00 45.89 ? 181 LYS A O     1 
ATOM   1320  C  CB    . LYS A  1 181 ? 131.546 102.607 113.921 1.00 45.89 ? 181 LYS A CB    1 
ATOM   1321  C  CG    . LYS A  1 181 ? 132.566 103.231 114.855 1.00 45.89 ? 181 LYS A CG    1 
ATOM   1322  C  CD    . LYS A  1 181 ? 132.578 102.560 116.214 1.00 45.89 ? 181 LYS A CD    1 
ATOM   1323  C  CE    . LYS A  1 181 ? 133.418 103.354 117.200 1.00 45.89 ? 181 LYS A CE    1 
ATOM   1324  N  NZ    . LYS A  1 181 ? 134.601 103.967 116.538 1.00 45.89 ? 181 LYS A NZ    1 
ATOM   1325  N  N     . LEU A  1 182 ? 129.523 103.395 111.297 1.00 39.98 ? 182 LEU A N     1 
ATOM   1326  C  CA    . LEU A  1 182 ? 128.548 102.993 110.291 1.00 39.98 ? 182 LEU A CA    1 
ATOM   1327  C  C     . LEU A  1 182 ? 129.088 103.262 108.893 1.00 39.98 ? 182 LEU A C     1 
ATOM   1328  O  O     . LEU A  1 182 ? 128.907 102.455 107.975 1.00 39.98 ? 182 LEU A O     1 
ATOM   1329  C  CB    . LEU A  1 182 ? 127.227 103.729 110.521 1.00 39.98 ? 182 LEU A CB    1 
ATOM   1330  C  CG    . LEU A  1 182 ? 126.165 103.640 109.426 1.00 39.98 ? 182 LEU A CG    1 
ATOM   1331  C  CD1   . LEU A  1 182 ? 125.677 102.221 109.268 1.00 39.98 ? 182 LEU A CD1   1 
ATOM   1332  C  CD2   . LEU A  1 182 ? 125.008 104.567 109.730 1.00 39.98 ? 182 LEU A CD2   1 
ATOM   1333  N  N     . GLU A  1 183 ? 129.782 104.392 108.725 1.00 43.87 ? 183 GLU A N     1 
ATOM   1334  C  CA    . GLU A  1 183 ? 130.324 104.776 107.425 1.00 43.87 ? 183 GLU A CA    1 
ATOM   1335  C  C     . GLU A  1 183 ? 131.447 103.856 106.971 1.00 43.87 ? 183 GLU A C     1 
ATOM   1336  O  O     . GLU A  1 183 ? 131.699 103.747 105.765 1.00 43.87 ? 183 GLU A O     1 
ATOM   1337  C  CB    . GLU A  1 183 ? 130.838 106.212 107.477 1.00 43.87 ? 183 GLU A CB    1 
ATOM   1338  C  CG    . GLU A  1 183 ? 129.811 107.264 107.154 1.00 43.87 ? 183 GLU A CG    1 
ATOM   1339  C  CD    . GLU A  1 183 ? 130.431 108.636 107.000 1.00 43.87 ? 183 GLU A CD    1 
ATOM   1340  O  OE1   . GLU A  1 183 ? 131.520 108.734 106.399 1.00 43.87 ? 183 GLU A OE1   1 
ATOM   1341  O  OE2   . GLU A  1 183 ? 129.834 109.617 107.487 1.00 43.87 ? 183 GLU A OE2   1 
ATOM   1342  N  N     . ASP A  1 184 ? 132.146 103.215 107.910 1.00 47.08 ? 184 ASP A N     1 
ATOM   1343  C  CA    . ASP A  1 184 ? 133.219 102.300 107.529 1.00 47.08 ? 184 ASP A CA    1 
ATOM   1344  C  C     . ASP A  1 184 ? 132.674 101.050 106.848 1.00 47.08 ? 184 ASP A C     1 
ATOM   1345  O  O     . ASP A  1 184 ? 133.354 100.435 106.020 1.00 47.08 ? 184 ASP A O     1 
ATOM   1346  C  CB    . ASP A  1 184 ? 134.050 101.922 108.753 1.00 47.08 ? 184 ASP A CB    1 
ATOM   1347  C  CG    . ASP A  1 184 ? 134.879 103.075 109.262 1.00 47.08 ? 184 ASP A CG    1 
ATOM   1348  O  OD1   . ASP A  1 184 ? 135.425 102.976 110.381 1.00 47.08 ? 184 ASP A OD1   1 
ATOM   1349  O  OD2   . ASP A  1 184 ? 134.981 104.083 108.534 1.00 47.08 ? 184 ASP A OD2   1 
ATOM   1350  N  N     . THR A  1 185 ? 131.449 100.657 107.185 1.00 42.52 ? 185 THR A N     1 
ATOM   1351  C  CA    . THR A  1 185 ? 130.839 99.465  106.615 1.00 42.52 ? 185 THR A CA    1 
ATOM   1352  C  C     . THR A  1 185 ? 129.692 99.773  105.662 1.00 42.52 ? 185 THR A C     1 
ATOM   1353  O  O     . THR A  1 185 ? 128.938 98.861  105.315 1.00 42.52 ? 185 THR A O     1 
ATOM   1354  C  CB    . THR A  1 185 ? 130.333 98.542  107.728 1.00 42.52 ? 185 THR A CB    1 
ATOM   1355  O  OG1   . THR A  1 185 ? 129.065 99.013  108.198 1.00 42.52 ? 185 THR A OG1   1 
ATOM   1356  C  CG2   . THR A  1 185 ? 131.316 98.506  108.889 1.00 42.52 ? 185 THR A CG2   1 
ATOM   1357  N  N     . TRP A  1 186 ? 129.550 101.021 105.218 1.00 35.16 ? 186 TRP A N     1 
ATOM   1358  C  CA    . TRP A  1 186 ? 128.420 101.396 104.376 1.00 35.16 ? 186 TRP A CA    1 
ATOM   1359  C  C     . TRP A  1 186 ? 128.858 101.672 102.947 1.00 35.16 ? 186 TRP A C     1 
ATOM   1360  O  O     . TRP A  1 186 ? 128.218 101.211 101.998 1.00 35.16 ? 186 TRP A O     1 
ATOM   1361  C  CB    . TRP A  1 186 ? 127.717 102.627 104.948 1.00 35.16 ? 186 TRP A CB    1 
ATOM   1362  C  CG    . TRP A  1 186 ? 126.294 102.770 104.533 1.00 35.16 ? 186 TRP A CG    1 
ATOM   1363  C  CD1   . TRP A  1 186 ? 125.628 102.013 103.623 1.00 35.16 ? 186 TRP A CD1   1 
ATOM   1364  C  CD2   . TRP A  1 186 ? 125.351 103.725 105.029 1.00 35.16 ? 186 TRP A CD2   1 
ATOM   1365  N  NE1   . TRP A  1 186 ? 124.334 102.442 103.511 1.00 35.16 ? 186 TRP A NE1   1 
ATOM   1366  C  CE2   . TRP A  1 186 ? 124.137 103.491 104.367 1.00 35.16 ? 186 TRP A CE2   1 
ATOM   1367  C  CE3   . TRP A  1 186 ? 125.417 104.758 105.966 1.00 35.16 ? 186 TRP A CE3   1 
ATOM   1368  C  CZ2   . TRP A  1 186 ? 122.998 104.248 104.610 1.00 35.16 ? 186 TRP A CZ2   1 
ATOM   1369  C  CZ3   . TRP A  1 186 ? 124.285 105.506 106.206 1.00 35.16 ? 186 TRP A CZ3   1 
ATOM   1370  C  CH2   . TRP A  1 186 ? 123.093 105.250 105.531 1.00 35.16 ? 186 TRP A CH2   1 
ATOM   1371  N  N     . TYR A  1 187 ? 129.938 102.429 102.783 1.00 43.55 ? 187 TYR A N     1 
ATOM   1372  C  CA    . TYR A  1 187 ? 130.397 102.839 101.462 1.00 43.55 ? 187 TYR A CA    1 
ATOM   1373  C  C     . TYR A  1 187 ? 131.054 101.655 100.765 1.00 43.55 ? 187 TYR A C     1 
ATOM   1374  O  O     . TYR A  1 187 ? 132.207 101.318 101.049 1.00 43.55 ? 187 TYR A O     1 
ATOM   1375  C  CB    . TYR A  1 187 ? 131.360 104.013 101.580 1.00 43.55 ? 187 TYR A CB    1 
ATOM   1376  C  CG    . TYR A  1 187 ? 130.713 105.259 102.128 1.00 43.55 ? 187 TYR A CG    1 
ATOM   1377  C  CD1   . TYR A  1 187 ? 129.387 105.552 101.849 1.00 43.55 ? 187 TYR A CD1   1 
ATOM   1378  C  CD2   . TYR A  1 187 ? 131.427 106.140 102.926 1.00 43.55 ? 187 TYR A CD2   1 
ATOM   1379  C  CE1   . TYR A  1 187 ? 128.790 106.688 102.348 1.00 43.55 ? 187 TYR A CE1   1 
ATOM   1380  C  CE2   . TYR A  1 187 ? 130.838 107.279 103.431 1.00 43.55 ? 187 TYR A CE2   1 
ATOM   1381  C  CZ    . TYR A  1 187 ? 129.519 107.546 103.138 1.00 43.55 ? 187 TYR A CZ    1 
ATOM   1382  O  OH    . TYR A  1 187 ? 128.927 108.680 103.637 1.00 43.55 ? 187 TYR A OH    1 
ATOM   1383  N  N     . THR A  1 188 ? 130.324 101.025 99.851  1.00 52.04 ? 188 THR A N     1 
ATOM   1384  C  CA    . THR A  1 188 ? 130.848 99.911  99.060  1.00 52.04 ? 188 THR A CA    1 
ATOM   1385  C  C     . THR A  1 188 ? 131.576 100.434 97.824  1.00 52.04 ? 188 THR A C     1 
ATOM   1386  O  O     . THR A  1 188 ? 131.188 100.184 96.684  1.00 52.04 ? 188 THR A O     1 
ATOM   1387  C  CB    . THR A  1 188 ? 129.719 98.962  98.669  1.00 52.04 ? 188 THR A CB    1 
ATOM   1388  O  OG1   . THR A  1 188 ? 128.972 99.530  97.585  1.00 52.04 ? 188 THR A OG1   1 
ATOM   1389  C  CG2   . THR A  1 188 ? 128.785 98.726  99.845  1.00 52.04 ? 188 THR A CG2   1 
ATOM   1390  N  N     . ARG A  1 189 ? 132.653 101.181 98.070  1.00 62.79 ? 189 ARG A N     1 
ATOM   1391  C  CA    . ARG A  1 189 ? 133.392 101.806 96.980  1.00 62.79 ? 189 ARG A CA    1 
ATOM   1392  C  C     . ARG A  1 189 ? 134.249 100.804 96.218  1.00 62.79 ? 189 ARG A C     1 
ATOM   1393  O  O     . ARG A  1 189 ? 134.558 101.030 95.043  1.00 62.79 ? 189 ARG A O     1 
ATOM   1394  C  CB    . ARG A  1 189 ? 134.264 102.940 97.522  1.00 62.79 ? 189 ARG A CB    1 
ATOM   1395  C  CG    . ARG A  1 189 ? 133.480 104.129 98.053  1.00 62.79 ? 189 ARG A CG    1 
ATOM   1396  C  CD    . ARG A  1 189 ? 134.390 105.131 98.747  1.00 62.79 ? 189 ARG A CD    1 
ATOM   1397  N  NE    . ARG A  1 189 ? 134.895 104.621 100.018 1.00 62.79 ? 189 ARG A NE    1 
ATOM   1398  C  CZ    . ARG A  1 189 ? 135.690 105.302 100.836 1.00 62.79 ? 189 ARG A CZ    1 
ATOM   1399  N  NH1   . ARG A  1 189 ? 136.076 106.531 100.520 1.00 62.79 ? 189 ARG A NH1   1 
ATOM   1400  N  NH2   . ARG A  1 189 ? 136.100 104.756 101.972 1.00 62.79 ? 189 ARG A NH2   1 
ATOM   1401  N  N     . PHE A  1 190 ? 134.639 99.704  96.859  1.00 66.67 ? 190 PHE A N     1 
ATOM   1402  C  CA    . PHE A  1 190 ? 135.493 98.717  96.211  1.00 66.67 ? 190 PHE A CA    1 
ATOM   1403  C  C     . PHE A  1 190 ? 134.719 97.877  95.202  1.00 66.67 ? 190 PHE A C     1 
ATOM   1404  O  O     . PHE A  1 190 ? 134.997 97.931  94.000  1.00 66.67 ? 190 PHE A O     1 
ATOM   1405  C  CB    . PHE A  1 190 ? 136.148 97.813  97.257  1.00 66.67 ? 190 PHE A CB    1 
ATOM   1406  N  N     . ALA A  1 191 ? 133.735 97.117  95.677  1.00 62.56 ? 191 ALA A N     1 
ATOM   1407  C  CA    . ALA A  1 191 ? 133.031 96.153  94.841  1.00 62.56 ? 191 ALA A CA    1 
ATOM   1408  C  C     . ALA A  1 191 ? 131.667 95.873  95.460  1.00 62.56 ? 191 ALA A C     1 
ATOM   1409  O  O     . ALA A  1 191 ? 131.182 96.631  96.305  1.00 62.56 ? 191 ALA A O     1 
ATOM   1410  C  CB    . ALA A  1 191 ? 133.859 94.873  94.673  1.00 62.56 ? 191 ALA A CB    1 
ATOM   1411  N  N     . LEU A  1 192 ? 131.044 94.783  95.016  1.00 56.27 ? 192 LEU A N     1 
ATOM   1412  C  CA    . LEU A  1 192 ? 129.736 94.384  95.518  1.00 56.27 ? 192 LEU A CA    1 
ATOM   1413  C  C     . LEU A  1 192 ? 129.834 93.936  96.973  1.00 56.27 ? 192 LEU A C     1 
ATOM   1414  O  O     . LEU A  1 192 ? 130.776 93.241  97.365  1.00 56.27 ? 192 LEU A O     1 
ATOM   1415  C  CB    . LEU A  1 192 ? 129.166 93.261  94.649  1.00 56.27 ? 192 LEU A CB    1 
ATOM   1416  C  CG    . LEU A  1 192 ? 127.686 92.880  94.747  1.00 56.27 ? 192 LEU A CG    1 
ATOM   1417  C  CD1   . LEU A  1 192 ? 127.144 92.584  93.359  1.00 56.27 ? 192 LEU A CD1   1 
ATOM   1418  C  CD2   . LEU A  1 192 ? 127.471 91.677  95.658  1.00 56.27 ? 192 LEU A CD2   1 
ATOM   1419  N  N     . LYS A  1 193 ? 128.844 94.336  97.771  1.00 51.52 ? 193 LYS A N     1 
ATOM   1420  C  CA    . LYS A  1 193 ? 128.846 94.092  99.209  1.00 51.52 ? 193 LYS A CA    1 
ATOM   1421  C  C     . LYS A  1 193 ? 127.427 94.202  99.752  1.00 51.52 ? 193 LYS A C     1 
ATOM   1422  O  O     . LYS A  1 193 ? 126.684 95.105  99.355  1.00 51.52 ? 193 LYS A O     1 
ATOM   1423  C  CB    . LYS A  1 193 ? 129.782 95.086  99.907  1.00 51.52 ? 193 LYS A CB    1 
ATOM   1424  C  CG    . LYS A  1 193 ? 129.715 95.103  101.422 1.00 51.52 ? 193 LYS A CG    1 
ATOM   1425  C  CD    . LYS A  1 193 ? 130.634 96.172  101.986 1.00 51.52 ? 193 LYS A CD    1 
ATOM   1426  C  CE    . LYS A  1 193 ? 130.624 96.172  103.504 1.00 51.52 ? 193 LYS A CE    1 
ATOM   1427  N  NZ    . LYS A  1 193 ? 129.330 96.660  104.051 1.00 51.52 ? 193 LYS A NZ    1 
ATOM   1428  N  N     . TYR A  1 194 ? 127.033 93.282  100.633 1.00 43.00 ? 194 TYR A N     1 
ATOM   1429  C  CA    . TYR A  1 194 ? 125.702 93.332  101.228 1.00 43.00 ? 194 TYR A CA    1 
ATOM   1430  C  C     . TYR A  1 194 ? 125.589 94.515  102.180 1.00 43.00 ? 194 TYR A C     1 
ATOM   1431  O  O     . TYR A  1 194 ? 126.449 94.721  103.041 1.00 43.00 ? 194 TYR A O     1 
ATOM   1432  C  CB    . TYR A  1 194 ? 125.397 92.032  101.971 1.00 43.00 ? 194 TYR A CB    1 
ATOM   1433  C  CG    . TYR A  1 194 ? 125.171 90.834  101.078 1.00 43.00 ? 194 TYR A CG    1 
ATOM   1434  C  CD1   . TYR A  1 194 ? 124.886 90.989  99.726  1.00 43.00 ? 194 TYR A CD1   1 
ATOM   1435  C  CD2   . TYR A  1 194 ? 125.252 89.545  101.588 1.00 43.00 ? 194 TYR A CD2   1 
ATOM   1436  C  CE1   . TYR A  1 194 ? 124.685 89.893  98.909  1.00 43.00 ? 194 TYR A CE1   1 
ATOM   1437  C  CE2   . TYR A  1 194 ? 125.053 88.442  100.779 1.00 43.00 ? 194 TYR A CE2   1 
ATOM   1438  C  CZ    . TYR A  1 194 ? 124.770 88.623  99.441  1.00 43.00 ? 194 TYR A CZ    1 
ATOM   1439  O  OH    . TYR A  1 194 ? 124.572 87.530  98.630  1.00 43.00 ? 194 TYR A OH    1 
ATOM   1440  N  N     . GLN A  1 195 ? 124.524 95.290  102.017 1.00 34.29 ? 195 GLN A N     1 
ATOM   1441  C  CA    . GLN A  1 195 ? 124.355 96.507  102.788 1.00 34.29 ? 195 GLN A CA    1 
ATOM   1442  C  C     . GLN A  1 195 ? 123.944 96.174  104.222 1.00 34.29 ? 195 GLN A C     1 
ATOM   1443  O  O     . GLN A  1 195 ? 123.082 95.322  104.445 1.00 34.29 ? 195 GLN A O     1 
ATOM   1444  C  CB    . GLN A  1 195 ? 123.301 97.393  102.134 1.00 34.29 ? 195 GLN A CB    1 
ATOM   1445  C  CG    . GLN A  1 195 ? 123.529 98.877  102.297 1.00 34.29 ? 195 GLN A CG    1 
ATOM   1446  C  CD    . GLN A  1 195 ? 122.639 99.687  101.388 1.00 34.29 ? 195 GLN A CD    1 
ATOM   1447  O  OE1   . GLN A  1 195 ? 121.754 99.149  100.734 1.00 34.29 ? 195 GLN A OE1   1 
ATOM   1448  N  NE2   . GLN A  1 195 ? 122.876 100.985 101.328 1.00 34.29 ? 195 GLN A NE2   1 
ATOM   1449  N  N     . PRO A  1 196 ? 124.560 96.822  105.217 1.00 33.04 ? 196 PRO A N     1 
ATOM   1450  C  CA    . PRO A  1 196 ? 124.218 96.543  106.631 1.00 33.04 ? 196 PRO A CA    1 
ATOM   1451  C  C     . PRO A  1 196 ? 122.928 97.226  107.085 1.00 33.04 ? 196 PRO A C     1 
ATOM   1452  O  O     . PRO A  1 196 ? 122.923 98.293  107.694 1.00 33.04 ? 196 PRO A O     1 
ATOM   1453  C  CB    . PRO A  1 196 ? 125.436 97.081  107.382 1.00 33.04 ? 196 PRO A CB    1 
ATOM   1454  C  CG    . PRO A  1 196 ? 125.949 98.173  106.520 1.00 33.04 ? 196 PRO A CG    1 
ATOM   1455  C  CD    . PRO A  1 196 ? 125.682 97.768  105.100 1.00 33.04 ? 196 PRO A CD    1 
ATOM   1456  N  N     . ILE A  1 197 ? 121.799 96.572  106.796 1.00 29.39 ? 197 ILE A N     1 
ATOM   1457  C  CA    . ILE A  1 197 ? 120.490 97.179  107.031 1.00 29.39 ? 197 ILE A CA    1 
ATOM   1458  C  C     . ILE A  1 197 ? 120.183 97.279  108.523 1.00 29.39 ? 197 ILE A C     1 
ATOM   1459  O  O     . ILE A  1 197 ? 119.455 98.180  108.952 1.00 29.39 ? 197 ILE A O     1 
ATOM   1460  C  CB    . ILE A  1 197 ? 119.405 96.388  106.280 1.00 29.39 ? 197 ILE A CB    1 
ATOM   1461  C  CG1   . ILE A  1 197 ? 119.879 96.055  104.871 1.00 29.39 ? 197 ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A  1 197 ? 118.131 97.192  106.159 1.00 29.39 ? 197 ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A  1 197 ? 119.019 95.032  104.170 1.00 29.39 ? 197 ILE A CD1   1 
ATOM   1464  N  N     . ASP A  1 198 ? 120.761 96.399  109.343 1.00 30.50 ? 198 ASP A N     1 
ATOM   1465  C  CA    . ASP A  1 198 ? 120.484 96.458  110.775 1.00 30.50 ? 198 ASP A CA    1 
ATOM   1466  C  C     . ASP A  1 198 ? 121.198 97.625  111.449 1.00 30.50 ? 198 ASP A C     1 
ATOM   1467  O  O     . ASP A  1 198 ? 120.625 98.265  112.337 1.00 30.50 ? 198 ASP A O     1 
ATOM   1468  C  CB    . ASP A  1 198 ? 120.869 95.139  111.439 1.00 30.50 ? 198 ASP A CB    1 
ATOM   1469  C  CG    . ASP A  1 198 ? 119.711 94.163  111.500 1.00 30.50 ? 198 ASP A CG    1 
ATOM   1470  O  OD1   . ASP A  1 198 ? 119.906 93.038  112.005 1.00 30.50 ? 198 ASP A OD1   1 
ATOM   1471  O  OD2   . ASP A  1 198 ? 118.606 94.519  111.040 1.00 30.50 ? 198 ASP A OD2   1 
ATOM   1472  N  N     . SER A  1 199 ? 122.423 97.943  111.029 1.00 30.58 ? 199 SER A N     1 
ATOM   1473  C  CA    . SER A  1 199 ? 123.106 99.096  111.605 1.00 30.58 ? 199 SER A CA    1 
ATOM   1474  C  C     . SER A  1 199 ? 122.534 100.410 111.086 1.00 30.58 ? 199 SER A C     1 
ATOM   1475  O  O     . SER A  1 199 ? 122.448 101.387 111.847 1.00 30.58 ? 199 SER A O     1 
ATOM   1476  C  CB    . SER A  1 199 ? 124.603 99.020  111.317 1.00 30.58 ? 199 SER A CB    1 
ATOM   1477  O  OG    . SER A  1 199 ? 125.269 100.155 111.836 1.00 30.58 ? 199 SER A OG    1 
ATOM   1478  N  N     . ILE A  1 200 ? 122.134 100.439 109.808 1.00 27.45 ? 200 ILE A N     1 
ATOM   1479  C  CA    . ILE A  1 200 ? 121.379 101.561 109.253 1.00 27.45 ? 200 ILE A CA    1 
ATOM   1480  C  C     . ILE A  1 200 ? 120.092 101.771 110.036 1.00 27.45 ? 200 ILE A C     1 
ATOM   1481  O  O     . ILE A  1 200 ? 119.717 102.907 110.338 1.00 27.45 ? 200 ILE A O     1 
ATOM   1482  C  CB    . ILE A  1 200 ? 121.095 101.325 107.757 1.00 27.45 ? 200 ILE A CB    1 
ATOM   1483  C  CG1   . ILE A  1 200 ? 122.371 101.410 106.935 1.00 27.45 ? 200 ILE A CG1   1 
ATOM   1484  C  CG2   . ILE A  1 200 ? 120.123 102.342 107.201 1.00 27.45 ? 200 ILE A CG2   1 
ATOM   1485  C  CD1   . ILE A  1 200 ? 122.219 100.777 105.581 1.00 27.45 ? 200 ILE A CD1   1 
ATOM   1486  N  N     . ARG A  1 201 ? 119.423 100.676 110.415 1.00 27.05 ? 201 ARG A N     1 
ATOM   1487  C  CA    . ARG A  1 201 ? 118.217 100.775 111.229 1.00 27.05 ? 201 ARG A CA    1 
ATOM   1488  C  C     . ARG A  1 201 ? 118.518 101.338 112.607 1.00 27.05 ? 201 ARG A C     1 
ATOM   1489  O  O     . ARG A  1 201 ? 117.869 102.298 113.037 1.00 27.05 ? 201 ARG A O     1 
ATOM   1490  C  CB    . ARG A  1 201 ? 117.549 99.409  111.348 1.00 27.05 ? 201 ARG A CB    1 
ATOM   1491  C  CG    . ARG A  1 201 ? 116.315 99.413  112.224 1.00 27.05 ? 201 ARG A CG    1 
ATOM   1492  C  CD    . ARG A  1 201 ? 116.515 98.573  113.467 1.00 27.05 ? 201 ARG A CD    1 
ATOM   1493  N  NE    . ARG A  1 201 ? 115.438 98.765  114.428 1.00 27.05 ? 201 ARG A NE    1 
ATOM   1494  C  CZ    . ARG A  1 201 ? 115.448 98.269  115.659 1.00 27.05 ? 201 ARG A CZ    1 
ATOM   1495  N  NH1   . ARG A  1 201 ? 116.480 97.549  116.072 1.00 27.05 ? 201 ARG A NH1   1 
ATOM   1496  N  NH2   . ARG A  1 201 ? 114.427 98.491  116.474 1.00 27.05 ? 201 ARG A NH2   1 
ATOM   1497  N  N     . GLY A  1 202 ? 119.542 100.800 113.273 1.00 30.07 ? 202 GLY A N     1 
ATOM   1498  C  CA    . GLY A  1 202 ? 119.855 101.230 114.626 1.00 30.07 ? 202 GLY A CA    1 
ATOM   1499  C  C     . GLY A  1 202 ? 120.355 102.660 114.708 1.00 30.07 ? 202 GLY A C     1 
ATOM   1500  O  O     . GLY A  1 202 ? 120.303 103.281 115.771 1.00 30.07 ? 202 GLY A O     1 
ATOM   1501  N  N     . TYR A  1 203 ? 120.841 103.206 113.594 1.00 29.72 ? 203 TYR A N     1 
ATOM   1502  C  CA    . TYR A  1 203 ? 121.209 104.616 113.601 1.00 29.72 ? 203 TYR A CA    1 
ATOM   1503  C  C     . TYR A  1 203 ? 120.119 105.547 113.076 1.00 29.72 ? 203 TYR A C     1 
ATOM   1504  O  O     . TYR A  1 203 ? 119.974 106.657 113.594 1.00 29.72 ? 203 TYR A O     1 
ATOM   1505  C  CB    . TYR A  1 203 ? 122.488 104.851 112.800 1.00 29.72 ? 203 TYR A CB    1 
ATOM   1506  C  CG    . TYR A  1 203 ? 123.075 106.213 113.059 1.00 29.72 ? 203 TYR A CG    1 
ATOM   1507  C  CD1   . TYR A  1 203 ? 123.716 106.493 114.255 1.00 29.72 ? 203 TYR A CD1   1 
ATOM   1508  C  CD2   . TYR A  1 203 ? 122.966 107.227 112.122 1.00 29.72 ? 203 TYR A CD2   1 
ATOM   1509  C  CE1   . TYR A  1 203 ? 124.244 107.740 114.504 1.00 29.72 ? 203 TYR A CE1   1 
ATOM   1510  C  CE2   . TYR A  1 203 ? 123.489 108.477 112.363 1.00 29.72 ? 203 TYR A CE2   1 
ATOM   1511  C  CZ    . TYR A  1 203 ? 124.127 108.726 113.554 1.00 29.72 ? 203 TYR A CZ    1 
ATOM   1512  O  OH    . TYR A  1 203 ? 124.652 109.972 113.796 1.00 29.72 ? 203 TYR A OH    1 
ATOM   1513  N  N     . PHE A  1 204 ? 119.343 105.143 112.069 1.00 24.35 ? 204 PHE A N     1 
ATOM   1514  C  CA    . PHE A  1 204 ? 118.457 106.056 111.360 1.00 24.35 ? 204 PHE A CA    1 
ATOM   1515  C  C     . PHE A  1 204 ? 116.981 105.716 111.484 1.00 24.35 ? 204 PHE A C     1 
ATOM   1516  O  O     . PHE A  1 204 ? 116.179 106.271 110.728 1.00 24.35 ? 204 PHE A O     1 
ATOM   1517  C  CB    . PHE A  1 204 ? 118.813 106.088 109.870 1.00 24.35 ? 204 PHE A CB    1 
ATOM   1518  C  CG    . PHE A  1 204 ? 120.002 106.931 109.540 1.00 24.35 ? 204 PHE A CG    1 
ATOM   1519  C  CD1   . PHE A  1 204 ? 119.983 108.294 109.757 1.00 24.35 ? 204 PHE A CD1   1 
ATOM   1520  C  CD2   . PHE A  1 204 ? 121.132 106.360 108.987 1.00 24.35 ? 204 PHE A CD2   1 
ATOM   1521  C  CE1   . PHE A  1 204 ? 121.075 109.068 109.445 1.00 24.35 ? 204 PHE A CE1   1 
ATOM   1522  C  CE2   . PHE A  1 204 ? 122.225 107.128 108.673 1.00 24.35 ? 204 PHE A CE2   1 
ATOM   1523  C  CZ    . PHE A  1 204 ? 122.196 108.483 108.903 1.00 24.35 ? 204 PHE A CZ    1 
ATOM   1524  N  N     . GLY A  1 205 ? 116.588 104.831 112.394 1.00 24.43 ? 205 GLY A N     1 
ATOM   1525  C  CA    . GLY A  1 205 ? 115.179 104.520 112.377 1.00 24.43 ? 205 GLY A CA    1 
ATOM   1526  C  C     . GLY A  1 205 ? 114.879 103.462 111.331 1.00 24.43 ? 205 GLY A C     1 
ATOM   1527  O  O     . GLY A  1 205 ? 115.766 102.924 110.673 1.00 24.43 ? 205 GLY A O     1 
ATOM   1528  N  N     . GLU A  1 206 ? 113.592 103.174 111.171 1.00 23.73 ? 206 GLU A N     1 
ATOM   1529  C  CA    . GLU A  1 206 ? 113.176 102.073 110.316 1.00 23.73 ? 206 GLU A CA    1 
ATOM   1530  C  C     . GLU A  1 206 ? 112.776 102.498 108.914 1.00 23.73 ? 206 GLU A C     1 
ATOM   1531  O  O     . GLU A  1 206 ? 112.879 101.687 107.995 1.00 23.73 ? 206 GLU A O     1 
ATOM   1532  C  CB    . GLU A  1 206 ? 112.018 101.313 110.960 1.00 23.73 ? 206 GLU A CB    1 
ATOM   1533  C  CG    . GLU A  1 206 ? 112.469 100.363 112.046 1.00 23.73 ? 206 GLU A CG    1 
ATOM   1534  C  CD    . GLU A  1 206 ? 112.409 100.981 113.425 1.00 23.73 ? 206 GLU A CD    1 
ATOM   1535  O  OE1   . GLU A  1 206 ? 111.851 102.089 113.556 1.00 23.73 ? 206 GLU A OE1   1 
ATOM   1536  O  OE2   . GLU A  1 206 ? 112.920 100.360 114.380 1.00 23.73 ? 206 GLU A OE2   1 
ATOM   1537  N  N     . THR A  1 207 ? 112.352 103.748 108.712 1.00 19.68 ? 207 THR A N     1 
ATOM   1538  C  CA    . THR A  1 207 ? 111.935 104.180 107.380 1.00 19.68 ? 207 THR A CA    1 
ATOM   1539  C  C     . THR A  1 207 ? 113.128 104.315 106.438 1.00 19.68 ? 207 THR A C     1 
ATOM   1540  O  O     . THR A  1 207 ? 113.075 103.857 105.288 1.00 19.68 ? 207 THR A O     1 
ATOM   1541  C  CB    . THR A  1 207 ? 111.172 105.499 107.480 1.00 19.68 ? 207 THR A CB    1 
ATOM   1542  O  OG1   . THR A  1 207 ? 110.031 105.320 108.325 1.00 19.68 ? 207 THR A OG1   1 
ATOM   1543  C  CG2   . THR A  1 207 ? 110.693 105.951 106.116 1.00 19.68 ? 207 THR A CG2   1 
ATOM   1544  N  N     . ILE A  1 208 ? 114.222 104.911 106.920 1.00 18.86 ? 208 ILE A N     1 
ATOM   1545  C  CA    . ILE A  1 208 ? 115.429 105.041 106.110 1.00 18.86 ? 208 ILE A CA    1 
ATOM   1546  C  C     . ILE A  1 208 ? 116.049 103.675 105.850 1.00 18.86 ? 208 ILE A C     1 
ATOM   1547  O  O     . ILE A  1 208 ? 116.568 103.409 104.760 1.00 18.86 ? 208 ILE A O     1 
ATOM   1548  C  CB    . ILE A  1 208 ? 116.428 105.988 106.793 1.00 18.86 ? 208 ILE A CB    1 
ATOM   1549  C  CG1   . ILE A  1 208 ? 115.703 107.192 107.391 1.00 18.86 ? 208 ILE A CG1   1 
ATOM   1550  C  CG2   . ILE A  1 208 ? 117.490 106.433 105.813 1.00 18.86 ? 208 ILE A CG2   1 
ATOM   1551  C  CD1   . ILE A  1 208 ? 115.126 108.130 106.372 1.00 18.86 ? 208 ILE A CD1   1 
ATOM   1552  N  N     . ALA A  1 209 ? 115.978 102.779 106.834 1.00 17.41 ? 209 ALA A N     1 
ATOM   1553  C  CA    . ALA A  1 209 ? 116.494 101.431 106.638 1.00 17.41 ? 209 ALA A CA    1 
ATOM   1554  C  C     . ALA A  1 209 ? 115.638 100.636 105.669 1.00 17.41 ? 209 ALA A C     1 
ATOM   1555  O  O     . ALA A  1 209 ? 116.168 99.819  104.915 1.00 17.41 ? 209 ALA A O     1 
ATOM   1556  C  CB    . ALA A  1 209 ? 116.576 100.698 107.965 1.00 17.41 ? 209 ALA A CB    1 
ATOM   1557  N  N     . LEU A  1 210 ? 114.327 100.870 105.659 1.00 16.32 ? 210 LEU A N     1 
ATOM   1558  C  CA    . LEU A  1 210 ? 113.471 100.198 104.692 1.00 16.32 ? 210 LEU A CA    1 
ATOM   1559  C  C     . LEU A  1 210 ? 113.714 100.728 103.290 1.00 16.32 ? 210 LEU A C     1 
ATOM   1560  O  O     . LEU A  1 210 ? 113.668 99.962  102.322 1.00 16.32 ? 210 LEU A O     1 
ATOM   1561  C  CB    . LEU A  1 210 ? 112.009 100.362 105.084 1.00 16.32 ? 210 LEU A CB    1 
ATOM   1562  C  CG    . LEU A  1 210 ? 111.128 99.164  104.770 1.00 16.32 ? 210 LEU A CG    1 
ATOM   1563  C  CD1   . LEU A  1 210 ? 111.605 97.956  105.532 1.00 16.32 ? 210 LEU A CD1   1 
ATOM   1564  C  CD2   . LEU A  1 210 ? 109.719 99.492  105.151 1.00 16.32 ? 210 LEU A CD2   1 
ATOM   1565  N  N     . TYR A  1 211 ? 114.010 102.026 103.164 1.00 16.07 ? 211 TYR A N     1 
ATOM   1566  C  CA    . TYR A  1 211 ? 114.378 102.558 101.855 1.00 16.07 ? 211 TYR A CA    1 
ATOM   1567  C  C     . TYR A  1 211 ? 115.702 101.980 101.371 1.00 16.07 ? 211 TYR A C     1 
ATOM   1568  O  O     . TYR A  1 211 ? 115.824 101.611 100.199 1.00 16.07 ? 211 TYR A O     1 
ATOM   1569  C  CB    . TYR A  1 211 ? 114.454 104.085 101.875 1.00 16.07 ? 211 TYR A CB    1 
ATOM   1570  C  CG    . TYR A  1 211 ? 115.230 104.630 100.696 1.00 16.07 ? 211 TYR A CG    1 
ATOM   1571  C  CD1   . TYR A  1 211 ? 114.746 104.498 99.400  1.00 16.07 ? 211 TYR A CD1   1 
ATOM   1572  C  CD2   . TYR A  1 211 ? 116.455 105.253 100.875 1.00 16.07 ? 211 TYR A CD2   1 
ATOM   1573  C  CE1   . TYR A  1 211 ? 115.459 104.964 98.327  1.00 16.07 ? 211 TYR A CE1   1 
ATOM   1574  C  CE2   . TYR A  1 211 ? 117.172 105.728 99.802  1.00 16.07 ? 211 TYR A CE2   1 
ATOM   1575  C  CZ    . TYR A  1 211 ? 116.669 105.577 98.532  1.00 16.07 ? 211 TYR A CZ    1 
ATOM   1576  O  OH    . TYR A  1 211 ? 117.373 106.056 97.456  1.00 16.07 ? 211 TYR A OH    1 
ATOM   1577  N  N     . PHE A  1 212 ? 116.703 101.894 102.246 1.00 19.00 ? 212 PHE A N     1 
ATOM   1578  C  CA    . PHE A  1 212 ? 117.989 101.371 101.799 1.00 19.00 ? 212 PHE A CA    1 
ATOM   1579  C  C     . PHE A  1 212 ? 117.932 99.868  101.559 1.00 19.00 ? 212 PHE A C     1 
ATOM   1580  O  O     . PHE A  1 212 ? 118.627 99.361  100.673 1.00 19.00 ? 212 PHE A O     1 
ATOM   1581  C  CB    . PHE A  1 212 ? 119.082 101.731 102.798 1.00 19.00 ? 212 PHE A CB    1 
ATOM   1582  C  CG    . PHE A  1 212 ? 119.672 103.086 102.566 1.00 19.00 ? 212 PHE A CG    1 
ATOM   1583  C  CD1   . PHE A  1 212 ? 120.525 103.305 101.502 1.00 19.00 ? 212 PHE A CD1   1 
ATOM   1584  C  CD2   . PHE A  1 212 ? 119.363 104.143 103.399 1.00 19.00 ? 212 PHE A CD2   1 
ATOM   1585  C  CE1   . PHE A  1 212 ? 121.066 104.550 101.280 1.00 19.00 ? 212 PHE A CE1   1 
ATOM   1586  C  CE2   . PHE A  1 212 ? 119.899 105.390 103.183 1.00 19.00 ? 212 PHE A CE2   1 
ATOM   1587  C  CZ    . PHE A  1 212 ? 120.752 105.593 102.121 1.00 19.00 ? 212 PHE A CZ    1 
ATOM   1588  N  N     . GLY A  1 213 ? 117.070 99.154  102.284 1.00 18.10 ? 213 GLY A N     1 
ATOM   1589  C  CA    . GLY A  1 213 ? 116.836 97.756  101.973 1.00 18.10 ? 213 GLY A CA    1 
ATOM   1590  C  C     . GLY A  1 213 ? 116.115 97.568  100.653 1.00 18.10 ? 213 GLY A C     1 
ATOM   1591  O  O     . GLY A  1 213 ? 116.423 96.642  99.900  1.00 18.10 ? 213 GLY A O     1 
ATOM   1592  N  N     . PHE A  1 214 ? 115.170 98.459  100.337 1.00 15.61 ? 214 PHE A N     1 
ATOM   1593  C  CA    . PHE A  1 214 ? 114.497 98.390  99.045  1.00 15.61 ? 214 PHE A CA    1 
ATOM   1594  C  C     . PHE A  1 214 ? 115.432 98.755  97.905  1.00 15.61 ? 214 PHE A C     1 
ATOM   1595  O  O     . PHE A  1 214 ? 115.325 98.185  96.820  1.00 15.61 ? 214 PHE A O     1 
ATOM   1596  C  CB    . PHE A  1 214 ? 113.279 99.306  99.028  1.00 15.61 ? 214 PHE A CB    1 
ATOM   1597  C  CG    . PHE A  1 214 ? 112.531 99.290  97.731  1.00 15.61 ? 214 PHE A CG    1 
ATOM   1598  C  CD1   . PHE A  1 214 ? 111.821 98.170  97.346  1.00 15.61 ? 214 PHE A CD1   1 
ATOM   1599  C  CD2   . PHE A  1 214 ? 112.535 100.393 96.901  1.00 15.61 ? 214 PHE A CD2   1 
ATOM   1600  C  CE1   . PHE A  1 214 ? 111.129 98.150  96.157  1.00 15.61 ? 214 PHE A CE1   1 
ATOM   1601  C  CE2   . PHE A  1 214 ? 111.845 100.378 95.713  1.00 15.61 ? 214 PHE A CE2   1 
ATOM   1602  C  CZ    . PHE A  1 214 ? 111.142 99.254  95.342  1.00 15.61 ? 214 PHE A CZ    1 
ATOM   1603  N  N     . LEU A  1 215 ? 116.362 99.678  98.134  1.00 17.48 ? 215 LEU A N     1 
ATOM   1604  C  CA    . LEU A  1 215 ? 117.326 100.029 97.097  1.00 17.48 ? 215 LEU A CA    1 
ATOM   1605  C  C     . LEU A  1 215 ? 118.342 98.912  96.885  1.00 17.48 ? 215 LEU A C     1 
ATOM   1606  O  O     . LEU A  1 215 ? 118.726 98.623  95.746  1.00 17.48 ? 215 LEU A O     1 
ATOM   1607  C  CB    . LEU A  1 215 ? 118.020 101.336 97.465  1.00 17.48 ? 215 LEU A CB    1 
ATOM   1608  C  CG    . LEU A  1 215 ? 119.151 101.826 96.573  1.00 17.48 ? 215 LEU A CG    1 
ATOM   1609  C  CD1   . LEU A  1 215 ? 118.654 102.026 95.168  1.00 17.48 ? 215 LEU A CD1   1 
ATOM   1610  C  CD2   . LEU A  1 215 ? 119.719 103.116 97.121  1.00 17.48 ? 215 LEU A CD2   1 
ATOM   1611  N  N     . GLU A  1 216 ? 118.776 98.267  97.971  1.00 22.22 ? 216 GLU A N     1 
ATOM   1612  C  CA    . GLU A  1 216 ? 119.652 97.104  97.862  1.00 22.22 ? 216 GLU A CA    1 
ATOM   1613  C  C     . GLU A  1 216 ? 118.945 95.933  97.194  1.00 22.22 ? 216 GLU A C     1 
ATOM   1614  O  O     . GLU A  1 216 ? 119.574 95.149  96.475  1.00 22.22 ? 216 GLU A O     1 
ATOM   1615  C  CB    . GLU A  1 216 ? 120.155 96.725  99.254  1.00 22.22 ? 216 GLU A CB    1 
ATOM   1616  C  CG    . GLU A  1 216 ? 121.153 95.578  99.338  1.00 22.22 ? 216 GLU A CG    1 
ATOM   1617  C  CD    . GLU A  1 216 ? 120.487 94.247  99.639  1.00 22.22 ? 216 GLU A CD    1 
ATOM   1618  O  OE1   . GLU A  1 216 ? 119.425 94.257  100.294 1.00 22.22 ? 216 GLU A OE1   1 
ATOM   1619  O  OE2   . GLU A  1 216 ? 121.031 93.198  99.237  1.00 22.22 ? 216 GLU A OE2   1 
ATOM   1620  N  N     . TYR A  1 217 ? 117.638 95.796  97.415  1.00 20.47 ? 217 TYR A N     1 
ATOM   1621  C  CA    . TYR A  1 217 ? 116.898 94.734  96.750  1.00 20.47 ? 217 TYR A CA    1 
ATOM   1622  C  C     . TYR A  1 217 ? 116.680 95.047  95.277  1.00 20.47 ? 217 TYR A C     1 
ATOM   1623  O  O     . TYR A  1 217 ? 116.824 94.166  94.424  1.00 20.47 ? 217 TYR A O     1 
ATOM   1624  C  CB    . TYR A  1 217 ? 115.560 94.509  97.443  1.00 20.47 ? 217 TYR A CB    1 
ATOM   1625  C  CG    . TYR A  1 217 ? 114.766 93.422  96.788  1.00 20.47 ? 217 TYR A CG    1 
ATOM   1626  C  CD1   . TYR A  1 217 ? 115.111 92.096  96.974  1.00 20.47 ? 217 TYR A CD1   1 
ATOM   1627  C  CD2   . TYR A  1 217 ? 113.684 93.717  95.971  1.00 20.47 ? 217 TYR A CD2   1 
ATOM   1628  C  CE1   . TYR A  1 217 ? 114.404 91.092  96.370  1.00 20.47 ? 217 TYR A CE1   1 
ATOM   1629  C  CE2   . TYR A  1 217 ? 112.971 92.719  95.359  1.00 20.47 ? 217 TYR A CE2   1 
ATOM   1630  C  CZ    . TYR A  1 217 ? 113.336 91.409  95.566  1.00 20.47 ? 217 TYR A CZ    1 
ATOM   1631  O  OH    . TYR A  1 217 ? 112.632 90.404  94.962  1.00 20.47 ? 217 TYR A OH    1 
ATOM   1632  N  N     . PHE A  1 218 ? 116.326 96.293  94.962  1.00 20.84 ? 218 PHE A N     1 
ATOM   1633  C  CA    . PHE A  1 218 ? 116.047 96.693  93.589  1.00 20.84 ? 218 PHE A CA    1 
ATOM   1634  C  C     . PHE A  1 218 ? 117.313 96.737  92.747  1.00 20.84 ? 218 PHE A C     1 
ATOM   1635  O  O     . PHE A  1 218 ? 117.243 96.618  91.521  1.00 20.84 ? 218 PHE A O     1 
ATOM   1636  C  CB    . PHE A  1 218 ? 115.360 98.054  93.595  1.00 20.84 ? 218 PHE A CB    1 
ATOM   1637  C  CG    . PHE A  1 218 ? 114.709 98.415  92.304  1.00 20.84 ? 218 PHE A CG    1 
ATOM   1638  C  CD1   . PHE A  1 218 ? 113.619 97.703  91.842  1.00 20.84 ? 218 PHE A CD1   1 
ATOM   1639  C  CD2   . PHE A  1 218 ? 115.177 99.483  91.560  1.00 20.84 ? 218 PHE A CD2   1 
ATOM   1640  C  CE1   . PHE A  1 218 ? 113.013 98.043  90.651  1.00 20.84 ? 218 PHE A CE1   1 
ATOM   1641  C  CE2   . PHE A  1 218 ? 114.577 99.828  90.370  1.00 20.84 ? 218 PHE A CE2   1 
ATOM   1642  C  CZ    . PHE A  1 218 ? 113.495 99.107  89.915  1.00 20.84 ? 218 PHE A CZ    1 
ATOM   1643  N  N     . THR A  1 219 ? 118.471 96.920  93.381  1.00 23.89 ? 219 THR A N     1 
ATOM   1644  C  CA    . THR A  1 219 ? 119.728 96.799  92.656  1.00 23.89 ? 219 THR A CA    1 
ATOM   1645  C  C     . THR A  1 219 ? 119.996 95.348  92.279  1.00 23.89 ? 219 THR A C     1 
ATOM   1646  O  O     . THR A  1 219 ? 120.390 95.057  91.144  1.00 23.89 ? 219 THR A O     1 
ATOM   1647  C  CB    . THR A  1 219 ? 120.870 97.352  93.502  1.00 23.89 ? 219 THR A CB    1 
ATOM   1648  O  OG1   . THR A  1 219 ? 120.577 98.702  93.875  1.00 23.89 ? 219 THR A OG1   1 
ATOM   1649  C  CG2   . THR A  1 219 ? 122.160 97.341  92.717  1.00 23.89 ? 219 THR A CG2   1 
ATOM   1650  N  N     . PHE A  1 220 ? 119.757 94.421  93.206  1.00 26.13 ? 220 PHE A N     1 
ATOM   1651  C  CA    . PHE A  1 220 ? 119.961 93.000  92.951  1.00 26.13 ? 220 PHE A CA    1 
ATOM   1652  C  C     . PHE A  1 220 ? 118.758 92.334  92.302  1.00 26.13 ? 220 PHE A C     1 
ATOM   1653  O  O     . PHE A  1 220 ? 118.674 91.103  92.308  1.00 26.13 ? 220 PHE A O     1 
ATOM   1654  C  CB    . PHE A  1 220 ? 120.306 92.259  94.249  1.00 26.13 ? 220 PHE A CB    1 
ATOM   1655  C  CG    . PHE A  1 220 ? 121.624 92.659  94.850  1.00 26.13 ? 220 PHE A CG    1 
ATOM   1656  C  CD1   . PHE A  1 220 ? 122.632 93.196  94.063  1.00 26.13 ? 220 PHE A CD1   1 
ATOM   1657  C  CD2   . PHE A  1 220 ? 121.859 92.478  96.202  1.00 26.13 ? 220 PHE A CD2   1 
ATOM   1658  C  CE1   . PHE A  1 220 ? 123.841 93.564  94.611  1.00 26.13 ? 220 PHE A CE1   1 
ATOM   1659  C  CE2   . PHE A  1 220 ? 123.068 92.839  96.763  1.00 26.13 ? 220 PHE A CE2   1 
ATOM   1660  C  CZ    . PHE A  1 220 ? 124.063 93.383  95.964  1.00 26.13 ? 220 PHE A CZ    1 
ATOM   1661  N  N     . ALA A  1 221 ? 117.824 93.111  91.760  1.00 24.29 ? 221 ALA A N     1 
ATOM   1662  C  CA    . ALA A  1 221 ? 116.695 92.571  91.025  1.00 24.29 ? 221 ALA A CA    1 
ATOM   1663  C  C     . ALA A  1 221 ? 116.670 93.006  89.571  1.00 24.29 ? 221 ALA A C     1 
ATOM   1664  O  O     . ALA A  1 221 ? 115.908 92.436  88.786  1.00 24.29 ? 221 ALA A O     1 
ATOM   1665  C  CB    . ALA A  1 221 ? 115.381 92.986  91.693  1.00 24.29 ? 221 ALA A CB    1 
ATOM   1666  N  N     . LEU A  1 222 ? 117.469 94.001  89.201  1.00 26.43 ? 222 LEU A N     1 
ATOM   1667  C  CA    . LEU A  1 222 ? 117.669 94.379  87.813  1.00 26.43 ? 222 LEU A CA    1 
ATOM   1668  C  C     . LEU A  1 222 ? 118.925 93.758  87.222  1.00 26.43 ? 222 LEU A C     1 
ATOM   1669  O  O     . LEU A  1 222 ? 119.209 93.971  86.041  1.00 26.43 ? 222 LEU A O     1 
ATOM   1670  C  CB    . LEU A  1 222 ? 117.732 95.901  87.684  1.00 26.43 ? 222 LEU A CB    1 
ATOM   1671  C  CG    . LEU A  1 222 ? 116.463 96.649  88.085  1.00 26.43 ? 222 LEU A CG    1 
ATOM   1672  C  CD1   . LEU A  1 222 ? 116.633 98.129  87.845  1.00 26.43 ? 222 LEU A CD1   1 
ATOM   1673  C  CD2   . LEU A  1 222 ? 115.262 96.124  87.324  1.00 26.43 ? 222 LEU A CD2   1 
ATOM   1674  N  N     . ILE A  1 223 ? 119.678 93.000  88.012  1.00 28.97 ? 223 ILE A N     1 
ATOM   1675  C  CA    . ILE A  1 223 ? 120.877 92.319  87.525  1.00 28.97 ? 223 ILE A CA    1 
ATOM   1676  C  C     . ILE A  1 223 ? 120.521 91.162  86.587  1.00 28.97 ? 223 ILE A C     1 
ATOM   1677  O  O     . ILE A  1 223 ? 121.203 91.028  85.562  1.00 28.97 ? 223 ILE A O     1 
ATOM   1678  C  CB    . ILE A  1 223 ? 121.788 91.895  88.698  1.00 28.97 ? 223 ILE A CB    1 
ATOM   1679  C  CG1   . ILE A  1 223 ? 122.433 93.126  89.330  1.00 28.97 ? 223 ILE A CG1   1 
ATOM   1680  C  CG2   . ILE A  1 223 ? 122.874 90.914  88.281  1.00 28.97 ? 223 ILE A CG2   1 
ATOM   1681  C  CD1   . ILE A  1 223 ? 123.244 92.813  90.551  1.00 28.97 ? 223 ILE A CD1   1 
ATOM   1682  N  N     . PRO A  1 224 ? 119.488 90.327  86.819  1.00 30.35 ? 224 PRO A N     1 
ATOM   1683  C  CA    . PRO A  1 224 ? 119.086 89.409  85.736  1.00 30.35 ? 224 PRO A CA    1 
ATOM   1684  C  C     . PRO A  1 224 ? 118.571 90.101  84.485  1.00 30.35 ? 224 PRO A C     1 
ATOM   1685  O  O     . PRO A  1 224 ? 118.855 89.620  83.383  1.00 30.35 ? 224 PRO A O     1 
ATOM   1686  C  CB    . PRO A  1 224 ? 118.000 88.553  86.395  1.00 30.35 ? 224 PRO A CB    1 
ATOM   1687  C  CG    . PRO A  1 224 ? 118.438 88.474  87.776  1.00 30.35 ? 224 PRO A CG    1 
ATOM   1688  C  CD    . PRO A  1 224 ? 118.877 89.874  88.087  1.00 30.35 ? 224 PRO A CD    1 
ATOM   1689  N  N     . MET A  1 225 ? 117.870 91.232  84.618  1.00 33.38 ? 225 MET A N     1 
ATOM   1690  C  CA    . MET A  1 225 ? 117.426 91.978  83.442  1.00 33.38 ? 225 MET A CA    1 
ATOM   1691  C  C     . MET A  1 225 ? 118.607 92.536  82.656  1.00 33.38 ? 225 MET A C     1 
ATOM   1692  O  O     . MET A  1 225 ? 118.624 92.475  81.421  1.00 33.38 ? 225 MET A O     1 
ATOM   1693  C  CB    . MET A  1 225 ? 116.490 93.112  83.858  1.00 33.38 ? 225 MET A CB    1 
ATOM   1694  C  CG    . MET A  1 225 ? 115.096 92.674  84.261  1.00 33.38 ? 225 MET A CG    1 
ATOM   1695  S  SD    . MET A  1 225 ? 113.972 94.077  84.393  1.00 33.38 ? 225 MET A SD    1 
ATOM   1696  C  CE    . MET A  1 225 ? 112.567 93.315  85.195  1.00 33.38 ? 225 MET A CE    1 
ATOM   1697  N  N     . ALA A  1 226 ? 119.620 93.047  83.356  1.00 32.92 ? 226 ALA A N     1 
ATOM   1698  C  CA    . ALA A  1 226 ? 120.782 93.606  82.675  1.00 32.92 ? 226 ALA A CA    1 
ATOM   1699  C  C     . ALA A  1 226 ? 121.661 92.515  82.078  1.00 32.92 ? 226 ALA A C     1 
ATOM   1700  O  O     . ALA A  1 226 ? 122.196 92.679  80.978  1.00 32.92 ? 226 ALA A O     1 
ATOM   1701  C  CB    . ALA A  1 226 ? 121.589 94.471  83.638  1.00 32.92 ? 226 ALA A CB    1 
ATOM   1702  N  N     . VAL A  1 227 ? 121.825 91.397  82.789  1.00 33.86 ? 227 VAL A N     1 
ATOM   1703  C  CA    . VAL A  1 227 ? 122.659 90.303  82.300  1.00 33.86 ? 227 VAL A CA    1 
ATOM   1704  C  C     . VAL A  1 227 ? 122.019 89.575  81.124  1.00 33.86 ? 227 VAL A C     1 
ATOM   1705  O  O     . VAL A  1 227 ? 122.718 89.270  80.152  1.00 33.86 ? 227 VAL A O     1 
ATOM   1706  C  CB    . VAL A  1 227 ? 123.007 89.357  83.467  1.00 33.86 ? 227 VAL A CB    1 
ATOM   1707  C  CG1   . VAL A  1 227 ? 123.571 88.033  82.982  1.00 33.86 ? 227 VAL A CG1   1 
ATOM   1708  C  CG2   . VAL A  1 227 ? 124.048 90.013  84.358  1.00 33.86 ? 227 VAL A CG2   1 
ATOM   1709  N  N     . ILE A  1 228 ? 120.712 89.325  81.146  1.00 35.51 ? 228 ILE A N     1 
ATOM   1710  C  CA    . ILE A  1 228 ? 120.045 88.734  79.989  1.00 35.51 ? 228 ILE A CA    1 
ATOM   1711  C  C     . ILE A  1 228 ? 119.958 89.727  78.835  1.00 35.51 ? 228 ILE A C     1 
ATOM   1712  O  O     . ILE A  1 228 ? 120.207 89.379  77.678  1.00 35.51 ? 228 ILE A O     1 
ATOM   1713  C  CB    . ILE A  1 228 ? 118.655 88.202  80.400  1.00 35.51 ? 228 ILE A CB    1 
ATOM   1714  C  CG1   . ILE A  1 228 ? 118.803 87.043  81.386  1.00 35.51 ? 228 ILE A CG1   1 
ATOM   1715  C  CG2   . ILE A  1 228 ? 117.863 87.729  79.197  1.00 35.51 ? 228 ILE A CG2   1 
ATOM   1716  C  CD1   . ILE A  1 228 ? 119.585 85.873  80.843  1.00 35.51 ? 228 ILE A CD1   1 
ATOM   1717  N  N     . GLY A  1 229 ? 119.662 90.992  79.124  1.00 37.83 ? 229 GLY A N     1 
ATOM   1718  C  CA    . GLY A  1 229 ? 119.478 91.961  78.065  1.00 37.83 ? 229 GLY A CA    1 
ATOM   1719  C  C     . GLY A  1 229 ? 120.741 92.545  77.468  1.00 37.83 ? 229 GLY A C     1 
ATOM   1720  O  O     . GLY A  1 229 ? 120.659 93.346  76.534  1.00 37.83 ? 229 GLY A O     1 
ATOM   1721  N  N     . LEU A  1 230 ? 121.912 92.181  77.985  1.00 40.83 ? 230 LEU A N     1 
ATOM   1722  C  CA    . LEU A  1 230 ? 123.138 92.716  77.396  1.00 40.83 ? 230 LEU A CA    1 
ATOM   1723  C  C     . LEU A  1 230 ? 123.578 91.961  76.134  1.00 40.83 ? 230 LEU A C     1 
ATOM   1724  O  O     . LEU A  1 230 ? 123.947 92.628  75.160  1.00 40.83 ? 230 LEU A O     1 
ATOM   1725  C  CB    . LEU A  1 230 ? 124.264 92.782  78.437  1.00 40.83 ? 230 LEU A CB    1 
ATOM   1726  C  CG    . LEU A  1 230 ? 125.573 93.435  77.997  1.00 40.83 ? 230 LEU A CG    1 
ATOM   1727  C  CD1   . LEU A  1 230 ? 125.317 94.812  77.420  1.00 40.83 ? 230 LEU A CD1   1 
ATOM   1728  C  CD2   . LEU A  1 230 ? 126.539 93.516  79.164  1.00 40.83 ? 230 LEU A CD2   1 
ATOM   1729  N  N     . PRO A  1 231 ? 123.576 90.616  76.059  1.00 44.91 ? 231 PRO A N     1 
ATOM   1730  C  CA    . PRO A  1 231 ? 123.783 89.997  74.743  1.00 44.91 ? 231 PRO A CA    1 
ATOM   1731  C  C     . PRO A  1 231 ? 122.530 89.955  73.895  1.00 44.91 ? 231 PRO A C     1 
ATOM   1732  O  O     . PRO A  1 231 ? 122.633 89.714  72.688  1.00 44.91 ? 231 PRO A O     1 
ATOM   1733  C  CB    . PRO A  1 231 ? 124.266 88.586  75.088  1.00 44.91 ? 231 PRO A CB    1 
ATOM   1734  C  CG    . PRO A  1 231 ? 123.582 88.291  76.320  1.00 44.91 ? 231 PRO A CG    1 
ATOM   1735  C  CD    . PRO A  1 231 ? 123.644 89.566  77.097  1.00 44.91 ? 231 PRO A CD    1 
ATOM   1736  N  N     . TYR A  1 232 ? 121.352 90.172  74.482  1.00 44.28 ? 232 TYR A N     1 
ATOM   1737  C  CA    . TYR A  1 232 ? 120.124 90.216  73.699  1.00 44.28 ? 232 TYR A CA    1 
ATOM   1738  C  C     . TYR A  1 232 ? 120.065 91.439  72.796  1.00 44.28 ? 232 TYR A C     1 
ATOM   1739  O  O     . TYR A  1 232 ? 119.382 91.404  71.769  1.00 44.28 ? 232 TYR A O     1 
ATOM   1740  C  CB    . TYR A  1 232 ? 118.914 90.191  74.632  1.00 44.28 ? 232 TYR A CB    1 
ATOM   1741  C  CG    . TYR A  1 232 ? 117.611 89.829  73.961  1.00 44.28 ? 232 TYR A CG    1 
ATOM   1742  C  CD1   . TYR A  1 232 ? 117.224 88.504  73.829  1.00 44.28 ? 232 TYR A CD1   1 
ATOM   1743  C  CD2   . TYR A  1 232 ? 116.757 90.813  73.481  1.00 44.28 ? 232 TYR A CD2   1 
ATOM   1744  C  CE1   . TYR A  1 232 ? 116.032 88.168  73.225  1.00 44.28 ? 232 TYR A CE1   1 
ATOM   1745  C  CE2   . TYR A  1 232 ? 115.566 90.488  72.874  1.00 44.28 ? 232 TYR A CE2   1 
ATOM   1746  C  CZ    . TYR A  1 232 ? 115.210 89.164  72.748  1.00 44.28 ? 232 TYR A CZ    1 
ATOM   1747  O  OH    . TYR A  1 232 ? 114.020 88.834  72.146  1.00 44.28 ? 232 TYR A OH    1 
ATOM   1748  N  N     . TYR A  1 233 ? 120.772 92.508  73.148  1.00 43.96 ? 233 TYR A N     1 
ATOM   1749  C  CA    . TYR A  1 233 ? 120.833 93.715  72.337  1.00 43.96 ? 233 TYR A CA    1 
ATOM   1750  C  C     . TYR A  1 233 ? 122.082 93.778  71.472  1.00 43.96 ? 233 TYR A C     1 
ATOM   1751  O  O     . TYR A  1 233 ? 122.016 94.249  70.333  1.00 43.96 ? 233 TYR A O     1 
ATOM   1752  C  CB    . TYR A  1 233 ? 120.770 94.951  73.237  1.00 43.96 ? 233 TYR A CB    1 
ATOM   1753  C  CG    . TYR A  1 233 ? 121.076 96.251  72.537  1.00 43.96 ? 233 TYR A CG    1 
ATOM   1754  C  CD1   . TYR A  1 233 ? 120.209 96.769  71.585  1.00 43.96 ? 233 TYR A CD1   1 
ATOM   1755  C  CD2   . TYR A  1 233 ? 122.229 96.964  72.833  1.00 43.96 ? 233 TYR A CD2   1 
ATOM   1756  C  CE1   . TYR A  1 233 ? 120.485 97.960  70.944  1.00 43.96 ? 233 TYR A CE1   1 
ATOM   1757  C  CE2   . TYR A  1 233 ? 122.514 98.154  72.197  1.00 43.96 ? 233 TYR A CE2   1 
ATOM   1758  C  CZ    . TYR A  1 233 ? 121.639 98.648  71.255  1.00 43.96 ? 233 TYR A CZ    1 
ATOM   1759  O  OH    . TYR A  1 233 ? 121.923 99.836  70.621  1.00 43.96 ? 233 TYR A OH    1 
ATOM   1760  N  N     . LEU A  1 234 ? 123.219 93.303  71.982  1.00 48.37 ? 234 LEU A N     1 
ATOM   1761  C  CA    . LEU A  1 234 ? 124.457 93.371  71.212  1.00 48.37 ? 234 LEU A CA    1 
ATOM   1762  C  C     . LEU A  1 234 ? 124.489 92.314  70.116  1.00 48.37 ? 234 LEU A C     1 
ATOM   1763  O  O     . LEU A  1 234 ? 124.758 92.630  68.952  1.00 48.37 ? 234 LEU A O     1 
ATOM   1764  C  CB    . LEU A  1 234 ? 125.660 93.217  72.139  1.00 48.37 ? 234 LEU A CB    1 
ATOM   1765  C  CG    . LEU A  1 234 ? 125.942 94.381  73.087  1.00 48.37 ? 234 LEU A CG    1 
ATOM   1766  C  CD1   . LEU A  1 234 ? 127.157 94.085  73.947  1.00 48.37 ? 234 LEU A CD1   1 
ATOM   1767  C  CD2   . LEU A  1 234 ? 126.134 95.669  72.309  1.00 48.37 ? 234 LEU A CD2   1 
ATOM   1768  N  N     . PHE A  1 235 ? 124.214 91.059  70.463  1.00 51.37 ? 235 PHE A N     1 
ATOM   1769  C  CA    . PHE A  1 235 ? 124.261 89.959  69.509  1.00 51.37 ? 235 PHE A CA    1 
ATOM   1770  C  C     . PHE A  1 235 ? 122.982 89.820  68.697  1.00 51.37 ? 235 PHE A C     1 
ATOM   1771  O  O     . PHE A  1 235 ? 122.926 88.946  67.825  1.00 51.37 ? 235 PHE A O     1 
ATOM   1772  C  CB    . PHE A  1 235 ? 124.539 88.639  70.231  1.00 51.37 ? 235 PHE A CB    1 
ATOM   1773  C  CG    . PHE A  1 235 ? 125.929 88.523  70.783  1.00 51.37 ? 235 PHE A CG    1 
ATOM   1774  C  CD1   . PHE A  1 235 ? 126.962 89.307  70.290  1.00 51.37 ? 235 PHE A CD1   1 
ATOM   1775  C  CD2   . PHE A  1 235 ? 126.200 87.622  71.799  1.00 51.37 ? 235 PHE A CD2   1 
ATOM   1776  C  CE1   . PHE A  1 235 ? 128.238 89.194  70.804  1.00 51.37 ? 235 PHE A CE1   1 
ATOM   1777  C  CE2   . PHE A  1 235 ? 127.473 87.503  72.316  1.00 51.37 ? 235 PHE A CE2   1 
ATOM   1778  C  CZ    . PHE A  1 235 ? 128.494 88.289  71.819  1.00 51.37 ? 235 PHE A CZ    1 
ATOM   1779  N  N     . VAL A  1 236 ? 121.998 90.700  68.935  1.00 52.31 ? 236 VAL A N     1 
ATOM   1780  C  CA    . VAL A  1 236 ? 120.613 90.689  68.446  1.00 52.31 ? 236 VAL A CA    1 
ATOM   1781  C  C     . VAL A  1 236 ? 120.022 89.275  68.351  1.00 52.31 ? 236 VAL A C     1 
ATOM   1782  O  O     . VAL A  1 236 ? 120.030 88.620  67.302  1.00 52.31 ? 236 VAL A O     1 
ATOM   1783  C  CB    . VAL A  1 236 ? 120.472 91.545  67.150  1.00 52.31 ? 236 VAL A CB    1 
ATOM   1784  C  CG1   . VAL A  1 236 ? 121.352 91.118  65.940  1.00 52.31 ? 236 VAL A CG1   1 
ATOM   1785  C  CG2   . VAL A  1 236 ? 119.006 91.682  66.739  1.00 52.31 ? 236 VAL A CG2   1 
ATOM   1786  N  N     . TRP A  1 237 ? 119.527 88.782  69.486  1.00 53.18 ? 237 TRP A N     1 
ATOM   1787  C  CA    . TRP A  1 237 ? 118.841 87.500  69.560  1.00 53.18 ? 237 TRP A CA    1 
ATOM   1788  C  C     . TRP A  1 237 ? 117.340 87.646  69.368  1.00 53.18 ? 237 TRP A C     1 
ATOM   1789  O  O     . TRP A  1 237 ? 116.584 86.721  69.682  1.00 53.18 ? 237 TRP A O     1 
ATOM   1790  C  CB    . TRP A  1 237 ? 119.136 86.809  70.890  1.00 53.18 ? 237 TRP A CB    1 
ATOM   1791  C  CG    . TRP A  1 237 ? 120.534 86.317  71.007  1.00 53.18 ? 237 TRP A CG    1 
ATOM   1792  C  CD1   . TRP A  1 237 ? 121.471 86.271  70.021  1.00 53.18 ? 237 TRP A CD1   1 
ATOM   1793  C  CD2   . TRP A  1 237 ? 121.161 85.797  72.182  1.00 53.18 ? 237 TRP A CD2   1 
ATOM   1794  N  NE1   . TRP A  1 237 ? 122.646 85.757  70.507  1.00 53.18 ? 237 TRP A NE1   1 
ATOM   1795  C  CE2   . TRP A  1 237 ? 122.482 85.458  71.833  1.00 53.18 ? 237 TRP A CE2   1 
ATOM   1796  C  CE3   . TRP A  1 237 ? 120.735 85.588  73.496  1.00 53.18 ? 237 TRP A CE3   1 
ATOM   1797  C  CZ2   . TRP A  1 237 ? 123.379 84.919  72.749  1.00 53.18 ? 237 TRP A CZ2   1 
ATOM   1798  C  CZ3   . TRP A  1 237 ? 121.626 85.053  74.404  1.00 53.18 ? 237 TRP A CZ3   1 
ATOM   1799  C  CH2   . TRP A  1 237 ? 122.934 84.724  74.027  1.00 53.18 ? 237 TRP A CH2   1 
ATOM   1800  N  N     . GLU A  1 238 ? 116.898 88.788  68.853  1.00 56.02 ? 238 GLU A N     1 
ATOM   1801  C  CA    . GLU A  1 238 ? 115.505 89.030  68.520  1.00 56.02 ? 238 GLU A CA    1 
ATOM   1802  C  C     . GLU A  1 238 ? 115.053 88.248  67.297  1.00 56.02 ? 238 GLU A C     1 
ATOM   1803  O  O     . GLU A  1 238 ? 113.851 88.172  67.034  1.00 56.02 ? 238 GLU A O     1 
ATOM   1804  C  CB    . GLU A  1 238 ? 115.290 90.525  68.288  1.00 56.02 ? 238 GLU A CB    1 
ATOM   1805  C  CG    . GLU A  1 238 ? 116.151 91.391  69.186  1.00 56.02 ? 238 GLU A CG    1 
ATOM   1806  C  CD    . GLU A  1 238 ? 116.080 92.857  68.828  1.00 56.02 ? 238 GLU A CD    1 
ATOM   1807  O  OE1   . GLU A  1 238 ? 115.264 93.214  67.953  1.00 56.02 ? 238 GLU A OE1   1 
ATOM   1808  O  OE2   . GLU A  1 238 ? 116.835 93.656  69.421  1.00 56.02 ? 238 GLU A OE2   1 
ATOM   1809  N  N     . ASP A  1 239 ? 115.989 87.680  66.538  1.00 58.30 ? 239 ASP A N     1 
ATOM   1810  C  CA    . ASP A  1 239 ? 115.632 86.906  65.357  1.00 58.30 ? 239 ASP A CA    1 
ATOM   1811  C  C     . ASP A  1 239 ? 115.078 85.542  65.746  1.00 58.30 ? 239 ASP A C     1 
ATOM   1812  O  O     . ASP A  1 239 ? 114.177 85.013  65.085  1.00 58.30 ? 239 ASP A O     1 
ATOM   1813  C  CB    . ASP A  1 239 ? 116.861 86.744  64.465  1.00 58.30 ? 239 ASP A CB    1 
ATOM   1814  C  CG    . ASP A  1 239 ? 117.417 88.070  63.998  1.00 58.30 ? 239 ASP A CG    1 
ATOM   1815  O  OD1   . ASP A  1 239 ? 116.634 89.032  63.873  1.00 58.30 ? 239 ASP A OD1   1 
ATOM   1816  O  OD2   . ASP A  1 239 ? 118.642 88.152  63.769  1.00 58.30 ? 239 ASP A OD2   1 
ATOM   1817  N  N     . TYR A  1 240 ? 115.606 84.959  66.821  1.00 56.47 ? 240 TYR A N     1 
ATOM   1818  C  CA    . TYR A  1 240 ? 115.319 83.562  67.124  1.00 56.47 ? 240 TYR A CA    1 
ATOM   1819  C  C     . TYR A  1 240 ? 114.021 83.404  67.904  1.00 56.47 ? 240 TYR A C     1 
ATOM   1820  O  O     . TYR A  1 240 ? 113.181 82.570  67.548  1.00 56.47 ? 240 TYR A O     1 
ATOM   1821  C  CB    . TYR A  1 240 ? 116.485 82.945  67.898  1.00 56.47 ? 240 TYR A CB    1 
ATOM   1822  C  CG    . TYR A  1 240 ? 117.828 83.077  67.211  1.00 56.47 ? 240 TYR A CG    1 
ATOM   1823  C  CD1   . TYR A  1 240 ? 117.942 82.969  65.829  1.00 56.47 ? 240 TYR A CD1   1 
ATOM   1824  C  CD2   . TYR A  1 240 ? 118.981 83.318  67.946  1.00 56.47 ? 240 TYR A CD2   1 
ATOM   1825  C  CE1   . TYR A  1 240 ? 119.167 83.096  65.200  1.00 56.47 ? 240 TYR A CE1   1 
ATOM   1826  C  CE2   . TYR A  1 240 ? 120.211 83.445  67.326  1.00 56.47 ? 240 TYR A CE2   1 
ATOM   1827  C  CZ    . TYR A  1 240 ? 120.297 83.334  65.954  1.00 56.47 ? 240 TYR A CZ    1 
ATOM   1828  O  OH    . TYR A  1 240 ? 121.518 83.459  65.334  1.00 56.47 ? 240 TYR A OH    1 
ATOM   1829  N  N     . ASP A  1 241 ? 113.834 84.189  68.964  1.00 50.93 ? 241 ASP A N     1 
ATOM   1830  C  CA    . ASP A  1 241 ? 112.632 84.087  69.780  1.00 50.93 ? 241 ASP A CA    1 
ATOM   1831  C  C     . ASP A  1 241 ? 111.506 84.993  69.308  1.00 50.93 ? 241 ASP A C     1 
ATOM   1832  O  O     . ASP A  1 241 ? 110.346 84.728  69.649  1.00 50.93 ? 241 ASP A O     1 
ATOM   1833  C  CB    . ASP A  1 241 ? 112.946 84.411  71.244  1.00 50.93 ? 241 ASP A CB    1 
ATOM   1834  C  CG    . ASP A  1 241 ? 113.069 85.898  71.496  1.00 50.93 ? 241 ASP A CG    1 
ATOM   1835  O  OD1   . ASP A  1 241 ? 113.800 86.575  70.744  1.00 50.93 ? 241 ASP A OD1   1 
ATOM   1836  O  OD2   . ASP A  1 241 ? 112.424 86.396  72.440  1.00 50.93 ? 241 ASP A OD2   1 
ATOM   1837  N  N     . LYS A  1 242 ? 111.832 86.035  68.535  1.00 49.77 ? 242 LYS A N     1 
ATOM   1838  C  CA    . LYS A  1 242 ? 110.913 87.054  68.032  1.00 49.77 ? 242 LYS A CA    1 
ATOM   1839  C  C     . LYS A  1 242 ? 110.124 87.705  69.160  1.00 49.77 ? 242 LYS A C     1 
ATOM   1840  O  O     . LYS A  1 242 ? 108.889 87.692  69.147  1.00 49.77 ? 242 LYS A O     1 
ATOM   1841  C  CB    . LYS A  1 242 ? 109.986 86.463  66.967  1.00 49.77 ? 242 LYS A CB    1 
ATOM   1842  C  CG    . LYS A  1 242 ? 110.754 85.840  65.812  1.00 49.77 ? 242 LYS A CG    1 
ATOM   1843  C  CD    . LYS A  1 242 ? 109.840 85.189  64.799  1.00 49.77 ? 242 LYS A CD    1 
ATOM   1844  C  CE    . LYS A  1 242 ? 110.637 84.373  63.793  1.00 49.77 ? 242 LYS A CE    1 
ATOM   1845  N  NZ    . LYS A  1 242 ? 111.548 85.224  62.979  1.00 49.77 ? 242 LYS A NZ    1 
ATOM   1846  N  N     . TYR A  1 243 ? 110.855 88.208  70.165  1.00 44.83 ? 243 TYR A N     1 
ATOM   1847  C  CA    . TYR A  1 243 ? 110.377 89.074  71.243  1.00 44.83 ? 243 TYR A CA    1 
ATOM   1848  C  C     . TYR A  1 243 ? 109.371 88.420  72.187  1.00 44.83 ? 243 TYR A C     1 
ATOM   1849  O  O     . TYR A  1 243 ? 108.765 89.108  73.011  1.00 44.83 ? 243 TYR A O     1 
ATOM   1850  C  CB    . TYR A  1 243 ? 109.763 90.350  70.664  1.00 44.83 ? 243 TYR A CB    1 
ATOM   1851  C  CG    . TYR A  1 243 ? 110.748 91.424  70.293  1.00 44.83 ? 243 TYR A CG    1 
ATOM   1852  C  CD1   . TYR A  1 243 ? 111.854 91.686  71.084  1.00 44.83 ? 243 TYR A CD1   1 
ATOM   1853  C  CD2   . TYR A  1 243 ? 110.563 92.184  69.149  1.00 44.83 ? 243 TYR A CD2   1 
ATOM   1854  C  CE1   . TYR A  1 243 ? 112.751 92.679  70.742  1.00 44.83 ? 243 TYR A CE1   1 
ATOM   1855  C  CE2   . TYR A  1 243 ? 111.450 93.173  68.799  1.00 44.83 ? 243 TYR A CE2   1 
ATOM   1856  C  CZ    . TYR A  1 243 ? 112.540 93.419  69.596  1.00 44.83 ? 243 TYR A CZ    1 
ATOM   1857  O  OH    . TYR A  1 243 ? 113.421 94.411  69.239  1.00 44.83 ? 243 TYR A OH    1 
ATOM   1858  N  N     . VAL A  1 244 ? 109.184 87.107  72.094  1.00 41.15 ? 244 VAL A N     1 
ATOM   1859  C  CA    . VAL A  1 244 ? 108.237 86.411  72.953  1.00 41.15 ? 244 VAL A CA    1 
ATOM   1860  C  C     . VAL A  1 244 ? 108.865 85.924  74.252  1.00 41.15 ? 244 VAL A C     1 
ATOM   1861  O  O     . VAL A  1 244 ? 108.259 86.107  75.322  1.00 41.15 ? 244 VAL A O     1 
ATOM   1862  C  CB    . VAL A  1 244 ? 107.581 85.234  72.197  1.00 41.15 ? 244 VAL A CB    1 
ATOM   1863  C  CG1   . VAL A  1 244 ? 106.632 84.444  73.089  1.00 41.15 ? 244 VAL A CG1   1 
ATOM   1864  C  CG2   . VAL A  1 244 ? 106.841 85.746  70.974  1.00 41.15 ? 244 VAL A CG2   1 
ATOM   1865  N  N     . ILE A  1 245 ? 110.073 85.360  74.213  1.00 38.36 ? 245 ILE A N     1 
ATOM   1866  C  CA    . ILE A  1 245 ? 110.699 84.813  75.413  1.00 38.36 ? 245 ILE A CA    1 
ATOM   1867  C  C     . ILE A  1 245 ? 111.157 85.934  76.343  1.00 38.36 ? 245 ILE A C     1 
ATOM   1868  O  O     . ILE A  1 245 ? 110.914 85.895  77.556  1.00 38.36 ? 245 ILE A O     1 
ATOM   1869  C  CB    . ILE A  1 245 ? 111.864 83.888  75.015  1.00 38.36 ? 245 ILE A CB    1 
ATOM   1870  C  CG1   . ILE A  1 245 ? 111.324 82.600  74.395  1.00 38.36 ? 245 ILE A CG1   1 
ATOM   1871  C  CG2   . ILE A  1 245 ? 112.757 83.570  76.205  1.00 38.36 ? 245 ILE A CG2   1 
ATOM   1872  C  CD1   . ILE A  1 245 ? 112.401 81.656  73.912  1.00 38.36 ? 245 ILE A CD1   1 
ATOM   1873  N  N     . PHE A  1 246 ? 111.791 86.965  75.781  1.00 34.77 ? 246 PHE A N     1 
ATOM   1874  C  CA    . PHE A  1 246 ? 112.426 87.995  76.597  1.00 34.77 ? 246 PHE A CA    1 
ATOM   1875  C  C     . PHE A  1 246 ? 111.400 88.905  77.259  1.00 34.77 ? 246 PHE A C     1 
ATOM   1876  O  O     . PHE A  1 246 ? 111.574 89.311  78.415  1.00 34.77 ? 246 PHE A O     1 
ATOM   1877  C  CB    . PHE A  1 246 ? 113.386 88.811  75.742  1.00 34.77 ? 246 PHE A CB    1 
ATOM   1878  C  CG    . PHE A  1 246 ? 114.139 89.853  76.505  1.00 34.77 ? 246 PHE A CG    1 
ATOM   1879  C  CD1   . PHE A  1 246 ? 114.898 89.506  77.608  1.00 34.77 ? 246 PHE A CD1   1 
ATOM   1880  C  CD2   . PHE A  1 246 ? 114.105 91.177  76.108  1.00 34.77 ? 246 PHE A CD2   1 
ATOM   1881  C  CE1   . PHE A  1 246 ? 115.600 90.462  78.309  1.00 34.77 ? 246 PHE A CE1   1 
ATOM   1882  C  CE2   . PHE A  1 246 ? 114.807 92.135  76.801  1.00 34.77 ? 246 PHE A CE2   1 
ATOM   1883  C  CZ    . PHE A  1 246 ? 115.555 91.777  77.905  1.00 34.77 ? 246 PHE A CZ    1 
ATOM   1884  N  N     . ALA A  1 247 ? 110.318 89.228  76.547  1.00 33.32 ? 247 ALA A N     1 
ATOM   1885  C  CA    . ALA A  1 247 ? 109.270 90.063  77.123  1.00 33.32 ? 247 ALA A CA    1 
ATOM   1886  C  C     . ALA A  1 247 ? 108.545 89.338  78.247  1.00 33.32 ? 247 ALA A C     1 
ATOM   1887  O  O     . ALA A  1 247 ? 108.262 89.924  79.299  1.00 33.32 ? 247 ALA A O     1 
ATOM   1888  C  CB    . ALA A  1 247 ? 108.284 90.487  76.039  1.00 33.32 ? 247 ALA A CB    1 
ATOM   1889  N  N     . SER A  1 248 ? 108.257 88.049  78.043  1.00 31.58 ? 248 SER A N     1 
ATOM   1890  C  CA    . SER A  1 248 ? 107.625 87.247  79.085  1.00 31.58 ? 248 SER A CA    1 
ATOM   1891  C  C     . SER A  1 248 ? 108.538 87.103  80.293  1.00 31.58 ? 248 SER A C     1 
ATOM   1892  O  O     . SER A  1 248 ? 108.075 87.168  81.438  1.00 31.58 ? 248 SER A O     1 
ATOM   1893  C  CB    . SER A  1 248 ? 107.242 85.876  78.532  1.00 31.58 ? 248 SER A CB    1 
ATOM   1894  O  OG    . SER A  1 248 ? 106.609 85.995  77.273  1.00 31.58 ? 248 SER A OG    1 
ATOM   1895  N  N     . PHE A  1 249 ? 109.846 86.958  80.054  1.00 31.23 ? 249 PHE A N     1 
ATOM   1896  C  CA    . PHE A  1 249 ? 110.803 86.872  81.152  1.00 31.23 ? 249 PHE A CA    1 
ATOM   1897  C  C     . PHE A  1 249 ? 110.859 88.172  81.941  1.00 31.23 ? 249 PHE A C     1 
ATOM   1898  O  O     . PHE A  1 249 ? 110.894 88.151  83.174  1.00 31.23 ? 249 PHE A O     1 
ATOM   1899  C  CB    . PHE A  1 249 ? 112.191 86.515  80.628  1.00 31.23 ? 249 PHE A CB    1 
ATOM   1900  C  CG    . PHE A  1 249 ? 113.274 86.668  81.655  1.00 31.23 ? 249 PHE A CG    1 
ATOM   1901  C  CD1   . PHE A  1 249 ? 113.336 85.815  82.745  1.00 31.23 ? 249 PHE A CD1   1 
ATOM   1902  C  CD2   . PHE A  1 249 ? 114.223 87.670  81.538  1.00 31.23 ? 249 PHE A CD2   1 
ATOM   1903  C  CE1   . PHE A  1 249 ? 114.328 85.954  83.696  1.00 31.23 ? 249 PHE A CE1   1 
ATOM   1904  C  CE2   . PHE A  1 249 ? 115.217 87.815  82.487  1.00 31.23 ? 249 PHE A CE2   1 
ATOM   1905  C  CZ    . PHE A  1 249 ? 115.269 86.955  83.566  1.00 31.23 ? 249 PHE A CZ    1 
ATOM   1906  N  N     . ASN A  1 250 ? 110.821 89.315  81.244  1.00 29.73 ? 250 ASN A N     1 
ATOM   1907  C  CA    . ASN A  1 250 ? 110.851 90.608  81.925  1.00 29.73 ? 250 ASN A CA    1 
ATOM   1908  C  C     . ASN A  1 250 ? 109.606 90.838  82.771  1.00 29.73 ? 250 ASN A C     1 
ATOM   1909  O  O     . ASN A  1 250 ? 109.710 91.277  83.922  1.00 29.73 ? 250 ASN A O     1 
ATOM   1910  C  CB    . ASN A  1 250 ? 110.996 91.740  80.916  1.00 29.73 ? 250 ASN A CB    1 
ATOM   1911  C  CG    . ASN A  1 250 ? 112.406 91.906  80.432  1.00 29.73 ? 250 ASN A CG    1 
ATOM   1912  O  OD1   . ASN A  1 250 ? 113.359 91.764  81.195  1.00 29.73 ? 250 ASN A OD1   1 
ATOM   1913  N  ND2   . ASN A  1 250 ? 112.551 92.228  79.158  1.00 29.73 ? 250 ASN A ND2   1 
ATOM   1914  N  N     . LEU A  1 251 ? 108.425 90.529  82.234  1.00 25.76 ? 251 LEU A N     1 
ATOM   1915  C  CA    . LEU A  1 251 ? 107.202 90.825  82.978  1.00 25.76 ? 251 LEU A CA    1 
ATOM   1916  C  C     . LEU A  1 251 ? 107.001 89.862  84.146  1.00 25.76 ? 251 LEU A C     1 
ATOM   1917  O  O     . LEU A  1 251 ? 106.622 90.288  85.252  1.00 25.76 ? 251 LEU A O     1 
ATOM   1918  C  CB    . LEU A  1 251 ? 106.008 90.817  82.031  1.00 25.76 ? 251 LEU A CB    1 
ATOM   1919  C  CG    . LEU A  1 251 ? 106.241 91.839  80.915  1.00 25.76 ? 251 LEU A CG    1 
ATOM   1920  C  CD1   . LEU A  1 251 ? 105.292 91.647  79.745  1.00 25.76 ? 251 LEU A CD1   1 
ATOM   1921  C  CD2   . LEU A  1 251 ? 106.200 93.256  81.442  1.00 25.76 ? 251 LEU A CD2   1 
ATOM   1922  N  N     . ILE A  1 252 ? 107.285 88.569  83.938  1.00 25.39 ? 252 ILE A N     1 
ATOM   1923  C  CA    . ILE A  1 252 ? 107.226 87.608  85.036  1.00 25.39 ? 252 ILE A CA    1 
ATOM   1924  C  C     . ILE A  1 252 ? 108.284 87.914  86.090  1.00 25.39 ? 252 ILE A C     1 
ATOM   1925  O  O     . ILE A  1 252 ? 108.013 87.811  87.293  1.00 25.39 ? 252 ILE A O     1 
ATOM   1926  C  CB    . ILE A  1 252 ? 107.342 86.174  84.475  1.00 25.39 ? 252 ILE A CB    1 
ATOM   1927  C  CG1   . ILE A  1 252 ? 106.113 85.851  83.623  1.00 25.39 ? 252 ILE A CG1   1 
ATOM   1928  C  CG2   . ILE A  1 252 ? 107.516 85.136  85.573  1.00 25.39 ? 252 ILE A CG2   1 
ATOM   1929  C  CD1   . ILE A  1 252 ? 104.814 85.972  84.368  1.00 25.39 ? 252 ILE A CD1   1 
ATOM   1930  N  N     . TRP A  1 253 ? 109.466 88.380  85.674  1.00 24.03 ? 253 TRP A N     1 
ATOM   1931  C  CA    . TRP A  1 253 ? 110.498 88.729  86.639  1.00 24.03 ? 253 TRP A CA    1 
ATOM   1932  C  C     . TRP A  1 253 ? 110.140 89.978  87.431  1.00 24.03 ? 253 TRP A C     1 
ATOM   1933  O  O     . TRP A  1 253 ? 110.456 90.053  88.621  1.00 24.03 ? 253 TRP A O     1 
ATOM   1934  C  CB    . TRP A  1 253 ? 111.835 88.915  85.930  1.00 24.03 ? 253 TRP A CB    1 
ATOM   1935  C  CG    . TRP A  1 253 ? 112.963 89.199  86.857  1.00 24.03 ? 253 TRP A CG    1 
ATOM   1936  C  CD1   . TRP A  1 253 ? 113.693 90.344  86.923  1.00 24.03 ? 253 TRP A CD1   1 
ATOM   1937  C  CD2   . TRP A  1 253 ? 113.498 88.322  87.854  1.00 24.03 ? 253 TRP A CD2   1 
ATOM   1938  N  NE1   . TRP A  1 253 ? 114.650 90.239  87.899  1.00 24.03 ? 253 TRP A NE1   1 
ATOM   1939  C  CE2   . TRP A  1 253 ? 114.552 89.005  88.484  1.00 24.03 ? 253 TRP A CE2   1 
ATOM   1940  C  CE3   . TRP A  1 253 ? 113.191 87.024  88.272  1.00 24.03 ? 253 TRP A CE3   1 
ATOM   1941  C  CZ2   . TRP A  1 253 ? 115.293 88.440  89.515  1.00 24.03 ? 253 TRP A CZ2   1 
ATOM   1942  C  CZ3   . TRP A  1 253 ? 113.929 86.465  89.293  1.00 24.03 ? 253 TRP A CZ3   1 
ATOM   1943  C  CH2   . TRP A  1 253 ? 114.969 87.171  89.902  1.00 24.03 ? 253 TRP A CH2   1 
ATOM   1944  N  N     . SER A  1 254 ? 109.457 90.944  86.809  1.00 21.75 ? 254 SER A N     1 
ATOM   1945  C  CA    . SER A  1 254 ? 109.031 92.131  87.545  1.00 21.75 ? 254 SER A CA    1 
ATOM   1946  C  C     . SER A  1 254 ? 107.957 91.792  88.574  1.00 21.75 ? 254 SER A C     1 
ATOM   1947  O  O     . SER A  1 254 ? 107.989 92.307  89.701  1.00 21.75 ? 254 SER A O     1 
ATOM   1948  C  CB    . SER A  1 254 ? 108.529 93.199  86.579  1.00 21.75 ? 254 SER A CB    1 
ATOM   1949  O  OG    . SER A  1 254 ? 107.140 93.060  86.359  1.00 21.75 ? 254 SER A OG    1 
ATOM   1950  N  N     . THR A  1 255 ? 107.024 90.898  88.224  1.00 22.26 ? 255 THR A N     1 
ATOM   1951  C  CA    . THR A  1 255 ? 106.034 90.462  89.212  1.00 22.26 ? 255 THR A CA    1 
ATOM   1952  C  C     . THR A  1 255 ? 106.678 89.665  90.344  1.00 22.26 ? 255 THR A C     1 
ATOM   1953  O  O     . THR A  1 255 ? 106.312 89.832  91.519  1.00 22.26 ? 255 THR A O     1 
ATOM   1954  C  CB    . THR A  1 255 ? 104.950 89.626  88.546  1.00 22.26 ? 255 THR A CB    1 
ATOM   1955  O  OG1   . THR A  1 255 ? 104.607 90.214  87.289  1.00 22.26 ? 255 THR A OG1   1 
ATOM   1956  C  CG2   . THR A  1 255 ? 103.720 89.574  89.424  1.00 22.26 ? 255 THR A CG2   1 
ATOM   1957  N  N     . VAL A  1 256 ? 107.658 88.822  90.011  1.00 20.72 ? 256 VAL A N     1 
ATOM   1958  C  CA    . VAL A  1 256 ? 108.326 88.003  91.017  1.00 20.72 ? 256 VAL A CA    1 
ATOM   1959  C  C     . VAL A  1 256 ? 109.132 88.872  91.977  1.00 20.72 ? 256 VAL A C     1 
ATOM   1960  O  O     . VAL A  1 256 ? 109.090 88.660  93.195  1.00 20.72 ? 256 VAL A O     1 
ATOM   1961  C  CB    . VAL A  1 256 ? 109.185 86.927  90.325  1.00 20.72 ? 256 VAL A CB    1 
ATOM   1962  C  CG1   . VAL A  1 256 ? 110.272 86.393  91.237  1.00 20.72 ? 256 VAL A CG1   1 
ATOM   1963  C  CG2   . VAL A  1 256 ? 108.302 85.782  89.878  1.00 20.72 ? 256 VAL A CG2   1 
ATOM   1964  N  N     . ILE A  1 257 ? 109.819 89.899  91.469  1.00 19.85 ? 257 ILE A N     1 
ATOM   1965  C  CA    . ILE A  1 257 ? 110.580 90.741  92.389  1.00 19.85 ? 257 ILE A CA    1 
ATOM   1966  C  C     . ILE A  1 257 ? 109.662 91.654  93.198  1.00 19.85 ? 257 ILE A C     1 
ATOM   1967  O  O     . ILE A  1 257 ? 109.941 91.921  94.373  1.00 19.85 ? 257 ILE A O     1 
ATOM   1968  C  CB    . ILE A  1 257 ? 111.680 91.540  91.666  1.00 19.85 ? 257 ILE A CB    1 
ATOM   1969  C  CG1   . ILE A  1 257 ? 111.099 92.522  90.649  1.00 19.85 ? 257 ILE A CG1   1 
ATOM   1970  C  CG2   . ILE A  1 257 ? 112.653 90.591  91.014  1.00 19.85 ? 257 ILE A CG2   1 
ATOM   1971  C  CD1   . ILE A  1 257 ? 112.087 93.500  90.085  1.00 19.85 ? 257 ILE A CD1   1 
ATOM   1972  N  N     . LEU A  1 258 ? 108.524 92.084  92.642  1.00 20.38 ? 258 LEU A N     1 
ATOM   1973  C  CA    . LEU A  1 258 ? 107.617 92.902  93.432  1.00 20.38 ? 258 LEU A CA    1 
ATOM   1974  C  C     . LEU A  1 258 ? 106.820 92.098  94.451  1.00 20.38 ? 258 LEU A C     1 
ATOM   1975  O  O     . LEU A  1 258 ? 106.217 92.697  95.345  1.00 20.38 ? 258 LEU A O     1 
ATOM   1976  C  CB    . LEU A  1 258 ? 106.668 93.672  92.516  1.00 20.38 ? 258 LEU A CB    1 
ATOM   1977  C  CG    . LEU A  1 258 ? 107.315 94.889  91.857  1.00 20.38 ? 258 LEU A CG    1 
ATOM   1978  C  CD1   . LEU A  1 258 ? 106.332 95.584  90.937  1.00 20.38 ? 258 LEU A CD1   1 
ATOM   1979  C  CD2   . LEU A  1 258 ? 107.838 95.844  92.913  1.00 20.38 ? 258 LEU A CD2   1 
ATOM   1980  N  N     . GLU A  1 259 ? 106.792 90.769  94.340  1.00 24.90 ? 259 GLU A N     1 
ATOM   1981  C  CA    . GLU A  1 259 ? 106.219 89.973  95.422  1.00 24.90 ? 259 GLU A CA    1 
ATOM   1982  C  C     . GLU A  1 259 ? 107.268 89.532  96.446  1.00 24.90 ? 259 GLU A C     1 
ATOM   1983  O  O     . GLU A  1 259 ? 107.005 89.527  97.663  1.00 24.90 ? 259 GLU A O     1 
ATOM   1984  C  CB    . GLU A  1 259 ? 105.505 88.749  94.848  1.00 24.90 ? 259 GLU A CB    1 
ATOM   1985  C  CG    . GLU A  1 259 ? 104.756 87.929  95.883  1.00 24.90 ? 259 GLU A CG    1 
ATOM   1986  C  CD    . GLU A  1 259 ? 103.436 88.552  96.323  1.00 24.90 ? 259 GLU A CD    1 
ATOM   1987  O  OE1   . GLU A  1 259 ? 103.002 89.556  95.720  1.00 24.90 ? 259 GLU A OE1   1 
ATOM   1988  O  OE2   . GLU A  1 259 ? 102.835 88.039  97.290  1.00 24.90 ? 259 GLU A OE2   1 
ATOM   1989  N  N     . LEU A  1 260 ? 108.468 89.173  95.984  1.00 20.45 ? 260 LEU A N     1 
ATOM   1990  C  CA    . LEU A  1 260 ? 109.524 88.797  96.913  1.00 20.45 ? 260 LEU A CA    1 
ATOM   1991  C  C     . LEU A  1 260 ? 110.045 89.987  97.707  1.00 20.45 ? 260 LEU A C     1 
ATOM   1992  O  O     . LEU A  1 260 ? 110.597 89.785  98.794  1.00 20.45 ? 260 LEU A O     1 
ATOM   1993  C  CB    . LEU A  1 260 ? 110.679 88.118  96.178  1.00 20.45 ? 260 LEU A CB    1 
ATOM   1994  C  CG    . LEU A  1 260 ? 110.444 86.765  95.507  1.00 20.45 ? 260 LEU A CG    1 
ATOM   1995  C  CD1   . LEU A  1 260 ? 111.766 86.163  95.076  1.00 20.45 ? 260 LEU A CD1   1 
ATOM   1996  C  CD2   . LEU A  1 260 ? 109.703 85.825  96.426  1.00 20.45 ? 260 LEU A CD2   1 
ATOM   1997  N  N     . TRP A  1 261 ? 109.847 91.219  97.223  1.00 18.08 ? 261 TRP A N     1 
ATOM   1998  C  CA    . TRP A  1 261 ? 110.115 92.365  98.082  1.00 18.08 ? 261 TRP A CA    1 
ATOM   1999  C  C     . TRP A  1 261 ? 109.135 92.422  99.244  1.00 18.08 ? 261 TRP A C     1 
ATOM   2000  O  O     . TRP A  1 261 ? 109.530 92.750  100.363 1.00 18.08 ? 261 TRP A O     1 
ATOM   2001  C  CB    . TRP A  1 261 ? 110.072 93.681  97.306  1.00 18.08 ? 261 TRP A CB    1 
ATOM   2002  C  CG    . TRP A  1 261 ? 109.907 94.853  98.232  1.00 18.08 ? 261 TRP A CG    1 
ATOM   2003  C  CD1   . TRP A  1 261 ? 108.817 95.656  98.346  1.00 18.08 ? 261 TRP A CD1   1 
ATOM   2004  C  CD2   . TRP A  1 261 ? 110.840 95.304  99.226  1.00 18.08 ? 261 TRP A CD2   1 
ATOM   2005  N  NE1   . TRP A  1 261 ? 109.019 96.594  99.326  1.00 18.08 ? 261 TRP A NE1   1 
ATOM   2006  C  CE2   . TRP A  1 261 ? 110.253 96.396  99.884  1.00 18.08 ? 261 TRP A CE2   1 
ATOM   2007  C  CE3   . TRP A  1 261 ? 112.118 94.891  99.617  1.00 18.08 ? 261 TRP A CE3   1 
ATOM   2008  C  CZ2   . TRP A  1 261 ? 110.898 97.085  100.902 1.00 18.08 ? 261 TRP A CZ2   1 
ATOM   2009  C  CZ3   . TRP A  1 261 ? 112.754 95.575  100.629 1.00 18.08 ? 261 TRP A CZ3   1 
ATOM   2010  C  CH2   . TRP A  1 261 ? 112.145 96.659  101.259 1.00 18.08 ? 261 TRP A CH2   1 
ATOM   2011  N  N     . LYS A  1 262 ? 107.859 92.100  99.008  1.00 20.78 ? 262 LYS A N     1 
ATOM   2012  C  CA    . LYS A  1 262 ? 106.897 92.081  100.107 1.00 20.78 ? 262 LYS A CA    1 
ATOM   2013  C  C     . LYS A  1 262 ? 107.223 90.992  101.116 1.00 20.78 ? 262 LYS A C     1 
ATOM   2014  O  O     . LYS A  1 262 ? 107.087 91.213  102.327 1.00 20.78 ? 262 LYS A O     1 
ATOM   2015  C  CB    . LYS A  1 262 ? 105.479 91.899  99.577  1.00 20.78 ? 262 LYS A CB    1 
ATOM   2016  C  CG    . LYS A  1 262 ? 104.877 93.162  99.001  1.00 20.78 ? 262 LYS A CG    1 
ATOM   2017  C  CD    . LYS A  1 262 ? 103.370 93.061  98.924  1.00 20.78 ? 262 LYS A CD    1 
ATOM   2018  C  CE    . LYS A  1 262 ? 102.946 91.943  98.000  1.00 20.78 ? 262 LYS A CE    1 
ATOM   2019  N  NZ    . LYS A  1 262 ? 101.469 91.833  97.953  1.00 20.78 ? 262 LYS A NZ    1 
ATOM   2020  N  N     . ARG A  1 263 ? 107.707 89.841  100.641 1.00 25.54 ? 263 ARG A N     1 
ATOM   2021  C  CA    . ARG A  1 263 ? 108.148 88.795  101.568 1.00 25.54 ? 263 ARG A CA    1 
ATOM   2022  C  C     . ARG A  1 263 ? 109.374 89.226  102.376 1.00 25.54 ? 263 ARG A C     1 
ATOM   2023  O  O     . ARG A  1 263 ? 109.403 89.062  103.606 1.00 25.54 ? 263 ARG A O     1 
ATOM   2024  C  CB    . ARG A  1 263 ? 108.428 87.501  100.809 1.00 25.54 ? 263 ARG A CB    1 
ATOM   2025  C  CG    . ARG A  1 263 ? 107.172 86.801  100.329 1.00 25.54 ? 263 ARG A CG    1 
ATOM   2026  C  CD    . ARG A  1 263 ? 107.500 85.640  99.425  1.00 25.54 ? 263 ARG A CD    1 
ATOM   2027  N  NE    . ARG A  1 263 ? 108.146 84.557  100.151 1.00 25.54 ? 263 ARG A NE    1 
ATOM   2028  C  CZ    . ARG A  1 263 ? 107.496 83.522  100.668 1.00 25.54 ? 263 ARG A CZ    1 
ATOM   2029  N  NH1   . ARG A  1 263 ? 106.181 83.435  100.536 1.00 25.54 ? 263 ARG A NH1   1 
ATOM   2030  N  NH2   . ARG A  1 263 ? 108.158 82.576  101.315 1.00 25.54 ? 263 ARG A NH2   1 
ATOM   2031  N  N     . GLY A  1 264 ? 110.381 89.806  101.714 1.00 22.60 ? 264 GLY A N     1 
ATOM   2032  C  CA    . GLY A  1 264 ? 111.561 90.273  102.426 1.00 22.60 ? 264 GLY A CA    1 
ATOM   2033  C  C     . GLY A  1 264 ? 111.288 91.441  103.353 1.00 22.60 ? 264 GLY A C     1 
ATOM   2034  O  O     . GLY A  1 264 ? 111.920 91.566  104.404 1.00 22.60 ? 264 GLY A O     1 
ATOM   2035  N  N     . CYS A  1 265 ? 110.321 92.286  103.002 1.00 22.35 ? 265 CYS A N     1 
ATOM   2036  C  CA    . CYS A  1 265 ? 109.938 93.409  103.845 1.00 22.35 ? 265 CYS A CA    1 
ATOM   2037  C  C     . CYS A  1 265 ? 109.172 92.940  105.069 1.00 22.35 ? 265 CYS A C     1 
ATOM   2038  O  O     . CYS A  1 265 ? 109.349 93.498  106.156 1.00 22.35 ? 265 CYS A O     1 
ATOM   2039  C  CB    . CYS A  1 265 ? 109.106 94.404  103.036 1.00 22.35 ? 265 CYS A CB    1 
ATOM   2040  S  SG    . CYS A  1 265 ? 108.174 95.603  103.999 1.00 22.35 ? 265 CYS A SG    1 
ATOM   2041  N  N     . ALA A  1 266 ? 108.327 91.911  104.916 1.00 26.30 ? 266 ALA A N     1 
ATOM   2042  C  CA    . ALA A  1 266 ? 107.682 91.306  106.078 1.00 26.30 ? 266 ALA A CA    1 
ATOM   2043  C  C     . ALA A  1 266 ? 108.709 90.677  107.009 1.00 26.30 ? 266 ALA A C     1 
ATOM   2044  O  O     . ALA A  1 266 ? 108.608 90.815  108.234 1.00 26.30 ? 266 ALA A O     1 
ATOM   2045  C  CB    . ALA A  1 266 ? 106.658 90.266  105.631 1.00 26.30 ? 266 ALA A CB    1 
ATOM   2046  N  N     . ASN A  1 267 ? 109.736 90.037  106.441 1.00 28.79 ? 267 ASN A N     1 
ATOM   2047  C  CA    . ASN A  1 267 ? 110.798 89.450  107.259 1.00 28.79 ? 267 ASN A CA    1 
ATOM   2048  C  C     . ASN A  1 267 ? 111.599 90.520  108.002 1.00 28.79 ? 267 ASN A C     1 
ATOM   2049  O  O     . ASN A  1 267 ? 111.881 90.377  109.200 1.00 28.79 ? 267 ASN A O     1 
ATOM   2050  C  CB    . ASN A  1 267 ? 111.718 88.604  106.382 1.00 28.79 ? 267 ASN A CB    1 
ATOM   2051  C  CG    . ASN A  1 267 ? 112.821 87.942  107.171 1.00 28.79 ? 267 ASN A CG    1 
ATOM   2052  O  OD1   . ASN A  1 267 ? 112.643 87.592  108.335 1.00 28.79 ? 267 ASN A OD1   1 
ATOM   2053  N  ND2   . ASN A  1 267 ? 113.974 87.765  106.539 1.00 28.79 ? 267 ASN A ND2   1 
ATOM   2054  N  N     . MET A  1 268 ? 111.956 91.608  107.311 1.00 28.11 ? 268 MET A N     1 
ATOM   2055  C  CA    . MET A  1 268 ? 112.730 92.677  107.938 1.00 28.11 ? 268 MET A CA    1 
ATOM   2056  C  C     . MET A  1 268 ? 111.920 93.405  109.003 1.00 28.11 ? 268 MET A C     1 
ATOM   2057  O  O     . MET A  1 268 ? 112.416 93.658  110.105 1.00 28.11 ? 268 MET A O     1 
ATOM   2058  C  CB    . MET A  1 268 ? 113.221 93.667  106.885 1.00 28.11 ? 268 MET A CB    1 
ATOM   2059  C  CG    . MET A  1 268 ? 114.516 93.284  106.208 1.00 28.11 ? 268 MET A CG    1 
ATOM   2060  S  SD    . MET A  1 268 ? 115.282 94.705  105.412 1.00 28.11 ? 268 MET A SD    1 
ATOM   2061  C  CE    . MET A  1 268 ? 114.003 95.158  104.249 1.00 28.11 ? 268 MET A CE    1 
ATOM   2062  N  N     . THR A  1 269 ? 110.671 93.751  108.699 1.00 27.86 ? 269 THR A N     1 
ATOM   2063  C  CA    . THR A  1 269 ? 109.852 94.476  109.656 1.00 27.86 ? 269 THR A CA    1 
ATOM   2064  C  C     . THR A  1 269 ? 109.333 93.597  110.783 1.00 27.86 ? 269 THR A C     1 
ATOM   2065  O  O     . THR A  1 269 ? 108.843 94.134  111.780 1.00 27.86 ? 269 THR A O     1 
ATOM   2066  C  CB    . THR A  1 269 ? 108.683 95.149  108.944 1.00 27.86 ? 269 THR A CB    1 
ATOM   2067  O  OG1   . THR A  1 269 ? 108.087 94.229  108.025 1.00 27.86 ? 269 THR A OG1   1 
ATOM   2068  C  CG2   . THR A  1 269 ? 109.176 96.358  108.185 1.00 27.86 ? 269 THR A CG2   1 
ATOM   2069  N  N     . TYR A  1 270 ? 109.421 92.270  110.664 1.00 32.65 ? 270 TYR A N     1 
ATOM   2070  C  CA    . TYR A  1 270 ? 109.269 91.456  111.862 1.00 32.65 ? 270 TYR A CA    1 
ATOM   2071  C  C     . TYR A  1 270 ? 110.565 91.423  112.658 1.00 32.65 ? 270 TYR A C     1 
ATOM   2072  O  O     . TYR A  1 270 ? 110.533 91.359  113.891 1.00 32.65 ? 270 TYR A O     1 
ATOM   2073  C  CB    . TYR A  1 270 ? 108.830 90.037  111.506 1.00 32.65 ? 270 TYR A CB    1 
ATOM   2074  C  CG    . TYR A  1 270 ? 108.678 89.145  112.717 1.00 32.65 ? 270 TYR A CG    1 
ATOM   2075  C  CD1   . TYR A  1 270 ? 107.557 89.236  113.529 1.00 32.65 ? 270 TYR A CD1   1 
ATOM   2076  C  CD2   . TYR A  1 270 ? 109.660 88.220  113.055 1.00 32.65 ? 270 TYR A CD2   1 
ATOM   2077  C  CE1   . TYR A  1 270 ? 107.414 88.430  114.640 1.00 32.65 ? 270 TYR A CE1   1 
ATOM   2078  C  CE2   . TYR A  1 270 ? 109.530 87.417  114.164 1.00 32.65 ? 270 TYR A CE2   1 
ATOM   2079  C  CZ    . TYR A  1 270 ? 108.404 87.522  114.951 1.00 32.65 ? 270 TYR A CZ    1 
ATOM   2080  O  OH    . TYR A  1 270 ? 108.269 86.716  116.055 1.00 32.65 ? 270 TYR A OH    1 
ATOM   2081  N  N     . ARG A  1 271 ? 111.712 91.459  111.973 1.00 30.97 ? 271 ARG A N     1 
ATOM   2082  C  CA    . ARG A  1 271 ? 112.992 91.422  112.673 1.00 30.97 ? 271 ARG A CA    1 
ATOM   2083  C  C     . ARG A  1 271 ? 113.270 92.693  113.467 1.00 30.97 ? 271 ARG A C     1 
ATOM   2084  O  O     . ARG A  1 271 ? 114.085 92.660  114.393 1.00 30.97 ? 271 ARG A O     1 
ATOM   2085  C  CB    . ARG A  1 271 ? 114.125 91.177  111.678 1.00 30.97 ? 271 ARG A CB    1 
ATOM   2086  C  CG    . ARG A  1 271 ? 115.281 90.376  112.238 1.00 30.97 ? 271 ARG A CG    1 
ATOM   2087  C  CD    . ARG A  1 271 ? 116.230 89.944  111.136 1.00 30.97 ? 271 ARG A CD    1 
ATOM   2088  N  NE    . ARG A  1 271 ? 117.084 91.040  110.690 1.00 30.97 ? 271 ARG A NE    1 
ATOM   2089  C  CZ    . ARG A  1 271 ? 117.167 91.457  109.432 1.00 30.97 ? 271 ARG A CZ    1 
ATOM   2090  N  NH1   . ARG A  1 271 ? 116.448 90.869  108.488 1.00 30.97 ? 271 ARG A NH1   1 
ATOM   2091  N  NH2   . ARG A  1 271 ? 117.971 92.462  109.117 1.00 30.97 ? 271 ARG A NH2   1 
ATOM   2092  N  N     . TRP A  1 272 ? 112.618 93.807  113.133 1.00 25.99 ? 272 TRP A N     1 
ATOM   2093  C  CA    . TRP A  1 272 ? 112.782 95.040  113.892 1.00 25.99 ? 272 TRP A CA    1 
ATOM   2094  C  C     . TRP A  1 272 ? 111.647 95.286  114.872 1.00 25.99 ? 272 TRP A C     1 
ATOM   2095  O  O     . TRP A  1 272 ? 111.847 95.974  115.877 1.00 25.99 ? 272 TRP A O     1 
ATOM   2096  C  CB    . TRP A  1 272 ? 112.887 96.240  112.952 1.00 25.99 ? 272 TRP A CB    1 
ATOM   2097  C  CG    . TRP A  1 272 ? 114.002 96.156  111.972 1.00 25.99 ? 272 TRP A CG    1 
ATOM   2098  C  CD1   . TRP A  1 272 ? 115.191 95.517  112.135 1.00 25.99 ? 272 TRP A CD1   1 
ATOM   2099  C  CD2   . TRP A  1 272 ? 114.035 96.741  110.671 1.00 25.99 ? 272 TRP A CD2   1 
ATOM   2100  N  NE1   . TRP A  1 272 ? 115.964 95.665  111.012 1.00 25.99 ? 272 TRP A NE1   1 
ATOM   2101  C  CE2   . TRP A  1 272 ? 115.274 96.414  110.098 1.00 25.99 ? 272 TRP A CE2   1 
ATOM   2102  C  CE3   . TRP A  1 272 ? 113.133 97.509  109.933 1.00 25.99 ? 272 TRP A CE3   1 
ATOM   2103  C  CZ2   . TRP A  1 272 ? 115.635 96.827  108.825 1.00 25.99 ? 272 TRP A CZ2   1 
ATOM   2104  C  CZ3   . TRP A  1 272 ? 113.492 97.918  108.673 1.00 25.99 ? 272 TRP A CZ3   1 
ATOM   2105  C  CH2   . TRP A  1 272 ? 114.731 97.576  108.129 1.00 25.99 ? 272 TRP A CH2   1 
ATOM   2106  N  N     . GLY A  1 273 ? 110.460 94.756  114.600 1.00 33.09 ? 273 GLY A N     1 
ATOM   2107  C  CA    . GLY A  1 273 ? 109.330 94.894  115.493 1.00 33.09 ? 273 GLY A CA    1 
ATOM   2108  C  C     . GLY A  1 273 ? 108.232 95.805  114.997 1.00 33.09 ? 273 GLY A C     1 
ATOM   2109  O  O     . GLY A  1 273 ? 107.157 95.831  115.608 1.00 33.09 ? 273 GLY A O     1 
ATOM   2110  N  N     . THR A  1 274 ? 108.448 96.542  113.911 1.00 31.90 ? 274 THR A N     1 
ATOM   2111  C  CA    . THR A  1 274 ? 107.450 97.492  113.437 1.00 31.90 ? 274 THR A CA    1 
ATOM   2112  C  C     . THR A  1 274 ? 106.326 96.845  112.642 1.00 31.90 ? 274 THR A C     1 
ATOM   2113  O  O     . THR A  1 274 ? 105.404 97.551  112.223 1.00 31.90 ? 274 THR A O     1 
ATOM   2114  C  CB    . THR A  1 274 ? 108.116 98.575  112.596 1.00 31.90 ? 274 THR A CB    1 
ATOM   2115  O  OG1   . THR A  1 274 ? 108.624 97.997  111.390 1.00 31.90 ? 274 THR A OG1   1 
ATOM   2116  C  CG2   . THR A  1 274 ? 109.245 99.204  113.371 1.00 31.90 ? 274 THR A CG2   1 
ATOM   2117  N  N     . LEU A  1 275 ? 106.374 95.533  112.417 1.00 36.01 ? 275 LEU A N     1 
ATOM   2118  C  CA    . LEU A  1 275 ? 105.209 94.819  111.915 1.00 36.01 ? 275 LEU A CA    1 
ATOM   2119  C  C     . LEU A  1 275 ? 104.153 94.637  112.997 1.00 36.01 ? 275 LEU A C     1 
ATOM   2120  O  O     . LEU A  1 275 ? 102.973 94.460  112.678 1.00 36.01 ? 275 LEU A O     1 
ATOM   2121  C  CB    . LEU A  1 275 ? 105.635 93.458  111.358 1.00 36.01 ? 275 LEU A CB    1 
ATOM   2122  C  CG    . LEU A  1 275 ? 104.655 92.630  110.529 1.00 36.01 ? 275 LEU A CG    1 
ATOM   2123  C  CD1   . LEU A  1 275 ? 104.274 93.365  109.262 1.00 36.01 ? 275 LEU A CD1   1 
ATOM   2124  C  CD2   . LEU A  1 275 ? 105.258 91.281  110.204 1.00 36.01 ? 275 LEU A CD2   1 
ATOM   2125  N  N     . LEU A  1 276 ? 104.552 94.712  114.267 1.00 45.90 ? 276 LEU A N     1 
ATOM   2126  C  CA    . LEU A  1 276 ? 103.664 94.473  115.393 1.00 45.90 ? 276 LEU A CA    1 
ATOM   2127  C  C     . LEU A  1 276 ? 103.300 95.729  116.170 1.00 45.90 ? 276 LEU A C     1 
ATOM   2128  O  O     . LEU A  1 276 ? 102.459 95.649  117.072 1.00 45.90 ? 276 LEU A O     1 
ATOM   2129  C  CB    . LEU A  1 276 ? 104.301 93.460  116.350 1.00 45.90 ? 276 LEU A CB    1 
ATOM   2130  C  CG    . LEU A  1 276 ? 104.578 92.123  115.679 1.00 45.90 ? 276 LEU A CG    1 
ATOM   2131  C  CD1   . LEU A  1 276 ? 105.715 91.393  116.367 1.00 45.90 ? 276 LEU A CD1   1 
ATOM   2132  C  CD2   . LEU A  1 276 ? 103.308 91.306  115.693 1.00 45.90 ? 276 LEU A CD2   1 
ATOM   2133  N  N     . MET A  1 277 ? 103.917 96.869  115.868 1.00 55.97 ? 277 MET A N     1 
ATOM   2134  C  CA    . MET A  1 277 ? 103.536 98.116  116.515 1.00 55.97 ? 277 MET A CA    1 
ATOM   2135  C  C     . MET A  1 277 ? 102.157 98.545  116.033 1.00 55.97 ? 277 MET A C     1 
ATOM   2136  O  O     . MET A  1 277 ? 101.876 98.526  114.831 1.00 55.97 ? 277 MET A O     1 
ATOM   2137  C  CB    . MET A  1 277 ? 104.563 99.207  116.226 1.00 55.97 ? 277 MET A CB    1 
ATOM   2138  C  CG    . MET A  1 277 ? 105.765 99.193  117.151 1.00 55.97 ? 277 MET A CG    1 
ATOM   2139  S  SD    . MET A  1 277 ? 106.818 100.641 116.943 1.00 55.97 ? 277 MET A SD    1 
ATOM   2140  C  CE    . MET A  1 277 ? 105.599 101.951 117.020 1.00 55.97 ? 277 MET A CE    1 
ATOM   2141  N  N     . LYS A  1 278 ? 101.296 98.918  116.976 1.00 67.24 ? 278 LYS A N     1 
ATOM   2142  C  CA    . LYS A  1 278 ? 99.926  99.278  116.650 1.00 67.24 ? 278 LYS A CA    1 
ATOM   2143  C  C     . LYS A  1 278 ? 99.876  100.621 115.929 1.00 67.24 ? 278 LYS A C     1 
ATOM   2144  O  O     . LYS A  1 278 ? 100.789 101.446 116.023 1.00 67.24 ? 278 LYS A O     1 
ATOM   2145  C  CB    . LYS A  1 278 ? 99.072  99.334  117.915 1.00 67.24 ? 278 LYS A CB    1 
ATOM   2146  C  CG    . LYS A  1 278 ? 99.097  98.059  118.737 1.00 67.24 ? 278 LYS A CG    1 
ATOM   2147  C  CD    . LYS A  1 278 ? 98.141  98.146  119.913 1.00 67.24 ? 278 LYS A CD    1 
ATOM   2148  N  N     . ARG A  1 279 ? 98.789  100.828 115.192 1.00 75.91 ? 279 ARG A N     1 
ATOM   2149  C  CA    . ARG A  1 279 ? 98.593  102.078 114.472 1.00 75.91 ? 279 ARG A CA    1 
ATOM   2150  C  C     . ARG A  1 279 ? 98.246  103.186 115.457 1.00 75.91 ? 279 ARG A C     1 
ATOM   2151  O  O     . ARG A  1 279 ? 97.172  103.167 116.069 1.00 75.91 ? 279 ARG A O     1 
ATOM   2152  C  CB    . ARG A  1 279 ? 97.492  101.922 113.427 1.00 75.91 ? 279 ARG A CB    1 
ATOM   2153  C  CG    . ARG A  1 279 ? 97.812  100.915 112.336 1.00 75.91 ? 279 ARG A CG    1 
ATOM   2154  C  CD    . ARG A  1 279 ? 96.588  100.609 111.490 1.00 75.91 ? 279 ARG A CD    1 
ATOM   2155  N  N     . LYS A  1 280 ? 99.160  104.138 115.622 1.00 75.64 ? 280 LYS A N     1 
ATOM   2156  C  CA    . LYS A  1 280 ? 98.904  105.276 116.491 1.00 75.64 ? 280 LYS A CA    1 
ATOM   2157  C  C     . LYS A  1 280 ? 97.870  106.194 115.858 1.00 75.64 ? 280 LYS A C     1 
ATOM   2158  O  O     . LYS A  1 280 ? 97.854  106.389 114.639 1.00 75.64 ? 280 LYS A O     1 
ATOM   2159  C  CB    . LYS A  1 280 ? 100.196 106.046 116.758 1.00 75.64 ? 280 LYS A CB    1 
ATOM   2160  N  N     . PHE A  1 281 ? 96.993  106.746 116.692 1.00 75.16 ? 281 PHE A N     1 
ATOM   2161  C  CA    . PHE A  1 281 ? 95.965  107.650 116.198 1.00 75.16 ? 281 PHE A CA    1 
ATOM   2162  C  C     . PHE A  1 281 ? 96.600  108.971 115.787 1.00 75.16 ? 281 PHE A C     1 
ATOM   2163  O  O     . PHE A  1 281 ? 97.403  109.544 116.530 1.00 75.16 ? 281 PHE A O     1 
ATOM   2164  C  CB    . PHE A  1 281 ? 94.894  107.879 117.261 1.00 75.16 ? 281 PHE A CB    1 
ATOM   2165  C  CG    . PHE A  1 281 ? 93.701  108.630 116.756 1.00 75.16 ? 281 PHE A CG    1 
ATOM   2166  C  CD1   . PHE A  1 281 ? 92.715  107.977 116.033 1.00 75.16 ? 281 PHE A CD1   1 
ATOM   2167  C  CD2   . PHE A  1 281 ? 93.569  109.991 116.989 1.00 75.16 ? 281 PHE A CD2   1 
ATOM   2168  C  CE1   . PHE A  1 281 ? 91.613  108.664 115.558 1.00 75.16 ? 281 PHE A CE1   1 
ATOM   2169  C  CE2   . PHE A  1 281 ? 92.473  110.687 116.513 1.00 75.16 ? 281 PHE A CE2   1 
ATOM   2170  C  CZ    . PHE A  1 281 ? 91.491  110.022 115.799 1.00 75.16 ? 281 PHE A CZ    1 
ATOM   2171  N  N     . GLU A  1 282 ? 96.242  109.450 114.601 1.00 63.80 ? 282 GLU A N     1 
ATOM   2172  C  CA    . GLU A  1 282 ? 96.920  110.586 113.999 1.00 63.80 ? 282 GLU A CA    1 
ATOM   2173  C  C     . GLU A  1 282 ? 96.266  111.897 114.416 1.00 63.80 ? 282 GLU A C     1 
ATOM   2174  O  O     . GLU A  1 282 ? 95.049  112.065 114.289 1.00 63.80 ? 282 GLU A O     1 
ATOM   2175  C  CB    . GLU A  1 282 ? 96.923  110.461 112.476 1.00 63.80 ? 282 GLU A CB    1 
ATOM   2176  C  CG    . GLU A  1 282 ? 97.975  109.508 111.943 1.00 63.80 ? 282 GLU A CG    1 
ATOM   2177  C  CD    . GLU A  1 282 ? 98.609  110.001 110.659 1.00 63.80 ? 282 GLU A CD    1 
ATOM   2178  O  OE1   . GLU A  1 282 ? 99.352  111.005 110.711 1.00 63.80 ? 282 GLU A OE1   1 
ATOM   2179  O  OE2   . GLU A  1 282 ? 98.372  109.384 109.600 1.00 63.80 ? 282 GLU A OE2   1 
ATOM   2180  N  N     . GLU A  1 283 ? 97.085  112.817 114.904 1.00 58.44 ? 283 GLU A N     1 
ATOM   2181  C  CA    . GLU A  1 283 ? 96.693  114.186 115.176 1.00 58.44 ? 283 GLU A CA    1 
ATOM   2182  C  C     . GLU A  1 283 ? 96.485  114.913 113.848 1.00 58.44 ? 283 GLU A C     1 
ATOM   2183  O  O     . GLU A  1 283 ? 97.020  114.490 112.820 1.00 58.44 ? 283 GLU A O     1 
ATOM   2184  C  CB    . GLU A  1 283 ? 97.787  114.852 116.017 1.00 58.44 ? 283 GLU A CB    1 
ATOM   2185  C  CG    . GLU A  1 283 ? 97.525  116.250 116.584 1.00 58.44 ? 283 GLU A CG    1 
ATOM   2186  C  CD    . GLU A  1 283 ? 96.447  116.272 117.655 1.00 58.44 ? 283 GLU A CD    1 
ATOM   2187  O  OE1   . GLU A  1 283 ? 96.235  115.236 118.317 1.00 58.44 ? 283 GLU A OE1   1 
ATOM   2188  O  OE2   . GLU A  1 283 ? 95.815  117.334 117.840 1.00 58.44 ? 283 GLU A OE2   1 
ATOM   2189  N  N     . PRO A  1 284 ? 95.660  115.964 113.826 1.00 51.35 ? 284 PRO A N     1 
ATOM   2190  C  CA    . PRO A  1 284 ? 95.610  116.838 112.647 1.00 51.35 ? 284 PRO A CA    1 
ATOM   2191  C  C     . PRO A  1 284 ? 96.968  117.444 112.324 1.00 51.35 ? 284 PRO A C     1 
ATOM   2192  O  O     . PRO A  1 284 ? 97.739  117.799 113.217 1.00 51.35 ? 284 PRO A O     1 
ATOM   2193  C  CB    . PRO A  1 284 ? 94.600  117.911 113.055 1.00 51.35 ? 284 PRO A CB    1 
ATOM   2194  C  CG    . PRO A  1 284 ? 93.657  117.177 113.928 1.00 51.35 ? 284 PRO A CG    1 
ATOM   2195  C  CD    . PRO A  1 284 ? 94.464  116.141 114.671 1.00 51.35 ? 284 PRO A CD    1 
ATOM   2196  N  N     . ARG A  1 285 ? 97.253  117.542 111.026 1.00 42.93 ? 285 ARG A N     1 
ATOM   2197  C  CA    . ARG A  1 285 ? 98.584  117.883 110.554 1.00 42.93 ? 285 ARG A CA    1 
ATOM   2198  C  C     . ARG A  1 285 ? 98.893  119.358 110.822 1.00 42.93 ? 285 ARG A C     1 
ATOM   2199  O  O     . ARG A  1 285 ? 97.978  120.168 110.985 1.00 42.93 ? 285 ARG A O     1 
ATOM   2200  C  CB    . ARG A  1 285 ? 98.700  117.564 109.062 1.00 42.93 ? 285 ARG A CB    1 
ATOM   2201  C  CG    . ARG A  1 285 ? 97.852  118.419 108.153 1.00 42.93 ? 285 ARG A CG    1 
ATOM   2202  C  CD    . ARG A  1 285 ? 98.215  118.170 106.702 1.00 42.93 ? 285 ARG A CD    1 
ATOM   2203  N  NE    . ARG A  1 285 ? 99.614  118.483 106.433 1.00 42.93 ? 285 ARG A NE    1 
ATOM   2204  C  CZ    . ARG A  1 285 ? 100.026 119.611 105.869 1.00 42.93 ? 285 ARG A CZ    1 
ATOM   2205  N  NH1   . ARG A  1 285 ? 101.318 119.821 105.662 1.00 42.93 ? 285 ARG A NH1   1 
ATOM   2206  N  NH2   . ARG A  1 285 ? 99.144  120.531 105.510 1.00 42.93 ? 285 ARG A NH2   1 
ATOM   2207  N  N     . PRO A  1 286 ? 100.186 119.735 110.885 1.00 47.09 ? 286 PRO A N     1 
ATOM   2208  C  CA    . PRO A  1 286 ? 100.533 121.132 111.180 1.00 47.09 ? 286 PRO A CA    1 
ATOM   2209  C  C     . PRO A  1 286 ? 100.220 122.088 110.042 1.00 47.09 ? 286 PRO A C     1 
ATOM   2210  O  O     . PRO A  1 286 ? 101.066 122.344 109.181 1.00 47.09 ? 286 PRO A O     1 
ATOM   2211  C  CB    . PRO A  1 286 ? 102.042 121.071 111.448 1.00 47.09 ? 286 PRO A CB    1 
ATOM   2212  C  CG    . PRO A  1 286 ? 102.493 119.801 110.826 1.00 47.09 ? 286 PRO A CG    1 
ATOM   2213  C  CD    . PRO A  1 286 ? 101.363 118.863 111.054 1.00 47.09 ? 286 PRO A CD    1 
ATOM   2214  N  N     . GLY A  1 287 ? 99.003  122.625 110.041 1.00 46.22 ? 287 GLY A N     1 
ATOM   2215  C  CA    . GLY A  1 287 ? 98.533  123.454 108.951 1.00 46.22 ? 287 GLY A CA    1 
ATOM   2216  C  C     . GLY A  1 287 ? 97.146  123.081 108.478 1.00 46.22 ? 287 GLY A C     1 
ATOM   2217  O  O     . GLY A  1 287 ? 96.749  123.416 107.359 1.00 46.22 ? 287 GLY A O     1 
ATOM   2218  N  N     . PHE A  1 288 ? 96.401  122.378 109.326 1.00 44.19 ? 288 PHE A N     1 
ATOM   2219  C  CA    . PHE A  1 288 ? 94.990  122.084 109.099 1.00 44.19 ? 288 PHE A CA    1 
ATOM   2220  C  C     . PHE A  1 288 ? 94.175  123.004 109.995 1.00 44.19 ? 288 PHE A C     1 
ATOM   2221  O  O     . PHE A  1 288 ? 94.145  122.816 111.216 1.00 44.19 ? 288 PHE A O     1 
ATOM   2222  C  CB    . PHE A  1 288 ? 94.677  120.621 109.394 1.00 44.19 ? 288 PHE A CB    1 
ATOM   2223  C  CG    . PHE A  1 288 ? 93.211  120.324 109.495 1.00 44.19 ? 288 PHE A CG    1 
ATOM   2224  C  CD1   . PHE A  1 288 ? 92.389  120.453 108.390 1.00 44.19 ? 288 PHE A CD1   1 
ATOM   2225  C  CD2   . PHE A  1 288 ? 92.657  119.913 110.693 1.00 44.19 ? 288 PHE A CD2   1 
ATOM   2226  C  CE1   . PHE A  1 288 ? 91.042  120.177 108.479 1.00 44.19 ? 288 PHE A CE1   1 
ATOM   2227  C  CE2   . PHE A  1 288 ? 91.310  119.634 110.787 1.00 44.19 ? 288 PHE A CE2   1 
ATOM   2228  C  CZ    . PHE A  1 288 ? 90.503  119.767 109.678 1.00 44.19 ? 288 PHE A CZ    1 
ATOM   2229  N  N     . HIS A  1 289 ? 93.519  123.994 109.399 1.00 46.98 ? 289 HIS A N     1 
ATOM   2230  C  CA    . HIS A  1 289 ? 92.757  124.983 110.147 1.00 46.98 ? 289 HIS A CA    1 
ATOM   2231  C  C     . HIS A  1 289 ? 91.293  124.946 109.734 1.00 46.98 ? 289 HIS A C     1 
ATOM   2232  O  O     . HIS A  1 289 ? 90.972  124.937 108.543 1.00 46.98 ? 289 HIS A O     1 
ATOM   2233  C  CB    . HIS A  1 289 ? 93.326  126.392 109.943 1.00 46.98 ? 289 HIS A CB    1 
ATOM   2234  C  CG    . HIS A  1 289 ? 93.523  126.770 108.507 1.00 46.98 ? 289 HIS A CG    1 
ATOM   2235  N  ND1   . HIS A  1 289 ? 92.478  127.110 107.675 1.00 46.98 ? 289 HIS A ND1   1 
ATOM   2236  C  CD2   . HIS A  1 289 ? 94.647  126.874 107.760 1.00 46.98 ? 289 HIS A CD2   1 
ATOM   2237  C  CE1   . HIS A  1 289 ? 92.949  127.401 106.476 1.00 46.98 ? 289 HIS A CE1   1 
ATOM   2238  N  NE2   . HIS A  1 289 ? 94.263  127.265 106.501 1.00 46.98 ? 289 HIS A NE2   1 
ATOM   2239  N  N     . GLY A  1 290 ? 90.417  124.934 110.722 1.00 54.24 ? 290 GLY A N     1 
ATOM   2240  C  CA    . GLY A  1 290 ? 88.982  124.958 110.496 1.00 54.24 ? 290 GLY A CA    1 
ATOM   2241  C  C     . GLY A  1 290 ? 88.321  125.793 111.566 1.00 54.24 ? 290 GLY A C     1 
ATOM   2242  O  O     . GLY A  1 290 ? 88.878  126.798 112.017 1.00 54.24 ? 290 GLY A O     1 
ATOM   2243  N  N     . VAL A  1 291 ? 87.124  125.382 111.976 1.00 60.98 ? 291 VAL A N     1 
ATOM   2244  C  CA    . VAL A  1 291 ? 86.416  126.023 113.080 1.00 60.98 ? 291 VAL A CA    1 
ATOM   2245  C  C     . VAL A  1 291 ? 86.540  125.118 114.301 1.00 60.98 ? 291 VAL A C     1 
ATOM   2246  O  O     . VAL A  1 291 ? 86.657  123.895 114.166 1.00 60.98 ? 291 VAL A O     1 
ATOM   2247  C  CB    . VAL A  1 291 ? 84.949  126.322 112.705 1.00 60.98 ? 291 VAL A CB    1 
ATOM   2248  C  CG1   . VAL A  1 291 ? 84.084  125.062 112.652 1.00 60.98 ? 291 VAL A CG1   1 
ATOM   2249  C  CG2   . VAL A  1 291 ? 84.342  127.369 113.636 1.00 60.98 ? 291 VAL A CG2   1 
ATOM   2250  N  N     . LEU A  1 292 ? 86.598  125.711 115.489 1.00 67.49 ? 292 LEU A N     1 
ATOM   2251  C  CA    . LEU A  1 292 ? 86.751  124.915 116.700 1.00 67.49 ? 292 LEU A CA    1 
ATOM   2252  C  C     . LEU A  1 292 ? 85.456  124.175 117.006 1.00 67.49 ? 292 LEU A C     1 
ATOM   2253  O  O     . LEU A  1 292 ? 84.374  124.768 116.985 1.00 67.49 ? 292 LEU A O     1 
ATOM   2254  C  CB    . LEU A  1 292 ? 87.149  125.800 117.882 1.00 67.49 ? 292 LEU A CB    1 
ATOM   2255  C  CG    . LEU A  1 292 ? 88.633  126.072 118.161 1.00 67.49 ? 292 LEU A CG    1 
ATOM   2256  C  CD1   . LEU A  1 292 ? 89.351  124.770 118.473 1.00 67.49 ? 292 LEU A CD1   1 
ATOM   2257  C  CD2   . LEU A  1 292 ? 89.338  126.826 117.037 1.00 67.49 ? 292 LEU A CD2   1 
ATOM   2258  N  N     . GLY A  1 293 ? 85.557  122.881 117.289 1.00 68.26 ? 293 GLY A N     1 
ATOM   2259  C  CA    . GLY A  1 293 ? 84.361  122.119 117.552 1.00 68.26 ? 293 GLY A CA    1 
ATOM   2260  C  C     . GLY A  1 293 ? 84.671  120.804 118.227 1.00 68.26 ? 293 GLY A C     1 
ATOM   2261  O  O     . GLY A  1 293 ? 85.805  120.540 118.632 1.00 68.26 ? 293 GLY A O     1 
ATOM   2262  N  N     . ILE A  1 294 ? 83.635  119.983 118.350 1.00 71.16 ? 294 ILE A N     1 
ATOM   2263  C  CA    . ILE A  1 294 ? 83.740  118.678 118.990 1.00 71.16 ? 294 ILE A CA    1 
ATOM   2264  C  C     . ILE A  1 294 ? 84.082  117.645 117.925 1.00 71.16 ? 294 ILE A C     1 
ATOM   2265  O  O     . ILE A  1 294 ? 83.356  117.497 116.936 1.00 71.16 ? 294 ILE A O     1 
ATOM   2266  C  CB    . ILE A  1 294 ? 82.438  118.311 119.719 1.00 71.16 ? 294 ILE A CB    1 
ATOM   2267  C  CG1   . ILE A  1 294 ? 82.244  119.198 120.952 1.00 71.16 ? 294 ILE A CG1   1 
ATOM   2268  C  CG2   . ILE A  1 294 ? 82.435  116.841 120.117 1.00 71.16 ? 294 ILE A CG2   1 
ATOM   2269  C  CD1   . ILE A  1 294 ? 83.425  119.204 121.900 1.00 71.16 ? 294 ILE A CD1   1 
ATOM   2270  N  N     . ASN A  1 295 ? 85.195  116.943 118.121 1.00 71.06 ? 295 ASN A N     1 
ATOM   2271  C  CA    . ASN A  1 295 ? 85.557  115.846 117.237 1.00 71.06 ? 295 ASN A CA    1 
ATOM   2272  C  C     . ASN A  1 295 ? 84.606  114.677 117.457 1.00 71.06 ? 295 ASN A C     1 
ATOM   2273  O  O     . ASN A  1 295 ? 84.315  114.310 118.598 1.00 71.06 ? 295 ASN A O     1 
ATOM   2274  C  CB    . ASN A  1 295 ? 87.000  115.419 117.493 1.00 71.06 ? 295 ASN A CB    1 
ATOM   2275  C  CG    . ASN A  1 295 ? 87.610  114.694 116.318 1.00 71.06 ? 295 ASN A CG    1 
ATOM   2276  O  OD1   . ASN A  1 295 ? 87.046  114.674 115.226 1.00 71.06 ? 295 ASN A OD1   1 
ATOM   2277  N  ND2   . ASN A  1 295 ? 88.774  114.094 116.534 1.00 71.06 ? 295 ASN A ND2   1 
ATOM   2278  N  N     . SER A  1 296 ? 84.109  114.102 116.362 1.00 67.55 ? 296 SER A N     1 
ATOM   2279  C  CA    . SER A  1 296 ? 83.097  113.056 116.478 1.00 67.55 ? 296 SER A CA    1 
ATOM   2280  C  C     . SER A  1 296 ? 83.706  111.736 116.930 1.00 67.55 ? 296 SER A C     1 
ATOM   2281  O  O     . SER A  1 296 ? 83.081  110.986 117.689 1.00 67.55 ? 296 SER A O     1 
ATOM   2282  C  CB    . SER A  1 296 ? 82.373  112.880 115.145 1.00 67.55 ? 296 SER A CB    1 
ATOM   2283  O  OG    . SER A  1 296 ? 83.070  111.974 114.309 1.00 67.55 ? 296 SER A OG    1 
ATOM   2284  N  N     . ILE A  1 297 ? 84.920  111.434 116.476 1.00 67.12 ? 297 ILE A N     1 
ATOM   2285  C  CA    . ILE A  1 297 ? 85.575  110.171 116.795 1.00 67.12 ? 297 ILE A CA    1 
ATOM   2286  C  C     . ILE A  1 297 ? 86.060  110.177 118.237 1.00 67.12 ? 297 ILE A C     1 
ATOM   2287  O  O     . ILE A  1 297 ? 85.642  109.345 119.048 1.00 67.12 ? 297 ILE A O     1 
ATOM   2288  C  CB    . ILE A  1 297 ? 86.744  109.898 115.833 1.00 67.12 ? 297 ILE A CB    1 
ATOM   2289  C  CG1   . ILE A  1 297 ? 86.241  109.818 114.391 1.00 67.12 ? 297 ILE A CG1   1 
ATOM   2290  C  CG2   . ILE A  1 297 ? 87.473  108.629 116.231 1.00 67.12 ? 297 ILE A CG2   1 
ATOM   2291  C  CD1   . ILE A  1 297 ? 87.335  109.939 113.355 1.00 67.12 ? 297 ILE A CD1   1 
ATOM   2292  N  N     . THR A  1 298 ? 86.942  111.122 118.567 1.00 72.82 ? 298 THR A N     1 
ATOM   2293  C  CA    . THR A  1 298 ? 87.605  111.088 119.865 1.00 72.82 ? 298 THR A CA    1 
ATOM   2294  C  C     . THR A  1 298 ? 86.743  111.679 120.971 1.00 72.82 ? 298 THR A C     1 
ATOM   2295  O  O     . THR A  1 298 ? 86.832  111.240 122.122 1.00 72.82 ? 298 THR A O     1 
ATOM   2296  C  CB    . THR A  1 298 ? 88.935  111.831 119.790 1.00 72.82 ? 298 THR A CB    1 
ATOM   2297  O  OG1   . THR A  1 298 ? 88.759  113.047 119.056 1.00 72.82 ? 298 THR A OG1   1 
ATOM   2298  C  CG2   . THR A  1 298 ? 89.967  110.977 119.090 1.00 72.82 ? 298 THR A CG2   1 
ATOM   2299  N  N     . GLY A  1 299 ? 85.911  112.667 120.652 1.00 74.32 ? 299 GLY A N     1 
ATOM   2300  C  CA    . GLY A  1 299 ? 85.109  113.338 121.648 1.00 74.32 ? 299 GLY A CA    1 
ATOM   2301  C  C     . GLY A  1 299 ? 85.736  114.578 122.243 1.00 74.32 ? 299 GLY A C     1 
ATOM   2302  O  O     . GLY A  1 299 ? 85.053  115.306 122.975 1.00 74.32 ? 299 GLY A O     1 
ATOM   2303  N  N     . LYS A  1 300 ? 87.007  114.846 121.957 1.00 77.84 ? 300 LYS A N     1 
ATOM   2304  C  CA    . LYS A  1 300 ? 87.673  116.038 122.461 1.00 77.84 ? 300 LYS A CA    1 
ATOM   2305  C  C     . LYS A  1 300 ? 87.397  117.213 121.524 1.00 77.84 ? 300 LYS A C     1 
ATOM   2306  O  O     . LYS A  1 300 ? 86.565  117.138 120.617 1.00 77.84 ? 300 LYS A O     1 
ATOM   2307  C  CB    . LYS A  1 300 ? 89.167  115.779 122.631 1.00 77.84 ? 300 LYS A CB    1 
ATOM   2308  C  CG    . LYS A  1 300 ? 89.849  115.211 121.397 1.00 77.84 ? 300 LYS A CG    1 
ATOM   2309  C  CD    . LYS A  1 300 ? 91.369  115.260 121.512 1.00 77.84 ? 300 LYS A CD    1 
ATOM   2310  C  CE    . LYS A  1 300 ? 91.868  114.709 122.842 1.00 77.84 ? 300 LYS A CE    1 
ATOM   2311  N  NZ    . LYS A  1 300 ? 91.478  113.286 123.047 1.00 77.84 ? 300 LYS A NZ    1 
ATOM   2312  N  N     . GLU A  1 301 ? 88.100  118.321 121.736 1.00 78.05 ? 301 GLU A N     1 
ATOM   2313  C  CA    . GLU A  1 301 ? 87.926  119.528 120.939 1.00 78.05 ? 301 GLU A CA    1 
ATOM   2314  C  C     . GLU A  1 301 ? 89.019  119.597 119.885 1.00 78.05 ? 301 GLU A C     1 
ATOM   2315  O  O     . GLU A  1 301 ? 90.204  119.444 120.199 1.00 78.05 ? 301 GLU A O     1 
ATOM   2316  C  CB    . GLU A  1 301 ? 87.952  120.778 121.820 1.00 78.05 ? 301 GLU A CB    1 
ATOM   2317  C  CG    . GLU A  1 301 ? 86.610  121.112 122.445 1.00 78.05 ? 301 GLU A CG    1 
ATOM   2318  C  CD    . GLU A  1 301 ? 86.415  122.597 122.653 1.00 78.05 ? 301 GLU A CD    1 
ATOM   2319  O  OE1   . GLU A  1 301 ? 87.322  123.373 122.286 1.00 78.05 ? 301 GLU A OE1   1 
ATOM   2320  O  OE2   . GLU A  1 301 ? 85.355  122.989 123.181 1.00 78.05 ? 301 GLU A OE2   1 
ATOM   2321  N  N     . GLU A  1 302 ? 88.619  119.828 118.643 1.00 66.39 ? 302 GLU A N     1 
ATOM   2322  C  CA    . GLU A  1 302 ? 89.523  119.818 117.508 1.00 66.39 ? 302 GLU A CA    1 
ATOM   2323  C  C     . GLU A  1 302 ? 89.030  120.813 116.471 1.00 66.39 ? 302 GLU A C     1 
ATOM   2324  O  O     . GLU A  1 302 ? 87.869  121.240 116.515 1.00 66.39 ? 302 GLU A O     1 
ATOM   2325  C  CB    . GLU A  1 302 ? 89.616  118.413 116.894 1.00 66.39 ? 302 GLU A CB    1 
ATOM   2326  N  N     . PRO A  1 303 ? 89.893  121.231 115.549 1.00 58.87 ? 303 PRO A N     1 
ATOM   2327  C  CA    . PRO A  1 303 ? 89.400  121.938 114.368 1.00 58.87 ? 303 PRO A CA    1 
ATOM   2328  C  C     . PRO A  1 303 ? 88.631  120.996 113.459 1.00 58.87 ? 303 PRO A C     1 
ATOM   2329  O  O     . PRO A  1 303 ? 89.018  119.847 113.238 1.00 58.87 ? 303 PRO A O     1 
ATOM   2330  C  CB    . PRO A  1 303 ? 90.679  122.443 113.693 1.00 58.87 ? 303 PRO A CB    1 
ATOM   2331  C  CG    . PRO A  1 303 ? 91.676  122.504 114.784 1.00 58.87 ? 303 PRO A CG    1 
ATOM   2332  C  CD    . PRO A  1 303 ? 91.356  121.350 115.676 1.00 58.87 ? 303 PRO A CD    1 
ATOM   2333  N  N     . LEU A  1 304 ? 87.521  121.501 112.939 1.00 55.73 ? 304 LEU A N     1 
ATOM   2334  C  CA    . LEU A  1 304 ? 86.654  120.776 112.028 1.00 55.73 ? 304 LEU A CA    1 
ATOM   2335  C  C     . LEU A  1 304 ? 86.566  121.548 110.724 1.00 55.73 ? 304 LEU A C     1 
ATOM   2336  O  O     . LEU A  1 304 ? 86.569  122.784 110.720 1.00 55.73 ? 304 LEU A O     1 
ATOM   2337  C  CB    . LEU A  1 304 ? 85.250  120.587 112.615 1.00 55.73 ? 304 LEU A CB    1 
ATOM   2338  C  CG    . LEU A  1 304 ? 85.072  119.793 113.910 1.00 55.73 ? 304 LEU A CG    1 
ATOM   2339  C  CD1   . LEU A  1 304 ? 83.630  119.339 114.042 1.00 55.73 ? 304 LEU A CD1   1 
ATOM   2340  C  CD2   . LEU A  1 304 ? 86.001  118.593 113.955 1.00 55.73 ? 304 LEU A CD2   1 
ATOM   2341  N  N     . TYR A  1 305 ? 86.496  120.809 109.621 1.00 46.12 ? 305 TYR A N     1 
ATOM   2342  C  CA    . TYR A  1 305 ? 86.359  121.384 108.298 1.00 46.12 ? 305 TYR A CA    1 
ATOM   2343  C  C     . TYR A  1 305 ? 85.248  120.637 107.573 1.00 46.12 ? 305 TYR A C     1 
ATOM   2344  O  O     . TYR A  1 305 ? 85.163  119.401 107.678 1.00 46.12 ? 305 TYR A O     1 
ATOM   2345  C  CB    . TYR A  1 305 ? 87.669  121.293 107.511 1.00 46.12 ? 305 TYR A CB    1 
ATOM   2346  C  CG    . TYR A  1 305 ? 87.798  122.333 106.427 1.00 46.12 ? 305 TYR A CG    1 
ATOM   2347  C  CD1   . TYR A  1 305 ? 88.126  123.645 106.736 1.00 46.12 ? 305 TYR A CD1   1 
ATOM   2348  C  CD2   . TYR A  1 305 ? 87.590  122.003 105.097 1.00 46.12 ? 305 TYR A CD2   1 
ATOM   2349  C  CE1   . TYR A  1 305 ? 88.243  124.601 105.748 1.00 46.12 ? 305 TYR A CE1   1 
ATOM   2350  C  CE2   . TYR A  1 305 ? 87.705  122.952 104.101 1.00 46.12 ? 305 TYR A CE2   1 
ATOM   2351  C  CZ    . TYR A  1 305 ? 88.032  124.248 104.434 1.00 46.12 ? 305 TYR A CZ    1 
ATOM   2352  O  OH    . TYR A  1 305 ? 88.147  125.196 103.446 1.00 46.12 ? 305 TYR A OH    1 
ATOM   2353  N  N     . PRO A  1 306 ? 84.371  121.335 106.856 1.00 46.96 ? 306 PRO A N     1 
ATOM   2354  C  CA    . PRO A  1 306 ? 83.336  120.640 106.085 1.00 46.96 ? 306 PRO A CA    1 
ATOM   2355  C  C     . PRO A  1 306 ? 83.944  119.930 104.889 1.00 46.96 ? 306 PRO A C     1 
ATOM   2356  O  O     . PRO A  1 306 ? 84.806  120.473 104.196 1.00 46.96 ? 306 PRO A O     1 
ATOM   2357  C  CB    . PRO A  1 306 ? 82.394  121.770 105.649 1.00 46.96 ? 306 PRO A CB    1 
ATOM   2358  C  CG    . PRO A  1 306 ? 82.783  122.962 106.476 1.00 46.96 ? 306 PRO A CG    1 
ATOM   2359  C  CD    . PRO A  1 306 ? 84.232  122.796 106.769 1.00 46.96 ? 306 PRO A CD    1 
ATOM   2360  N  N     . SER A  1 307 ? 83.492  118.696 104.659 1.00 42.91 ? 307 SER A N     1 
ATOM   2361  C  CA    . SER A  1 307 ? 84.091  117.869 103.619 1.00 42.91 ? 307 SER A CA    1 
ATOM   2362  C  C     . SER A  1 307 ? 83.757  118.353 102.216 1.00 42.91 ? 307 SER A C     1 
ATOM   2363  O  O     . SER A  1 307 ? 84.560  118.141 101.300 1.00 42.91 ? 307 SER A O     1 
ATOM   2364  C  CB    . SER A  1 307 ? 83.648  116.416 103.783 1.00 42.91 ? 307 SER A CB    1 
ATOM   2365  O  OG    . SER A  1 307 ? 84.508  115.544 103.073 1.00 42.91 ? 307 SER A OG    1 
ATOM   2366  N  N     . TYR A  1 308 ? 82.607  119.008 102.027 1.00 46.67 ? 308 TYR A N     1 
ATOM   2367  C  CA    . TYR A  1 308 ? 82.252  119.478 100.693 1.00 46.67 ? 308 TYR A CA    1 
ATOM   2368  C  C     . TYR A  1 308 ? 83.130  120.642 100.257 1.00 46.67 ? 308 TYR A C     1 
ATOM   2369  O  O     . TYR A  1 308 ? 83.415  120.777 99.065  1.00 46.67 ? 308 TYR A O     1 
ATOM   2370  C  CB    . TYR A  1 308 ? 80.770  119.861 100.623 1.00 46.67 ? 308 TYR A CB    1 
ATOM   2371  C  CG    . TYR A  1 308 ? 80.318  120.962 101.562 1.00 46.67 ? 308 TYR A CG    1 
ATOM   2372  C  CD1   . TYR A  1 308 ? 79.829  120.661 102.827 1.00 46.67 ? 308 TYR A CD1   1 
ATOM   2373  C  CD2   . TYR A  1 308 ? 80.340  122.297 101.169 1.00 46.67 ? 308 TYR A CD2   1 
ATOM   2374  C  CE1   . TYR A  1 308 ? 79.399  121.658 103.683 1.00 46.67 ? 308 TYR A CE1   1 
ATOM   2375  C  CE2   . TYR A  1 308 ? 79.919  123.300 102.019 1.00 46.67 ? 308 TYR A CE2   1 
ATOM   2376  C  CZ    . TYR A  1 308 ? 79.449  122.974 103.275 1.00 46.67 ? 308 TYR A CZ    1 
ATOM   2377  O  OH    . TYR A  1 308 ? 79.023  123.968 104.126 1.00 46.67 ? 308 TYR A OH    1 
ATOM   2378  N  N     . LYS A  1 309 ? 83.591  121.467 101.202 1.00 45.22 ? 309 LYS A N     1 
ATOM   2379  C  CA    . LYS A  1 309 ? 84.517  122.541 100.855 1.00 45.22 ? 309 LYS A CA    1 
ATOM   2380  C  C     . LYS A  1 309 ? 85.870  121.986 100.430 1.00 45.22 ? 309 LYS A C     1 
ATOM   2381  O  O     . LYS A  1 309 ? 86.492  122.502 99.494  1.00 45.22 ? 309 LYS A O     1 
ATOM   2382  C  CB    . LYS A  1 309 ? 84.679  123.498 102.034 1.00 45.22 ? 309 LYS A CB    1 
ATOM   2383  C  CG    . LYS A  1 309 ? 83.433  124.298 102.361 1.00 45.22 ? 309 LYS A CG    1 
ATOM   2384  C  CD    . LYS A  1 309 ? 83.721  125.340 103.428 1.00 45.22 ? 309 LYS A CD    1 
ATOM   2385  C  CE    . LYS A  1 309 ? 82.538  126.270 103.632 1.00 45.22 ? 309 LYS A CE    1 
ATOM   2386  N  NZ    . LYS A  1 309 ? 82.864  127.361 104.588 1.00 45.22 ? 309 LYS A NZ    1 
ATOM   2387  N  N     . ARG A  1 310 ? 86.323  120.914 101.083 1.00 39.63 ? 310 ARG A N     1 
ATOM   2388  C  CA    . ARG A  1 310 ? 87.574  120.273 100.693 1.00 39.63 ? 310 ARG A CA    1 
ATOM   2389  C  C     . ARG A  1 310 ? 87.448  119.599 99.332  1.00 39.63 ? 310 ARG A C     1 
ATOM   2390  O  O     . ARG A  1 310 ? 88.358  119.698 98.498  1.00 39.63 ? 310 ARG A O     1 
ATOM   2391  C  CB    . ARG A  1 310 ? 87.993  119.265 101.764 1.00 39.63 ? 310 ARG A CB    1 
ATOM   2392  C  CG    . ARG A  1 310 ? 89.183  118.405 101.397 1.00 39.63 ? 310 ARG A CG    1 
ATOM   2393  C  CD    . ARG A  1 310 ? 89.962  118.004 102.629 1.00 39.63 ? 310 ARG A CD    1 
ATOM   2394  N  NE    . ARG A  1 310 ? 89.205  117.107 103.494 1.00 39.63 ? 310 ARG A NE    1 
ATOM   2395  C  CZ    . ARG A  1 310 ? 88.855  117.397 104.741 1.00 39.63 ? 310 ARG A CZ    1 
ATOM   2396  N  NH1   . ARG A  1 310 ? 89.193  118.562 105.269 1.00 39.63 ? 310 ARG A NH1   1 
ATOM   2397  N  NH2   . ARG A  1 310 ? 88.169  116.522 105.462 1.00 39.63 ? 310 ARG A NH2   1 
ATOM   2398  N  N     . GLN A  1 311 ? 86.314  118.939 99.075  1.00 38.97 ? 311 GLN A N     1 
ATOM   2399  C  CA    . GLN A  1 311 ? 86.110  118.309 97.774  1.00 38.97 ? 311 GLN A CA    1 
ATOM   2400  C  C     . GLN A  1 311 ? 85.953  119.339 96.663  1.00 38.97 ? 311 GLN A C     1 
ATOM   2401  O  O     . GLN A  1 311 ? 86.393  119.094 95.535  1.00 38.97 ? 311 GLN A O     1 
ATOM   2402  C  CB    . GLN A  1 311 ? 84.899  117.382 97.816  1.00 38.97 ? 311 GLN A CB    1 
ATOM   2403  C  CG    . GLN A  1 311 ? 85.081  116.169 98.707  1.00 38.97 ? 311 GLN A CG    1 
ATOM   2404  C  CD    . GLN A  1 311 ? 86.224  115.283 98.263  1.00 38.97 ? 311 GLN A CD    1 
ATOM   2405  O  OE1   . GLN A  1 311 ? 86.410  115.041 97.072  1.00 38.97 ? 311 GLN A OE1   1 
ATOM   2406  N  NE2   . GLN A  1 311 ? 86.999  114.792 99.222  1.00 38.97 ? 311 GLN A NE2   1 
ATOM   2407  N  N     . LEU A  1 312 ? 85.360  120.499 96.962  1.00 39.94 ? 312 LEU A N     1 
ATOM   2408  C  CA    . LEU A  1 312 ? 85.317  121.583 95.987  1.00 39.94 ? 312 LEU A CA    1 
ATOM   2409  C  C     . LEU A  1 312 ? 86.705  122.138 95.709  1.00 39.94 ? 312 LEU A C     1 
ATOM   2410  O  O     . LEU A  1 312 ? 87.063  122.339 94.542  1.00 39.94 ? 312 LEU A O     1 
ATOM   2411  C  CB    . LEU A  1 312 ? 84.403  122.704 96.478  1.00 39.94 ? 312 LEU A CB    1 
ATOM   2412  C  CG    . LEU A  1 312 ? 82.892  122.557 96.305  1.00 39.94 ? 312 LEU A CG    1 
ATOM   2413  C  CD1   . LEU A  1 312 ? 82.210  123.886 96.570  1.00 39.94 ? 312 LEU A CD1   1 
ATOM   2414  C  CD2   . LEU A  1 312 ? 82.543  122.033 94.924  1.00 39.94 ? 312 LEU A CD2   1 
ATOM   2415  N  N     . ARG A  1 313 ? 87.504  122.359 96.762  1.00 38.77 ? 313 ARG A N     1 
ATOM   2416  C  CA    . ARG A  1 313 ? 88.857  122.882 96.601  1.00 38.77 ? 313 ARG A CA    1 
ATOM   2417  C  C     . ARG A  1 313 ? 89.762  121.910 95.859  1.00 38.77 ? 313 ARG A C     1 
ATOM   2418  O  O     . ARG A  1 313 ? 90.727  122.337 95.217  1.00 38.77 ? 313 ARG A O     1 
ATOM   2419  C  CB    . ARG A  1 313 ? 89.461  123.214 97.964  1.00 38.77 ? 313 ARG A CB    1 
ATOM   2420  C  CG    . ARG A  1 313 ? 89.017  124.543 98.530  1.00 38.77 ? 313 ARG A CG    1 
ATOM   2421  C  CD    . ARG A  1 313 ? 89.511  124.724 99.948  1.00 38.77 ? 313 ARG A CD    1 
ATOM   2422  N  NE    . ARG A  1 313 ? 90.031  126.067 100.166 1.00 38.77 ? 313 ARG A NE    1 
ATOM   2423  C  CZ    . ARG A  1 313 ? 90.493  126.505 101.330 1.00 38.77 ? 313 ARG A CZ    1 
ATOM   2424  N  NH1   . ARG A  1 313 ? 90.496  125.703 102.384 1.00 38.77 ? 313 ARG A NH1   1 
ATOM   2425  N  NH2   . ARG A  1 313 ? 90.950  127.743 101.442 1.00 38.77 ? 313 ARG A NH2   1 
ATOM   2426  N  N     . ILE A  1 314 ? 89.480  120.612 95.934  1.00 37.49 ? 314 ILE A N     1 
ATOM   2427  C  CA    . ILE A  1 314 ? 90.197  119.668 95.084  1.00 37.49 ? 314 ILE A CA    1 
ATOM   2428  C  C     . ILE A  1 314 ? 89.669  119.728 93.655  1.00 37.49 ? 314 ILE A C     1 
ATOM   2429  O  O     . ILE A  1 314 ? 90.361  120.204 92.749  1.00 37.49 ? 314 ILE A O     1 
ATOM   2430  C  CB    . ILE A  1 314 ? 90.117  118.241 95.655  1.00 37.49 ? 314 ILE A CB    1 
ATOM   2431  C  CG1   . ILE A  1 314 ? 90.842  118.156 96.995  1.00 37.49 ? 314 ILE A CG1   1 
ATOM   2432  C  CG2   . ILE A  1 314 ? 90.749  117.257 94.698  1.00 37.49 ? 314 ILE A CG2   1 
ATOM   2433  C  CD1   . ILE A  1 314 ? 90.768  116.789 97.637  1.00 37.49 ? 314 ILE A CD1   1 
ATOM   2434  N  N     . TYR A  1 315 ? 88.402  119.350 93.454  1.00 38.56 ? 315 TYR A N     1 
ATOM   2435  C  CA    . TYR A  1 315 ? 87.865  119.046 92.134  1.00 38.56 ? 315 TYR A CA    1 
ATOM   2436  C  C     . TYR A  1 315 ? 87.498  120.279 91.316  1.00 38.56 ? 315 TYR A C     1 
ATOM   2437  O  O     . TYR A  1 315 ? 86.972  120.130 90.208  1.00 38.56 ? 315 TYR A O     1 
ATOM   2438  C  CB    . TYR A  1 315 ? 86.643  118.137 92.262  1.00 38.56 ? 315 TYR A CB    1 
ATOM   2439  C  CG    . TYR A  1 315 ? 86.978  116.722 92.659  1.00 38.56 ? 315 TYR A CG    1 
ATOM   2440  C  CD1   . TYR A  1 315 ? 88.196  116.156 92.313  1.00 38.56 ? 315 TYR A CD1   1 
ATOM   2441  C  CD2   . TYR A  1 315 ? 86.075  115.951 93.377  1.00 38.56 ? 315 TYR A CD2   1 
ATOM   2442  C  CE1   . TYR A  1 315 ? 88.509  114.863 92.673  1.00 38.56 ? 315 TYR A CE1   1 
ATOM   2443  C  CE2   . TYR A  1 315 ? 86.378  114.655 93.742  1.00 38.56 ? 315 TYR A CE2   1 
ATOM   2444  C  CZ    . TYR A  1 315 ? 87.597  114.117 93.387  1.00 38.56 ? 315 TYR A CZ    1 
ATOM   2445  O  OH    . TYR A  1 315 ? 87.908  112.827 93.747  1.00 38.56 ? 315 TYR A OH    1 
ATOM   2446  N  N     . LEU A  1 316 ? 87.747  121.487 91.819  1.00 39.71 ? 316 LEU A N     1 
ATOM   2447  C  CA    . LEU A  1 316 ? 87.580  122.666 90.975  1.00 39.71 ? 316 LEU A CA    1 
ATOM   2448  C  C     . LEU A  1 316 ? 88.829  123.516 90.840  1.00 39.71 ? 316 LEU A C     1 
ATOM   2449  O  O     . LEU A  1 316 ? 88.885  124.338 89.921  1.00 39.71 ? 316 LEU A O     1 
ATOM   2450  C  CB    . LEU A  1 316 ? 86.438  123.552 91.488  1.00 39.71 ? 316 LEU A CB    1 
ATOM   2451  C  CG    . LEU A  1 316 ? 85.004  123.263 91.030  1.00 39.71 ? 316 LEU A CG    1 
ATOM   2452  C  CD1   . LEU A  1 316 ? 84.415  122.010 91.659  1.00 39.71 ? 316 LEU A CD1   1 
ATOM   2453  C  CD2   . LEU A  1 316 ? 84.124  124.469 91.316  1.00 39.71 ? 316 LEU A CD2   1 
ATOM   2454  N  N     . VAL A  1 317 ? 89.832  123.364 91.704  1.00 37.88 ? 317 VAL A N     1 
ATOM   2455  C  CA    . VAL A  1 317 ? 91.051  124.153 91.634  1.00 37.88 ? 317 VAL A CA    1 
ATOM   2456  C  C     . VAL A  1 317 ? 92.270  123.288 91.339  1.00 37.88 ? 317 VAL A C     1 
ATOM   2457  O  O     . VAL A  1 317 ? 93.078  123.629 90.468  1.00 37.88 ? 317 VAL A O     1 
ATOM   2458  C  CB    . VAL A  1 317 ? 91.261  124.967 92.929  1.00 37.88 ? 317 VAL A CB    1 
ATOM   2459  C  CG1   . VAL A  1 317 ? 92.556  125.765 92.871  1.00 37.88 ? 317 VAL A CG1   1 
ATOM   2460  C  CG2   . VAL A  1 317 ? 90.083  125.894 93.169  1.00 37.88 ? 317 VAL A CG2   1 
ATOM   2461  N  N     . SER A  1 318 ? 92.415  122.153 92.031  1.00 37.36 ? 318 SER A N     1 
ATOM   2462  C  CA    . SER A  1 318 ? 93.625  121.356 91.878  1.00 37.36 ? 318 SER A CA    1 
ATOM   2463  C  C     . SER A  1 318 ? 93.642  120.599 90.557  1.00 37.36 ? 318 SER A C     1 
ATOM   2464  O  O     . SER A  1 318 ? 94.637  120.653 89.829  1.00 37.36 ? 318 SER A O     1 
ATOM   2465  C  CB    . SER A  1 318 ? 93.759  120.381 93.043  1.00 37.36 ? 318 SER A CB    1 
ATOM   2466  O  OG    . SER A  1 318 ? 92.948  119.241 92.833  1.00 37.36 ? 318 SER A OG    1 
ATOM   2467  N  N     . LEU A  1 319 ? 92.554  119.909 90.229  1.00 37.11 ? 319 LEU A N     1 
ATOM   2468  C  CA    . LEU A  1 319 ? 92.435  119.134 88.996  1.00 37.11 ? 319 LEU A CA    1 
ATOM   2469  C  C     . LEU A  1 319 ? 92.514  119.980 87.715  1.00 37.11 ? 319 LEU A C     1 
ATOM   2470  O  O     . LEU A  1 319 ? 93.153  119.521 86.754  1.00 37.11 ? 319 LEU A O     1 
ATOM   2471  C  CB    . LEU A  1 319 ? 91.148  118.298 89.037  1.00 37.11 ? 319 LEU A CB    1 
ATOM   2472  C  CG    . LEU A  1 319 ? 90.725  117.520 87.793  1.00 37.11 ? 319 LEU A CG    1 
ATOM   2473  C  CD1   . LEU A  1 319 ? 91.759  116.470 87.444  1.00 37.11 ? 319 LEU A CD1   1 
ATOM   2474  C  CD2   . LEU A  1 319 ? 89.366  116.883 88.005  1.00 37.11 ? 319 LEU A CD2   1 
ATOM   2475  N  N     . PRO A  1 320 ? 91.929  121.193 87.625  1.00 36.43 ? 320 PRO A N     1 
ATOM   2476  C  CA    . PRO A  1 320 ? 92.264  122.039 86.466  1.00 36.43 ? 320 PRO A CA    1 
ATOM   2477  C  C     . PRO A  1 320 ? 93.716  122.475 86.415  1.00 36.43 ? 320 PRO A C     1 
ATOM   2478  O  O     . PRO A  1 320 ? 94.264  122.605 85.315  1.00 36.43 ? 320 PRO A O     1 
ATOM   2479  C  CB    . PRO A  1 320 ? 91.326  123.241 86.628  1.00 36.43 ? 320 PRO A CB    1 
ATOM   2480  C  CG    . PRO A  1 320 ? 90.165  122.684 87.290  1.00 36.43 ? 320 PRO A CG    1 
ATOM   2481  C  CD    . PRO A  1 320 ? 90.744  121.757 88.309  1.00 36.43 ? 320 PRO A CD    1 
ATOM   2482  N  N     . PHE A  1 321 ? 94.370  122.670 87.563  1.00 34.00 ? 321 PHE A N     1 
ATOM   2483  C  CA    . PHE A  1 321 ? 95.787  123.020 87.540  1.00 34.00 ? 321 PHE A CA    1 
ATOM   2484  C  C     . PHE A  1 321 ? 96.641  121.840 87.093  1.00 34.00 ? 321 PHE A C     1 
ATOM   2485  O  O     . PHE A  1 321 ? 97.630  122.024 86.373  1.00 34.00 ? 321 PHE A O     1 
ATOM   2486  C  CB    . PHE A  1 321 ? 96.241  123.511 88.911  1.00 34.00 ? 321 PHE A CB    1 
ATOM   2487  C  CG    . PHE A  1 321 ? 97.664  123.983 88.937  1.00 34.00 ? 321 PHE A CG    1 
ATOM   2488  C  CD1   . PHE A  1 321 ? 98.002  125.220 88.417  1.00 34.00 ? 321 PHE A CD1   1 
ATOM   2489  C  CD2   . PHE A  1 321 ? 98.665  123.188 89.473  1.00 34.00 ? 321 PHE A CD2   1 
ATOM   2490  C  CE1   . PHE A  1 321 ? 99.312  125.660 88.434  1.00 34.00 ? 321 PHE A CE1   1 
ATOM   2491  C  CE2   . PHE A  1 321 ? 99.976  123.620 89.494  1.00 34.00 ? 321 PHE A CE2   1 
ATOM   2492  C  CZ    . PHE A  1 321 ? 100.300 124.858 88.973  1.00 34.00 ? 321 PHE A CZ    1 
ATOM   2493  N  N     . VAL A  1 322 ? 96.265  120.623 87.494  1.00 33.49 ? 322 VAL A N     1 
ATOM   2494  C  CA    . VAL A  1 322 ? 96.985  119.434 87.047  1.00 33.49 ? 322 VAL A CA    1 
ATOM   2495  C  C     . VAL A  1 322 ? 96.792  119.226 85.549  1.00 33.49 ? 322 VAL A C     1 
ATOM   2496  O  O     . VAL A  1 322 ? 97.746  118.903 84.832  1.00 33.49 ? 322 VAL A O     1 
ATOM   2497  C  CB    . VAL A  1 322 ? 96.543  118.206 87.866  1.00 33.49 ? 322 VAL A CB    1 
ATOM   2498  C  CG1   . VAL A  1 322 ? 97.164  116.928 87.329  1.00 33.49 ? 322 VAL A CG1   1 
ATOM   2499  C  CG2   . VAL A  1 322 ? 96.930  118.386 89.314  1.00 33.49 ? 322 VAL A CG2   1 
ATOM   2500  N  N     . CYS A  1 323 ? 95.573  119.462 85.044  1.00 34.11 ? 323 CYS A N     1 
ATOM   2501  C  CA    . CYS A  1 323 ? 95.329  119.330 83.608  1.00 34.11 ? 323 CYS A CA    1 
ATOM   2502  C  C     . CYS A  1 323 ? 96.071  120.399 82.809  1.00 34.11 ? 323 CYS A C     1 
ATOM   2503  O  O     . CYS A  1 323 ? 96.599  120.115 81.724  1.00 34.11 ? 323 CYS A O     1 
ATOM   2504  C  CB    . CYS A  1 323 ? 93.830  119.391 83.326  1.00 34.11 ? 323 CYS A CB    1 
ATOM   2505  S  SG    . CYS A  1 323 ? 92.929  117.899 83.799  1.00 34.11 ? 323 CYS A SG    1 
ATOM   2506  N  N     . LEU A  1 324 ? 96.151  121.620 83.347  1.00 31.81 ? 324 LEU A N     1 
ATOM   2507  C  CA    . LEU A  1 324 ? 96.921  122.678 82.700  1.00 31.81 ? 324 LEU A CA    1 
ATOM   2508  C  C     . LEU A  1 324 ? 98.411  122.352 82.688  1.00 31.81 ? 324 LEU A C     1 
ATOM   2509  O  O     . LEU A  1 324 ? 99.101  122.608 81.694  1.00 31.81 ? 324 LEU A O     1 
ATOM   2510  C  CB    . LEU A  1 324 ? 96.664  124.008 83.406  1.00 31.81 ? 324 LEU A CB    1 
ATOM   2511  C  CG    . LEU A  1 324 ? 97.633  125.161 83.149  1.00 31.81 ? 324 LEU A CG    1 
ATOM   2512  C  CD1   . LEU A  1 324 ? 97.396  125.754 81.774  1.00 31.81 ? 324 LEU A CD1   1 
ATOM   2513  C  CD2   . LEU A  1 324 ? 97.499  126.221 84.225  1.00 31.81 ? 324 LEU A CD2   1 
ATOM   2514  N  N     . CYS A  1 325 ? 98.917  121.752 83.768  1.00 29.03 ? 325 CYS A N     1 
ATOM   2515  C  CA    . CYS A  1 325 ? 100.328 121.383 83.806  1.00 29.03 ? 325 CYS A CA    1 
ATOM   2516  C  C     . CYS A  1 325 ? 100.641 120.221 82.869  1.00 29.03 ? 325 CYS A C     1 
ATOM   2517  O  O     . CYS A  1 325 ? 101.723 120.191 82.270  1.00 29.03 ? 325 CYS A O     1 
ATOM   2518  C  CB    . CYS A  1 325 ? 100.739 121.050 85.237  1.00 29.03 ? 325 CYS A CB    1 
ATOM   2519  S  SG    . CYS A  1 325 ? 101.089 122.510 86.235  1.00 29.03 ? 325 CYS A SG    1 
ATOM   2520  N  N     . LEU A  1 326 ? 99.707  119.278 82.703  1.00 27.55 ? 326 LEU A N     1 
ATOM   2521  C  CA    . LEU A  1 326 ? 99.906  118.213 81.720  1.00 27.55 ? 326 LEU A CA    1 
ATOM   2522  C  C     . LEU A  1 326 ? 99.888  118.763 80.298  1.00 27.55 ? 326 LEU A C     1 
ATOM   2523  O  O     . LEU A  1 326 ? 100.683 118.329 79.449  1.00 27.55 ? 326 LEU A O     1 
ATOM   2524  C  CB    . LEU A  1 326 ? 98.845  117.123 81.875  1.00 27.55 ? 326 LEU A CB    1 
ATOM   2525  C  CG    . LEU A  1 326 ? 98.774  116.303 83.167  1.00 27.55 ? 326 LEU A CG    1 
ATOM   2526  C  CD1   . LEU A  1 326 ? 97.901  115.074 82.981  1.00 27.55 ? 326 LEU A CD1   1 
ATOM   2527  C  CD2   . LEU A  1 326 ? 100.146 115.921 83.677  1.00 27.55 ? 326 LEU A CD2   1 
ATOM   2528  N  N     . TYR A  1 327 ? 99.007  119.733 80.025  1.00 30.68 ? 327 TYR A N     1 
ATOM   2529  C  CA    . TYR A  1 327 ? 98.991  120.365 78.708  1.00 30.68 ? 327 TYR A CA    1 
ATOM   2530  C  C     . TYR A  1 327 ? 100.273 121.152 78.452  1.00 30.68 ? 327 TYR A C     1 
ATOM   2531  O  O     . TYR A  1 327 ? 100.797 121.152 77.331  1.00 30.68 ? 327 TYR A O     1 
ATOM   2532  C  CB    . TYR A  1 327 ? 97.772  121.274 78.568  1.00 30.68 ? 327 TYR A CB    1 
ATOM   2533  C  CG    . TYR A  1 327 ? 97.859  122.213 77.389  1.00 30.68 ? 327 TYR A CG    1 
ATOM   2534  C  CD1   . TYR A  1 327 ? 97.759  121.734 76.091  1.00 30.68 ? 327 TYR A CD1   1 
ATOM   2535  C  CD2   . TYR A  1 327 ? 98.051  123.577 77.574  1.00 30.68 ? 327 TYR A CD2   1 
ATOM   2536  C  CE1   . TYR A  1 327 ? 97.845  122.586 75.008  1.00 30.68 ? 327 TYR A CE1   1 
ATOM   2537  C  CE2   . TYR A  1 327 ? 98.140  124.436 76.497  1.00 30.68 ? 327 TYR A CE2   1 
ATOM   2538  C  CZ    . TYR A  1 327 ? 98.035  123.935 75.218  1.00 30.68 ? 327 TYR A CZ    1 
ATOM   2539  O  OH    . TYR A  1 327 ? 98.120  124.790 74.144  1.00 30.68 ? 327 TYR A OH    1 
ATOM   2540  N  N     . PHE A  1 328 ? 100.805 121.810 79.485  1.00 29.68 ? 328 PHE A N     1 
ATOM   2541  C  CA    . PHE A  1 328 ? 102.061 122.535 79.325  1.00 29.68 ? 328 PHE A CA    1 
ATOM   2542  C  C     . PHE A  1 328 ? 103.236 121.587 79.123  1.00 29.68 ? 328 PHE A C     1 
ATOM   2543  O  O     . PHE A  1 328 ? 104.167 121.912 78.376  1.00 29.68 ? 328 PHE A O     1 
ATOM   2544  C  CB    . PHE A  1 328 ? 102.311 123.436 80.529  1.00 29.68 ? 328 PHE A CB    1 
ATOM   2545  C  CG    . PHE A  1 328 ? 103.498 124.334 80.372  1.00 29.68 ? 328 PHE A CG    1 
ATOM   2546  C  CD1   . PHE A  1 328 ? 103.479 125.369 79.453  1.00 29.68 ? 328 PHE A CD1   1 
ATOM   2547  C  CD2   . PHE A  1 328 ? 104.634 124.145 81.141  1.00 29.68 ? 328 PHE A CD2   1 
ATOM   2548  C  CE1   . PHE A  1 328 ? 104.572 126.203 79.302  1.00 29.68 ? 328 PHE A CE1   1 
ATOM   2549  C  CE2   . PHE A  1 328 ? 105.732 124.975 80.997  1.00 29.68 ? 328 PHE A CE2   1 
ATOM   2550  C  CZ    . PHE A  1 328 ? 105.701 126.004 80.076  1.00 29.68 ? 328 PHE A CZ    1 
ATOM   2551  N  N     . SER A  1 329 ? 103.200 120.411 79.757  1.00 27.23 ? 329 SER A N     1 
ATOM   2552  C  CA    . SER A  1 329 ? 104.231 119.405 79.519  1.00 27.23 ? 329 SER A CA    1 
ATOM   2553  C  C     . SER A  1 329 ? 104.176 118.883 78.089  1.00 27.23 ? 329 SER A C     1 
ATOM   2554  O  O     . SER A  1 329 ? 105.221 118.683 77.454  1.00 27.23 ? 329 SER A O     1 
ATOM   2555  C  CB    . SER A  1 329 ? 104.079 118.257 80.512  1.00 27.23 ? 329 SER A CB    1 
ATOM   2556  O  OG    . SER A  1 329 ? 105.039 117.250 80.265  1.00 27.23 ? 329 SER A OG    1 
ATOM   2557  N  N     . LEU A  1 330 ? 102.965 118.689 77.553  1.00 28.71 ? 330 LEU A N     1 
ATOM   2558  C  CA    . LEU A  1 330 ? 102.838 118.304 76.148  1.00 28.71 ? 330 LEU A CA    1 
ATOM   2559  C  C     . LEU A  1 330 ? 103.301 119.414 75.207  1.00 28.71 ? 330 LEU A C     1 
ATOM   2560  O  O     . LEU A  1 330 ? 103.869 119.129 74.144  1.00 28.71 ? 330 LEU A O     1 
ATOM   2561  C  CB    . LEU A  1 330 ? 101.395 117.916 75.832  1.00 28.71 ? 330 LEU A CB    1 
ATOM   2562  C  CG    . LEU A  1 330 ? 100.813 116.691 76.537  1.00 28.71 ? 330 LEU A CG    1 
ATOM   2563  C  CD1   . LEU A  1 330 ? 99.546  116.237 75.836  1.00 28.71 ? 330 LEU A CD1   1 
ATOM   2564  C  CD2   . LEU A  1 330 ? 101.821 115.557 76.611  1.00 28.71 ? 330 LEU A CD2   1 
ATOM   2565  N  N     . TYR A  1 331 ? 103.096 120.677 75.588  1.00 29.52 ? 331 TYR A N     1 
ATOM   2566  C  CA    . TYR A  1 331 ? 103.545 121.786 74.750  1.00 29.52 ? 331 TYR A CA    1 
ATOM   2567  C  C     . TYR A  1 331 ? 105.068 121.896 74.729  1.00 29.52 ? 331 TYR A C     1 
ATOM   2568  O  O     . TYR A  1 331 ? 105.663 122.155 73.674  1.00 29.52 ? 331 TYR A O     1 
ATOM   2569  C  CB    . TYR A  1 331 ? 102.910 123.087 75.235  1.00 29.52 ? 331 TYR A CB    1 
ATOM   2570  C  CG    . TYR A  1 331 ? 103.288 124.293 74.417  1.00 29.52 ? 331 TYR A CG    1 
ATOM   2571  C  CD1   . TYR A  1 331 ? 102.896 124.403 73.090  1.00 29.52 ? 331 TYR A CD1   1 
ATOM   2572  C  CD2   . TYR A  1 331 ? 104.019 125.331 74.976  1.00 29.52 ? 331 TYR A CD2   1 
ATOM   2573  C  CE1   . TYR A  1 331 ? 103.238 125.508 72.336  1.00 29.52 ? 331 TYR A CE1   1 
ATOM   2574  C  CE2   . TYR A  1 331 ? 104.363 126.440 74.232  1.00 29.52 ? 331 TYR A CE2   1 
ATOM   2575  C  CZ    . TYR A  1 331 ? 103.970 126.523 72.913  1.00 29.52 ? 331 TYR A CZ    1 
ATOM   2576  O  OH    . TYR A  1 331 ? 104.311 127.627 72.167  1.00 29.52 ? 331 TYR A OH    1 
ATOM   2577  N  N     . VAL A  1 332 ? 105.716 121.681 75.878  1.00 28.15 ? 332 VAL A N     1 
ATOM   2578  C  CA    . VAL A  1 332 ? 107.176 121.618 75.910  1.00 28.15 ? 332 VAL A CA    1 
ATOM   2579  C  C     . VAL A  1 332 ? 107.701 120.407 75.136  1.00 28.15 ? 332 VAL A C     1 
ATOM   2580  O  O     . VAL A  1 332 ? 108.750 120.500 74.481  1.00 28.15 ? 332 VAL A O     1 
ATOM   2581  C  CB    . VAL A  1 332 ? 107.660 121.641 77.374  1.00 28.15 ? 332 VAL A CB    1 
ATOM   2582  C  CG1   . VAL A  1 332 ? 109.165 121.521 77.473  1.00 28.15 ? 332 VAL A CG1   1 
ATOM   2583  C  CG2   . VAL A  1 332 ? 107.243 122.939 78.031  1.00 28.15 ? 332 VAL A CG2   1 
ATOM   2584  N  N     . MET A  1 333 ? 106.962 119.291 75.143  1.00 30.48 ? 333 MET A N     1 
ATOM   2585  C  CA    . MET A  1 333 ? 107.328 118.140 74.316  1.00 30.48 ? 333 MET A CA    1 
ATOM   2586  C  C     . MET A  1 333 ? 107.281 118.480 72.828  1.00 30.48 ? 333 MET A C     1 
ATOM   2587  O  O     . MET A  1 333 ? 108.181 118.103 72.065  1.00 30.48 ? 333 MET A O     1 
ATOM   2588  C  CB    . MET A  1 333 ? 106.404 116.964 74.621  1.00 30.48 ? 333 MET A CB    1 
ATOM   2589  C  CG    . MET A  1 333 ? 106.694 115.727 73.801  1.00 30.48 ? 333 MET A CG    1 
ATOM   2590  S  SD    . MET A  1 333 ? 105.398 114.487 73.916  1.00 30.48 ? 333 MET A SD    1 
ATOM   2591  C  CE    . MET A  1 333 ? 104.154 115.195 72.847  1.00 30.48 ? 333 MET A CE    1 
ATOM   2592  N  N     . MET A  1 334 ? 106.250 119.215 72.402  1.00 32.19 ? 334 MET A N     1 
ATOM   2593  C  CA    . MET A  1 334 ? 106.164 119.612 70.998  1.00 32.19 ? 334 MET A CA    1 
ATOM   2594  C  C     . MET A  1 334 ? 107.250 120.616 70.619  1.00 32.19 ? 334 MET A C     1 
ATOM   2595  O  O     . MET A  1 334 ? 107.752 120.580 69.486  1.00 32.19 ? 334 MET A O     1 
ATOM   2596  C  CB    . MET A  1 334 ? 104.782 120.182 70.690  1.00 32.19 ? 334 MET A CB    1 
ATOM   2597  C  CG    . MET A  1 334 ? 103.652 119.176 70.821  1.00 32.19 ? 334 MET A CG    1 
ATOM   2598  S  SD    . MET A  1 334 ? 103.989 117.611 69.994  1.00 32.19 ? 334 MET A SD    1 
ATOM   2599  C  CE    . MET A  1 334 ? 103.962 118.110 68.276  1.00 32.19 ? 334 MET A CE    1 
ATOM   2600  N  N     . ILE A  1 335 ? 107.634 121.498 71.550  1.00 33.10 ? 335 ILE A N     1 
ATOM   2601  C  CA    . ILE A  1 335 ? 108.775 122.388 71.320  1.00 33.10 ? 335 ILE A CA    1 
ATOM   2602  C  C     . ILE A  1 335 ? 110.060 121.583 71.142  1.00 33.10 ? 335 ILE A C     1 
ATOM   2603  O  O     . ILE A  1 335 ? 110.875 121.875 70.254  1.00 33.10 ? 335 ILE A O     1 
ATOM   2604  C  CB    . ILE A  1 335 ? 108.896 123.415 72.464  1.00 33.10 ? 335 ILE A CB    1 
ATOM   2605  C  CG1   . ILE A  1 335 ? 107.749 124.418 72.406  1.00 33.10 ? 335 ILE A CG1   1 
ATOM   2606  C  CG2   . ILE A  1 335 ? 110.223 124.156 72.433  1.00 33.10 ? 335 ILE A CG2   1 
ATOM   2607  C  CD1   . ILE A  1 335 ? 107.725 125.355 73.586  1.00 33.10 ? 335 ILE A CD1   1 
ATOM   2608  N  N     . TYR A  1 336 ? 110.238 120.534 71.955  1.00 34.54 ? 336 TYR A N     1 
ATOM   2609  C  CA    . TYR A  1 336 ? 111.417 119.678 71.824  1.00 34.54 ? 336 TYR A CA    1 
ATOM   2610  C  C     . TYR A  1 336 ? 111.425 118.935 70.494  1.00 34.54 ? 336 TYR A C     1 
ATOM   2611  O  O     . TYR A  1 336 ? 112.485 118.759 69.887  1.00 34.54 ? 336 TYR A O     1 
ATOM   2612  C  CB    . TYR A  1 336 ? 111.490 118.686 72.986  1.00 34.54 ? 336 TYR A CB    1 
ATOM   2613  C  CG    . TYR A  1 336 ? 112.289 117.431 72.688  1.00 34.54 ? 336 TYR A CG    1 
ATOM   2614  C  CD1   . TYR A  1 336 ? 113.672 117.477 72.539  1.00 34.54 ? 336 TYR A CD1   1 
ATOM   2615  C  CD2   . TYR A  1 336 ? 111.659 116.201 72.562  1.00 34.54 ? 336 TYR A CD2   1 
ATOM   2616  C  CE1   . TYR A  1 336 ? 114.398 116.335 72.266  1.00 34.54 ? 336 TYR A CE1   1 
ATOM   2617  C  CE2   . TYR A  1 336 ? 112.379 115.055 72.292  1.00 34.54 ? 336 TYR A CE2   1 
ATOM   2618  C  CZ    . TYR A  1 336 ? 113.745 115.129 72.146  1.00 34.54 ? 336 TYR A CZ    1 
ATOM   2619  O  OH    . TYR A  1 336 ? 114.462 113.988 71.877  1.00 34.54 ? 336 TYR A OH    1 
ATOM   2620  N  N     . PHE A  1 337 ? 110.259 118.513 70.011  1.00 35.57 ? 337 PHE A N     1 
ATOM   2621  C  CA    . PHE A  1 337 ? 110.243 117.808 68.732  1.00 35.57 ? 337 PHE A CA    1 
ATOM   2622  C  C     . PHE A  1 337 ? 110.479 118.744 67.552  1.00 35.57 ? 337 PHE A C     1 
ATOM   2623  O  O     . PHE A  1 337 ? 111.117 118.341 66.568  1.00 35.57 ? 337 PHE A O     1 
ATOM   2624  C  CB    . PHE A  1 337 ? 108.937 117.042 68.567  1.00 35.57 ? 337 PHE A CB    1 
ATOM   2625  C  CG    . PHE A  1 337 ? 108.970 115.694 69.204  1.00 35.57 ? 337 PHE A CG    1 
ATOM   2626  C  CD1   . PHE A  1 337 ? 109.755 114.689 68.670  1.00 35.57 ? 337 PHE A CD1   1 
ATOM   2627  C  CD2   . PHE A  1 337 ? 108.250 115.439 70.353  1.00 35.57 ? 337 PHE A CD2   1 
ATOM   2628  C  CE1   . PHE A  1 337 ? 109.803 113.452 69.262  1.00 35.57 ? 337 PHE A CE1   1 
ATOM   2629  C  CE2   . PHE A  1 337 ? 108.298 114.206 70.950  1.00 35.57 ? 337 PHE A CE2   1 
ATOM   2630  C  CZ    . PHE A  1 337 ? 109.072 113.213 70.404  1.00 35.57 ? 337 PHE A CZ    1 
ATOM   2631  N  N     . ASP A  1 338 ? 110.010 119.993 67.643  1.00 42.19 ? 338 ASP A N     1 
ATOM   2632  C  CA    . ASP A  1 338 ? 110.365 120.984 66.629  1.00 42.19 ? 338 ASP A CA    1 
ATOM   2633  C  C     . ASP A  1 338 ? 111.860 121.285 66.651  1.00 42.19 ? 338 ASP A C     1 
ATOM   2634  O  O     . ASP A  1 338 ? 112.483 121.454 65.595  1.00 42.19 ? 338 ASP A O     1 
ATOM   2635  C  CB    . ASP A  1 338 ? 109.554 122.261 66.835  1.00 42.19 ? 338 ASP A CB    1 
ATOM   2636  C  CG    . ASP A  1 338 ? 108.082 122.067 66.539  1.00 42.19 ? 338 ASP A CG    1 
ATOM   2637  O  OD1   . ASP A  1 338 ? 107.726 121.023 65.954  1.00 42.19 ? 338 ASP A OD1   1 
ATOM   2638  O  OD2   . ASP A  1 338 ? 107.281 122.958 66.891  1.00 42.19 ? 338 ASP A OD2   1 
ATOM   2639  N  N     . MET A  1 339 ? 112.458 121.319 67.847  1.00 49.87 ? 339 MET A N     1 
ATOM   2640  C  CA    . MET A  1 339 ? 113.904 121.488 67.961  1.00 49.87 ? 339 MET A CA    1 
ATOM   2641  C  C     . MET A  1 339 ? 114.660 120.287 67.400  1.00 49.87 ? 339 MET A C     1 
ATOM   2642  O  O     . MET A  1 339 ? 115.727 120.453 66.802  1.00 49.87 ? 339 MET A O     1 
ATOM   2643  C  CB    . MET A  1 339 ? 114.278 121.726 69.426  1.00 49.87 ? 339 MET A CB    1 
ATOM   2644  C  CG    . MET A  1 339 ? 115.760 121.934 69.692  1.00 49.87 ? 339 MET A CG    1 
ATOM   2645  S  SD    . MET A  1 339 ? 116.066 122.983 71.123  1.00 49.87 ? 339 MET A SD    1 
ATOM   2646  C  CE    . MET A  1 339 ? 115.190 124.467 70.639  1.00 49.87 ? 339 MET A CE    1 
ATOM   2647  N  N     . GLU A  1 340 ? 114.109 119.083 67.559  1.00 49.66 ? 340 GLU A N     1 
ATOM   2648  C  CA    . GLU A  1 340 ? 114.733 117.883 67.008  1.00 49.66 ? 340 GLU A CA    1 
ATOM   2649  C  C     . GLU A  1 340 ? 114.704 117.890 65.484  1.00 49.66 ? 340 GLU A C     1 
ATOM   2650  O  O     . GLU A  1 340 ? 115.696 117.531 64.837  1.00 49.66 ? 340 GLU A O     1 
ATOM   2651  C  CB    . GLU A  1 340 ? 114.031 116.639 67.552  1.00 49.66 ? 340 GLU A CB    1 
ATOM   2652  C  CG    . GLU A  1 340 ? 114.597 115.325 67.052  1.00 49.66 ? 340 GLU A CG    1 
ATOM   2653  C  CD    . GLU A  1 340 ? 115.732 114.820 67.913  1.00 49.66 ? 340 GLU A CD    1 
ATOM   2654  O  OE1   . GLU A  1 340 ? 115.767 115.170 69.110  1.00 49.66 ? 340 GLU A OE1   1 
ATOM   2655  O  OE2   . GLU A  1 340 ? 116.589 114.075 67.395  1.00 49.66 ? 340 GLU A OE2   1 
ATOM   2656  N  N     . VAL A  1 341 ? 113.577 118.307 64.897  1.00 54.79 ? 341 VAL A N     1 
ATOM   2657  C  CA    . VAL A  1 341 ? 113.483 118.420 63.442  1.00 54.79 ? 341 VAL A CA    1 
ATOM   2658  C  C     . VAL A  1 341 ? 114.414 119.515 62.919  1.00 54.79 ? 341 VAL A C     1 
ATOM   2659  O  O     . VAL A  1 341 ? 115.068 119.344 61.878  1.00 54.79 ? 341 VAL A O     1 
ATOM   2660  C  CB    . VAL A  1 341 ? 112.012 118.655 63.041  1.00 54.79 ? 341 VAL A CB    1 
ATOM   2661  C  CG1   . VAL A  1 341 ? 111.876 119.021 61.569  1.00 54.79 ? 341 VAL A CG1   1 
ATOM   2662  C  CG2   . VAL A  1 341 ? 111.188 117.417 63.349  1.00 54.79 ? 341 VAL A CG2   1 
ATOM   2663  N  N     . TRP A  1 342 ? 114.534 120.626 63.656  1.00 61.06 ? 342 TRP A N     1 
ATOM   2664  C  CA    . TRP A  1 342 ? 115.467 121.688 63.285  1.00 61.06 ? 342 TRP A CA    1 
ATOM   2665  C  C     . TRP A  1 342 ? 116.920 121.228 63.360  1.00 61.06 ? 342 TRP A C     1 
ATOM   2666  O  O     . TRP A  1 342 ? 117.722 121.569 62.482  1.00 61.06 ? 342 TRP A O     1 
ATOM   2667  C  CB    . TRP A  1 342 ? 115.232 122.902 64.186  1.00 61.06 ? 342 TRP A CB    1 
ATOM   2668  C  CG    . TRP A  1 342 ? 116.278 123.970 64.110  1.00 61.06 ? 342 TRP A CG    1 
ATOM   2669  C  CD1   . TRP A  1 342 ? 116.301 125.032 63.257  1.00 61.06 ? 342 TRP A CD1   1 
ATOM   2670  C  CD2   . TRP A  1 342 ? 117.433 124.101 64.947  1.00 61.06 ? 342 TRP A CD2   1 
ATOM   2671  N  NE1   . TRP A  1 342 ? 117.409 125.808 63.496  1.00 61.06 ? 342 TRP A NE1   1 
ATOM   2672  C  CE2   . TRP A  1 342 ? 118.121 125.257 64.529  1.00 61.06 ? 342 TRP A CE2   1 
ATOM   2673  C  CE3   . TRP A  1 342 ? 117.960 123.345 65.998  1.00 61.06 ? 342 TRP A CE3   1 
ATOM   2674  C  CZ2   . TRP A  1 342 ? 119.305 125.678 65.129  1.00 61.06 ? 342 TRP A CZ2   1 
ATOM   2675  C  CZ3   . TRP A  1 342 ? 119.134 123.764 66.593  1.00 61.06 ? 342 TRP A CZ3   1 
ATOM   2676  C  CH2   . TRP A  1 342 ? 119.795 124.919 66.156  1.00 61.06 ? 342 TRP A CH2   1 
ATOM   2677  N  N     . ALA A  1 343 ? 117.271 120.434 64.373  1.00 62.30 ? 343 ALA A N     1 
ATOM   2678  C  CA    . ALA A  1 343 ? 118.628 119.910 64.476  1.00 62.30 ? 343 ALA A CA    1 
ATOM   2679  C  C     . ALA A  1 343 ? 118.919 118.855 63.418  1.00 62.30 ? 343 ALA A C     1 
ATOM   2680  O  O     . ALA A  1 343 ? 120.055 118.762 62.942  1.00 62.30 ? 343 ALA A O     1 
ATOM   2681  C  CB    . ALA A  1 343 ? 118.868 119.330 65.869  1.00 62.30 ? 343 ALA A CB    1 
ATOM   2682  N  N     . LEU A  1 344 ? 117.914 118.071 63.021  1.00 66.51 ? 344 LEU A N     1 
ATOM   2683  C  CA    . LEU A  1 344 ? 118.099 117.135 61.917  1.00 66.51 ? 344 LEU A CA    1 
ATOM   2684  C  C     . LEU A  1 344 ? 118.294 117.857 60.589  1.00 66.51 ? 344 LEU A C     1 
ATOM   2685  O  O     . LEU A  1 344 ? 119.119 117.433 59.771  1.00 66.51 ? 344 LEU A O     1 
ATOM   2686  C  CB    . LEU A  1 344 ? 116.909 116.180 61.827  1.00 66.51 ? 344 LEU A CB    1 
ATOM   2687  C  CG    . LEU A  1 344 ? 117.110 114.949 60.945  1.00 66.51 ? 344 LEU A CG    1 
ATOM   2688  C  CD1   . LEU A  1 344 ? 118.210 114.067 61.511  1.00 66.51 ? 344 LEU A CD1   1 
ATOM   2689  C  CD2   . LEU A  1 344 ? 115.812 114.172 60.806  1.00 66.51 ? 344 LEU A CD2   1 
ATOM   2690  N  N     . GLY A  1 345 ? 117.567 118.956 60.369  1.00 71.15 ? 345 GLY A N     1 
ATOM   2691  C  CA    . GLY A  1 345 ? 117.811 119.772 59.190  1.00 71.15 ? 345 GLY A CA    1 
ATOM   2692  C  C     . GLY A  1 345 ? 119.166 120.452 59.204  1.00 71.15 ? 345 GLY A C     1 
ATOM   2693  O  O     . GLY A  1 345 ? 119.809 120.586 58.157  1.00 71.15 ? 345 GLY A O     1 
ATOM   2694  N  N     . LEU A  1 346 ? 119.626 120.877 60.386  1.00 72.14 ? 346 LEU A N     1 
ATOM   2695  C  CA    . LEU A  1 346 ? 120.967 121.442 60.509  1.00 72.14 ? 346 LEU A CA    1 
ATOM   2696  C  C     . LEU A  1 346 ? 122.046 120.394 60.269  1.00 72.14 ? 346 LEU A C     1 
ATOM   2697  O  O     . LEU A  1 346 ? 123.115 120.717 59.739  1.00 72.14 ? 346 LEU A O     1 
ATOM   2698  C  CB    . LEU A  1 346 ? 121.143 122.073 61.889  1.00 72.14 ? 346 LEU A CB    1 
ATOM   2699  C  CG    . LEU A  1 346 ? 122.029 123.314 61.967  1.00 72.14 ? 346 LEU A CG    1 
ATOM   2700  C  CD1   . LEU A  1 346 ? 121.549 124.372 60.988  1.00 72.14 ? 346 LEU A CD1   1 
ATOM   2701  C  CD2   . LEU A  1 346 ? 122.058 123.861 63.385  1.00 72.14 ? 346 LEU A CD2   1 
ATOM   2702  N  N     . HIS A  1 347 ? 121.789 119.142 60.656  1.00 77.99 ? 347 HIS A N     1 
ATOM   2703  C  CA    . HIS A  1 347 ? 122.712 118.058 60.337  1.00 77.99 ? 347 HIS A CA    1 
ATOM   2704  C  C     . HIS A  1 347 ? 122.710 117.749 58.846  1.00 77.99 ? 347 HIS A C     1 
ATOM   2705  O  O     . HIS A  1 347 ? 123.759 117.426 58.278  1.00 77.99 ? 347 HIS A O     1 
ATOM   2706  C  CB    . HIS A  1 347 ? 122.351 116.815 61.153  1.00 77.99 ? 347 HIS A CB    1 
ATOM   2707  C  CG    . HIS A  1 347 ? 122.787 115.524 60.531  1.00 77.99 ? 347 HIS A CG    1 
ATOM   2708  N  ND1   . HIS A  1 347 ? 124.066 115.028 60.664  1.00 77.99 ? 347 HIS A ND1   1 
ATOM   2709  C  CD2   . HIS A  1 347 ? 122.107 114.616 59.790  1.00 77.99 ? 347 HIS A CD2   1 
ATOM   2710  C  CE1   . HIS A  1 347 ? 124.159 113.877 60.022  1.00 77.99 ? 347 HIS A CE1   1 
ATOM   2711  N  NE2   . HIS A  1 347 ? 122.984 113.605 59.482  1.00 77.99 ? 347 HIS A NE2   1 
ATOM   2712  N  N     . GLU A  1 348 ? 121.546 117.850 58.201  1.00 80.18 ? 348 GLU A N     1 
ATOM   2713  C  CA    . GLU A  1 348 ? 121.469 117.700 56.752  1.00 80.18 ? 348 GLU A CA    1 
ATOM   2714  C  C     . GLU A  1 348 ? 122.161 118.842 56.016  1.00 80.18 ? 348 GLU A C     1 
ATOM   2715  O  O     . GLU A  1 348 ? 122.610 118.659 54.880  1.00 80.18 ? 348 GLU A O     1 
ATOM   2716  C  CB    . GLU A  1 348 ? 120.007 117.611 56.312  1.00 80.18 ? 348 GLU A CB    1 
ATOM   2717  C  CG    . GLU A  1 348 ? 119.783 116.833 55.029  1.00 80.18 ? 348 GLU A CG    1 
ATOM   2718  C  CD    . GLU A  1 348 ? 118.332 116.444 54.832  1.00 80.18 ? 348 GLU A CD    1 
ATOM   2719  O  OE1   . GLU A  1 348 ? 117.738 115.866 55.765  1.00 80.18 ? 348 GLU A OE1   1 
ATOM   2720  O  OE2   . GLU A  1 348 ? 117.783 116.719 53.744  1.00 80.18 ? 348 GLU A OE2   1 
ATOM   2721  N  N     . ASN A  1 349 ? 122.255 120.016 56.641  1.00 83.70 ? 349 ASN A N     1 
ATOM   2722  C  CA    . ASN A  1 349 ? 122.821 121.191 55.989  1.00 83.70 ? 349 ASN A CA    1 
ATOM   2723  C  C     . ASN A  1 349 ? 124.347 121.217 56.048  1.00 83.70 ? 349 ASN A C     1 
ATOM   2724  O  O     . ASN A  1 349 ? 125.009 121.254 55.005  1.00 83.70 ? 349 ASN A O     1 
ATOM   2725  C  CB    . ASN A  1 349 ? 122.253 122.462 56.630  1.00 83.70 ? 349 ASN A CB    1 
ATOM   2726  C  CG    . ASN A  1 349 ? 122.611 123.729 55.863  1.00 83.70 ? 349 ASN A CG    1 
ATOM   2727  O  OD1   . ASN A  1 349 ? 123.102 123.681 54.734  1.00 83.70 ? 349 ASN A OD1   1 
ATOM   2728  N  ND2   . ASN A  1 349 ? 122.366 124.877 56.485  1.00 83.70 ? 349 ASN A ND2   1 
ATOM   2729  N  N     . SER A  1 350 ? 124.916 121.199 57.255  1.00 85.46 ? 350 SER A N     1 
ATOM   2730  C  CA    . SER A  1 350 ? 126.282 121.675 57.452  1.00 85.46 ? 350 SER A CA    1 
ATOM   2731  C  C     . SER A  1 350 ? 127.369 120.692 57.027  1.00 85.46 ? 350 SER A C     1 
ATOM   2732  O  O     . SER A  1 350 ? 128.133 120.977 56.100  1.00 85.46 ? 350 SER A O     1 
ATOM   2733  C  CB    . SER A  1 350 ? 126.489 122.051 58.921  1.00 85.46 ? 350 SER A CB    1 
ATOM   2734  N  N     . GLY A  1 351 ? 127.457 119.543 57.686  1.00 86.83 ? 351 GLY A N     1 
ATOM   2735  C  CA    . GLY A  1 351 ? 128.586 118.670 57.461  1.00 86.83 ? 351 GLY A CA    1 
ATOM   2736  C  C     . GLY A  1 351 ? 128.386 117.299 58.067  1.00 86.83 ? 351 GLY A C     1 
ATOM   2737  O  O     . GLY A  1 351 ? 127.259 116.827 58.232  1.00 86.83 ? 351 GLY A O     1 
ATOM   2738  N  N     . SER A  1 352 ? 129.509 116.659 58.397  1.00 84.95 ? 352 SER A N     1 
ATOM   2739  C  CA    . SER A  1 352 ? 129.495 115.283 58.878  1.00 84.95 ? 352 SER A CA    1 
ATOM   2740  C  C     . SER A  1 352 ? 130.155 115.137 60.244  1.00 84.95 ? 352 SER A C     1 
ATOM   2741  O  O     . SER A  1 352 ? 129.698 114.344 61.074  1.00 84.95 ? 352 SER A O     1 
ATOM   2742  C  CB    . SER A  1 352 ? 130.187 114.366 57.867  1.00 84.95 ? 352 SER A CB    1 
ATOM   2743  N  N     . GLU A  1 353 ? 131.232 115.884 60.486  1.00 83.38 ? 353 GLU A N     1 
ATOM   2744  C  CA    . GLU A  1 353 ? 132.020 115.713 61.702  1.00 83.38 ? 353 GLU A CA    1 
ATOM   2745  C  C     . GLU A  1 353 ? 131.345 116.281 62.944  1.00 83.38 ? 353 GLU A C     1 
ATOM   2746  O  O     . GLU A  1 353 ? 131.261 115.586 63.963  1.00 83.38 ? 353 GLU A O     1 
ATOM   2747  C  CB    . GLU A  1 353 ? 133.395 116.365 61.531  1.00 83.38 ? 353 GLU A CB    1 
ATOM   2748  N  N     . TRP A  1 354 ? 130.863 117.521 62.887  1.00 85.27 ? 354 TRP A N     1 
ATOM   2749  C  CA    . TRP A  1 354 ? 130.211 118.157 64.023  1.00 85.27 ? 354 TRP A CA    1 
ATOM   2750  C  C     . TRP A  1 354 ? 128.699 118.011 63.997  1.00 85.27 ? 354 TRP A C     1 
ATOM   2751  O  O     . TRP A  1 354 ? 128.028 118.494 64.913  1.00 85.27 ? 354 TRP A O     1 
ATOM   2752  C  CB    . TRP A  1 354 ? 130.574 119.644 64.076  1.00 85.27 ? 354 TRP A CB    1 
ATOM   2753  C  CG    . TRP A  1 354 ? 131.983 119.906 64.492  1.00 85.27 ? 354 TRP A CG    1 
ATOM   2754  C  CD1   . TRP A  1 354 ? 132.814 119.055 65.157  1.00 85.27 ? 354 TRP A CD1   1 
ATOM   2755  C  CD2   . TRP A  1 354 ? 132.735 121.102 64.258  1.00 85.27 ? 354 TRP A CD2   1 
ATOM   2756  N  NE1   . TRP A  1 354 ? 134.037 119.649 65.358  1.00 85.27 ? 354 TRP A NE1   1 
ATOM   2757  C  CE2   . TRP A  1 354 ? 134.014 120.907 64.815  1.00 85.27 ? 354 TRP A CE2   1 
ATOM   2758  C  CE3   . TRP A  1 354 ? 132.449 122.321 63.634  1.00 85.27 ? 354 TRP A CE3   1 
ATOM   2759  C  CZ2   . TRP A  1 354 ? 135.006 121.884 64.766  1.00 85.27 ? 354 TRP A CZ2   1 
ATOM   2760  C  CZ3   . TRP A  1 354 ? 133.435 123.290 63.587  1.00 85.27 ? 354 TRP A CZ3   1 
ATOM   2761  C  CH2   . TRP A  1 354 ? 134.698 123.066 64.149  1.00 85.27 ? 354 TRP A CH2   1 
ATOM   2762  N  N     . THR A  1 355 ? 128.145 117.365 62.976  1.00 80.28 ? 355 THR A N     1 
ATOM   2763  C  CA    . THR A  1 355 ? 126.703 117.228 62.849  1.00 80.28 ? 355 THR A CA    1 
ATOM   2764  C  C     . THR A  1 355 ? 126.210 115.839 63.219  1.00 80.28 ? 355 THR A C     1 
ATOM   2765  O  O     . THR A  1 355 ? 125.078 115.485 62.875  1.00 80.28 ? 355 THR A O     1 
ATOM   2766  C  CB    . THR A  1 355 ? 126.260 117.584 61.431  1.00 80.28 ? 355 THR A CB    1 
ATOM   2767  O  OG1   . THR A  1 355 ? 126.572 116.504 60.543  1.00 80.28 ? 355 THR A OG1   1 
ATOM   2768  C  CG2   . THR A  1 355 ? 126.962 118.843 60.968  1.00 80.28 ? 355 THR A CG2   1 
ATOM   2769  N  N     . SER A  1 356 ? 127.037 115.036 63.886  1.00 75.39 ? 356 SER A N     1 
ATOM   2770  C  CA    . SER A  1 356 ? 126.574 113.819 64.538  1.00 75.39 ? 356 SER A CA    1 
ATOM   2771  C  C     . SER A  1 356 ? 126.476 114.004 66.046  1.00 75.39 ? 356 SER A C     1 
ATOM   2772  O  O     . SER A  1 356 ? 125.688 113.320 66.708  1.00 75.39 ? 356 SER A O     1 
ATOM   2773  C  CB    . SER A  1 356 ? 127.509 112.652 64.210  1.00 75.39 ? 356 SER A CB    1 
ATOM   2774  O  OG    . SER A  1 356 ? 127.113 111.476 64.895  1.00 75.39 ? 356 SER A OG    1 
ATOM   2775  N  N     . VAL A  1 357 ? 127.258 114.933 66.592  1.00 68.42 ? 357 VAL A N     1 
ATOM   2776  C  CA    . VAL A  1 357 ? 127.271 115.233 68.018  1.00 68.42 ? 357 VAL A CA    1 
ATOM   2777  C  C     . VAL A  1 357 ? 126.097 116.168 68.289  1.00 68.42 ? 357 VAL A C     1 
ATOM   2778  O  O     . VAL A  1 357 ? 125.524 116.181 69.385  1.00 68.42 ? 357 VAL A O     1 
ATOM   2779  C  CB    . VAL A  1 357 ? 128.632 115.844 68.415  1.00 68.42 ? 357 VAL A CB    1 
ATOM   2780  C  CG1   . VAL A  1 357 ? 128.678 116.299 69.872  1.00 68.42 ? 357 VAL A CG1   1 
ATOM   2781  C  CG2   . VAL A  1 357 ? 129.751 114.856 68.124  1.00 68.42 ? 357 VAL A CG2   1 
ATOM   2782  N  N     . LEU A  1 358 ? 125.678 116.896 67.254  1.00 65.48 ? 358 LEU A N     1 
ATOM   2783  C  CA    . LEU A  1 358 ? 124.581 117.849 67.342  1.00 65.48 ? 358 LEU A CA    1 
ATOM   2784  C  C     . LEU A  1 358 ? 123.222 117.184 67.541  1.00 65.48 ? 358 LEU A C     1 
ATOM   2785  O  O     . LEU A  1 358 ? 122.292 117.843 68.018  1.00 65.48 ? 358 LEU A O     1 
ATOM   2786  C  CB    . LEU A  1 358 ? 124.555 118.718 66.076  1.00 65.48 ? 358 LEU A CB    1 
ATOM   2787  C  CG    . LEU A  1 358 ? 123.751 120.019 66.061  1.00 65.48 ? 358 LEU A CG    1 
ATOM   2788  C  CD1   . LEU A  1 358 ? 124.152 120.901 67.228  1.00 65.48 ? 358 LEU A CD1   1 
ATOM   2789  C  CD2   . LEU A  1 358 ? 123.936 120.747 64.742  1.00 65.48 ? 358 LEU A CD2   1 
ATOM   2790  N  N     . LEU A  1 359 ? 123.088 115.898 67.221  1.00 63.98 ? 359 LEU A N     1 
ATOM   2791  C  CA    . LEU A  1 359 ? 121.837 115.186 67.447  1.00 63.98 ? 359 LEU A CA    1 
ATOM   2792  C  C     . LEU A  1 359 ? 121.603 114.822 68.906  1.00 63.98 ? 359 LEU A C     1 
ATOM   2793  O  O     . LEU A  1 359 ? 120.465 114.512 69.274  1.00 63.98 ? 359 LEU A O     1 
ATOM   2794  C  CB    . LEU A  1 359 ? 121.781 113.905 66.605  1.00 63.98 ? 359 LEU A CB    1 
ATOM   2795  C  CG    . LEU A  1 359 ? 121.237 113.957 65.174  1.00 63.98 ? 359 LEU A CG    1 
ATOM   2796  C  CD1   . LEU A  1 359 ? 122.168 114.686 64.221  1.00 63.98 ? 359 LEU A CD1   1 
ATOM   2797  C  CD2   . LEU A  1 359 ? 120.961 112.545 64.680  1.00 63.98 ? 359 LEU A CD2   1 
ATOM   2798  N  N     . TYR A  1 360 ? 122.640 114.846 69.741  1.00 54.56 ? 360 TYR A N     1 
ATOM   2799  C  CA    . TYR A  1 360 ? 122.490 114.504 71.149  1.00 54.56 ? 360 TYR A CA    1 
ATOM   2800  C  C     . TYR A  1 360 ? 122.242 115.718 72.032  1.00 54.56 ? 360 TYR A C     1 
ATOM   2801  O  O     . TYR A  1 360 ? 121.902 115.550 73.205  1.00 54.56 ? 360 TYR A O     1 
ATOM   2802  C  CB    . TYR A  1 360 ? 123.730 113.761 71.653  1.00 54.56 ? 360 TYR A CB    1 
ATOM   2803  C  CG    . TYR A  1 360 ? 124.041 112.486 70.902  1.00 54.56 ? 360 TYR A CG    1 
ATOM   2804  C  CD1   . TYR A  1 360 ? 123.023 111.665 70.433  1.00 54.56 ? 360 TYR A CD1   1 
ATOM   2805  C  CD2   . TYR A  1 360 ? 125.354 112.103 70.668  1.00 54.56 ? 360 TYR A CD2   1 
ATOM   2806  C  CE1   . TYR A  1 360 ? 123.306 110.500 69.746  1.00 54.56 ? 360 TYR A CE1   1 
ATOM   2807  C  CE2   . TYR A  1 360 ? 125.647 110.940 69.983  1.00 54.56 ? 360 TYR A CE2   1 
ATOM   2808  C  CZ    . TYR A  1 360 ? 124.619 110.144 69.525  1.00 54.56 ? 360 TYR A CZ    1 
ATOM   2809  O  OH    . TYR A  1 360 ? 124.908 108.985 68.843  1.00 54.56 ? 360 TYR A OH    1 
ATOM   2810  N  N     . VAL A  1 361 ? 122.403 116.923 71.500  1.00 48.50 ? 361 VAL A N     1 
ATOM   2811  C  CA    . VAL A  1 361 ? 122.189 118.166 72.243  1.00 48.50 ? 361 VAL A CA    1 
ATOM   2812  C  C     . VAL A  1 361 ? 120.719 118.429 72.598  1.00 48.50 ? 361 VAL A C     1 
ATOM   2813  O  O     . VAL A  1 361 ? 120.458 118.723 73.779  1.00 48.50 ? 361 VAL A O     1 
ATOM   2814  C  CB    . VAL A  1 361 ? 122.821 119.351 71.488  1.00 48.50 ? 361 VAL A CB    1 
ATOM   2815  C  CG1   . VAL A  1 361 ? 122.435 120.682 72.110  1.00 48.50 ? 361 VAL A CG1   1 
ATOM   2816  C  CG2   . VAL A  1 361 ? 124.331 119.201 71.462  1.00 48.50 ? 361 VAL A CG2   1 
ATOM   2817  N  N     . PRO A  1 362 ? 119.722 118.350 71.684  1.00 45.04 ? 362 PRO A N     1 
ATOM   2818  C  CA    . PRO A  1 362 ? 118.356 118.711 72.112  1.00 45.04 ? 362 PRO A CA    1 
ATOM   2819  C  C     . PRO A  1 362 ? 117.726 117.734 73.092  1.00 45.04 ? 362 PRO A C     1 
ATOM   2820  O  O     . PRO A  1 362 ? 116.888 118.154 73.895  1.00 45.04 ? 362 PRO A O     1 
ATOM   2821  C  CB    . PRO A  1 362 ? 117.576 118.758 70.793  1.00 45.04 ? 362 PRO A CB    1 
ATOM   2822  C  CG    . PRO A  1 362 ? 118.266 117.805 69.946  1.00 45.04 ? 362 PRO A CG    1 
ATOM   2823  C  CD    . PRO A  1 362 ? 119.706 118.057 70.232  1.00 45.04 ? 362 PRO A CD    1 
ATOM   2824  N  N     . SER A  1 363 ? 118.134 116.464 73.094  1.00 38.47 ? 363 SER A N     1 
ATOM   2825  C  CA    . SER A  1 363 ? 117.637 115.552 74.118  1.00 38.47 ? 363 SER A CA    1 
ATOM   2826  C  C     . SER A  1 363 ? 118.236 115.865 75.485  1.00 38.47 ? 363 SER A C     1 
ATOM   2827  O  O     . SER A  1 363 ? 117.557 115.709 76.506  1.00 38.47 ? 363 SER A O     1 
ATOM   2828  C  CB    . SER A  1 363 ? 117.923 114.109 73.720  1.00 38.47 ? 363 SER A CB    1 
ATOM   2829  O  OG    . SER A  1 363 ? 117.523 113.866 72.384  1.00 38.47 ? 363 SER A OG    1 
ATOM   2830  N  N     . ILE A  1 364 ? 119.481 116.348 75.523  1.00 34.24 ? 364 ILE A N     1 
ATOM   2831  C  CA    . ILE A  1 364 ? 120.087 116.778 76.782  1.00 34.24 ? 364 ILE A CA    1 
ATOM   2832  C  C     . ILE A  1 364 ? 119.398 118.036 77.303  1.00 34.24 ? 364 ILE A C     1 
ATOM   2833  O  O     . ILE A  1 364 ? 119.106 118.153 78.506  1.00 34.24 ? 364 ILE A O     1 
ATOM   2834  C  CB    . ILE A  1 364 ? 121.601 116.981 76.583  1.00 34.24 ? 364 ILE A CB    1 
ATOM   2835  C  CG1   . ILE A  1 364 ? 122.304 115.630 76.491  1.00 34.24 ? 364 ILE A CG1   1 
ATOM   2836  C  CG2   . ILE A  1 364 ? 122.218 117.796 77.704  1.00 34.24 ? 364 ILE A CG2   1 
ATOM   2837  C  CD1   . ILE A  1 364 ? 123.738 115.725 76.043  1.00 34.24 ? 364 ILE A CD1   1 
ATOM   2838  N  N     . ILE A  1 365 ? 119.090 118.975 76.401  1.00 32.38 ? 365 ILE A N     1 
ATOM   2839  C  CA    . ILE A  1 365 ? 118.362 120.186 76.783  1.00 32.38 ? 365 ILE A CA    1 
ATOM   2840  C  C     . ILE A  1 365 ? 116.959 119.838 77.273  1.00 32.38 ? 365 ILE A C     1 
ATOM   2841  O  O     . ILE A  1 365 ? 116.473 120.402 78.262  1.00 32.38 ? 365 ILE A O     1 
ATOM   2842  C  CB    . ILE A  1 365 ? 118.332 121.177 75.603  1.00 32.38 ? 365 ILE A CB    1 
ATOM   2843  C  CG1   . ILE A  1 365 ? 119.751 121.606 75.238  1.00 32.38 ? 365 ILE A CG1   1 
ATOM   2844  C  CG2   . ILE A  1 365 ? 117.503 122.406 75.932  1.00 32.38 ? 365 ILE A CG2   1 
ATOM   2845  C  CD1   . ILE A  1 365 ? 119.818 122.581 74.083  1.00 32.38 ? 365 ILE A CD1   1 
ATOM   2846  N  N     . TYR A  1 366 ? 116.317 118.855 76.636  1.00 29.26 ? 366 TYR A N     1 
ATOM   2847  C  CA    . TYR A  1 366 ? 115.001 118.418 77.083  1.00 29.26 ? 366 TYR A CA    1 
ATOM   2848  C  C     . TYR A  1 366 ? 115.060 117.708 78.428  1.00 29.26 ? 366 TYR A C     1 
ATOM   2849  O  O     . TYR A  1 366 ? 114.133 117.845 79.227  1.00 29.26 ? 366 TYR A O     1 
ATOM   2850  C  CB    . TYR A  1 366 ? 114.364 117.505 76.041  1.00 29.26 ? 366 TYR A CB    1 
ATOM   2851  C  CG    . TYR A  1 366 ? 112.934 117.136 76.347  1.00 29.26 ? 366 TYR A CG    1 
ATOM   2852  C  CD1   . TYR A  1 366 ? 112.029 118.092 76.781  1.00 29.26 ? 366 TYR A CD1   1 
ATOM   2853  C  CD2   . TYR A  1 366 ? 112.488 115.832 76.195  1.00 29.26 ? 366 TYR A CD2   1 
ATOM   2854  C  CE1   . TYR A  1 366 ? 110.721 117.758 77.063  1.00 29.26 ? 366 TYR A CE1   1 
ATOM   2855  C  CE2   . TYR A  1 366 ? 111.182 115.490 76.471  1.00 29.26 ? 366 TYR A CE2   1 
ATOM   2856  C  CZ    . TYR A  1 366 ? 110.304 116.455 76.906  1.00 29.26 ? 366 TYR A CZ    1 
ATOM   2857  O  OH    . TYR A  1 366 ? 109.001 116.117 77.184  1.00 29.26 ? 366 TYR A OH    1 
ATOM   2858  N  N     . ALA A  1 367 ? 116.139 116.972 78.707  1.00 27.68 ? 367 ALA A N     1 
ATOM   2859  C  CA    . ALA A  1 367 ? 116.270 116.331 80.013  1.00 27.68 ? 367 ALA A CA    1 
ATOM   2860  C  C     . ALA A  1 367 ? 116.472 117.359 81.120  1.00 27.68 ? 367 ALA A C     1 
ATOM   2861  O  O     . ALA A  1 367 ? 115.919 117.213 82.220  1.00 27.68 ? 367 ALA A O     1 
ATOM   2862  C  CB    . ALA A  1 367 ? 117.423 115.333 79.995  1.00 27.68 ? 367 ALA A CB    1 
ATOM   2863  N  N     . ILE A  1 368 ? 117.238 118.416 80.839  1.00 27.27 ? 368 ILE A N     1 
ATOM   2864  C  CA    . ILE A  1 368 ? 117.422 119.480 81.827  1.00 27.27 ? 368 ILE A CA    1 
ATOM   2865  C  C     . ILE A  1 368 ? 116.119 120.251 82.046  1.00 27.27 ? 368 ILE A C     1 
ATOM   2866  O  O     . ILE A  1 368 ? 115.770 120.597 83.185  1.00 27.27 ? 368 ILE A O     1 
ATOM   2867  C  CB    . ILE A  1 368 ? 118.580 120.396 81.393  1.00 27.27 ? 368 ILE A CB    1 
ATOM   2868  C  CG1   . ILE A  1 368 ? 119.887 119.605 81.383  1.00 27.27 ? 368 ILE A CG1   1 
ATOM   2869  C  CG2   . ILE A  1 368 ? 118.718 121.593 82.314  1.00 27.27 ? 368 ILE A CG2   1 
ATOM   2870  C  CD1   . ILE A  1 368 ? 121.087 120.408 80.939  1.00 27.27 ? 368 ILE A CD1   1 
ATOM   2871  N  N     . VAL A  1 369 ? 115.350 120.475 80.976  1.00 25.74 ? 369 VAL A N     1 
ATOM   2872  C  CA    . VAL A  1 369 ? 114.065 121.158 81.111  1.00 25.74 ? 369 VAL A CA    1 
ATOM   2873  C  C     . VAL A  1 369 ? 113.053 120.276 81.847  1.00 25.74 ? 369 VAL A C     1 
ATOM   2874  O  O     . VAL A  1 369 ? 112.234 120.780 82.629  1.00 25.74 ? 369 VAL A O     1 
ATOM   2875  C  CB    . VAL A  1 369 ? 113.586 121.605 79.713  1.00 25.74 ? 369 VAL A CB    1 
ATOM   2876  C  CG1   . VAL A  1 369 ? 112.121 121.989 79.692  1.00 25.74 ? 369 VAL A CG1   1 
ATOM   2877  C  CG2   . VAL A  1 369 ? 114.415 122.784 79.240  1.00 25.74 ? 369 VAL A CG2   1 
ATOM   2878  N  N     . ILE A  1 370 ? 113.140 118.953 81.675  1.00 25.98 ? 370 ILE A N     1 
ATOM   2879  C  CA    . ILE A  1 370 ? 112.299 118.025 82.432  1.00 25.98 ? 370 ILE A CA    1 
ATOM   2880  C  C     . ILE A  1 370 ? 112.637 118.090 83.918  1.00 25.98 ? 370 ILE A C     1 
ATOM   2881  O  O     . ILE A  1 370 ? 111.747 118.192 84.771  1.00 25.98 ? 370 ILE A O     1 
ATOM   2882  C  CB    . ILE A  1 370 ? 112.449 116.595 81.877  1.00 25.98 ? 370 ILE A CB    1 
ATOM   2883  C  CG1   . ILE A  1 370 ? 111.555 116.390 80.662  1.00 25.98 ? 370 ILE A CG1   1 
ATOM   2884  C  CG2   . ILE A  1 370 ? 112.105 115.539 82.916  1.00 25.98 ? 370 ILE A CG2   1 
ATOM   2885  C  CD1   . ILE A  1 370 ? 111.760 115.051 80.010  1.00 25.98 ? 370 ILE A CD1   1 
ATOM   2886  N  N     . GLU A  1 371 ? 113.931 118.067 84.248  1.00 28.30 ? 371 GLU A N     1 
ATOM   2887  C  CA    . GLU A  1 371 ? 114.321 118.117 85.653  1.00 28.30 ? 371 GLU A CA    1 
ATOM   2888  C  C     . GLU A  1 371 ? 114.126 119.491 86.284  1.00 28.30 ? 371 GLU A C     1 
ATOM   2889  O  O     . GLU A  1 371 ? 114.178 119.596 87.513  1.00 28.30 ? 371 GLU A O     1 
ATOM   2890  C  CB    . GLU A  1 371 ? 115.773 117.680 85.816  1.00 28.30 ? 371 GLU A CB    1 
ATOM   2891  C  CG    . GLU A  1 371 ? 115.955 116.176 85.943  1.00 28.30 ? 371 GLU A CG    1 
ATOM   2892  C  CD    . GLU A  1 371 ? 115.457 115.631 87.271  1.00 28.30 ? 371 GLU A CD    1 
ATOM   2893  O  OE1   . GLU A  1 371 ? 114.558 114.763 87.261  1.00 28.30 ? 371 GLU A OE1   1 
ATOM   2894  O  OE2   . GLU A  1 371 ? 115.964 116.066 88.326  1.00 28.30 ? 371 GLU A OE2   1 
ATOM   2895  N  N     . ILE A  1 372 ? 113.915 120.537 85.491  1.00 24.86 ? 372 ILE A N     1 
ATOM   2896  C  CA    . ILE A  1 372 ? 113.521 121.831 86.048  1.00 24.86 ? 372 ILE A CA    1 
ATOM   2897  C  C     . ILE A  1 372 ? 112.009 121.909 86.253  1.00 24.86 ? 372 ILE A C     1 
ATOM   2898  O  O     . ILE A  1 372 ? 111.537 122.338 87.316  1.00 24.86 ? 372 ILE A O     1 
ATOM   2899  C  CB    . ILE A  1 372 ? 114.042 122.963 85.136  1.00 24.86 ? 372 ILE A CB    1 
ATOM   2900  C  CG1   . ILE A  1 372 ? 115.514 123.239 85.433  1.00 24.86 ? 372 ILE A CG1   1 
ATOM   2901  C  CG2   . ILE A  1 372 ? 113.236 124.243 85.301  1.00 24.86 ? 372 ILE A CG2   1 
ATOM   2902  C  CD1   . ILE A  1 372 ? 116.116 124.329 84.577  1.00 24.86 ? 372 ILE A CD1   1 
ATOM   2903  N  N     . MET A  1 373 ? 111.240 121.467 85.249  1.00 27.34 ? 373 MET A N     1 
ATOM   2904  C  CA    . MET A  1 373 ? 109.783 121.499 85.326  1.00 27.34 ? 373 MET A CA    1 
ATOM   2905  C  C     . MET A  1 373 ? 109.247 120.569 86.403  1.00 27.34 ? 373 MET A C     1 
ATOM   2906  O  O     . MET A  1 373 ? 108.203 120.860 86.995  1.00 27.34 ? 373 MET A O     1 
ATOM   2907  C  CB    . MET A  1 373 ? 109.176 121.125 83.977  1.00 27.34 ? 373 MET A CB    1 
ATOM   2908  C  CG    . MET A  1 373 ? 109.192 122.235 82.952  1.00 27.34 ? 373 MET A CG    1 
ATOM   2909  S  SD    . MET A  1 373 ? 108.735 121.627 81.320  1.00 27.34 ? 373 MET A SD    1 
ATOM   2910  C  CE    . MET A  1 373 ? 107.053 121.103 81.623  1.00 27.34 ? 373 MET A CE    1 
ATOM   2911  N  N     . ASN A  1 374 ? 109.951 119.469 86.687  1.00 25.04 ? 374 ASN A N     1 
ATOM   2912  C  CA    . ASN A  1 374 ? 109.512 118.568 87.746  1.00 25.04 ? 374 ASN A CA    1 
ATOM   2913  C  C     . ASN A  1 374 ? 109.637 119.219 89.116  1.00 25.04 ? 374 ASN A C     1 
ATOM   2914  O  O     . ASN A  1 374 ? 108.742 119.078 89.954  1.00 25.04 ? 374 ASN A O     1 
ATOM   2915  C  CB    . ASN A  1 374 ? 110.311 117.270 87.692  1.00 25.04 ? 374 ASN A CB    1 
ATOM   2916  C  CG    . ASN A  1 374 ? 109.876 116.373 86.560  1.00 25.04 ? 374 ASN A CG    1 
ATOM   2917  O  OD1   . ASN A  1 374 ? 109.004 116.733 85.771  1.00 25.04 ? 374 ASN A OD1   1 
ATOM   2918  N  ND2   . ASN A  1 374 ? 110.478 115.194 86.472  1.00 25.04 ? 374 ASN A ND2   1 
ATOM   2919  N  N     . ARG A  1 375 ? 110.712 119.975 89.349  1.00 26.09 ? 375 ARG A N     1 
ATOM   2920  C  CA    . ARG A  1 375 ? 110.866 120.653 90.632  1.00 26.09 ? 375 ARG A CA    1 
ATOM   2921  C  C     . ARG A  1 375 ? 109.903 121.828 90.759  1.00 26.09 ? 375 ARG A C     1 
ATOM   2922  O  O     . ARG A  1 375 ? 109.387 122.099 91.855  1.00 26.09 ? 375 ARG A O     1 
ATOM   2923  C  CB    . ARG A  1 375 ? 112.310 121.113 90.810  1.00 26.09 ? 375 ARG A CB    1 
ATOM   2924  C  CG    . ARG A  1 375 ? 113.298 119.967 90.836  1.00 26.09 ? 375 ARG A CG    1 
ATOM   2925  C  CD    . ARG A  1 375 ? 114.679 120.428 91.246  1.00 26.09 ? 375 ARG A CD    1 
ATOM   2926  N  NE    . ARG A  1 375 ? 115.687 119.417 90.944  1.00 26.09 ? 375 ARG A NE    1 
ATOM   2927  C  CZ    . ARG A  1 375 ? 116.119 118.509 91.813  1.00 26.09 ? 375 ARG A CZ    1 
ATOM   2928  N  NH1   . ARG A  1 375 ? 115.635 118.484 93.046  1.00 26.09 ? 375 ARG A NH1   1 
ATOM   2929  N  NH2   . ARG A  1 375 ? 117.038 117.627 91.448  1.00 26.09 ? 375 ARG A NH2   1 
ATOM   2930  N  N     . LEU A  1 376 ? 109.632 122.522 89.647  1.00 25.66 ? 376 LEU A N     1 
ATOM   2931  C  CA    . LEU A  1 376 ? 108.650 123.605 89.684  1.00 25.66 ? 376 LEU A CA    1 
ATOM   2932  C  C     . LEU A  1 376 ? 107.245 123.076 89.959  1.00 25.66 ? 376 LEU A C     1 
ATOM   2933  O  O     . LEU A  1 376 ? 106.507 123.652 90.773  1.00 25.66 ? 376 LEU A O     1 
ATOM   2934  C  CB    . LEU A  1 376 ? 108.680 124.393 88.376  1.00 25.66 ? 376 LEU A CB    1 
ATOM   2935  C  CG    . LEU A  1 376 ? 109.943 125.198 88.069  1.00 25.66 ? 376 LEU A CG    1 
ATOM   2936  C  CD1   . LEU A  1 376 ? 109.699 126.135 86.903  1.00 25.66 ? 376 LEU A CD1   1 
ATOM   2937  C  CD2   . LEU A  1 376 ? 110.409 125.974 89.284  1.00 25.66 ? 376 LEU A CD2   1 
ATOM   2938  N  N     . TYR A  1 377 ? 106.872 121.959 89.326  1.00 22.75 ? 377 TYR A N     1 
ATOM   2939  C  CA    . TYR A  1 377 ? 105.592 121.335 89.636  1.00 22.75 ? 377 TYR A CA    1 
ATOM   2940  C  C     . TYR A  1 377 ? 105.573 120.764 91.044  1.00 22.75 ? 377 TYR A C     1 
ATOM   2941  O  O     . TYR A  1 377 ? 104.509 120.701 91.657  1.00 22.75 ? 377 TYR A O     1 
ATOM   2942  C  CB    . TYR A  1 377 ? 105.260 120.233 88.631  1.00 22.75 ? 377 TYR A CB    1 
ATOM   2943  C  CG    . TYR A  1 377 ? 103.899 119.600 88.857  1.00 22.75 ? 377 TYR A CG    1 
ATOM   2944  C  CD1   . TYR A  1 377 ? 102.752 120.192 88.357  1.00 22.75 ? 377 TYR A CD1   1 
ATOM   2945  C  CD2   . TYR A  1 377 ? 103.763 118.416 89.577  1.00 22.75 ? 377 TYR A CD2   1 
ATOM   2946  C  CE1   . TYR A  1 377 ? 101.513 119.630 88.566  1.00 22.75 ? 377 TYR A CE1   1 
ATOM   2947  C  CE2   . TYR A  1 377 ? 102.531 117.864 89.810  1.00 22.75 ? 377 TYR A CE2   1 
ATOM   2948  C  CZ    . TYR A  1 377 ? 101.413 118.463 89.287  1.00 22.75 ? 377 TYR A CZ    1 
ATOM   2949  O  OH    . TYR A  1 377 ? 100.187 117.893 89.503  1.00 22.75 ? 377 TYR A OH    1 
ATOM   2950  N  N     . ARG A  1 378 ? 106.721 120.333 91.568  1.00 25.45 ? 378 ARG A N     1 
ATOM   2951  C  CA    . ARG A  1 378 ? 106.757 119.821 92.932  1.00 25.45 ? 378 ARG A CA    1 
ATOM   2952  C  C     . ARG A  1 378 ? 106.472 120.926 93.940  1.00 25.45 ? 378 ARG A C     1 
ATOM   2953  O  O     . ARG A  1 378 ? 105.704 120.721 94.888  1.00 25.45 ? 378 ARG A O     1 
ATOM   2954  C  CB    . ARG A  1 378 ? 108.109 119.168 93.201  1.00 25.45 ? 378 ARG A CB    1 
ATOM   2955  C  CG    . ARG A  1 378 ? 108.335 118.785 94.637  1.00 25.45 ? 378 ARG A CG    1 
ATOM   2956  C  CD    . ARG A  1 378 ? 107.424 117.651 95.051  1.00 25.45 ? 378 ARG A CD    1 
ATOM   2957  N  NE    . ARG A  1 378 ? 107.518 117.406 96.485  1.00 25.45 ? 378 ARG A NE    1 
ATOM   2958  C  CZ    . ARG A  1 378 ? 108.444 116.642 97.049  1.00 25.45 ? 378 ARG A CZ    1 
ATOM   2959  N  NH1   . ARG A  1 378 ? 109.350 116.034 96.299  1.00 25.45 ? 378 ARG A NH1   1 
ATOM   2960  N  NH2   . ARG A  1 378 ? 108.458 116.476 98.364  1.00 25.45 ? 378 ARG A NH2   1 
ATOM   2961  N  N     . TYR A  1 379 ? 107.040 122.117 93.717  1.00 31.37 ? 379 TYR A N     1 
ATOM   2962  C  CA    . TYR A  1 379 ? 106.720 123.263 94.569  1.00 31.37 ? 379 TYR A CA    1 
ATOM   2963  C  C     . TYR A  1 379 ? 105.257 123.673 94.428  1.00 31.37 ? 379 TYR A C     1 
ATOM   2964  O  O     . TYR A  1 379 ? 104.583 123.948 95.433  1.00 31.37 ? 379 TYR A O     1 
ATOM   2965  C  CB    . TYR A  1 379 ? 107.629 124.447 94.241  1.00 31.37 ? 379 TYR A CB    1 
ATOM   2966  C  CG    . TYR A  1 379 ? 109.072 124.275 94.663  1.00 31.37 ? 379 TYR A CG    1 
ATOM   2967  C  CD1   . TYR A  1 379 ? 109.441 123.304 95.587  1.00 31.37 ? 379 TYR A CD1   1 
ATOM   2968  C  CD2   . TYR A  1 379 ? 110.068 125.088 94.133  1.00 31.37 ? 379 TYR A CD2   1 
ATOM   2969  C  CE1   . TYR A  1 379 ? 110.761 123.144 95.970  1.00 31.37 ? 379 TYR A CE1   1 
ATOM   2970  C  CE2   . TYR A  1 379 ? 111.390 124.937 94.509  1.00 31.37 ? 379 TYR A CE2   1 
ATOM   2971  C  CZ    . TYR A  1 379 ? 111.730 123.964 95.428  1.00 31.37 ? 379 TYR A CZ    1 
ATOM   2972  O  OH    . TYR A  1 379 ? 113.044 123.809 95.808  1.00 31.37 ? 379 TYR A OH    1 
ATOM   2973  N  N     . ALA A  1 380 ? 104.741 123.682 93.191  1.00 27.40 ? 380 ALA A N     1 
ATOM   2974  C  CA    . ALA A  1 380 ? 103.348 124.066 92.966  1.00 27.40 ? 380 ALA A CA    1 
ATOM   2975  C  C     . ALA A  1 380 ? 102.377 123.058 93.570  1.00 27.40 ? 380 ALA A C     1 
ATOM   2976  O  O     . ALA A  1 380 ? 101.350 123.444 94.133  1.00 27.40 ? 380 ALA A O     1 
ATOM   2977  C  CB    . ALA A  1 380 ? 103.082 124.231 91.473  1.00 27.40 ? 380 ALA A CB    1 
ATOM   2978  N  N     . ALA A  1 381 ? 102.702 121.769 93.507  1.00 27.76 ? 381 ALA A N     1 
ATOM   2979  C  CA    . ALA A  1 381 ? 101.830 120.744 94.062  1.00 27.76 ? 381 ALA A CA    1 
ATOM   2980  C  C     . ALA A  1 381 ? 101.905 120.691 95.578  1.00 27.76 ? 381 ALA A C     1 
ATOM   2981  O  O     . ALA A  1 381 ? 100.892 120.409 96.223  1.00 27.76 ? 381 ALA A O     1 
ATOM   2982  C  CB    . ALA A  1 381 ? 102.179 119.378 93.476  1.00 27.76 ? 381 ALA A CB    1 
ATOM   2983  N  N     . GLU A  1 382 ? 103.075 120.970 96.163  1.00 30.35 ? 382 GLU A N     1 
ATOM   2984  C  CA    . GLU A  1 382 ? 103.167 121.074 97.616  1.00 30.35 ? 382 GLU A CA    1 
ATOM   2985  C  C     . GLU A  1 382 ? 102.349 122.246 98.137  1.00 30.35 ? 382 GLU A C     1 
ATOM   2986  O  O     . GLU A  1 382 ? 101.645 122.118 99.149  1.00 30.35 ? 382 GLU A O     1 
ATOM   2987  C  CB    . GLU A  1 382 ? 104.625 121.214 98.045  1.00 30.35 ? 382 GLU A CB    1 
ATOM   2988  C  CG    . GLU A  1 382 ? 105.364 119.902 98.195  1.00 30.35 ? 382 GLU A CG    1 
ATOM   2989  C  CD    . GLU A  1 382 ? 106.806 120.099 98.615  1.00 30.35 ? 382 GLU A CD    1 
ATOM   2990  O  OE1   . GLU A  1 382 ? 107.230 121.264 98.759  1.00 30.35 ? 382 GLU A OE1   1 
ATOM   2991  O  OE2   . GLU A  1 382 ? 107.515 119.090 98.808  1.00 30.35 ? 382 GLU A OE2   1 
ATOM   2992  N  N     . PHE A  1 383 ? 102.405 123.391 97.443  1.00 32.94 ? 383 PHE A N     1 
ATOM   2993  C  CA    . PHE A  1 383 ? 101.573 124.523 97.842  1.00 32.94 ? 383 PHE A CA    1 
ATOM   2994  C  C     . PHE A  1 383 ? 100.091 124.231 97.629  1.00 32.94 ? 383 PHE A C     1 
ATOM   2995  O  O     . PHE A  1 383 ? 99.259  124.586 98.470  1.00 32.94 ? 383 PHE A O     1 
ATOM   2996  C  CB    . PHE A  1 383 ? 101.975 125.782 97.078  1.00 32.94 ? 383 PHE A CB    1 
ATOM   2997  C  CG    . PHE A  1 383 ? 100.924 126.857 97.092  1.00 32.94 ? 383 PHE A CG    1 
ATOM   2998  C  CD1   . PHE A  1 383 ? 100.640 127.548 98.260  1.00 32.94 ? 383 PHE A CD1   1 
ATOM   2999  C  CD2   . PHE A  1 383 ? 100.218 127.173 95.941  1.00 32.94 ? 383 PHE A CD2   1 
ATOM   3000  C  CE1   . PHE A  1 383 ? 99.671  128.532 98.281  1.00 32.94 ? 383 PHE A CE1   1 
ATOM   3001  C  CE2   . PHE A  1 383 ? 99.247  128.155 95.957  1.00 32.94 ? 383 PHE A CE2   1 
ATOM   3002  C  CZ    . PHE A  1 383 ? 98.974  128.836 97.128  1.00 32.94 ? 383 PHE A CZ    1 
ATOM   3003  N  N     . LEU A  1 384 ? 99.741  123.577 96.521  1.00 31.90 ? 384 LEU A N     1 
ATOM   3004  C  CA    . LEU A  1 384 ? 98.340  123.339 96.205  1.00 31.90 ? 384 LEU A CA    1 
ATOM   3005  C  C     . LEU A  1 384 ? 97.727  122.224 97.038  1.00 31.90 ? 384 LEU A C     1 
ATOM   3006  O  O     . LEU A  1 384 ? 96.500  122.165 97.154  1.00 31.90 ? 384 LEU A O     1 
ATOM   3007  C  CB    . LEU A  1 384 ? 98.201  123.013 94.723  1.00 31.90 ? 384 LEU A CB    1 
ATOM   3008  C  CG    . LEU A  1 384 ? 96.895  123.409 94.050  1.00 31.90 ? 384 LEU A CG    1 
ATOM   3009  C  CD1   . LEU A  1 384 ? 96.728  124.910 94.075  1.00 31.90 ? 384 LEU A CD1   1 
ATOM   3010  C  CD2   . LEU A  1 384 ? 96.914  122.905 92.634  1.00 31.90 ? 384 LEU A CD2   1 
ATOM   3011  N  N     . THR A  1 385 ? 98.538  121.337 97.611  1.00 32.15 ? 385 THR A N     1 
ATOM   3012  C  CA    . THR A  1 385 ? 98.018  120.290 98.475  1.00 32.15 ? 385 THR A CA    1 
ATOM   3013  C  C     . THR A  1 385 ? 98.067  120.688 99.944  1.00 32.15 ? 385 THR A C     1 
ATOM   3014  O  O     . THR A  1 385 ? 97.249  120.207 100.735 1.00 32.15 ? 385 THR A O     1 
ATOM   3015  C  CB    . THR A  1 385 ? 98.801  118.993 98.243  1.00 32.15 ? 385 THR A CB    1 
ATOM   3016  O  OG1   . THR A  1 385 ? 98.952  118.794 96.836  1.00 32.15 ? 385 THR A OG1   1 
ATOM   3017  C  CG2   . THR A  1 385 ? 98.034  117.799 98.759  1.00 32.15 ? 385 THR A CG2   1 
ATOM   3018  N  N     . SER A  1 386 ? 98.963  121.604 100.318 1.00 35.64 ? 386 SER A N     1 
ATOM   3019  C  CA    . SER A  1 386 ? 98.872  122.222 101.634 1.00 35.64 ? 386 SER A CA    1 
ATOM   3020  C  C     . SER A  1 386 ? 97.764  123.265 101.719 1.00 35.64 ? 386 SER A C     1 
ATOM   3021  O  O     . SER A  1 386 ? 97.489  123.766 102.814 1.00 35.64 ? 386 SER A O     1 
ATOM   3022  C  CB    . SER A  1 386 ? 100.208 122.862 102.008 1.00 35.64 ? 386 SER A CB    1 
ATOM   3023  O  OG    . SER A  1 386 ? 100.277 124.196 101.539 1.00 35.64 ? 386 SER A OG    1 
ATOM   3024  N  N     . TRP A  1 387 ? 97.130  123.603 100.596 1.00 37.96 ? 387 TRP A N     1 
ATOM   3025  C  CA    . TRP A  1 387 ? 96.052  124.579 100.545 1.00 37.96 ? 387 TRP A CA    1 
ATOM   3026  C  C     . TRP A  1 387 ? 94.674  123.949 100.694 1.00 37.96 ? 387 TRP A C     1 
ATOM   3027  O  O     . TRP A  1 387 ? 93.734  124.636 101.103 1.00 37.96 ? 387 TRP A O     1 
ATOM   3028  C  CB    . TRP A  1 387 ? 96.138  125.354 99.223  1.00 37.96 ? 387 TRP A CB    1 
ATOM   3029  C  CG    . TRP A  1 387 ? 95.071  126.371 98.987  1.00 37.96 ? 387 TRP A CG    1 
ATOM   3030  C  CD1   . TRP A  1 387 ? 94.969  127.602 99.560  1.00 37.96 ? 387 TRP A CD1   1 
ATOM   3031  C  CD2   . TRP A  1 387 ? 93.958  126.249 98.097  1.00 37.96 ? 387 TRP A CD2   1 
ATOM   3032  N  NE1   . TRP A  1 387 ? 93.857  128.253 99.087  1.00 37.96 ? 387 TRP A NE1   1 
ATOM   3033  C  CE2   . TRP A  1 387 ? 93.219  127.443 98.186  1.00 37.96 ? 387 TRP A CE2   1 
ATOM   3034  C  CE3   . TRP A  1 387 ? 93.513  125.244 97.234  1.00 37.96 ? 387 TRP A CE3   1 
ATOM   3035  C  CZ2   . TRP A  1 387 ? 92.060  127.659 97.448  1.00 37.96 ? 387 TRP A CZ2   1 
ATOM   3036  C  CZ3   . TRP A  1 387 ? 92.363  125.460 96.502  1.00 37.96 ? 387 TRP A CZ3   1 
ATOM   3037  C  CH2   . TRP A  1 387 ? 91.650  126.657 96.613  1.00 37.96 ? 387 TRP A CH2   1 
ATOM   3038  N  N     . GLU A  1 388 ? 94.538  122.655 100.416 1.00 38.06 ? 388 GLU A N     1 
ATOM   3039  C  CA    . GLU A  1 388 ? 93.245  121.985 100.456 1.00 38.06 ? 388 GLU A CA    1 
ATOM   3040  C  C     . GLU A  1 388 ? 92.788  121.623 101.862 1.00 38.06 ? 388 GLU A C     1 
ATOM   3041  O  O     . GLU A  1 388 ? 91.697  121.059 102.000 1.00 38.06 ? 388 GLU A O     1 
ATOM   3042  C  CB    . GLU A  1 388 ? 93.280  120.716 99.608  1.00 38.06 ? 388 GLU A CB    1 
ATOM   3043  C  CG    . GLU A  1 388 ? 93.584  120.954 98.154  1.00 38.06 ? 388 GLU A CG    1 
ATOM   3044  C  CD    . GLU A  1 388 ? 94.061  119.701 97.462  1.00 38.06 ? 388 GLU A CD    1 
ATOM   3045  O  OE1   . GLU A  1 388 ? 93.986  118.620 98.079  1.00 38.06 ? 388 GLU A OE1   1 
ATOM   3046  O  OE2   . GLU A  1 388 ? 94.512  119.796 96.303  1.00 38.06 ? 388 GLU A OE2   1 
ATOM   3047  N  N     . ASN A  1 389 ? 93.600  121.921 102.883 1.00 40.38 ? 389 ASN A N     1 
ATOM   3048  C  CA    . ASN A  1 389 ? 93.294  121.698 104.301 1.00 40.38 ? 389 ASN A CA    1 
ATOM   3049  C  C     . ASN A  1 389 ? 93.002  120.226 104.591 1.00 40.38 ? 389 ASN A C     1 
ATOM   3050  O  O     . ASN A  1 389 ? 91.936  119.859 105.085 1.00 40.38 ? 389 ASN A O     1 
ATOM   3051  C  CB    . ASN A  1 389 ? 92.141  122.592 104.772 1.00 40.38 ? 389 ASN A CB    1 
ATOM   3052  C  CG    . ASN A  1 389 ? 92.622  123.821 105.505 1.00 40.38 ? 389 ASN A CG    1 
ATOM   3053  O  OD1   . ASN A  1 389 ? 93.758  124.256 105.331 1.00 40.38 ? 389 ASN A OD1   1 
ATOM   3054  N  ND2   . ASN A  1 389 ? 91.757  124.392 106.330 1.00 40.38 ? 389 ASN A ND2   1 
ATOM   3055  N  N     . HIS A  1 390 ? 93.972  119.382 104.258 1.00 36.02 ? 390 HIS A N     1 
ATOM   3056  C  CA    . HIS A  1 390 ? 93.858  117.966 104.565 1.00 36.02 ? 390 HIS A CA    1 
ATOM   3057  C  C     . HIS A  1 390 ? 94.041  117.745 106.059 1.00 36.02 ? 390 HIS A C     1 
ATOM   3058  O  O     . HIS A  1 390 ? 94.862  118.403 106.701 1.00 36.02 ? 390 HIS A O     1 
ATOM   3059  C  CB    . HIS A  1 390 ? 94.893  117.169 103.779 1.00 36.02 ? 390 HIS A CB    1 
ATOM   3060  C  CG    . HIS A  1 390 ? 94.480  116.874 102.374 1.00 36.02 ? 390 HIS A CG    1 
ATOM   3061  N  ND1   . HIS A  1 390 ? 93.385  116.097 102.070 1.00 36.02 ? 390 HIS A ND1   1 
ATOM   3062  C  CD2   . HIS A  1 390 ? 95.012  117.256 101.190 1.00 36.02 ? 390 HIS A CD2   1 
ATOM   3063  C  CE1   . HIS A  1 390 ? 93.261  116.010 100.758 1.00 36.02 ? 390 HIS A CE1   1 
ATOM   3064  N  NE2   . HIS A  1 390 ? 94.236  116.704 100.201 1.00 36.02 ? 390 HIS A NE2   1 
ATOM   3065  N  N     . ARG A  1 391 ? 93.265  116.818 106.616 1.00 44.45 ? 391 ARG A N     1 
ATOM   3066  C  CA    . ARG A  1 391 ? 93.266  116.639 108.063 1.00 44.45 ? 391 ARG A CA    1 
ATOM   3067  C  C     . ARG A  1 391 ? 94.486  115.855 108.529 1.00 44.45 ? 391 ARG A C     1 
ATOM   3068  O  O     . ARG A  1 391 ? 95.321  116.372 109.278 1.00 44.45 ? 391 ARG A O     1 
ATOM   3069  C  CB    . ARG A  1 391 ? 91.982  115.942 108.509 1.00 44.45 ? 391 ARG A CB    1 
ATOM   3070  C  CG    . ARG A  1 391 ? 91.729  116.052 109.997 1.00 44.45 ? 391 ARG A CG    1 
ATOM   3071  C  CD    . ARG A  1 391 ? 90.484  115.296 110.410 1.00 44.45 ? 391 ARG A CD    1 
ATOM   3072  N  NE    . ARG A  1 391 ? 90.257  115.396 111.846 1.00 44.45 ? 391 ARG A NE    1 
ATOM   3073  C  CZ    . ARG A  1 391 ? 90.788  114.575 112.743 1.00 44.45 ? 391 ARG A CZ    1 
ATOM   3074  N  NH1   . ARG A  1 391 ? 91.576  113.585 112.353 1.00 44.45 ? 391 ARG A NH1   1 
ATOM   3075  N  NH2   . ARG A  1 391 ? 90.529  114.742 114.031 1.00 44.45 ? 391 ARG A NH2   1 
ATOM   3076  N  N     . LEU A  1 392 ? 94.610  114.607 108.094 1.00 42.85 ? 392 LEU A N     1 
ATOM   3077  C  CA    . LEU A  1 392 ? 95.730  113.785 108.516 1.00 42.85 ? 392 LEU A CA    1 
ATOM   3078  C  C     . LEU A  1 392 ? 96.949  114.072 107.645 1.00 42.85 ? 392 LEU A C     1 
ATOM   3079  O  O     . LEU A  1 392 ? 96.908  114.873 106.709 1.00 42.85 ? 392 LEU A O     1 
ATOM   3080  C  CB    . LEU A  1 392 ? 95.353  112.309 108.458 1.00 42.85 ? 392 LEU A CB    1 
ATOM   3081  C  CG    . LEU A  1 392 ? 94.007  111.937 109.075 1.00 42.85 ? 392 LEU A CG    1 
ATOM   3082  C  CD1   . LEU A  1 392 ? 93.583  110.550 108.627 1.00 42.85 ? 392 LEU A CD1   1 
ATOM   3083  C  CD2   . LEU A  1 392 ? 94.079  112.014 110.585 1.00 42.85 ? 392 LEU A CD2   1 
ATOM   3084  N  N     . GLU A  1 393 ? 98.057  113.409 107.961 1.00 37.17 ? 393 GLU A N     1 
ATOM   3085  C  CA    . GLU A  1 393 ? 99.243  113.473 107.122 1.00 37.17 ? 393 GLU A CA    1 
ATOM   3086  C  C     . GLU A  1 393 ? 99.230  112.411 106.034 1.00 37.17 ? 393 GLU A C     1 
ATOM   3087  O  O     . GLU A  1 393 ? 99.810  112.628 104.964 1.00 37.17 ? 393 GLU A O     1 
ATOM   3088  C  CB    . GLU A  1 393 ? 100.502 113.332 107.987 1.00 37.17 ? 393 GLU A CB    1 
ATOM   3089  C  CG    . GLU A  1 393 ? 101.827 113.602 107.279 1.00 37.17 ? 393 GLU A CG    1 
ATOM   3090  C  CD    . GLU A  1 393 ? 102.057 115.070 106.976 1.00 37.17 ? 393 GLU A CD    1 
ATOM   3091  O  OE1   . GLU A  1 393 ? 101.455 115.926 107.655 1.00 37.17 ? 393 GLU A OE1   1 
ATOM   3092  O  OE2   . GLU A  1 393 ? 102.846 115.371 106.057 1.00 37.17 ? 393 GLU A OE2   1 
ATOM   3093  N  N     . SER A  1 394 ? 98.547  111.288 106.272 1.00 35.05 ? 394 SER A N     1 
ATOM   3094  C  CA    . SER A  1 394 ? 98.474  110.227 105.275 1.00 35.05 ? 394 SER A CA    1 
ATOM   3095  C  C     . SER A  1 394 ? 97.668  110.658 104.057 1.00 35.05 ? 394 SER A C     1 
ATOM   3096  O  O     . SER A  1 394 ? 98.039  110.341 102.924 1.00 35.05 ? 394 SER A O     1 
ATOM   3097  C  CB    . SER A  1 394 ? 97.870  108.970 105.895 1.00 35.05 ? 394 SER A CB    1 
ATOM   3098  O  OG    . SER A  1 394 ? 96.457  108.994 105.809 1.00 35.05 ? 394 SER A OG    1 
ATOM   3099  N  N     . ALA A  1 395 ? 96.579  111.402 104.266 1.00 32.69 ? 395 ALA A N     1 
ATOM   3100  C  CA    . ALA A  1 395 ? 95.772  111.868 103.140 1.00 32.69 ? 395 ALA A CA    1 
ATOM   3101  C  C     . ALA A  1 395 ? 96.509  112.925 102.328 1.00 32.69 ? 395 ALA A C     1 
ATOM   3102  O  O     . ALA A  1 395 ? 96.439  112.927 101.091 1.00 32.69 ? 395 ALA A O     1 
ATOM   3103  C  CB    . ALA A  1 395 ? 94.438  112.413 103.641 1.00 32.69 ? 395 ALA A CB    1 
ATOM   3104  N  N     . TYR A  1 396 ? 97.231  113.820 103.011 1.00 30.79 ? 396 TYR A N     1 
ATOM   3105  C  CA    . TYR A  1 396 ? 98.044  114.822 102.329 1.00 30.79 ? 396 TYR A CA    1 
ATOM   3106  C  C     . TYR A  1 396 ? 99.155  114.171 101.520 1.00 30.79 ? 396 TYR A C     1 
ATOM   3107  O  O     . TYR A  1 396 ? 99.403  114.560 100.371 1.00 30.79 ? 396 TYR A O     1 
ATOM   3108  C  CB    . TYR A  1 396 ? 98.628  115.794 103.352 1.00 30.79 ? 396 TYR A CB    1 
ATOM   3109  C  CG    . TYR A  1 396 ? 99.817  116.589 102.863 1.00 30.79 ? 396 TYR A CG    1 
ATOM   3110  C  CD1   . TYR A  1 396 ? 99.656  117.623 101.957 1.00 30.79 ? 396 TYR A CD1   1 
ATOM   3111  C  CD2   . TYR A  1 396 ? 101.098 116.316 103.322 1.00 30.79 ? 396 TYR A CD2   1 
ATOM   3112  C  CE1   . TYR A  1 396 ? 100.736 118.358 101.511 1.00 30.79 ? 396 TYR A CE1   1 
ATOM   3113  C  CE2   . TYR A  1 396 ? 102.184 117.044 102.880 1.00 30.79 ? 396 TYR A CE2   1 
ATOM   3114  C  CZ    . TYR A  1 396 ? 101.994 118.063 101.975 1.00 30.79 ? 396 TYR A CZ    1 
ATOM   3115  O  OH    . TYR A  1 396 ? 103.068 118.794 101.535 1.00 30.79 ? 396 TYR A OH    1 
ATOM   3116  N  N     . GLN A  1 397 ? 99.811  113.160 102.096 1.00 28.60 ? 397 GLN A N     1 
ATOM   3117  C  CA    . GLN A  1 397 ? 100.848 112.436 101.375 1.00 28.60 ? 397 GLN A CA    1 
ATOM   3118  C  C     . GLN A  1 397 ? 100.282 111.669 100.191 1.00 28.60 ? 397 GLN A C     1 
ATOM   3119  O  O     . GLN A  1 397 ? 100.910 111.642 99.136  1.00 28.60 ? 397 GLN A O     1 
ATOM   3120  C  CB    . GLN A  1 397 ? 101.587 111.483 102.313 1.00 28.60 ? 397 GLN A CB    1 
ATOM   3121  C  CG    . GLN A  1 397 ? 102.611 112.161 103.202 1.00 28.60 ? 397 GLN A CG    1 
ATOM   3122  C  CD    . GLN A  1 397 ? 103.745 112.778 102.416 1.00 28.60 ? 397 GLN A CD    1 
ATOM   3123  O  OE1   . GLN A  1 397 ? 104.194 112.224 101.416 1.00 28.60 ? 397 GLN A OE1   1 
ATOM   3124  N  NE2   . GLN A  1 397 ? 104.214 113.935 102.863 1.00 28.60 ? 397 GLN A NE2   1 
ATOM   3125  N  N     . ASN A  1 398 ? 99.085  111.092 100.322 1.00 27.51 ? 398 ASN A N     1 
ATOM   3126  C  CA    . ASN A  1 398 ? 98.488  110.358 99.209  1.00 27.51 ? 398 ASN A CA    1 
ATOM   3127  C  C     . ASN A  1 398 ? 98.107  111.286 98.062  1.00 27.51 ? 398 ASN A C     1 
ATOM   3128  O  O     . ASN A  1 398 ? 98.337  110.954 96.892  1.00 27.51 ? 398 ASN A O     1 
ATOM   3129  C  CB    . ASN A  1 398 ? 97.266  109.579 99.688  1.00 27.51 ? 398 ASN A CB    1 
ATOM   3130  C  CG    . ASN A  1 398 ? 97.636  108.377 100.520 1.00 27.51 ? 398 ASN A CG    1 
ATOM   3131  O  OD1   . ASN A  1 398 ? 98.800  108.180 100.861 1.00 27.51 ? 398 ASN A OD1   1 
ATOM   3132  N  ND2   . ASN A  1 398 ? 96.645  107.566 100.857 1.00 27.51 ? 398 ASN A ND2   1 
ATOM   3133  N  N     . HIS A  1 399 ? 97.557  112.464 98.375  1.00 25.94 ? 399 HIS A N     1 
ATOM   3134  C  CA    . HIS A  1 399 ? 97.200  113.411 97.322  1.00 25.94 ? 399 HIS A CA    1 
ATOM   3135  C  C     . HIS A  1 399 ? 98.438  113.971 96.631  1.00 25.94 ? 399 HIS A C     1 
ATOM   3136  O  O     . HIS A  1 399 ? 98.461  114.105 95.396  1.00 25.94 ? 399 HIS A O     1 
ATOM   3137  C  CB    . HIS A  1 399 ? 96.354  114.542 97.897  1.00 25.94 ? 399 HIS A CB    1 
ATOM   3138  C  CG    . HIS A  1 399 ? 94.945  114.146 98.195  1.00 25.94 ? 399 HIS A CG    1 
ATOM   3139  N  ND1   . HIS A  1 399 ? 94.625  113.171 99.114  1.00 25.94 ? 399 HIS A ND1   1 
ATOM   3140  C  CD2   . HIS A  1 399 ? 93.769  114.591 97.695  1.00 25.94 ? 399 HIS A CD2   1 
ATOM   3141  C  CE1   . HIS A  1 399 ? 93.314  113.033 99.168  1.00 25.94 ? 399 HIS A CE1   1 
ATOM   3142  N  NE2   . HIS A  1 399 ? 92.770  113.883 98.316  1.00 25.94 ? 399 HIS A NE2   1 
ATOM   3143  N  N     . LEU A  1 400 ? 99.485  114.279 97.407  1.00 23.30 ? 400 LEU A N     1 
ATOM   3144  C  CA    . LEU A  1 400 ? 100.726 114.770 96.819  1.00 23.30 ? 400 LEU A CA    1 
ATOM   3145  C  C     . LEU A  1 400 ? 101.401 113.705 95.964  1.00 23.30 ? 400 LEU A C     1 
ATOM   3146  O  O     . LEU A  1 400 ? 101.923 114.015 94.886  1.00 23.30 ? 400 LEU A O     1 
ATOM   3147  C  CB    . LEU A  1 400 ? 101.668 115.248 97.917  1.00 23.30 ? 400 LEU A CB    1 
ATOM   3148  C  CG    . LEU A  1 400 ? 102.953 115.918 97.446  1.00 23.30 ? 400 LEU A CG    1 
ATOM   3149  C  CD1   . LEU A  1 400 ? 102.627 117.183 96.683  1.00 23.30 ? 400 LEU A CD1   1 
ATOM   3150  C  CD2   . LEU A  1 400 ? 103.849 116.218 98.628  1.00 23.30 ? 400 LEU A CD2   1 
ATOM   3151  N  N     . ILE A  1 401 ? 101.375 112.445 96.415  1.00 20.76 ? 401 ILE A N     1 
ATOM   3152  C  CA    . ILE A  1 401 ? 101.946 111.346 95.641  1.00 20.76 ? 401 ILE A CA    1 
ATOM   3153  C  C     . ILE A  1 401 ? 101.179 111.144 94.344  1.00 20.76 ? 401 ILE A C     1 
ATOM   3154  O  O     . ILE A  1 401 ? 101.790 110.944 93.292  1.00 20.76 ? 401 ILE A O     1 
ATOM   3155  C  CB    . ILE A  1 401 ? 102.010 110.065 96.501  1.00 20.76 ? 401 ILE A CB    1 
ATOM   3156  C  CG1   . ILE A  1 401 ? 103.178 110.164 97.481  1.00 20.76 ? 401 ILE A CG1   1 
ATOM   3157  C  CG2   . ILE A  1 401 ? 102.151 108.805 95.664  1.00 20.76 ? 401 ILE A CG2   1 
ATOM   3158  C  CD1   . ILE A  1 401 ? 103.162 109.156 98.582  1.00 20.76 ? 401 ILE A CD1   1 
ATOM   3159  N  N     . LEU A  1 402 ? 99.849  111.288 94.371  1.00 20.46 ? 402 LEU A N     1 
ATOM   3160  C  CA    . LEU A  1 402 ? 99.067  111.133 93.144  1.00 20.46 ? 402 LEU A CA    1 
ATOM   3161  C  C     . LEU A  1 402 ? 99.376  112.233 92.131  1.00 20.46 ? 402 LEU A C     1 
ATOM   3162  O  O     . LEU A  1 402 ? 99.612  111.943 90.948  1.00 20.46 ? 402 LEU A O     1 
ATOM   3163  C  CB    . LEU A  1 402 ? 97.576  111.112 93.459  1.00 20.46 ? 402 LEU A CB    1 
ATOM   3164  C  CG    . LEU A  1 402 ? 96.705  110.930 92.218  1.00 20.46 ? 402 LEU A CG    1 
ATOM   3165  C  CD1   . LEU A  1 402 ? 97.027  109.618 91.528  1.00 20.46 ? 402 LEU A CD1   1 
ATOM   3166  C  CD2   . LEU A  1 402 ? 95.251  110.983 92.593  1.00 20.46 ? 402 LEU A CD2   1 
ATOM   3167  N  N     . LYS A  1 403 ? 99.420  113.493 92.586  1.00 20.23 ? 403 LYS A N     1 
ATOM   3168  C  CA    . LYS A  1 403 ? 99.706  114.610 91.682  1.00 20.23 ? 403 LYS A CA    1 
ATOM   3169  C  C     . LYS A  1 403 ? 101.109 114.510 91.086  1.00 20.23 ? 403 LYS A C     1 
ATOM   3170  O  O     . LYS A  1 403 ? 101.290 114.616 89.861  1.00 20.23 ? 403 LYS A O     1 
ATOM   3171  C  CB    . LYS A  1 403 ? 99.545  115.938 92.418  1.00 20.23 ? 403 LYS A CB    1 
ATOM   3172  C  CG    . LYS A  1 403 ? 98.124  116.303 92.788  1.00 20.23 ? 403 LYS A CG    1 
ATOM   3173  C  CD    . LYS A  1 403 ? 98.098  117.603 93.572  1.00 20.23 ? 403 LYS A CD    1 
ATOM   3174  C  CE    . LYS A  1 403 ? 96.685  118.013 93.934  1.00 20.23 ? 403 LYS A CE    1 
ATOM   3175  N  NZ    . LYS A  1 403 ? 96.018  117.008 94.799  1.00 20.23 ? 403 LYS A NZ    1 
ATOM   3176  N  N     . VAL A  1 404 ? 102.110 114.268 91.940  1.00 18.07 ? 404 VAL A N     1 
ATOM   3177  C  CA    . VAL A  1 404 ? 103.493 114.227 91.481  1.00 18.07 ? 404 VAL A CA    1 
ATOM   3178  C  C     . VAL A  1 404 ? 103.746 112.994 90.617  1.00 18.07 ? 404 VAL A C     1 
ATOM   3179  O  O     . VAL A  1 404 ? 104.465 113.078 89.616  1.00 18.07 ? 404 VAL A O     1 
ATOM   3180  C  CB    . VAL A  1 404 ? 104.435 114.311 92.698  1.00 18.07 ? 404 VAL A CB    1 
ATOM   3181  C  CG1   . VAL A  1 404 ? 105.873 114.098 92.307  1.00 18.07 ? 404 VAL A CG1   1 
ATOM   3182  C  CG2   . VAL A  1 404 ? 104.303 115.667 93.355  1.00 18.07 ? 404 VAL A CG2   1 
ATOM   3183  N  N     . LEU A  1 405 ? 103.097 111.864 90.920  1.00 17.34 ? 405 LEU A N     1 
ATOM   3184  C  CA    . LEU A  1 405 ? 103.280 110.660 90.119  1.00 17.34 ? 405 LEU A CA    1 
ATOM   3185  C  C     . LEU A  1 405 ? 102.666 110.808 88.737  1.00 17.34 ? 405 LEU A C     1 
ATOM   3186  O  O     . LEU A  1 405 ? 103.288 110.412 87.744  1.00 17.34 ? 405 LEU A O     1 
ATOM   3187  C  CB    . LEU A  1 405 ? 102.674 109.454 90.830  1.00 17.34 ? 405 LEU A CB    1 
ATOM   3188  C  CG    . LEU A  1 405 ? 103.574 108.667 91.776  1.00 17.34 ? 405 LEU A CG    1 
ATOM   3189  C  CD1   . LEU A  1 405 ? 102.919 107.355 92.146  1.00 17.34 ? 405 LEU A CD1   1 
ATOM   3190  C  CD2   . LEU A  1 405 ? 104.915 108.440 91.151  1.00 17.34 ? 405 LEU A CD2   1 
ATOM   3191  N  N     . VAL A  1 406 ? 101.470 111.403 88.648  1.00 19.75 ? 406 VAL A N     1 
ATOM   3192  C  CA    . VAL A  1 406 ? 100.821 111.588 87.351  1.00 19.75 ? 406 VAL A CA    1 
ATOM   3193  C  C     . VAL A  1 406 ? 101.626 112.545 86.477  1.00 19.75 ? 406 VAL A C     1 
ATOM   3194  O  O     . VAL A  1 406 ? 101.931 112.234 85.313  1.00 19.75 ? 406 VAL A O     1 
ATOM   3195  C  CB    . VAL A  1 406 ? 99.372  112.068 87.544  1.00 19.75 ? 406 VAL A CB    1 
ATOM   3196  C  CG1   . VAL A  1 406 ? 98.835  112.711 86.282  1.00 19.75 ? 406 VAL A CG1   1 
ATOM   3197  C  CG2   . VAL A  1 406 ? 98.495  110.904 87.948  1.00 19.75 ? 406 VAL A CG2   1 
ATOM   3198  N  N     . PHE A  1 407 ? 102.042 113.689 87.039  1.00 20.37 ? 407 PHE A N     1 
ATOM   3199  C  CA    . PHE A  1 407 ? 102.798 114.633 86.218  1.00 20.37 ? 407 PHE A CA    1 
ATOM   3200  C  C     . PHE A  1 407 ? 104.193 114.125 85.883  1.00 20.37 ? 407 PHE A C     1 
ATOM   3201  O  O     . PHE A  1 407 ? 104.678 114.385 84.782  1.00 20.37 ? 407 PHE A O     1 
ATOM   3202  C  CB    . PHE A  1 407 ? 102.911 115.992 86.891  1.00 20.37 ? 407 PHE A CB    1 
ATOM   3203  C  CG    . PHE A  1 407 ? 103.667 117.009 86.075  1.00 20.37 ? 407 PHE A CG    1 
ATOM   3204  C  CD1   . PHE A  1 407 ? 103.072 117.617 84.986  1.00 20.37 ? 407 PHE A CD1   1 
ATOM   3205  C  CD2   . PHE A  1 407 ? 104.971 117.352 86.393  1.00 20.37 ? 407 PHE A CD2   1 
ATOM   3206  C  CE1   . PHE A  1 407 ? 103.758 118.547 84.231  1.00 20.37 ? 407 PHE A CE1   1 
ATOM   3207  C  CE2   . PHE A  1 407 ? 105.662 118.276 85.637  1.00 20.37 ? 407 PHE A CE2   1 
ATOM   3208  C  CZ    . PHE A  1 407 ? 105.053 118.876 84.560  1.00 20.37 ? 407 PHE A CZ    1 
ATOM   3209  N  N     . ASN A  1 408 ? 104.850 113.394 86.786  1.00 19.59 ? 408 ASN A N     1 
ATOM   3210  C  CA    . ASN A  1 408 ? 106.200 112.942 86.482  1.00 19.59 ? 408 ASN A CA    1 
ATOM   3211  C  C     . ASN A  1 408 ? 106.190 111.795 85.487  1.00 19.59 ? 408 ASN A C     1 
ATOM   3212  O  O     . ASN A  1 408 ? 107.068 111.729 84.620  1.00 19.59 ? 408 ASN A O     1 
ATOM   3213  C  CB    . ASN A  1 408 ? 106.932 112.549 87.757  1.00 19.59 ? 408 ASN A CB    1 
ATOM   3214  C  CG    . ASN A  1 408 ? 107.495 113.743 88.476  1.00 19.59 ? 408 ASN A CG    1 
ATOM   3215  O  OD1   . ASN A  1 408 ? 107.524 114.844 87.935  1.00 19.59 ? 408 ASN A OD1   1 
ATOM   3216  N  ND2   . ASN A  1 408 ? 107.967 113.535 89.688  1.00 19.59 ? 408 ASN A ND2   1 
ATOM   3217  N  N     . PHE A  1 409 ? 105.184 110.912 85.565  1.00 20.59 ? 409 PHE A N     1 
ATOM   3218  C  CA    . PHE A  1 409 ? 105.007 109.886 84.543  1.00 20.59 ? 409 PHE A CA    1 
ATOM   3219  C  C     . PHE A  1 409 ? 104.775 110.509 83.175  1.00 20.59 ? 409 PHE A C     1 
ATOM   3220  O  O     . PHE A  1 409 ? 105.447 110.138 82.202  1.00 20.59 ? 409 PHE A O     1 
ATOM   3221  C  CB    . PHE A  1 409 ? 103.846 108.964 84.919  1.00 20.59 ? 409 PHE A CB    1 
ATOM   3222  C  CG    . PHE A  1 409 ? 103.644 107.813 83.969  1.00 20.59 ? 409 PHE A CG    1 
ATOM   3223  C  CD1   . PHE A  1 409 ? 104.349 106.638 84.131  1.00 20.59 ? 409 PHE A CD1   1 
ATOM   3224  C  CD2   . PHE A  1 409 ? 102.727 107.897 82.932  1.00 20.59 ? 409 PHE A CD2   1 
ATOM   3225  C  CE1   . PHE A  1 409 ? 104.163 105.581 83.263  1.00 20.59 ? 409 PHE A CE1   1 
ATOM   3226  C  CE2   . PHE A  1 409 ? 102.542 106.845 82.062  1.00 20.59 ? 409 PHE A CE2   1 
ATOM   3227  C  CZ    . PHE A  1 409 ? 103.257 105.686 82.231  1.00 20.59 ? 409 PHE A CZ    1 
ATOM   3228  N  N     . LEU A  1 410 ? 103.860 111.485 83.087  1.00 21.90 ? 410 LEU A N     1 
ATOM   3229  C  CA    . LEU A  1 410 ? 103.575 112.097 81.791  1.00 21.90 ? 410 LEU A CA    1 
ATOM   3230  C  C     . LEU A  1 410 ? 104.772 112.879 81.264  1.00 21.90 ? 410 LEU A C     1 
ATOM   3231  O  O     . LEU A  1 410 ? 105.176 112.695 80.111  1.00 21.90 ? 410 LEU A O     1 
ATOM   3232  C  CB    . LEU A  1 410 ? 102.354 113.004 81.875  1.00 21.90 ? 410 LEU A CB    1 
ATOM   3233  C  CG    . LEU A  1 410 ? 101.856 113.318 80.466  1.00 21.90 ? 410 LEU A CG    1 
ATOM   3234  C  CD1   . LEU A  1 410 ? 100.845 112.277 80.022  1.00 21.90 ? 410 LEU A CD1   1 
ATOM   3235  C  CD2   . LEU A  1 410 ? 101.289 114.715 80.355  1.00 21.90 ? 410 LEU A CD2   1 
ATOM   3236  N  N     . ASN A  1 411 ? 105.395 113.699 82.110  1.00 22.43 ? 411 ASN A N     1 
ATOM   3237  C  CA    . ASN A  1 411 ? 106.495 114.549 81.684  1.00 22.43 ? 411 ASN A CA    1 
ATOM   3238  C  C     . ASN A  1 411 ? 107.760 113.764 81.370  1.00 22.43 ? 411 ASN A C     1 
ATOM   3239  O  O     . ASN A  1 411 ? 108.578 114.228 80.571  1.00 22.43 ? 411 ASN A O     1 
ATOM   3240  C  CB    . ASN A  1 411 ? 106.787 115.590 82.760  1.00 22.43 ? 411 ASN A CB    1 
ATOM   3241  C  CG    . ASN A  1 411 ? 107.541 116.777 82.226  1.00 22.43 ? 411 ASN A CG    1 
ATOM   3242  O  OD1   . ASN A  1 411 ? 107.497 117.068 81.034  1.00 22.43 ? 411 ASN A OD1   1 
ATOM   3243  N  ND2   . ASN A  1 411 ? 108.237 117.479 83.109  1.00 22.43 ? 411 ASN A ND2   1 
ATOM   3244  N  N     . CYS A  1 412 ? 107.946 112.583 81.962  1.00 21.87 ? 412 CYS A N     1 
ATOM   3245  C  CA    . CYS A  1 412 ? 109.137 111.814 81.630  1.00 21.87 ? 412 CYS A CA    1 
ATOM   3246  C  C     . CYS A  1 412 ? 108.920 110.908 80.425  1.00 21.87 ? 412 CYS A C     1 
ATOM   3247  O  O     . CYS A  1 412 ? 109.825 110.766 79.597  1.00 21.87 ? 412 CYS A O     1 
ATOM   3248  C  CB    . CYS A  1 412 ? 109.600 111.000 82.837  1.00 21.87 ? 412 CYS A CB    1 
ATOM   3249  S  SG    . CYS A  1 412 ? 110.282 111.989 84.184  1.00 21.87 ? 412 CYS A SG    1 
ATOM   3250  N  N     . PHE A  1 413 ? 107.746 110.286 80.289  1.00 21.70 ? 413 PHE A N     1 
ATOM   3251  C  CA    . PHE A  1 413 ? 107.567 109.284 79.248  1.00 21.70 ? 413 PHE A CA    1 
ATOM   3252  C  C     . PHE A  1 413 ? 106.707 109.752 78.079  1.00 21.70 ? 413 PHE A C     1 
ATOM   3253  O  O     . PHE A  1 413 ? 106.420 108.945 77.188  1.00 21.70 ? 413 PHE A O     1 
ATOM   3254  C  CB    . PHE A  1 413 ? 106.981 108.008 79.848  1.00 21.70 ? 413 PHE A CB    1 
ATOM   3255  C  CG    . PHE A  1 413 ? 107.753 107.487 81.020  1.00 21.70 ? 413 PHE A CG    1 
ATOM   3256  C  CD1   . PHE A  1 413 ? 109.032 106.996 80.858  1.00 21.70 ? 413 PHE A CD1   1 
ATOM   3257  C  CD2   . PHE A  1 413 ? 107.199 107.489 82.285  1.00 21.70 ? 413 PHE A CD2   1 
ATOM   3258  C  CE1   . PHE A  1 413 ? 109.740 106.519 81.938  1.00 21.70 ? 413 PHE A CE1   1 
ATOM   3259  C  CE2   . PHE A  1 413 ? 107.904 107.016 83.367  1.00 21.70 ? 413 PHE A CE2   1 
ATOM   3260  C  CZ    . PHE A  1 413 ? 109.174 106.533 83.192  1.00 21.70 ? 413 PHE A CZ    1 
ATOM   3261  N  N     . ALA A  1 414 ? 106.327 111.034 78.026  1.00 23.54 ? 414 ALA A N     1 
ATOM   3262  C  CA    . ALA A  1 414 ? 105.483 111.497 76.930  1.00 23.54 ? 414 ALA A CA    1 
ATOM   3263  C  C     . ALA A  1 414 ? 106.243 111.541 75.613  1.00 23.54 ? 414 ALA A C     1 
ATOM   3264  O  O     . ALA A  1 414 ? 105.701 111.156 74.571  1.00 23.54 ? 414 ALA A O     1 
ATOM   3265  C  CB    . ALA A  1 414 ? 104.907 112.871 77.261  1.00 23.54 ? 414 ALA A CB    1 
ATOM   3266  N  N     . SER A  1 415 ? 107.500 111.990 75.639  1.00 25.41 ? 415 SER A N     1 
ATOM   3267  C  CA    . SER A  1 415 ? 108.289 112.038 74.413  1.00 25.41 ? 415 SER A CA    1 
ATOM   3268  C  C     . SER A  1 415 ? 108.623 110.644 73.905  1.00 25.41 ? 415 SER A C     1 
ATOM   3269  O  O     . SER A  1 415 ? 108.611 110.409 72.692  1.00 25.41 ? 415 SER A O     1 
ATOM   3270  C  CB    . SER A  1 415 ? 109.571 112.830 74.640  1.00 25.41 ? 415 SER A CB    1 
ATOM   3271  O  OG    . SER A  1 415 ? 110.599 111.987 75.123  1.00 25.41 ? 415 SER A OG    1 
ATOM   3272  N  N     . LEU A  1 416 ? 108.877 109.701 74.812  1.00 24.37 ? 416 LEU A N     1 
ATOM   3273  C  CA    . LEU A  1 416 ? 109.150 108.334 74.389  1.00 24.37 ? 416 LEU A CA    1 
ATOM   3274  C  C     . LEU A  1 416 ? 107.897 107.644 73.868  1.00 24.37 ? 416 LEU A C     1 
ATOM   3275  O  O     . LEU A  1 416 ? 107.982 106.853 72.923  1.00 24.37 ? 416 LEU A O     1 
ATOM   3276  C  CB    . LEU A  1 416 ? 109.763 107.548 75.540  1.00 24.37 ? 416 LEU A CB    1 
ATOM   3277  C  CG    . LEU A  1 416 ? 110.982 108.226 76.157  1.00 24.37 ? 416 LEU A CG    1 
ATOM   3278  C  CD1   . LEU A  1 416 ? 111.473 107.445 77.350  1.00 24.37 ? 416 LEU A CD1   1 
ATOM   3279  C  CD2   . LEU A  1 416 ? 112.078 108.366 75.124  1.00 24.37 ? 416 LEU A CD2   1 
ATOM   3280  N  N     . PHE A  1 417 ? 106.726 107.955 74.433  1.00 25.91 ? 417 PHE A N     1 
ATOM   3281  C  CA    . PHE A  1 417 ? 105.488 107.408 73.888  1.00 25.91 ? 417 PHE A CA    1 
ATOM   3282  C  C     . PHE A  1 417 ? 105.172 108.007 72.524  1.00 25.91 ? 417 PHE A C     1 
ATOM   3283  O  O     . PHE A  1 417 ? 104.679 107.304 71.633  1.00 25.91 ? 417 PHE A O     1 
ATOM   3284  C  CB    . PHE A  1 417 ? 104.335 107.648 74.857  1.00 25.91 ? 417 PHE A CB    1 
ATOM   3285  C  CG    . PHE A  1 417 ? 104.287 106.674 75.997  1.00 25.91 ? 417 PHE A CG    1 
ATOM   3286  C  CD1   . PHE A  1 417 ? 104.864 105.422 75.881  1.00 25.91 ? 417 PHE A CD1   1 
ATOM   3287  C  CD2   . PHE A  1 417 ? 103.666 107.013 77.186  1.00 25.91 ? 417 PHE A CD2   1 
ATOM   3288  C  CE1   . PHE A  1 417 ? 104.820 104.526 76.927  1.00 25.91 ? 417 PHE A CE1   1 
ATOM   3289  C  CE2   . PHE A  1 417 ? 103.620 106.121 78.236  1.00 25.91 ? 417 PHE A CE2   1 
ATOM   3290  C  CZ    . PHE A  1 417 ? 104.197 104.877 78.105  1.00 25.91 ? 417 PHE A CZ    1 
ATOM   3291  N  N     . TYR A  1 418 ? 105.467 109.297 72.336  1.00 28.30 ? 418 TYR A N     1 
ATOM   3292  C  CA    . TYR A  1 418 ? 105.251 109.923 71.036  1.00 28.30 ? 418 TYR A CA    1 
ATOM   3293  C  C     . TYR A  1 418 ? 106.224 109.401 69.988  1.00 28.30 ? 418 TYR A C     1 
ATOM   3294  O  O     . TYR A  1 418 ? 105.877 109.344 68.805  1.00 28.30 ? 418 TYR A O     1 
ATOM   3295  C  CB    . TYR A  1 418 ? 105.370 111.442 71.149  1.00 28.30 ? 418 TYR A CB    1 
ATOM   3296  C  CG    . TYR A  1 418 ? 104.960 112.184 69.896  1.00 28.30 ? 418 TYR A CG    1 
ATOM   3297  C  CD1   . TYR A  1 418 ? 103.625 112.457 69.635  1.00 28.30 ? 418 TYR A CD1   1 
ATOM   3298  C  CD2   . TYR A  1 418 ? 105.909 112.614 68.975  1.00 28.30 ? 418 TYR A CD2   1 
ATOM   3299  C  CE1   . TYR A  1 418 ? 103.246 113.136 68.492  1.00 28.30 ? 418 TYR A CE1   1 
ATOM   3300  C  CE2   . TYR A  1 418 ? 105.541 113.290 67.831  1.00 28.30 ? 418 TYR A CE2   1 
ATOM   3301  C  CZ    . TYR A  1 418 ? 104.210 113.548 67.594  1.00 28.30 ? 418 TYR A CZ    1 
ATOM   3302  O  OH    . TYR A  1 418 ? 103.844 114.224 66.455  1.00 28.30 ? 418 TYR A OH    1 
ATOM   3303  N  N     . ILE A  1 419 ? 107.443 109.035 70.384  1.00 27.12 ? 419 ILE A N     1 
ATOM   3304  C  CA    . ILE A  1 419 ? 108.356 108.437 69.417  1.00 27.12 ? 419 ILE A CA    1 
ATOM   3305  C  C     . ILE A  1 419 ? 107.923 107.013 69.089  1.00 27.12 ? 419 ILE A C     1 
ATOM   3306  O  O     . ILE A  1 419 ? 107.882 106.616 67.918  1.00 27.12 ? 419 ILE A O     1 
ATOM   3307  C  CB    . ILE A  1 419 ? 109.803 108.487 69.936  1.00 27.12 ? 419 ILE A CB    1 
ATOM   3308  C  CG1   . ILE A  1 419 ? 110.318 109.918 69.931  1.00 27.12 ? 419 ILE A CG1   1 
ATOM   3309  C  CG2   . ILE A  1 419 ? 110.714 107.685 69.051  1.00 27.12 ? 419 ILE A CG2   1 
ATOM   3310  C  CD1   . ILE A  1 419 ? 111.646 110.088 70.619  1.00 27.12 ? 419 ILE A CD1   1 
ATOM   3311  N  N     . ALA A  1 420 ? 107.545 106.237 70.107  1.00 29.47 ? 420 ALA A N     1 
ATOM   3312  C  CA    . ALA A  1 420 ? 107.285 104.819 69.903  1.00 29.47 ? 420 ALA A CA    1 
ATOM   3313  C  C     . ALA A  1 420 ? 105.964 104.545 69.196  1.00 29.47 ? 420 ALA A C     1 
ATOM   3314  O  O     . ALA A  1 420 ? 105.887 103.602 68.403  1.00 29.47 ? 420 ALA A O     1 
ATOM   3315  C  CB    . ALA A  1 420 ? 107.308 104.087 71.243  1.00 29.47 ? 420 ALA A CB    1 
ATOM   3316  N  N     . PHE A  1 421 ? 104.921 105.333 69.454  1.00 31.29 ? 421 PHE A N     1 
ATOM   3317  C  CA    . PHE A  1 421 ? 103.593 104.982 68.971  1.00 31.29 ? 421 PHE A CA    1 
ATOM   3318  C  C     . PHE A  1 421 ? 103.016 105.959 67.956  1.00 31.29 ? 421 PHE A C     1 
ATOM   3319  O  O     . PHE A  1 421 ? 101.913 105.722 67.458  1.00 31.29 ? 421 PHE A O     1 
ATOM   3320  C  CB    . PHE A  1 421 ? 102.631 104.838 70.152  1.00 31.29 ? 421 PHE A CB    1 
ATOM   3321  C  CG    . PHE A  1 421 ? 103.084 103.840 71.169  1.00 31.29 ? 421 PHE A CG    1 
ATOM   3322  C  CD1   . PHE A  1 421 ? 103.484 102.576 70.779  1.00 31.29 ? 421 PHE A CD1   1 
ATOM   3323  C  CD2   . PHE A  1 421 ? 103.117 104.165 72.513  1.00 31.29 ? 421 PHE A CD2   1 
ATOM   3324  C  CE1   . PHE A  1 421 ? 103.908 101.652 71.709  1.00 31.29 ? 421 PHE A CE1   1 
ATOM   3325  C  CE2   . PHE A  1 421 ? 103.539 103.243 73.448  1.00 31.29 ? 421 PHE A CE2   1 
ATOM   3326  C  CZ    . PHE A  1 421 ? 103.935 101.987 73.045  1.00 31.29 ? 421 PHE A CZ    1 
ATOM   3327  N  N     . VAL A  1 422 ? 103.716 107.042 67.630  1.00 31.47 ? 422 VAL A N     1 
ATOM   3328  C  CA    . VAL A  1 422 ? 103.278 107.981 66.605  1.00 31.47 ? 422 VAL A CA    1 
ATOM   3329  C  C     . VAL A  1 422 ? 104.290 108.077 65.470  1.00 31.47 ? 422 VAL A C     1 
ATOM   3330  O  O     . VAL A  1 422 ? 103.950 107.866 64.302  1.00 31.47 ? 422 VAL A O     1 
ATOM   3331  C  CB    . VAL A  1 422 ? 102.989 109.374 67.203  1.00 31.47 ? 422 VAL A CB    1 
ATOM   3332  C  CG1   . VAL A  1 422 ? 102.784 110.395 66.102  1.00 31.47 ? 422 VAL A CG1   1 
ATOM   3333  C  CG2   . VAL A  1 422 ? 101.773 109.314 68.104  1.00 31.47 ? 422 VAL A CG2   1 
ATOM   3334  N  N     . LEU A  1 423 ? 105.547 108.385 65.795  1.00 31.96 ? 423 LEU A N     1 
ATOM   3335  C  CA    . LEU A  1 423 ? 106.576 108.424 64.762  1.00 31.96 ? 423 LEU A CA    1 
ATOM   3336  C  C     . LEU A  1 423 ? 106.973 107.025 64.310  1.00 31.96 ? 423 LEU A C     1 
ATOM   3337  O  O     . LEU A  1 423 ? 107.227 106.819 63.116  1.00 31.96 ? 423 LEU A O     1 
ATOM   3338  C  CB    . LEU A  1 423 ? 107.805 109.182 65.263  1.00 31.96 ? 423 LEU A CB    1 
ATOM   3339  C  CG    . LEU A  1 423 ? 107.639 110.635 65.712  1.00 31.96 ? 423 LEU A CG    1 
ATOM   3340  C  CD1   . LEU A  1 423 ? 108.994 111.306 65.815  1.00 31.96 ? 423 LEU A CD1   1 
ATOM   3341  C  CD2   . LEU A  1 423 ? 106.740 111.409 64.766  1.00 31.96 ? 423 LEU A CD2   1 
ATOM   3342  N  N     . LYS A  1 424 ? 107.011 106.068 65.243  1.00 37.11 ? 424 LYS A N     1 
ATOM   3343  C  CA    . LYS A  1 424 ? 107.406 104.669 65.031  1.00 37.11 ? 424 LYS A CA    1 
ATOM   3344  C  C     . LYS A  1 424 ? 108.798 104.572 64.399  1.00 37.11 ? 424 LYS A C     1 
ATOM   3345  O  O     . LYS A  1 424 ? 108.988 104.038 63.308  1.00 37.11 ? 424 LYS A O     1 
ATOM   3346  C  CB    . LYS A  1 424 ? 106.370 103.911 64.192  1.00 37.11 ? 424 LYS A CB    1 
ATOM   3347  C  CG    . LYS A  1 424 ? 104.927 104.132 64.604  1.00 37.11 ? 424 LYS A CG    1 
ATOM   3348  C  CD    . LYS A  1 424 ? 104.021 103.096 63.961  1.00 37.11 ? 424 LYS A CD    1 
ATOM   3349  C  CE    . LYS A  1 424 ? 102.556 103.451 64.133  1.00 37.11 ? 424 LYS A CE    1 
ATOM   3350  N  NZ    . LYS A  1 424 ? 102.209 104.709 63.421  1.00 37.11 ? 424 LYS A NZ    1 
ATOM   3351  N  N     . ASP A  1 425 ? 109.776 105.113 65.129  1.00 38.76 ? 425 ASP A N     1 
ATOM   3352  C  CA    . ASP A  1 425 ? 111.164 105.167 64.662  1.00 38.76 ? 425 ASP A CA    1 
ATOM   3353  C  C     . ASP A  1 425 ? 112.031 104.682 65.823  1.00 38.76 ? 425 ASP A C     1 
ATOM   3354  O  O     . ASP A  1 425 ? 112.278 105.424 66.777  1.00 38.76 ? 425 ASP A O     1 
ATOM   3355  C  CB    . ASP A  1 425 ? 111.538 106.573 64.207  1.00 38.76 ? 425 ASP A CB    1 
ATOM   3356  C  CG    . ASP A  1 425 ? 112.934 106.649 63.623  1.00 38.76 ? 425 ASP A CG    1 
ATOM   3357  O  OD1   . ASP A  1 425 ? 113.056 106.634 62.380  1.00 38.76 ? 425 ASP A OD1   1 
ATOM   3358  O  OD2   . ASP A  1 425 ? 113.908 106.721 64.396  1.00 38.76 ? 425 ASP A OD2   1 
ATOM   3359  N  N     . MET A  1 426 ? 112.493 103.431 65.731  1.00 38.13 ? 426 MET A N     1 
ATOM   3360  C  CA    . MET A  1 426 ? 113.132 102.789 66.876  1.00 38.13 ? 426 MET A CA    1 
ATOM   3361  C  C     . MET A  1 426 ? 114.548 103.298 67.118  1.00 38.13 ? 426 MET A C     1 
ATOM   3362  O  O     . MET A  1 426 ? 115.044 103.205 68.245  1.00 38.13 ? 426 MET A O     1 
ATOM   3363  C  CB    . MET A  1 426 ? 113.148 101.274 66.689  1.00 38.13 ? 426 MET A CB    1 
ATOM   3364  C  CG    . MET A  1 426 ? 111.768 100.647 66.662  1.00 38.13 ? 426 MET A CG    1 
ATOM   3365  S  SD    . MET A  1 426 ? 110.725 101.217 68.014  1.00 38.13 ? 426 MET A SD    1 
ATOM   3366  C  CE    . MET A  1 426 ? 109.210 100.335 67.662  1.00 38.13 ? 426 MET A CE    1 
ATOM   3367  N  N     . LYS A  1 427 ? 115.213 103.829 66.089  1.00 37.56 ? 427 LYS A N     1 
ATOM   3368  C  CA    . LYS A  1 427 ? 116.559 104.366 66.281  1.00 37.56 ? 427 LYS A CA    1 
ATOM   3369  C  C     . LYS A  1 427 ? 116.527 105.638 67.120  1.00 37.56 ? 427 LYS A C     1 
ATOM   3370  O  O     . LYS A  1 427 ? 117.317 105.793 68.065  1.00 37.56 ? 427 LYS A O     1 
ATOM   3371  C  CB    . LYS A  1 427 ? 117.213 104.627 64.924  1.00 37.56 ? 427 LYS A CB    1 
ATOM   3372  C  CG    . LYS A  1 427 ? 118.622 105.188 64.998  1.00 37.56 ? 427 LYS A CG    1 
ATOM   3373  C  CD    . LYS A  1 427 ? 119.306 105.136 63.640  1.00 37.56 ? 427 LYS A CD    1 
ATOM   3374  C  CE    . LYS A  1 427 ? 120.797 105.408 63.763  1.00 37.56 ? 427 LYS A CE    1 
ATOM   3375  N  NZ    . LYS A  1 427 ? 121.571 104.879 62.604  1.00 37.56 ? 427 LYS A NZ    1 
ATOM   3376  N  N     . LEU A  1 428 ? 115.600 106.548 66.803  1.00 36.05 ? 428 LEU A N     1 
ATOM   3377  C  CA    . LEU A  1 428 ? 115.395 107.734 67.625  1.00 36.05 ? 428 LEU A CA    1 
ATOM   3378  C  C     . LEU A  1 428 ? 114.873 107.372 69.008  1.00 36.05 ? 428 LEU A C     1 
ATOM   3379  O  O     . LEU A  1 428 ? 115.190 108.061 69.979  1.00 36.05 ? 428 LEU A O     1 
ATOM   3380  C  CB    . LEU A  1 428 ? 114.436 108.700 66.926  1.00 36.05 ? 428 LEU A CB    1 
ATOM   3381  C  CG    . LEU A  1 428 ? 114.106 110.033 67.594  1.00 36.05 ? 428 LEU A CG    1 
ATOM   3382  C  CD1   . LEU A  1 428 ? 115.366 110.837 67.859  1.00 36.05 ? 428 LEU A CD1   1 
ATOM   3383  C  CD2   . LEU A  1 428 ? 113.127 110.828 66.752  1.00 36.05 ? 428 LEU A CD2   1 
ATOM   3384  N  N     . LEU A  1 429 ? 114.113 106.278 69.125  1.00 30.75 ? 429 LEU A N     1 
ATOM   3385  C  CA    . LEU A  1 429 ? 113.647 105.838 70.437  1.00 30.75 ? 429 LEU A CA    1 
ATOM   3386  C  C     . LEU A  1 429 ? 114.800 105.350 71.299  1.00 30.75 ? 429 LEU A C     1 
ATOM   3387  O  O     . LEU A  1 429 ? 114.869 105.688 72.485  1.00 30.75 ? 429 LEU A O     1 
ATOM   3388  C  CB    . LEU A  1 429 ? 112.595 104.742 70.291  1.00 30.75 ? 429 LEU A CB    1 
ATOM   3389  C  CG    . LEU A  1 429 ? 112.017 104.172 71.587  1.00 30.75 ? 429 LEU A CG    1 
ATOM   3390  C  CD1   . LEU A  1 429 ? 111.453 105.271 72.460  1.00 30.75 ? 429 LEU A CD1   1 
ATOM   3391  C  CD2   . LEU A  1 429 ? 110.941 103.165 71.267  1.00 30.75 ? 429 LEU A CD2   1 
ATOM   3392  N  N     . ARG A  1 430 ? 115.727 104.584 70.713  1.00 34.27 ? 430 ARG A N     1 
ATOM   3393  C  CA    . ARG A  1 430 ? 116.908 104.138 71.448  1.00 34.27 ? 430 ARG A CA    1 
ATOM   3394  C  C     . ARG A  1 430 ? 117.778 105.314 71.868  1.00 34.27 ? 430 ARG A C     1 
ATOM   3395  O  O     . ARG A  1 430 ? 118.196 105.398 73.032  1.00 34.27 ? 430 ARG A O     1 
ATOM   3396  C  CB    . ARG A  1 430 ? 117.722 103.163 70.601  1.00 34.27 ? 430 ARG A CB    1 
ATOM   3397  C  CG    . ARG A  1 430 ? 117.098 101.797 70.413  1.00 34.27 ? 430 ARG A CG    1 
ATOM   3398  C  CD    . ARG A  1 430 ? 118.005 100.912 69.577  1.00 34.27 ? 430 ARG A CD    1 
ATOM   3399  N  NE    . ARG A  1 430 ? 117.252 100.070 68.656  1.00 34.27 ? 430 ARG A NE    1 
ATOM   3400  C  CZ    . ARG A  1 430 ? 116.923 98.807  68.899  1.00 34.27 ? 430 ARG A CZ    1 
ATOM   3401  N  NH1   . ARG A  1 430 ? 117.285 98.235  70.037  1.00 34.27 ? 430 ARG A NH1   1 
ATOM   3402  N  NH2   . ARG A  1 430 ? 116.233 98.115  68.004  1.00 34.27 ? 430 ARG A NH2   1 
ATOM   3403  N  N     . GLN A  1 431 ? 118.026 106.251 70.941  1.00 36.53 ? 431 GLN A N     1 
ATOM   3404  C  CA    . GLN A  1 431 ? 118.866 107.409 71.247  1.00 36.53 ? 431 GLN A CA    1 
ATOM   3405  C  C     . GLN A  1 431 ? 118.233 108.300 72.310  1.00 36.53 ? 431 GLN A C     1 
ATOM   3406  O  O     . GLN A  1 431 ? 118.903 108.694 73.273  1.00 36.53 ? 431 GLN A O     1 
ATOM   3407  C  CB    . GLN A  1 431 ? 119.135 108.216 69.979  1.00 36.53 ? 431 GLN A CB    1 
ATOM   3408  C  CG    . GLN A  1 431 ? 120.204 107.631 69.077  1.00 36.53 ? 431 GLN A CG    1 
ATOM   3409  C  CD    . GLN A  1 431 ? 120.563 108.560 67.937  1.00 36.53 ? 431 GLN A CD    1 
ATOM   3410  O  OE1   . GLN A  1 431 ? 120.044 109.671 67.842  1.00 36.53 ? 431 GLN A OE1   1 
ATOM   3411  N  NE2   . GLN A  1 431 ? 121.455 108.109 67.063  1.00 36.53 ? 431 GLN A NE2   1 
ATOM   3412  N  N     . SER A  1 432 ? 116.936 108.584 72.178  1.00 29.78 ? 432 SER A N     1 
ATOM   3413  C  CA    . SER A  1 432 ? 116.263 109.472 73.115  1.00 29.78 ? 432 SER A CA    1 
ATOM   3414  C  C     . SER A  1 432 ? 116.098 108.820 74.479  1.00 29.78 ? 432 SER A C     1 
ATOM   3415  O  O     . SER A  1 432 ? 116.247 109.492 75.502  1.00 29.78 ? 432 SER A O     1 
ATOM   3416  C  CB    . SER A  1 432 ? 114.908 109.892 72.553  1.00 29.78 ? 432 SER A CB    1 
ATOM   3417  O  OG    . SER A  1 432 ? 114.230 110.744 73.454  1.00 29.78 ? 432 SER A OG    1 
ATOM   3418  N  N     . LEU A  1 433 ? 115.831 107.510 74.520  1.00 25.95 ? 433 LEU A N     1 
ATOM   3419  C  CA    . LEU A  1 433 ? 115.677 106.825 75.797  1.00 25.95 ? 433 LEU A CA    1 
ATOM   3420  C  C     . LEU A  1 433 ? 116.999 106.742 76.544  1.00 25.95 ? 433 LEU A C     1 
ATOM   3421  O  O     . LEU A  1 433 ? 117.045 107.011 77.752  1.00 25.95 ? 433 LEU A O     1 
ATOM   3422  C  CB    . LEU A  1 433 ? 115.092 105.432 75.572  1.00 25.95 ? 433 LEU A CB    1 
ATOM   3423  C  CG    . LEU A  1 433 ? 115.085 104.446 76.736  1.00 25.95 ? 433 LEU A CG    1 
ATOM   3424  C  CD1   . LEU A  1 433 ? 114.252 104.973 77.879  1.00 25.95 ? 433 LEU A CD1   1 
ATOM   3425  C  CD2   . LEU A  1 433 ? 114.546 103.113 76.272  1.00 25.95 ? 433 LEU A CD2   1 
ATOM   3426  N  N     . ALA A  1 434 ? 118.090 106.417 75.838  1.00 27.85 ? 434 ALA A N     1 
ATOM   3427  C  CA    . ALA A  1 434 ? 119.396 106.359 76.487  1.00 27.85 ? 434 ALA A CA    1 
ATOM   3428  C  C     . ALA A  1 434 ? 119.848 107.736 76.955  1.00 27.85 ? 434 ALA A C     1 
ATOM   3429  O  O     . ALA A  1 434 ? 120.358 107.872 78.075  1.00 27.85 ? 434 ALA A O     1 
ATOM   3430  C  CB    . ALA A  1 434 ? 120.429 105.751 75.541  1.00 27.85 ? 434 ALA A CB    1 
ATOM   3431  N  N     . THR A  1 435 ? 119.619 108.774 76.142  1.00 29.32 ? 435 THR A N     1 
ATOM   3432  C  CA    . THR A  1 435 ? 120.054 110.114 76.521  1.00 29.32 ? 435 THR A CA    1 
ATOM   3433  C  C     . THR A  1 435 ? 119.228 110.662 77.679  1.00 29.32 ? 435 THR A C     1 
ATOM   3434  O  O     . THR A  1 435 ? 119.789 111.243 78.616  1.00 29.32 ? 435 THR A O     1 
ATOM   3435  C  CB    . THR A  1 435 ? 119.984 111.049 75.315  1.00 29.32 ? 435 THR A CB    1 
ATOM   3436  O  OG1   . THR A  1 435 ? 120.768 110.504 74.249  1.00 29.32 ? 435 THR A OG1   1 
ATOM   3437  C  CG2   . THR A  1 435 ? 120.552 112.406 75.668  1.00 29.32 ? 435 THR A CG2   1 
ATOM   3438  N  N     . LEU A  1 436 ? 117.906 110.442 77.659  1.00 26.59 ? 436 LEU A N     1 
ATOM   3439  C  CA    . LEU A  1 436 ? 117.043 110.896 78.745  1.00 26.59 ? 436 LEU A CA    1 
ATOM   3440  C  C     . LEU A  1 436 ? 117.377 110.189 80.051  1.00 26.59 ? 436 LEU A C     1 
ATOM   3441  O  O     . LEU A  1 436 ? 117.516 110.842 81.092  1.00 26.59 ? 436 LEU A O     1 
ATOM   3442  C  CB    . LEU A  1 436 ? 115.574 110.673 78.384  1.00 26.59 ? 436 LEU A CB    1 
ATOM   3443  C  CG    . LEU A  1 436 ? 114.850 111.723 77.540  1.00 26.59 ? 436 LEU A CG    1 
ATOM   3444  C  CD1   . LEU A  1 436 ? 113.358 111.469 77.558  1.00 26.59 ? 436 LEU A CD1   1 
ATOM   3445  C  CD2   . LEU A  1 436 ? 115.149 113.116 78.035  1.00 26.59 ? 436 LEU A CD2   1 
ATOM   3446  N  N     . LEU A  1 437 ? 117.563 108.863 80.005  1.00 24.46 ? 437 LEU A N     1 
ATOM   3447  C  CA    . LEU A  1 437 ? 117.878 108.110 81.214  1.00 24.46 ? 437 LEU A CA    1 
ATOM   3448  C  C     . LEU A  1 437 ? 119.237 108.487 81.792  1.00 24.46 ? 437 LEU A C     1 
ATOM   3449  O  O     . LEU A  1 437 ? 119.336 108.743 82.998  1.00 24.46 ? 437 LEU A O     1 
ATOM   3450  C  CB    . LEU A  1 437 ? 117.823 106.613 80.923  1.00 24.46 ? 437 LEU A CB    1 
ATOM   3451  C  CG    . LEU A  1 437 ? 118.156 105.679 82.083  1.00 24.46 ? 437 LEU A CG    1 
ATOM   3452  C  CD1   . LEU A  1 437 ? 117.239 105.944 83.256  1.00 24.46 ? 437 LEU A CD1   1 
ATOM   3453  C  CD2   . LEU A  1 437 ? 118.036 104.240 81.638  1.00 24.46 ? 437 LEU A CD2   1 
ATOM   3454  N  N     . ILE A  1 438 ? 120.273 108.576 80.957  1.00 24.50 ? 438 ILE A N     1 
ATOM   3455  C  CA    . ILE A  1 438 ? 121.610 108.897 81.449  1.00 24.50 ? 438 ILE A CA    1 
ATOM   3456  C  C     . ILE A  1 438 ? 121.701 110.339 81.941  1.00 24.50 ? 438 ILE A C     1 
ATOM   3457  O  O     . ILE A  1 438 ? 122.247 110.591 83.020  1.00 24.50 ? 438 ILE A O     1 
ATOM   3458  C  CB    . ILE A  1 438 ? 122.643 108.591 80.347  1.00 24.50 ? 438 ILE A CB    1 
ATOM   3459  C  CG1   . ILE A  1 438 ? 122.807 107.080 80.200  1.00 24.50 ? 438 ILE A CG1   1 
ATOM   3460  C  CG2   . ILE A  1 438 ? 123.987 109.227 80.651  1.00 24.50 ? 438 ILE A CG2   1 
ATOM   3461  C  CD1   . ILE A  1 438 ? 123.784 106.670 79.125  1.00 24.50 ? 438 ILE A CD1   1 
ATOM   3462  N  N     . THR A  1 439 ? 121.127 111.299 81.205  1.00 24.24 ? 439 THR A N     1 
ATOM   3463  C  CA    . THR A  1 439 ? 121.229 112.697 81.607  1.00 24.24 ? 439 THR A CA    1 
ATOM   3464  C  C     . THR A  1 439 ? 120.382 112.985 82.841  1.00 24.24 ? 439 THR A C     1 
ATOM   3465  O  O     . THR A  1 439 ? 120.817 113.726 83.733  1.00 24.24 ? 439 THR A O     1 
ATOM   3466  C  CB    . THR A  1 439 ? 120.824 113.600 80.445  1.00 24.24 ? 439 THR A CB    1 
ATOM   3467  O  OG1   . THR A  1 439 ? 121.629 113.283 79.306  1.00 24.24 ? 439 THR A OG1   1 
ATOM   3468  C  CG2   . THR A  1 439 ? 121.057 115.058 80.787  1.00 24.24 ? 439 THR A CG2   1 
ATOM   3469  N  N     . SER A  1 440 ? 119.193 112.374 82.941  1.00 23.50 ? 440 SER A N     1 
ATOM   3470  C  CA    . SER A  1 440 ? 118.372 112.559 84.130  1.00 23.50 ? 440 SER A CA    1 
ATOM   3471  C  C     . SER A  1 440 ? 119.007 111.923 85.357  1.00 23.50 ? 440 SER A C     1 
ATOM   3472  O  O     . SER A  1 440 ? 118.953 112.508 86.441  1.00 23.50 ? 440 SER A O     1 
ATOM   3473  C  CB    . SER A  1 440 ? 116.977 111.987 83.901  1.00 23.50 ? 440 SER A CB    1 
ATOM   3474  O  OG    . SER A  1 440 ? 116.315 111.780 85.134  1.00 23.50 ? 440 SER A OG    1 
ATOM   3475  N  N     . GLN A  1 441 ? 119.662 110.767 85.200  1.00 24.49 ? 441 GLN A N     1 
ATOM   3476  C  CA    . GLN A  1 441 ? 120.328 110.144 86.340  1.00 24.49 ? 441 GLN A CA    1 
ATOM   3477  C  C     . GLN A  1 441 ? 121.558 110.931 86.776  1.00 24.49 ? 441 GLN A C     1 
ATOM   3478  O  O     . GLN A  1 441 ? 121.816 111.066 87.978  1.00 24.49 ? 441 GLN A O     1 
ATOM   3479  C  CB    . GLN A  1 441 ? 120.710 108.710 86.001  1.00 24.49 ? 441 GLN A CB    1 
ATOM   3480  C  CG    . GLN A  1 441 ? 119.597 107.715 86.219  1.00 24.49 ? 441 GLN A CG    1 
ATOM   3481  C  CD    . GLN A  1 441 ? 119.989 106.328 85.779  1.00 24.49 ? 441 GLN A CD    1 
ATOM   3482  O  OE1   . GLN A  1 441 ? 121.065 106.126 85.219  1.00 24.49 ? 441 GLN A OE1   1 
ATOM   3483  N  NE2   . GLN A  1 441 ? 119.125 105.357 86.041  1.00 24.49 ? 441 GLN A NE2   1 
ATOM   3484  N  N     . ILE A  1 442 ? 122.317 111.473 85.820  1.00 23.55 ? 442 ILE A N     1 
ATOM   3485  C  CA    . ILE A  1 442 ? 123.508 112.246 86.161  1.00 23.55 ? 442 ILE A CA    1 
ATOM   3486  C  C     . ILE A  1 442 ? 123.123 113.557 86.840  1.00 23.55 ? 442 ILE A C     1 
ATOM   3487  O  O     . ILE A  1 442 ? 123.715 113.942 87.859  1.00 23.55 ? 442 ILE A O     1 
ATOM   3488  C  CB    . ILE A  1 442 ? 124.364 112.465 84.898  1.00 23.55 ? 442 ILE A CB    1 
ATOM   3489  C  CG1   . ILE A  1 442 ? 125.227 111.232 84.634  1.00 23.55 ? 442 ILE A CG1   1 
ATOM   3490  C  CG2   . ILE A  1 442 ? 125.244 113.701 85.012  1.00 23.55 ? 442 ILE A CG2   1 
ATOM   3491  C  CD1   . ILE A  1 442 ? 126.057 111.321 83.378  1.00 23.55 ? 442 ILE A CD1   1 
ATOM   3492  N  N     . LEU A  1 443 ? 122.091 114.233 86.328  1.00 26.96 ? 443 LEU A N     1 
ATOM   3493  C  CA    . LEU A  1 443 ? 121.651 115.480 86.943  1.00 26.96 ? 443 LEU A CA    1 
ATOM   3494  C  C     . LEU A  1 443 ? 120.980 115.227 88.289  1.00 26.96 ? 443 LEU A C     1 
ATOM   3495  O  O     . LEU A  1 443 ? 121.073 116.062 89.197  1.00 26.96 ? 443 LEU A O     1 
ATOM   3496  C  CB    . LEU A  1 443 ? 120.710 116.220 85.999  1.00 26.96 ? 443 LEU A CB    1 
ATOM   3497  C  CG    . LEU A  1 443 ? 120.660 117.727 86.216  1.00 26.96 ? 443 LEU A CG    1 
ATOM   3498  C  CD1   . LEU A  1 443 ? 121.899 118.362 85.621  1.00 26.96 ? 443 LEU A CD1   1 
ATOM   3499  C  CD2   . LEU A  1 443 ? 119.416 118.308 85.592  1.00 26.96 ? 443 LEU A CD2   1 
ATOM   3500  N  N     . ASN A  1 444 ? 120.332 114.067 88.445  1.00 28.29 ? 444 ASN A N     1 
ATOM   3501  C  CA    . ASN A  1 444 ? 119.795 113.655 89.736  1.00 28.29 ? 444 ASN A CA    1 
ATOM   3502  C  C     . ASN A  1 444 ? 120.906 113.439 90.753  1.00 28.29 ? 444 ASN A C     1 
ATOM   3503  O  O     . ASN A  1 444 ? 120.796 113.911 91.889  1.00 28.29 ? 444 ASN A O     1 
ATOM   3504  C  CB    . ASN A  1 444 ? 118.967 112.380 89.540  1.00 28.29 ? 444 ASN A CB    1 
ATOM   3505  C  CG    . ASN A  1 444 ? 118.037 112.067 90.705  1.00 28.29 ? 444 ASN A CG    1 
ATOM   3506  O  OD1   . ASN A  1 444 ? 118.313 112.374 91.863  1.00 28.29 ? 444 ASN A OD1   1 
ATOM   3507  N  ND2   . ASN A  1 444 ? 116.911 111.446 90.386  1.00 28.29 ? 444 ASN A ND2   1 
ATOM   3508  N  N     . GLN A  1 445 ? 121.983 112.755 90.366  1.00 29.86 ? 445 GLN A N     1 
ATOM   3509  C  CA    . GLN A  1 445 ? 123.073 112.517 91.305  1.00 29.86 ? 445 GLN A CA    1 
ATOM   3510  C  C     . GLN A  1 445 ? 123.874 113.779 91.593  1.00 29.86 ? 445 GLN A C     1 
ATOM   3511  O  O     . GLN A  1 445 ? 124.516 113.868 92.643  1.00 29.86 ? 445 GLN A O     1 
ATOM   3512  C  CB    . GLN A  1 445 ? 124.003 111.426 90.780  1.00 29.86 ? 445 GLN A CB    1 
ATOM   3513  C  CG    . GLN A  1 445 ? 123.392 110.039 90.768  1.00 29.86 ? 445 GLN A CG    1 
ATOM   3514  C  CD    . GLN A  1 445 ? 123.399 109.383 92.130  1.00 29.86 ? 445 GLN A CD    1 
ATOM   3515  O  OE1   . GLN A  1 445 ? 122.590 109.711 92.997  1.00 29.86 ? 445 GLN A OE1   1 
ATOM   3516  N  NE2   . GLN A  1 445 ? 124.320 108.450 92.328  1.00 29.86 ? 445 GLN A NE2   1 
ATOM   3517  N  N     . ILE A  1 446 ? 123.856 114.757 90.689  1.00 30.16 ? 446 ILE A N     1 
ATOM   3518  C  CA    . ILE A  1 446 ? 124.562 116.005 90.961  1.00 30.16 ? 446 ILE A CA    1 
ATOM   3519  C  C     . ILE A  1 446 ? 123.734 116.907 91.871  1.00 30.16 ? 446 ILE A C     1 
ATOM   3520  O  O     . ILE A  1 446 ? 124.220 117.375 92.906  1.00 30.16 ? 446 ILE A O     1 
ATOM   3521  C  CB    . ILE A  1 446 ? 124.947 116.705 89.644  1.00 30.16 ? 446 ILE A CB    1 
ATOM   3522  C  CG1   . ILE A  1 446 ? 126.184 116.037 89.047  1.00 30.16 ? 446 ILE A CG1   1 
ATOM   3523  C  CG2   . ILE A  1 446 ? 125.238 118.179 89.868  1.00 30.16 ? 446 ILE A CG2   1 
ATOM   3524  C  CD1   . ILE A  1 446 ? 126.640 116.642 87.743  1.00 30.16 ? 446 ILE A CD1   1 
ATOM   3525  N  N     . MET A  1 447 ? 122.468 117.151 91.524  1.00 34.02 ? 447 MET A N     1 
ATOM   3526  C  CA    . MET A  1 447 ? 121.640 118.047 92.321  1.00 34.02 ? 447 MET A CA    1 
ATOM   3527  C  C     . MET A  1 447 ? 121.120 117.414 93.604  1.00 34.02 ? 447 MET A C     1 
ATOM   3528  O  O     . MET A  1 447 ? 120.642 118.142 94.479  1.00 34.02 ? 447 MET A O     1 
ATOM   3529  C  CB    . MET A  1 447 ? 120.453 118.548 91.495  1.00 34.02 ? 447 MET A CB    1 
ATOM   3530  C  CG    . MET A  1 447 ? 120.835 119.342 90.262  1.00 34.02 ? 447 MET A CG    1 
ATOM   3531  S  SD    . MET A  1 447 ? 122.293 120.368 90.518  1.00 34.02 ? 447 MET A SD    1 
ATOM   3532  C  CE    . MET A  1 447 ? 122.491 121.088 88.890  1.00 34.02 ? 447 MET A CE    1 
ATOM   3533  N  N     . GLU A  1 448 ? 121.197 116.090 93.745  1.00 31.59 ? 448 GLU A N     1 
ATOM   3534  C  CA    . GLU A  1 448 ? 120.644 115.443 94.929  1.00 31.59 ? 448 GLU A CA    1 
ATOM   3535  C  C     . GLU A  1 448 ? 121.649 115.418 96.073  1.00 31.59 ? 448 GLU A C     1 
ATOM   3536  O  O     . GLU A  1 448 ? 121.333 115.833 97.192  1.00 31.59 ? 448 GLU A O     1 
ATOM   3537  C  CB    . GLU A  1 448 ? 120.186 114.023 94.588  1.00 31.59 ? 448 GLU A CB    1 
ATOM   3538  C  CG    . GLU A  1 448 ? 119.970 113.127 95.802  1.00 31.59 ? 448 GLU A CG    1 
ATOM   3539  C  CD    . GLU A  1 448 ? 119.486 111.733 95.439  1.00 31.59 ? 448 GLU A CD    1 
ATOM   3540  O  OE1   . GLU A  1 448 ? 119.909 111.204 94.392  1.00 31.59 ? 448 GLU A OE1   1 
ATOM   3541  O  OE2   . GLU A  1 448 ? 118.681 111.163 96.204  1.00 31.59 ? 448 GLU A OE2   1 
ATOM   3542  N  N     . SER A  1 449 ? 122.860 114.945 95.815  1.00 35.49 ? 449 SER A N     1 
ATOM   3543  C  CA    . SER A  1 449 ? 123.765 114.707 96.932  1.00 35.49 ? 449 SER A CA    1 
ATOM   3544  C  C     . SER A  1 449 ? 125.125 115.371 96.793  1.00 35.49 ? 449 SER A C     1 
ATOM   3545  O  O     . SER A  1 449 ? 125.663 115.835 97.795  1.00 35.49 ? 449 SER A O     1 
ATOM   3546  C  CB    . SER A  1 449 ? 123.956 113.204 97.128  1.00 35.49 ? 449 SER A CB    1 
ATOM   3547  O  OG    . SER A  1 449 ? 125.007 112.725 96.312  1.00 35.49 ? 449 SER A OG    1 
ATOM   3548  N  N     . PHE A  1 450 ? 125.693 115.434 95.586  1.00 37.89 ? 450 PHE A N     1 
ATOM   3549  C  CA    . PHE A  1 450 ? 127.094 115.831 95.441  1.00 37.89 ? 450 PHE A CA    1 
ATOM   3550  C  C     . PHE A  1 450 ? 127.293 117.332 95.632  1.00 37.89 ? 450 PHE A C     1 
ATOM   3551  O  O     . PHE A  1 450 ? 128.161 117.754 96.406  1.00 37.89 ? 450 PHE A O     1 
ATOM   3552  C  CB    . PHE A  1 450 ? 127.623 115.394 94.077  1.00 37.89 ? 450 PHE A CB    1 
ATOM   3553  C  CG    . PHE A  1 450 ? 127.859 113.919 93.968  1.00 37.89 ? 450 PHE A CG    1 
ATOM   3554  C  CD1   . PHE A  1 450 ? 128.237 113.184 95.079  1.00 37.89 ? 450 PHE A CD1   1 
ATOM   3555  C  CD2   . PHE A  1 450 ? 127.701 113.266 92.758  1.00 37.89 ? 450 PHE A CD2   1 
ATOM   3556  C  CE1   . PHE A  1 450 ? 128.453 111.823 94.984  1.00 37.89 ? 450 PHE A CE1   1 
ATOM   3557  C  CE2   . PHE A  1 450 ? 127.915 111.906 92.656  1.00 37.89 ? 450 PHE A CE2   1 
ATOM   3558  C  CZ    . PHE A  1 450 ? 128.291 111.184 93.771  1.00 37.89 ? 450 PHE A CZ    1 
ATOM   3559  N  N     . LEU A  1 451 ? 126.519 118.148 94.920  1.00 37.51 ? 451 LEU A N     1 
ATOM   3560  C  CA    . LEU A  1 451 ? 126.572 119.592 95.137  1.00 37.51 ? 451 LEU A CA    1 
ATOM   3561  C  C     . LEU A  1 451 ? 126.122 120.033 96.536  1.00 37.51 ? 451 LEU A C     1 
ATOM   3562  O  O     . LEU A  1 451 ? 126.778 120.934 97.094  1.00 37.51 ? 451 LEU A O     1 
ATOM   3563  C  CB    . LEU A  1 451 ? 125.780 120.305 94.029  1.00 37.51 ? 451 LEU A CB    1 
ATOM   3564  C  CG    . LEU A  1 451 ? 125.433 121.784 94.206  1.00 37.51 ? 451 LEU A CG    1 
ATOM   3565  C  CD1   . LEU A  1 451 ? 126.681 122.640 94.118  1.00 37.51 ? 451 LEU A CD1   1 
ATOM   3566  C  CD2   . LEU A  1 451 ? 124.408 122.221 93.176  1.00 37.51 ? 451 LEU A CD2   1 
ATOM   3567  N  N     . PRO A  1 452 ? 125.067 119.472 97.164  1.00 35.91 ? 452 PRO A N     1 
ATOM   3568  C  CA    . PRO A  1 452 ? 124.844 119.806 98.579  1.00 35.91 ? 452 PRO A CA    1 
ATOM   3569  C  C     . PRO A  1 452 ? 125.942 119.322 99.508  1.00 35.91 ? 452 PRO A C     1 
ATOM   3570  O  O     . PRO A  1 452 ? 126.188 119.982 100.521 1.00 35.91 ? 452 PRO A O     1 
ATOM   3571  C  CB    . PRO A  1 452 ? 123.503 119.134 98.892  1.00 35.91 ? 452 PRO A CB    1 
ATOM   3572  C  CG    . PRO A  1 452 ? 122.812 119.124 97.616  1.00 35.91 ? 452 PRO A CG    1 
ATOM   3573  C  CD    . PRO A  1 452 ? 123.876 118.770 96.638  1.00 35.91 ? 452 PRO A CD    1 
ATOM   3574  N  N     . TYR A  1 453 ? 126.634 118.223 99.188  1.00 41.07 ? 453 TYR A N     1 
ATOM   3575  C  CA    . TYR A  1 453 ? 127.771 117.819 100.011 1.00 41.07 ? 453 TYR A CA    1 
ATOM   3576  C  C     . TYR A  1 453 ? 128.934 118.788 99.877  1.00 41.07 ? 453 TYR A C     1 
ATOM   3577  O  O     . TYR A  1 453 ? 129.620 119.065 100.865 1.00 41.07 ? 453 TYR A O     1 
ATOM   3578  C  CB    . TYR A  1 453 ? 128.239 116.413 99.649  1.00 41.07 ? 453 TYR A CB    1 
ATOM   3579  C  CG    . TYR A  1 453 ? 129.539 116.026 100.307 1.00 41.07 ? 453 TYR A CG    1 
ATOM   3580  C  CD1   . TYR A  1 453 ? 129.635 115.920 101.687 1.00 41.07 ? 453 TYR A CD1   1 
ATOM   3581  C  CD2   . TYR A  1 453 ? 130.673 115.782 99.550  1.00 41.07 ? 453 TYR A CD2   1 
ATOM   3582  C  CE1   . TYR A  1 453 ? 130.822 115.573 102.294 1.00 41.07 ? 453 TYR A CE1   1 
ATOM   3583  C  CE2   . TYR A  1 453 ? 131.866 115.433 100.147 1.00 41.07 ? 453 TYR A CE2   1 
ATOM   3584  C  CZ    . TYR A  1 453 ? 131.933 115.330 101.518 1.00 41.07 ? 453 TYR A CZ    1 
ATOM   3585  O  OH    . TYR A  1 453 ? 133.121 114.984 102.115 1.00 41.07 ? 453 TYR A OH    1 
ATOM   3586  N  N     . TRP A  1 454 ? 129.155 119.328 98.677  1.00 46.89 ? 454 TRP A N     1 
ATOM   3587  C  CA    . TRP A  1 454 ? 130.216 120.315 98.498  1.00 46.89 ? 454 TRP A CA    1 
ATOM   3588  C  C     . TRP A  1 454 ? 129.888 121.617 99.222  1.00 46.89 ? 454 TRP A C     1 
ATOM   3589  O  O     . TRP A  1 454 ? 130.759 122.206 99.883  1.00 46.89 ? 454 TRP A O     1 
ATOM   3590  C  CB    . TRP A  1 454 ? 130.443 120.562 97.010  1.00 46.89 ? 454 TRP A CB    1 
ATOM   3591  C  CG    . TRP A  1 454 ? 131.544 121.517 96.722  1.00 46.89 ? 454 TRP A CG    1 
ATOM   3592  C  CD1   . TRP A  1 454 ? 132.877 121.311 96.913  1.00 46.89 ? 454 TRP A CD1   1 
ATOM   3593  C  CD2   . TRP A  1 454 ? 131.412 122.833 96.180  1.00 46.89 ? 454 TRP A CD2   1 
ATOM   3594  N  NE1   . TRP A  1 454 ? 133.585 122.421 96.527  1.00 46.89 ? 454 TRP A NE1   1 
ATOM   3595  C  CE2   . TRP A  1 454 ? 132.708 123.370 96.072  1.00 46.89 ? 454 TRP A CE2   1 
ATOM   3596  C  CE3   . TRP A  1 454 ? 130.323 123.610 95.778  1.00 46.89 ? 454 TRP A CE3   1 
ATOM   3597  C  CZ2   . TRP A  1 454 ? 132.945 124.649 95.579  1.00 46.89 ? 454 TRP A CZ2   1 
ATOM   3598  C  CZ3   . TRP A  1 454 ? 130.560 124.878 95.290  1.00 46.89 ? 454 TRP A CZ3   1 
ATOM   3599  C  CH2   . TRP A  1 454 ? 131.860 125.386 95.194  1.00 46.89 ? 454 TRP A CH2   1 
ATOM   3600  N  N     . LEU A  1 455 ? 128.629 122.062 99.135  1.00 43.75 ? 455 LEU A N     1 
ATOM   3601  C  CA    . LEU A  1 455 ? 128.210 123.249 99.875  1.00 43.75 ? 455 LEU A CA    1 
ATOM   3602  C  C     . LEU A  1 455 ? 128.255 123.022 101.382 1.00 43.75 ? 455 LEU A C     1 
ATOM   3603  O  O     . LEU A  1 455 ? 128.598 123.939 102.137 1.00 43.75 ? 455 LEU A O     1 
ATOM   3604  C  CB    . LEU A  1 455 ? 126.806 123.664 99.444  1.00 43.75 ? 455 LEU A CB    1 
ATOM   3605  C  CG    . LEU A  1 455 ? 126.739 124.512 98.176  1.00 43.75 ? 455 LEU A CG    1 
ATOM   3606  C  CD1   . LEU A  1 455 ? 125.307 124.634 97.693  1.00 43.75 ? 455 LEU A CD1   1 
ATOM   3607  C  CD2   . LEU A  1 455 ? 127.341 125.880 98.427  1.00 43.75 ? 455 LEU A CD2   1 
ATOM   3608  N  N     . GLN A  1 456 ? 127.959 121.801 101.832 1.00 43.18 ? 456 GLN A N     1 
ATOM   3609  C  CA    . GLN A  1 456 ? 128.027 121.495 103.255 1.00 43.18 ? 456 GLN A CA    1 
ATOM   3610  C  C     . GLN A  1 456 ? 129.468 121.431 103.739 1.00 43.18 ? 456 GLN A C     1 
ATOM   3611  O  O     . GLN A  1 456 ? 129.755 121.811 104.876 1.00 43.18 ? 456 GLN A O     1 
ATOM   3612  C  CB    . GLN A  1 456 ? 127.301 120.182 103.541 1.00 43.18 ? 456 GLN A CB    1 
ATOM   3613  C  CG    . GLN A  1 456 ? 127.086 119.903 105.012 1.00 43.18 ? 456 GLN A CG    1 
ATOM   3614  C  CD    . GLN A  1 456 ? 126.341 121.018 105.707 1.00 43.18 ? 456 GLN A CD    1 
ATOM   3615  O  OE1   . GLN A  1 456 ? 125.325 121.505 105.213 1.00 43.18 ? 456 GLN A OE1   1 
ATOM   3616  N  NE2   . GLN A  1 456 ? 126.845 121.434 106.861 1.00 43.18 ? 456 GLN A NE2   1 
ATOM   3617  N  N     . ARG A  1 457 ? 130.389 120.967 102.889 1.00 47.57 ? 457 ARG A N     1 
ATOM   3618  C  CA    . ARG A  1 457 ? 131.804 120.982 103.249 1.00 47.57 ? 457 ARG A CA    1 
ATOM   3619  C  C     . ARG A  1 457 ? 132.328 122.405 103.362 1.00 47.57 ? 457 ARG A C     1 
ATOM   3620  O  O     . ARG A  1 457 ? 133.094 122.718 104.284 1.00 47.57 ? 457 ARG A O     1 
ATOM   3621  C  CB    . ARG A  1 457 ? 132.623 120.201 102.223 1.00 47.57 ? 457 ARG A CB    1 
ATOM   3622  C  CG    . ARG A  1 457 ? 132.938 118.776 102.624 1.00 47.57 ? 457 ARG A CG    1 
ATOM   3623  C  CD    . ARG A  1 457 ? 134.023 118.192 101.736 1.00 47.57 ? 457 ARG A CD    1 
ATOM   3624  N  NE    . ARG A  1 457 ? 135.359 118.542 102.205 1.00 47.57 ? 457 ARG A NE    1 
ATOM   3625  C  CZ    . ARG A  1 457 ? 136.075 117.793 103.037 1.00 47.57 ? 457 ARG A CZ    1 
ATOM   3626  N  NH1   . ARG A  1 457 ? 135.583 116.650 103.489 1.00 47.57 ? 457 ARG A NH1   1 
ATOM   3627  N  NH2   . ARG A  1 457 ? 137.283 118.186 103.417 1.00 47.57 ? 457 ARG A NH2   1 
ATOM   3628  N  N     . LYS A  1 458 ? 131.911 123.280 102.440 1.00 52.56 ? 458 LYS A N     1 
ATOM   3629  C  CA    . LYS A  1 458 ? 132.294 124.690 102.511 1.00 52.56 ? 458 LYS A CA    1 
ATOM   3630  C  C     . LYS A  1 458 ? 131.741 125.355 103.769 1.00 52.56 ? 458 LYS A C     1 
ATOM   3631  O  O     . LYS A  1 458 ? 132.461 126.077 104.476 1.00 52.56 ? 458 LYS A O     1 
ATOM   3632  C  CB    . LYS A  1 458 ? 131.808 125.419 101.259 1.00 52.56 ? 458 LYS A CB    1 
ATOM   3633  C  CG    . LYS A  1 458 ? 132.179 126.885 101.208 1.00 52.56 ? 458 LYS A CG    1 
ATOM   3634  C  CD    . LYS A  1 458 ? 131.688 127.528 99.923  1.00 52.56 ? 458 LYS A CD    1 
ATOM   3635  C  CE    . LYS A  1 458 ? 132.117 128.984 99.837  1.00 52.56 ? 458 LYS A CE    1 
ATOM   3636  N  NZ    . LYS A  1 458 ? 131.437 129.826 100.860 1.00 52.56 ? 458 LYS A NZ    1 
ATOM   3637  N  N     . HIS A  1 459 ? 130.466 125.094 104.080 1.00 54.89 ? 459 HIS A N     1 
ATOM   3638  C  CA    . HIS A  1 459 ? 129.853 125.653 105.280 1.00 54.89 ? 459 HIS A CA    1 
ATOM   3639  C  C     . HIS A  1 459 ? 130.471 125.088 106.553 1.00 54.89 ? 459 HIS A C     1 
ATOM   3640  O  O     . HIS A  1 459 ? 130.613 125.815 107.541 1.00 54.89 ? 459 HIS A O     1 
ATOM   3641  C  CB    . HIS A  1 459 ? 128.349 125.393 105.263 1.00 54.89 ? 459 HIS A CB    1 
ATOM   3642  C  CG    . HIS A  1 459 ? 127.569 126.289 106.172 1.00 54.89 ? 459 HIS A CG    1 
ATOM   3643  N  ND1   . HIS A  1 459 ? 127.324 127.613 105.881 1.00 54.89 ? 459 HIS A ND1   1 
ATOM   3644  C  CD2   . HIS A  1 459 ? 126.976 126.049 107.365 1.00 54.89 ? 459 HIS A CD2   1 
ATOM   3645  C  CE1   . HIS A  1 459 ? 126.614 128.151 106.857 1.00 54.89 ? 459 HIS A CE1   1 
ATOM   3646  N  NE2   . HIS A  1 459 ? 126.390 127.224 107.769 1.00 54.89 ? 459 HIS A NE2   1 
ATOM   3647  N  N     . GLY A  1 460 ? 130.875 123.817 106.540 1.00 57.41 ? 460 GLY A N     1 
ATOM   3648  C  CA    . GLY A  1 460 ? 131.508 123.235 107.710 1.00 57.41 ? 460 GLY A CA    1 
ATOM   3649  C  C     . GLY A  1 460 ? 132.902 123.776 107.951 1.00 57.41 ? 460 GLY A C     1 
ATOM   3650  O  O     . GLY A  1 460 ? 133.299 123.990 109.099 1.00 57.41 ? 460 GLY A O     1 
ATOM   3651  N  N     . VAL A  1 461 ? 133.657 124.017 106.873 1.00 60.74 ? 461 VAL A N     1 
ATOM   3652  C  CA    . VAL A  1 461 ? 134.970 124.649 107.000 1.00 60.74 ? 461 VAL A CA    1 
ATOM   3653  C  C     . VAL A  1 461 ? 134.827 126.075 107.524 1.00 60.74 ? 461 VAL A C     1 
ATOM   3654  O  O     . VAL A  1 461 ? 135.592 126.511 108.398 1.00 60.74 ? 461 VAL A O     1 
ATOM   3655  C  CB    . VAL A  1 461 ? 135.711 124.591 105.648 1.00 60.74 ? 461 VAL A CB    1 
ATOM   3656  C  CG1   . VAL A  1 461 ? 136.875 125.570 105.593 1.00 60.74 ? 461 VAL A CG1   1 
ATOM   3657  C  CG2   . VAL A  1 461 ? 136.210 123.178 105.388 1.00 60.74 ? 461 VAL A CG2   1 
ATOM   3658  N  N     . ARG A  1 462 ? 133.806 126.799 107.049 1.00 64.62 ? 462 ARG A N     1 
ATOM   3659  C  CA    . ARG A  1 462 ? 133.578 128.163 107.525 1.00 64.62 ? 462 ARG A CA    1 
ATOM   3660  C  C     . ARG A  1 462 ? 133.155 128.192 108.994 1.00 64.62 ? 462 ARG A C     1 
ATOM   3661  O  O     . ARG A  1 462 ? 133.629 129.037 109.764 1.00 64.62 ? 462 ARG A O     1 
ATOM   3662  C  CB    . ARG A  1 462 ? 132.530 128.850 106.652 1.00 64.62 ? 462 ARG A CB    1 
ATOM   3663  C  CG    . ARG A  1 462 ? 132.456 130.351 106.845 1.00 64.62 ? 462 ARG A CG    1 
ATOM   3664  C  CD    . ARG A  1 462 ? 131.853 131.027 105.629 1.00 64.62 ? 462 ARG A CD    1 
ATOM   3665  N  NE    . ARG A  1 462 ? 130.671 130.322 105.148 1.00 64.62 ? 462 ARG A NE    1 
ATOM   3666  C  CZ    . ARG A  1 462 ? 129.832 130.807 104.240 1.00 64.62 ? 462 ARG A CZ    1 
ATOM   3667  N  NH1   . ARG A  1 462 ? 130.043 132.005 103.713 1.00 64.62 ? 462 ARG A NH1   1 
ATOM   3668  N  NH2   . ARG A  1 462 ? 128.780 130.096 103.861 1.00 64.62 ? 462 ARG A NH2   1 
ATOM   3669  N  N     . VAL A  1 463 ? 132.293 127.257 109.405 1.00 64.50 ? 463 VAL A N     1 
ATOM   3670  C  CA    . VAL A  1 463 ? 131.848 127.194 110.797 1.00 64.50 ? 463 VAL A CA    1 
ATOM   3671  C  C     . VAL A  1 463 ? 132.994 126.769 111.712 1.00 64.50 ? 463 VAL A C     1 
ATOM   3672  O  O     . VAL A  1 463 ? 133.147 127.298 112.820 1.00 64.50 ? 463 VAL A O     1 
ATOM   3673  C  CB    . VAL A  1 463 ? 130.620 126.264 110.904 1.00 64.50 ? 463 VAL A CB    1 
ATOM   3674  C  CG1   . VAL A  1 463 ? 130.380 125.776 112.328 1.00 64.50 ? 463 VAL A CG1   1 
ATOM   3675  C  CG2   . VAL A  1 463 ? 129.382 126.983 110.395 1.00 64.50 ? 463 VAL A CG2   1 
ATOM   3676  N  N     . LYS A  1 464 ? 133.849 125.853 111.241 1.00 68.24 ? 464 LYS A N     1 
ATOM   3677  C  CA    . LYS A  1 464 ? 135.033 125.449 111.995 1.00 68.24 ? 464 LYS A CA    1 
ATOM   3678  C  C     . LYS A  1 464 ? 136.009 126.602 112.189 1.00 68.24 ? 464 LYS A C     1 
ATOM   3679  O  O     . LYS A  1 464 ? 136.523 126.799 113.299 1.00 68.24 ? 464 LYS A O     1 
ATOM   3680  C  CB    . LYS A  1 464 ? 135.732 124.299 111.272 1.00 68.24 ? 464 LYS A CB    1 
ATOM   3681  C  CG    . LYS A  1 464 ? 136.555 123.389 112.162 1.00 68.24 ? 464 LYS A CG    1 
ATOM   3682  C  CD    . LYS A  1 464 ? 135.693 122.417 112.952 1.00 68.24 ? 464 LYS A CD    1 
ATOM   3683  C  CE    . LYS A  1 464 ? 134.594 121.767 112.113 1.00 68.24 ? 464 LYS A CE    1 
ATOM   3684  N  NZ    . LYS A  1 464 ? 133.883 120.699 112.869 1.00 68.24 ? 464 LYS A NZ    1 
ATOM   3685  N  N     . ARG A  1 465 ? 136.258 127.380 111.133 1.00 73.82 ? 465 ARG A N     1 
ATOM   3686  C  CA    . ARG A  1 465 ? 137.158 128.521 111.242 1.00 73.82 ? 465 ARG A CA    1 
ATOM   3687  C  C     . ARG A  1 465 ? 136.553 129.651 112.068 1.00 73.82 ? 465 ARG A C     1 
ATOM   3688  O  O     . ARG A  1 465 ? 137.293 130.446 112.657 1.00 73.82 ? 465 ARG A O     1 
ATOM   3689  C  CB    . ARG A  1 465 ? 137.533 129.019 109.846 1.00 73.82 ? 465 ARG A CB    1 
ATOM   3690  C  CG    . ARG A  1 465 ? 138.822 129.816 109.785 1.00 73.82 ? 465 ARG A CG    1 
ATOM   3691  C  CD    . ARG A  1 465 ? 139.002 130.448 108.416 1.00 73.82 ? 465 ARG A CD    1 
ATOM   3692  N  NE    . ARG A  1 465 ? 137.740 130.948 107.878 1.00 73.82 ? 465 ARG A NE    1 
ATOM   3693  C  CZ    . ARG A  1 465 ? 137.244 132.154 108.132 1.00 73.82 ? 465 ARG A CZ    1 
ATOM   3694  N  NH1   . ARG A  1 465 ? 137.904 132.994 108.917 1.00 73.82 ? 465 ARG A NH1   1 
ATOM   3695  N  NH2   . ARG A  1 465 ? 136.087 132.521 107.600 1.00 73.82 ? 465 ARG A NH2   1 
ATOM   3696  N  N     . LYS A  1 466 ? 135.221 129.736 112.130 1.00 73.69 ? 466 LYS A N     1 
ATOM   3697  C  CA    . LYS A  1 466 ? 134.592 130.699 113.029 1.00 73.69 ? 466 LYS A CA    1 
ATOM   3698  C  C     . LYS A  1 466 ? 134.688 130.251 114.483 1.00 73.69 ? 466 LYS A C     1 
ATOM   3699  O  O     . LYS A  1 466 ? 134.916 131.081 115.371 1.00 73.69 ? 466 LYS A O     1 
ATOM   3700  C  CB    . LYS A  1 466 ? 133.131 130.914 112.622 1.00 73.69 ? 466 LYS A CB    1 
ATOM   3701  C  CG    . LYS A  1 466 ? 132.365 131.937 113.459 1.00 73.69 ? 466 LYS A CG    1 
ATOM   3702  C  CD    . LYS A  1 466 ? 131.373 131.276 114.409 1.00 73.69 ? 466 LYS A CD    1 
ATOM   3703  C  CE    . LYS A  1 466 ? 130.518 132.306 115.126 1.00 73.69 ? 466 LYS A CE    1 
ATOM   3704  N  NZ    . LYS A  1 466 ? 129.818 131.720 116.303 1.00 73.69 ? 466 LYS A NZ    1 
ATOM   3705  N  N     . VAL A  1 467 ? 134.516 128.953 114.742 1.00 76.69 ? 467 VAL A N     1 
ATOM   3706  C  CA    . VAL A  1 467 ? 134.511 128.448 116.112 1.00 76.69 ? 467 VAL A CA    1 
ATOM   3707  C  C     . VAL A  1 467 ? 135.921 128.466 116.696 1.00 76.69 ? 467 VAL A C     1 
ATOM   3708  O  O     . VAL A  1 467 ? 136.113 128.792 117.875 1.00 76.69 ? 467 VAL A O     1 
ATOM   3709  C  CB    . VAL A  1 467 ? 133.868 127.043 116.142 1.00 76.69 ? 467 VAL A CB    1 
ATOM   3710  C  CG1   . VAL A  1 467 ? 134.234 126.254 117.393 1.00 76.69 ? 467 VAL A CG1   1 
ATOM   3711  C  CG2   . VAL A  1 467 ? 132.357 127.164 116.047 1.00 76.69 ? 467 VAL A CG2   1 
ATOM   3712  N  N     . GLN A  1 468 ? 136.936 128.187 115.869 1.00 82.97 ? 468 GLN A N     1 
ATOM   3713  C  CA    . GLN A  1 468 ? 138.313 128.177 116.360 1.00 82.97 ? 468 GLN A CA    1 
ATOM   3714  C  C     . GLN A  1 468 ? 138.827 129.566 116.733 1.00 82.97 ? 468 GLN A C     1 
ATOM   3715  O  O     . GLN A  1 468 ? 139.807 129.668 117.478 1.00 82.97 ? 468 GLN A O     1 
ATOM   3716  C  CB    . GLN A  1 468 ? 139.240 127.548 115.320 1.00 82.97 ? 468 GLN A CB    1 
ATOM   3717  C  CG    . GLN A  1 468 ? 139.174 126.031 115.271 1.00 82.97 ? 468 GLN A CG    1 
ATOM   3718  C  CD    . GLN A  1 468 ? 140.197 125.438 114.326 1.00 82.97 ? 468 GLN A CD    1 
ATOM   3719  O  OE1   . GLN A  1 468 ? 140.826 126.152 113.546 1.00 82.97 ? 468 GLN A OE1   1 
ATOM   3720  N  NE2   . GLN A  1 468 ? 140.371 124.123 114.392 1.00 82.97 ? 468 GLN A NE2   1 
ATOM   3721  N  N     . ALA A  1 469 ? 138.196 130.631 116.239 1.00 83.96 ? 469 ALA A N     1 
ATOM   3722  C  CA    . ALA A  1 469 ? 138.526 131.994 116.659 1.00 83.96 ? 469 ALA A CA    1 
ATOM   3723  C  C     . ALA A  1 469 ? 137.533 132.446 117.733 1.00 83.96 ? 469 ALA A C     1 
ATOM   3724  O  O     . ALA A  1 469 ? 136.623 133.244 117.501 1.00 83.96 ? 469 ALA A O     1 
ATOM   3725  C  CB    . ALA A  1 469 ? 138.532 132.935 115.461 1.00 83.96 ? 469 ALA A CB    1 
ATOM   3726  N  N     . LEU A  1 470 ? 137.728 131.911 118.932 1.00 85.80 ? 470 LEU A N     1 
ATOM   3727  C  CA    . LEU A  1 470 ? 136.816 132.119 120.050 1.00 85.80 ? 470 LEU A CA    1 
ATOM   3728  C  C     . LEU A  1 470 ? 137.555 132.780 121.212 1.00 85.80 ? 470 LEU A C     1 
ATOM   3729  O  O     . LEU A  1 470 ? 138.785 132.860 121.234 1.00 85.80 ? 470 LEU A O     1 
ATOM   3730  C  CB    . LEU A  1 470 ? 136.188 130.791 120.481 1.00 85.80 ? 470 LEU A CB    1 
ATOM   3731  C  CG    . LEU A  1 470 ? 134.741 130.801 120.973 1.00 85.80 ? 470 LEU A CG    1 
ATOM   3732  C  CD1   . LEU A  1 470 ? 133.841 131.508 119.976 1.00 85.80 ? 470 LEU A CD1   1 
ATOM   3733  C  CD2   . LEU A  1 470 ? 134.271 129.380 121.194 1.00 85.80 ? 470 LEU A CD2   1 
ATOM   3734  N  N     . LYS A  1 471 ? 136.779 133.258 122.191 1.00 87.77 ? 471 LYS A N     1 
ATOM   3735  C  CA    . LYS A  1 471 ? 137.335 133.931 123.359 1.00 87.77 ? 471 LYS A CA    1 
ATOM   3736  C  C     . LYS A  1 471 ? 136.667 133.464 124.648 1.00 87.77 ? 471 LYS A C     1 
ATOM   3737  O  O     . LYS A  1 471 ? 136.496 134.254 125.583 1.00 87.77 ? 471 LYS A O     1 
ATOM   3738  C  CB    . LYS A  1 471 ? 137.208 135.451 123.228 1.00 87.77 ? 471 LYS A CB    1 
ATOM   3739  N  N     . ALA A  1 472 ? 136.284 132.191 124.718 1.00 91.45 ? 472 ALA A N     1 
ATOM   3740  C  CA    . ALA A  1 472 ? 135.636 131.632 125.895 1.00 91.45 ? 472 ALA A CA    1 
ATOM   3741  C  C     . ALA A  1 472 ? 136.186 130.240 126.173 1.00 91.45 ? 472 ALA A C     1 
ATOM   3742  O  O     . ALA A  1 472 ? 136.864 129.633 125.339 1.00 91.45 ? 472 ALA A O     1 
ATOM   3743  C  CB    . ALA A  1 472 ? 134.112 131.578 125.724 1.00 91.45 ? 472 ALA A CB    1 
ATOM   3744  N  N     . ASP A  1 473 ? 135.883 129.734 127.366 1.00 91.07 ? 473 ASP A N     1 
ATOM   3745  C  CA    . ASP A  1 473 ? 136.271 128.384 127.775 1.00 91.07 ? 473 ASP A CA    1 
ATOM   3746  C  C     . ASP A  1 473 ? 135.198 127.365 127.406 1.00 91.07 ? 473 ASP A C     1 
ATOM   3747  O  O     . ASP A  1 473 ? 134.691 126.619 128.242 1.00 91.07 ? 473 ASP A O     1 
ATOM   3748  C  CB    . ASP A  1 473 ? 136.561 128.358 129.271 1.00 91.07 ? 473 ASP A CB    1 
ATOM   3749  N  N     . ILE A  1 474 ? 134.849 127.336 126.121 1.00 87.67 ? 474 ILE A N     1 
ATOM   3750  C  CA    . ILE A  1 474 ? 133.744 126.514 125.650 1.00 87.67 ? 474 ILE A CA    1 
ATOM   3751  C  C     . ILE A  1 474 ? 134.261 125.130 125.284 1.00 87.67 ? 474 ILE A C     1 
ATOM   3752  O  O     . ILE A  1 474 ? 135.259 124.993 124.564 1.00 87.67 ? 474 ILE A O     1 
ATOM   3753  C  CB    . ILE A  1 474 ? 133.057 127.200 124.458 1.00 87.67 ? 474 ILE A CB    1 
ATOM   3754  C  CG1   . ILE A  1 474 ? 132.192 128.361 124.947 1.00 87.67 ? 474 ILE A CG1   1 
ATOM   3755  C  CG2   . ILE A  1 474 ? 132.221 126.222 123.642 1.00 87.67 ? 474 ILE A CG2   1 
ATOM   3756  C  CD1   . ILE A  1 474 ? 131.645 129.221 123.837 1.00 87.67 ? 474 ILE A CD1   1 
ATOM   3757  N  N     . ASP A  1 475 ? 133.597 124.095 125.800 1.00 81.97 ? 475 ASP A N     1 
ATOM   3758  C  CA    . ASP A  1 475 ? 133.806 122.735 125.311 1.00 81.97 ? 475 ASP A CA    1 
ATOM   3759  C  C     . ASP A  1 475 ? 133.288 122.681 123.882 1.00 81.97 ? 475 ASP A C     1 
ATOM   3760  O  O     . ASP A  1 475 ? 132.079 122.662 123.644 1.00 81.97 ? 475 ASP A O     1 
ATOM   3761  C  CB    . ASP A  1 475 ? 133.094 121.724 126.203 1.00 81.97 ? 475 ASP A CB    1 
ATOM   3762  N  N     . ALA A  1 476 ? 134.212 122.668 122.921 1.00 75.82 ? 476 ALA A N     1 
ATOM   3763  C  CA    . ALA A  1 476 ? 133.862 122.901 121.527 1.00 75.82 ? 476 ALA A CA    1 
ATOM   3764  C  C     . ALA A  1 476 ? 133.163 121.719 120.874 1.00 75.82 ? 476 ALA A C     1 
ATOM   3765  O  O     . ALA A  1 476 ? 132.444 121.920 119.891 1.00 75.82 ? 476 ALA A O     1 
ATOM   3766  C  CB    . ALA A  1 476 ? 135.114 123.259 120.725 1.00 75.82 ? 476 ALA A CB    1 
ATOM   3767  N  N     . THR A  1 477 ? 133.327 120.509 121.410 1.00 71.96 ? 477 THR A N     1 
ATOM   3768  C  CA    . THR A  1 477 ? 132.806 119.297 120.788 1.00 71.96 ? 477 THR A CA    1 
ATOM   3769  C  C     . THR A  1 477 ? 131.280 119.239 120.780 1.00 71.96 ? 477 THR A C     1 
ATOM   3770  O  O     . THR A  1 477 ? 130.703 118.570 119.916 1.00 71.96 ? 477 THR A O     1 
ATOM   3771  C  CB    . THR A  1 477 ? 133.380 118.069 121.505 1.00 71.96 ? 477 THR A CB    1 
ATOM   3772  O  OG1   . THR A  1 477 ? 134.736 118.336 121.879 1.00 71.96 ? 477 THR A OG1   1 
ATOM   3773  C  CG2   . THR A  1 477 ? 133.380 116.852 120.588 1.00 71.96 ? 477 THR A CG2   1 
ATOM   3774  N  N     . LEU A  1 478 ? 130.613 119.945 121.685 1.00 62.24 ? 478 LEU A N     1 
ATOM   3775  C  CA    . LEU A  1 478 ? 129.157 119.995 121.713 1.00 62.24 ? 478 LEU A CA    1 
ATOM   3776  C  C     . LEU A  1 478 ? 128.585 121.263 121.102 1.00 62.24 ? 478 LEU A C     1 
ATOM   3777  O  O     . LEU A  1 478 ? 127.664 121.183 120.281 1.00 62.24 ? 478 LEU A O     1 
ATOM   3778  C  CB    . LEU A  1 478 ? 128.656 119.856 123.153 1.00 62.24 ? 478 LEU A CB    1 
ATOM   3779  C  CG    . LEU A  1 478 ? 127.144 119.876 123.349 1.00 62.24 ? 478 LEU A CG    1 
ATOM   3780  C  CD1   . LEU A  1 478 ? 126.500 118.709 122.628 1.00 62.24 ? 478 LEU A CD1   1 
ATOM   3781  C  CD2   . LEU A  1 478 ? 126.821 119.839 124.827 1.00 62.24 ? 478 LEU A CD2   1 
ATOM   3782  N  N     . TYR A  1 479 ? 129.110 122.433 121.483 1.00 64.60 ? 479 TYR A N     1 
ATOM   3783  C  CA    . TYR A  1 479 ? 128.616 123.697 120.945 1.00 64.60 ? 479 TYR A CA    1 
ATOM   3784  C  C     . TYR A  1 479 ? 128.910 123.819 119.457 1.00 64.60 ? 479 TYR A C     1 
ATOM   3785  O  O     . TYR A  1 479 ? 128.057 124.274 118.687 1.00 64.60 ? 479 TYR A O     1 
ATOM   3786  C  CB    . TYR A  1 479 ? 129.236 124.866 121.710 1.00 64.60 ? 479 TYR A CB    1 
ATOM   3787  C  CG    . TYR A  1 479 ? 129.008 126.222 121.080 1.00 64.60 ? 479 TYR A CG    1 
ATOM   3788  C  CD1   . TYR A  1 479 ? 127.778 126.855 121.179 1.00 64.60 ? 479 TYR A CD1   1 
ATOM   3789  C  CD2   . TYR A  1 479 ? 130.030 126.877 120.399 1.00 64.60 ? 479 TYR A CD2   1 
ATOM   3790  C  CE1   . TYR A  1 479 ? 127.565 128.096 120.612 1.00 64.60 ? 479 TYR A CE1   1 
ATOM   3791  C  CE2   . TYR A  1 479 ? 129.824 128.115 119.823 1.00 64.60 ? 479 TYR A CE2   1 
ATOM   3792  C  CZ    . TYR A  1 479 ? 128.590 128.719 119.934 1.00 64.60 ? 479 TYR A CZ    1 
ATOM   3793  O  OH    . TYR A  1 479 ? 128.379 129.953 119.365 1.00 64.60 ? 479 TYR A OH    1 
ATOM   3794  N  N     . GLU A  1 480 ? 130.109 123.403 119.041 1.00 64.50 ? 480 GLU A N     1 
ATOM   3795  C  CA    . GLU A  1 480 ? 130.487 123.401 117.633 1.00 64.50 ? 480 GLU A CA    1 
ATOM   3796  C  C     . GLU A  1 480 ? 129.599 122.467 116.822 1.00 64.50 ? 480 GLU A C     1 
ATOM   3797  O  O     . GLU A  1 480 ? 129.182 122.804 115.706 1.00 64.50 ? 480 GLU A O     1 
ATOM   3798  C  CB    . GLU A  1 480 ? 131.954 122.992 117.537 1.00 64.50 ? 480 GLU A CB    1 
ATOM   3799  C  CG    . GLU A  1 480 ? 132.480 122.634 116.179 1.00 64.50 ? 480 GLU A CG    1 
ATOM   3800  C  CD    . GLU A  1 480 ? 133.593 121.610 116.289 1.00 64.50 ? 480 GLU A CD    1 
ATOM   3801  O  OE1   . GLU A  1 480 ? 133.309 120.469 116.709 1.00 64.50 ? 480 GLU A OE1   1 
ATOM   3802  O  OE2   . GLU A  1 480 ? 134.758 121.955 116.014 1.00 64.50 ? 480 GLU A OE2   1 
ATOM   3803  N  N     . GLN A  1 481 ? 129.250 121.315 117.399 1.00 53.78 ? 481 GLN A N     1 
ATOM   3804  C  CA    . GLN A  1 481 ? 128.387 120.351 116.725 1.00 53.78 ? 481 GLN A CA    1 
ATOM   3805  C  C     . GLN A  1 481 ? 126.967 120.886 116.575 1.00 53.78 ? 481 GLN A C     1 
ATOM   3806  O  O     . GLN A  1 481 ? 126.350 120.740 115.514 1.00 53.78 ? 481 GLN A O     1 
ATOM   3807  C  CB    . GLN A  1 481 ? 128.394 119.034 117.499 1.00 53.78 ? 481 GLN A CB    1 
ATOM   3808  C  CG    . GLN A  1 481 ? 127.362 118.026 117.048 1.00 53.78 ? 481 GLN A CG    1 
ATOM   3809  C  CD    . GLN A  1 481 ? 127.436 116.739 117.836 1.00 53.78 ? 481 GLN A CD    1 
ATOM   3810  O  OE1   . GLN A  1 481 ? 128.267 116.596 118.732 1.00 53.78 ? 481 GLN A OE1   1 
ATOM   3811  N  NE2   . GLN A  1 481 ? 126.566 115.793 117.509 1.00 53.78 ? 481 GLN A NE2   1 
ATOM   3812  N  N     . VAL A  1 482 ? 126.440 121.527 117.623 1.00 50.58 ? 482 VAL A N     1 
ATOM   3813  C  CA    . VAL A  1 482 ? 125.083 122.069 117.557 1.00 50.58 ? 482 VAL A CA    1 
ATOM   3814  C  C     . VAL A  1 482 ? 125.013 123.256 116.597 1.00 50.58 ? 482 VAL A C     1 
ATOM   3815  O  O     . VAL A  1 482 ? 124.042 123.389 115.838 1.00 50.58 ? 482 VAL A O     1 
ATOM   3816  C  CB    . VAL A  1 482 ? 124.597 122.423 118.978 1.00 50.58 ? 482 VAL A CB    1 
ATOM   3817  C  CG1   . VAL A  1 482 ? 123.300 123.215 118.955 1.00 50.58 ? 482 VAL A CG1   1 
ATOM   3818  C  CG2   . VAL A  1 482 ? 124.394 121.156 119.781 1.00 50.58 ? 482 VAL A CG2   1 
ATOM   3819  N  N     . ILE A  1 483 ? 126.053 124.097 116.560 1.00 52.45 ? 483 ILE A N     1 
ATOM   3820  C  CA    . ILE A  1 483 ? 126.082 125.215 115.618 1.00 52.45 ? 483 ILE A CA    1 
ATOM   3821  C  C     . ILE A  1 483 ? 126.206 124.717 114.182 1.00 52.45 ? 483 ILE A C     1 
ATOM   3822  O  O     . ILE A  1 483 ? 125.564 125.256 113.270 1.00 52.45 ? 483 ILE A O     1 
ATOM   3823  C  CB    . ILE A  1 483 ? 127.207 126.198 116.000 1.00 52.45 ? 483 ILE A CB    1 
ATOM   3824  C  CG1   . ILE A  1 483 ? 126.846 126.911 117.299 1.00 52.45 ? 483 ILE A CG1   1 
ATOM   3825  C  CG2   . ILE A  1 483 ? 127.481 127.229 114.913 1.00 52.45 ? 483 ILE A CG2   1 
ATOM   3826  C  CD1   . ILE A  1 483 ? 125.570 127.699 117.210 1.00 52.45 ? 483 ILE A CD1   1 
ATOM   3827  N  N     . LEU A  1 484 ? 126.982 123.651 113.961 1.00 50.42 ? 484 LEU A N     1 
ATOM   3828  C  CA    . LEU A  1 484 ? 127.104 123.104 112.613 1.00 50.42 ? 484 LEU A CA    1 
ATOM   3829  C  C     . LEU A  1 484 ? 125.809 122.442 112.156 1.00 50.42 ? 484 LEU A C     1 
ATOM   3830  O  O     . LEU A  1 484 ? 125.382 122.633 111.012 1.00 50.42 ? 484 LEU A O     1 
ATOM   3831  C  CB    . LEU A  1 484 ? 128.262 122.111 112.551 1.00 50.42 ? 484 LEU A CB    1 
ATOM   3832  C  CG    . LEU A  1 484 ? 128.515 121.479 111.186 1.00 50.42 ? 484 LEU A CG    1 
ATOM   3833  C  CD1   . LEU A  1 484 ? 128.750 122.557 110.149 1.00 50.42 ? 484 LEU A CD1   1 
ATOM   3834  C  CD2   . LEU A  1 484 ? 129.697 120.533 111.254 1.00 50.42 ? 484 LEU A CD2   1 
ATOM   3835  N  N     . GLU A  1 485 ? 125.155 121.685 113.034 1.00 44.66 ? 485 GLU A N     1 
ATOM   3836  C  CA    . GLU A  1 485 ? 123.924 121.002 112.660 1.00 44.66 ? 485 GLU A CA    1 
ATOM   3837  C  C     . GLU A  1 485 ? 122.697 121.899 112.713 1.00 44.66 ? 485 GLU A C     1 
ATOM   3838  O  O     . GLU A  1 485 ? 121.618 121.458 112.309 1.00 44.66 ? 485 GLU A O     1 
ATOM   3839  C  CB    . GLU A  1 485 ? 123.703 119.786 113.555 1.00 44.66 ? 485 GLU A CB    1 
ATOM   3840  C  CG    . GLU A  1 485 ? 124.751 118.719 113.383 1.00 44.66 ? 485 GLU A CG    1 
ATOM   3841  C  CD    . GLU A  1 485 ? 124.385 117.437 114.084 1.00 44.66 ? 485 GLU A CD    1 
ATOM   3842  O  OE1   . GLU A  1 485 ? 123.223 116.999 113.956 1.00 44.66 ? 485 GLU A OE1   1 
ATOM   3843  O  OE2   . GLU A  1 485 ? 125.259 116.872 114.770 1.00 44.66 ? 485 GLU A OE2   1 
ATOM   3844  N  N     . LYS A  1 486 ? 122.823 123.128 113.214 1.00 45.67 ? 486 LYS A N     1 
ATOM   3845  C  CA    . LYS A  1 486 ? 121.700 124.057 113.164 1.00 45.67 ? 486 LYS A CA    1 
ATOM   3846  C  C     . LYS A  1 486 ? 121.421 124.499 111.735 1.00 45.67 ? 486 LYS A C     1 
ATOM   3847  O  O     . LYS A  1 486 ? 120.259 124.610 111.327 1.00 45.67 ? 486 LYS A O     1 
ATOM   3848  C  CB    . LYS A  1 486 ? 121.985 125.263 114.060 1.00 45.67 ? 486 LYS A CB    1 
ATOM   3849  C  CG    . LYS A  1 486 ? 120.953 126.373 113.985 1.00 45.67 ? 486 LYS A CG    1 
ATOM   3850  C  CD    . LYS A  1 486 ? 121.286 127.502 114.942 1.00 45.67 ? 486 LYS A CD    1 
ATOM   3851  C  CE    . LYS A  1 486 ? 122.591 128.179 114.563 1.00 45.67 ? 486 LYS A CE    1 
ATOM   3852  N  NZ    . LYS A  1 486 ? 122.477 128.927 113.284 1.00 45.67 ? 486 LYS A NZ    1 
ATOM   3853  N  N     . GLU A  1 487 ? 122.473 124.717 110.948 1.00 47.69 ? 487 GLU A N     1 
ATOM   3854  C  CA    . GLU A  1 487 ? 122.351 125.263 109.604 1.00 47.69 ? 487 GLU A CA    1 
ATOM   3855  C  C     . GLU A  1 487 ? 122.407 124.196 108.519 1.00 47.69 ? 487 GLU A C     1 
ATOM   3856  O  O     . GLU A  1 487 ? 122.524 124.536 107.338 1.00 47.69 ? 487 GLU A O     1 
ATOM   3857  C  CB    . GLU A  1 487 ? 123.437 126.313 109.366 1.00 47.69 ? 487 GLU A CB    1 
ATOM   3858  C  CG    . GLU A  1 487 ? 123.258 127.573 110.193 1.00 47.69 ? 487 GLU A CG    1 
ATOM   3859  C  CD    . GLU A  1 487 ? 124.574 128.148 110.674 1.00 47.69 ? 487 GLU A CD    1 
ATOM   3860  O  OE1   . GLU A  1 487 ? 125.624 127.794 110.098 1.00 47.69 ? 487 GLU A OE1   1 
ATOM   3861  O  OE2   . GLU A  1 487 ? 124.560 128.952 111.630 1.00 47.69 ? 487 GLU A OE2   1 
ATOM   3862  N  N     . MET A  1 488 ? 122.327 122.919 108.881 1.00 39.69 ? 488 MET A N     1 
ATOM   3863  C  CA    . MET A  1 488 ? 122.235 121.864 107.885 1.00 39.69 ? 488 MET A CA    1 
ATOM   3864  C  C     . MET A  1 488 ? 120.823 121.819 107.307 1.00 39.69 ? 488 MET A C     1 
ATOM   3865  O  O     . MET A  1 488 ? 119.899 122.474 107.795 1.00 39.69 ? 488 MET A O     1 
ATOM   3866  C  CB    . MET A  1 488 ? 122.613 120.516 108.491 1.00 39.69 ? 488 MET A CB    1 
ATOM   3867  C  CG    . MET A  1 488 ? 124.100 120.233 108.547 1.00 39.69 ? 488 MET A CG    1 
ATOM   3868  S  SD    . MET A  1 488 ? 124.435 118.591 109.208 1.00 39.69 ? 488 MET A SD    1 
ATOM   3869  C  CE    . MET A  1 488 ? 126.204 118.480 108.979 1.00 39.69 ? 488 MET A CE    1 
ATOM   3870  N  N     . GLY A  1 489 ? 120.649 121.034 106.251 1.00 34.60 ? 489 GLY A N     1 
ATOM   3871  C  CA    . GLY A  1 489 ? 119.339 120.847 105.666 1.00 34.60 ? 489 GLY A CA    1 
ATOM   3872  C  C     . GLY A  1 489 ? 118.600 119.698 106.323 1.00 34.60 ? 489 GLY A C     1 
ATOM   3873  O  O     . GLY A  1 489 ? 119.201 118.739 106.788 1.00 34.60 ? 489 GLY A O     1 
ATOM   3874  N  N     . THR A  1 490 ? 117.278 119.808 106.367 1.00 30.18 ? 490 THR A N     1 
ATOM   3875  C  CA    . THR A  1 490 ? 116.459 118.767 106.968 1.00 30.18 ? 490 THR A CA    1 
ATOM   3876  C  C     . THR A  1 490 ? 116.061 117.742 105.915 1.00 30.18 ? 490 THR A C     1 
ATOM   3877  O  O     . THR A  1 490 ? 116.088 118.022 104.714 1.00 30.18 ? 490 THR A O     1 
ATOM   3878  C  CB    . THR A  1 490 ? 115.219 119.362 107.641 1.00 30.18 ? 490 THR A CB    1 
ATOM   3879  O  OG1   . THR A  1 490 ? 114.577 118.359 108.437 1.00 30.18 ? 490 THR A OG1   1 
ATOM   3880  C  CG2   . THR A  1 490 ? 114.233 119.908 106.620 1.00 30.18 ? 490 THR A CG2   1 
ATOM   3881  N  N     . TYR A  1 491 ? 115.735 116.538 106.371 1.00 26.82 ? 491 TYR A N     1 
ATOM   3882  C  CA    . TYR A  1 491 ? 115.331 115.469 105.469 1.00 26.82 ? 491 TYR A CA    1 
ATOM   3883  C  C     . TYR A  1 491 ? 113.821 115.508 105.287 1.00 26.82 ? 491 TYR A C     1 
ATOM   3884  O  O     . TYR A  1 491 ? 113.070 115.353 106.255 1.00 26.82 ? 491 TYR A O     1 
ATOM   3885  C  CB    . TYR A  1 491 ? 115.776 114.114 106.009 1.00 26.82 ? 491 TYR A CB    1 
ATOM   3886  C  CG    . TYR A  1 491 ? 115.704 113.008 104.987 1.00 26.82 ? 491 TYR A CG    1 
ATOM   3887  C  CD1   . TYR A  1 491 ? 116.553 112.998 103.893 1.00 26.82 ? 491 TYR A CD1   1 
ATOM   3888  C  CD2   . TYR A  1 491 ? 114.786 111.978 105.114 1.00 26.82 ? 491 TYR A CD2   1 
ATOM   3889  C  CE1   . TYR A  1 491 ? 116.493 111.995 102.953 1.00 26.82 ? 491 TYR A CE1   1 
ATOM   3890  C  CE2   . TYR A  1 491 ? 114.719 110.968 104.177 1.00 26.82 ? 491 TYR A CE2   1 
ATOM   3891  C  CZ    . TYR A  1 491 ? 115.577 110.982 103.100 1.00 26.82 ? 491 TYR A CZ    1 
ATOM   3892  O  OH    . TYR A  1 491 ? 115.519 109.980 102.162 1.00 26.82 ? 491 TYR A OH    1 
ATOM   3893  N  N     . LEU A  1 492 ? 113.376 115.712 104.053 1.00 29.14 ? 492 LEU A N     1 
ATOM   3894  C  CA    . LEU A  1 492 ? 111.950 115.840 103.760 1.00 29.14 ? 492 LEU A CA    1 
ATOM   3895  C  C     . LEU A  1 492 ? 111.324 114.500 103.390 1.00 29.14 ? 492 LEU A C     1 
ATOM   3896  O  O     . LEU A  1 492 ? 110.660 114.365 102.364 1.00 29.14 ? 492 LEU A O     1 
ATOM   3897  C  CB    . LEU A  1 492 ? 111.745 116.864 102.651 1.00 29.14 ? 492 LEU A CB    1 
ATOM   3898  C  CG    . LEU A  1 492 ? 111.813 118.330 103.079 1.00 29.14 ? 492 LEU A CG    1 
ATOM   3899  C  CD1   . LEU A  1 492 ? 112.281 119.201 101.927 1.00 29.14 ? 492 LEU A CD1   1 
ATOM   3900  C  CD2   . LEU A  1 492 ? 110.461 118.798 103.593 1.00 29.14 ? 492 LEU A CD2   1 
ATOM   3901  N  N     . GLY A  1 493 ? 111.534 113.492 104.232 1.00 23.89 ? 493 GLY A N     1 
ATOM   3902  C  CA    . GLY A  1 493 ? 110.929 112.191 104.028 1.00 23.89 ? 493 GLY A CA    1 
ATOM   3903  C  C     . GLY A  1 493 ? 111.531 111.378 102.901 1.00 23.89 ? 493 GLY A C     1 
ATOM   3904  O  O     . GLY A  1 493 ? 112.331 111.883 102.110 1.00 23.89 ? 493 GLY A O     1 
ATOM   3905  N  N     . THR A  1 494 ? 111.162 110.101 102.827 1.00 19.83 ? 494 THR A N     1 
ATOM   3906  C  CA    . THR A  1 494 ? 111.586 109.240 101.725 1.00 19.83 ? 494 THR A CA    1 
ATOM   3907  C  C     . THR A  1 494 ? 110.492 109.224 100.660 1.00 19.83 ? 494 THR A C     1 
ATOM   3908  O  O     . THR A  1 494 ? 109.755 108.256 100.484 1.00 19.83 ? 494 THR A O     1 
ATOM   3909  C  CB    . THR A  1 494 ? 111.896 107.837 102.223 1.00 19.83 ? 494 THR A CB    1 
ATOM   3910  O  OG1   . THR A  1 494 ? 110.769 107.326 102.942 1.00 19.83 ? 494 THR A OG1   1 
ATOM   3911  C  CG2   . THR A  1 494 ? 113.100 107.854 103.135 1.00 19.83 ? 494 THR A CG2   1 
ATOM   3912  N  N     . PHE A  1 495 ? 110.381 110.347 99.957  1.00 20.61 ? 495 PHE A N     1 
ATOM   3913  C  CA    . PHE A  1 495 ? 109.457 110.465 98.840  1.00 20.61 ? 495 PHE A CA    1 
ATOM   3914  C  C     . PHE A  1 495 ? 110.171 110.678 97.516  1.00 20.61 ? 495 PHE A C     1 
ATOM   3915  O  O     . PHE A  1 495 ? 109.834 110.021 96.531  1.00 20.61 ? 495 PHE A O     1 
ATOM   3916  C  CB    . PHE A  1 495 ? 108.459 111.604 99.084  1.00 20.61 ? 495 PHE A CB    1 
ATOM   3917  C  CG    . PHE A  1 495 ? 107.675 111.991 97.865  1.00 20.61 ? 495 PHE A CG    1 
ATOM   3918  C  CD1   . PHE A  1 495 ? 106.854 111.076 97.227  1.00 20.61 ? 495 PHE A CD1   1 
ATOM   3919  C  CD2   . PHE A  1 495 ? 107.755 113.273 97.358  1.00 20.61 ? 495 PHE A CD2   1 
ATOM   3920  C  CE1   . PHE A  1 495 ? 106.151 111.431 96.100  1.00 20.61 ? 495 PHE A CE1   1 
ATOM   3921  C  CE2   . PHE A  1 495 ? 107.040 113.632 96.237  1.00 20.61 ? 495 PHE A CE2   1 
ATOM   3922  C  CZ    . PHE A  1 495 ? 106.235 112.709 95.614  1.00 20.61 ? 495 PHE A CZ    1 
ATOM   3923  N  N     . ASP A  1 496 ? 111.145 111.588 97.461  1.00 22.04 ? 496 ASP A N     1 
ATOM   3924  C  CA    . ASP A  1 496 ? 111.923 111.752 96.238  1.00 22.04 ? 496 ASP A CA    1 
ATOM   3925  C  C     . ASP A  1 496 ? 112.811 110.546 95.984  1.00 22.04 ? 496 ASP A C     1 
ATOM   3926  O  O     . ASP A  1 496 ? 113.059 110.186 94.826  1.00 22.04 ? 496 ASP A O     1 
ATOM   3927  C  CB    . ASP A  1 496 ? 112.776 113.015 96.318  1.00 22.04 ? 496 ASP A CB    1 
ATOM   3928  C  CG    . ASP A  1 496 ? 111.994 114.214 96.794  1.00 22.04 ? 496 ASP A CG    1 
ATOM   3929  O  OD1   . ASP A  1 496 ? 111.938 114.440 98.021  1.00 22.04 ? 496 ASP A OD1   1 
ATOM   3930  O  OD2   . ASP A  1 496 ? 111.437 114.934 95.941  1.00 22.04 ? 496 ASP A OD2   1 
ATOM   3931  N  N     . ASP A  1 497 ? 113.274 109.902 97.050  1.00 19.74 ? 497 ASP A N     1 
ATOM   3932  C  CA    . ASP A  1 497 ? 114.171 108.767 96.930  1.00 19.74 ? 497 ASP A CA    1 
ATOM   3933  C  C     . ASP A  1 497 ? 113.463 107.505 96.463  1.00 19.74 ? 497 ASP A C     1 
ATOM   3934  O  O     . ASP A  1 497 ? 114.118 106.615 95.915  1.00 19.74 ? 497 ASP A O     1 
ATOM   3935  C  CB    . ASP A  1 497 ? 114.860 108.530 98.268  1.00 19.74 ? 497 ASP A CB    1 
ATOM   3936  C  CG    . ASP A  1 497 ? 115.734 109.694 98.680  1.00 19.74 ? 497 ASP A CG    1 
ATOM   3937  O  OD1   . ASP A  1 497 ? 116.525 110.168 97.838  1.00 19.74 ? 497 ASP A OD1   1 
ATOM   3938  O  OD2   . ASP A  1 497 ? 115.632 110.140 99.840  1.00 19.74 ? 497 ASP A OD2   1 
ATOM   3939  N  N     . TYR A  1 498 ? 112.151 107.404 96.662  1.00 15.76 ? 498 TYR A N     1 
ATOM   3940  C  CA    . TYR A  1 498 ? 111.376 106.344 96.033  1.00 15.76 ? 498 TYR A CA    1 
ATOM   3941  C  C     . TYR A  1 498 ? 110.901 106.742 94.650  1.00 15.76 ? 498 TYR A C     1 
ATOM   3942  O  O     . TYR A  1 498 ? 110.699 105.875 93.794  1.00 15.76 ? 498 TYR A O     1 
ATOM   3943  C  CB    . TYR A  1 498 ? 110.157 105.985 96.881  1.00 15.76 ? 498 TYR A CB    1 
ATOM   3944  C  CG    . TYR A  1 498 ? 110.435 105.062 98.036  1.00 15.76 ? 498 TYR A CG    1 
ATOM   3945  C  CD1   . TYR A  1 498 ? 111.215 103.930 97.878  1.00 15.76 ? 498 TYR A CD1   1 
ATOM   3946  C  CD2   . TYR A  1 498 ? 109.897 105.317 99.283  1.00 15.76 ? 498 TYR A CD2   1 
ATOM   3947  C  CE1   . TYR A  1 498 ? 111.459 103.089 98.938  1.00 15.76 ? 498 TYR A CE1   1 
ATOM   3948  C  CE2   . TYR A  1 498 ? 110.135 104.487 100.344 1.00 15.76 ? 498 TYR A CE2   1 
ATOM   3949  C  CZ    . TYR A  1 498 ? 110.913 103.376 100.168 1.00 15.76 ? 498 TYR A CZ    1 
ATOM   3950  O  OH    . TYR A  1 498 ? 111.142 102.552 101.239 1.00 15.76 ? 498 TYR A OH    1 
ATOM   3951  N  N     . LEU A  1 499 ? 110.723 108.042 94.420  1.00 16.38 ? 499 LEU A N     1 
ATOM   3952  C  CA    . LEU A  1 499 ? 110.285 108.530 93.119  1.00 16.38 ? 499 LEU A CA    1 
ATOM   3953  C  C     . LEU A  1 499 ? 111.365 108.338 92.065  1.00 16.38 ? 499 LEU A C     1 
ATOM   3954  O  O     . LEU A  1 499 ? 111.061 108.049 90.901  1.00 16.38 ? 499 LEU A O     1 
ATOM   3955  C  CB    . LEU A  1 499 ? 109.902 109.999 93.243  1.00 16.38 ? 499 LEU A CB    1 
ATOM   3956  C  CG    . LEU A  1 499 ? 109.424 110.790 92.042  1.00 16.38 ? 499 LEU A CG    1 
ATOM   3957  C  CD1   . LEU A  1 499 ? 108.201 110.153 91.453  1.00 16.38 ? 499 LEU A CD1   1 
ATOM   3958  C  CD2   . LEU A  1 499 ? 109.125 112.183 92.520  1.00 16.38 ? 499 LEU A CD2   1 
ATOM   3959  N  N     . GLU A  1 500 ? 112.633 108.483 92.462  1.00 20.86 ? 500 GLU A N     1 
ATOM   3960  C  CA    . GLU A  1 500 ? 113.741 108.210 91.552  1.00 20.86 ? 500 GLU A CA    1 
ATOM   3961  C  C     . GLU A  1 500 ? 113.773 106.741 91.143  1.00 20.86 ? 500 GLU A C     1 
ATOM   3962  O  O     . GLU A  1 500 ? 113.988 106.422 89.968  1.00 20.86 ? 500 GLU A O     1 
ATOM   3963  C  CB    . GLU A  1 500 ? 115.058 108.622 92.206  1.00 20.86 ? 500 GLU A CB    1 
ATOM   3964  C  CG    . GLU A  1 500 ? 116.299 108.195 91.445  1.00 20.86 ? 500 GLU A CG    1 
ATOM   3965  C  CD    . GLU A  1 500 ? 117.577 108.735 92.056  1.00 20.86 ? 500 GLU A CD    1 
ATOM   3966  O  OE1   . GLU A  1 500 ? 117.488 109.580 92.972  1.00 20.86 ? 500 GLU A OE1   1 
ATOM   3967  O  OE2   . GLU A  1 500 ? 118.668 108.308 91.621  1.00 20.86 ? 500 GLU A OE2   1 
ATOM   3968  N  N     . LEU A  1 501 ? 113.514 105.835 92.088  1.00 16.75 ? 501 LEU A N     1 
ATOM   3969  C  CA    . LEU A  1 501 ? 113.461 104.413 91.763  1.00 16.75 ? 501 LEU A CA    1 
ATOM   3970  C  C     . LEU A  1 501 ? 112.240 104.069 90.924  1.00 16.75 ? 501 LEU A C     1 
ATOM   3971  O  O     . LEU A  1 501 ? 112.307 103.173 90.076  1.00 16.75 ? 501 LEU A O     1 
ATOM   3972  C  CB    . LEU A  1 501 ? 113.464 103.580 93.039  1.00 16.75 ? 501 LEU A CB    1 
ATOM   3973  C  CG    . LEU A  1 501 ? 114.768 103.606 93.823  1.00 16.75 ? 501 LEU A CG    1 
ATOM   3974  C  CD1   . LEU A  1 501 ? 114.661 102.718 95.039  1.00 16.75 ? 501 LEU A CD1   1 
ATOM   3975  C  CD2   . LEU A  1 501 ? 115.902 103.163 92.932  1.00 16.75 ? 501 LEU A CD2   1 
ATOM   3976  N  N     . PHE A  1 502 ? 111.126 104.773 91.140  1.00 15.58 ? 502 PHE A N     1 
ATOM   3977  C  CA    . PHE A  1 502 ? 109.942 104.575 90.311  1.00 15.58 ? 502 PHE A CA    1 
ATOM   3978  C  C     . PHE A  1 502 ? 110.201 104.994 88.871  1.00 15.58 ? 502 PHE A C     1 
ATOM   3979  O  O     . PHE A  1 502 ? 109.829 104.279 87.935  1.00 15.58 ? 502 PHE A O     1 
ATOM   3980  C  CB    . PHE A  1 502 ? 108.768 105.354 90.894  1.00 15.58 ? 502 PHE A CB    1 
ATOM   3981  C  CG    . PHE A  1 502 ? 107.507 105.249 90.092  1.00 15.58 ? 502 PHE A CG    1 
ATOM   3982  C  CD1   . PHE A  1 502 ? 106.713 104.126 90.182  1.00 15.58 ? 502 PHE A CD1   1 
ATOM   3983  C  CD2   . PHE A  1 502 ? 107.105 106.284 89.263  1.00 15.58 ? 502 PHE A CD2   1 
ATOM   3984  C  CE1   . PHE A  1 502 ? 105.550 104.030 89.456  1.00 15.58 ? 502 PHE A CE1   1 
ATOM   3985  C  CE2   . PHE A  1 502 ? 105.943 106.189 88.531  1.00 15.58 ? 502 PHE A CE2   1 
ATOM   3986  C  CZ    . PHE A  1 502 ? 105.163 105.064 88.635  1.00 15.58 ? 502 PHE A CZ    1 
ATOM   3987  N  N     . LEU A  1 503 ? 110.860 106.135 88.672  1.00 17.33 ? 503 LEU A N     1 
ATOM   3988  C  CA    . LEU A  1 503 ? 111.183 106.559 87.314  1.00 17.33 ? 503 LEU A CA    1 
ATOM   3989  C  C     . LEU A  1 503 ? 112.272 105.698 86.684  1.00 17.33 ? 503 LEU A C     1 
ATOM   3990  O  O     . LEU A  1 503 ? 112.279 105.522 85.462  1.00 17.33 ? 503 LEU A O     1 
ATOM   3991  C  CB    . LEU A  1 503 ? 111.593 108.028 87.301  1.00 17.33 ? 503 LEU A CB    1 
ATOM   3992  C  CG    . LEU A  1 503 ? 110.492 109.002 87.715  1.00 17.33 ? 503 LEU A CG    1 
ATOM   3993  C  CD1   . LEU A  1 503 ? 110.950 110.431 87.523  1.00 17.33 ? 503 LEU A CD1   1 
ATOM   3994  C  CD2   . LEU A  1 503 ? 109.218 108.740 86.937  1.00 17.33 ? 503 LEU A CD2   1 
ATOM   3995  N  N     . GLN A  1 504 ? 113.178 105.139 87.491  1.00 19.76 ? 504 GLN A N     1 
ATOM   3996  C  CA    . GLN A  1 504 ? 114.147 104.182 86.966  1.00 19.76 ? 504 GLN A CA    1 
ATOM   3997  C  C     . GLN A  1 504 ? 113.461 102.913 86.485  1.00 19.76 ? 504 GLN A C     1 
ATOM   3998  O  O     . GLN A  1 504 ? 113.774 102.404 85.403  1.00 19.76 ? 504 GLN A O     1 
ATOM   3999  C  CB    . GLN A  1 504 ? 115.178 103.835 88.031  1.00 19.76 ? 504 GLN A CB    1 
ATOM   4000  C  CG    . GLN A  1 504 ? 116.416 104.678 88.004  1.00 19.76 ? 504 GLN A CG    1 
ATOM   4001  C  CD    . GLN A  1 504 ? 117.424 104.205 89.017  1.00 19.76 ? 504 GLN A CD    1 
ATOM   4002  O  OE1   . GLN A  1 504 ? 117.771 103.026 89.056  1.00 19.76 ? 504 GLN A OE1   1 
ATOM   4003  N  NE2   . GLN A  1 504 ? 117.884 105.115 89.863  1.00 19.76 ? 504 GLN A NE2   1 
ATOM   4004  N  N     . PHE A  1 505 ? 112.519 102.391 87.276  1.00 19.47 ? 505 PHE A N     1 
ATOM   4005  C  CA    . PHE A  1 505 ? 111.743 101.228 86.860  1.00 19.47 ? 505 PHE A CA    1 
ATOM   4006  C  C     . PHE A  1 505 ? 110.874 101.538 85.650  1.00 19.47 ? 505 PHE A C     1 
ATOM   4007  O  O     . PHE A  1 505 ? 110.613 100.650 84.833  1.00 19.47 ? 505 PHE A O     1 
ATOM   4008  C  CB    . PHE A  1 505 ? 110.877 100.741 88.016  1.00 19.47 ? 505 PHE A CB    1 
ATOM   4009  C  CG    . PHE A  1 505 ? 110.301 99.377  87.808  1.00 19.47 ? 505 PHE A CG    1 
ATOM   4010  C  CD1   . PHE A  1 505 ? 111.106 98.328  87.406  1.00 19.47 ? 505 PHE A CD1   1 
ATOM   4011  C  CD2   . PHE A  1 505 ? 108.956 99.142  88.021  1.00 19.47 ? 505 PHE A CD2   1 
ATOM   4012  C  CE1   . PHE A  1 505 ? 110.578 97.069  87.219  1.00 19.47 ? 505 PHE A CE1   1 
ATOM   4013  C  CE2   . PHE A  1 505 ? 108.422 97.887  87.837  1.00 19.47 ? 505 PHE A CE2   1 
ATOM   4014  C  CZ    . PHE A  1 505 ? 109.234 96.849  87.435  1.00 19.47 ? 505 PHE A CZ    1 
ATOM   4015  N  N     . GLY A  1 506 ? 110.438 102.790 85.512  1.00 19.28 ? 506 GLY A N     1 
ATOM   4016  C  CA    . GLY A  1 506 ? 109.698 103.176 84.325  1.00 19.28 ? 506 GLY A CA    1 
ATOM   4017  C  C     . GLY A  1 506 ? 110.561 103.209 83.078  1.00 19.28 ? 506 GLY A C     1 
ATOM   4018  O  O     . GLY A  1 506 ? 110.157 102.720 82.023  1.00 19.28 ? 506 GLY A O     1 
ATOM   4019  N  N     . TYR A  1 507 ? 111.755 103.797 83.177  1.00 20.41 ? 507 TYR A N     1 
ATOM   4020  C  CA    . TYR A  1 507 ? 112.655 103.838 82.026  1.00 20.41 ? 507 TYR A CA    1 
ATOM   4021  C  C     . TYR A  1 507 ? 113.177 102.455 81.665  1.00 20.41 ? 507 TYR A C     1 
ATOM   4022  O  O     . TYR A  1 507 ? 113.487 102.198 80.498  1.00 20.41 ? 507 TYR A O     1 
ATOM   4023  C  CB    . TYR A  1 507 ? 113.829 104.775 82.295  1.00 20.41 ? 507 TYR A CB    1 
ATOM   4024  C  CG    . TYR A  1 507 ? 113.520 106.236 82.094  1.00 20.41 ? 507 TYR A CG    1 
ATOM   4025  C  CD1   . TYR A  1 507 ? 113.057 106.704 80.876  1.00 20.41 ? 507 TYR A CD1   1 
ATOM   4026  C  CD2   . TYR A  1 507 ? 113.708 107.150 83.120  1.00 20.41 ? 507 TYR A CD2   1 
ATOM   4027  C  CE1   . TYR A  1 507 ? 112.775 108.040 80.689  1.00 20.41 ? 507 TYR A CE1   1 
ATOM   4028  C  CE2   . TYR A  1 507 ? 113.429 108.487 82.944  1.00 20.41 ? 507 TYR A CE2   1 
ATOM   4029  C  CZ    . TYR A  1 507 ? 112.964 108.926 81.725  1.00 20.41 ? 507 TYR A CZ    1 
ATOM   4030  O  OH    . TYR A  1 507 ? 112.687 110.259 81.543  1.00 20.41 ? 507 TYR A OH    1 
ATOM   4031  N  N     . VAL A  1 508 ? 113.281 101.556 82.642  1.00 21.70 ? 508 VAL A N     1 
ATOM   4032  C  CA    . VAL A  1 508 ? 113.782 100.217 82.363  1.00 21.70 ? 508 VAL A CA    1 
ATOM   4033  C  C     . VAL A  1 508 ? 112.686 99.335  81.783  1.00 21.70 ? 508 VAL A C     1 
ATOM   4034  O  O     . VAL A  1 508 ? 112.866 98.710  80.732  1.00 21.70 ? 508 VAL A O     1 
ATOM   4035  C  CB    . VAL A  1 508 ? 114.386 99.605  83.640  1.00 21.70 ? 508 VAL A CB    1 
ATOM   4036  C  CG1   . VAL A  1 508 ? 114.531 98.097  83.511  1.00 21.70 ? 508 VAL A CG1   1 
ATOM   4037  C  CG2   . VAL A  1 508 ? 115.721 100.234 83.920  1.00 21.70 ? 508 VAL A CG2   1 
ATOM   4038  N  N     . SER A  1 509 ? 111.529 99.282  82.438  1.00 22.49 ? 509 SER A N     1 
ATOM   4039  C  CA    . SER A  1 509 ? 110.574 98.219  82.170  1.00 22.49 ? 509 SER A CA    1 
ATOM   4040  C  C     . SER A  1 509 ? 109.540 98.564  81.107  1.00 22.49 ? 509 SER A C     1 
ATOM   4041  O  O     . SER A  1 509 ? 108.928 97.646  80.554  1.00 22.49 ? 509 SER A O     1 
ATOM   4042  C  CB    . SER A  1 509 ? 109.860 97.827  83.464  1.00 22.49 ? 509 SER A CB    1 
ATOM   4043  O  OG    . SER A  1 509 ? 108.678 97.106  83.194  1.00 22.49 ? 509 SER A OG    1 
ATOM   4044  N  N     . LEU A  1 510 ? 109.327 99.847  80.800  1.00 22.75 ? 510 LEU A N     1 
ATOM   4045  C  CA    . LEU A  1 510 ? 108.334 100.200 79.787  1.00 22.75 ? 510 LEU A CA    1 
ATOM   4046  C  C     . LEU A  1 510 ? 108.827 99.866  78.386  1.00 22.75 ? 510 LEU A C     1 
ATOM   4047  O  O     . LEU A  1 510 ? 108.050 99.406  77.544  1.00 22.75 ? 510 LEU A O     1 
ATOM   4048  C  CB    . LEU A  1 510 ? 107.979 101.682 79.872  1.00 22.75 ? 510 LEU A CB    1 
ATOM   4049  C  CG    . LEU A  1 510 ? 106.993 102.146 80.941  1.00 22.75 ? 510 LEU A CG    1 
ATOM   4050  C  CD1   . LEU A  1 510 ? 106.933 103.653 80.959  1.00 22.75 ? 510 LEU A CD1   1 
ATOM   4051  C  CD2   . LEU A  1 510 ? 105.624 101.584 80.676  1.00 22.75 ? 510 LEU A CD2   1 
ATOM   4052  N  N     . PHE A  1 511 ? 110.110 100.088 78.116  1.00 26.08 ? 511 PHE A N     1 
ATOM   4053  C  CA    . PHE A  1 511 ? 110.656 99.839  76.788  1.00 26.08 ? 511 PHE A CA    1 
ATOM   4054  C  C     . PHE A  1 511 ? 111.834 98.879  76.861  1.00 26.08 ? 511 PHE A C     1 
ATOM   4055  O  O     . PHE A  1 511 ? 112.875 99.120  76.245  1.00 26.08 ? 511 PHE A O     1 
ATOM   4056  C  CB    . PHE A  1 511 ? 111.089 101.146 76.124  1.00 26.08 ? 511 PHE A CB    1 
ATOM   4057  C  CG    . PHE A  1 511 ? 110.146 102.288 76.356  1.00 26.08 ? 511 PHE A CG    1 
ATOM   4058  C  CD1   . PHE A  1 511 ? 108.966 102.385 75.640  1.00 26.08 ? 511 PHE A CD1   1 
ATOM   4059  C  CD2   . PHE A  1 511 ? 110.445 103.271 77.283  1.00 26.08 ? 511 PHE A CD2   1 
ATOM   4060  C  CE1   . PHE A  1 511 ? 108.099 103.434 75.847  1.00 26.08 ? 511 PHE A CE1   1 
ATOM   4061  C  CE2   . PHE A  1 511 ? 109.580 104.323 77.496  1.00 26.08 ? 511 PHE A CE2   1 
ATOM   4062  C  CZ    . PHE A  1 511 ? 108.406 104.403 76.777  1.00 26.08 ? 511 PHE A CZ    1 
ATOM   4063  N  N     . SER A  1 512 ? 111.683 97.791  77.612  1.00 30.88 ? 512 SER A N     1 
ATOM   4064  C  CA    . SER A  1 512 ? 112.732 96.786  77.703  1.00 30.88 ? 512 SER A CA    1 
ATOM   4065  C  C     . SER A  1 512 ? 112.802 95.891  76.476  1.00 30.88 ? 512 SER A C     1 
ATOM   4066  O  O     . SER A  1 512 ? 113.794 95.176  76.305  1.00 30.88 ? 512 SER A O     1 
ATOM   4067  C  CB    . SER A  1 512 ? 112.530 95.916  78.945  1.00 30.88 ? 512 SER A CB    1 
ATOM   4068  O  OG    . SER A  1 512 ? 111.280 95.253  78.902  1.00 30.88 ? 512 SER A OG    1 
ATOM   4069  N  N     . CYS A  1 513 ? 111.777 95.909  75.624  1.00 37.84 ? 513 CYS A N     1 
ATOM   4070  C  CA    . CYS A  1 513 ? 111.817 95.102  74.411  1.00 37.84 ? 513 CYS A CA    1 
ATOM   4071  C  C     . CYS A  1 513 ? 112.725 95.726  73.362  1.00 37.84 ? 513 CYS A C     1 
ATOM   4072  O  O     . CYS A  1 513 ? 113.565 95.039  72.770  1.00 37.84 ? 513 CYS A O     1 
ATOM   4073  C  CB    . CYS A  1 513 ? 110.407 94.927  73.854  1.00 37.84 ? 513 CYS A CB    1 
ATOM   4074  S  SG    . CYS A  1 513 ? 109.401 93.745  74.756  1.00 37.84 ? 513 CYS A SG    1 
ATOM   4075  N  N     . VAL A  1 514 ? 112.580 97.028  73.124  1.00 35.46 ? 514 VAL A N     1 
ATOM   4076  C  CA    . VAL A  1 514 ? 113.309 97.668  72.037  1.00 35.46 ? 514 VAL A CA    1 
ATOM   4077  C  C     . VAL A  1 514 ? 114.674 98.150  72.511  1.00 35.46 ? 514 VAL A C     1 
ATOM   4078  O  O     . VAL A  1 514 ? 115.533 98.512  71.701  1.00 35.46 ? 514 VAL A O     1 
ATOM   4079  C  CB    . VAL A  1 514 ? 112.480 98.819  71.445  1.00 35.46 ? 514 VAL A CB    1 
ATOM   4080  C  CG1   . VAL A  1 514 ? 111.093 98.331  71.091  1.00 35.46 ? 514 VAL A CG1   1 
ATOM   4081  C  CG2   . VAL A  1 514 ? 112.402 99.963  72.430  1.00 35.46 ? 514 VAL A CG2   1 
ATOM   4082  N  N     . TYR A  1 515 ? 114.898 98.164  73.823  1.00 32.79 ? 515 TYR A N     1 
ATOM   4083  C  CA    . TYR A  1 515 ? 116.143 98.674  74.401  1.00 32.79 ? 515 TYR A CA    1 
ATOM   4084  C  C     . TYR A  1 515 ? 116.357 98.071  75.780  1.00 32.79 ? 515 TYR A C     1 
ATOM   4085  O  O     . TYR A  1 515 ? 116.054 98.695  76.803  1.00 32.79 ? 515 TYR A O     1 
ATOM   4086  C  CB    . TYR A  1 515 ? 116.121 100.202 74.475  1.00 32.79 ? 515 TYR A CB    1 
ATOM   4087  C  CG    . TYR A  1 515 ? 117.486 100.835 74.528  1.00 32.79 ? 515 TYR A CG    1 
ATOM   4088  C  CD1   . TYR A  1 515 ? 118.424 100.584 73.540  1.00 32.79 ? 515 TYR A CD1   1 
ATOM   4089  C  CD2   . TYR A  1 515 ? 117.833 101.694 75.559  1.00 32.79 ? 515 TYR A CD2   1 
ATOM   4090  C  CE1   . TYR A  1 515 ? 119.673 101.166 73.579  1.00 32.79 ? 515 TYR A CE1   1 
ATOM   4091  C  CE2   . TYR A  1 515 ? 119.080 102.281 75.608  1.00 32.79 ? 515 TYR A CE2   1 
ATOM   4092  C  CZ    . TYR A  1 515 ? 119.994 102.012 74.615  1.00 32.79 ? 515 TYR A CZ    1 
ATOM   4093  O  OH    . TYR A  1 515 ? 121.238 102.592 74.658  1.00 32.79 ? 515 TYR A OH    1 
ATOM   4094  N  N     . PRO A  1 516 ? 116.889 96.847  75.849  1.00 32.17 ? 516 PRO A N     1 
ATOM   4095  C  CA    . PRO A  1 516 ? 117.154 96.242  77.162  1.00 32.17 ? 516 PRO A CA    1 
ATOM   4096  C  C     . PRO A  1 516 ? 118.400 96.775  77.838  1.00 32.17 ? 516 PRO A C     1 
ATOM   4097  O  O     . PRO A  1 516 ? 118.513 96.651  79.067  1.00 32.17 ? 516 PRO A O     1 
ATOM   4098  C  CB    . PRO A  1 516 ? 117.302 94.755  76.835  1.00 32.17 ? 516 PRO A CB    1 
ATOM   4099  C  CG    . PRO A  1 516 ? 117.802 94.737  75.445  1.00 32.17 ? 516 PRO A CG    1 
ATOM   4100  C  CD    . PRO A  1 516 ? 117.236 95.936  74.744  1.00 32.17 ? 516 PRO A CD    1 
ATOM   4101  N  N     . LEU A  1 517 ? 119.315 97.384  77.073  1.00 32.71 ? 517 LEU A N     1 
ATOM   4102  C  CA    . LEU A  1 517 ? 120.570 97.924  77.591  1.00 32.71 ? 517 LEU A CA    1 
ATOM   4103  C  C     . LEU A  1 517 ? 120.354 98.991  78.656  1.00 32.71 ? 517 LEU A C     1 
ATOM   4104  O  O     . LEU A  1 517 ? 121.194 99.131  79.555  1.00 32.71 ? 517 LEU A O     1 
ATOM   4105  C  CB    . LEU A  1 517 ? 121.386 98.490  76.425  1.00 32.71 ? 517 LEU A CB    1 
ATOM   4106  C  CG    . LEU A  1 517 ? 122.728 99.178  76.666  1.00 32.71 ? 517 LEU A CG    1 
ATOM   4107  C  CD1   . LEU A  1 517 ? 123.732 98.194  77.221  1.00 32.71 ? 517 LEU A CD1   1 
ATOM   4108  C  CD2   . LEU A  1 517 ? 123.242 99.805  75.386  1.00 32.71 ? 517 LEU A CD2   1 
ATOM   4109  N  N     . ALA A  1 518 ? 119.219 99.701  78.599  1.00 31.16 ? 518 ALA A N     1 
ATOM   4110  C  CA    . ALA A  1 518 ? 118.865 100.698 79.604  1.00 31.16 ? 518 ALA A CA    1 
ATOM   4111  C  C     . ALA A  1 518 ? 118.749 100.104 81.001  1.00 31.16 ? 518 ALA A C     1 
ATOM   4112  O  O     . ALA A  1 518 ? 118.979 100.814 81.988  1.00 31.16 ? 518 ALA A O     1 
ATOM   4113  C  CB    . ALA A  1 518 ? 117.552 101.380 79.221  1.00 31.16 ? 518 ALA A CB    1 
ATOM   4114  N  N     . ALA A  1 519 ? 118.408 98.810  81.101  1.00 28.60 ? 519 ALA A N     1 
ATOM   4115  C  CA    . ALA A  1 519 ? 118.395 98.138  82.398  1.00 28.60 ? 519 ALA A CA    1 
ATOM   4116  C  C     . ALA A  1 519 ? 119.776 98.143  83.035  1.00 28.60 ? 519 ALA A C     1 
ATOM   4117  O  O     . ALA A  1 519 ? 119.906 98.392  84.241  1.00 28.60 ? 519 ALA A O     1 
ATOM   4118  C  CB    . ALA A  1 519 ? 117.878 96.709  82.249  1.00 28.60 ? 519 ALA A CB    1 
ATOM   4119  N  N     . ALA A  1 520 ? 120.822 97.934  82.224  1.00 29.81 ? 520 ALA A N     1 
ATOM   4120  C  CA    . ALA A  1 520 ? 122.190 98.071  82.715  1.00 29.81 ? 520 ALA A CA    1 
ATOM   4121  C  C     . ALA A  1 520 ? 122.468 99.497  83.163  1.00 29.81 ? 520 ALA A C     1 
ATOM   4122  O  O     . ALA A  1 520 ? 123.117 99.716  84.194  1.00 29.81 ? 520 ALA A O     1 
ATOM   4123  C  CB    . ALA A  1 520 ? 123.183 97.644  81.636  1.00 29.81 ? 520 ALA A CB    1 
ATOM   4124  N  N     . PHE A  1 521 ? 121.892 100.478 82.457  1.00 29.44 ? 521 PHE A N     1 
ATOM   4125  C  CA    . PHE A  1 521 ? 122.029 101.877 82.843  1.00 29.44 ? 521 PHE A CA    1 
ATOM   4126  C  C     . PHE A  1 521 ? 121.314 102.200 84.146  1.00 29.44 ? 521 PHE A C     1 
ATOM   4127  O  O     . PHE A  1 521 ? 121.551 103.275 84.705  1.00 29.44 ? 521 PHE A O     1 
ATOM   4128  C  CB    . PHE A  1 521 ? 121.501 102.793 81.738  1.00 29.44 ? 521 PHE A CB    1 
ATOM   4129  C  CG    . PHE A  1 521 ? 122.346 102.805 80.499  1.00 29.44 ? 521 PHE A CG    1 
ATOM   4130  C  CD1   . PHE A  1 521 ? 123.684 102.442 80.546  1.00 29.44 ? 521 PHE A CD1   1 
ATOM   4131  C  CD2   . PHE A  1 521 ? 121.801 103.187 79.285  1.00 29.44 ? 521 PHE A CD2   1 
ATOM   4132  C  CE1   . PHE A  1 521 ? 124.458 102.454 79.404  1.00 29.44 ? 521 PHE A CE1   1 
ATOM   4133  C  CE2   . PHE A  1 521 ? 122.570 103.203 78.140  1.00 29.44 ? 521 PHE A CE2   1 
ATOM   4134  C  CZ    . PHE A  1 521 ? 123.900 102.837 78.199  1.00 29.44 ? 521 PHE A CZ    1 
ATOM   4135  N  N     . ALA A  1 522 ? 120.449 101.314 84.639  1.00 27.61 ? 522 ALA A N     1 
ATOM   4136  C  CA    . ALA A  1 522 ? 119.960 101.492 85.995  1.00 27.61 ? 522 ALA A CA    1 
ATOM   4137  C  C     . ALA A  1 522 ? 120.939 100.941 87.017  1.00 27.61 ? 522 ALA A C     1 
ATOM   4138  O  O     . ALA A  1 522 ? 121.183 101.590 88.041  1.00 27.61 ? 522 ALA A O     1 
ATOM   4139  C  CB    . ALA A  1 522 ? 118.600 100.823 86.165  1.00 27.61 ? 522 ALA A CB    1 
ATOM   4140  N  N     . VAL A  1 523 ? 121.536 99.776  86.733  1.00 27.08 ? 523 VAL A N     1 
ATOM   4141  C  CA    . VAL A  1 523 ? 122.349 99.089  87.734  1.00 27.08 ? 523 VAL A CA    1 
ATOM   4142  C  C     . VAL A  1 523 ? 123.631 99.863  87.999  1.00 27.08 ? 523 VAL A C     1 
ATOM   4143  O  O     . VAL A  1 523 ? 123.988 100.119 89.157  1.00 27.08 ? 523 VAL A O     1 
ATOM   4144  C  CB    . VAL A  1 523 ? 122.633 97.645  87.290  1.00 27.08 ? 523 VAL A CB    1 
ATOM   4145  C  CG1   . VAL A  1 523 ? 123.517 96.944  88.299  1.00 27.08 ? 523 VAL A CG1   1 
ATOM   4146  C  CG2   . VAL A  1 523 ? 121.332 96.891  87.115  1.00 27.08 ? 523 VAL A CG2   1 
ATOM   4147  N  N     . LEU A  1 524 ? 124.286 100.334 86.935  1.00 27.29 ? 524 LEU A N     1 
ATOM   4148  C  CA    . LEU A  1 524 ? 125.434 101.224 87.054  1.00 27.29 ? 524 LEU A CA    1 
ATOM   4149  C  C     . LEU A  1 524 ? 125.083 102.564 87.686  1.00 27.29 ? 524 LEU A C     1 
ATOM   4150  O  O     . LEU A  1 524 ? 125.990 103.269 88.135  1.00 27.29 ? 524 LEU A O     1 
ATOM   4151  C  CB    . LEU A  1 524 ? 126.063 101.460 85.683  1.00 27.29 ? 524 LEU A CB    1 
ATOM   4152  C  CG    . LEU A  1 524 ? 126.855 100.295 85.097  1.00 27.29 ? 524 LEU A CG    1 
ATOM   4153  C  CD1   . LEU A  1 524 ? 127.381 100.659 83.724  1.00 27.29 ? 524 LEU A CD1   1 
ATOM   4154  C  CD2   . LEU A  1 524 ? 127.992 99.908  86.020  1.00 27.29 ? 524 LEU A CD2   1 
ATOM   4155  N  N     . ASN A  1 525 ? 123.803 102.936 87.729  1.00 27.21 ? 525 ASN A N     1 
ATOM   4156  C  CA    . ASN A  1 525 ? 123.415 104.080 88.538  1.00 27.21 ? 525 ASN A CA    1 
ATOM   4157  C  C     . ASN A  1 525 ? 123.292 103.690 90.002  1.00 27.21 ? 525 ASN A C     1 
ATOM   4158  O  O     . ASN A  1 525 ? 123.772 104.413 90.883  1.00 27.21 ? 525 ASN A O     1 
ATOM   4159  C  CB    . ASN A  1 525 ? 122.100 104.665 88.040  1.00 27.21 ? 525 ASN A CB    1 
ATOM   4160  C  CG    . ASN A  1 525 ? 121.708 105.916 88.789  1.00 27.21 ? 525 ASN A CG    1 
ATOM   4161  O  OD1   . ASN A  1 525 ? 122.159 107.010 88.466  1.00 27.21 ? 525 ASN A OD1   1 
ATOM   4162  N  ND2   . ASN A  1 525 ? 120.867 105.761 89.801  1.00 27.21 ? 525 ASN A ND2   1 
ATOM   4163  N  N     . ASN A  1 526 ? 122.666 102.538 90.273  1.00 26.29 ? 526 ASN A N     1 
ATOM   4164  C  CA    . ASN A  1 526 ? 122.333 102.177 91.648  1.00 26.29 ? 526 ASN A CA    1 
ATOM   4165  C  C     . ASN A  1 526 ? 123.573 101.842 92.458  1.00 26.29 ? 526 ASN A C     1 
ATOM   4166  O  O     . ASN A  1 526 ? 123.621 102.142 93.656  1.00 26.29 ? 526 ASN A O     1 
ATOM   4167  C  CB    . ASN A  1 526 ? 121.351 101.010 91.661  1.00 26.29 ? 526 ASN A CB    1 
ATOM   4168  C  CG    . ASN A  1 526 ? 119.945 101.439 91.321  1.00 26.29 ? 526 ASN A CG    1 
ATOM   4169  O  OD1   . ASN A  1 526 ? 119.651 102.629 91.254  1.00 26.29 ? 526 ASN A OD1   1 
ATOM   4170  N  ND2   . ASN A  1 526 ? 119.065 100.472 91.108  1.00 26.29 ? 526 ASN A ND2   1 
ATOM   4171  N  N     . PHE A  1 527 ? 124.606 101.299 91.804  1.00 29.18 ? 527 PHE A N     1 
ATOM   4172  C  CA    . PHE A  1 527 ? 125.903 101.087 92.438  1.00 29.18 ? 527 PHE A CA    1 
ATOM   4173  C  C     . PHE A  1 527 ? 126.541 102.387 92.910  1.00 29.18 ? 527 PHE A C     1 
ATOM   4174  O  O     . PHE A  1 527 ? 127.377 102.356 93.819  1.00 29.18 ? 527 PHE A O     1 
ATOM   4175  C  CB    . PHE A  1 527 ? 126.851 100.381 91.469  1.00 29.18 ? 527 PHE A CB    1 
ATOM   4176  C  CG    . PHE A  1 527 ? 126.597 98.909  91.330  1.00 29.18 ? 527 PHE A CG    1 
ATOM   4177  C  CD1   . PHE A  1 527 ? 125.921 98.208  92.315  1.00 29.18 ? 527 PHE A CD1   1 
ATOM   4178  C  CD2   . PHE A  1 527 ? 127.038 98.226  90.209  1.00 29.18 ? 527 PHE A CD2   1 
ATOM   4179  C  CE1   . PHE A  1 527 ? 125.692 96.849  92.185  1.00 29.18 ? 527 PHE A CE1   1 
ATOM   4180  C  CE2   . PHE A  1 527 ? 126.811 96.870  90.071  1.00 29.18 ? 527 PHE A CE2   1 
ATOM   4181  C  CZ    . PHE A  1 527 ? 126.135 96.181  91.061  1.00 29.18 ? 527 PHE A CZ    1 
ATOM   4182  N  N     . THR A  1 528 ? 126.176 103.523 92.319  1.00 29.74 ? 528 THR A N     1 
ATOM   4183  C  CA    . THR A  1 528 ? 126.555 104.802 92.893  1.00 29.74 ? 528 THR A CA    1 
ATOM   4184  C  C     . THR A  1 528 ? 125.542 105.297 93.911  1.00 29.74 ? 528 THR A C     1 
ATOM   4185  O  O     . THR A  1 528 ? 125.941 105.869 94.934  1.00 29.74 ? 528 THR A O     1 
ATOM   4186  C  CB    . THR A  1 528 ? 126.721 105.856 91.799  1.00 29.74 ? 528 THR A CB    1 
ATOM   4187  O  OG1   . THR A  1 528 ? 125.432 106.336 91.401  1.00 29.74 ? 528 THR A OG1   1 
ATOM   4188  C  CG2   . THR A  1 528 ? 127.428 105.266 90.595  1.00 29.74 ? 528 THR A CG2   1 
ATOM   4189  N  N     . GLU A  1 529 ? 124.247 105.051 93.671  1.00 28.77 ? 529 GLU A N     1 
ATOM   4190  C  CA    . GLU A  1 529 ? 123.202 105.666 94.488  1.00 28.77 ? 529 GLU A CA    1 
ATOM   4191  C  C     . GLU A  1 529 ? 123.193 105.092 95.898  1.00 28.77 ? 529 GLU A C     1 
ATOM   4192  O  O     . GLU A  1 529 ? 122.973 105.831 96.866  1.00 28.77 ? 529 GLU A O     1 
ATOM   4193  C  CB    . GLU A  1 529 ? 121.840 105.493 93.816  1.00 28.77 ? 529 GLU A CB    1 
ATOM   4194  C  CG    . GLU A  1 529 ? 120.736 106.358 94.401  1.00 28.77 ? 529 GLU A CG    1 
ATOM   4195  C  CD    . GLU A  1 529 ? 120.515 107.666 93.647  1.00 28.77 ? 529 GLU A CD    1 
ATOM   4196  O  OE1   . GLU A  1 529 ? 120.931 107.785 92.475  1.00 28.77 ? 529 GLU A OE1   1 
ATOM   4197  O  OE2   . GLU A  1 529 ? 119.918 108.589 94.240  1.00 28.77 ? 529 GLU A OE2   1 
ATOM   4198  N  N     . VAL A  1 530 ? 123.480 103.788 96.023  1.00 28.83 ? 530 VAL A N     1 
ATOM   4199  C  CA    . VAL A  1 530 ? 123.688 103.134 97.316  1.00 28.83 ? 530 VAL A CA    1 
ATOM   4200  C  C     . VAL A  1 530 ? 124.784 103.839 98.106  1.00 28.83 ? 530 VAL A C     1 
ATOM   4201  O  O     . VAL A  1 530 ? 124.659 104.050 99.319  1.00 28.83 ? 530 VAL A O     1 
ATOM   4202  C  CB    . VAL A  1 530 ? 124.011 101.641 97.097  1.00 28.83 ? 530 VAL A CB    1 
ATOM   4203  C  CG1   . VAL A  1 530 ? 124.545 100.983 98.357  1.00 28.83 ? 530 VAL A CG1   1 
ATOM   4204  C  CG2   . VAL A  1 530 ? 122.784 100.900 96.612  1.00 28.83 ? 530 VAL A CG2   1 
ATOM   4205  N  N     . ASN A  1 531 ? 125.843 104.273 97.424  1.00 33.55 ? 531 ASN A N     1 
ATOM   4206  C  CA    . ASN A  1 531 ? 126.818 105.133 98.080  1.00 33.55 ? 531 ASN A CA    1 
ATOM   4207  C  C     . ASN A  1 531 ? 126.253 106.532 98.282  1.00 33.55 ? 531 ASN A C     1 
ATOM   4208  O  O     . ASN A  1 531 ? 126.281 107.064 99.400  1.00 33.55 ? 531 ASN A O     1 
ATOM   4209  C  CB    . ASN A  1 531 ? 128.107 105.184 97.266  1.00 33.55 ? 531 ASN A CB    1 
ATOM   4210  C  CG    . ASN A  1 531 ? 128.708 103.817 97.052  1.00 33.55 ? 531 ASN A CG    1 
ATOM   4211  O  OD1   . ASN A  1 531 ? 128.138 102.808 97.460  1.00 33.55 ? 531 ASN A OD1   1 
ATOM   4212  N  ND2   . ASN A  1 531 ? 129.863 103.772 96.403  1.00 33.55 ? 531 ASN A ND2   1 
ATOM   4213  N  N     . SER A  1 532 ? 125.666 107.107 97.222  1.00 30.94 ? 532 SER A N     1 
ATOM   4214  C  CA    . SER A  1 532 ? 125.430 108.550 97.168  1.00 30.94 ? 532 SER A CA    1 
ATOM   4215  C  C     . SER A  1 532 ? 124.370 108.986 98.164  1.00 30.94 ? 532 SER A C     1 
ATOM   4216  O  O     . SER A  1 532 ? 124.603 109.912 98.952  1.00 30.94 ? 532 SER A O     1 
ATOM   4217  C  CB    . SER A  1 532 ? 125.027 108.965 95.758  1.00 30.94 ? 532 SER A CB    1 
ATOM   4218  O  OG    . SER A  1 532 ? 124.313 110.185 95.785  1.00 30.94 ? 532 SER A OG    1 
ATOM   4219  N  N     . ASP A  1 533 ? 123.220 108.298 98.166  1.00 28.31 ? 533 ASP A N     1 
ATOM   4220  C  CA    . ASP A  1 533 ? 122.187 108.521 99.170  1.00 28.31 ? 533 ASP A CA    1 
ATOM   4221  C  C     . ASP A  1 533 ? 122.713 108.302 100.581 1.00 28.31 ? 533 ASP A C     1 
ATOM   4222  O  O     . ASP A  1 533 ? 122.319 109.033 101.497 1.00 28.31 ? 533 ASP A O     1 
ATOM   4223  C  CB    . ASP A  1 533 ? 120.994 107.604 98.913  1.00 28.31 ? 533 ASP A CB    1 
ATOM   4224  C  CG    . ASP A  1 533 ? 120.096 108.109 97.803  1.00 28.31 ? 533 ASP A CG    1 
ATOM   4225  O  OD1   . ASP A  1 533 ? 120.174 109.306 97.463  1.00 28.31 ? 533 ASP A OD1   1 
ATOM   4226  O  OD2   . ASP A  1 533 ? 119.307 107.306 97.268  1.00 28.31 ? 533 ASP A OD2   1 
ATOM   4227  N  N     . ALA A  1 534 ? 123.638 107.345 100.754 1.00 29.37 ? 534 ALA A N     1 
ATOM   4228  C  CA    . ALA A  1 534 ? 124.270 107.141 102.053 1.00 29.37 ? 534 ALA A CA    1 
ATOM   4229  C  C     . ALA A  1 534 ? 125.042 108.375 102.483 1.00 29.37 ? 534 ALA A C     1 
ATOM   4230  O  O     . ALA A  1 534 ? 124.919 108.819 103.632 1.00 29.37 ? 534 ALA A O     1 
ATOM   4231  C  CB    . ALA A  1 534 ? 125.195 105.928 102.006 1.00 29.37 ? 534 ALA A CB    1 
ATOM   4232  N  N     . LEU A  1 535 ? 125.781 108.985 101.547 1.00 30.86 ? 535 LEU A N     1 
ATOM   4233  C  CA    . LEU A  1 535 ? 126.461 110.243 101.834 1.00 30.86 ? 535 LEU A CA    1 
ATOM   4234  C  C     . LEU A  1 535 ? 125.453 111.341 102.138 1.00 30.86 ? 535 LEU A C     1 
ATOM   4235  O  O     . LEU A  1 535 ? 125.676 112.168 103.031 1.00 30.86 ? 535 LEU A O     1 
ATOM   4236  C  CB    . LEU A  1 535 ? 127.355 110.628 100.658 1.00 30.86 ? 535 LEU A CB    1 
ATOM   4237  C  CG    . LEU A  1 535 ? 127.953 112.031 100.629 1.00 30.86 ? 535 LEU A CG    1 
ATOM   4238  C  CD1   . LEU A  1 535 ? 128.959 112.192 101.745 1.00 30.86 ? 535 LEU A CD1   1 
ATOM   4239  C  CD2   . LEU A  1 535 ? 128.600 112.294 99.287  1.00 30.86 ? 535 LEU A CD2   1 
ATOM   4240  N  N     . LYS A  1 536 ? 124.293 111.287 101.475 1.00 27.33 ? 536 LYS A N     1 
ATOM   4241  C  CA    . LYS A  1 536 ? 123.237 112.261 101.721 1.00 27.33 ? 536 LYS A CA    1 
ATOM   4242  C  C     . LYS A  1 536 ? 122.660 112.104 103.121 1.00 27.33 ? 536 LYS A C     1 
ATOM   4243  O  O     . LYS A  1 536 ? 122.154 113.070 103.703 1.00 27.33 ? 536 LYS A O     1 
ATOM   4244  C  CB    . LYS A  1 536 ? 122.147 112.106 100.664 1.00 27.33 ? 536 LYS A CB    1 
ATOM   4245  C  CG    . LYS A  1 536 ? 121.177 113.254 100.584 1.00 27.33 ? 536 LYS A CG    1 
ATOM   4246  C  CD    . LYS A  1 536 ? 120.130 113.002 99.524  1.00 27.33 ? 536 LYS A CD    1 
ATOM   4247  C  CE    . LYS A  1 536 ? 119.373 111.719 99.790  1.00 27.33 ? 536 LYS A CE    1 
ATOM   4248  N  NZ    . LYS A  1 536 ? 118.475 111.389 98.655  1.00 27.33 ? 536 LYS A NZ    1 
ATOM   4249  N  N     . MET A  1 537 ? 122.750 110.903 103.693 1.00 26.65 ? 537 MET A N     1 
ATOM   4250  C  CA    . MET A  1 537 ? 122.284 110.741 105.061 1.00 26.65 ? 537 MET A CA    1 
ATOM   4251  C  C     . MET A  1 537 ? 123.393 110.996 106.066 1.00 26.65 ? 537 MET A C     1 
ATOM   4252  O  O     . MET A  1 537 ? 123.117 111.138 107.261 1.00 26.65 ? 537 MET A O     1 
ATOM   4253  C  CB    . MET A  1 537 ? 121.703 109.343 105.264 1.00 26.65 ? 537 MET A CB    1 
ATOM   4254  C  CG    . MET A  1 537 ? 120.565 109.008 104.334 1.00 26.65 ? 537 MET A CG    1 
ATOM   4255  S  SD    . MET A  1 537 ? 119.319 110.296 104.324 1.00 26.65 ? 537 MET A SD    1 
ATOM   4256  C  CE    . MET A  1 537 ? 118.684 110.152 105.986 1.00 26.65 ? 537 MET A CE    1 
ATOM   4257  N  N     . CYS A  1 538 ? 124.643 111.071 105.615 1.00 32.41 ? 538 CYS A N     1 
ATOM   4258  C  CA    . CYS A  1 538 ? 125.726 111.049 106.587 1.00 32.41 ? 538 CYS A CA    1 
ATOM   4259  C  C     . CYS A  1 538 ? 126.373 112.411 106.788 1.00 32.41 ? 538 CYS A C     1 
ATOM   4260  O  O     . CYS A  1 538 ? 126.564 112.840 107.929 1.00 32.41 ? 538 CYS A O     1 
ATOM   4261  C  CB    . CYS A  1 538 ? 126.781 110.030 106.161 1.00 32.41 ? 538 CYS A CB    1 
ATOM   4262  S  SG    . CYS A  1 538 ? 126.372 108.344 106.628 1.00 32.41 ? 538 CYS A SG    1 
ATOM   4263  N  N     . ARG A  1 539 ? 126.714 113.105 105.707 1.00 38.28 ? 539 ARG A N     1 
ATOM   4264  C  CA    . ARG A  1 539 ? 127.457 114.348 105.812 1.00 38.28 ? 539 ARG A CA    1 
ATOM   4265  C  C     . ARG A  1 539 ? 126.754 115.538 105.180 1.00 38.28 ? 539 ARG A C     1 
ATOM   4266  O  O     . ARG A  1 539 ? 127.380 116.592 105.035 1.00 38.28 ? 539 ARG A O     1 
ATOM   4267  C  CB    . ARG A  1 539 ? 128.844 114.190 105.175 1.00 38.28 ? 539 ARG A CB    1 
ATOM   4268  C  CG    . ARG A  1 539 ? 129.702 113.117 105.820 1.00 38.28 ? 539 ARG A CG    1 
ATOM   4269  C  CD    . ARG A  1 539 ? 130.012 113.458 107.266 1.00 38.28 ? 539 ARG A CD    1 
ATOM   4270  N  NE    . ARG A  1 539 ? 130.452 112.289 108.022 1.00 38.28 ? 539 ARG A NE    1 
ATOM   4271  C  CZ    . ARG A  1 539 ? 130.785 112.317 109.308 1.00 38.28 ? 539 ARG A CZ    1 
ATOM   4272  N  NH1   . ARG A  1 539 ? 130.731 113.455 109.983 1.00 38.28 ? 539 ARG A NH1   1 
ATOM   4273  N  NH2   . ARG A  1 539 ? 131.174 111.207 109.919 1.00 38.28 ? 539 ARG A NH2   1 
ATOM   4274  N  N     . VAL A  1 540 ? 125.485 115.409 104.798 1.00 31.23 ? 540 VAL A N     1 
ATOM   4275  C  CA    . VAL A  1 540 ? 124.756 116.457 104.095 1.00 31.23 ? 540 VAL A CA    1 
ATOM   4276  C  C     . VAL A  1 540 ? 123.602 116.993 104.932 1.00 31.23 ? 540 VAL A C     1 
ATOM   4277  O  O     . VAL A  1 540 ? 123.455 118.206 105.104 1.00 31.23 ? 540 VAL A O     1 
ATOM   4278  C  CB    . VAL A  1 540 ? 124.243 115.960 102.726 1.00 31.23 ? 540 VAL A CB    1 
ATOM   4279  C  CG1   . VAL A  1 540 ? 123.483 117.058 102.013 1.00 31.23 ? 540 VAL A CG1   1 
ATOM   4280  C  CG2   . VAL A  1 540 ? 125.390 115.465 101.879 1.00 31.23 ? 540 VAL A CG2   1 
ATOM   4281  N  N     . PHE A  1 541 ? 122.779 116.102 105.468 1.00 29.84 ? 541 PHE A N     1 
ATOM   4282  C  CA    . PHE A  1 541 ? 121.541 116.468 106.133 1.00 29.84 ? 541 PHE A CA    1 
ATOM   4283  C  C     . PHE A  1 541 ? 121.683 116.352 107.643 1.00 29.84 ? 541 PHE A C     1 
ATOM   4284  O  O     . PHE A  1 541 ? 122.663 115.816 108.165 1.00 29.84 ? 541 PHE A O     1 
ATOM   4285  C  CB    . PHE A  1 541 ? 120.389 115.582 105.651 1.00 29.84 ? 541 PHE A CB    1 
ATOM   4286  C  CG    . PHE A  1 541 ? 119.831 115.982 104.320 1.00 29.84 ? 541 PHE A CG    1 
ATOM   4287  C  CD1   . PHE A  1 541 ? 119.813 117.309 103.931 1.00 29.84 ? 541 PHE A CD1   1 
ATOM   4288  C  CD2   . PHE A  1 541 ? 119.324 115.032 103.459 1.00 29.84 ? 541 PHE A CD2   1 
ATOM   4289  C  CE1   . PHE A  1 541 ? 119.296 117.677 102.703 1.00 29.84 ? 541 PHE A CE1   1 
ATOM   4290  C  CE2   . PHE A  1 541 ? 118.803 115.394 102.235 1.00 29.84 ? 541 PHE A CE2   1 
ATOM   4291  C  CZ    . PHE A  1 541 ? 118.792 116.717 101.856 1.00 29.84 ? 541 PHE A CZ    1 
ATOM   4292  N  N     . LYS A  1 542 ? 120.677 116.868 108.345 1.00 34.72 ? 542 LYS A N     1 
ATOM   4293  C  CA    . LYS A  1 542 ? 120.533 116.596 109.764 1.00 34.72 ? 542 LYS A CA    1 
ATOM   4294  C  C     . LYS A  1 542 ? 120.133 115.141 109.978 1.00 34.72 ? 542 LYS A C     1 
ATOM   4295  O  O     . LYS A  1 542 ? 119.757 114.424 109.046 1.00 34.72 ? 542 LYS A O     1 
ATOM   4296  C  CB    . LYS A  1 542 ? 119.476 117.498 110.396 1.00 34.72 ? 542 LYS A CB    1 
ATOM   4297  C  CG    . LYS A  1 542 ? 119.840 118.954 110.510 1.00 34.72 ? 542 LYS A CG    1 
ATOM   4298  C  CD    . LYS A  1 542 ? 118.659 119.736 111.048 1.00 34.72 ? 542 LYS A CD    1 
ATOM   4299  C  CE    . LYS A  1 542 ? 118.728 121.193 110.651 1.00 34.72 ? 542 LYS A CE    1 
ATOM   4300  N  NZ    . LYS A  1 542 ? 117.421 121.869 110.847 1.00 34.72 ? 542 LYS A NZ    1 
ATOM   4301  N  N     . ARG A  1 543 ? 120.203 114.710 111.223 1.00 31.76 ? 543 ARG A N     1 
ATOM   4302  C  CA    . ARG A  1 543 ? 119.700 113.393 111.570 1.00 31.76 ? 543 ARG A CA    1 
ATOM   4303  C  C     . ARG A  1 543 ? 118.181 113.410 111.503 1.00 31.76 ? 543 ARG A C     1 
ATOM   4304  O  O     . ARG A  1 543 ? 117.554 114.251 112.156 1.00 31.76 ? 543 ARG A O     1 
ATOM   4305  C  CB    . ARG A  1 543 ? 120.166 112.994 112.958 1.00 31.76 ? 543 ARG A CB    1 
ATOM   4306  C  CG    . ARG A  1 543 ? 119.777 111.591 113.353 1.00 31.76 ? 543 ARG A CG    1 
ATOM   4307  C  CD    . ARG A  1 543 ? 120.498 111.183 114.613 1.00 31.76 ? 543 ARG A CD    1 
ATOM   4308  N  NE    . ARG A  1 543 ? 120.216 109.806 114.987 1.00 31.76 ? 543 ARG A NE    1 
ATOM   4309  C  CZ    . ARG A  1 543 ? 120.933 109.120 115.866 1.00 31.76 ? 543 ARG A CZ    1 
ATOM   4310  N  NH1   . ARG A  1 543 ? 121.974 109.686 116.458 1.00 31.76 ? 543 ARG A NH1   1 
ATOM   4311  N  NH2   . ARG A  1 543 ? 120.611 107.869 116.154 1.00 31.76 ? 543 ARG A NH2   1 
ATOM   4312  N  N     . PRO A  1 544 ? 117.553 112.551 110.709 1.00 29.13 ? 544 PRO A N     1 
ATOM   4313  C  CA    . PRO A  1 544 ? 116.092 112.497 110.709 1.00 29.13 ? 544 PRO A CA    1 
ATOM   4314  C  C     . PRO A  1 544 ? 115.579 111.812 111.961 1.00 29.13 ? 544 PRO A C     1 
ATOM   4315  O  O     . PRO A  1 544 ? 116.262 110.986 112.569 1.00 29.13 ? 544 PRO A O     1 
ATOM   4316  C  CB    . PRO A  1 544 ? 115.771 111.678 109.457 1.00 29.13 ? 544 PRO A CB    1 
ATOM   4317  C  CG    . PRO A  1 544 ? 116.956 110.804 109.291 1.00 29.13 ? 544 PRO A CG    1 
ATOM   4318  C  CD    . PRO A  1 544 ? 118.137 111.617 109.733 1.00 29.13 ? 544 PRO A CD    1 
ATOM   4319  N  N     . PHE A  1 545 ? 114.363 112.176 112.354 1.00 30.52 ? 545 PHE A N     1 
ATOM   4320  C  CA    . PHE A  1 545 ? 113.722 111.497 113.469 1.00 30.52 ? 545 PHE A CA    1 
ATOM   4321  C  C     . PHE A  1 545 ? 113.316 110.094 113.048 1.00 30.52 ? 545 PHE A C     1 
ATOM   4322  O  O     . PHE A  1 545 ? 112.888 109.875 111.911 1.00 30.52 ? 545 PHE A O     1 
ATOM   4323  C  CB    . PHE A  1 545 ? 112.505 112.278 113.953 1.00 30.52 ? 545 PHE A CB    1 
ATOM   4324  C  CG    . PHE A  1 545 ? 112.811 113.253 115.046 1.00 30.52 ? 545 PHE A CG    1 
ATOM   4325  C  CD1   . PHE A  1 545 ? 113.426 112.831 116.211 1.00 30.52 ? 545 PHE A CD1   1 
ATOM   4326  C  CD2   . PHE A  1 545 ? 112.464 114.585 114.921 1.00 30.52 ? 545 PHE A CD2   1 
ATOM   4327  C  CE1   . PHE A  1 545 ? 113.708 113.723 117.224 1.00 30.52 ? 545 PHE A CE1   1 
ATOM   4328  C  CE2   . PHE A  1 545 ? 112.739 115.482 115.934 1.00 30.52 ? 545 PHE A CE2   1 
ATOM   4329  C  CZ    . PHE A  1 545 ? 113.357 115.048 117.088 1.00 30.52 ? 545 PHE A CZ    1 
ATOM   4330  N  N     . SER A  1 546 ? 113.470 109.143 113.963 1.00 31.03 ? 546 SER A N     1 
ATOM   4331  C  CA    . SER A  1 546 ? 113.142 107.756 113.675 1.00 31.03 ? 546 SER A CA    1 
ATOM   4332  C  C     . SER A  1 546 ? 111.638 107.589 113.542 1.00 31.03 ? 546 SER A C     1 
ATOM   4333  O  O     . SER A  1 546 ? 110.878 108.006 114.419 1.00 31.03 ? 546 SER A O     1 
ATOM   4334  C  CB    . SER A  1 546 ? 113.675 106.857 114.783 1.00 31.03 ? 546 SER A CB    1 
ATOM   4335  O  OG    . SER A  1 546 ? 114.987 107.244 115.140 1.00 31.03 ? 546 SER A OG    1 
ATOM   4336  N  N     . GLU A  1 547 ? 111.204 106.997 112.437 1.00 25.86 ? 547 GLU A N     1 
ATOM   4337  C  CA    . GLU A  1 547 ? 109.796 106.761 112.210 1.00 25.86 ? 547 GLU A CA    1 
ATOM   4338  C  C     . GLU A  1 547 ? 109.564 105.282 111.944 1.00 25.86 ? 547 GLU A C     1 
ATOM   4339  O  O     . GLU A  1 547 ? 110.179 104.722 111.028 1.00 25.86 ? 547 GLU A O     1 
ATOM   4340  C  CB    . GLU A  1 547 ? 109.281 107.590 111.029 1.00 25.86 ? 547 GLU A CB    1 
ATOM   4341  C  CG    . GLU A  1 547 ? 109.150 109.072 111.328 1.00 25.86 ? 547 GLU A CG    1 
ATOM   4342  N  N     . PRO A  1 548 ? 108.709 104.616 112.715 1.00 24.82 ? 548 PRO A N     1 
ATOM   4343  C  CA    . PRO A  1 548 ? 108.410 103.210 112.438 1.00 24.82 ? 548 PRO A CA    1 
ATOM   4344  C  C     . PRO A  1 548 ? 107.540 103.064 111.202 1.00 24.82 ? 548 PRO A C     1 
ATOM   4345  O  O     . PRO A  1 548 ? 106.575 103.804 111.002 1.00 24.82 ? 548 PRO A O     1 
ATOM   4346  C  CB    . PRO A  1 548 ? 107.663 102.751 113.698 1.00 24.82 ? 548 PRO A CB    1 
ATOM   4347  C  CG    . PRO A  1 548 ? 107.944 103.802 114.726 1.00 24.82 ? 548 PRO A CG    1 
ATOM   4348  C  CD    . PRO A  1 548 ? 108.077 105.070 113.961 1.00 24.82 ? 548 PRO A CD    1 
ATOM   4349  N  N     . SER A  1 549 ? 107.898 102.096 110.363 1.00 24.05 ? 549 SER A N     1 
ATOM   4350  C  CA    . SER A  1 549 ? 107.151 101.820 109.148 1.00 24.05 ? 549 SER A CA    1 
ATOM   4351  C  C     . SER A  1 549 ? 107.194 100.326 108.879 1.00 24.05 ? 549 SER A C     1 
ATOM   4352  O  O     . SER A  1 549 ? 108.247 99.698  108.998 1.00 24.05 ? 549 SER A O     1 
ATOM   4353  C  CB    . SER A  1 549 ? 107.716 102.592 107.954 1.00 24.05 ? 549 SER A CB    1 
ATOM   4354  O  OG    . SER A  1 549 ? 107.216 103.916 107.927 1.00 24.05 ? 549 SER A OG    1 
ATOM   4355  N  N     . ALA A  1 550 ? 106.044 99.767  108.513 1.00 22.78 ? 550 ALA A N     1 
ATOM   4356  C  CA    . ALA A  1 550 ? 105.931 98.338  108.271 1.00 22.78 ? 550 ALA A CA    1 
ATOM   4357  C  C     . ALA A  1 550 ? 106.088 97.960  106.807 1.00 22.78 ? 550 ALA A C     1 
ATOM   4358  O  O     . ALA A  1 550 ? 106.333 96.787  106.511 1.00 22.78 ? 550 ALA A O     1 
ATOM   4359  C  CB    . ALA A  1 550 ? 104.581 97.820  108.779 1.00 22.78 ? 550 ALA A CB    1 
ATOM   4360  N  N     . ASN A  1 551 ? 105.947 98.915  105.893 1.00 19.37 ? 551 ASN A N     1 
ATOM   4361  C  CA    . ASN A  1 551 ? 106.076 98.657  104.468 1.00 19.37 ? 551 ASN A CA    1 
ATOM   4362  C  C     . ASN A  1 551 ? 106.516 99.939  103.774 1.00 19.37 ? 551 ASN A C     1 
ATOM   4363  O  O     . ASN A  1 551 ? 106.702 100.979 104.410 1.00 19.37 ? 551 ASN A O     1 
ATOM   4364  C  CB    . ASN A  1 551 ? 104.766 98.101  103.901 1.00 19.37 ? 551 ASN A CB    1 
ATOM   4365  C  CG    . ASN A  1 551 ? 103.557 98.945  104.268 1.00 19.37 ? 551 ASN A CG    1 
ATOM   4366  O  OD1   . ASN A  1 551 ? 103.674 99.999  104.891 1.00 19.37 ? 551 ASN A OD1   1 
ATOM   4367  N  ND2   . ASN A  1 551 ? 102.378 98.468  103.890 1.00 19.37 ? 551 ASN A ND2   1 
ATOM   4368  N  N     . ILE A  1 552 ? 106.693 99.859  102.454 1.00 15.03 ? 552 ILE A N     1 
ATOM   4369  C  CA    . ILE A  1 552 ? 106.985 101.067 101.693 1.00 15.03 ? 552 ILE A CA    1 
ATOM   4370  C  C     . ILE A  1 552 ? 105.737 101.914 101.508 1.00 15.03 ? 552 ILE A C     1 
ATOM   4371  O  O     . ILE A  1 552 ? 105.845 103.107 101.205 1.00 15.03 ? 552 ILE A O     1 
ATOM   4372  C  CB    . ILE A  1 552 ? 107.616 100.737 100.332 1.00 15.03 ? 552 ILE A CB    1 
ATOM   4373  C  CG1   . ILE A  1 552 ? 106.752 99.750  99.558  1.00 15.03 ? 552 ILE A CG1   1 
ATOM   4374  C  CG2   . ILE A  1 552 ? 108.989 100.157 100.521 1.00 15.03 ? 552 ILE A CG2   1 
ATOM   4375  C  CD1   . ILE A  1 552 ? 107.250 99.498  98.156  1.00 15.03 ? 552 ILE A CD1   1 
ATOM   4376  N  N     . GLY A  1 553 ? 104.558 101.331 101.686 1.00 16.08 ? 553 GLY A N     1 
ATOM   4377  C  CA    . GLY A  1 553 ? 103.333 102.098 101.714 1.00 16.08 ? 553 GLY A CA    1 
ATOM   4378  C  C     . GLY A  1 553 ? 102.555 102.034 100.423 1.00 16.08 ? 553 GLY A C     1 
ATOM   4379  O  O     . GLY A  1 553 ? 102.194 100.953 99.951  1.00 16.08 ? 553 GLY A O     1 
ATOM   4380  N  N     . VAL A  1 554 ? 102.291 103.204 99.841  1.00 16.46 ? 554 VAL A N     1 
ATOM   4381  C  CA    . VAL A  1 554 ? 101.536 103.280 98.595  1.00 16.46 ? 554 VAL A CA    1 
ATOM   4382  C  C     . VAL A  1 554 ? 102.431 103.050 97.389  1.00 16.46 ? 554 VAL A C     1 
ATOM   4383  O  O     . VAL A  1 554 ? 101.934 102.927 96.263  1.00 16.46 ? 554 VAL A O     1 
ATOM   4384  C  CB    . VAL A  1 554 ? 100.831 104.649 98.553  1.00 16.46 ? 554 VAL A CB    1 
ATOM   4385  C  CG1   . VAL A  1 554 ? 101.824 105.743 98.251  1.00 16.46 ? 554 VAL A CG1   1 
ATOM   4386  C  CG2   . VAL A  1 554 ? 99.627  104.662 97.617  1.00 16.46 ? 554 VAL A CG2   1 
ATOM   4387  N  N     . TRP A  1 555 ? 103.744 102.953 97.595  1.00 14.87 ? 555 TRP A N     1 
ATOM   4388  C  CA    . TRP A  1 555 ? 104.658 102.747 96.482  1.00 14.87 ? 555 TRP A CA    1 
ATOM   4389  C  C     . TRP A  1 555 ? 104.579 101.341 95.910  1.00 14.87 ? 555 TRP A C     1 
ATOM   4390  O  O     . TRP A  1 555 ? 104.975 101.142 94.759  1.00 14.87 ? 555 TRP A O     1 
ATOM   4391  C  CB    . TRP A  1 555 ? 106.087 103.051 96.914  1.00 14.87 ? 555 TRP A CB    1 
ATOM   4392  C  CG    . TRP A  1 555 ? 106.344 104.503 97.054  1.00 14.87 ? 555 TRP A CG    1 
ATOM   4393  C  CD1   . TRP A  1 555 ? 106.541 105.191 98.209  1.00 14.87 ? 555 TRP A CD1   1 
ATOM   4394  C  CD2   . TRP A  1 555 ? 106.422 105.460 95.997  1.00 14.87 ? 555 TRP A CD2   1 
ATOM   4395  N  NE1   . TRP A  1 555 ? 106.743 106.519 97.939  1.00 14.87 ? 555 TRP A NE1   1 
ATOM   4396  C  CE2   . TRP A  1 555 ? 106.674 106.709 96.586  1.00 14.87 ? 555 TRP A CE2   1 
ATOM   4397  C  CE3   . TRP A  1 555 ? 106.305 105.381 94.608  1.00 14.87 ? 555 TRP A CE3   1 
ATOM   4398  C  CZ2   . TRP A  1 555 ? 106.811 107.867 95.836  1.00 14.87 ? 555 TRP A CZ2   1 
ATOM   4399  C  CZ3   . TRP A  1 555 ? 106.441 106.530 93.869  1.00 14.87 ? 555 TRP A CZ3   1 
ATOM   4400  C  CH2   . TRP A  1 555 ? 106.692 107.757 94.482  1.00 14.87 ? 555 TRP A CH2   1 
ATOM   4401  N  N     . GLN A  1 556 ? 104.077 100.370 96.676  1.00 16.69 ? 556 GLN A N     1 
ATOM   4402  C  CA    . GLN A  1 556 ? 103.869 99.031  96.135  1.00 16.69 ? 556 GLN A CA    1 
ATOM   4403  C  C     . GLN A  1 556 ? 102.820 99.043  95.033  1.00 16.69 ? 556 GLN A C     1 
ATOM   4404  O  O     . GLN A  1 556 ? 102.990 98.396  93.991  1.00 16.69 ? 556 GLN A O     1 
ATOM   4405  C  CB    . GLN A  1 556 ? 103.457 98.077  97.252  1.00 16.69 ? 556 GLN A CB    1 
ATOM   4406  C  CG    . GLN A  1 556 ? 103.516 96.622  96.862  1.00 16.69 ? 556 GLN A CG    1 
ATOM   4407  C  CD    . GLN A  1 556 ? 104.917 96.074  96.928  1.00 16.69 ? 556 GLN A CD    1 
ATOM   4408  O  OE1   . GLN A  1 556 ? 105.736 96.536  97.718  1.00 16.69 ? 556 GLN A OE1   1 
ATOM   4409  N  NE2   . GLN A  1 556 ? 105.204 95.083  96.098  1.00 16.69 ? 556 GLN A NE2   1 
ATOM   4410  N  N     . LEU A  1 557 ? 101.746 99.809  95.233  1.00 17.19 ? 557 LEU A N     1 
ATOM   4411  C  CA    . LEU A  1 557 ? 100.721 99.958  94.207  1.00 17.19 ? 557 LEU A CA    1 
ATOM   4412  C  C     . LEU A  1 557 ? 101.261 100.692 92.988  1.00 17.19 ? 557 LEU A C     1 
ATOM   4413  O  O     . LEU A  1 557 ? 100.909 100.357 91.853  1.00 17.19 ? 557 LEU A O     1 
ATOM   4414  C  CB    . LEU A  1 557 ? 99.515  100.690 94.788  1.00 17.19 ? 557 LEU A CB    1 
ATOM   4415  C  CG    . LEU A  1 557 ? 98.365  100.994 93.834  1.00 17.19 ? 557 LEU A CG    1 
ATOM   4416  C  CD1   . LEU A  1 557 ? 97.707  99.707  93.378  1.00 17.19 ? 557 LEU A CD1   1 
ATOM   4417  C  CD2   . LEU A  1 557 ? 97.362  101.916 94.490  1.00 17.19 ? 557 LEU A CD2   1 
ATOM   4418  N  N     . ALA A  1 558 ? 102.154 101.663 93.198  1.00 16.09 ? 558 ALA A N     1 
ATOM   4419  C  CA    . ALA A  1 558 ? 102.727 102.403 92.078  1.00 16.09 ? 558 ALA A CA    1 
ATOM   4420  C  C     . ALA A  1 558 ? 103.663 101.530 91.253  1.00 16.09 ? 558 ALA A C     1 
ATOM   4421  O  O     . ALA A  1 558 ? 103.618 101.561 90.017  1.00 16.09 ? 558 ALA A O     1 
ATOM   4422  C  CB    . ALA A  1 558 ? 103.458 103.641 92.588  1.00 16.09 ? 558 ALA A CB    1 
ATOM   4423  N  N     . PHE A  1 559 ? 104.494 100.721 91.915  1.00 16.04 ? 559 PHE A N     1 
ATOM   4424  C  CA    . PHE A  1 559 ? 105.382 99.820  91.189  1.00 16.04 ? 559 PHE A CA    1 
ATOM   4425  C  C     . PHE A  1 559 ? 104.610 98.711  90.482  1.00 16.04 ? 559 PHE A C     1 
ATOM   4426  O  O     . PHE A  1 559 ? 104.967 98.330  89.359  1.00 16.04 ? 559 PHE A O     1 
ATOM   4427  C  CB    . PHE A  1 559 ? 106.422 99.232  92.140  1.00 16.04 ? 559 PHE A CB    1 
ATOM   4428  C  CG    . PHE A  1 559 ? 107.650 100.085 92.301  1.00 16.04 ? 559 PHE A CG    1 
ATOM   4429  C  CD1   . PHE A  1 559 ? 108.699 99.981  91.411  1.00 16.04 ? 559 PHE A CD1   1 
ATOM   4430  C  CD2   . PHE A  1 559 ? 107.756 100.983 93.346  1.00 16.04 ? 559 PHE A CD2   1 
ATOM   4431  C  CE1   . PHE A  1 559 ? 109.826 100.761 91.558  1.00 16.04 ? 559 PHE A CE1   1 
ATOM   4432  C  CE2   . PHE A  1 559 ? 108.876 101.766 93.499  1.00 16.04 ? 559 PHE A CE2   1 
ATOM   4433  C  CZ    . PHE A  1 559 ? 109.912 101.655 92.605  1.00 16.04 ? 559 PHE A CZ    1 
ATOM   4434  N  N     . GLU A  1 560 ? 103.527 98.212  91.088  1.00 18.13 ? 560 GLU A N     1 
ATOM   4435  C  CA    . GLU A  1 560 ? 102.712 97.213  90.404  1.00 18.13 ? 560 GLU A CA    1 
ATOM   4436  C  C     . GLU A  1 560 ? 101.938 97.813  89.234  1.00 18.13 ? 560 GLU A C     1 
ATOM   4437  O  O     . GLU A  1 560 ? 101.761 97.148  88.208  1.00 18.13 ? 560 GLU A O     1 
ATOM   4438  C  CB    . GLU A  1 560 ? 101.759 96.548  91.392  1.00 18.13 ? 560 GLU A CB    1 
ATOM   4439  C  CG    . GLU A  1 560 ? 102.442 95.562  92.320  1.00 18.13 ? 560 GLU A CG    1 
ATOM   4440  C  CD    . GLU A  1 560 ? 101.522 95.041  93.405  1.00 18.13 ? 560 GLU A CD    1 
ATOM   4441  O  OE1   . GLU A  1 560 ? 100.403 95.576  93.548  1.00 18.13 ? 560 GLU A OE1   1 
ATOM   4442  O  OE2   . GLU A  1 560 ? 101.920 94.096  94.117  1.00 18.13 ? 560 GLU A OE2   1 
ATOM   4443  N  N     . THR A  1 561 ? 101.504 99.071  89.348  1.00 17.89 ? 561 THR A N     1 
ATOM   4444  C  CA    . THR A  1 561 ? 100.831 99.728  88.233  1.00 17.89 ? 561 THR A CA    1 
ATOM   4445  C  C     . THR A  1 561 ? 101.803 99.996  87.090  1.00 17.89 ? 561 THR A C     1 
ATOM   4446  O  O     . THR A  1 561 ? 101.432 99.886  85.915  1.00 17.89 ? 561 THR A O     1 
ATOM   4447  C  CB    . THR A  1 561 ? 100.180 101.024 88.716  1.00 17.89 ? 561 THR A CB    1 
ATOM   4448  O  OG1   . THR A  1 561 ? 99.358  100.741 89.851  1.00 17.89 ? 561 THR A OG1   1 
ATOM   4449  C  CG2   . THR A  1 561 ? 99.309  101.635 87.638  1.00 17.89 ? 561 THR A CG2   1 
ATOM   4450  N  N     . MET A  1 562 ? 103.057 100.318 87.417  1.00 18.08 ? 562 MET A N     1 
ATOM   4451  C  CA    . MET A  1 562 ? 104.087 100.441 86.389  1.00 18.08 ? 562 MET A CA    1 
ATOM   4452  C  C     . MET A  1 562 ? 104.340 99.107  85.697  1.00 18.08 ? 562 MET A C     1 
ATOM   4453  O  O     . MET A  1 562 ? 104.439 99.045  84.465  1.00 18.08 ? 562 MET A O     1 
ATOM   4454  C  CB    . MET A  1 562 ? 105.375 100.977 87.005  1.00 18.08 ? 562 MET A CB    1 
ATOM   4455  C  CG    . MET A  1 562 ? 106.534 101.040 86.046  1.00 18.08 ? 562 MET A CG    1 
ATOM   4456  S  SD    . MET A  1 562 ? 106.171 102.133 84.671  1.00 18.08 ? 562 MET A SD    1 
ATOM   4457  C  CE    . MET A  1 562 ? 106.248 103.710 85.498  1.00 18.08 ? 562 MET A CE    1 
ATOM   4458  N  N     . SER A  1 563 ? 104.400 98.021  86.471  1.00 18.46 ? 563 SER A N     1 
ATOM   4459  C  CA    . SER A  1 563 ? 104.597 96.697  85.892  1.00 18.46 ? 563 SER A CA    1 
ATOM   4460  C  C     . SER A  1 563 ? 103.390 96.193  85.108  1.00 18.46 ? 563 SER A C     1 
ATOM   4461  O  O     . SER A  1 563 ? 103.546 95.274  84.300  1.00 18.46 ? 563 SER A O     1 
ATOM   4462  C  CB    . SER A  1 563 ? 104.941 95.693  86.988  1.00 18.46 ? 563 SER A CB    1 
ATOM   4463  O  OG    . SER A  1 563 ? 104.645 94.376  86.566  1.00 18.46 ? 563 SER A OG    1 
ATOM   4464  N  N     . VAL A  1 564 ? 102.203 96.748  85.333  1.00 17.80 ? 564 VAL A N     1 
ATOM   4465  C  CA    . VAL A  1 564 ? 101.024 96.410  84.542  1.00 17.80 ? 564 VAL A CA    1 
ATOM   4466  C  C     . VAL A  1 564 ? 100.949 97.232  83.258  1.00 17.80 ? 564 VAL A C     1 
ATOM   4467  O  O     . VAL A  1 564 ? 100.645 96.690  82.194  1.00 17.80 ? 564 VAL A O     1 
ATOM   4468  C  CB    . VAL A  1 564 ? 99.751  96.570  85.405  1.00 17.80 ? 564 VAL A CB    1 
ATOM   4469  C  CG1   . VAL A  1 564 ? 98.490  96.626  84.563  1.00 17.80 ? 564 VAL A CG1   1 
ATOM   4470  C  CG2   . VAL A  1 564 ? 99.645  95.413  86.375  1.00 17.80 ? 564 VAL A CG2   1 
ATOM   4471  N  N     . ILE A  1 565 ? 101.263 98.530  83.333  1.00 18.63 ? 565 ILE A N     1 
ATOM   4472  C  CA    . ILE A  1 565 ? 101.309 99.391  82.148  1.00 18.63 ? 565 ILE A CA    1 
ATOM   4473  C  C     . ILE A  1 565 ? 102.400 98.934  81.184  1.00 18.63 ? 565 ILE A C     1 
ATOM   4474  O  O     . ILE A  1 565 ? 102.220 98.966  79.952  1.00 18.63 ? 565 ILE A O     1 
ATOM   4475  C  CB    . ILE A  1 565 ? 101.498 100.857 82.599  1.00 18.63 ? 565 ILE A CB    1 
ATOM   4476  C  CG1   . ILE A  1 565 ? 100.217 101.382 83.239  1.00 18.63 ? 565 ILE A CG1   1 
ATOM   4477  C  CG2   . ILE A  1 565 ? 101.896 101.773 81.457  1.00 18.63 ? 565 ILE A CG2   1 
ATOM   4478  C  CD1   . ILE A  1 565 ? 100.374 102.737 83.877  1.00 18.63 ? 565 ILE A CD1   1 
ATOM   4479  N  N     . SER A  1 566 ? 103.513 98.430  81.722  1.00 21.00 ? 566 SER A N     1 
ATOM   4480  C  CA    . SER A  1 566 ? 104.606 97.978  80.876  1.00 21.00 ? 566 SER A CA    1 
ATOM   4481  C  C     . SER A  1 566 ? 104.276 96.714  80.093  1.00 21.00 ? 566 SER A C     1 
ATOM   4482  O  O     . SER A  1 566 ? 104.922 96.466  79.076  1.00 21.00 ? 566 SER A O     1 
ATOM   4483  C  CB    . SER A  1 566 ? 105.851 97.757  81.721  1.00 21.00 ? 566 SER A CB    1 
ATOM   4484  O  OG    . SER A  1 566 ? 105.889 96.441  82.229  1.00 21.00 ? 566 SER A OG    1 
ATOM   4485  N  N     . VAL A  1 567 ? 103.265 95.945  80.506  1.00 21.94 ? 567 VAL A N     1 
ATOM   4486  C  CA    . VAL A  1 567 ? 102.812 94.802  79.712  1.00 21.94 ? 567 VAL A CA    1 
ATOM   4487  C  C     . VAL A  1 567 ? 102.215 95.275  78.393  1.00 21.94 ? 567 VAL A C     1 
ATOM   4488  O  O     . VAL A  1 567 ? 102.587 94.793  77.314  1.00 21.94 ? 567 VAL A O     1 
ATOM   4489  C  CB    . VAL A  1 567 ? 101.798 93.964  80.509  1.00 21.94 ? 567 VAL A CB    1 
ATOM   4490  C  CG1   . VAL A  1 567 ? 101.073 92.990  79.605  1.00 21.94 ? 567 VAL A CG1   1 
ATOM   4491  C  CG2   . VAL A  1 567 ? 102.480 93.228  81.619  1.00 21.94 ? 567 VAL A CG2   1 
ATOM   4492  N  N     . VAL A  1 568 ? 101.295 96.242  78.467  1.00 24.39 ? 568 VAL A N     1 
ATOM   4493  C  CA    . VAL A  1 568 ? 100.656 96.790  77.274  1.00 24.39 ? 568 VAL A CA    1 
ATOM   4494  C  C     . VAL A  1 568 ? 101.673 97.522  76.409  1.00 24.39 ? 568 VAL A C     1 
ATOM   4495  O  O     . VAL A  1 568 ? 101.655 97.406  75.177  1.00 24.39 ? 568 VAL A O     1 
ATOM   4496  C  CB    . VAL A  1 568 ? 99.489  97.709  77.678  1.00 24.39 ? 568 VAL A CB    1 
ATOM   4497  C  CG1   . VAL A  1 568 ? 98.718  98.166  76.460  1.00 24.39 ? 568 VAL A CG1   1 
ATOM   4498  C  CG2   . VAL A  1 568 ? 98.572  96.995  78.645  1.00 24.39 ? 568 VAL A CG2   1 
ATOM   4499  N  N     . THR A  1 569 ? 102.606 98.243  77.040  1.00 25.24 ? 569 THR A N     1 
ATOM   4500  C  CA    . THR A  1 569 ? 103.601 98.980  76.263  1.00 25.24 ? 569 THR A CA    1 
ATOM   4501  C  C     . THR A  1 569 ? 104.591 98.038  75.576  1.00 25.24 ? 569 THR A C     1 
ATOM   4502  O  O     . THR A  1 569 ? 104.934 98.238  74.402  1.00 25.24 ? 569 THR A O     1 
ATOM   4503  C  CB    . THR A  1 569 ? 104.324 99.978  77.163  1.00 25.24 ? 569 THR A CB    1 
ATOM   4504  O  OG1   . THR A  1 569 ? 103.360 100.847 77.764  1.00 25.24 ? 569 THR A OG1   1 
ATOM   4505  C  CG2   . THR A  1 569 ? 105.280 100.827 76.358  1.00 25.24 ? 569 THR A CG2   1 
ATOM   4506  N  N     . ASN A  1 570 ? 105.009 96.969  76.264  1.00 27.43 ? 570 ASN A N     1 
ATOM   4507  C  CA    . ASN A  1 570 ? 105.919 96.000  75.666  1.00 27.43 ? 570 ASN A CA    1 
ATOM   4508  C  C     . ASN A  1 570 ? 105.247 95.214  74.550  1.00 27.43 ? 570 ASN A C     1 
ATOM   4509  O  O     . ASN A  1 570 ? 105.878 94.924  73.531  1.00 27.43 ? 570 ASN A O     1 
ATOM   4510  C  CB    . ASN A  1 570 ? 106.448 95.048  76.735  1.00 27.43 ? 570 ASN A CB    1 
ATOM   4511  C  CG    . ASN A  1 570 ? 107.695 95.567  77.401  1.00 27.43 ? 570 ASN A CG    1 
ATOM   4512  O  OD1   . ASN A  1 570 ? 108.270 96.561  76.969  1.00 27.43 ? 570 ASN A OD1   1 
ATOM   4513  N  ND2   . ASN A  1 570 ? 108.125 94.894  78.460  1.00 27.43 ? 570 ASN A ND2   1 
ATOM   4514  N  N     . CYS A  1 571 ? 103.963 94.881  74.702  1.00 29.50 ? 571 CYS A N     1 
ATOM   4515  C  CA    . CYS A  1 571 ? 103.289 94.156  73.630  1.00 29.50 ? 571 CYS A CA    1 
ATOM   4516  C  C     . CYS A  1 571 ? 102.999 95.056  72.434  1.00 29.50 ? 571 CYS A C     1 
ATOM   4517  O  O     . CYS A  1 571 ? 103.066 94.597  71.286  1.00 29.50 ? 571 CYS A O     1 
ATOM   4518  C  CB    . CYS A  1 571 ? 102.013 93.511  74.158  1.00 29.50 ? 571 CYS A CB    1 
ATOM   4519  S  SG    . CYS A  1 571 ? 102.346 92.058  75.175  1.00 29.50 ? 571 CYS A SG    1 
ATOM   4520  N  N     . ALA A  1 572 ? 102.720 96.340  72.669  1.00 29.94 ? 572 ALA A N     1 
ATOM   4521  C  CA    . ALA A  1 572 ? 102.569 97.268  71.557  1.00 29.94 ? 572 ALA A CA    1 
ATOM   4522  C  C     . ALA A  1 572 ? 103.890 97.555  70.860  1.00 29.94 ? 572 ALA A C     1 
ATOM   4523  O  O     . ALA A  1 572 ? 103.886 97.906  69.678  1.00 29.94 ? 572 ALA A O     1 
ATOM   4524  C  CB    . ALA A  1 572 ? 101.946 98.573  72.041  1.00 29.94 ? 572 ALA A CB    1 
ATOM   4525  N  N     . LEU A  1 573 ? 105.016 97.422  71.560  1.00 31.97 ? 573 LEU A N     1 
ATOM   4526  C  CA    . LEU A  1 573 ? 106.313 97.509  70.901  1.00 31.97 ? 573 LEU A CA    1 
ATOM   4527  C  C     . LEU A  1 573 ? 106.717 96.213  70.214  1.00 31.97 ? 573 LEU A C     1 
ATOM   4528  O  O     . LEU A  1 573 ? 107.535 96.249  69.289  1.00 31.97 ? 573 LEU A O     1 
ATOM   4529  C  CB    . LEU A  1 573 ? 107.394 97.904  71.906  1.00 31.97 ? 573 LEU A CB    1 
ATOM   4530  C  CG    . LEU A  1 573 ? 107.373 99.369  72.324  1.00 31.97 ? 573 LEU A CG    1 
ATOM   4531  C  CD1   . LEU A  1 573 ? 108.366 99.595  73.433  1.00 31.97 ? 573 LEU A CD1   1 
ATOM   4532  C  CD2   . LEU A  1 573 ? 107.684 100.254 71.140  1.00 31.97 ? 573 LEU A CD2   1 
ATOM   4533  N  N     . ILE A  1 574 ? 106.184 95.075  70.660  1.00 34.33 ? 574 ILE A N     1 
ATOM   4534  C  CA    . ILE A  1 574 ? 106.375 93.821  69.936  1.00 34.33 ? 574 ILE A CA    1 
ATOM   4535  C  C     . ILE A  1 574 ? 105.620 93.861  68.616  1.00 34.33 ? 574 ILE A C     1 
ATOM   4536  O  O     . ILE A  1 574 ? 106.166 93.531  67.556  1.00 34.33 ? 574 ILE A O     1 
ATOM   4537  C  CB    . ILE A  1 574 ? 105.931 92.629  70.803  1.00 34.33 ? 574 ILE A CB    1 
ATOM   4538  C  CG1   . ILE A  1 574 ? 106.954 92.349  71.894  1.00 34.33 ? 574 ILE A CG1   1 
ATOM   4539  C  CG2   . ILE A  1 574 ? 105.739 91.377  69.970  1.00 34.33 ? 574 ILE A CG2   1 
ATOM   4540  C  CD1   . ILE A  1 574 ? 106.414 91.469  72.980  1.00 34.33 ? 574 ILE A CD1   1 
ATOM   4541  N  N     . GLY A  1 575 ? 104.370 94.315  68.651  1.00 40.03 ? 575 GLY A N     1 
ATOM   4542  C  CA    . GLY A  1 575 ? 103.549 94.360  67.454  1.00 40.03 ? 575 GLY A CA    1 
ATOM   4543  C  C     . GLY A  1 575 ? 103.818 95.509  66.498  1.00 40.03 ? 575 GLY A C     1 
ATOM   4544  O  O     . GLY A  1 575 ? 102.953 95.858  65.691  1.00 40.03 ? 575 GLY A O     1 
ATOM   4545  N  N     . MET A  1 576 ? 105.006 96.108  66.574  1.00 42.83 ? 576 MET A N     1 
ATOM   4546  C  CA    . MET A  1 576 ? 105.432 97.136  65.635  1.00 42.83 ? 576 MET A CA    1 
ATOM   4547  C  C     . MET A  1 576 ? 106.825 96.901  65.084  1.00 42.83 ? 576 MET A C     1 
ATOM   4548  O  O     . MET A  1 576 ? 107.250 97.652  64.201  1.00 42.83 ? 576 MET A O     1 
ATOM   4549  C  CB    . MET A  1 576 ? 105.398 98.520  66.294  1.00 42.83 ? 576 MET A CB    1 
ATOM   4550  C  CG    . MET A  1 576 ? 104.016 99.062  66.538  1.00 42.83 ? 576 MET A CG    1 
ATOM   4551  S  SD    . MET A  1 576 ? 104.082 100.722 67.216  1.00 42.83 ? 576 MET A SD    1 
ATOM   4552  C  CE    . MET A  1 576 ? 102.347 101.009 67.512  1.00 42.83 ? 576 MET A CE    1 
ATOM   4553  N  N     . SER A  1 577 ? 107.552 95.905  65.575  1.00 46.50 ? 577 SER A N     1 
ATOM   4554  C  CA    . SER A  1 577 ? 108.907 95.661  65.124  1.00 46.50 ? 577 SER A CA    1 
ATOM   4555  C  C     . SER A  1 577 ? 108.893 95.003  63.745  1.00 46.50 ? 577 SER A C     1 
ATOM   4556  O  O     . SER A  1 577 ? 107.908 94.367  63.364  1.00 46.50 ? 577 SER A O     1 
ATOM   4557  C  CB    . SER A  1 577 ? 109.630 94.765  66.123  1.00 46.50 ? 577 SER A CB    1 
ATOM   4558  O  OG    . SER A  1 577 ? 108.803 93.684  66.512  1.00 46.50 ? 577 SER A OG    1 
ATOM   4559  N  N     . PRO A  1 578 ? 109.974 95.144  62.969  1.00 53.33 ? 578 PRO A N     1 
ATOM   4560  C  CA    . PRO A  1 578 ? 110.060 94.406  61.700  1.00 53.33 ? 578 PRO A CA    1 
ATOM   4561  C  C     . PRO A  1 578 ? 110.315 92.918  61.870  1.00 53.33 ? 578 PRO A C     1 
ATOM   4562  O  O     . PRO A  1 578 ? 110.227 92.182  60.880  1.00 53.33 ? 578 PRO A O     1 
ATOM   4563  C  CB    . PRO A  1 578 ? 111.226 95.088  60.975  1.00 53.33 ? 578 PRO A CB    1 
ATOM   4564  C  CG    . PRO A  1 578 ? 112.032 95.708  62.057  1.00 53.33 ? 578 PRO A CG    1 
ATOM   4565  C  CD    . PRO A  1 578 ? 111.044 96.151  63.084  1.00 53.33 ? 578 PRO A CD    1 
ATOM   4566  N  N     . GLN A  1 579 ? 110.624 92.450  63.080  1.00 55.04 ? 579 GLN A N     1 
ATOM   4567  C  CA    . GLN A  1 579 ? 110.848 91.025  63.295  1.00 55.04 ? 579 GLN A CA    1 
ATOM   4568  C  C     . GLN A  1 579 ? 109.539 90.253  63.366  1.00 55.04 ? 579 GLN A C     1 
ATOM   4569  O  O     . GLN A  1 579 ? 109.405 89.195  62.742  1.00 55.04 ? 579 GLN A O     1 
ATOM   4570  C  CB    . GLN A  1 579 ? 111.650 90.808  64.577  1.00 55.04 ? 579 GLN A CB    1 
ATOM   4571  C  CG    . GLN A  1 579 ? 113.045 91.390  64.547  1.00 55.04 ? 579 GLN A CG    1 
ATOM   4572  C  CD    . GLN A  1 579 ? 113.925 90.714  63.523  1.00 55.04 ? 579 GLN A CD    1 
ATOM   4573  O  OE1   . GLN A  1 579 ? 113.833 89.504  63.312  1.00 55.04 ? 579 GLN A OE1   1 
ATOM   4574  N  NE2   . GLN A  1 579 ? 114.792 91.489  62.882  1.00 55.04 ? 579 GLN A NE2   1 
ATOM   4575  N  N     . VAL A  1 580 ? 108.567 90.760  64.122  1.00 50.92 ? 580 VAL A N     1 
ATOM   4576  C  CA    . VAL A  1 580 ? 107.316 90.034  64.297  1.00 50.92 ? 580 VAL A CA    1 
ATOM   4577  C  C     . VAL A  1 580 ? 106.425 90.206  63.070  1.00 50.92 ? 580 VAL A C     1 
ATOM   4578  O  O     . VAL A  1 580 ? 105.662 89.300  62.717  1.00 50.92 ? 580 VAL A O     1 
ATOM   4579  C  CB    . VAL A  1 580 ? 106.629 90.504  65.593  1.00 50.92 ? 580 VAL A CB    1 
ATOM   4580  C  CG1   . VAL A  1 580 ? 105.385 89.689  65.900  1.00 50.92 ? 580 VAL A CG1   1 
ATOM   4581  C  CG2   . VAL A  1 580 ? 107.603 90.443  66.755  1.00 50.92 ? 580 VAL A CG2   1 
ATOM   4582  N  N     . ASN A  1 581 ? 106.544 91.337  62.369  1.00 53.63 ? 581 ASN A N     1 
ATOM   4583  C  CA    . ASN A  1 581 ? 105.742 91.570  61.173  1.00 53.63 ? 581 ASN A CA    1 
ATOM   4584  C  C     . ASN A  1 581 ? 106.166 90.699  59.997  1.00 53.63 ? 581 ASN A C     1 
ATOM   4585  O  O     . ASN A  1 581 ? 105.396 90.558  59.041  1.00 53.63 ? 581 ASN A O     1 
ATOM   4586  C  CB    . ASN A  1 581 ? 105.810 93.041  60.772  1.00 53.63 ? 581 ASN A CB    1 
ATOM   4587  C  CG    . ASN A  1 581 ? 104.872 93.902  61.577  1.00 53.63 ? 581 ASN A CG    1 
ATOM   4588  O  OD1   . ASN A  1 581 ? 103.732 94.134  61.182  1.00 53.63 ? 581 ASN A OD1   1 
ATOM   4589  N  ND2   . ASN A  1 581 ? 105.343 94.379  62.719  1.00 53.63 ? 581 ASN A ND2   1 
ATOM   4590  N  N     . ALA A  1 582 ? 107.365 90.114  60.039  1.00 56.25 ? 582 ALA A N     1 
ATOM   4591  C  CA    . ALA A  1 582 ? 107.765 89.166  59.007  1.00 56.25 ? 582 ALA A CA    1 
ATOM   4592  C  C     . ALA A  1 582 ? 107.050 87.829  59.145  1.00 56.25 ? 582 ALA A C     1 
ATOM   4593  O  O     . ALA A  1 582 ? 107.029 87.050  58.187  1.00 56.25 ? 582 ALA A O     1 
ATOM   4594  C  CB    . ALA A  1 582 ? 109.278 88.953  59.043  1.00 56.25 ? 582 ALA A CB    1 
ATOM   4595  N  N     . VAL A  1 583 ? 106.470 87.546  60.312  1.00 53.56 ? 583 VAL A N     1 
ATOM   4596  C  CA    . VAL A  1 583 ? 105.703 86.318  60.489  1.00 53.56 ? 583 VAL A CA    1 
ATOM   4597  C  C     . VAL A  1 583 ? 104.358 86.428  59.782  1.00 53.56 ? 583 VAL A C     1 
ATOM   4598  O  O     . VAL A  1 583 ? 103.913 85.489  59.109  1.00 53.56 ? 583 VAL A O     1 
ATOM   4599  C  CB    . VAL A  1 583 ? 105.541 86.016  61.990  1.00 53.56 ? 583 VAL A CB    1 
ATOM   4600  C  CG1   . VAL A  1 583 ? 104.658 84.802  62.213  1.00 53.56 ? 583 VAL A CG1   1 
ATOM   4601  C  CG2   . VAL A  1 583 ? 106.895 85.812  62.627  1.00 53.56 ? 583 VAL A CG2   1 
ATOM   4602  N  N     . PHE A  1 584 ? 103.699 87.583  59.902  1.00 55.28 ? 584 PHE A N     1 
ATOM   4603  C  CA    . PHE A  1 584 ? 102.399 87.845  59.287  1.00 55.28 ? 584 PHE A CA    1 
ATOM   4604  C  C     . PHE A  1 584 ? 102.566 89.008  58.316  1.00 55.28 ? 584 PHE A C     1 
ATOM   4605  O  O     . PHE A  1 584 ? 102.258 90.160  58.657  1.00 55.28 ? 584 PHE A O     1 
ATOM   4606  C  CB    . PHE A  1 584 ? 101.331 88.164  60.334  1.00 55.28 ? 584 PHE A CB    1 
ATOM   4607  C  CG    . PHE A  1 584 ? 101.435 87.344  61.588  1.00 55.28 ? 584 PHE A CG    1 
ATOM   4608  C  CD1   . PHE A  1 584 ? 100.827 86.103  61.670  1.00 55.28 ? 584 PHE A CD1   1 
ATOM   4609  C  CD2   . PHE A  1 584 ? 102.115 87.825  62.697  1.00 55.28 ? 584 PHE A CD2   1 
ATOM   4610  C  CE1   . PHE A  1 584 ? 100.913 85.349  62.827  1.00 55.28 ? 584 PHE A CE1   1 
ATOM   4611  C  CE2   . PHE A  1 584 ? 102.207 87.075  63.853  1.00 55.28 ? 584 PHE A CE2   1 
ATOM   4612  C  CZ    . PHE A  1 584 ? 101.605 85.838  63.918  1.00 55.28 ? 584 PHE A CZ    1 
ATOM   4613  N  N     . PRO A  1 585 ? 103.053 88.752  57.098  1.00 57.75 ? 585 PRO A N     1 
ATOM   4614  C  CA    . PRO A  1 585 ? 103.343 89.859  56.178  1.00 57.75 ? 585 PRO A CA    1 
ATOM   4615  C  C     . PRO A  1 585 ? 102.100 90.437  55.521  1.00 57.75 ? 585 PRO A C     1 
ATOM   4616  O  O     . PRO A  1 585 ? 102.020 91.648  55.297  1.00 57.75 ? 585 PRO A O     1 
ATOM   4617  C  CB    . PRO A  1 585 ? 104.274 89.219  55.136  1.00 57.75 ? 585 PRO A CB    1 
ATOM   4618  C  CG    . PRO A  1 585 ? 104.562 87.820  55.635  1.00 57.75 ? 585 PRO A CG    1 
ATOM   4619  C  CD    . PRO A  1 585 ? 103.417 87.455  56.511  1.00 57.75 ? 585 PRO A CD    1 
ATOM   4620  N  N     . GLU A  1 586 ? 101.126 89.585  55.208  1.00 58.25 ? 586 GLU A N     1 
ATOM   4621  C  CA    . GLU A  1 586 ? 99.949  90.025  54.469  1.00 58.25 ? 586 GLU A CA    1 
ATOM   4622  C  C     . GLU A  1 586 ? 98.749  90.281  55.372  1.00 58.25 ? 586 GLU A C     1 
ATOM   4623  O  O     . GLU A  1 586 ? 97.981  91.218  55.127  1.00 58.25 ? 586 GLU A O     1 
ATOM   4624  C  CB    . GLU A  1 586 ? 99.582  88.989  53.404  1.00 58.25 ? 586 GLU A CB    1 
ATOM   4625  N  N     . SER A  1 587 ? 98.572  89.473  56.412  1.00 55.75 ? 587 SER A N     1 
ATOM   4626  C  CA    . SER A  1 587 ? 97.411  89.552  57.295  1.00 55.75 ? 587 SER A CA    1 
ATOM   4627  C  C     . SER A  1 587 ? 97.838  90.228  58.595  1.00 55.75 ? 587 SER A C     1 
ATOM   4628  O  O     . SER A  1 587 ? 98.320  89.576  59.522  1.00 55.75 ? 587 SER A O     1 
ATOM   4629  C  CB    . SER A  1 587 ? 96.833  88.168  57.554  1.00 55.75 ? 587 SER A CB    1 
ATOM   4630  O  OG    . SER A  1 587 ? 97.703  87.403  58.368  1.00 55.75 ? 587 SER A OG    1 
ATOM   4631  N  N     . LYS A  1 588 ? 97.649  91.545  58.661  1.00 51.38 ? 588 LYS A N     1 
ATOM   4632  C  CA    . LYS A  1 588 ? 97.933  92.318  59.861  1.00 51.38 ? 588 LYS A CA    1 
ATOM   4633  C  C     . LYS A  1 588 ? 96.755  92.361  60.824  1.00 51.38 ? 588 LYS A C     1 
ATOM   4634  O  O     . LYS A  1 588 ? 96.785  93.129  61.791  1.00 51.38 ? 588 LYS A O     1 
ATOM   4635  C  CB    . LYS A  1 588 ? 98.351  93.742  59.490  1.00 51.38 ? 588 LYS A CB    1 
ATOM   4636  C  CG    . LYS A  1 588 ? 99.507  93.815  58.515  1.00 51.38 ? 588 LYS A CG    1 
ATOM   4637  C  CD    . LYS A  1 588 ? 100.744 93.157  59.086  1.00 51.38 ? 588 LYS A CD    1 
ATOM   4638  C  CE    . LYS A  1 588 ? 101.961 93.454  58.234  1.00 51.38 ? 588 LYS A CE    1 
ATOM   4639  N  NZ    . LYS A  1 588 ? 103.129 92.637  58.653  1.00 51.38 ? 588 LYS A NZ    1 
ATOM   4640  N  N     . ALA A  1 589 ? 95.716  91.565  60.579  1.00 50.69 ? 589 ALA A N     1 
ATOM   4641  C  CA    . ALA A  1 589 ? 94.589  91.463  61.491  1.00 50.69 ? 589 ALA A CA    1 
ATOM   4642  C  C     . ALA A  1 589 ? 94.686  90.264  62.419  1.00 50.69 ? 589 ALA A C     1 
ATOM   4643  O  O     . ALA A  1 589 ? 93.976  90.226  63.429  1.00 50.69 ? 589 ALA A O     1 
ATOM   4644  C  CB    . ALA A  1 589 ? 93.272  91.392  60.706  1.00 50.69 ? 589 ALA A CB    1 
ATOM   4645  N  N     . ASP A  1 590 ? 95.537  89.291  62.106  1.00 47.89 ? 590 ASP A N     1 
ATOM   4646  C  CA    . ASP A  1 590 ? 95.793  88.174  63.003  1.00 47.89 ? 590 ASP A CA    1 
ATOM   4647  C  C     . ASP A  1 590 ? 96.972  88.466  63.920  1.00 47.89 ? 590 ASP A C     1 
ATOM   4648  O  O     . ASP A  1 590 ? 97.058  87.901  65.018  1.00 47.89 ? 590 ASP A O     1 
ATOM   4649  C  CB    . ASP A  1 590 ? 96.055  86.905  62.185  1.00 47.89 ? 590 ASP A CB    1 
ATOM   4650  C  CG    . ASP A  1 590 ? 95.868  85.627  62.987  1.00 47.89 ? 590 ASP A CG    1 
ATOM   4651  O  OD1   . ASP A  1 590 ? 95.483  85.696  64.172  1.00 47.89 ? 590 ASP A OD1   1 
ATOM   4652  O  OD2   . ASP A  1 590 ? 96.106  84.540  62.420  1.00 47.89 ? 590 ASP A OD2   1 
ATOM   4653  N  N     . LEU A  1 591 ? 97.866  89.363  63.492  1.00 44.27 ? 591 LEU A N     1 
ATOM   4654  C  CA    . LEU A  1 591 ? 98.992  89.773  64.325  1.00 44.27 ? 591 LEU A CA    1 
ATOM   4655  C  C     . LEU A  1 591 ? 98.517  90.527  65.559  1.00 44.27 ? 591 LEU A C     1 
ATOM   4656  O  O     . LEU A  1 591 ? 99.006  90.283  66.669  1.00 44.27 ? 591 LEU A O     1 
ATOM   4657  C  CB    . LEU A  1 591 ? 99.953  90.634  63.506  1.00 44.27 ? 591 LEU A CB    1 
ATOM   4658  C  CG    . LEU A  1 591 ? 100.884 91.582  64.260  1.00 44.27 ? 591 LEU A CG    1 
ATOM   4659  C  CD1   . LEU A  1 591 ? 101.985 90.806  64.944  1.00 44.27 ? 591 LEU A CD1   1 
ATOM   4660  C  CD2   . LEU A  1 591 ? 101.466 92.620  63.325  1.00 44.27 ? 591 LEU A CD2   1 
ATOM   4661  N  N     . ILE A  1 592 ? 97.551  91.432  65.382  1.00 39.32 ? 592 ILE A N     1 
ATOM   4662  C  CA    . ILE A  1 592 ? 97.010  92.195  66.502  1.00 39.32 ? 592 ILE A CA    1 
ATOM   4663  C  C     . ILE A  1 592 ? 96.263  91.281  67.462  1.00 39.32 ? 592 ILE A C     1 
ATOM   4664  O  O     . ILE A  1 592 ? 96.370  91.429  68.683  1.00 39.32 ? 592 ILE A O     1 
ATOM   4665  C  CB    . ILE A  1 592 ? 96.113  93.328  65.978  1.00 39.32 ? 592 ILE A CB    1 
ATOM   4666  C  CG1   . ILE A  1 592 ? 96.876  94.166  64.958  1.00 39.32 ? 592 ILE A CG1   1 
ATOM   4667  C  CG2   . ILE A  1 592 ? 95.628  94.206  67.114  1.00 39.32 ? 592 ILE A CG2   1 
ATOM   4668  C  CD1   . ILE A  1 592 ? 96.044  95.244  64.323  1.00 39.32 ? 592 ILE A CD1   1 
ATOM   4669  N  N     . LEU A  1 593 ? 95.546  90.288  66.931  1.00 38.37 ? 593 LEU A N     1 
ATOM   4670  C  CA    . LEU A  1 593 ? 94.821  89.353  67.786  1.00 38.37 ? 593 LEU A CA    1 
ATOM   4671  C  C     . LEU A  1 593 ? 95.770  88.457  68.570  1.00 38.37 ? 593 LEU A C     1 
ATOM   4672  O  O     . LEU A  1 593 ? 95.539  88.194  69.755  1.00 38.37 ? 593 LEU A O     1 
ATOM   4673  C  CB    . LEU A  1 593 ? 93.863  88.512  66.948  1.00 38.37 ? 593 LEU A CB    1 
ATOM   4674  C  CG    . LEU A  1 593 ? 92.505  89.150  66.676  1.00 38.37 ? 593 LEU A CG    1 
ATOM   4675  C  CD1   . LEU A  1 593 ? 91.656  88.230  65.824  1.00 38.37 ? 593 LEU A CD1   1 
ATOM   4676  C  CD2   . LEU A  1 593 ? 91.804  89.473  67.980  1.00 38.37 ? 593 LEU A CD2   1 
ATOM   4677  N  N     . ILE A  1 594 ? 96.861  88.012  67.942  1.00 32.96 ? 594 ILE A N     1 
ATOM   4678  C  CA    . ILE A  1 594 ? 97.825  87.169  68.645  1.00 32.96 ? 594 ILE A CA    1 
ATOM   4679  C  C     . ILE A  1 594 ? 98.589  87.973  69.695  1.00 32.96 ? 594 ILE A C     1 
ATOM   4680  O  O     . ILE A  1 594 ? 98.817  87.486  70.811  1.00 32.96 ? 594 ILE A O     1 
ATOM   4681  C  CB    . ILE A  1 594 ? 98.753  86.489  67.618  1.00 32.96 ? 594 ILE A CB    1 
ATOM   4682  C  CG1   . ILE A  1 594 ? 98.009  85.338  66.942  1.00 32.96 ? 594 ILE A CG1   1 
ATOM   4683  C  CG2   . ILE A  1 594 ? 100.036 85.971  68.252  1.00 32.96 ? 594 ILE A CG2   1 
ATOM   4684  C  CD1   . ILE A  1 594 ? 98.796  84.644  65.867  1.00 32.96 ? 594 ILE A CD1   1 
ATOM   4685  N  N     . VAL A  1 595 ? 98.930  89.230  69.390  1.00 29.83 ? 595 VAL A N     1 
ATOM   4686  C  CA    . VAL A  1 595 ? 99.631  90.076  70.355  1.00 29.83 ? 595 VAL A CA    1 
ATOM   4687  C  C     . VAL A  1 595 ? 98.720  90.426  71.531  1.00 29.83 ? 595 VAL A C     1 
ATOM   4688  O  O     . VAL A  1 595 ? 99.149  90.401  72.690  1.00 29.83 ? 595 VAL A O     1 
ATOM   4689  C  CB    . VAL A  1 595 ? 100.185 91.326  69.643  1.00 29.83 ? 595 VAL A CB    1 
ATOM   4690  C  CG1   . VAL A  1 595 ? 100.510 92.437  70.619  1.00 29.83 ? 595 VAL A CG1   1 
ATOM   4691  C  CG2   . VAL A  1 595 ? 101.425 90.964  68.854  1.00 29.83 ? 595 VAL A CG2   1 
ATOM   4692  N  N     . VAL A  1 596 ? 97.437  90.685  71.263  1.00 26.92 ? 596 VAL A N     1 
ATOM   4693  C  CA    . VAL A  1 596 ? 96.485  90.977  72.332  1.00 26.92 ? 596 VAL A CA    1 
ATOM   4694  C  C     . VAL A  1 596 ? 96.209  89.734  73.176  1.00 26.92 ? 596 VAL A C     1 
ATOM   4695  O  O     . VAL A  1 596 ? 96.065  89.829  74.403  1.00 26.92 ? 596 VAL A O     1 
ATOM   4696  C  CB    . VAL A  1 596 ? 95.211  91.588  71.711  1.00 26.92 ? 596 VAL A CB    1 
ATOM   4697  C  CG1   . VAL A  1 596 ? 93.997  91.459  72.615  1.00 26.92 ? 596 VAL A CG1   1 
ATOM   4698  C  CG2   . VAL A  1 596 ? 95.454  93.046  71.388  1.00 26.92 ? 596 VAL A CG2   1 
ATOM   4699  N  N     . ALA A  1 597 ? 96.204  88.547  72.560  1.00 24.54 ? 597 ALA A N     1 
ATOM   4700  C  CA    . ALA A  1 597 ? 96.036  87.317  73.328  1.00 24.54 ? 597 ALA A CA    1 
ATOM   4701  C  C     . ALA A  1 597 ? 97.246  87.038  74.212  1.00 24.54 ? 597 ALA A C     1 
ATOM   4702  O  O     . ALA A  1 597 ? 97.091  86.610  75.361  1.00 24.54 ? 597 ALA A O     1 
ATOM   4703  C  CB    . ALA A  1 597 ? 95.780  86.143  72.386  1.00 24.54 ? 597 ALA A CB    1 
ATOM   4704  N  N     . VAL A  1 598 ? 98.453  87.305  73.704  1.00 24.45 ? 598 VAL A N     1 
ATOM   4705  C  CA    . VAL A  1 598 ? 99.664  87.152  74.510  1.00 24.45 ? 598 VAL A CA    1 
ATOM   4706  C  C     . VAL A  1 598 ? 99.685  88.174  75.644  1.00 24.45 ? 598 VAL A C     1 
ATOM   4707  O  O     . VAL A  1 598 ? 100.068 87.858  76.776  1.00 24.45 ? 598 VAL A O     1 
ATOM   4708  C  CB    . VAL A  1 598 ? 100.906 87.252  73.599  1.00 24.45 ? 598 VAL A CB    1 
ATOM   4709  C  CG1   . VAL A  1 598 ? 102.182 87.511  74.386  1.00 24.45 ? 598 VAL A CG1   1 
ATOM   4710  C  CG2   . VAL A  1 598 ? 101.055 85.982  72.782  1.00 24.45 ? 598 VAL A CG2   1 
ATOM   4711  N  N     . GLU A  1 599 ? 99.197  89.388  75.376  1.00 24.80 ? 599 GLU A N     1 
ATOM   4712  C  CA    . GLU A  1 599 ? 99.137  90.439  76.389  1.00 24.80 ? 599 GLU A CA    1 
ATOM   4713  C  C     . GLU A  1 599 ? 98.145  90.103  77.499  1.00 24.80 ? 599 GLU A C     1 
ATOM   4714  O  O     . GLU A  1 599 ? 98.448  90.283  78.685  1.00 24.80 ? 599 GLU A O     1 
ATOM   4715  C  CB    . GLU A  1 599 ? 98.777  91.760  75.713  1.00 24.80 ? 599 GLU A CB    1 
ATOM   4716  C  CG    . GLU A  1 599 ? 98.728  92.960  76.615  1.00 24.80 ? 599 GLU A CG    1 
ATOM   4717  C  CD    . GLU A  1 599 ? 97.313  93.352  76.960  1.00 24.80 ? 599 GLU A CD    1 
ATOM   4718  O  OE1   . GLU A  1 599 ? 96.409  93.067  76.151  1.00 24.80 ? 599 GLU A OE1   1 
ATOM   4719  O  OE2   . GLU A  1 599 ? 97.103  93.956  78.030  1.00 24.80 ? 599 GLU A OE2   1 
ATOM   4720  N  N     . HIS A  1 600 ? 96.969  89.589  77.137  1.00 23.32 ? 600 HIS A N     1 
ATOM   4721  C  CA    . HIS A  1 600 ? 95.991  89.199  78.147  1.00 23.32 ? 600 HIS A CA    1 
ATOM   4722  C  C     . HIS A  1 600 ? 96.432  87.957  78.910  1.00 23.32 ? 600 HIS A C     1 
ATOM   4723  O  O     . HIS A  1 600 ? 96.167  87.852  80.112  1.00 23.32 ? 600 HIS A O     1 
ATOM   4724  C  CB    . HIS A  1 600 ? 94.628  88.969  77.501  1.00 23.32 ? 600 HIS A CB    1 
ATOM   4725  C  CG    . HIS A  1 600 ? 93.885  90.231  77.198  1.00 23.32 ? 600 HIS A CG    1 
ATOM   4726  N  ND1   . HIS A  1 600 ? 93.212  90.432  76.013  1.00 23.32 ? 600 HIS A ND1   1 
ATOM   4727  C  CD2   . HIS A  1 600 ? 93.707  91.358  77.927  1.00 23.32 ? 600 HIS A CD2   1 
ATOM   4728  C  CE1   . HIS A  1 600 ? 92.653  91.628  76.024  1.00 23.32 ? 600 HIS A CE1   1 
ATOM   4729  N  NE2   . HIS A  1 600 ? 92.938  92.210  77.174  1.00 23.32 ? 600 HIS A NE2   1 
ATOM   4730  N  N     . ALA A  1 601 ? 97.127  87.026  78.247  1.00 22.52 ? 601 ALA A N     1 
ATOM   4731  C  CA    . ALA A  1 601 ? 97.665  85.868  78.951  1.00 22.52 ? 601 ALA A CA    1 
ATOM   4732  C  C     . ALA A  1 601 ? 98.769  86.273  79.917  1.00 22.52 ? 601 ALA A C     1 
ATOM   4733  O  O     . ALA A  1 601 ? 98.879  85.708  81.010  1.00 22.52 ? 601 ALA A O     1 
ATOM   4734  C  CB    . ALA A  1 601 ? 98.182  84.837  77.951  1.00 22.52 ? 601 ALA A CB    1 
ATOM   4735  N  N     . LEU A  1 602 ? 99.568  87.278  79.551  1.00 23.56 ? 602 LEU A N     1 
ATOM   4736  C  CA    . LEU A  1 602 ? 100.615 87.755  80.446  1.00 23.56 ? 602 LEU A CA    1 
ATOM   4737  C  C     . LEU A  1 602 ? 100.031 88.515  81.628  1.00 23.56 ? 602 LEU A C     1 
ATOM   4738  O  O     . LEU A  1 602 ? 100.530 88.389  82.750  1.00 23.56 ? 602 LEU A O     1 
ATOM   4739  C  CB    . LEU A  1 602 ? 101.605 88.627  79.679  1.00 23.56 ? 602 LEU A CB    1 
ATOM   4740  C  CG    . LEU A  1 602 ? 102.697 87.836  78.963  1.00 23.56 ? 602 LEU A CG    1 
ATOM   4741  C  CD1   . LEU A  1 602 ? 103.551 88.749  78.110  1.00 23.56 ? 602 LEU A CD1   1 
ATOM   4742  C  CD2   . LEU A  1 602 ? 103.546 87.095  79.974  1.00 23.56 ? 602 LEU A CD2   1 
ATOM   4743  N  N     . LEU A  1 603 ? 98.961  89.285  81.405  1.00 22.22 ? 603 LEU A N     1 
ATOM   4744  C  CA    . LEU A  1 603 ? 98.290  89.956  82.517  1.00 22.22 ? 603 LEU A CA    1 
ATOM   4745  C  C     . LEU A  1 603 ? 97.632  88.955  83.460  1.00 22.22 ? 603 LEU A C     1 
ATOM   4746  O  O     . LEU A  1 603 ? 97.696  89.116  84.687  1.00 22.22 ? 603 LEU A O     1 
ATOM   4747  C  CB    . LEU A  1 603 ? 97.251  90.945  81.995  1.00 22.22 ? 603 LEU A CB    1 
ATOM   4748  C  CG    . LEU A  1 603 ? 97.743  92.311  81.530  1.00 22.22 ? 603 LEU A CG    1 
ATOM   4749  C  CD1   . LEU A  1 603 ? 96.561  93.200  81.216  1.00 22.22 ? 603 LEU A CD1   1 
ATOM   4750  C  CD2   . LEU A  1 603 ? 98.618  92.944  82.586  1.00 22.22 ? 603 LEU A CD2   1 
ATOM   4751  N  N     . ALA A  1 604 ? 97.019  87.904  82.908  1.00 22.14 ? 604 ALA A N     1 
ATOM   4752  C  CA    . ALA A  1 604 ? 96.391  86.886  83.743  1.00 22.14 ? 604 ALA A CA    1 
ATOM   4753  C  C     . ALA A  1 604 ? 97.428  86.092  84.525  1.00 22.14 ? 604 ALA A C     1 
ATOM   4754  O  O     . ALA A  1 604 ? 97.230  85.811  85.711  1.00 22.14 ? 604 ALA A O     1 
ATOM   4755  C  CB    . ALA A  1 604 ? 95.538  85.954  82.886  1.00 22.14 ? 604 ALA A CB    1 
ATOM   4756  N  N     . LEU A  1 605 ? 98.553  85.749  83.889  1.00 23.92 ? 605 LEU A N     1 
ATOM   4757  C  CA    . LEU A  1 605 ? 99.606  85.020  84.585  1.00 23.92 ? 605 LEU A CA    1 
ATOM   4758  C  C     . LEU A  1 605 ? 100.299 85.893  85.624  1.00 23.92 ? 605 LEU A C     1 
ATOM   4759  O  O     . LEU A  1 605 ? 100.696 85.394  86.681  1.00 23.92 ? 605 LEU A O     1 
ATOM   4760  C  CB    . LEU A  1 605 ? 100.611 84.474  83.571  1.00 23.92 ? 605 LEU A CB    1 
ATOM   4761  C  CG    . LEU A  1 605 ? 101.831 83.709  84.083  1.00 23.92 ? 605 LEU A CG    1 
ATOM   4762  C  CD1   . LEU A  1 605 ? 101.403 82.543  84.952  1.00 23.92 ? 605 LEU A CD1   1 
ATOM   4763  C  CD2   . LEU A  1 605 ? 102.674 83.223  82.920  1.00 23.92 ? 605 LEU A CD2   1 
ATOM   4764  N  N     . LYS A  1 606 ? 100.401 87.199  85.371  1.00 23.47 ? 606 LYS A N     1 
ATOM   4765  C  CA    . LYS A  1 606 ? 100.950 88.129  86.350  1.00 23.47 ? 606 LYS A CA    1 
ATOM   4766  C  C     . LYS A  1 606 ? 100.045 88.269  87.569  1.00 23.47 ? 606 LYS A C     1 
ATOM   4767  O  O     . LYS A  1 606 ? 100.530 88.258  88.707  1.00 23.47 ? 606 LYS A O     1 
ATOM   4768  C  CB    . LYS A  1 606 ? 101.178 89.483  85.683  1.00 23.47 ? 606 LYS A CB    1 
ATOM   4769  C  CG    . LYS A  1 606 ? 101.418 90.634  86.627  1.00 23.47 ? 606 LYS A CG    1 
ATOM   4770  C  CD    . LYS A  1 606 ? 101.633 91.912  85.850  1.00 23.47 ? 606 LYS A CD    1 
ATOM   4771  C  CE    . LYS A  1 606 ? 102.864 91.812  84.978  1.00 23.47 ? 606 LYS A CE    1 
ATOM   4772  N  NZ    . LYS A  1 606 ? 104.109 91.972  85.763  1.00 23.47 ? 606 LYS A NZ    1 
ATOM   4773  N  N     . PHE A  1 607 ? 98.730  88.371  87.359  1.00 26.50 ? 607 PHE A N     1 
ATOM   4774  C  CA    . PHE A  1 607 ? 97.821  88.447  88.500  1.00 26.50 ? 607 PHE A CA    1 
ATOM   4775  C  C     . PHE A  1 607 ? 97.732  87.119  89.245  1.00 26.50 ? 607 PHE A C     1 
ATOM   4776  O  O     . PHE A  1 607 ? 97.577  87.112  90.472  1.00 26.50 ? 607 PHE A O     1 
ATOM   4777  C  CB    . PHE A  1 607 ? 96.439  88.905  88.043  1.00 26.50 ? 607 PHE A CB    1 
ATOM   4778  C  CG    . PHE A  1 607 ? 96.358  90.378  87.748  1.00 26.50 ? 607 PHE A CG    1 
ATOM   4779  C  CD1   . PHE A  1 607 ? 97.261  91.263  88.317  1.00 26.50 ? 607 PHE A CD1   1 
ATOM   4780  C  CD2   . PHE A  1 607 ? 95.382  90.876  86.900  1.00 26.50 ? 607 PHE A CD2   1 
ATOM   4781  C  CE1   . PHE A  1 607 ? 97.192  92.616  88.047  1.00 26.50 ? 607 PHE A CE1   1 
ATOM   4782  C  CE2   . PHE A  1 607 ? 95.308  92.230  86.626  1.00 26.50 ? 607 PHE A CE2   1 
ATOM   4783  C  CZ    . PHE A  1 607 ? 96.214  93.099  87.201  1.00 26.50 ? 607 PHE A CZ    1 
ATOM   4784  N  N     . ILE A  1 608 ? 97.874  85.996  88.537  1.00 23.69 ? 608 ILE A N     1 
ATOM   4785  C  CA    . ILE A  1 608 ? 97.900  84.690  89.190  1.00 23.69 ? 608 ILE A CA    1 
ATOM   4786  C  C     . ILE A  1 608 ? 99.171  84.530  90.021  1.00 23.69 ? 608 ILE A C     1 
ATOM   4787  O  O     . ILE A  1 608 ? 99.131  84.007  91.141  1.00 23.69 ? 608 ILE A O     1 
ATOM   4788  C  CB    . ILE A  1 608 ? 97.737  83.582  88.130  1.00 23.69 ? 608 ILE A CB    1 
ATOM   4789  C  CG1   . ILE A  1 608 ? 96.261  83.412  87.776  1.00 23.69 ? 608 ILE A CG1   1 
ATOM   4790  C  CG2   . ILE A  1 608 ? 98.315  82.249  88.580  1.00 23.69 ? 608 ILE A CG2   1 
ATOM   4791  C  CD1   . ILE A  1 608 ? 96.025  82.586  86.536  1.00 23.69 ? 608 ILE A CD1   1 
ATOM   4792  N  N     . LEU A  1 609 ? 100.307 85.020  89.515  1.00 24.29 ? 609 LEU A N     1 
ATOM   4793  C  CA    . LEU A  1 609 ? 101.543 84.993  90.293  1.00 24.29 ? 609 LEU A CA    1 
ATOM   4794  C  C     . LEU A  1 609 ? 101.490 85.932  91.490  1.00 24.29 ? 609 LEU A C     1 
ATOM   4795  O  O     . LEU A  1 609 ? 102.072 85.627  92.535  1.00 24.29 ? 609 LEU A O     1 
ATOM   4796  C  CB    . LEU A  1 609 ? 102.735 85.354  89.412  1.00 24.29 ? 609 LEU A CB    1 
ATOM   4797  C  CG    . LEU A  1 609 ? 103.548 84.189  88.860  1.00 24.29 ? 609 LEU A CG    1 
ATOM   4798  C  CD1   . LEU A  1 609 ? 104.656 84.710  87.978  1.00 24.29 ? 609 LEU A CD1   1 
ATOM   4799  C  CD2   . LEU A  1 609 ? 104.115 83.368  89.997  1.00 24.29 ? 609 LEU A CD2   1 
ATOM   4800  N  N     . ALA A  1 610 ? 100.814 87.071  91.364  1.00 25.67 ? 610 ALA A N     1 
ATOM   4801  C  CA    . ALA A  1 610 ? 100.697 87.978  92.497  1.00 25.67 ? 610 ALA A CA    1 
ATOM   4802  C  C     . ALA A  1 610 ? 99.707  87.486  93.543  1.00 25.67 ? 610 ALA A C     1 
ATOM   4803  O  O     . ALA A  1 610 ? 99.861  87.815  94.724  1.00 25.67 ? 610 ALA A O     1 
ATOM   4804  C  CB    . ALA A  1 610 ? 100.292 89.373  92.021  1.00 25.67 ? 610 ALA A CB    1 
ATOM   4805  N  N     . PHE A  1 611 ? 98.701  86.710  93.141  1.00 28.68 ? 611 PHE A N     1 
ATOM   4806  C  CA    . PHE A  1 611 ? 97.735  86.168  94.087  1.00 28.68 ? 611 PHE A CA    1 
ATOM   4807  C  C     . PHE A  1 611 ? 98.170  84.842  94.698  1.00 28.68 ? 611 PHE A C     1 
ATOM   4808  O  O     . PHE A  1 611 ? 97.758  84.528  95.819  1.00 28.68 ? 611 PHE A O     1 
ATOM   4809  C  CB    . PHE A  1 611 ? 96.377  85.996  93.397  1.00 28.68 ? 611 PHE A CB    1 
ATOM   4810  C  CG    . PHE A  1 611 ? 95.277  85.563  94.319  1.00 28.68 ? 611 PHE A CG    1 
ATOM   4811  C  CD1   . PHE A  1 611 ? 94.737  86.448  95.237  1.00 28.68 ? 611 PHE A CD1   1 
ATOM   4812  C  CD2   . PHE A  1 611 ? 94.784  84.267  94.268  1.00 28.68 ? 611 PHE A CD2   1 
ATOM   4813  C  CE1   . PHE A  1 611 ? 93.723  86.049  96.090  1.00 28.68 ? 611 PHE A CE1   1 
ATOM   4814  C  CE2   . PHE A  1 611 ? 93.771  83.861  95.118  1.00 28.68 ? 611 PHE A CE2   1 
ATOM   4815  C  CZ    . PHE A  1 611 ? 93.241  84.753  96.030  1.00 28.68 ? 611 PHE A CZ    1 
ATOM   4816  N  N     . ALA A  1 612 ? 99.007  84.069  94.006  1.00 28.04 ? 612 ALA A N     1 
ATOM   4817  C  CA    . ALA A  1 612 ? 99.347  82.730  94.475  1.00 28.04 ? 612 ALA A CA    1 
ATOM   4818  C  C     . ALA A  1 612 ? 100.401 82.767  95.574  1.00 28.04 ? 612 ALA A C     1 
ATOM   4819  O  O     . ALA A  1 612 ? 100.281 82.059  96.578  1.00 28.04 ? 612 ALA A O     1 
ATOM   4820  C  CB    . ALA A  1 612 ? 99.827  81.873  93.304  1.00 28.04 ? 612 ALA A CB    1 
ATOM   4821  N  N     . ILE A  1 613 ? 101.441 83.574  95.396  1.00 27.49 ? 613 ILE A N     1 
ATOM   4822  C  CA    . ILE A  1 613 ? 102.518 83.690  96.376  1.00 27.49 ? 613 ILE A CA    1 
ATOM   4823  C  C     . ILE A  1 613 ? 102.004 84.459  97.587  1.00 27.49 ? 613 ILE A C     1 
ATOM   4824  O  O     . ILE A  1 613 ? 101.407 85.533  97.425  1.00 27.49 ? 613 ILE A O     1 
ATOM   4825  C  CB    . ILE A  1 613 ? 103.750 84.376  95.766  1.00 27.49 ? 613 ILE A CB    1 
ATOM   4826  C  CG1   . ILE A  1 613 ? 104.084 83.774  94.405  1.00 27.49 ? 613 ILE A CG1   1 
ATOM   4827  C  CG2   . ILE A  1 613 ? 104.945 84.257  96.688  1.00 27.49 ? 613 ILE A CG2   1 
ATOM   4828  C  CD1   . ILE A  1 613 ? 105.190 84.501  93.685  1.00 27.49 ? 613 ILE A CD1   1 
ATOM   4829  N  N     . PRO A  1 614 ? 102.186 83.951  98.804  1.00 31.17 ? 614 PRO A N     1 
ATOM   4830  C  CA    . PRO A  1 614 ? 101.728 84.692  99.983  1.00 31.17 ? 614 PRO A CA    1 
ATOM   4831  C  C     . PRO A  1 614 ? 102.626 85.879  100.287 1.00 31.17 ? 614 PRO A C     1 
ATOM   4832  O  O     . PRO A  1 614 ? 103.818 85.888  99.971  1.00 31.17 ? 614 PRO A O     1 
ATOM   4833  C  CB    . PRO A  1 614 ? 101.791 83.648  101.101 1.00 31.17 ? 614 PRO A CB    1 
ATOM   4834  C  CG    . PRO A  1 614 ? 102.833 82.700  100.655 1.00 31.17 ? 614 PRO A CG    1 
ATOM   4835  C  CD    . PRO A  1 614 ? 102.716 82.625  99.163  1.00 31.17 ? 614 PRO A CD    1 
ATOM   4836  N  N     . ASP A  1 615 ? 102.030 86.894  100.914 1.00 36.20 ? 615 ASP A N     1 
ATOM   4837  C  CA    . ASP A  1 615 ? 102.744 88.135  101.196 1.00 36.20 ? 615 ASP A CA    1 
ATOM   4838  C  C     . ASP A  1 615 ? 103.737 87.960  102.338 1.00 36.20 ? 615 ASP A C     1 
ATOM   4839  O  O     . ASP A  1 615 ? 104.910 88.321  102.214 1.00 36.20 ? 615 ASP A O     1 
ATOM   4840  C  CB    . ASP A  1 615 ? 101.747 89.251  101.511 1.00 36.20 ? 615 ASP A CB    1 
ATOM   4841  C  CG    . ASP A  1 615 ? 100.737 89.457  100.401 1.00 36.20 ? 615 ASP A CG    1 
ATOM   4842  O  OD1   . ASP A  1 615 ? 100.769 88.688  99.416  1.00 36.20 ? 615 ASP A OD1   1 
ATOM   4843  O  OD2   . ASP A  1 615 ? 99.911  90.387  100.512 1.00 36.20 ? 615 ASP A OD2   1 
ATOM   4844  N  N     . LYS A  1 616 ? 103.282 87.424  103.461 1.00 36.66 ? 616 LYS A N     1 
ATOM   4845  C  CA    . LYS A  1 616 ? 104.198 87.103  104.542 1.00 36.66 ? 616 LYS A CA    1 
ATOM   4846  C  C     . LYS A  1 616 ? 104.785 85.710  104.332 1.00 36.66 ? 616 LYS A C     1 
ATOM   4847  O  O     . LYS A  1 616 ? 104.135 84.841  103.748 1.00 36.66 ? 616 LYS A O     1 
ATOM   4848  C  CB    . LYS A  1 616 ? 103.479 87.161  105.885 1.00 36.66 ? 616 LYS A CB    1 
ATOM   4849  C  CG    . LYS A  1 616 ? 102.823 88.492  106.181 1.00 36.66 ? 616 LYS A CG    1 
ATOM   4850  C  CD    . LYS A  1 616 ? 101.993 88.418  107.447 1.00 36.66 ? 616 LYS A CD    1 
ATOM   4851  C  CE    . LYS A  1 616 ? 101.064 89.610  107.556 1.00 36.66 ? 616 LYS A CE    1 
ATOM   4852  N  NZ    . LYS A  1 616 ? 101.767 90.877  107.221 1.00 36.66 ? 616 LYS A NZ    1 
ATOM   4853  N  N     . PRO A  1 617 ? 106.012 85.464  104.805 1.00 37.43 ? 617 PRO A N     1 
ATOM   4854  C  CA    . PRO A  1 617 ? 106.592 84.121  104.667 1.00 37.43 ? 617 PRO A CA    1 
ATOM   4855  C  C     . PRO A  1 617 ? 105.958 83.101  105.600 1.00 37.43 ? 617 PRO A C     1 
ATOM   4856  O  O     . PRO A  1 617 ? 104.996 83.405  106.312 1.00 37.43 ? 617 PRO A O     1 
ATOM   4857  C  CB    . PRO A  1 617 ? 108.072 84.338  105.008 1.00 37.43 ? 617 PRO A CB    1 
ATOM   4858  C  CG    . PRO A  1 617 ? 108.295 85.793  104.880 1.00 37.43 ? 617 PRO A CG    1 
ATOM   4859  C  CD    . PRO A  1 617 ? 107.011 86.437  105.266 1.00 37.43 ? 617 PRO A CD    1 
ATOM   4860  N  N     . ARG A  1 618 ? 106.488 81.879  105.603 1.00 44.76 ? 618 ARG A N     1 
ATOM   4861  C  CA    . ARG A  1 618 ? 105.892 80.820  106.408 1.00 44.76 ? 618 ARG A CA    1 
ATOM   4862  C  C     . ARG A  1 618 ? 106.174 81.016  107.892 1.00 44.76 ? 618 ARG A C     1 
ATOM   4863  O  O     . ARG A  1 618 ? 105.249 80.993  108.713 1.00 44.76 ? 618 ARG A O     1 
ATOM   4864  C  CB    . ARG A  1 618 ? 106.402 79.456  105.943 1.00 44.76 ? 618 ARG A CB    1 
ATOM   4865  C  CG    . ARG A  1 618 ? 105.657 78.280  106.548 1.00 44.76 ? 618 ARG A CG    1 
ATOM   4866  C  CD    . ARG A  1 618 ? 104.165 78.380  106.288 1.00 44.76 ? 618 ARG A CD    1 
ATOM   4867  N  NE    . ARG A  1 618 ? 103.458 77.167  106.687 1.00 44.76 ? 618 ARG A NE    1 
ATOM   4868  C  CZ    . ARG A  1 618 ? 102.142 77.005  106.597 1.00 44.76 ? 618 ARG A CZ    1 
ATOM   4869  N  NH1   . ARG A  1 618 ? 101.383 77.982  106.120 1.00 44.76 ? 618 ARG A NH1   1 
ATOM   4870  N  NH2   . ARG A  1 618 ? 101.584 75.867  106.984 1.00 44.76 ? 618 ARG A NH2   1 
ATOM   4871  N  N     . HIS A  1 619 ? 107.442 81.224  108.254 1.00 48.21 ? 619 HIS A N     1 
ATOM   4872  C  CA    . HIS A  1 619 ? 107.803 81.293  109.665 1.00 48.21 ? 619 HIS A CA    1 
ATOM   4873  C  C     . HIS A  1 619 ? 107.345 82.590  110.317 1.00 48.21 ? 619 HIS A C     1 
ATOM   4874  O  O     . HIS A  1 619 ? 107.025 82.592  111.511 1.00 48.21 ? 619 HIS A O     1 
ATOM   4875  C  CB    . HIS A  1 619 ? 109.311 81.112  109.836 1.00 48.21 ? 619 HIS A CB    1 
ATOM   4876  C  CG    . HIS A  1 619 ? 110.133 82.091  109.062 1.00 48.21 ? 619 HIS A CG    1 
ATOM   4877  N  ND1   . HIS A  1 619 ? 110.400 81.941  107.719 1.00 48.21 ? 619 HIS A ND1   1 
ATOM   4878  C  CD2   . HIS A  1 619 ? 110.765 83.224  109.447 1.00 48.21 ? 619 HIS A CD2   1 
ATOM   4879  C  CE1   . HIS A  1 619 ? 111.153 82.945  107.307 1.00 48.21 ? 619 HIS A CE1   1 
ATOM   4880  N  NE2   . HIS A  1 619 ? 111.388 83.738  108.336 1.00 48.21 ? 619 HIS A NE2   1 
ATOM   4881  N  N     . ILE A  1 620 ? 107.270 83.683  109.552 1.00 42.55 ? 620 ILE A N     1 
ATOM   4882  C  CA    . ILE A  1 620 ? 106.698 84.918  110.078 1.00 42.55 ? 620 ILE A CA    1 
ATOM   4883  C  C     . ILE A  1 620 ? 105.212 84.741  110.356 1.00 42.55 ? 620 ILE A C     1 
ATOM   4884  O  O     . ILE A  1 620 ? 104.701 85.228  111.371 1.00 42.55 ? 620 ILE A O     1 
ATOM   4885  C  CB    . ILE A  1 620 ? 106.955 86.082  109.105 1.00 42.55 ? 620 ILE A CB    1 
ATOM   4886  C  CG1   . ILE A  1 620 ? 108.434 86.148  108.732 1.00 42.55 ? 620 ILE A CG1   1 
ATOM   4887  C  CG2   . ILE A  1 620 ? 106.511 87.399  109.708 1.00 42.55 ? 620 ILE A CG2   1 
ATOM   4888  C  CD1   . ILE A  1 620 ? 109.340 86.443  109.893 1.00 42.55 ? 620 ILE A CD1   1 
ATOM   4889  N  N     . GLN A  1 621 ? 104.509 84.005  109.493 1.00 47.65 ? 621 GLN A N     1 
ATOM   4890  C  CA    . GLN A  1 621 ? 103.090 83.748  109.714 1.00 47.65 ? 621 GLN A CA    1 
ATOM   4891  C  C     . GLN A  1 621 ? 102.874 82.828  110.909 1.00 47.65 ? 621 GLN A C     1 
ATOM   4892  O  O     . GLN A  1 621 ? 101.924 83.019  111.678 1.00 47.65 ? 621 GLN A O     1 
ATOM   4893  C  CB    . GLN A  1 621 ? 102.473 83.152  108.453 1.00 47.65 ? 621 GLN A CB    1 
ATOM   4894  C  CG    . GLN A  1 621 ? 100.964 83.133  108.442 1.00 47.65 ? 621 GLN A CG    1 
ATOM   4895  C  CD    . GLN A  1 621 ? 100.411 82.860  107.060 1.00 47.65 ? 621 GLN A CD    1 
ATOM   4896  O  OE1   . GLN A  1 621 ? 101.165 82.673  106.105 1.00 47.65 ? 621 GLN A OE1   1 
ATOM   4897  N  NE2   . GLN A  1 621 ? 99.090  82.839  106.944 1.00 47.65 ? 621 GLN A NE2   1 
ATOM   4898  N  N     . MET A  1 622 ? 103.765 81.848  111.099 1.00 50.13 ? 622 MET A N     1 
ATOM   4899  C  CA    . MET A  1 622 ? 103.697 80.992  112.282 1.00 50.13 ? 622 MET A CA    1 
ATOM   4900  C  C     . MET A  1 622 ? 103.966 81.781  113.559 1.00 50.13 ? 622 MET A C     1 
ATOM   4901  O  O     . MET A  1 622 ? 103.316 81.548  114.585 1.00 50.13 ? 622 MET A O     1 
ATOM   4902  C  CB    . MET A  1 622 ? 104.686 79.835  112.160 1.00 50.13 ? 622 MET A CB    1 
ATOM   4903  C  CG    . MET A  1 622 ? 104.358 78.847  111.059 1.00 50.13 ? 622 MET A CG    1 
ATOM   4904  S  SD    . MET A  1 622 ? 105.089 77.222  111.340 1.00 50.13 ? 622 MET A SD    1 
ATOM   4905  C  CE    . MET A  1 622 ? 106.761 77.488  110.754 1.00 50.13 ? 622 MET A CE    1 
ATOM   4906  N  N     . LYS A  1 623 ? 104.897 82.736  113.509 1.00 46.69 ? 623 LYS A N     1 
ATOM   4907  C  CA    . LYS A  1 623 ? 105.198 83.529  114.697 1.00 46.69 ? 623 LYS A CA    1 
ATOM   4908  C  C     . LYS A  1 623 ? 104.069 84.502  115.022 1.00 46.69 ? 623 LYS A C     1 
ATOM   4909  O  O     . LYS A  1 623 ? 103.761 84.725  116.199 1.00 46.69 ? 623 LYS A O     1 
ATOM   4910  C  CB    . LYS A  1 623 ? 106.519 84.267  114.509 1.00 46.69 ? 623 LYS A CB    1 
ATOM   4911  C  CG    . LYS A  1 623 ? 107.731 83.373  114.695 1.00 46.69 ? 623 LYS A CG    1 
ATOM   4912  C  CD    . LYS A  1 623 ? 108.923 83.904  113.933 1.00 46.69 ? 623 LYS A CD    1 
ATOM   4913  C  CE    . LYS A  1 623 ? 110.127 83.002  114.088 1.00 46.69 ? 623 LYS A CE    1 
ATOM   4914  N  NZ    . LYS A  1 623 ? 111.323 83.584  113.422 1.00 46.69 ? 623 LYS A NZ    1 
ATOM   4915  N  N     . LEU A  1 624 ? 103.417 85.063  113.999 1.00 51.00 ? 624 LEU A N     1 
ATOM   4916  C  CA    . LEU A  1 624 ? 102.252 85.906  114.262 1.00 51.00 ? 624 LEU A CA    1 
ATOM   4917  C  C     . LEU A  1 624 ? 101.072 85.089  114.775 1.00 51.00 ? 624 LEU A C     1 
ATOM   4918  O  O     . LEU A  1 624 ? 100.311 85.570  115.625 1.00 51.00 ? 624 LEU A O     1 
ATOM   4919  C  CB    . LEU A  1 624 ? 101.838 86.684  113.011 1.00 51.00 ? 624 LEU A CB    1 
ATOM   4920  C  CG    . LEU A  1 624 ? 102.791 87.695  112.369 1.00 51.00 ? 624 LEU A CG    1 
ATOM   4921  C  CD1   . LEU A  1 624 ? 102.011 88.688  111.524 1.00 51.00 ? 624 LEU A CD1   1 
ATOM   4922  C  CD2   . LEU A  1 624 ? 103.651 88.409  113.394 1.00 51.00 ? 624 LEU A CD2   1 
ATOM   4923  N  N     . ALA A  1 625 ? 100.920 83.849  114.300 1.00 56.00 ? 625 ALA A N     1 
ATOM   4924  C  CA    . ALA A  1 625 ? 99.860  82.988  114.814 1.00 56.00 ? 625 ALA A CA    1 
ATOM   4925  C  C     . ALA A  1 625 ? 100.122 82.589  116.261 1.00 56.00 ? 625 ALA A C     1 
ATOM   4926  O  O     . ALA A  1 625 ? 99.186  82.505  117.064 1.00 56.00 ? 625 ALA A O     1 
ATOM   4927  C  CB    . ALA A  1 625 ? 99.716  81.752  113.930 1.00 56.00 ? 625 ALA A CB    1 
ATOM   4928  N  N     . ARG A  1 626 ? 101.391 82.364  116.616 1.00 57.55 ? 626 ARG A N     1 
ATOM   4929  C  CA    . ARG A  1 626 ? 101.737 82.076  118.006 1.00 57.55 ? 626 ARG A CA    1 
ATOM   4930  C  C     . ARG A  1 626 ? 101.499 83.288  118.900 1.00 57.55 ? 626 ARG A C     1 
ATOM   4931  O  O     . ARG A  1 626 ? 100.996 83.149  120.024 1.00 57.55 ? 626 ARG A O     1 
ATOM   4932  C  CB    . ARG A  1 626 ? 103.191 81.619  118.096 1.00 57.55 ? 626 ARG A CB    1 
ATOM   4933  C  CG    . ARG A  1 626 ? 103.624 81.201  119.486 1.00 57.55 ? 626 ARG A CG    1 
ATOM   4934  C  CD    . ARG A  1 626 ? 105.072 80.750  119.500 1.00 57.55 ? 626 ARG A CD    1 
ATOM   4935  N  NE    . ARG A  1 626 ? 105.337 79.742  118.478 1.00 57.55 ? 626 ARG A NE    1 
ATOM   4936  C  CZ    . ARG A  1 626 ? 106.419 79.729  117.707 1.00 57.55 ? 626 ARG A CZ    1 
ATOM   4937  N  NH1   . ARG A  1 626 ? 107.343 80.669  117.845 1.00 57.55 ? 626 ARG A NH1   1 
ATOM   4938  N  NH2   . ARG A  1 626 ? 106.579 78.775  116.801 1.00 57.55 ? 626 ARG A NH2   1 
ATOM   4939  N  N     . LEU A  1 627 ? 101.837 84.486  118.409 1.00 58.74 ? 627 LEU A N     1 
ATOM   4940  C  CA    . LEU A  1 627 ? 101.594 85.706  119.173 1.00 58.74 ? 627 LEU A CA    1 
ATOM   4941  C  C     . LEU A  1 627 ? 100.107 85.995  119.334 1.00 58.74 ? 627 LEU A C     1 
ATOM   4942  O  O     . LEU A  1 627 ? 99.702  86.603  120.330 1.00 58.74 ? 627 LEU A O     1 
ATOM   4943  C  CB    . LEU A  1 627 ? 102.291 86.889  118.504 1.00 58.74 ? 627 LEU A CB    1 
ATOM   4944  C  CG    . LEU A  1 627 ? 102.748 88.012  119.433 1.00 58.74 ? 627 LEU A CG    1 
ATOM   4945  C  CD1   . LEU A  1 627 ? 103.579 87.456  120.569 1.00 58.74 ? 627 LEU A CD1   1 
ATOM   4946  C  CD2   . LEU A  1 627 ? 103.533 89.056  118.664 1.00 58.74 ? 627 LEU A CD2   1 
ATOM   4947  N  N     . GLU A  1 628 ? 99.284  85.575  118.371 1.00 68.49 ? 628 GLU A N     1 
ATOM   4948  C  CA    . GLU A  1 628 ? 97.839  85.719  118.526 1.00 68.49 ? 628 GLU A CA    1 
ATOM   4949  C  C     . GLU A  1 628 ? 97.288  84.684  119.502 1.00 68.49 ? 628 GLU A C     1 
ATOM   4950  O  O     . GLU A  1 628 ? 96.401  84.993  120.312 1.00 68.49 ? 628 GLU A O     1 
ATOM   4951  C  CB    . GLU A  1 628 ? 97.168  85.625  117.150 1.00 68.49 ? 628 GLU A CB    1 
ATOM   4952  C  CG    . GLU A  1 628 ? 95.630  85.603  117.107 1.00 68.49 ? 628 GLU A CG    1 
ATOM   4953  C  CD    . GLU A  1 628 ? 95.025  84.210  117.225 1.00 68.49 ? 628 GLU A CD    1 
ATOM   4954  O  OE1   . GLU A  1 628 ? 95.786  83.223  117.152 1.00 68.49 ? 628 GLU A OE1   1 
ATOM   4955  O  OE2   . GLU A  1 628 ? 93.792  84.105  117.389 1.00 68.49 ? 628 GLU A OE2   1 
ATOM   4956  N  N     . PHE A  1 629 ? 97.802  83.451  119.440 1.00 71.19 ? 629 PHE A N     1 
ATOM   4957  C  CA    . PHE A  1 629 ? 97.299  82.389  120.304 1.00 71.19 ? 629 PHE A CA    1 
ATOM   4958  C  C     . PHE A  1 629 ? 97.663  82.618  121.764 1.00 71.19 ? 629 PHE A C     1 
ATOM   4959  O  O     . PHE A  1 629 ? 96.885  82.254  122.651 1.00 71.19 ? 629 PHE A O     1 
ATOM   4960  C  CB    . PHE A  1 629 ? 97.825  81.031  119.842 1.00 71.19 ? 629 PHE A CB    1 
ATOM   4961  C  CG    . PHE A  1 629 ? 97.426  79.895  120.739 1.00 71.19 ? 629 PHE A CG    1 
ATOM   4962  C  CD1   . PHE A  1 629 ? 96.111  79.464  120.782 1.00 71.19 ? 629 PHE A CD1   1 
ATOM   4963  C  CD2   . PHE A  1 629 ? 98.362  79.270  121.550 1.00 71.19 ? 629 PHE A CD2   1 
ATOM   4964  C  CE1   . PHE A  1 629 ? 95.735  78.424  121.612 1.00 71.19 ? 629 PHE A CE1   1 
ATOM   4965  C  CE2   . PHE A  1 629 ? 97.993  78.231  122.383 1.00 71.19 ? 629 PHE A CE2   1 
ATOM   4966  C  CZ    . PHE A  1 629 ? 96.679  77.806  122.412 1.00 71.19 ? 629 PHE A CZ    1 
ATOM   4967  N  N     . GLU A  1 630 ? 98.826  83.220  122.035 1.00 72.63 ? 630 GLU A N     1 
ATOM   4968  C  CA    . GLU A  1 630 ? 99.181  83.519  123.421 1.00 72.63 ? 630 GLU A CA    1 
ATOM   4969  C  C     . GLU A  1 630 ? 98.263  84.580  124.022 1.00 72.63 ? 630 GLU A C     1 
ATOM   4970  O  O     . GLU A  1 630 ? 97.871  84.469  125.190 1.00 72.63 ? 630 GLU A O     1 
ATOM   4971  C  CB    . GLU A  1 630 ? 100.646 83.957  123.516 1.00 72.63 ? 630 GLU A CB    1 
ATOM   4972  C  CG    . GLU A  1 630 ? 101.705 82.870  123.228 1.00 72.63 ? 630 GLU A CG    1 
ATOM   4973  C  CD    . GLU A  1 630 ? 101.447 81.515  123.888 1.00 72.63 ? 630 GLU A CD    1 
ATOM   4974  O  OE1   . GLU A  1 630 ? 101.023 81.464  125.064 1.00 72.63 ? 630 GLU A OE1   1 
ATOM   4975  O  OE2   . GLU A  1 630 ? 101.672 80.487  123.215 1.00 72.63 ? 630 GLU A OE2   1 
ATOM   4976  N  N     . SER A  1 631 ? 97.870  85.582  123.231 1.00 74.69 ? 631 SER A N     1 
ATOM   4977  C  CA    . SER A  1 631 ? 96.917  86.576  123.717 1.00 74.69 ? 631 SER A CA    1 
ATOM   4978  C  C     . SER A  1 631 ? 95.520  85.988  123.877 1.00 74.69 ? 631 SER A C     1 
ATOM   4979  O  O     . SER A  1 631 ? 94.797  86.359  124.812 1.00 74.69 ? 631 SER A O     1 
ATOM   4980  C  CB    . SER A  1 631 ? 96.883  87.777  122.774 1.00 74.69 ? 631 SER A CB    1 
ATOM   4981  O  OG    . SER A  1 631 ? 95.741  88.579  123.011 1.00 74.69 ? 631 SER A OG    1 
ATOM   4982  N  N     . LEU A  1 632 ? 95.132  85.060  122.995 1.00 77.47 ? 632 LEU A N     1 
ATOM   4983  C  CA    . LEU A  1 632 ? 93.839  84.395  123.150 1.00 77.47 ? 632 LEU A CA    1 
ATOM   4984  C  C     . LEU A  1 632 ? 93.819  83.509  124.393 1.00 77.47 ? 632 LEU A C     1 
ATOM   4985  O  O     . LEU A  1 632 ? 92.803  83.438  125.096 1.00 77.47 ? 632 LEU A O     1 
ATOM   4986  C  CB    . LEU A  1 632 ? 93.508  83.597  121.884 1.00 77.47 ? 632 LEU A CB    1 
ATOM   4987  C  CG    . LEU A  1 632 ? 92.296  82.660  121.807 1.00 77.47 ? 632 LEU A CG    1 
ATOM   4988  C  CD1   . LEU A  1 632 ? 91.697  82.748  120.420 1.00 77.47 ? 632 LEU A CD1   1 
ATOM   4989  C  CD2   . LEU A  1 632 ? 92.663  81.205  122.087 1.00 77.47 ? 632 LEU A CD2   1 
ATOM   4990  N  N     . GLU A  1 633 ? 94.939  82.846  124.694 1.00 80.51 ? 633 GLU A N     1 
ATOM   4991  C  CA    . GLU A  1 633 ? 95.026  82.055  125.917 1.00 80.51 ? 633 GLU A CA    1 
ATOM   4992  C  C     . GLU A  1 633 ? 95.039  82.938  127.158 1.00 80.51 ? 633 GLU A C     1 
ATOM   4993  O  O     . GLU A  1 633 ? 94.493  82.545  128.194 1.00 80.51 ? 633 GLU A O     1 
ATOM   4994  C  CB    . GLU A  1 633 ? 96.268  81.166  125.889 1.00 80.51 ? 633 GLU A CB    1 
ATOM   4995  C  CG    . GLU A  1 633 ? 96.110  79.872  126.666 1.00 80.51 ? 633 GLU A CG    1 
ATOM   4996  C  CD    . GLU A  1 633 ? 97.438  79.211  126.982 1.00 80.51 ? 633 GLU A CD    1 
ATOM   4997  O  OE1   . GLU A  1 633 ? 98.488  79.754  126.581 1.00 80.51 ? 633 GLU A OE1   1 
ATOM   4998  O  OE2   . GLU A  1 633 ? 97.431  78.148  127.637 1.00 80.51 ? 633 GLU A OE2   1 
ATOM   4999  N  N     . ALA A  1 634 ? 95.641  84.129  127.070 1.00 82.24 ? 634 ALA A N     1 
ATOM   5000  C  CA    . ALA A  1 634 ? 95.575  85.081  128.178 1.00 82.24 ? 634 ALA A CA    1 
ATOM   5001  C  C     . ALA A  1 634 ? 94.146  85.557  128.415 1.00 82.24 ? 634 ALA A C     1 
ATOM   5002  O  O     . ALA A  1 634 ? 93.713  85.700  129.567 1.00 82.24 ? 634 ALA A O     1 
ATOM   5003  C  CB    . ALA A  1 634 ? 96.496  86.269  127.905 1.00 82.24 ? 634 ALA A CB    1 
ATOM   5004  N  N     . LEU A  1 635 ? 93.392  85.780  127.334 1.00 84.97 ? 635 LEU A N     1 
ATOM   5005  C  CA    . LEU A  1 635 ? 91.985  86.154  127.462 1.00 84.97 ? 635 LEU A CA    1 
ATOM   5006  C  C     . LEU A  1 635 ? 91.161  85.016  128.062 1.00 84.97 ? 635 LEU A C     1 
ATOM   5007  O  O     . LEU A  1 635 ? 90.276  85.254  128.894 1.00 84.97 ? 635 LEU A O     1 
ATOM   5008  C  CB    . LEU A  1 635 ? 91.433  86.560  126.094 1.00 84.97 ? 635 LEU A CB    1 
ATOM   5009  C  CG    . LEU A  1 635 ? 89.922  86.684  125.871 1.00 84.97 ? 635 LEU A CG    1 
ATOM   5010  C  CD1   . LEU A  1 635 ? 89.291  87.708  126.813 1.00 84.97 ? 635 LEU A CD1   1 
ATOM   5011  C  CD2   . LEU A  1 635 ? 89.623  87.030  124.420 1.00 84.97 ? 635 LEU A CD2   1 
ATOM   5012  N  N     . LYS A  1 636 ? 91.460  83.773  127.673 1.00 85.19 ? 636 LYS A N     1 
ATOM   5013  C  CA    . LYS A  1 636 ? 90.733  82.627  128.215 1.00 85.19 ? 636 LYS A CA    1 
ATOM   5014  C  C     . LYS A  1 636 ? 91.048  82.408  129.691 1.00 85.19 ? 636 LYS A C     1 
ATOM   5015  O  O     . LYS A  1 636 ? 90.164  82.036  130.474 1.00 85.19 ? 636 LYS A O     1 
ATOM   5016  C  CB    . LYS A  1 636 ? 91.061  81.372  127.408 1.00 85.19 ? 636 LYS A CB    1 
ATOM   5017  N  N     . GLN A  1 637 ? 92.300  82.641  130.095 1.00 86.55 ? 637 GLN A N     1 
ATOM   5018  C  CA    . GLN A  1 637 ? 92.651  82.502  131.505 1.00 86.55 ? 637 GLN A CA    1 
ATOM   5019  C  C     . GLN A  1 637 ? 92.097  83.648  132.340 1.00 86.55 ? 637 GLN A C     1 
ATOM   5020  O  O     . GLN A  1 637 ? 91.806  83.459  133.526 1.00 86.55 ? 637 GLN A O     1 
ATOM   5021  C  CB    . GLN A  1 637 ? 94.170  82.403  131.671 1.00 86.55 ? 637 GLN A CB    1 
ATOM   5022  C  CG    . GLN A  1 637 ? 94.835  81.123  131.124 1.00 86.55 ? 637 GLN A CG    1 
ATOM   5023  C  CD    . GLN A  1 637 ? 94.179  79.804  131.540 1.00 86.55 ? 637 GLN A CD    1 
ATOM   5024  O  OE1   . GLN A  1 637 ? 93.617  79.670  132.632 1.00 86.55 ? 637 GLN A OE1   1 
ATOM   5025  N  NE2   . GLN A  1 637 ? 94.248  78.818  130.651 1.00 86.55 ? 637 GLN A NE2   1 
ATOM   5026  N  N     . GLN A  1 638 ? 91.951  84.839  131.751 1.00 88.62 ? 638 GLN A N     1 
ATOM   5027  C  CA    . GLN A  1 638 ? 91.248  85.916  132.439 1.00 88.62 ? 638 GLN A CA    1 
ATOM   5028  C  C     . GLN A  1 638 ? 89.761  85.621  132.585 1.00 88.62 ? 638 GLN A C     1 
ATOM   5029  O  O     . GLN A  1 638 ? 89.168  85.970  133.611 1.00 88.62 ? 638 GLN A O     1 
ATOM   5030  C  CB    . GLN A  1 638 ? 91.445  87.239  131.696 1.00 88.62 ? 638 GLN A CB    1 
ATOM   5031  C  CG    . GLN A  1 638 ? 90.988  88.468  132.470 1.00 88.62 ? 638 GLN A CG    1 
ATOM   5032  C  CD    . GLN A  1 638 ? 91.209  89.754  131.702 1.00 88.62 ? 638 GLN A CD    1 
ATOM   5033  O  OE1   . GLN A  1 638 ? 91.835  89.757  130.643 1.00 88.62 ? 638 GLN A OE1   1 
ATOM   5034  N  NE2   . GLN A  1 638 ? 90.700  90.858  132.235 1.00 88.62 ? 638 GLN A NE2   1 
ATOM   5035  N  N     . GLN A  1 639 ? 89.154  84.978  131.584 1.00 87.13 ? 639 GLN A N     1 
ATOM   5036  C  CA    . GLN A  1 639 ? 87.751  84.589  131.673 1.00 87.13 ? 639 GLN A CA    1 
ATOM   5037  C  C     . GLN A  1 639 ? 87.531  83.477  132.694 1.00 87.13 ? 639 GLN A C     1 
ATOM   5038  O  O     . GLN A  1 639 ? 86.512  83.479  133.396 1.00 87.13 ? 639 GLN A O     1 
ATOM   5039  C  CB    . GLN A  1 639 ? 87.249  84.170  130.283 1.00 87.13 ? 639 GLN A CB    1 
ATOM   5040  C  CG    . GLN A  1 639 ? 85.826  83.607  130.203 1.00 87.13 ? 639 GLN A CG    1 
ATOM   5041  C  CD    . GLN A  1 639 ? 85.772  82.089  130.286 1.00 87.13 ? 639 GLN A CD    1 
ATOM   5042  O  OE1   . GLN A  1 639 ? 86.802  81.425  130.393 1.00 87.13 ? 639 GLN A OE1   1 
ATOM   5043  N  NE2   . GLN A  1 639 ? 84.565  81.535  130.241 1.00 87.13 ? 639 GLN A NE2   1 
ATOM   5044  N  N     . MET A  1 640 ? 88.473  82.536  132.804 1.00 90.02 ? 640 MET A N     1 
ATOM   5045  C  CA    . MET A  1 640 ? 88.272  81.372  133.663 1.00 90.02 ? 640 MET A CA    1 
ATOM   5046  C  C     . MET A  1 640 ? 88.373  81.719  135.145 1.00 90.02 ? 640 MET A C     1 
ATOM   5047  O  O     . MET A  1 640 ? 87.689  81.107  135.973 1.00 90.02 ? 640 MET A O     1 
ATOM   5048  C  CB    . MET A  1 640 ? 89.278  80.280  133.304 1.00 90.02 ? 640 MET A CB    1 
ATOM   5049  C  CG    . MET A  1 640 ? 88.707  79.188  132.419 1.00 90.02 ? 640 MET A CG    1 
ATOM   5050  S  SD    . MET A  1 640 ? 87.298  78.350  133.169 1.00 90.02 ? 640 MET A SD    1 
ATOM   5051  C  CE    . MET A  1 640 ? 88.022  77.756  134.696 1.00 90.02 ? 640 MET A CE    1 
ATOM   5052  N  N     . LYS A  1 641 ? 89.213  82.684  135.503 1.00 87.69 ? 641 LYS A N     1 
ATOM   5053  C  CA    . LYS A  1 641 ? 89.351  83.081  136.901 1.00 87.69 ? 641 LYS A CA    1 
ATOM   5054  C  C     . LYS A  1 641 ? 88.169  83.934  137.349 1.00 87.69 ? 641 LYS A C     1 
ATOM   5055  O  O     . LYS A  1 641 ? 87.266  83.449  138.032 1.00 87.69 ? 641 LYS A O     1 
ATOM   5056  C  CB    . LYS A  1 641 ? 90.660  83.840  137.124 1.00 87.69 ? 641 LYS A CB    1 
ATOM   5057  C  CG    . LYS A  1 641 ? 91.905  82.985  136.963 1.00 87.69 ? 641 LYS A CG    1 
ATOM   5058  C  CD    . LYS A  1 641 ? 93.118  83.835  136.627 1.00 87.69 ? 641 LYS A CD    1 
ATOM   5059  C  CE    . LYS A  1 641 ? 94.303  82.970  136.233 1.00 87.69 ? 641 LYS A CE    1 
ATOM   5060  N  NZ    . LYS A  1 641 ? 95.431  83.780  135.700 1.00 87.69 ? 641 LYS A NZ    1 
ATOM   5061  N  N     . SER B  1 13  ? 64.519  69.092  134.829 1.00 65.36 ? 13  SER B N     1 
ATOM   5062  C  CA    . SER B  1 13  ? 63.774  68.118  134.041 1.00 65.36 ? 13  SER B CA    1 
ATOM   5063  C  C     . SER B  1 13  ? 62.562  68.762  133.378 1.00 65.36 ? 13  SER B C     1 
ATOM   5064  O  O     . SER B  1 13  ? 61.777  68.091  132.709 1.00 65.36 ? 13  SER B O     1 
ATOM   5065  C  CB    . SER B  1 13  ? 63.334  66.943  134.916 1.00 65.36 ? 13  SER B CB    1 
ATOM   5066  N  N     . SER B  1 14  ? 62.415  70.075  133.571 1.00 63.21 ? 14  SER B N     1 
ATOM   5067  C  CA    . SER B  1 14  ? 61.327  70.834  132.966 1.00 63.21 ? 14  SER B CA    1 
ATOM   5068  C  C     . SER B  1 14  ? 61.849  72.010  132.150 1.00 63.21 ? 14  SER B C     1 
ATOM   5069  O  O     . SER B  1 14  ? 61.119  72.982  131.935 1.00 63.21 ? 14  SER B O     1 
ATOM   5070  C  CB    . SER B  1 14  ? 60.349  71.331  134.034 1.00 63.21 ? 14  SER B CB    1 
ATOM   5071  O  OG    . SER B  1 14  ? 60.762  72.580  134.561 1.00 63.21 ? 14  SER B OG    1 
ATOM   5072  N  N     . PHE B  1 15  ? 63.095  71.940  131.690 1.00 54.80 ? 15  PHE B N     1 
ATOM   5073  C  CA    . PHE B  1 15  ? 63.709  73.030  130.950 1.00 54.80 ? 15  PHE B CA    1 
ATOM   5074  C  C     . PHE B  1 15  ? 63.249  73.011  129.494 1.00 54.80 ? 15  PHE B C     1 
ATOM   5075  O  O     . PHE B  1 15  ? 62.437  72.182  129.074 1.00 54.80 ? 15  PHE B O     1 
ATOM   5076  C  CB    . PHE B  1 15  ? 65.235  72.955  131.057 1.00 54.80 ? 15  PHE B CB    1 
ATOM   5077  C  CG    . PHE B  1 15  ? 65.845  71.726  130.425 1.00 54.80 ? 15  PHE B CG    1 
ATOM   5078  C  CD1   . PHE B  1 15  ? 65.932  70.534  131.129 1.00 54.80 ? 15  PHE B CD1   1 
ATOM   5079  C  CD2   . PHE B  1 15  ? 66.365  71.774  129.141 1.00 54.80 ? 15  PHE B CD2   1 
ATOM   5080  C  CE1   . PHE B  1 15  ? 66.495  69.412  130.555 1.00 54.80 ? 15  PHE B CE1   1 
ATOM   5081  C  CE2   . PHE B  1 15  ? 66.928  70.654  128.562 1.00 54.80 ? 15  PHE B CE2   1 
ATOM   5082  C  CZ    . PHE B  1 15  ? 66.994  69.474  129.272 1.00 54.80 ? 15  PHE B CZ    1 
ATOM   5083  N  N     . THR B  1 16  ? 63.784  73.944  128.708 1.00 47.73 ? 16  THR B N     1 
ATOM   5084  C  CA    . THR B  1 16  ? 63.479  74.023  127.289 1.00 47.73 ? 16  THR B CA    1 
ATOM   5085  C  C     . THR B  1 16  ? 64.576  73.329  126.502 1.00 47.73 ? 16  THR B C     1 
ATOM   5086  O  O     . THR B  1 16  ? 65.746  73.725  126.617 1.00 47.73 ? 16  THR B O     1 
ATOM   5087  C  CB    . THR B  1 16  ? 63.356  75.475  126.846 1.00 47.73 ? 16  THR B CB    1 
ATOM   5088  O  OG1   . THR B  1 16  ? 64.449  76.230  127.384 1.00 47.73 ? 16  THR B OG1   1 
ATOM   5089  C  CG2   . THR B  1 16  ? 62.047  76.067  127.337 1.00 47.73 ? 16  THR B CG2   1 
ATOM   5090  N  N     . PRO B  1 17  ? 64.263  72.304  125.711 1.00 44.45 ? 17  PRO B N     1 
ATOM   5091  C  CA    . PRO B  1 17  ? 65.313  71.613  124.956 1.00 44.45 ? 17  PRO B CA    1 
ATOM   5092  C  C     . PRO B  1 17  ? 65.796  72.460  123.793 1.00 44.45 ? 17  PRO B C     1 
ATOM   5093  O  O     . PRO B  1 17  ? 65.003  73.055  123.062 1.00 44.45 ? 17  PRO B O     1 
ATOM   5094  C  CB    . PRO B  1 17  ? 64.621  70.334  124.465 1.00 44.45 ? 17  PRO B CB    1 
ATOM   5095  C  CG    . PRO B  1 17  ? 63.287  70.295  125.160 1.00 44.45 ? 17  PRO B CG    1 
ATOM   5096  C  CD    . PRO B  1 17  ? 62.942  71.703  125.484 1.00 44.45 ? 17  PRO B CD    1 
ATOM   5097  N  N     . LEU B  1 18  ? 67.110  72.513  123.629 1.00 38.92 ? 18  LEU B N     1 
ATOM   5098  C  CA    . LEU B  1 18  ? 67.716  73.332  122.590 1.00 38.92 ? 18  LEU B CA    1 
ATOM   5099  C  C     . LEU B  1 18  ? 68.518  72.534  121.579 1.00 38.92 ? 18  LEU B C     1 
ATOM   5100  O  O     . LEU B  1 18  ? 68.454  72.830  120.386 1.00 38.92 ? 18  LEU B O     1 
ATOM   5101  C  CB    . LEU B  1 18  ? 68.612  74.405  123.222 1.00 38.92 ? 18  LEU B CB    1 
ATOM   5102  C  CG    . LEU B  1 18  ? 67.898  75.381  124.157 1.00 38.92 ? 18  LEU B CG    1 
ATOM   5103  C  CD1   . LEU B  1 18  ? 68.832  76.477  124.614 1.00 38.92 ? 18  LEU B CD1   1 
ATOM   5104  C  CD2   . LEU B  1 18  ? 66.679  75.978  123.486 1.00 38.92 ? 18  LEU B CD2   1 
ATOM   5105  N  N     . VAL B  1 19  ? 69.274  71.530  122.014 1.00 32.70 ? 19  VAL B N     1 
ATOM   5106  C  CA    . VAL B  1 19  ? 70.130  70.757  121.122 1.00 32.70 ? 19  VAL B CA    1 
ATOM   5107  C  C     . VAL B  1 19  ? 69.845  69.277  121.339 1.00 32.70 ? 19  VAL B C     1 
ATOM   5108  O  O     . VAL B  1 19  ? 69.777  68.815  122.479 1.00 32.70 ? 19  VAL B O     1 
ATOM   5109  C  CB    . VAL B  1 19  ? 71.616  71.103  121.369 1.00 32.70 ? 19  VAL B CB    1 
ATOM   5110  C  CG1   . VAL B  1 19  ? 72.539  69.998  120.924 1.00 32.70 ? 19  VAL B CG1   1 
ATOM   5111  C  CG2   . VAL B  1 19  ? 71.973  72.387  120.654 1.00 32.70 ? 19  VAL B CG2   1 
ATOM   5112  N  N     . VAL B  1 20  ? 69.660  68.530  120.254 1.00 33.96 ? 20  VAL B N     1 
ATOM   5113  C  CA    . VAL B  1 20  ? 69.407  67.098  120.324 1.00 33.96 ? 20  VAL B CA    1 
ATOM   5114  C  C     . VAL B  1 20  ? 70.665  66.365  119.890 1.00 33.96 ? 20  VAL B C     1 
ATOM   5115  O  O     . VAL B  1 20  ? 71.225  66.654  118.824 1.00 33.96 ? 20  VAL B O     1 
ATOM   5116  C  CB    . VAL B  1 20  ? 68.211  66.693  119.449 1.00 33.96 ? 20  VAL B CB    1 
ATOM   5117  C  CG1   . VAL B  1 20  ? 67.902  65.223  119.625 1.00 33.96 ? 20  VAL B CG1   1 
ATOM   5118  C  CG2   . VAL B  1 20  ? 67.010  67.527  119.797 1.00 33.96 ? 20  VAL B CG2   1 
ATOM   5119  N  N     . ILE B  1 21  ? 71.107  65.425  120.719 1.00 40.36 ? 21  ILE B N     1 
ATOM   5120  C  CA    . ILE B  1 21  ? 72.223  64.539  120.411 1.00 40.36 ? 21  ILE B CA    1 
ATOM   5121  C  C     . ILE B  1 21  ? 71.652  63.147  120.190 1.00 40.36 ? 21  ILE B C     1 
ATOM   5122  O  O     . ILE B  1 21  ? 70.978  62.603  121.073 1.00 40.36 ? 21  ILE B O     1 
ATOM   5123  C  CB    . ILE B  1 21  ? 73.265  64.528  121.539 1.00 40.36 ? 21  ILE B CB    1 
ATOM   5124  C  CG1   . ILE B  1 21  ? 73.850  65.923  121.740 1.00 40.36 ? 21  ILE B CG1   1 
ATOM   5125  C  CG2   . ILE B  1 21  ? 74.364  63.532  121.236 1.00 40.36 ? 21  ILE B CG2   1 
ATOM   5126  C  CD1   . ILE B  1 21  ? 74.852  66.002  122.863 1.00 40.36 ? 21  ILE B CD1   1 
ATOM   5127  N  N     . GLU B  1 22  ? 71.909  62.566  119.023 1.00 50.35 ? 22  GLU B N     1 
ATOM   5128  C  CA    . GLU B  1 22  ? 71.414  61.231  118.711 1.00 50.35 ? 22  GLU B CA    1 
ATOM   5129  C  C     . GLU B  1 22  ? 72.580  60.255  118.786 1.00 50.35 ? 22  GLU B C     1 
ATOM   5130  O  O     . GLU B  1 22  ? 73.521  60.343  117.992 1.00 50.35 ? 22  GLU B O     1 
ATOM   5131  C  CB    . GLU B  1 22  ? 70.753  61.187  117.337 1.00 50.35 ? 22  GLU B CB    1 
ATOM   5132  C  CG    . GLU B  1 22  ? 70.153  59.832  117.008 1.00 50.35 ? 22  GLU B CG    1 
ATOM   5133  C  CD    . GLU B  1 22  ? 69.814  59.676  115.542 1.00 50.35 ? 22  GLU B CD    1 
ATOM   5134  O  OE1   . GLU B  1 22  ? 70.122  60.596  114.758 1.00 50.35 ? 22  GLU B OE1   1 
ATOM   5135  O  OE2   . GLU B  1 22  ? 69.241  58.631  115.172 1.00 50.35 ? 22  GLU B OE2   1 
ATOM   5136  N  N     . LEU B  1 23  ? 72.521  59.334  119.743 1.00 57.68 ? 23  LEU B N     1 
ATOM   5137  C  CA    . LEU B  1 23  ? 73.538  58.303  119.842 1.00 57.68 ? 23  LEU B CA    1 
ATOM   5138  C  C     . LEU B  1 23  ? 73.268  57.196  118.826 1.00 57.68 ? 23  LEU B C     1 
ATOM   5139  O  O     . LEU B  1 23  ? 72.226  57.153  118.168 1.00 57.68 ? 23  LEU B O     1 
ATOM   5140  C  CB    . LEU B  1 23  ? 73.582  57.720  121.252 1.00 57.68 ? 23  LEU B CB    1 
ATOM   5141  C  CG    . LEU B  1 23  ? 73.991  58.618  122.421 1.00 57.68 ? 23  LEU B CG    1 
ATOM   5142  C  CD1   . LEU B  1 23  ? 74.435  57.763  123.589 1.00 57.68 ? 23  LEU B CD1   1 
ATOM   5143  C  CD2   . LEU B  1 23  ? 75.092  59.575  122.030 1.00 57.68 ? 23  LEU B CD2   1 
ATOM   5144  N  N     . ALA B  1 24  ? 74.229  56.286  118.703 1.00 65.42 ? 24  ALA B N     1 
ATOM   5145  C  CA    . ALA B  1 24  ? 74.067  55.136  117.830 1.00 65.42 ? 24  ALA B CA    1 
ATOM   5146  C  C     . ALA B  1 24  ? 73.246  54.058  118.534 1.00 65.42 ? 24  ALA B C     1 
ATOM   5147  O  O     . ALA B  1 24  ? 72.840  54.199  119.691 1.00 65.42 ? 24  ALA B O     1 
ATOM   5148  C  CB    . ALA B  1 24  ? 75.428  54.600  117.396 1.00 65.42 ? 24  ALA B CB    1 
ATOM   5149  N  N     . GLN B  1 25  ? 72.994  52.959  117.825 1.00 74.45 ? 25  GLN B N     1 
ATOM   5150  C  CA    . GLN B  1 25  ? 72.225  51.860  118.407 1.00 74.45 ? 25  GLN B CA    1 
ATOM   5151  C  C     . GLN B  1 25  ? 73.088  51.039  119.359 1.00 74.45 ? 25  GLN B C     1 
ATOM   5152  O  O     . GLN B  1 25  ? 72.775  50.908  120.547 1.00 74.45 ? 25  GLN B O     1 
ATOM   5153  C  CB    . GLN B  1 25  ? 71.640  50.982  117.297 1.00 74.45 ? 25  GLN B CB    1 
ATOM   5154  C  CG    . GLN B  1 25  ? 70.579  51.667  116.455 1.00 74.45 ? 25  GLN B CG    1 
ATOM   5155  C  CD    . GLN B  1 25  ? 69.281  51.873  117.207 1.00 74.45 ? 25  GLN B CD    1 
ATOM   5156  O  OE1   . GLN B  1 25  ? 68.959  51.126  118.130 1.00 74.45 ? 25  GLN B OE1   1 
ATOM   5157  N  NE2   . GLN B  1 25  ? 68.528  52.893  116.816 1.00 74.45 ? 25  GLN B NE2   1 
ATOM   5158  N  N     . ASP B  1 26  ? 74.188  50.482  118.850 1.00 78.70 ? 26  ASP B N     1 
ATOM   5159  C  CA    . ASP B  1 26  ? 75.070  49.629  119.645 1.00 78.70 ? 26  ASP B CA    1 
ATOM   5160  C  C     . ASP B  1 26  ? 76.030  50.510  120.438 1.00 78.70 ? 26  ASP B C     1 
ATOM   5161  O  O     . ASP B  1 26  ? 77.211  50.662  120.114 1.00 78.70 ? 26  ASP B O     1 
ATOM   5162  C  CB    . ASP B  1 26  ? 75.818  48.650  118.748 1.00 78.70 ? 26  ASP B CB    1 
ATOM   5163  N  N     . VAL B  1 27  ? 75.503  51.104  121.505 1.00 77.01 ? 27  VAL B N     1 
ATOM   5164  C  CA    . VAL B  1 27  ? 76.280  51.926  122.425 1.00 77.01 ? 27  VAL B CA    1 
ATOM   5165  C  C     . VAL B  1 27  ? 76.076  51.359  123.821 1.00 77.01 ? 27  VAL B C     1 
ATOM   5166  O  O     . VAL B  1 27  ? 74.935  51.233  124.284 1.00 77.01 ? 27  VAL B O     1 
ATOM   5167  C  CB    . VAL B  1 27  ? 75.870  53.407  122.358 1.00 77.01 ? 27  VAL B CB    1 
ATOM   5168  C  CG1   . VAL B  1 27  ? 76.436  54.179  123.538 1.00 77.01 ? 27  VAL B CG1   1 
ATOM   5169  C  CG2   . VAL B  1 27  ? 76.342  54.024  121.055 1.00 77.01 ? 27  VAL B CG2   1 
ATOM   5170  N  N     . LYS B  1 28  ? 77.175  51.005  124.483 1.00 81.39 ? 28  LYS B N     1 
ATOM   5171  C  CA    . LYS B  1 28  ? 77.098  50.398  125.802 1.00 81.39 ? 28  LYS B CA    1 
ATOM   5172  C  C     . LYS B  1 28  ? 76.693  51.428  126.853 1.00 81.39 ? 28  LYS B C     1 
ATOM   5173  O  O     . LYS B  1 28  ? 76.713  52.640  126.620 1.00 81.39 ? 28  LYS B O     1 
ATOM   5174  C  CB    . LYS B  1 28  ? 78.436  49.760  126.173 1.00 81.39 ? 28  LYS B CB    1 
ATOM   5175  C  CG    . LYS B  1 28  ? 79.040  48.920  125.061 1.00 81.39 ? 28  LYS B CG    1 
ATOM   5176  C  CD    . LYS B  1 28  ? 80.172  48.048  125.574 1.00 81.39 ? 28  LYS B CD    1 
ATOM   5177  C  CE    . LYS B  1 28  ? 81.191  47.773  124.483 1.00 81.39 ? 28  LYS B CE    1 
ATOM   5178  N  NZ    . LYS B  1 28  ? 80.598  47.031  123.338 1.00 81.39 ? 28  LYS B NZ    1 
ATOM   5179  N  N     . GLU B  1 29  ? 76.312  50.922  128.029 1.00 82.05 ? 29  GLU B N     1 
ATOM   5180  C  CA    . GLU B  1 29  ? 75.807  51.790  129.087 1.00 82.05 ? 29  GLU B CA    1 
ATOM   5181  C  C     . GLU B  1 29  ? 76.913  52.623  129.720 1.00 82.05 ? 29  GLU B C     1 
ATOM   5182  O  O     . GLU B  1 29  ? 76.655  53.748  130.166 1.00 82.05 ? 29  GLU B O     1 
ATOM   5183  C  CB    . GLU B  1 29  ? 75.102  50.956  130.155 1.00 82.05 ? 29  GLU B CB    1 
ATOM   5184  C  CG    . GLU B  1 29  ? 74.133  51.741  131.022 1.00 82.05 ? 29  GLU B CG    1 
ATOM   5185  C  CD    . GLU B  1 29  ? 72.744  51.822  130.422 1.00 82.05 ? 29  GLU B CD    1 
ATOM   5186  O  OE1   . GLU B  1 29  ? 72.046  52.828  130.668 1.00 82.05 ? 29  GLU B OE1   1 
ATOM   5187  O  OE2   . GLU B  1 29  ? 72.349  50.877  129.708 1.00 82.05 ? 29  GLU B OE2   1 
ATOM   5188  N  N     . GLU B  1 30  ? 78.141  52.093  129.764 1.00 80.50 ? 30  GLU B N     1 
ATOM   5189  C  CA    . GLU B  1 30  ? 79.244  52.793  130.419 1.00 80.50 ? 30  GLU B CA    1 
ATOM   5190  C  C     . GLU B  1 30  ? 79.624  54.062  129.668 1.00 80.50 ? 30  GLU B C     1 
ATOM   5191  O  O     . GLU B  1 30  ? 79.910  55.092  130.290 1.00 80.50 ? 30  GLU B O     1 
ATOM   5192  C  CB    . GLU B  1 30  ? 80.451  51.864  130.547 1.00 80.50 ? 30  GLU B CB    1 
ATOM   5193  N  N     . THR B  1 31  ? 79.601  54.013  128.332 1.00 78.72 ? 31  THR B N     1 
ATOM   5194  C  CA    . THR B  1 31  ? 79.853  55.207  127.532 1.00 78.72 ? 31  THR B CA    1 
ATOM   5195  C  C     . THR B  1 31  ? 78.751  56.243  127.713 1.00 78.72 ? 31  THR B C     1 
ATOM   5196  O  O     . THR B  1 31  ? 79.035  57.446  127.749 1.00 78.72 ? 31  THR B O     1 
ATOM   5197  C  CB    . THR B  1 31  ? 79.991  54.828  126.058 1.00 78.72 ? 31  THR B CB    1 
ATOM   5198  O  OG1   . THR B  1 31  ? 80.824  53.670  125.940 1.00 78.72 ? 31  THR B OG1   1 
ATOM   5199  C  CG2   . THR B  1 31  ? 80.614  55.964  125.265 1.00 78.72 ? 31  THR B CG2   1 
ATOM   5200  N  N     . LYS B  1 32  ? 77.502  55.794  127.873 1.00 75.51 ? 32  LYS B N     1 
ATOM   5201  C  CA    . LYS B  1 32  ? 76.392  56.716  128.097 1.00 75.51 ? 32  LYS B CA    1 
ATOM   5202  C  C     . LYS B  1 32  ? 76.512  57.417  129.443 1.00 75.51 ? 32  LYS B C     1 
ATOM   5203  O  O     . LYS B  1 32  ? 76.330  58.637  129.528 1.00 75.51 ? 32  LYS B O     1 
ATOM   5204  C  CB    . LYS B  1 32  ? 75.063  55.971  128.004 1.00 75.51 ? 32  LYS B CB    1 
ATOM   5205  C  CG    . LYS B  1 32  ? 74.694  55.533  126.603 1.00 75.51 ? 32  LYS B CG    1 
ATOM   5206  C  CD    . LYS B  1 32  ? 73.317  54.895  126.572 1.00 75.51 ? 32  LYS B CD    1 
ATOM   5207  N  N     . GLU B  1 33  ? 76.837  56.668  130.503 1.00 77.63 ? 33  GLU B N     1 
ATOM   5208  C  CA    . GLU B  1 33  ? 77.000  57.297  131.811 1.00 77.63 ? 33  GLU B CA    1 
ATOM   5209  C  C     . GLU B  1 33  ? 78.249  58.166  131.871 1.00 77.63 ? 33  GLU B C     1 
ATOM   5210  O  O     . GLU B  1 33  ? 78.250  59.187  132.565 1.00 77.63 ? 33  GLU B O     1 
ATOM   5211  C  CB    . GLU B  1 33  ? 77.032  56.243  132.925 1.00 77.63 ? 33  GLU B CB    1 
ATOM   5212  C  CG    . GLU B  1 33  ? 75.879  55.214  132.947 1.00 77.63 ? 33  GLU B CG    1 
ATOM   5213  C  CD    . GLU B  1 33  ? 74.461  55.794  133.023 1.00 77.63 ? 33  GLU B CD    1 
ATOM   5214  O  OE1   . GLU B  1 33  ? 74.267  56.956  133.443 1.00 77.63 ? 33  GLU B OE1   1 
ATOM   5215  O  OE2   . GLU B  1 33  ? 73.520  55.063  132.646 1.00 77.63 ? 33  GLU B OE2   1 
ATOM   5216  N  N     . TRP B  1 34  ? 79.298  57.813  131.124 1.00 73.22 ? 34  TRP B N     1 
ATOM   5217  C  CA    . TRP B  1 34  ? 80.493  58.651  131.095 1.00 73.22 ? 34  TRP B CA    1 
ATOM   5218  C  C     . TRP B  1 34  ? 80.244  59.954  130.344 1.00 73.22 ? 34  TRP B C     1 
ATOM   5219  O  O     . TRP B  1 34  ? 80.711  61.018  130.769 1.00 73.22 ? 34  TRP B O     1 
ATOM   5220  C  CB    . TRP B  1 34  ? 81.651  57.878  130.471 1.00 73.22 ? 34  TRP B CB    1 
ATOM   5221  C  CG    . TRP B  1 34  ? 82.848  58.715  130.182 1.00 73.22 ? 34  TRP B CG    1 
ATOM   5222  C  CD1   . TRP B  1 34  ? 83.801  59.121  131.067 1.00 73.22 ? 34  TRP B CD1   1 
ATOM   5223  C  CD2   . TRP B  1 34  ? 83.227  59.248  128.911 1.00 73.22 ? 34  TRP B CD2   1 
ATOM   5224  N  NE1   . TRP B  1 34  ? 84.752  59.876  130.426 1.00 73.22 ? 34  TRP B NE1   1 
ATOM   5225  C  CE2   . TRP B  1 34  ? 84.421  59.968  129.100 1.00 73.22 ? 34  TRP B CE2   1 
ATOM   5226  C  CE3   . TRP B  1 34  ? 82.671  59.187  127.631 1.00 73.22 ? 34  TRP B CE3   1 
ATOM   5227  C  CZ2   . TRP B  1 34  ? 85.068  60.622  128.057 1.00 73.22 ? 34  TRP B CZ2   1 
ATOM   5228  C  CZ3   . TRP B  1 34  ? 83.314  59.835  126.598 1.00 73.22 ? 34  TRP B CZ3   1 
ATOM   5229  C  CH2   . TRP B  1 34  ? 84.500  60.542  126.816 1.00 73.22 ? 34  TRP B CH2   1 
ATOM   5230  N  N     . LEU B  1 35  ? 79.488  59.899  129.242 1.00 67.26 ? 35  LEU B N     1 
ATOM   5231  C  CA    . LEU B  1 35  ? 79.128  61.121  128.528 1.00 67.26 ? 35  LEU B CA    1 
ATOM   5232  C  C     . LEU B  1 35  ? 78.185  61.989  129.355 1.00 67.26 ? 35  LEU B C     1 
ATOM   5233  O  O     . LEU B  1 35  ? 78.326  63.219  129.383 1.00 67.26 ? 35  LEU B O     1 
ATOM   5234  C  CB    . LEU B  1 35  ? 78.497  60.770  127.181 1.00 67.26 ? 35  LEU B CB    1 
ATOM   5235  C  CG    . LEU B  1 35  ? 78.054  61.938  126.299 1.00 67.26 ? 35  LEU B CG    1 
ATOM   5236  C  CD1   . LEU B  1 35  ? 79.256  62.744  125.838 1.00 67.26 ? 35  LEU B CD1   1 
ATOM   5237  C  CD2   . LEU B  1 35  ? 77.251  61.442  125.109 1.00 67.26 ? 35  LEU B CD2   1 
ATOM   5238  N  N     . LYS B  1 36  ? 77.233  61.362  130.054 1.00 64.85 ? 36  LYS B N     1 
ATOM   5239  C  CA    . LYS B  1 36  ? 76.319  62.107  130.910 1.00 64.85 ? 36  LYS B CA    1 
ATOM   5240  C  C     . LYS B  1 36  ? 77.039  62.723  132.104 1.00 64.85 ? 36  LYS B C     1 
ATOM   5241  O  O     . LYS B  1 36  ? 76.664  63.809  132.558 1.00 64.85 ? 36  LYS B O     1 
ATOM   5242  C  CB    . LYS B  1 36  ? 75.188  61.194  131.380 1.00 64.85 ? 36  LYS B CB    1 
ATOM   5243  C  CG    . LYS B  1 36  ? 74.003  61.933  131.957 1.00 64.85 ? 36  LYS B CG    1 
ATOM   5244  C  CD    . LYS B  1 36  ? 72.925  60.993  132.459 1.00 64.85 ? 36  LYS B CD    1 
ATOM   5245  C  CE    . LYS B  1 36  ? 71.693  61.775  132.881 1.00 64.85 ? 36  LYS B CE    1 
ATOM   5246  N  NZ    . LYS B  1 36  ? 70.490  60.911  133.015 1.00 64.85 ? 36  LYS B NZ    1 
ATOM   5247  N  N     . ASN B  1 37  ? 78.077  62.066  132.612 1.00 69.09 ? 37  ASN B N     1 
ATOM   5248  C  CA    . ASN B  1 37  ? 78.888  62.622  133.683 1.00 69.09 ? 37  ASN B CA    1 
ATOM   5249  C  C     . ASN B  1 37  ? 79.871  63.673  133.186 1.00 69.09 ? 37  ASN B C     1 
ATOM   5250  O  O     . ASN B  1 37  ? 80.321  64.503  133.979 1.00 69.09 ? 37  ASN B O     1 
ATOM   5251  C  CB    . ASN B  1 37  ? 79.646  61.500  134.403 1.00 69.09 ? 37  ASN B CB    1 
ATOM   5252  C  CG    . ASN B  1 37  ? 80.191  61.934  135.747 1.00 69.09 ? 37  ASN B CG    1 
ATOM   5253  O  OD1   . ASN B  1 37  ? 81.350  61.680  136.073 1.00 69.09 ? 37  ASN B OD1   1 
ATOM   5254  N  ND2   . ASN B  1 37  ? 79.354  62.594  136.538 1.00 69.09 ? 37  ASN B ND2   1 
ATOM   5255  N  N     . ARG B  1 38  ? 80.216  63.659  131.900 1.00 66.28 ? 38  ARG B N     1 
ATOM   5256  C  CA    . ARG B  1 38  ? 81.051  64.713  131.341 1.00 66.28 ? 38  ARG B CA    1 
ATOM   5257  C  C     . ARG B  1 38  ? 80.253  65.896  130.815 1.00 66.28 ? 38  ARG B C     1 
ATOM   5258  O  O     . ARG B  1 38  ? 80.851  66.926  130.488 1.00 66.28 ? 38  ARG B O     1 
ATOM   5259  C  CB    . ARG B  1 38  ? 81.930  64.162  130.213 1.00 66.28 ? 38  ARG B CB    1 
ATOM   5260  C  CG    . ARG B  1 38  ? 83.170  63.434  130.696 1.00 66.28 ? 38  ARG B CG    1 
ATOM   5261  C  CD    . ARG B  1 38  ? 83.984  64.293  131.649 1.00 66.28 ? 38  ARG B CD    1 
ATOM   5262  N  NE    . ARG B  1 38  ? 84.594  65.435  130.976 1.00 66.28 ? 38  ARG B NE    1 
ATOM   5263  C  CZ    . ARG B  1 38  ? 85.782  65.405  130.381 1.00 66.28 ? 38  ARG B CZ    1 
ATOM   5264  N  NH1   . ARG B  1 38  ? 86.493  64.287  130.373 1.00 66.28 ? 38  ARG B NH1   1 
ATOM   5265  N  NH2   . ARG B  1 38  ? 86.259  66.492  129.794 1.00 66.28 ? 38  ARG B NH2   1 
ATOM   5266  N  N     . ILE B  1 39  ? 78.932  65.779  130.724 1.00 61.44 ? 39  ILE B N     1 
ATOM   5267  C  CA    . ILE B  1 39  ? 78.104  66.902  130.289 1.00 61.44 ? 39  ILE B CA    1 
ATOM   5268  C  C     . ILE B  1 39  ? 77.567  67.697  131.478 1.00 61.44 ? 39  ILE B C     1 
ATOM   5269  O  O     . ILE B  1 39  ? 77.659  68.928  131.504 1.00 61.44 ? 39  ILE B O     1 
ATOM   5270  C  CB    . ILE B  1 39  ? 76.969  66.387  129.373 1.00 61.44 ? 39  ILE B CB    1 
ATOM   5271  C  CG1   . ILE B  1 39  ? 77.509  66.139  127.965 1.00 61.44 ? 39  ILE B CG1   1 
ATOM   5272  C  CG2   . ILE B  1 39  ? 75.811  67.368  129.306 1.00 61.44 ? 39  ILE B CG2   1 
ATOM   5273  C  CD1   . ILE B  1 39  ? 76.481  65.606  127.000 1.00 61.44 ? 39  ILE B CD1   1 
ATOM   5274  N  N     . ILE B  1 40  ? 77.033  67.018  132.498 1.00 61.26 ? 40  ILE B N     1 
ATOM   5275  C  CA    . ILE B  1 40  ? 76.336  67.719  133.575 1.00 61.26 ? 40  ILE B CA    1 
ATOM   5276  C  C     . ILE B  1 40  ? 77.331  68.356  134.546 1.00 61.26 ? 40  ILE B C     1 
ATOM   5277  O  O     . ILE B  1 40  ? 77.028  69.373  135.186 1.00 61.26 ? 40  ILE B O     1 
ATOM   5278  C  CB    . ILE B  1 40  ? 75.372  66.751  134.292 1.00 61.26 ? 40  ILE B CB    1 
ATOM   5279  C  CG1   . ILE B  1 40  ? 74.416  66.111  133.295 1.00 61.26 ? 40  ILE B CG1   1 
ATOM   5280  C  CG2   . ILE B  1 40  ? 74.490  67.460  135.313 1.00 61.26 ? 40  ILE B CG2   1 
ATOM   5281  C  CD1   . ILE B  1 40  ? 73.569  65.021  133.910 1.00 61.26 ? 40  ILE B CD1   1 
ATOM   5282  N  N     . ALA B  1 41  ? 78.544  67.805  134.636 1.00 66.21 ? 41  ALA B N     1 
ATOM   5283  C  CA    . ALA B  1 41  ? 79.518  68.256  135.625 1.00 66.21 ? 41  ALA B CA    1 
ATOM   5284  C  C     . ALA B  1 41  ? 80.009  69.669  135.325 1.00 66.21 ? 41  ALA B C     1 
ATOM   5285  O  O     . ALA B  1 41  ? 80.001  70.126  134.179 1.00 66.21 ? 41  ALA B O     1 
ATOM   5286  C  CB    . ALA B  1 41  ? 80.707  67.299  135.683 1.00 66.21 ? 41  ALA B CB    1 
ATOM   5287  N  N     . LYS B  1 42  ? 80.435  70.360  136.381 1.00 68.91 ? 42  LYS B N     1 
ATOM   5288  C  CA    . LYS B  1 42  ? 80.690  71.791  136.325 1.00 68.91 ? 42  LYS B CA    1 
ATOM   5289  C  C     . LYS B  1 42  ? 81.968  72.095  135.545 1.00 68.91 ? 42  LYS B C     1 
ATOM   5290  O  O     . LYS B  1 42  ? 82.721  71.202  135.145 1.00 68.91 ? 42  LYS B O     1 
ATOM   5291  C  CB    . LYS B  1 42  ? 80.777  72.366  137.738 1.00 68.91 ? 42  LYS B CB    1 
ATOM   5292  C  CG    . LYS B  1 42  ? 79.681  71.866  138.666 1.00 68.91 ? 42  LYS B CG    1 
ATOM   5293  C  CD    . LYS B  1 42  ? 79.893  72.341  140.093 1.00 68.91 ? 42  LYS B CD    1 
ATOM   5294  C  CE    . LYS B  1 42  ? 79.419  73.773  140.277 1.00 68.91 ? 42  LYS B CE    1 
ATOM   5295  N  NZ    . LYS B  1 42  ? 77.934  73.876  140.246 1.00 68.91 ? 42  LYS B NZ    1 
ATOM   5296  N  N     . LYS B  1 43  ? 82.205  73.392  135.331 1.00 66.70 ? 43  LYS B N     1 
ATOM   5297  C  CA    . LYS B  1 43  ? 83.332  73.824  134.512 1.00 66.70 ? 43  LYS B CA    1 
ATOM   5298  C  C     . LYS B  1 43  ? 84.661  73.643  135.234 1.00 66.70 ? 43  LYS B C     1 
ATOM   5299  O  O     . LYS B  1 43  ? 85.704  73.512  134.584 1.00 66.70 ? 43  LYS B O     1 
ATOM   5300  C  CB    . LYS B  1 43  ? 83.144  75.284  134.101 1.00 66.70 ? 43  LYS B CB    1 
ATOM   5301  C  CG    . LYS B  1 43  ? 83.844  75.671  132.811 1.00 66.70 ? 43  LYS B CG    1 
ATOM   5302  C  CD    . LYS B  1 43  ? 83.249  74.935  131.625 1.00 66.70 ? 43  LYS B CD    1 
ATOM   5303  C  CE    . LYS B  1 43  ? 83.809  75.457  130.314 1.00 66.70 ? 43  LYS B CE    1 
ATOM   5304  N  NZ    . LYS B  1 43  ? 83.488  76.895  130.113 1.00 66.70 ? 43  LYS B NZ    1 
ATOM   5305  N  N     . LYS B  1 44  ? 84.648  73.633  136.568 1.00 71.41 ? 44  LYS B N     1 
ATOM   5306  C  CA    . LYS B  1 44  ? 85.871  73.408  137.328 1.00 71.41 ? 44  LYS B CA    1 
ATOM   5307  C  C     . LYS B  1 44  ? 86.226  71.931  137.440 1.00 71.41 ? 44  LYS B C     1 
ATOM   5308  O  O     . LYS B  1 44  ? 87.386  71.607  137.716 1.00 71.41 ? 44  LYS B O     1 
ATOM   5309  C  CB    . LYS B  1 44  ? 85.741  74.018  138.726 1.00 71.41 ? 44  LYS B CB    1 
ATOM   5310  C  CG    . LYS B  1 44  ? 84.557  73.499  139.524 1.00 71.41 ? 44  LYS B CG    1 
ATOM   5311  C  CD    . LYS B  1 44  ? 84.252  74.396  140.713 1.00 71.41 ? 44  LYS B CD    1 
ATOM   5312  C  CE    . LYS B  1 44  ? 83.585  75.687  140.273 1.00 71.41 ? 44  LYS B CE    1 
ATOM   5313  N  NZ    . LYS B  1 44  ? 83.169  76.520  141.434 1.00 71.41 ? 44  LYS B NZ    1 
ATOM   5314  N  N     . ASP B  1 45  ? 85.263  71.035  137.233 1.00 72.86 ? 45  ASP B N     1 
ATOM   5315  C  CA    . ASP B  1 45  ? 85.502  69.600  137.265 1.00 72.86 ? 45  ASP B CA    1 
ATOM   5316  C  C     . ASP B  1 45  ? 85.777  69.020  135.882 1.00 72.86 ? 45  ASP B C     1 
ATOM   5317  O  O     . ASP B  1 45  ? 85.730  67.797  135.712 1.00 72.86 ? 45  ASP B O     1 
ATOM   5318  C  CB    . ASP B  1 45  ? 84.313  68.881  137.906 1.00 72.86 ? 45  ASP B CB    1 
ATOM   5319  C  CG    . ASP B  1 45  ? 83.857  69.541  139.192 1.00 72.86 ? 45  ASP B CG    1 
ATOM   5320  O  OD1   . ASP B  1 45  ? 84.697  70.175  139.865 1.00 72.86 ? 45  ASP B OD1   1 
ATOM   5321  O  OD2   . ASP B  1 45  ? 82.660  69.427  139.530 1.00 72.86 ? 45  ASP B OD2   1 
ATOM   5322  N  N     . GLY B  1 46  ? 86.058  69.868  134.895 1.00 70.52 ? 46  GLY B N     1 
ATOM   5323  C  CA    . GLY B  1 46  ? 86.348  69.394  133.558 1.00 70.52 ? 46  GLY B CA    1 
ATOM   5324  C  C     . GLY B  1 46  ? 85.142  69.016  132.734 1.00 70.52 ? 46  GLY B C     1 
ATOM   5325  O  O     . GLY B  1 46  ? 85.265  68.196  131.819 1.00 70.52 ? 46  GLY B O     1 
ATOM   5326  N  N     . GLY B  1 47  ? 83.975  69.584  133.026 1.00 66.25 ? 47  GLY B N     1 
ATOM   5327  C  CA    . GLY B  1 47  ? 82.778  69.283  132.267 1.00 66.25 ? 47  GLY B CA    1 
ATOM   5328  C  C     . GLY B  1 47  ? 82.310  70.441  131.411 1.00 66.25 ? 47  GLY B C     1 
ATOM   5329  O  O     . GLY B  1 47  ? 83.122  71.224  130.911 1.00 66.25 ? 47  GLY B O     1 
ATOM   5330  N  N     . ALA B  1 48  ? 80.995  70.560  131.233 1.00 61.11 ? 48  ALA B N     1 
ATOM   5331  C  CA    . ALA B  1 48  ? 80.431  71.650  130.450 1.00 61.11 ? 48  ALA B CA    1 
ATOM   5332  C  C     . ALA B  1 48  ? 79.267  72.358  131.124 1.00 61.11 ? 48  ALA B C     1 
ATOM   5333  O  O     . ALA B  1 48  ? 78.878  73.428  130.643 1.00 61.11 ? 48  ALA B O     1 
ATOM   5334  C  CB    . ALA B  1 48  ? 79.976  71.140  129.077 1.00 61.11 ? 48  ALA B CB    1 
ATOM   5335  N  N     . GLN B  1 49  ? 78.699  71.794  132.200 1.00 58.39 ? 49  GLN B N     1 
ATOM   5336  C  CA    . GLN B  1 49  ? 77.627  72.394  133.006 1.00 58.39 ? 49  GLN B CA    1 
ATOM   5337  C  C     . GLN B  1 49  ? 76.377  72.675  132.173 1.00 58.39 ? 49  GLN B C     1 
ATOM   5338  O  O     . GLN B  1 49  ? 75.806  73.765  132.213 1.00 58.39 ? 49  GLN B O     1 
ATOM   5339  C  CB    . GLN B  1 49  ? 78.107  73.657  133.730 1.00 58.39 ? 49  GLN B CB    1 
ATOM   5340  C  CG    . GLN B  1 49  ? 77.462  73.886  135.087 1.00 58.39 ? 49  GLN B CG    1 
ATOM   5341  C  CD    . GLN B  1 49  ? 77.958  75.150  135.760 1.00 58.39 ? 49  GLN B CD    1 
ATOM   5342  O  OE1   . GLN B  1 49  ? 79.150  75.455  135.732 1.00 58.39 ? 49  GLN B OE1   1 
ATOM   5343  N  NE2   . GLN B  1 49  ? 77.042  75.895  136.368 1.00 58.39 ? 49  GLN B NE2   1 
ATOM   5344  N  N     . LEU B  1 50  ? 75.954  71.675  131.409 1.00 52.14 ? 50  LEU B N     1 
ATOM   5345  C  CA    . LEU B  1 50  ? 74.748  71.760  130.600 1.00 52.14 ? 50  LEU B CA    1 
ATOM   5346  C  C     . LEU B  1 50  ? 73.686  70.827  131.161 1.00 52.14 ? 50  LEU B C     1 
ATOM   5347  O  O     . LEU B  1 50  ? 73.992  69.717  131.603 1.00 52.14 ? 50  LEU B O     1 
ATOM   5348  C  CB    . LEU B  1 50  ? 75.030  71.401  129.141 1.00 52.14 ? 50  LEU B CB    1 
ATOM   5349  C  CG    . LEU B  1 50  ? 76.044  72.266  128.398 1.00 52.14 ? 50  LEU B CG    1 
ATOM   5350  C  CD1   . LEU B  1 50  ? 76.477  71.576  127.124 1.00 52.14 ? 50  LEU B CD1   1 
ATOM   5351  C  CD2   . LEU B  1 50  ? 75.460  73.631  128.095 1.00 52.14 ? 50  LEU B CD2   1 
ATOM   5352  N  N     . LEU B  1 51  ? 72.441  71.289  131.145 1.00 49.68 ? 51  LEU B N     1 
ATOM   5353  C  CA    . LEU B  1 51  ? 71.321  70.455  131.550 1.00 49.68 ? 51  LEU B CA    1 
ATOM   5354  C  C     . LEU B  1 51  ? 71.086  69.362  130.517 1.00 49.68 ? 51  LEU B C     1 
ATOM   5355  O  O     . LEU B  1 51  ? 70.928  69.639  129.325 1.00 49.68 ? 51  LEU B O     1 
ATOM   5356  C  CB    . LEU B  1 51  ? 70.062  71.301  131.719 1.00 49.68 ? 51  LEU B CB    1 
ATOM   5357  C  CG    . LEU B  1 51  ? 69.646  71.656  133.147 1.00 49.68 ? 51  LEU B CG    1 
ATOM   5358  C  CD1   . LEU B  1 51  ? 70.753  72.400  133.874 1.00 49.68 ? 51  LEU B CD1   1 
ATOM   5359  C  CD2   . LEU B  1 51  ? 68.368  72.475  133.132 1.00 49.68 ? 51  LEU B CD2   1 
ATOM   5360  N  N     . PHE B  1 52  ? 71.051  68.120  130.984 1.00 52.31 ? 52  PHE B N     1 
ATOM   5361  C  CA    . PHE B  1 52  ? 70.954  66.946  130.133 1.00 52.31 ? 52  PHE B CA    1 
ATOM   5362  C  C     . PHE B  1 52  ? 69.690  66.183  130.492 1.00 52.31 ? 52  PHE B C     1 
ATOM   5363  O  O     . PHE B  1 52  ? 69.288  66.139  131.657 1.00 52.31 ? 52  PHE B O     1 
ATOM   5364  C  CB    . PHE B  1 52  ? 72.190  66.064  130.313 1.00 52.31 ? 52  PHE B CB    1 
ATOM   5365  C  CG    . PHE B  1 52  ? 72.332  64.980  129.292 1.00 52.31 ? 52  PHE B CG    1 
ATOM   5366  C  CD1   . PHE B  1 52  ? 72.975  65.224  128.091 1.00 52.31 ? 52  PHE B CD1   1 
ATOM   5367  C  CD2   . PHE B  1 52  ? 71.866  63.702  129.553 1.00 52.31 ? 52  PHE B CD2   1 
ATOM   5368  C  CE1   . PHE B  1 52  ? 73.124  64.218  127.155 1.00 52.31 ? 52  PHE B CE1   1 
ATOM   5369  C  CE2   . PHE B  1 52  ? 72.013  62.694  128.623 1.00 52.31 ? 52  PHE B CE2   1 
ATOM   5370  C  CZ    . PHE B  1 52  ? 72.647  62.952  127.426 1.00 52.31 ? 52  PHE B CZ    1 
ATOM   5371  N  N     . ARG B  1 53  ? 69.063  65.577  129.487 1.00 53.79 ? 53  ARG B N     1 
ATOM   5372  C  CA    . ARG B  1 53  ? 67.810  64.874  129.720 1.00 53.79 ? 53  ARG B CA    1 
ATOM   5373  C  C     . ARG B  1 53  ? 67.652  63.799  128.661 1.00 53.79 ? 53  ARG B C     1 
ATOM   5374  O  O     . ARG B  1 53  ? 68.106  63.986  127.529 1.00 53.79 ? 53  ARG B O     1 
ATOM   5375  C  CB    . ARG B  1 53  ? 66.622  65.848  129.675 1.00 53.79 ? 53  ARG B CB    1 
ATOM   5376  C  CG    . ARG B  1 53  ? 65.327  65.306  130.246 1.00 53.79 ? 53  ARG B CG    1 
ATOM   5377  C  CD    . ARG B  1 53  ? 64.410  66.420  130.709 1.00 53.79 ? 53  ARG B CD    1 
ATOM   5378  N  NE    . ARG B  1 53  ? 64.045  67.327  129.625 1.00 53.79 ? 53  ARG B NE    1 
ATOM   5379  C  CZ    . ARG B  1 53  ? 62.996  67.153  128.830 1.00 53.79 ? 53  ARG B CZ    1 
ATOM   5380  N  NH1   . ARG B  1 53  ? 62.206  66.101  128.992 1.00 53.79 ? 53  ARG B NH1   1 
ATOM   5381  N  NH2   . ARG B  1 53  ? 62.735  68.032  127.874 1.00 53.79 ? 53  ARG B NH2   1 
ATOM   5382  N  N     . PRO B  1 54  ? 67.047  62.664  128.992 1.00 57.57 ? 54  PRO B N     1 
ATOM   5383  C  CA    . PRO B  1 54  ? 66.570  61.762  127.942 1.00 57.57 ? 54  PRO B CA    1 
ATOM   5384  C  C     . PRO B  1 54  ? 65.363  62.357  127.235 1.00 57.57 ? 54  PRO B C     1 
ATOM   5385  O  O     . PRO B  1 54  ? 64.736  63.308  127.705 1.00 57.57 ? 54  PRO B O     1 
ATOM   5386  C  CB    . PRO B  1 54  ? 66.195  60.486  128.702 1.00 57.57 ? 54  PRO B CB    1 
ATOM   5387  C  CG    . PRO B  1 54  ? 66.931  60.576  129.992 1.00 57.57 ? 54  PRO B CG    1 
ATOM   5388  C  CD    . PRO B  1 54  ? 66.997  62.033  130.320 1.00 57.57 ? 54  PRO B CD    1 
ATOM   5389  N  N     . LEU B  1 55  ? 65.045  61.783  126.075 1.00 61.15 ? 55  LEU B N     1 
ATOM   5390  C  CA    . LEU B  1 55  ? 63.873  62.243  125.338 1.00 61.15 ? 55  LEU B CA    1 
ATOM   5391  C  C     . LEU B  1 55  ? 62.589  61.839  126.048 1.00 61.15 ? 55  LEU B C     1 
ATOM   5392  O  O     . LEU B  1 55  ? 61.610  62.594  126.054 1.00 61.15 ? 55  LEU B O     1 
ATOM   5393  C  CB    . LEU B  1 55  ? 63.896  61.690  123.915 1.00 61.15 ? 55  LEU B CB    1 
ATOM   5394  C  CG    . LEU B  1 55  ? 62.843  62.239  122.954 1.00 61.15 ? 55  LEU B CG    1 
ATOM   5395  C  CD1   . LEU B  1 55  ? 62.873  63.754  122.936 1.00 61.15 ? 55  LEU B CD1   1 
ATOM   5396  C  CD2   . LEU B  1 55  ? 63.069  61.684  121.567 1.00 61.15 ? 55  LEU B CD2   1 
ATOM   5397  N  N     . LEU B  1 56  ? 62.579  60.659  126.660 1.00 72.86 ? 56  LEU B N     1 
ATOM   5398  C  CA    . LEU B  1 56  ? 61.416  60.150  127.371 1.00 72.86 ? 56  LEU B CA    1 
ATOM   5399  C  C     . LEU B  1 56  ? 61.880  59.480  128.654 1.00 72.86 ? 56  LEU B C     1 
ATOM   5400  O  O     . LEU B  1 56  ? 62.809  58.668  128.628 1.00 72.86 ? 56  LEU B O     1 
ATOM   5401  C  CB    . LEU B  1 56  ? 60.635  59.156  126.507 1.00 72.86 ? 56  LEU B CB    1 
ATOM   5402  C  CG    . LEU B  1 56  ? 59.861  59.718  125.316 1.00 72.86 ? 56  LEU B CG    1 
ATOM   5403  C  CD1   . LEU B  1 56  ? 59.435  58.592  124.395 1.00 72.86 ? 56  LEU B CD1   1 
ATOM   5404  C  CD2   . LEU B  1 56  ? 58.660  60.519  125.790 1.00 72.86 ? 56  LEU B CD2   1 
ATOM   5405  N  N     . ASN B  1 57  ? 61.237  59.823  129.773 1.00 76.12 ? 57  ASN B N     1 
ATOM   5406  C  CA    . ASN B  1 57  ? 61.578  59.199  131.046 1.00 76.12 ? 57  ASN B CA    1 
ATOM   5407  C  C     . ASN B  1 57  ? 61.140  57.742  131.120 1.00 76.12 ? 57  ASN B C     1 
ATOM   5408  O  O     . ASN B  1 57  ? 61.735  56.965  131.874 1.00 76.12 ? 57  ASN B O     1 
ATOM   5409  C  CB    . ASN B  1 57  ? 60.973  60.003  132.201 1.00 76.12 ? 57  ASN B CB    1 
ATOM   5410  C  CG    . ASN B  1 57  ? 59.470  60.215  132.058 1.00 76.12 ? 57  ASN B CG    1 
ATOM   5411  O  OD1   . ASN B  1 57  ? 58.838  59.735  131.116 1.00 76.12 ? 57  ASN B OD1   1 
ATOM   5412  N  ND2   . ASN B  1 57  ? 58.890  60.941  133.007 1.00 76.12 ? 57  ASN B ND2   1 
ATOM   5413  N  N     . LYS B  1 58  ? 60.118  57.360  130.359 1.00 79.64 ? 58  LYS B N     1 
ATOM   5414  C  CA    . LYS B  1 58  ? 59.652  55.986  130.291 1.00 79.64 ? 58  LYS B CA    1 
ATOM   5415  C  C     . LYS B  1 58  ? 59.665  55.525  128.841 1.00 79.64 ? 58  LYS B C     1 
ATOM   5416  O  O     . LYS B  1 58  ? 59.646  56.333  127.911 1.00 79.64 ? 58  LYS B O     1 
ATOM   5417  C  CB    . LYS B  1 58  ? 58.240  55.839  130.872 1.00 79.64 ? 58  LYS B CB    1 
ATOM   5418  C  CG    . LYS B  1 58  ? 58.150  56.038  132.383 1.00 79.64 ? 58  LYS B CG    1 
ATOM   5419  C  CD    . LYS B  1 58  ? 56.722  55.874  132.931 1.00 79.64 ? 58  LYS B CD    1 
ATOM   5420  C  CE    . LYS B  1 58  ? 55.852  54.924  132.106 1.00 79.64 ? 58  LYS B CE    1 
ATOM   5421  N  NZ    . LYS B  1 58  ? 54.653  54.463  132.854 1.00 79.64 ? 58  LYS B NZ    1 
ATOM   5422  N  N     . TYR B  1 59  ? 59.694  54.209  128.655 1.00 85.17 ? 59  TYR B N     1 
ATOM   5423  C  CA    . TYR B  1 59  ? 59.696  53.626  127.323 1.00 85.17 ? 59  TYR B CA    1 
ATOM   5424  C  C     . TYR B  1 59  ? 58.775  52.417  127.297 1.00 85.17 ? 59  TYR B C     1 
ATOM   5425  O  O     . TYR B  1 59  ? 58.690  51.659  128.266 1.00 85.17 ? 59  TYR B O     1 
ATOM   5426  C  CB    . TYR B  1 59  ? 61.110  53.223  126.885 1.00 85.17 ? 59  TYR B CB    1 
ATOM   5427  C  CG    . TYR B  1 59  ? 61.886  54.340  126.223 1.00 85.17 ? 59  TYR B CG    1 
ATOM   5428  C  CD1   . TYR B  1 59  ? 62.614  55.251  126.979 1.00 85.17 ? 59  TYR B CD1   1 
ATOM   5429  C  CD2   . TYR B  1 59  ? 61.887  54.484  124.841 1.00 85.17 ? 59  TYR B CD2   1 
ATOM   5430  C  CE1   . TYR B  1 59  ? 63.324  56.277  126.375 1.00 85.17 ? 59  TYR B CE1   1 
ATOM   5431  C  CE2   . TYR B  1 59  ? 62.593  55.505  124.228 1.00 85.17 ? 59  TYR B CE2   1 
ATOM   5432  C  CZ    . TYR B  1 59  ? 63.309  56.397  125.000 1.00 85.17 ? 59  TYR B CZ    1 
ATOM   5433  O  OH    . TYR B  1 59  ? 64.012  57.413  124.395 1.00 85.17 ? 59  TYR B OH    1 
ATOM   5434  N  N     . GLU B  1 60  ? 58.087  52.245  126.175 1.00 94.19 ? 60  GLU B N     1 
ATOM   5435  C  CA    . GLU B  1 60  ? 57.219  51.101  125.941 1.00 94.19 ? 60  GLU B CA    1 
ATOM   5436  C  C     . GLU B  1 60  ? 57.814  50.256  124.816 1.00 94.19 ? 60  GLU B C     1 
ATOM   5437  O  O     . GLU B  1 60  ? 58.866  50.581  124.262 1.00 94.19 ? 60  GLU B O     1 
ATOM   5438  C  CB    . GLU B  1 60  ? 55.795  51.562  125.623 1.00 94.19 ? 60  GLU B CB    1 
ATOM   5439  C  CG    . GLU B  1 60  ? 55.135  52.340  126.747 1.00 94.19 ? 60  GLU B CG    1 
ATOM   5440  N  N     . GLN B  1 61  ? 57.121  49.168  124.470 1.00 96.77 ? 61  GLN B N     1 
ATOM   5441  C  CA    . GLN B  1 61  ? 57.637  48.233  123.474 1.00 96.77 ? 61  GLN B CA    1 
ATOM   5442  C  C     . GLN B  1 61  ? 57.603  48.793  122.057 1.00 96.77 ? 61  GLN B C     1 
ATOM   5443  O  O     . GLN B  1 61  ? 58.281  48.252  121.177 1.00 96.77 ? 61  GLN B O     1 
ATOM   5444  C  CB    . GLN B  1 61  ? 56.849  46.924  123.526 1.00 96.77 ? 61  GLN B CB    1 
ATOM   5445  N  N     . GLU B  1 62  ? 56.837  49.858  121.814 1.00 98.04 ? 62  GLU B N     1 
ATOM   5446  C  CA    . GLU B  1 62  ? 56.745  50.419  120.471 1.00 98.04 ? 62  GLU B CA    1 
ATOM   5447  C  C     . GLU B  1 62  ? 57.905  51.365  120.176 1.00 98.04 ? 62  GLU B C     1 
ATOM   5448  O  O     . GLU B  1 62  ? 58.463  51.349  119.074 1.00 98.04 ? 62  GLU B O     1 
ATOM   5449  C  CB    . GLU B  1 62  ? 55.408  51.141  120.298 1.00 98.04 ? 62  GLU B CB    1 
ATOM   5450  N  N     . THR B  1 63  ? 58.281  52.198  121.149 1.00 92.76 ? 63  THR B N     1 
ATOM   5451  C  CA    . THR B  1 63  ? 59.283  53.238  120.943 1.00 92.76 ? 63  THR B CA    1 
ATOM   5452  C  C     . THR B  1 63  ? 60.682  52.818  121.384 1.00 92.76 ? 63  THR B C     1 
ATOM   5453  O  O     . THR B  1 63  ? 61.492  53.681  121.747 1.00 92.76 ? 63  THR B O     1 
ATOM   5454  C  CB    . THR B  1 63  ? 58.866  54.518  121.667 1.00 92.76 ? 63  THR B CB    1 
ATOM   5455  O  OG1   . THR B  1 63  ? 59.138  54.385  123.067 1.00 92.76 ? 63  THR B OG1   1 
ATOM   5456  C  CG2   . THR B  1 63  ? 57.384  54.781  121.469 1.00 92.76 ? 63  THR B CG2   1 
ATOM   5457  N  N     . LEU B  1 64  ? 60.996  51.521  121.359 1.00 91.04 ? 64  LEU B N     1 
ATOM   5458  C  CA    . LEU B  1 64  ? 62.328  51.066  121.744 1.00 91.04 ? 64  LEU B CA    1 
ATOM   5459  C  C     . LEU B  1 64  ? 63.388  51.346  120.687 1.00 91.04 ? 64  LEU B C     1 
ATOM   5460  O  O     . LEU B  1 64  ? 64.579  51.322  121.015 1.00 91.04 ? 64  LEU B O     1 
ATOM   5461  C  CB    . LEU B  1 64  ? 62.312  49.568  122.060 1.00 91.04 ? 64  LEU B CB    1 
ATOM   5462  C  CG    . LEU B  1 64  ? 61.725  49.099  123.393 1.00 91.04 ? 64  LEU B CG    1 
ATOM   5463  C  CD1   . LEU B  1 64  ? 62.207  47.694  123.716 1.00 91.04 ? 64  LEU B CD1   1 
ATOM   5464  C  CD2   . LEU B  1 64  ? 62.109  50.052  124.518 1.00 91.04 ? 64  LEU B CD2   1 
ATOM   5465  N  N     . GLU B  1 65  ? 62.995  51.610  119.443 1.00 86.03 ? 65  GLU B N     1 
ATOM   5466  C  CA    . GLU B  1 65  ? 63.938  51.884  118.367 1.00 86.03 ? 65  GLU B CA    1 
ATOM   5467  C  C     . GLU B  1 65  ? 64.366  53.344  118.320 1.00 86.03 ? 65  GLU B C     1 
ATOM   5468  O  O     . GLU B  1 65  ? 65.157  53.720  117.450 1.00 86.03 ? 65  GLU B O     1 
ATOM   5469  C  CB    . GLU B  1 65  ? 63.336  51.475  117.022 1.00 86.03 ? 65  GLU B CB    1 
ATOM   5470  N  N     . ASN B  1 66  ? 63.854  54.174  119.224 1.00 79.35 ? 66  ASN B N     1 
ATOM   5471  C  CA    . ASN B  1 66  ? 64.181  55.596  119.297 1.00 79.35 ? 66  ASN B CA    1 
ATOM   5472  C  C     . ASN B  1 66  ? 64.689  55.927  120.695 1.00 79.35 ? 66  ASN B C     1 
ATOM   5473  O  O     . ASN B  1 66  ? 64.319  56.934  121.298 1.00 79.35 ? 66  ASN B O     1 
ATOM   5474  C  CB    . ASN B  1 66  ? 62.964  56.449  118.942 1.00 79.35 ? 66  ASN B CB    1 
ATOM   5475  C  CG    . ASN B  1 66  ? 62.467  56.212  117.526 1.00 79.35 ? 66  ASN B CG    1 
ATOM   5476  O  OD1   . ASN B  1 66  ? 61.299  56.452  117.223 1.00 79.35 ? 66  ASN B OD1   1 
ATOM   5477  N  ND2   . ASN B  1 66  ? 63.366  55.804  116.638 1.00 79.35 ? 66  ASN B ND2   1 
ATOM   5478  N  N     . GLN B  1 67  ? 65.548  55.061  121.228 1.00 78.47 ? 67  GLN B N     1 
ATOM   5479  C  CA    . GLN B  1 67  ? 65.985  55.128  122.615 1.00 78.47 ? 67  GLN B CA    1 
ATOM   5480  C  C     . GLN B  1 67  ? 67.308  55.871  122.778 1.00 78.47 ? 67  GLN B C     1 
ATOM   5481  O  O     . GLN B  1 67  ? 67.860  55.908  123.882 1.00 78.47 ? 67  GLN B O     1 
ATOM   5482  C  CB    . GLN B  1 67  ? 66.093  53.708  123.183 1.00 78.47 ? 67  GLN B CB    1 
ATOM   5483  C  CG    . GLN B  1 67  ? 65.799  53.566  124.674 1.00 78.47 ? 67  GLN B CG    1 
ATOM   5484  C  CD    . GLN B  1 67  ? 66.039  52.157  125.181 1.00 78.47 ? 67  GLN B CD    1 
ATOM   5485  O  OE1   . GLN B  1 67  ? 65.900  51.187  124.436 1.00 78.47 ? 67  GLN B OE1   1 
ATOM   5486  N  NE2   . GLN B  1 67  ? 66.399  52.037  126.453 1.00 78.47 ? 67  GLN B NE2   1 
ATOM   5487  N  N     . ASN B  1 68  ? 67.822  56.479  121.713 1.00 62.78 ? 68  ASN B N     1 
ATOM   5488  C  CA    . ASN B  1 68  ? 69.146  57.081  121.735 1.00 62.78 ? 68  ASN B CA    1 
ATOM   5489  C  C     . ASN B  1 68  ? 69.133  58.598  121.618 1.00 62.78 ? 68  ASN B C     1 
ATOM   5490  O  O     . ASN B  1 68  ? 70.204  59.211  121.633 1.00 62.78 ? 68  ASN B O     1 
ATOM   5491  C  CB    . ASN B  1 68  ? 70.004  56.487  120.614 1.00 62.78 ? 68  ASN B CB    1 
ATOM   5492  C  CG    . ASN B  1 68  ? 69.270  56.433  119.293 1.00 62.78 ? 68  ASN B CG    1 
ATOM   5493  O  OD1   . ASN B  1 68  ? 68.114  56.845  119.197 1.00 62.78 ? 68  ASN B OD1   1 
ATOM   5494  N  ND2   . ASN B  1 68  ? 69.937  55.925  118.263 1.00 62.78 ? 68  ASN B ND2   1 
ATOM   5495  N  N     . LEU B  1 69  ? 67.965  59.221  121.503 1.00 54.21 ? 69  LEU B N     1 
ATOM   5496  C  CA    . LEU B  1 69  ? 67.891  60.669  121.371 1.00 54.21 ? 69  LEU B CA    1 
ATOM   5497  C  C     . LEU B  1 69  ? 67.903  61.327  122.743 1.00 54.21 ? 69  LEU B C     1 
ATOM   5498  O  O     . LEU B  1 69  ? 67.143  60.938  123.633 1.00 54.21 ? 69  LEU B O     1 
ATOM   5499  C  CB    . LEU B  1 69  ? 66.633  61.065  120.605 1.00 54.21 ? 69  LEU B CB    1 
ATOM   5500  C  CG    . LEU B  1 69  ? 66.617  60.656  119.135 1.00 54.21 ? 69  LEU B CG    1 
ATOM   5501  C  CD1   . LEU B  1 69  ? 65.231  60.212  118.727 1.00 54.21 ? 69  LEU B CD1   1 
ATOM   5502  C  CD2   . LEU B  1 69  ? 67.090  61.802  118.264 1.00 54.21 ? 69  LEU B CD2   1 
ATOM   5503  N  N     . TYR B  1 70  ? 68.756  62.336  122.908 1.00 50.48 ? 70  TYR B N     1 
ATOM   5504  C  CA    . TYR B  1 70  ? 68.918  63.034  124.173 1.00 50.48 ? 70  TYR B CA    1 
ATOM   5505  C  C     . TYR B  1 70  ? 68.823  64.534  123.944 1.00 50.48 ? 70  TYR B C     1 
ATOM   5506  O  O     . TYR B  1 70  ? 69.210  65.038  122.888 1.00 50.48 ? 70  TYR B O     1 
ATOM   5507  C  CB    . TYR B  1 70  ? 70.258  62.696  124.816 1.00 50.48 ? 70  TYR B CB    1 
ATOM   5508  C  CG    . TYR B  1 70  ? 70.385  61.258  125.257 1.00 50.48 ? 70  TYR B CG    1 
ATOM   5509  C  CD1   . TYR B  1 70  ? 69.348  60.624  125.927 1.00 50.48 ? 70  TYR B CD1   1 
ATOM   5510  C  CD2   . TYR B  1 70  ? 71.540  60.534  125.003 1.00 50.48 ? 70  TYR B CD2   1 
ATOM   5511  C  CE1   . TYR B  1 70  ? 69.456  59.309  126.333 1.00 50.48 ? 70  TYR B CE1   1 
ATOM   5512  C  CE2   . TYR B  1 70  ? 71.658  59.218  125.404 1.00 50.48 ? 70  TYR B CE2   1 
ATOM   5513  C  CZ    . TYR B  1 70  ? 70.613  58.612  126.068 1.00 50.48 ? 70  TYR B CZ    1 
ATOM   5514  O  OH    . TYR B  1 70  ? 70.727  57.302  126.469 1.00 50.48 ? 70  TYR B OH    1 
ATOM   5515  N  N     . LEU B  1 71  ? 68.313  65.245  124.946 1.00 45.27 ? 71  LEU B N     1 
ATOM   5516  C  CA    . LEU B  1 71  ? 68.113  66.683  124.873 1.00 45.27 ? 71  LEU B CA    1 
ATOM   5517  C  C     . LEU B  1 71  ? 69.098  67.400  125.786 1.00 45.27 ? 71  LEU B C     1 
ATOM   5518  O  O     . LEU B  1 71  ? 69.368  66.952  126.905 1.00 45.27 ? 71  LEU B O     1 
ATOM   5519  C  CB    . LEU B  1 71  ? 66.684  67.054  125.262 1.00 45.27 ? 71  LEU B CB    1 
ATOM   5520  C  CG    . LEU B  1 71  ? 65.593  66.224  124.591 1.00 45.27 ? 71  LEU B CG    1 
ATOM   5521  C  CD1   . LEU B  1 71  ? 64.236  66.638  125.100 1.00 45.27 ? 71  LEU B CD1   1 
ATOM   5522  C  CD2   . LEU B  1 71  ? 65.654  66.378  123.092 1.00 45.27 ? 71  LEU B CD2   1 
ATOM   5523  N  N     . VAL B  1 72  ? 69.632  68.515  125.295 1.00 39.38 ? 72  VAL B N     1 
ATOM   5524  C  CA    . VAL B  1 72  ? 70.611  69.329  126.000 1.00 39.38 ? 72  VAL B CA    1 
ATOM   5525  C  C     . VAL B  1 72  ? 70.121  70.769  125.987 1.00 39.38 ? 72  VAL B C     1 
ATOM   5526  O  O     . VAL B  1 72  ? 69.862  71.332  124.916 1.00 39.38 ? 72  VAL B O     1 
ATOM   5527  C  CB    . VAL B  1 72  ? 72.006  69.226  125.354 1.00 39.38 ? 72  VAL B CB    1 
ATOM   5528  C  CG1   . VAL B  1 72  ? 72.956  70.223  125.980 1.00 39.38 ? 72  VAL B CG1   1 
ATOM   5529  C  CG2   . VAL B  1 72  ? 72.564  67.822  125.484 1.00 39.38 ? 72  VAL B CG2   1 
ATOM   5530  N  N     . GLY B  1 73  ? 69.978  71.351  127.175 1.00 45.56 ? 73  GLY B N     1 
ATOM   5531  C  CA    . GLY B  1 73  ? 69.702  72.766  127.338 1.00 45.56 ? 73  GLY B CA    1 
ATOM   5532  C  C     . GLY B  1 73  ? 70.587  73.306  128.439 1.00 45.56 ? 73  GLY B C     1 
ATOM   5533  O  O     . GLY B  1 73  ? 71.564  72.640  128.788 1.00 45.56 ? 73  GLY B O     1 
ATOM   5534  N  N     . ALA B  1 74  ? 70.282  74.483  128.987 1.00 51.62 ? 74  ALA B N     1 
ATOM   5535  C  CA    . ALA B  1 74  ? 70.982  75.005  130.159 1.00 51.62 ? 74  ALA B CA    1 
ATOM   5536  C  C     . ALA B  1 74  ? 70.120  76.077  130.815 1.00 51.62 ? 74  ALA B C     1 
ATOM   5537  O  O     . ALA B  1 74  ? 69.002  76.360  130.378 1.00 51.62 ? 74  ALA B O     1 
ATOM   5538  C  CB    . ALA B  1 74  ? 72.361  75.568  129.807 1.00 51.62 ? 74  ALA B CB    1 
ATOM   5539  N  N     . SER B  1 75  ? 70.659  76.673  131.878 1.00 58.47 ? 75  SER B N     1 
ATOM   5540  C  CA    . SER B  1 75  ? 70.006  77.748  132.608 1.00 58.47 ? 75  SER B CA    1 
ATOM   5541  C  C     . SER B  1 75  ? 70.536  79.098  132.128 1.00 58.47 ? 75  SER B C     1 
ATOM   5542  O  O     . SER B  1 75  ? 71.498  79.173  131.365 1.00 58.47 ? 75  SER B O     1 
ATOM   5543  C  CB    . SER B  1 75  ? 70.216  77.570  134.110 1.00 58.47 ? 75  SER B CB    1 
ATOM   5544  O  OG    . SER B  1 75  ? 71.544  77.167  134.390 1.00 58.47 ? 75  SER B OG    1 
ATOM   5545  N  N     . LYS B  1 76  ? 69.921  80.180  132.623 1.00 63.43 ? 76  LYS B N     1 
ATOM   5546  C  CA    . LYS B  1 76  ? 70.148  81.511  132.058 1.00 63.43 ? 76  LYS B CA    1 
ATOM   5547  C  C     . LYS B  1 76  ? 71.542  82.043  132.373 1.00 63.43 ? 76  LYS B C     1 
ATOM   5548  O  O     . LYS B  1 76  ? 72.193  82.638  131.504 1.00 63.43 ? 76  LYS B O     1 
ATOM   5549  C  CB    . LYS B  1 76  ? 69.092  82.484  132.576 1.00 63.43 ? 76  LYS B CB    1 
ATOM   5550  C  CG    . LYS B  1 76  ? 67.693  82.244  132.040 1.00 63.43 ? 76  LYS B CG    1 
ATOM   5551  C  CD    . LYS B  1 76  ? 66.684  83.169  132.703 1.00 63.43 ? 76  LYS B CD    1 
ATOM   5552  C  CE    . LYS B  1 76  ? 67.087  84.626  132.563 1.00 63.43 ? 76  LYS B CE    1 
ATOM   5553  N  NZ    . LYS B  1 76  ? 66.091  85.531  133.194 1.00 63.43 ? 76  LYS B NZ    1 
ATOM   5554  N  N     . ILE B  1 77  ? 72.008  81.850  133.611 1.00 56.24 ? 77  ILE B N     1 
ATOM   5555  C  CA    . ILE B  1 77  ? 73.343  82.303  133.992 1.00 56.24 ? 77  ILE B CA    1 
ATOM   5556  C  C     . ILE B  1 77  ? 74.404  81.506  133.245 1.00 56.24 ? 77  ILE B C     1 
ATOM   5557  O  O     . ILE B  1 77  ? 75.458  82.045  132.876 1.00 56.24 ? 77  ILE B O     1 
ATOM   5558  C  CB    . ILE B  1 77  ? 73.515  82.194  135.518 1.00 56.24 ? 77  ILE B CB    1 
ATOM   5559  C  CG1   . ILE B  1 77  ? 72.306  82.802  136.227 1.00 56.24 ? 77  ILE B CG1   1 
ATOM   5560  C  CG2   . ILE B  1 77  ? 74.783  82.899  135.975 1.00 56.24 ? 77  ILE B CG2   1 
ATOM   5561  C  CD1   . ILE B  1 77  ? 71.908  82.069  137.488 1.00 56.24 ? 77  ILE B CD1   1 
ATOM   5562  N  N     . ARG B  1 78  ? 74.116  80.233  132.963 1.00 54.27 ? 78  ARG B N     1 
ATOM   5563  C  CA    . ARG B  1 78  ? 75.005  79.422  132.142 1.00 54.27 ? 78  ARG B CA    1 
ATOM   5564  C  C     . ARG B  1 78  ? 75.079  79.948  130.715 1.00 54.27 ? 78  ARG B C     1 
ATOM   5565  O  O     . ARG B  1 78  ? 76.161  79.978  130.121 1.00 54.27 ? 78  ARG B O     1 
ATOM   5566  C  CB    . ARG B  1 78  ? 74.543  77.967  132.152 1.00 54.27 ? 78  ARG B CB    1 
ATOM   5567  C  CG    . ARG B  1 78  ? 75.523  77.010  131.507 1.00 54.27 ? 78  ARG B CG    1 
ATOM   5568  C  CD    . ARG B  1 78  ? 76.891  77.120  132.147 1.00 54.27 ? 78  ARG B CD    1 
ATOM   5569  N  NE    . ARG B  1 78  ? 77.937  76.521  131.324 1.00 54.27 ? 78  ARG B NE    1 
ATOM   5570  C  CZ    . ARG B  1 78  ? 78.665  77.191  130.437 1.00 54.27 ? 78  ARG B CZ    1 
ATOM   5571  N  NH1   . ARG B  1 78  ? 78.461  78.486  130.251 1.00 54.27 ? 78  ARG B NH1   1 
ATOM   5572  N  NH2   . ARG B  1 78  ? 79.598  76.564  129.737 1.00 54.27 ? 78  ARG B NH2   1 
ATOM   5573  N  N     . MET B  1 79  ? 73.949  80.397  130.157 1.00 53.52 ? 79  MET B N     1 
ATOM   5574  C  CA    . MET B  1 79  ? 73.979  80.922  128.795 1.00 53.52 ? 79  MET B CA    1 
ATOM   5575  C  C     . MET B  1 79  ? 74.680  82.271  128.741 1.00 53.52 ? 79  MET B C     1 
ATOM   5576  O  O     . MET B  1 79  ? 75.343  82.585  127.750 1.00 53.52 ? 79  MET B O     1 
ATOM   5577  C  CB    . MET B  1 79  ? 72.570  81.031  128.212 1.00 53.52 ? 79  MET B CB    1 
ATOM   5578  C  CG    . MET B  1 79  ? 71.817  79.723  128.193 1.00 53.52 ? 79  MET B CG    1 
ATOM   5579  S  SD    . MET B  1 79  ? 72.797  78.360  127.563 1.00 53.52 ? 79  MET B SD    1 
ATOM   5580  C  CE    . MET B  1 79  ? 72.945  78.794  125.851 1.00 53.52 ? 79  MET B CE    1 
ATOM   5581  N  N     . LEU B  1 80  ? 74.567  83.075  129.802 1.00 53.64 ? 80  LEU B N     1 
ATOM   5582  C  CA    . LEU B  1 80  ? 75.281  84.349  129.816 1.00 53.64 ? 80  LEU B CA    1 
ATOM   5583  C  C     . LEU B  1 80  ? 76.786  84.143  129.962 1.00 53.64 ? 80  LEU B C     1 
ATOM   5584  O  O     . LEU B  1 80  ? 77.579  84.837  129.311 1.00 53.64 ? 80  LEU B O     1 
ATOM   5585  C  CB    . LEU B  1 80  ? 74.742  85.245  130.929 1.00 53.64 ? 80  LEU B CB    1 
ATOM   5586  C  CG    . LEU B  1 80  ? 73.293  85.699  130.758 1.00 53.64 ? 80  LEU B CG    1 
ATOM   5587  C  CD1   . LEU B  1 80  ? 72.891  86.638  131.879 1.00 53.64 ? 80  LEU B CD1   1 
ATOM   5588  C  CD2   . LEU B  1 80  ? 73.083  86.355  129.407 1.00 53.64 ? 80  LEU B CD2   1 
ATOM   5589  N  N     . LEU B  1 81  ? 77.202  83.176  130.787 1.00 53.65 ? 81  LEU B N     1 
ATOM   5590  C  CA    . LEU B  1 81  ? 78.625  82.864  130.883 1.00 53.65 ? 81  LEU B CA    1 
ATOM   5591  C  C     . LEU B  1 81  ? 79.153  82.236  129.598 1.00 53.65 ? 81  LEU B C     1 
ATOM   5592  O  O     . LEU B  1 81  ? 80.294  82.501  129.201 1.00 53.65 ? 81  LEU B O     1 
ATOM   5593  C  CB    . LEU B  1 81  ? 78.884  81.944  132.074 1.00 53.65 ? 81  LEU B CB    1 
ATOM   5594  C  CG    . LEU B  1 81  ? 78.717  82.583  133.452 1.00 53.65 ? 81  LEU B CG    1 
ATOM   5595  C  CD1   . LEU B  1 81  ? 78.887  81.543  134.544 1.00 53.65 ? 81  LEU B CD1   1 
ATOM   5596  C  CD2   . LEU B  1 81  ? 79.702  83.724  133.637 1.00 53.65 ? 81  LEU B CD2   1 
ATOM   5597  N  N     . GLY B  1 82  ? 78.331  81.437  128.913 1.00 52.03 ? 82  GLY B N     1 
ATOM   5598  C  CA    . GLY B  1 82  ? 78.730  80.914  127.620 1.00 52.03 ? 82  GLY B CA    1 
ATOM   5599  C  C     . GLY B  1 82  ? 78.796  81.976  126.542 1.00 52.03 ? 82  GLY B C     1 
ATOM   5600  O  O     . GLY B  1 82  ? 79.614  81.880  125.626 1.00 52.03 ? 82  GLY B O     1 
ATOM   5601  N  N     . ALA B  1 83  ? 77.943  82.999  126.633 1.00 50.80 ? 83  ALA B N     1 
ATOM   5602  C  CA    . ALA B  1 83  ? 78.041  84.128  125.717 1.00 50.80 ? 83  ALA B CA    1 
ATOM   5603  C  C     . ALA B  1 83  ? 79.278  84.964  125.999 1.00 50.80 ? 83  ALA B C     1 
ATOM   5604  O  O     . ALA B  1 83  ? 79.842  85.562  125.077 1.00 50.80 ? 83  ALA B O     1 
ATOM   5605  C  CB    . ALA B  1 83  ? 76.786  84.993  125.810 1.00 50.80 ? 83  ALA B CB    1 
ATOM   5606  N  N     . GLU B  1 84  ? 79.697  85.037  127.264 1.00 54.89 ? 84  GLU B N     1 
ATOM   5607  C  CA    . GLU B  1 84  ? 80.986  85.648  127.575 1.00 54.89 ? 84  GLU B CA    1 
ATOM   5608  C  C     . GLU B  1 84  ? 82.134  84.825  127.002 1.00 54.89 ? 84  GLU B C     1 
ATOM   5609  O  O     . GLU B  1 84  ? 83.119  85.383  126.502 1.00 54.89 ? 84  GLU B O     1 
ATOM   5610  C  CB    . GLU B  1 84  ? 81.146  85.802  129.088 1.00 54.89 ? 84  GLU B CB    1 
ATOM   5611  C  CG    . GLU B  1 84  ? 82.455  86.456  129.515 1.00 54.89 ? 84  GLU B CG    1 
ATOM   5612  C  CD    . GLU B  1 84  ? 82.559  86.645  131.014 1.00 54.89 ? 84  GLU B CD    1 
ATOM   5613  O  OE1   . GLU B  1 84  ? 82.137  87.708  131.513 1.00 54.89 ? 84  GLU B OE1   1 
ATOM   5614  O  OE2   . GLU B  1 84  ? 83.069  85.730  131.695 1.00 54.89 ? 84  GLU B OE2   1 
ATOM   5615  N  N     . ALA B  1 85  ? 82.014  83.496  127.053 1.00 52.29 ? 85  ALA B N     1 
ATOM   5616  C  CA    . ALA B  1 85  ? 83.084  82.628  126.568 1.00 52.29 ? 85  ALA B CA    1 
ATOM   5617  C  C     . ALA B  1 85  ? 83.182  82.645  125.046 1.00 52.29 ? 85  ALA B C     1 
ATOM   5618  O  O     . ALA B  1 85  ? 84.284  82.562  124.491 1.00 52.29 ? 85  ALA B O     1 
ATOM   5619  C  CB    . ALA B  1 85  ? 82.869  81.202  127.072 1.00 52.29 ? 85  ALA B CB    1 
ATOM   5620  N  N     . VAL B  1 86  ? 82.045  82.740  124.356 1.00 46.50 ? 86  VAL B N     1 
ATOM   5621  C  CA    . VAL B  1 86  ? 82.051  82.753  122.895 1.00 46.50 ? 86  VAL B CA    1 
ATOM   5622  C  C     . VAL B  1 86  ? 82.551  84.096  122.380 1.00 46.50 ? 86  VAL B C     1 
ATOM   5623  O  O     . VAL B  1 86  ? 83.433  84.161  121.515 1.00 46.50 ? 86  VAL B O     1 
ATOM   5624  C  CB    . VAL B  1 86  ? 80.649  82.419  122.353 1.00 46.50 ? 86  VAL B CB    1 
ATOM   5625  C  CG1   . VAL B  1 86  ? 80.504  82.845  120.904 1.00 46.50 ? 86  VAL B CG1   1 
ATOM   5626  C  CG2   . VAL B  1 86  ? 80.373  80.938  122.489 1.00 46.50 ? 86  VAL B CG2   1 
ATOM   5627  N  N     . GLY B  1 87  ? 82.023  85.186  122.925 1.00 47.64 ? 87  GLY B N     1 
ATOM   5628  C  CA    . GLY B  1 87  ? 82.416  86.505  122.477 1.00 47.64 ? 87  GLY B CA    1 
ATOM   5629  C  C     . GLY B  1 87  ? 81.382  87.171  121.597 1.00 47.64 ? 87  GLY B C     1 
ATOM   5630  O  O     . GLY B  1 87  ? 81.724  87.729  120.551 1.00 47.64 ? 87  GLY B O     1 
ATOM   5631  N  N     . LEU B  1 88  ? 80.115  87.094  121.997 1.00 45.94 ? 88  LEU B N     1 
ATOM   5632  C  CA    . LEU B  1 88  ? 79.055  87.798  121.292 1.00 45.94 ? 88  LEU B CA    1 
ATOM   5633  C  C     . LEU B  1 88  ? 79.237  89.304  121.421 1.00 45.94 ? 88  LEU B C     1 
ATOM   5634  O  O     . LEU B  1 88  ? 79.669  89.813  122.457 1.00 45.94 ? 88  LEU B O     1 
ATOM   5635  C  CB    . LEU B  1 88  ? 77.687  87.403  121.842 1.00 45.94 ? 88  LEU B CB    1 
ATOM   5636  C  CG    . LEU B  1 88  ? 77.224  85.962  121.654 1.00 45.94 ? 88  LEU B CG    1 
ATOM   5637  C  CD1   . LEU B  1 88  ? 75.826  85.797  122.211 1.00 45.94 ? 88  LEU B CD1   1 
ATOM   5638  C  CD2   . LEU B  1 88  ? 77.263  85.572  120.192 1.00 45.94 ? 88  LEU B CD2   1 
ATOM   5639  N  N     . VAL B  1 89  ? 78.905  90.017  120.349 1.00 45.54 ? 89  VAL B N     1 
ATOM   5640  C  CA    . VAL B  1 89  ? 79.024  91.469  120.334 1.00 45.54 ? 89  VAL B CA    1 
ATOM   5641  C  C     . VAL B  1 89  ? 77.630  92.075  120.337 1.00 45.54 ? 89  VAL B C     1 
ATOM   5642  O  O     . VAL B  1 89  ? 76.917  92.027  119.329 1.00 45.54 ? 89  VAL B O     1 
ATOM   5643  C  CB    . VAL B  1 89  ? 79.840  91.950  119.124 1.00 45.54 ? 89  VAL B CB    1 
ATOM   5644  C  CG1   . VAL B  1 89  ? 79.916  93.460  119.108 1.00 45.54 ? 89  VAL B CG1   1 
ATOM   5645  C  CG2   . VAL B  1 89  ? 81.230  91.355  119.167 1.00 45.54 ? 89  VAL B CG2   1 
ATOM   5646  N  N     . LYS B  1 90  ? 77.231  92.639  121.469 1.00 50.46 ? 90  LYS B N     1 
ATOM   5647  C  CA    . LYS B  1 90  ? 75.895  93.186  121.620 1.00 50.46 ? 90  LYS B CA    1 
ATOM   5648  C  C     . LYS B  1 90  ? 75.940  94.708  121.722 1.00 50.46 ? 90  LYS B C     1 
ATOM   5649  O  O     . LYS B  1 90  ? 76.994  95.322  121.910 1.00 50.46 ? 90  LYS B O     1 
ATOM   5650  C  CB    . LYS B  1 90  ? 75.211  92.591  122.848 1.00 50.46 ? 90  LYS B CB    1 
ATOM   5651  C  CG    . LYS B  1 90  ? 75.255  91.079  122.903 1.00 50.46 ? 90  LYS B CG    1 
ATOM   5652  C  CD    . LYS B  1 90  ? 74.303  90.462  121.902 1.00 50.46 ? 90  LYS B CD    1 
ATOM   5653  C  CE    . LYS B  1 90  ? 72.861  90.763  122.260 1.00 50.46 ? 90  LYS B CE    1 
ATOM   5654  N  NZ    . LYS B  1 90  ? 71.910  90.112  121.318 1.00 50.46 ? 90  LYS B NZ    1 
ATOM   5655  N  N     . GLU B  1 91  ? 74.760  95.313  121.615 1.00 57.39 ? 91  GLU B N     1 
ATOM   5656  C  CA    . GLU B  1 91  ? 74.617  96.762  121.584 1.00 57.39 ? 91  GLU B CA    1 
ATOM   5657  C  C     . GLU B  1 91  ? 74.527  97.307  123.004 1.00 57.39 ? 91  GLU B C     1 
ATOM   5658  O  O     . GLU B  1 91  ? 73.630  96.928  123.764 1.00 57.39 ? 91  GLU B O     1 
ATOM   5659  C  CB    . GLU B  1 91  ? 73.377  97.158  120.785 1.00 57.39 ? 91  GLU B CB    1 
ATOM   5660  C  CG    . GLU B  1 91  ? 73.251  98.652  120.543 1.00 57.39 ? 91  GLU B CG    1 
ATOM   5661  N  N     . CYS B  1 92  ? 75.450  98.198  123.356 1.00 62.28 ? 92  CYS B N     1 
ATOM   5662  C  CA    . CYS B  1 92  ? 75.393  98.869  124.644 1.00 62.28 ? 92  CYS B CA    1 
ATOM   5663  C  C     . CYS B  1 92  ? 74.316  99.953  124.644 1.00 62.28 ? 92  CYS B C     1 
ATOM   5664  O  O     . CYS B  1 92  ? 73.673  100.240 123.630 1.00 62.28 ? 92  CYS B O     1 
ATOM   5665  C  CB    . CYS B  1 92  ? 76.746  99.478  125.000 1.00 62.28 ? 92  CYS B CB    1 
ATOM   5666  S  SG    . CYS B  1 92  ? 78.032  98.285  125.366 1.00 62.28 ? 92  CYS B SG    1 
ATOM   5667  N  N     . ASN B  1 93  ? 74.130  100.566 125.814 1.00 63.85 ? 93  ASN B N     1 
ATOM   5668  C  CA    . ASN B  1 93  ? 73.123  101.608 125.969 1.00 63.85 ? 93  ASN B CA    1 
ATOM   5669  C  C     . ASN B  1 93  ? 73.507  102.904 125.269 1.00 63.85 ? 93  ASN B C     1 
ATOM   5670  O  O     . ASN B  1 93  ? 72.624  103.717 124.977 1.00 63.85 ? 93  ASN B O     1 
ATOM   5671  C  CB    . ASN B  1 93  ? 72.877  101.876 127.453 1.00 63.85 ? 93  ASN B CB    1 
ATOM   5672  C  CG    . ASN B  1 93  ? 71.695  101.104 127.995 1.00 63.85 ? 93  ASN B CG    1 
ATOM   5673  O  OD1   . ASN B  1 93  ? 70.983  100.434 127.248 1.00 63.85 ? 93  ASN B OD1   1 
ATOM   5674  N  ND2   . ASN B  1 93  ? 71.483  101.186 129.304 1.00 63.85 ? 93  ASN B ND2   1 
ATOM   5675  N  N     . ASP B  1 94  ? 74.797  103.120 124.997 1.00 64.13 ? 94  ASP B N     1 
ATOM   5676  C  CA    . ASP B  1 94  ? 75.266  104.321 124.316 1.00 64.13 ? 94  ASP B CA    1 
ATOM   5677  C  C     . ASP B  1 94  ? 75.446  104.121 122.812 1.00 64.13 ? 94  ASP B C     1 
ATOM   5678  O  O     . ASP B  1 94  ? 76.319  104.766 122.212 1.00 64.13 ? 94  ASP B O     1 
ATOM   5679  C  CB    . ASP B  1 94  ? 76.560  104.826 124.966 1.00 64.13 ? 94  ASP B CB    1 
ATOM   5680  C  CG    . ASP B  1 94  ? 77.730  103.854 124.823 1.00 64.13 ? 94  ASP B CG    1 
ATOM   5681  O  OD1   . ASP B  1 94  ? 77.515  102.665 124.504 1.00 64.13 ? 94  ASP B OD1   1 
ATOM   5682  O  OD2   . ASP B  1 94  ? 78.881  104.290 125.037 1.00 64.13 ? 94  ASP B OD2   1 
ATOM   5683  N  N     . ASN B  1 95  ? 74.640  103.236 122.209 1.00 59.84 ? 95  ASN B N     1 
ATOM   5684  C  CA    . ASN B  1 95  ? 74.627  102.944 120.768 1.00 59.84 ? 95  ASN B CA    1 
ATOM   5685  C  C     . ASN B  1 95  ? 75.983  102.455 120.261 1.00 59.84 ? 95  ASN B C     1 
ATOM   5686  O  O     . ASN B  1 95  ? 76.442  102.863 119.192 1.00 59.84 ? 95  ASN B O     1 
ATOM   5687  C  CB    . ASN B  1 95  ? 74.148  104.149 119.951 1.00 59.84 ? 95  ASN B CB    1 
ATOM   5688  C  CG    . ASN B  1 95  ? 72.640  104.229 119.865 1.00 59.84 ? 95  ASN B CG    1 
ATOM   5689  O  OD1   . ASN B  1 95  ? 71.943  104.082 120.868 1.00 59.84 ? 95  ASN B OD1   1 
ATOM   5690  N  ND2   . ASN B  1 95  ? 72.127  104.462 118.663 1.00 59.84 ? 95  ASN B ND2   1 
ATOM   5691  N  N     . THR B  1 96  ? 76.630  101.582 121.024 1.00 58.84 ? 96  THR B N     1 
ATOM   5692  C  CA    . THR B  1 96  ? 77.941  101.053 120.687 1.00 58.84 ? 96  THR B CA    1 
ATOM   5693  C  C     . THR B  1 96  ? 77.896  99.531  120.781 1.00 58.84 ? 96  THR B C     1 
ATOM   5694  O  O     . THR B  1 96  ? 77.253  98.961  121.665 1.00 58.84 ? 96  THR B O     1 
ATOM   5695  C  CB    . THR B  1 96  ? 79.008  101.642 121.624 1.00 58.84 ? 96  THR B CB    1 
ATOM   5696  O  OG1   . THR B  1 96  ? 78.888  103.069 121.632 1.00 58.84 ? 96  THR B OG1   1 
ATOM   5697  C  CG2   . THR B  1 96  ? 80.409  101.299 121.155 1.00 58.84 ? 96  THR B CG2   1 
ATOM   5698  N  N     . MET B  1 97  ? 78.583  98.865  119.854 1.00 50.26 ? 97  MET B N     1 
ATOM   5699  C  CA    . MET B  1 97  ? 78.626  97.407  119.790 1.00 50.26 ? 97  MET B CA    1 
ATOM   5700  C  C     . MET B  1 97  ? 79.886  96.942  120.513 1.00 50.26 ? 97  MET B C     1 
ATOM   5701  O  O     . MET B  1 97  ? 80.995  97.070  119.988 1.00 50.26 ? 97  MET B O     1 
ATOM   5702  C  CB    . MET B  1 97  ? 78.606  96.920  118.345 1.00 50.26 ? 97  MET B CB    1 
ATOM   5703  C  CG    . MET B  1 97  ? 77.504  97.519  117.496 1.00 50.26 ? 97  MET B CG    1 
ATOM   5704  S  SD    . MET B  1 97  ? 75.856  97.060  118.051 1.00 50.26 ? 97  MET B SD    1 
ATOM   5705  C  CE    . MET B  1 97  ? 75.869  95.303  117.722 1.00 50.26 ? 97  MET B CE    1 
ATOM   5706  N  N     . ARG B  1 98  ? 79.711  96.403  121.713 1.00 52.82 ? 98  ARG B N     1 
ATOM   5707  C  CA    . ARG B  1 98  ? 80.819  95.892  122.507 1.00 52.82 ? 98  ARG B CA    1 
ATOM   5708  C  C     . ARG B  1 98  ? 80.633  94.408  122.787 1.00 52.82 ? 98  ARG B C     1 
ATOM   5709  O  O     . ARG B  1 98  ? 79.526  93.872  122.706 1.00 52.82 ? 98  ARG B O     1 
ATOM   5710  C  CB    . ARG B  1 98  ? 80.941  96.650  123.829 1.00 52.82 ? 98  ARG B CB    1 
ATOM   5711  C  CG    . ARG B  1 98  ? 81.252  98.127  123.695 1.00 52.82 ? 98  ARG B CG    1 
ATOM   5712  C  CD    . ARG B  1 98  ? 81.852  98.667  124.984 1.00 52.82 ? 98  ARG B CD    1 
ATOM   5713  N  NE    . ARG B  1 98  ? 82.051  100.111 124.927 1.00 52.82 ? 98  ARG B NE    1 
ATOM   5714  C  CZ    . ARG B  1 98  ? 83.136  100.698 124.437 1.00 52.82 ? 98  ARG B CZ    1 
ATOM   5715  N  NH1   . ARG B  1 98  ? 84.135  99.964  123.969 1.00 52.82 ? 98  ARG B NH1   1 
ATOM   5716  N  NH2   . ARG B  1 98  ? 83.227  102.021 124.424 1.00 52.82 ? 98  ARG B NH2   1 
ATOM   5717  N  N     . ALA B  1 99  ? 81.738  93.749  123.127 1.00 49.20 ? 99  ALA B N     1 
ATOM   5718  C  CA    . ALA B  1 99  ? 81.700  92.338  123.474 1.00 49.20 ? 99  ALA B CA    1 
ATOM   5719  C  C     . ALA B  1 99  ? 80.960  92.129  124.791 1.00 49.20 ? 99  ALA B C     1 
ATOM   5720  O  O     . ALA B  1 99  ? 80.996  92.965  125.697 1.00 49.20 ? 99  ALA B O     1 
ATOM   5721  C  CB    . ALA B  1 99  ? 83.114  91.770  123.569 1.00 49.20 ? 99  ALA B CB    1 
ATOM   5722  N  N     . PHE B  1 100 ? 80.275  90.996  124.887 1.00 51.80 ? 100 PHE B N     1 
ATOM   5723  C  CA    . PHE B  1 100 ? 79.423  90.704  126.031 1.00 51.80 ? 100 PHE B CA    1 
ATOM   5724  C  C     . PHE B  1 100 ? 80.245  90.049  127.132 1.00 51.80 ? 100 PHE B C     1 
ATOM   5725  O  O     . PHE B  1 100 ? 80.913  89.037  126.897 1.00 51.80 ? 100 PHE B O     1 
ATOM   5726  C  CB    . PHE B  1 100 ? 78.262  89.800  125.624 1.00 51.80 ? 100 PHE B CB    1 
ATOM   5727  C  CG    . PHE B  1 100 ? 77.305  89.512  126.740 1.00 51.80 ? 100 PHE B CG    1 
ATOM   5728  C  CD1   . PHE B  1 100 ? 76.407  90.473  127.160 1.00 51.80 ? 100 PHE B CD1   1 
ATOM   5729  C  CD2   . PHE B  1 100 ? 77.303  88.279  127.367 1.00 51.80 ? 100 PHE B CD2   1 
ATOM   5730  C  CE1   . PHE B  1 100 ? 75.530  90.217  128.189 1.00 51.80 ? 100 PHE B CE1   1 
ATOM   5731  C  CE2   . PHE B  1 100 ? 76.423  88.015  128.396 1.00 51.80 ? 100 PHE B CE2   1 
ATOM   5732  C  CZ    . PHE B  1 100 ? 75.535  88.986  128.805 1.00 51.80 ? 100 PHE B CZ    1 
ATOM   5733  N  N     . THR B  1 101 ? 80.195  90.627  128.328 1.00 55.70 ? 101 THR B N     1 
ATOM   5734  C  CA    . THR B  1 101 ? 80.800  90.050  129.517 1.00 55.70 ? 101 THR B CA    1 
ATOM   5735  C  C     . THR B  1 101 ? 79.775  90.033  130.641 1.00 55.70 ? 101 THR B C     1 
ATOM   5736  O  O     . THR B  1 101 ? 78.876  90.877  130.693 1.00 55.70 ? 101 THR B O     1 
ATOM   5737  C  CB    . THR B  1 101 ? 82.042  90.832  129.957 1.00 55.70 ? 101 THR B CB    1 
ATOM   5738  O  OG1   . THR B  1 101 ? 81.781  92.238  129.868 1.00 55.70 ? 101 THR B OG1   1 
ATOM   5739  C  CG2   . THR B  1 101 ? 83.229  90.486  129.075 1.00 55.70 ? 101 THR B CG2   1 
ATOM   5740  N  N     . TYR B  1 102 ? 79.911  89.061  131.544 1.00 61.03 ? 102 TYR B N     1 
ATOM   5741  C  CA    . TYR B  1 102 ? 78.928  88.914  132.610 1.00 61.03 ? 102 TYR B CA    1 
ATOM   5742  C  C     . TYR B  1 102 ? 79.093  89.962  133.704 1.00 61.03 ? 102 TYR B C     1 
ATOM   5743  O  O     . TYR B  1 102 ? 78.112  90.316  134.366 1.00 61.03 ? 102 TYR B O     1 
ATOM   5744  C  CB    . TYR B  1 102 ? 79.007  87.513  133.215 1.00 61.03 ? 102 TYR B CB    1 
ATOM   5745  C  CG    . TYR B  1 102 ? 77.845  87.189  134.124 1.00 61.03 ? 102 TYR B CG    1 
ATOM   5746  C  CD1   . TYR B  1 102 ? 76.583  86.940  133.603 1.00 61.03 ? 102 TYR B CD1   1 
ATOM   5747  C  CD2   . TYR B  1 102 ? 78.008  87.141  135.502 1.00 61.03 ? 102 TYR B CD2   1 
ATOM   5748  C  CE1   . TYR B  1 102 ? 75.515  86.645  134.429 1.00 61.03 ? 102 TYR B CE1   1 
ATOM   5749  C  CE2   . TYR B  1 102 ? 76.944  86.847  136.337 1.00 61.03 ? 102 TYR B CE2   1 
ATOM   5750  C  CZ    . TYR B  1 102 ? 75.701  86.600  135.793 1.00 61.03 ? 102 TYR B CZ    1 
ATOM   5751  O  OH    . TYR B  1 102 ? 74.640  86.307  136.616 1.00 61.03 ? 102 TYR B OH    1 
ATOM   5752  N  N     . ARG B  1 103 ? 80.313  90.462  133.915 1.00 63.53 ? 103 ARG B N     1 
ATOM   5753  C  CA    . ARG B  1 103 ? 80.519  91.477  134.943 1.00 63.53 ? 103 ARG B CA    1 
ATOM   5754  C  C     . ARG B  1 103 ? 79.979  92.834  134.512 1.00 63.53 ? 103 ARG B C     1 
ATOM   5755  O  O     . ARG B  1 103 ? 79.554  93.627  135.360 1.00 63.53 ? 103 ARG B O     1 
ATOM   5756  C  CB    . ARG B  1 103 ? 82.004  91.587  135.283 1.00 63.53 ? 103 ARG B CB    1 
ATOM   5757  C  CG    . ARG B  1 103 ? 82.607  90.314  135.843 1.00 63.53 ? 103 ARG B CG    1 
ATOM   5758  C  CD    . ARG B  1 103 ? 84.094  90.483  136.081 1.00 63.53 ? 103 ARG B CD    1 
ATOM   5759  N  NE    . ARG B  1 103 ? 84.769  91.012  134.901 1.00 63.53 ? 103 ARG B NE    1 
ATOM   5760  C  CZ    . ARG B  1 103 ? 86.085  91.162  134.798 1.00 63.53 ? 103 ARG B CZ    1 
ATOM   5761  N  NH1   . ARG B  1 103 ? 86.873  90.821  135.808 1.00 63.53 ? 103 ARG B NH1   1 
ATOM   5762  N  NH2   . ARG B  1 103 ? 86.613  91.652  133.685 1.00 63.53 ? 103 ARG B NH2   1 
ATOM   5763  N  N     . THR B  1 104 ? 79.987  93.117  133.211 1.00 59.97 ? 104 THR B N     1 
ATOM   5764  C  CA    . THR B  1 104 ? 79.499  94.378  132.667 1.00 59.97 ? 104 THR B CA    1 
ATOM   5765  C  C     . THR B  1 104 ? 78.172  94.202  131.938 1.00 59.97 ? 104 THR B C     1 
ATOM   5766  O  O     . THR B  1 104 ? 77.897  94.902  130.962 1.00 59.97 ? 104 THR B O     1 
ATOM   5767  C  CB    . THR B  1 104 ? 80.535  94.991  131.727 1.00 59.97 ? 104 THR B CB    1 
ATOM   5768  O  OG1   . THR B  1 104 ? 80.482  94.323  130.461 1.00 59.97 ? 104 THR B OG1   1 
ATOM   5769  C  CG2   . THR B  1 104 ? 81.932  94.851  132.305 1.00 59.97 ? 104 THR B CG2   1 
ATOM   5770  N  N     . ARG B  1 105 ? 77.339  93.274  132.406 1.00 61.40 ? 105 ARG B N     1 
ATOM   5771  C  CA    . ARG B  1 105 ? 76.143  92.879  131.674 1.00 61.40 ? 105 ARG B CA    1 
ATOM   5772  C  C     . ARG B  1 105 ? 75.017  93.902  131.740 1.00 61.40 ? 105 ARG B C     1 
ATOM   5773  O  O     . ARG B  1 105 ? 74.094  93.824  130.925 1.00 61.40 ? 105 ARG B O     1 
ATOM   5774  C  CB    . ARG B  1 105 ? 75.638  91.531  132.194 1.00 61.40 ? 105 ARG B CB    1 
ATOM   5775  C  CG    . ARG B  1 105 ? 75.112  91.566  133.616 1.00 61.40 ? 105 ARG B CG    1 
ATOM   5776  C  CD    . ARG B  1 105 ? 74.672  90.184  134.065 1.00 61.40 ? 105 ARG B CD    1 
ATOM   5777  N  NE    . ARG B  1 105 ? 73.592  90.244  135.045 1.00 61.40 ? 105 ARG B NE    1 
ATOM   5778  C  CZ    . ARG B  1 105 ? 73.763  90.096  136.354 1.00 61.40 ? 105 ARG B CZ    1 
ATOM   5779  N  NH1   . ARG B  1 105 ? 74.974  89.878  136.846 1.00 61.40 ? 105 ARG B NH1   1 
ATOM   5780  N  NH2   . ARG B  1 105 ? 72.722  90.166  137.172 1.00 61.40 ? 105 ARG B NH2   1 
ATOM   5781  N  N     . GLN B  1 106 ? 75.067  94.857  132.667 1.00 62.83 ? 106 GLN B N     1 
ATOM   5782  C  CA    . GLN B  1 106 ? 73.982  95.821  132.798 1.00 62.83 ? 106 GLN B CA    1 
ATOM   5783  C  C     . GLN B  1 106 ? 74.069  96.967  131.799 1.00 62.83 ? 106 GLN B C     1 
ATOM   5784  O  O     . GLN B  1 106 ? 73.122  97.754  131.705 1.00 62.83 ? 106 GLN B O     1 
ATOM   5785  C  CB    . GLN B  1 106 ? 73.949  96.388  134.219 1.00 62.83 ? 106 GLN B CB    1 
ATOM   5786  C  CG    . GLN B  1 106 ? 73.532  95.382  135.277 1.00 62.83 ? 106 GLN B CG    1 
ATOM   5787  C  CD    . GLN B  1 106 ? 72.027  95.265  135.413 1.00 62.83 ? 106 GLN B CD    1 
ATOM   5788  O  OE1   . GLN B  1 106 ? 71.273  95.977  134.750 1.00 62.83 ? 106 GLN B OE1   1 
ATOM   5789  N  NE2   . GLN B  1 106 ? 71.581  94.363  136.279 1.00 62.83 ? 106 GLN B NE2   1 
ATOM   5790  N  N     . ASN B  1 107 ? 75.167  97.080  131.054 1.00 62.50 ? 107 ASN B N     1 
ATOM   5791  C  CA    . ASN B  1 107 ? 75.339  98.175  130.107 1.00 62.50 ? 107 ASN B CA    1 
ATOM   5792  C  C     . ASN B  1 107 ? 74.615  97.949  128.787 1.00 62.50 ? 107 ASN B C     1 
ATOM   5793  O  O     . ASN B  1 107 ? 74.548  98.878  127.975 1.00 62.50 ? 107 ASN B O     1 
ATOM   5794  C  CB    . ASN B  1 107 ? 76.826  98.395  129.825 1.00 62.50 ? 107 ASN B CB    1 
ATOM   5795  C  CG    . ASN B  1 107 ? 77.641  98.555  131.088 1.00 62.50 ? 107 ASN B CG    1 
ATOM   5796  O  OD1   . ASN B  1 107 ? 77.099  98.554  132.193 1.00 62.50 ? 107 ASN B OD1   1 
ATOM   5797  N  ND2   . ASN B  1 107 ? 78.952  98.692  130.933 1.00 62.50 ? 107 ASN B ND2   1 
ATOM   5798  N  N     . PHE B  1 108 ? 74.070  96.760  128.556 1.00 57.35 ? 108 PHE B N     1 
ATOM   5799  C  CA    . PHE B  1 108 ? 73.591  96.364  127.241 1.00 57.35 ? 108 PHE B CA    1 
ATOM   5800  C  C     . PHE B  1 108 ? 72.094  96.605  127.101 1.00 57.35 ? 108 PHE B C     1 
ATOM   5801  O  O     . PHE B  1 108 ? 71.344  96.589  128.080 1.00 57.35 ? 108 PHE B O     1 
ATOM   5802  C  CB    . PHE B  1 108 ? 73.922  94.896  126.980 1.00 57.35 ? 108 PHE B CB    1 
ATOM   5803  C  CG    . PHE B  1 108 ? 75.392  94.616  126.950 1.00 57.35 ? 108 PHE B CG    1 
ATOM   5804  C  CD1   . PHE B  1 108 ? 76.168  95.045  125.889 1.00 57.35 ? 108 PHE B CD1   1 
ATOM   5805  C  CD2   . PHE B  1 108 ? 76.008  93.961  128.000 1.00 57.35 ? 108 PHE B CD2   1 
ATOM   5806  C  CE1   . PHE B  1 108 ? 77.526  94.798  125.862 1.00 57.35 ? 108 PHE B CE1   1 
ATOM   5807  C  CE2   . PHE B  1 108 ? 77.367  93.718  127.981 1.00 57.35 ? 108 PHE B CE2   1 
ATOM   5808  C  CZ    . PHE B  1 108 ? 78.125  94.136  126.910 1.00 57.35 ? 108 PHE B CZ    1 
ATOM   5809  N  N     . LYS B  1 109 ? 71.671  96.826  125.859 1.00 61.87 ? 109 LYS B N     1 
ATOM   5810  C  CA    . LYS B  1 109 ? 70.310  97.250  125.564 1.00 61.87 ? 109 LYS B CA    1 
ATOM   5811  C  C     . LYS B  1 109 ? 69.344  96.077  125.666 1.00 61.87 ? 109 LYS B C     1 
ATOM   5812  O  O     . LYS B  1 109 ? 69.625  94.984  125.167 1.00 61.87 ? 109 LYS B O     1 
ATOM   5813  C  CB    . LYS B  1 109 ? 70.248  97.867  124.167 1.00 61.87 ? 109 LYS B CB    1 
ATOM   5814  C  CG    . LYS B  1 109 ? 68.932  98.546  123.833 1.00 61.87 ? 109 LYS B CG    1 
ATOM   5815  C  CD    . LYS B  1 109 ? 68.973  99.177  122.449 1.00 61.87 ? 109 LYS B CD    1 
ATOM   5816  C  CE    . LYS B  1 109 ? 70.078  100.216 122.344 1.00 61.87 ? 109 LYS B CE    1 
ATOM   5817  N  NZ    . LYS B  1 109 ? 70.190  100.775 120.970 1.00 61.87 ? 109 LYS B NZ    1 
ATOM   5818  N  N     . GLY B  1 110 ? 68.205  96.310  126.313 1.00 68.59 ? 110 GLY B N     1 
ATOM   5819  C  CA    . GLY B  1 110 ? 67.180  95.293  126.421 1.00 68.59 ? 110 GLY B CA    1 
ATOM   5820  C  C     . GLY B  1 110 ? 67.481  94.178  127.391 1.00 68.59 ? 110 GLY B C     1 
ATOM   5821  O  O     . GLY B  1 110 ? 66.863  93.113  127.300 1.00 68.59 ? 110 GLY B O     1 
ATOM   5822  N  N     . PHE B  1 111 ? 68.406  94.384  128.321 1.00 69.44 ? 111 PHE B N     1 
ATOM   5823  C  CA    . PHE B  1 111 ? 68.791  93.356  129.274 1.00 69.44 ? 111 PHE B CA    1 
ATOM   5824  C  C     . PHE B  1 111 ? 68.209  93.652  130.647 1.00 69.44 ? 111 PHE B C     1 
ATOM   5825  O  O     . PHE B  1 111 ? 68.380  94.750  131.184 1.00 69.44 ? 111 PHE B O     1 
ATOM   5826  C  CB    . PHE B  1 111 ? 70.312  93.248  129.380 1.00 69.44 ? 111 PHE B CB    1 
ATOM   5827  C  CG    . PHE B  1 111 ? 70.774  92.183  130.330 1.00 69.44 ? 111 PHE B CG    1 
ATOM   5828  C  CD1   . PHE B  1 111 ? 70.714  90.849  129.970 1.00 69.44 ? 111 PHE B CD1   1 
ATOM   5829  C  CD2   . PHE B  1 111 ? 71.264  92.513  131.582 1.00 69.44 ? 111 PHE B CD2   1 
ATOM   5830  C  CE1   . PHE B  1 111 ? 71.136  89.862  130.838 1.00 69.44 ? 111 PHE B CE1   1 
ATOM   5831  C  CE2   . PHE B  1 111 ? 71.686  91.532  132.456 1.00 69.44 ? 111 PHE B CE2   1 
ATOM   5832  C  CZ    . PHE B  1 111 ? 71.624  90.205  132.082 1.00 69.44 ? 111 PHE B CZ    1 
ATOM   5833  N  N     . ASP B  1 112 ? 67.520  92.662  131.210 1.00 79.14 ? 112 ASP B N     1 
ATOM   5834  C  CA    . ASP B  1 112 ? 67.111  92.679  132.607 1.00 79.14 ? 112 ASP B CA    1 
ATOM   5835  C  C     . ASP B  1 112 ? 67.790  91.517  133.315 1.00 79.14 ? 112 ASP B C     1 
ATOM   5836  O  O     . ASP B  1 112 ? 68.476  90.699  132.698 1.00 79.14 ? 112 ASP B O     1 
ATOM   5837  C  CB    . ASP B  1 112 ? 65.588  92.568  132.773 1.00 79.14 ? 112 ASP B CB    1 
ATOM   5838  C  CG    . ASP B  1 112 ? 64.834  93.716  132.132 1.00 79.14 ? 112 ASP B CG    1 
ATOM   5839  O  OD1   . ASP B  1 112 ? 65.474  94.662  131.634 1.00 79.14 ? 112 ASP B OD1   1 
ATOM   5840  O  OD2   . ASP B  1 112 ? 63.587  93.669  132.126 1.00 79.14 ? 112 ASP B OD2   1 
ATOM   5841  N  N     . ASP B  1 113 ? 67.595  91.450  134.628 1.00 84.25 ? 113 ASP B N     1 
ATOM   5842  C  CA    . ASP B  1 113 ? 67.995  90.284  135.401 1.00 84.25 ? 113 ASP B CA    1 
ATOM   5843  C  C     . ASP B  1 113 ? 66.959  89.170  135.339 1.00 84.25 ? 113 ASP B C     1 
ATOM   5844  O  O     . ASP B  1 113 ? 67.257  88.040  135.737 1.00 84.25 ? 113 ASP B O     1 
ATOM   5845  C  CB    . ASP B  1 113 ? 68.247  90.675  136.860 1.00 84.25 ? 113 ASP B CB    1 
ATOM   5846  N  N     . ASN B  1 114 ? 65.757  89.466  134.845 1.00 87.20 ? 114 ASN B N     1 
ATOM   5847  C  CA    . ASN B  1 114 ? 64.670  88.503  134.740 1.00 87.20 ? 114 ASN B CA    1 
ATOM   5848  C  C     . ASN B  1 114 ? 64.108  88.438  133.323 1.00 87.20 ? 114 ASN B C     1 
ATOM   5849  O  O     . ASN B  1 114 ? 62.894  88.333  133.135 1.00 87.20 ? 114 ASN B O     1 
ATOM   5850  C  CB    . ASN B  1 114 ? 63.561  88.846  135.733 1.00 87.20 ? 114 ASN B CB    1 
ATOM   5851  C  CG    . ASN B  1 114 ? 64.034  88.806  137.172 1.00 87.20 ? 114 ASN B CG    1 
ATOM   5852  O  OD1   . ASN B  1 114 ? 64.078  89.832  137.851 1.00 87.20 ? 114 ASN B OD1   1 
ATOM   5853  N  ND2   . ASN B  1 114 ? 64.387  87.618  137.647 1.00 87.20 ? 114 ASN B ND2   1 
ATOM   5854  N  N     . ASN B  1 115 ? 64.977  88.507  132.317 1.00 80.15 ? 115 ASN B N     1 
ATOM   5855  C  CA    . ASN B  1 115 ? 64.565  88.563  130.918 1.00 80.15 ? 115 ASN B CA    1 
ATOM   5856  C  C     . ASN B  1 115 ? 65.148  87.366  130.179 1.00 80.15 ? 115 ASN B C     1 
ATOM   5857  O  O     . ASN B  1 115 ? 66.369  87.259  130.025 1.00 80.15 ? 115 ASN B O     1 
ATOM   5858  C  CB    . ASN B  1 115 ? 65.015  89.870  130.269 1.00 80.15 ? 115 ASN B CB    1 
ATOM   5859  C  CG    . ASN B  1 115 ? 64.154  90.259  129.086 1.00 80.15 ? 115 ASN B CG    1 
ATOM   5860  O  OD1   . ASN B  1 115 ? 63.050  89.746  128.913 1.00 80.15 ? 115 ASN B OD1   1 
ATOM   5861  N  ND2   . ASN B  1 115 ? 64.657  91.173  128.264 1.00 80.15 ? 115 ASN B ND2   1 
ATOM   5862  N  N     . ASP B  1 116 ? 64.276  86.473  129.720 1.00 76.96 ? 116 ASP B N     1 
ATOM   5863  C  CA    . ASP B  1 116 ? 64.683  85.356  128.879 1.00 76.96 ? 116 ASP B CA    1 
ATOM   5864  C  C     . ASP B  1 116 ? 64.662  85.685  127.391 1.00 76.96 ? 116 ASP B C     1 
ATOM   5865  O  O     . ASP B  1 116 ? 64.829  84.776  126.571 1.00 76.96 ? 116 ASP B O     1 
ATOM   5866  C  CB    . ASP B  1 116 ? 63.799  84.136  129.165 1.00 76.96 ? 116 ASP B CB    1 
ATOM   5867  C  CG    . ASP B  1 116 ? 62.311  84.451  129.093 1.00 76.96 ? 116 ASP B CG    1 
ATOM   5868  O  OD1   . ASP B  1 116 ? 61.505  83.531  129.346 1.00 76.96 ? 116 ASP B OD1   1 
ATOM   5869  O  OD2   . ASP B  1 116 ? 61.941  85.615  128.831 1.00 76.96 ? 116 ASP B OD2   1 
ATOM   5870  N  N     . ASP B  1 117 ? 64.458  86.948  127.024 1.00 73.43 ? 117 ASP B N     1 
ATOM   5871  C  CA    . ASP B  1 117 ? 64.384  87.363  125.631 1.00 73.43 ? 117 ASP B CA    1 
ATOM   5872  C  C     . ASP B  1 117 ? 65.649  88.061  125.153 1.00 73.43 ? 117 ASP B C     1 
ATOM   5873  O  O     . ASP B  1 117 ? 65.661  88.602  124.044 1.00 73.43 ? 117 ASP B O     1 
ATOM   5874  C  CB    . ASP B  1 117 ? 63.179  88.280  125.415 1.00 73.43 ? 117 ASP B CB    1 
ATOM   5875  C  CG    . ASP B  1 117 ? 61.910  87.724  126.020 1.00 73.43 ? 117 ASP B CG    1 
ATOM   5876  O  OD1   . ASP B  1 117 ? 61.072  88.525  126.483 1.00 73.43 ? 117 ASP B OD1   1 
ATOM   5877  O  OD2   . ASP B  1 117 ? 61.749  86.486  126.030 1.00 73.43 ? 117 ASP B OD2   1 
ATOM   5878  N  N     . PHE B  1 118 ? 66.706  88.072  125.962 1.00 61.87 ? 118 PHE B N     1 
ATOM   5879  C  CA    . PHE B  1 118 ? 67.943  88.730  125.563 1.00 61.87 ? 118 PHE B CA    1 
ATOM   5880  C  C     . PHE B  1 118 ? 68.683  87.895  124.527 1.00 61.87 ? 118 PHE B C     1 
ATOM   5881  O  O     . PHE B  1 118 ? 68.901  88.347  123.399 1.00 61.87 ? 118 PHE B O     1 
ATOM   5882  C  CB    . PHE B  1 118 ? 68.837  88.982  126.775 1.00 61.87 ? 118 PHE B CB    1 
ATOM   5883  C  CG    . PHE B  1 118 ? 70.071  89.769  126.457 1.00 61.87 ? 118 PHE B CG    1 
ATOM   5884  C  CD1   . PHE B  1 118 ? 69.986  90.953  125.744 1.00 61.87 ? 118 PHE B CD1   1 
ATOM   5885  C  CD2   . PHE B  1 118 ? 71.315  89.323  126.864 1.00 61.87 ? 118 PHE B CD2   1 
ATOM   5886  C  CE1   . PHE B  1 118 ? 71.121  91.681  125.449 1.00 61.87 ? 118 PHE B CE1   1 
ATOM   5887  C  CE2   . PHE B  1 118 ? 72.451  90.046  126.572 1.00 61.87 ? 118 PHE B CE2   1 
ATOM   5888  C  CZ    . PHE B  1 118 ? 72.354  91.227  125.864 1.00 61.87 ? 118 PHE B CZ    1 
ATOM   5889  N  N     . LEU B  1 119 ? 69.071  86.680  124.900 1.00 53.16 ? 119 LEU B N     1 
ATOM   5890  C  CA    . LEU B  1 119 ? 69.716  85.783  123.952 1.00 53.16 ? 119 LEU B CA    1 
ATOM   5891  C  C     . LEU B  1 119 ? 68.661  84.979  123.206 1.00 53.16 ? 119 LEU B C     1 
ATOM   5892  O  O     . LEU B  1 119 ? 67.869  84.257  123.818 1.00 53.16 ? 119 LEU B O     1 
ATOM   5893  C  CB    . LEU B  1 119 ? 70.683  84.849  124.675 1.00 53.16 ? 119 LEU B CB    1 
ATOM   5894  C  CG    . LEU B  1 119 ? 71.958  85.463  125.253 1.00 53.16 ? 119 LEU B CG    1 
ATOM   5895  C  CD1   . LEU B  1 119 ? 72.918  84.372  125.681 1.00 53.16 ? 119 LEU B CD1   1 
ATOM   5896  C  CD2   . LEU B  1 119 ? 72.625  86.384  124.251 1.00 53.16 ? 119 LEU B CD2   1 
ATOM   5897  N  N     . THR B  1 120 ? 68.652  85.103  121.881 1.00 46.29 ? 120 THR B N     1 
ATOM   5898  C  CA    . THR B  1 120 ? 67.686  84.386  121.064 1.00 46.29 ? 120 THR B CA    1 
ATOM   5899  C  C     . THR B  1 120 ? 68.043  82.901  121.009 1.00 46.29 ? 120 THR B C     1 
ATOM   5900  O  O     . THR B  1 120 ? 69.119  82.476  121.433 1.00 46.29 ? 120 THR B O     1 
ATOM   5901  C  CB    . THR B  1 120 ? 67.630  84.990  119.665 1.00 46.29 ? 120 THR B CB    1 
ATOM   5902  O  OG1   . THR B  1 120 ? 68.923  84.902  119.057 1.00 46.29 ? 120 THR B OG1   1 
ATOM   5903  C  CG2   . THR B  1 120 ? 67.213  86.448  119.734 1.00 46.29 ? 120 THR B CG2   1 
ATOM   5904  N  N     . MET B  1 121 ? 67.118  82.104  120.464 1.00 42.48 ? 121 MET B N     1 
ATOM   5905  C  CA    . MET B  1 121 ? 67.288  80.654  120.432 1.00 42.48 ? 121 MET B CA    1 
ATOM   5906  C  C     . MET B  1 121 ? 68.425  80.234  119.509 1.00 42.48 ? 121 MET B C     1 
ATOM   5907  O  O     . MET B  1 121 ? 69.075  79.209  119.756 1.00 42.48 ? 121 MET B O     1 
ATOM   5908  C  CB    . MET B  1 121 ? 65.984  79.994  119.995 1.00 42.48 ? 121 MET B CB    1 
ATOM   5909  C  CG    . MET B  1 121 ? 65.733  78.620  120.581 1.00 42.48 ? 121 MET B CG    1 
ATOM   5910  S  SD    . MET B  1 121 ? 64.352  77.819  119.746 1.00 42.48 ? 121 MET B SD    1 
ATOM   5911  C  CE    . MET B  1 121 ? 64.098  76.383  120.778 1.00 42.48 ? 121 MET B CE    1 
ATOM   5912  N  N     . ALA B  1 122 ? 68.689  81.020  118.463 1.00 39.54 ? 122 ALA B N     1 
ATOM   5913  C  CA    . ALA B  1 122 ? 69.818  80.744  117.582 1.00 39.54 ? 122 ALA B CA    1 
ATOM   5914  C  C     . ALA B  1 122 ? 71.143  80.956  118.301 1.00 39.54 ? 122 ALA B C     1 
ATOM   5915  O  O     . ALA B  1 122 ? 72.055  80.125  118.194 1.00 39.54 ? 122 ALA B O     1 
ATOM   5916  C  CB    . ALA B  1 122 ? 69.732  81.626  116.340 1.00 39.54 ? 122 ALA B CB    1 
ATOM   5917  N  N     . GLU B  1 123 ? 71.259  82.054  119.055 1.00 42.80 ? 123 GLU B N     1 
ATOM   5918  C  CA    . GLU B  1 123 ? 72.462  82.298  119.844 1.00 42.80 ? 123 GLU B CA    1 
ATOM   5919  C  C     . GLU B  1 123 ? 72.620  81.282  120.965 1.00 42.80 ? 123 GLU B C     1 
ATOM   5920  O  O     . GLU B  1 123 ? 73.746  80.879  121.269 1.00 42.80 ? 123 GLU B O     1 
ATOM   5921  C  CB    . GLU B  1 123 ? 72.443  83.712  120.419 1.00 42.80 ? 123 GLU B CB    1 
ATOM   5922  C  CG    . GLU B  1 123 ? 72.743  84.800  119.409 1.00 42.80 ? 123 GLU B CG    1 
ATOM   5923  C  CD    . GLU B  1 123 ? 72.147  86.137  119.800 1.00 42.80 ? 123 GLU B CD    1 
ATOM   5924  O  OE1   . GLU B  1 123 ? 71.121  86.145  120.511 1.00 42.80 ? 123 GLU B OE1   1 
ATOM   5925  O  OE2   . GLU B  1 123 ? 72.702  87.179  119.395 1.00 42.80 ? 123 GLU B OE2   1 
ATOM   5926  N  N     . CYS B  1 124 ? 71.513  80.838  121.568 1.00 41.29 ? 124 CYS B N     1 
ATOM   5927  C  CA    . CYS B  1 124 ? 71.598  79.822  122.612 1.00 41.29 ? 124 CYS B CA    1 
ATOM   5928  C  C     . CYS B  1 124 ? 72.050  78.479  122.055 1.00 41.29 ? 124 CYS B C     1 
ATOM   5929  O  O     . CYS B  1 124 ? 72.869  77.788  122.676 1.00 41.29 ? 124 CYS B O     1 
ATOM   5930  C  CB    . CYS B  1 124 ? 70.259  79.682  123.333 1.00 41.29 ? 124 CYS B CB    1 
ATOM   5931  S  SG    . CYS B  1 124 ? 69.750  81.134  124.280 1.00 41.29 ? 124 CYS B SG    1 
ATOM   5932  N  N     . GLN B  1 125 ? 71.555  78.102  120.875 1.00 35.91 ? 125 GLN B N     1 
ATOM   5933  C  CA    . GLN B  1 125 ? 72.001  76.849  120.278 1.00 35.91 ? 125 GLN B CA    1 
ATOM   5934  C  C     . GLN B  1 125 ? 73.441  76.941  119.790 1.00 35.91 ? 125 GLN B C     1 
ATOM   5935  O  O     . GLN B  1 125 ? 74.176  75.949  119.857 1.00 35.91 ? 125 GLN B O     1 
ATOM   5936  C  CB    . GLN B  1 125 ? 71.061  76.451  119.149 1.00 35.91 ? 125 GLN B CB    1 
ATOM   5937  C  CG    . GLN B  1 125 ? 69.790  75.824  119.660 1.00 35.91 ? 125 GLN B CG    1 
ATOM   5938  C  CD    . GLN B  1 125 ? 68.601  76.146  118.800 1.00 35.91 ? 125 GLN B CD    1 
ATOM   5939  O  OE1   . GLN B  1 125 ? 68.700  76.917  117.851 1.00 35.91 ? 125 GLN B OE1   1 
ATOM   5940  N  NE2   . GLN B  1 125 ? 67.461  75.556  119.127 1.00 35.91 ? 125 GLN B NE2   1 
ATOM   5941  N  N     . PHE B  1 126 ? 73.876  78.127  119.351 1.00 33.89 ? 126 PHE B N     1 
ATOM   5942  C  CA    . PHE B  1 126 ? 75.281  78.320  119.003 1.00 33.89 ? 126 PHE B CA    1 
ATOM   5943  C  C     . PHE B  1 126 ? 76.179  78.221  120.231 1.00 33.89 ? 126 PHE B C     1 
ATOM   5944  O  O     . PHE B  1 126 ? 77.269  77.643  120.159 1.00 33.89 ? 126 PHE B O     1 
ATOM   5945  C  CB    . PHE B  1 126 ? 75.464  79.668  118.309 1.00 33.89 ? 126 PHE B CB    1 
ATOM   5946  C  CG    . PHE B  1 126 ? 76.891  80.000  117.978 1.00 33.89 ? 126 PHE B CG    1 
ATOM   5947  C  CD1   . PHE B  1 126 ? 77.713  79.076  117.350 1.00 33.89 ? 126 PHE B CD1   1 
ATOM   5948  C  CD2   . PHE B  1 126 ? 77.407  81.245  118.286 1.00 33.89 ? 126 PHE B CD2   1 
ATOM   5949  C  CE1   . PHE B  1 126 ? 79.022  79.386  117.048 1.00 33.89 ? 126 PHE B CE1   1 
ATOM   5950  C  CE2   . PHE B  1 126 ? 78.714  81.562  117.984 1.00 33.89 ? 126 PHE B CE2   1 
ATOM   5951  C  CZ    . PHE B  1 126 ? 79.523  80.631  117.365 1.00 33.89 ? 126 PHE B CZ    1 
ATOM   5952  N  N     . ILE B  1 127 ? 75.732  78.756  121.370 1.00 38.66 ? 127 ILE B N     1 
ATOM   5953  C  CA    . ILE B  1 127 ? 76.531  78.686  122.591 1.00 38.66 ? 127 ILE B CA    1 
ATOM   5954  C  C     . ILE B  1 127 ? 76.611  77.250  123.100 1.00 38.66 ? 127 ILE B C     1 
ATOM   5955  O  O     . ILE B  1 127 ? 77.675  76.791  123.535 1.00 38.66 ? 127 ILE B O     1 
ATOM   5956  C  CB    . ILE B  1 127 ? 75.960  79.652  123.647 1.00 38.66 ? 127 ILE B CB    1 
ATOM   5957  C  CG1   . ILE B  1 127 ? 76.306  81.090  123.279 1.00 38.66 ? 127 ILE B CG1   1 
ATOM   5958  C  CG2   . ILE B  1 127 ? 76.519  79.382  125.024 1.00 38.66 ? 127 ILE B CG2   1 
ATOM   5959  C  CD1   . ILE B  1 127 ? 75.377  82.095  123.892 1.00 38.66 ? 127 ILE B CD1   1 
ATOM   5960  N  N     . ILE B  1 128 ? 75.509  76.500  123.001 1.00 36.44 ? 128 ILE B N     1 
ATOM   5961  C  CA    . ILE B  1 128 ? 75.530  75.102  123.430 1.00 36.44 ? 128 ILE B CA    1 
ATOM   5962  C  C     . ILE B  1 128 ? 76.392  74.252  122.496 1.00 36.44 ? 128 ILE B C     1 
ATOM   5963  O  O     . ILE B  1 128 ? 77.131  73.371  122.957 1.00 36.44 ? 128 ILE B O     1 
ATOM   5964  C  CB    . ILE B  1 128 ? 74.086  74.578  123.555 1.00 36.44 ? 128 ILE B CB    1 
ATOM   5965  C  CG1   . ILE B  1 128 ? 73.414  75.227  124.763 1.00 36.44 ? 128 ILE B CG1   1 
ATOM   5966  C  CG2   . ILE B  1 128 ? 74.040  73.066  123.705 1.00 36.44 ? 128 ILE B CG2   1 
ATOM   5967  C  CD1   . ILE B  1 128 ? 72.050  74.678  125.086 1.00 36.44 ? 128 ILE B CD1   1 
ATOM   5968  N  N     . LYS B  1 129 ? 76.374  74.537  121.188 1.00 37.06 ? 129 LYS B N     1 
ATOM   5969  C  CA    . LYS B  1 129 ? 77.271  73.835  120.272 1.00 37.06 ? 129 LYS B CA    1 
ATOM   5970  C  C     . LYS B  1 129 ? 78.731  74.195  120.521 1.00 37.06 ? 129 LYS B C     1 
ATOM   5971  O  O     . LYS B  1 129 ? 79.607  73.330  120.405 1.00 37.06 ? 129 LYS B O     1 
ATOM   5972  C  CB    . LYS B  1 129 ? 76.890  74.143  118.825 1.00 37.06 ? 129 LYS B CB    1 
ATOM   5973  C  CG    . LYS B  1 129 ? 77.710  73.404  117.775 1.00 37.06 ? 129 LYS B CG    1 
ATOM   5974  C  CD    . LYS B  1 129 ? 77.681  71.900  117.994 1.00 37.06 ? 129 LYS B CD    1 
ATOM   5975  C  CE    . LYS B  1 129 ? 78.716  71.197  117.129 1.00 37.06 ? 129 LYS B CE    1 
ATOM   5976  N  NZ    . LYS B  1 129 ? 78.539  71.490  115.680 1.00 37.06 ? 129 LYS B NZ    1 
ATOM   5977  N  N     . HIS B  1 130 ? 79.011  75.444  120.896 1.00 40.70 ? 130 HIS B N     1 
ATOM   5978  C  CA    . HIS B  1 130 ? 80.386  75.824  121.201 1.00 40.70 ? 130 HIS B CA    1 
ATOM   5979  C  C     . HIS B  1 130 ? 80.863  75.219  122.515 1.00 40.70 ? 130 HIS B C     1 
ATOM   5980  O  O     . HIS B  1 130 ? 82.057  74.941  122.667 1.00 40.70 ? 130 HIS B O     1 
ATOM   5981  C  CB    . HIS B  1 130 ? 80.516  77.343  121.246 1.00 40.70 ? 130 HIS B CB    1 
ATOM   5982  C  CG    . HIS B  1 130 ? 81.910  77.819  121.502 1.00 40.70 ? 130 HIS B CG    1 
ATOM   5983  N  ND1   . HIS B  1 130 ? 82.818  78.039  120.490 1.00 40.70 ? 130 HIS B ND1   1 
ATOM   5984  C  CD2   . HIS B  1 130 ? 82.555  78.109  122.656 1.00 40.70 ? 130 HIS B CD2   1 
ATOM   5985  C  CE1   . HIS B  1 130 ? 83.961  78.449  121.009 1.00 40.70 ? 130 HIS B CE1   1 
ATOM   5986  N  NE2   . HIS B  1 130 ? 83.828  78.499  122.322 1.00 40.70 ? 130 HIS B NE2   1 
ATOM   5987  N  N     . GLU B  1 131 ? 79.960  75.010  123.472 1.00 44.48 ? 131 GLU B N     1 
ATOM   5988  C  CA    . GLU B  1 131 ? 80.365  74.377  124.722 1.00 44.48 ? 131 GLU B CA    1 
ATOM   5989  C  C     . GLU B  1 131 ? 80.490  72.868  124.580 1.00 44.48 ? 131 GLU B C     1 
ATOM   5990  O  O     . GLU B  1 131 ? 81.277  72.248  125.301 1.00 44.48 ? 131 GLU B O     1 
ATOM   5991  C  CB    . GLU B  1 131 ? 79.382  74.721  125.844 1.00 44.48 ? 131 GLU B CB    1 
ATOM   5992  C  CG    . GLU B  1 131 ? 79.391  76.188  126.297 1.00 44.48 ? 131 GLU B CG    1 
ATOM   5993  C  CD    . GLU B  1 131 ? 80.759  76.725  126.720 1.00 44.48 ? 131 GLU B CD    1 
ATOM   5994  O  OE1   . GLU B  1 131 ? 81.601  75.954  127.234 1.00 44.48 ? 131 GLU B OE1   1 
ATOM   5995  O  OE2   . GLU B  1 131 ? 80.994  77.937  126.529 1.00 44.48 ? 131 GLU B OE2   1 
ATOM   5996  N  N     . LEU B  1 132 ? 79.725  72.261  123.672 1.00 41.59 ? 132 LEU B N     1 
ATOM   5997  C  CA    . LEU B  1 132 ? 79.922  70.845  123.384 1.00 41.59 ? 132 LEU B CA    1 
ATOM   5998  C  C     . LEU B  1 132 ? 81.168  70.618  122.542 1.00 41.59 ? 132 LEU B C     1 
ATOM   5999  O  O     . LEU B  1 132 ? 81.798  69.561  122.645 1.00 41.59 ? 132 LEU B O     1 
ATOM   6000  C  CB    . LEU B  1 132 ? 78.696  70.274  122.676 1.00 41.59 ? 132 LEU B CB    1 
ATOM   6001  C  CG    . LEU B  1 132 ? 77.463  70.036  123.541 1.00 41.59 ? 132 LEU B CG    1 
ATOM   6002  C  CD1   . LEU B  1 132 ? 76.317  69.526  122.694 1.00 41.59 ? 132 LEU B CD1   1 
ATOM   6003  C  CD2   . LEU B  1 132 ? 77.788  69.055  124.644 1.00 41.59 ? 132 LEU B CD2   1 
ATOM   6004  N  N     . GLU B  1 133 ? 81.530  71.587  121.699 1.00 44.32 ? 133 GLU B N     1 
ATOM   6005  C  CA    . GLU B  1 133 ? 82.752  71.471  120.912 1.00 44.32 ? 133 GLU B CA    1 
ATOM   6006  C  C     . GLU B  1 133 ? 83.984  71.618  121.794 1.00 44.32 ? 133 GLU B C     1 
ATOM   6007  O  O     . GLU B  1 133 ? 84.952  70.863  121.655 1.00 44.32 ? 133 GLU B O     1 
ATOM   6008  C  CB    . GLU B  1 133 ? 82.761  72.517  119.799 1.00 44.32 ? 133 GLU B CB    1 
ATOM   6009  C  CG    . GLU B  1 133 ? 82.114  72.062  118.506 1.00 44.32 ? 133 GLU B CG    1 
ATOM   6010  C  CD    . GLU B  1 133 ? 82.644  72.809  117.296 1.00 44.32 ? 133 GLU B CD    1 
ATOM   6011  O  OE1   . GLU B  1 133 ? 82.852  72.168  116.245 1.00 44.32 ? 133 GLU B OE1   1 
ATOM   6012  O  OE2   . GLU B  1 133 ? 82.853  74.037  117.394 1.00 44.32 ? 133 GLU B OE2   1 
ATOM   6013  N  N     . ASN B  1 134 ? 83.965  72.585  122.713 1.00 47.14 ? 134 ASN B N     1 
ATOM   6014  C  CA    . ASN B  1 134 ? 85.065  72.792  123.654 1.00 47.14 ? 134 ASN B CA    1 
ATOM   6015  C  C     . ASN B  1 134 ? 84.867  71.937  124.908 1.00 47.14 ? 134 ASN B C     1 
ATOM   6016  O  O     . ASN B  1 134 ? 84.762  72.425  126.033 1.00 47.14 ? 134 ASN B O     1 
ATOM   6017  C  CB    . ASN B  1 134 ? 85.191  74.267  124.006 1.00 47.14 ? 134 ASN B CB    1 
ATOM   6018  C  CG    . ASN B  1 134 ? 85.905  75.057  122.935 1.00 47.14 ? 134 ASN B CG    1 
ATOM   6019  O  OD1   . ASN B  1 134 ? 85.557  74.979  121.758 1.00 47.14 ? 134 ASN B OD1   1 
ATOM   6020  N  ND2   . ASN B  1 134 ? 86.911  75.824  123.335 1.00 47.14 ? 134 ASN B ND2   1 
ATOM   6021  N  N     . LEU B  1 135 ? 84.817  70.629  124.684 1.00 53.17 ? 135 LEU B N     1 
ATOM   6022  C  CA    . LEU B  1 135 ? 84.709  69.620  125.731 1.00 53.17 ? 135 LEU B CA    1 
ATOM   6023  C  C     . LEU B  1 135 ? 85.859  68.654  125.479 1.00 53.17 ? 135 LEU B C     1 
ATOM   6024  O  O     . LEU B  1 135 ? 85.722  67.695  124.717 1.00 53.17 ? 135 LEU B O     1 
ATOM   6025  C  CB    . LEU B  1 135 ? 83.358  68.927  125.691 1.00 53.17 ? 135 LEU B CB    1 
ATOM   6026  C  CG    . LEU B  1 135 ? 82.978  68.075  126.896 1.00 53.17 ? 135 LEU B CG    1 
ATOM   6027  C  CD1   . LEU B  1 135 ? 82.990  68.918  128.151 1.00 53.17 ? 135 LEU B CD1   1 
ATOM   6028  C  CD2   . LEU B  1 135 ? 81.613  67.450  126.683 1.00 53.17 ? 135 LEU B CD2   1 
ATOM   6029  N  N     . ARG B  1 136 ? 86.998  68.918  126.107 1.00 59.52 ? 136 ARG B N     1 
ATOM   6030  C  CA    . ARG B  1 136 ? 88.236  68.228  125.785 1.00 59.52 ? 136 ARG B CA    1 
ATOM   6031  C  C     . ARG B  1 136 ? 88.556  67.158  126.819 1.00 59.52 ? 136 ARG B C     1 
ATOM   6032  O  O     . ARG B  1 136 ? 88.121  67.226  127.970 1.00 59.52 ? 136 ARG B O     1 
ATOM   6033  C  CB    . ARG B  1 136 ? 89.392  69.222  125.691 1.00 59.52 ? 136 ARG B CB    1 
ATOM   6034  C  CG    . ARG B  1 136 ? 89.051  70.475  124.910 1.00 59.52 ? 136 ARG B CG    1 
ATOM   6035  C  CD    . ARG B  1 136 ? 90.183  70.869  123.986 1.00 59.52 ? 136 ARG B CD    1 
ATOM   6036  N  NE    . ARG B  1 136 ? 89.854  72.050  123.195 1.00 59.52 ? 136 ARG B NE    1 
ATOM   6037  C  CZ    . ARG B  1 136 ? 89.235  72.012  122.021 1.00 59.52 ? 136 ARG B CZ    1 
ATOM   6038  N  NH1   . ARG B  1 136 ? 88.877  70.851  121.496 1.00 59.52 ? 136 ARG B NH1   1 
ATOM   6039  N  NH2   . ARG B  1 136 ? 88.976  73.137  121.370 1.00 59.52 ? 136 ARG B NH2   1 
ATOM   6040  N  N     . ALA B  1 137 ? 89.326  66.164  126.388 1.00 72.48 ? 137 ALA B N     1 
ATOM   6041  C  CA    . ALA B  1 137 ? 89.778  65.082  127.249 1.00 72.48 ? 137 ALA B CA    1 
ATOM   6042  C  C     . ALA B  1 137 ? 91.160  65.404  127.797 1.00 72.48 ? 137 ALA B C     1 
ATOM   6043  O  O     . ALA B  1 137 ? 92.037  65.866  127.063 1.00 72.48 ? 137 ALA B O     1 
ATOM   6044  C  CB    . ALA B  1 137 ? 89.814  63.756  126.490 1.00 72.48 ? 137 ALA B CB    1 
ATOM   6045  N  N     . LYS B  1 138 ? 91.347  65.162  129.096 1.00 81.29 ? 138 LYS B N     1 
ATOM   6046  C  CA    . LYS B  1 138 ? 92.621  65.441  129.754 1.00 81.29 ? 138 LYS B CA    1 
ATOM   6047  C  C     . LYS B  1 138 ? 93.277  64.157  130.248 1.00 81.29 ? 138 LYS B C     1 
ATOM   6048  O  O     . LYS B  1 138 ? 94.433  63.898  129.908 1.00 81.29 ? 138 LYS B O     1 
ATOM   6049  C  CB    . LYS B  1 138 ? 92.412  66.439  130.894 1.00 81.29 ? 138 LYS B CB    1 
ATOM   6050  N  N     . ASP B  1 139 ? 92.576  63.342  131.038 1.00 86.66 ? 139 ASP B N     1 
ATOM   6051  C  CA    . ASP B  1 139 ? 93.206  62.171  131.637 1.00 86.66 ? 139 ASP B CA    1 
ATOM   6052  C  C     . ASP B  1 139 ? 92.990  60.921  130.793 1.00 86.66 ? 139 ASP B C     1 
ATOM   6053  O  O     . ASP B  1 139 ? 93.853  60.036  130.755 1.00 86.66 ? 139 ASP B O     1 
ATOM   6054  C  CB    . ASP B  1 139 ? 92.668  61.954  133.050 1.00 86.66 ? 139 ASP B CB    1 
ATOM   6055  C  CG    . ASP B  1 139 ? 92.847  63.169  133.934 1.00 86.66 ? 139 ASP B CG    1 
ATOM   6056  O  OD1   . ASP B  1 139 ? 91.992  63.395  134.816 1.00 86.66 ? 139 ASP B OD1   1 
ATOM   6057  O  OD2   . ASP B  1 139 ? 93.842  63.900  133.748 1.00 86.66 ? 139 ASP B OD2   1 
ATOM   6058  N  N     . GLU B  1 140 ? 91.846  60.829  130.117 1.00 83.66 ? 140 GLU B N     1 
ATOM   6059  C  CA    . GLU B  1 140 ? 91.452  59.588  129.463 1.00 83.66 ? 140 GLU B CA    1 
ATOM   6060  C  C     . GLU B  1 140 ? 92.257  59.356  128.191 1.00 83.66 ? 140 GLU B C     1 
ATOM   6061  O  O     . GLU B  1 140 ? 92.372  60.245  127.342 1.00 83.66 ? 140 GLU B O     1 
ATOM   6062  C  CB    . GLU B  1 140 ? 89.959  59.615  129.143 1.00 83.66 ? 140 GLU B CB    1 
ATOM   6063  C  CG    . GLU B  1 140 ? 89.073  59.806  130.360 1.00 83.66 ? 140 GLU B CG    1 
ATOM   6064  C  CD    . GLU B  1 140 ? 88.304  61.111  130.321 1.00 83.66 ? 140 GLU B CD    1 
ATOM   6065  O  OE1   . GLU B  1 140 ? 87.074  61.085  130.535 1.00 83.66 ? 140 GLU B OE1   1 
ATOM   6066  O  OE2   . GLU B  1 140 ? 88.929  62.163  130.074 1.00 83.66 ? 140 GLU B OE2   1 
ATOM   6067  N  N     . LYS B  1 141 ? 92.816  58.153  128.065 1.00 79.99 ? 141 LYS B N     1 
ATOM   6068  C  CA    . LYS B  1 141 ? 93.525  57.756  126.857 1.00 79.99 ? 141 LYS B CA    1 
ATOM   6069  C  C     . LYS B  1 141 ? 92.600  57.135  125.822 1.00 79.99 ? 141 LYS B C     1 
ATOM   6070  O  O     . LYS B  1 141 ? 92.938  57.110  124.633 1.00 79.99 ? 141 LYS B O     1 
ATOM   6071  C  CB    . LYS B  1 141 ? 94.646  56.771  127.199 1.00 79.99 ? 141 LYS B CB    1 
ATOM   6072  C  CG    . LYS B  1 141 ? 95.745  57.359  128.066 1.00 79.99 ? 141 LYS B CG    1 
ATOM   6073  C  CD    . LYS B  1 141 ? 96.691  56.280  128.566 1.00 79.99 ? 141 LYS B CD    1 
ATOM   6074  C  CE    . LYS B  1 141 ? 97.491  55.671  127.427 1.00 79.99 ? 141 LYS B CE    1 
ATOM   6075  N  NZ    . LYS B  1 141 ? 98.469  56.635  126.856 1.00 79.99 ? 141 LYS B NZ    1 
ATOM   6076  N  N     . MET B  1 142 ? 91.447  56.626  126.247 1.00 82.02 ? 142 MET B N     1 
ATOM   6077  C  CA    . MET B  1 142 ? 90.460  56.081  125.331 1.00 82.02 ? 142 MET B CA    1 
ATOM   6078  C  C     . MET B  1 142 ? 89.069  56.374  125.869 1.00 82.02 ? 142 MET B C     1 
ATOM   6079  O  O     . MET B  1 142 ? 88.892  56.717  127.040 1.00 82.02 ? 142 MET B O     1 
ATOM   6080  C  CB    . MET B  1 142 ? 90.645  54.572  125.126 1.00 82.02 ? 142 MET B CB    1 
ATOM   6081  C  CG    . MET B  1 142 ? 90.189  53.724  126.300 1.00 82.02 ? 142 MET B CG    1 
ATOM   6082  N  N     . ILE B  1 143 ? 88.083  56.247  124.992 1.00 78.95 ? 143 ILE B N     1 
ATOM   6083  C  CA    . ILE B  1 143 ? 86.685  56.363  125.416 1.00 78.95 ? 143 ILE B CA    1 
ATOM   6084  C  C     . ILE B  1 143 ? 86.312  55.118  126.214 1.00 78.95 ? 143 ILE B C     1 
ATOM   6085  O  O     . ILE B  1 143 ? 86.592  53.994  125.760 1.00 78.95 ? 143 ILE B O     1 
ATOM   6086  C  CB    . ILE B  1 143 ? 85.775  56.543  124.197 1.00 78.95 ? 143 ILE B CB    1 
ATOM   6087  C  CG1   . ILE B  1 143 ? 85.897  57.972  123.663 1.00 78.95 ? 143 ILE B CG1   1 
ATOM   6088  C  CG2   . ILE B  1 143 ? 84.325  56.222  124.527 1.00 78.95 ? 143 ILE B CG2   1 
ATOM   6089  C  CD1   . ILE B  1 143 ? 85.023  58.262  122.469 1.00 78.95 ? 143 ILE B CD1   1 
ATOM   6090  N  N     . PRO B  1 144 ? 85.722  55.259  127.414 1.00 79.54 ? 144 PRO B N     1 
ATOM   6091  C  CA    . PRO B  1 144 ? 85.433  54.085  128.252 1.00 79.54 ? 144 PRO B CA    1 
ATOM   6092  C  C     . PRO B  1 144 ? 84.374  53.170  127.660 1.00 79.54 ? 144 PRO B C     1 
ATOM   6093  O  O     . PRO B  1 144 ? 83.196  53.529  127.575 1.00 79.54 ? 144 PRO B O     1 
ATOM   6094  C  CB    . PRO B  1 144 ? 84.953  54.704  129.572 1.00 79.54 ? 144 PRO B CB    1 
ATOM   6095  C  CG    . PRO B  1 144 ? 85.432  56.121  129.538 1.00 79.54 ? 144 PRO B CG    1 
ATOM   6096  C  CD    . PRO B  1 144 ? 85.401  56.519  128.102 1.00 79.54 ? 144 PRO B CD    1 
ATOM   6097  N  N     . GLY B  1 145 ? 84.798  51.977  127.250 1.00 81.46 ? 145 GLY B N     1 
ATOM   6098  C  CA    . GLY B  1 145 ? 83.942  51.021  126.580 1.00 81.46 ? 145 GLY B CA    1 
ATOM   6099  C  C     . GLY B  1 145 ? 84.288  50.785  125.128 1.00 81.46 ? 145 GLY B C     1 
ATOM   6100  O  O     . GLY B  1 145 ? 83.825  49.792  124.554 1.00 81.46 ? 145 GLY B O     1 
ATOM   6101  N  N     . TYR B  1 146 ? 85.086  51.657  124.513 1.00 81.47 ? 146 TYR B N     1 
ATOM   6102  C  CA    . TYR B  1 146 ? 85.458  51.520  123.114 1.00 81.47 ? 146 TYR B CA    1 
ATOM   6103  C  C     . TYR B  1 146 ? 86.977  51.513  123.006 1.00 81.47 ? 146 TYR B C     1 
ATOM   6104  O  O     . TYR B  1 146 ? 87.633  52.477  123.438 1.00 81.47 ? 146 TYR B O     1 
ATOM   6105  C  CB    . TYR B  1 146 ? 84.858  52.653  122.270 1.00 81.47 ? 146 TYR B CB    1 
ATOM   6106  C  CG    . TYR B  1 146 ? 83.432  52.400  121.836 1.00 81.47 ? 146 TYR B CG    1 
ATOM   6107  C  CD1   . TYR B  1 146 ? 82.393  52.405  122.759 1.00 81.47 ? 146 TYR B CD1   1 
ATOM   6108  C  CD2   . TYR B  1 146 ? 83.125  52.154  120.504 1.00 81.47 ? 146 TYR B CD2   1 
ATOM   6109  C  CE1   . TYR B  1 146 ? 81.088  52.171  122.368 1.00 81.47 ? 146 TYR B CE1   1 
ATOM   6110  C  CE2   . TYR B  1 146 ? 81.822  51.920  120.103 1.00 81.47 ? 146 TYR B CE2   1 
ATOM   6111  C  CZ    . TYR B  1 146 ? 80.810  51.930  121.040 1.00 81.47 ? 146 TYR B CZ    1 
ATOM   6112  O  OH    . TYR B  1 146 ? 79.512  51.698  120.647 1.00 81.47 ? 146 TYR B OH    1 
ATOM   6113  N  N     . PRO B  1 147 ? 87.577  50.456  122.453 1.00 80.97 ? 147 PRO B N     1 
ATOM   6114  C  CA    . PRO B  1 147 ? 89.044  50.369  122.420 1.00 80.97 ? 147 PRO B CA    1 
ATOM   6115  C  C     . PRO B  1 147 ? 89.693  51.280  121.389 1.00 80.97 ? 147 PRO B C     1 
ATOM   6116  O  O     . PRO B  1 147 ? 90.709  51.920  121.675 1.00 80.97 ? 147 PRO B O     1 
ATOM   6117  C  CB    . PRO B  1 147 ? 89.302  48.892  122.085 1.00 80.97 ? 147 PRO B CB    1 
ATOM   6118  C  CG    . PRO B  1 147 ? 87.969  48.198  122.223 1.00 80.97 ? 147 PRO B CG    1 
ATOM   6119  C  CD    . PRO B  1 147 ? 86.946  49.236  121.928 1.00 80.97 ? 147 PRO B CD    1 
ATOM   6120  N  N     . GLN B  1 148 ? 89.115  51.350  120.190 1.00 80.96 ? 148 GLN B N     1 
ATOM   6121  C  CA    . GLN B  1 148 ? 89.772  52.011  119.068 1.00 80.96 ? 148 GLN B CA    1 
ATOM   6122  C  C     . GLN B  1 148 ? 89.682  53.530  119.115 1.00 80.96 ? 148 GLN B C     1 
ATOM   6123  O  O     . GLN B  1 148 ? 90.341  54.194  118.307 1.00 80.96 ? 148 GLN B O     1 
ATOM   6124  C  CB    . GLN B  1 148 ? 89.181  51.514  117.747 1.00 80.96 ? 148 GLN B CB    1 
ATOM   6125  C  CG    . GLN B  1 148 ? 89.524  50.076  117.415 1.00 80.96 ? 148 GLN B CG    1 
ATOM   6126  C  CD    . GLN B  1 148 ? 88.847  49.604  116.147 1.00 80.96 ? 148 GLN B CD    1 
ATOM   6127  O  OE1   . GLN B  1 148 ? 87.839  50.168  115.723 1.00 80.96 ? 148 GLN B OE1   1 
ATOM   6128  N  NE2   . GLN B  1 148 ? 89.400  48.566  115.531 1.00 80.96 ? 148 GLN B NE2   1 
ATOM   6129  N  N     . ALA B  1 149 ? 88.893  54.097  120.026 1.00 79.94 ? 149 ALA B N     1 
ATOM   6130  C  CA    . ALA B  1 149 ? 88.749  55.548  120.129 1.00 79.94 ? 149 ALA B CA    1 
ATOM   6131  C  C     . ALA B  1 149 ? 89.996  56.116  120.801 1.00 79.94 ? 149 ALA B C     1 
ATOM   6132  O  O     . ALA B  1 149 ? 90.069  56.282  122.020 1.00 79.94 ? 149 ALA B O     1 
ATOM   6133  C  CB    . ALA B  1 149 ? 87.485  55.907  120.896 1.00 79.94 ? 149 ALA B CB    1 
ATOM   6134  N  N     . LYS B  1 150 ? 90.997  56.419  119.978 1.00 77.73 ? 150 LYS B N     1 
ATOM   6135  C  CA    . LYS B  1 150 ? 92.275  56.924  120.470 1.00 77.73 ? 150 LYS B CA    1 
ATOM   6136  C  C     . LYS B  1 150 ? 92.121  58.376  120.903 1.00 77.73 ? 150 LYS B C     1 
ATOM   6137  O  O     . LYS B  1 150 ? 91.913  59.262  120.068 1.00 77.73 ? 150 LYS B O     1 
ATOM   6138  C  CB    . LYS B  1 150 ? 93.343  56.787  119.390 1.00 77.73 ? 150 LYS B CB    1 
ATOM   6139  N  N     . LEU B  1 151 ? 92.225  58.624  122.205 1.00 78.68 ? 151 LEU B N     1 
ATOM   6140  C  CA    . LEU B  1 151 ? 92.059  59.954  122.776 1.00 78.68 ? 151 LEU B CA    1 
ATOM   6141  C  C     . LEU B  1 151 ? 93.390  60.440  123.334 1.00 78.68 ? 151 LEU B C     1 
ATOM   6142  O  O     . LEU B  1 151 ? 93.978  59.789  124.203 1.00 78.68 ? 151 LEU B O     1 
ATOM   6143  C  CB    . LEU B  1 151 ? 90.995  59.949  123.872 1.00 78.68 ? 151 LEU B CB    1 
ATOM   6144  C  CG    . LEU B  1 151 ? 89.543  60.128  123.433 1.00 78.68 ? 151 LEU B CG    1 
ATOM   6145  C  CD1   . LEU B  1 151 ? 88.653  60.301  124.647 1.00 78.68 ? 151 LEU B CD1   1 
ATOM   6146  C  CD2   . LEU B  1 151 ? 89.405  61.313  122.495 1.00 78.68 ? 151 LEU B CD2   1 
ATOM   6147  N  N     . TYR B  1 152 ? 93.853  61.577  122.841 1.00 76.42 ? 152 TYR B N     1 
ATOM   6148  C  CA    . TYR B  1 152 ? 95.033  62.250  123.351 1.00 76.42 ? 152 TYR B CA    1 
ATOM   6149  C  C     . TYR B  1 152 ? 94.616  63.490  124.134 1.00 76.42 ? 152 TYR B C     1 
ATOM   6150  O  O     . TYR B  1 152 ? 93.517  64.015  123.927 1.00 76.42 ? 152 TYR B O     1 
ATOM   6151  C  CB    . TYR B  1 152 ? 95.986  62.633  122.203 1.00 76.42 ? 152 TYR B CB    1 
ATOM   6152  C  CG    . TYR B  1 152 ? 95.376  63.453  121.087 1.00 76.42 ? 152 TYR B CG    1 
ATOM   6153  C  CD1   . TYR B  1 152 ? 94.747  62.840  120.009 1.00 76.42 ? 152 TYR B CD1   1 
ATOM   6154  C  CD2   . TYR B  1 152 ? 95.461  64.840  121.095 1.00 76.42 ? 152 TYR B CD2   1 
ATOM   6155  C  CE1   . TYR B  1 152 ? 94.197  63.584  118.986 1.00 76.42 ? 152 TYR B CE1   1 
ATOM   6156  C  CE2   . TYR B  1 152 ? 94.916  65.593  120.074 1.00 76.42 ? 152 TYR B CE2   1 
ATOM   6157  C  CZ    . TYR B  1 152 ? 94.286  64.959  119.023 1.00 76.42 ? 152 TYR B CZ    1 
ATOM   6158  O  OH    . TYR B  1 152 ? 93.740  65.704  118.005 1.00 76.42 ? 152 TYR B OH    1 
ATOM   6159  N  N     . PRO B  1 153 ? 95.439  63.957  125.079 1.00 77.29 ? 153 PRO B N     1 
ATOM   6160  C  CA    . PRO B  1 153 ? 95.090  65.179  125.821 1.00 77.29 ? 153 PRO B CA    1 
ATOM   6161  C  C     . PRO B  1 153 ? 95.087  66.405  124.918 1.00 77.29 ? 153 PRO B C     1 
ATOM   6162  O  O     . PRO B  1 153 ? 96.065  66.691  124.225 1.00 77.29 ? 153 PRO B O     1 
ATOM   6163  C  CB    . PRO B  1 153 ? 96.182  65.271  126.896 1.00 77.29 ? 153 PRO B CB    1 
ATOM   6164  C  CG    . PRO B  1 153 ? 97.263  64.351  126.440 1.00 77.29 ? 153 PRO B CG    1 
ATOM   6165  C  CD    . PRO B  1 153 ? 96.564  63.253  125.717 1.00 77.29 ? 153 PRO B CD    1 
ATOM   6166  N  N     . GLY B  1 154 ? 93.969  67.126  124.934 1.00 73.14 ? 154 GLY B N     1 
ATOM   6167  C  CA    . GLY B  1 154 ? 93.743  68.236  124.035 1.00 73.14 ? 154 GLY B CA    1 
ATOM   6168  C  C     . GLY B  1 154 ? 92.811  67.942  122.879 1.00 73.14 ? 154 GLY B C     1 
ATOM   6169  O  O     . GLY B  1 154 ? 92.660  68.795  121.998 1.00 73.14 ? 154 GLY B O     1 
ATOM   6170  N  N     . LYS B  1 155 ? 92.184  66.771  122.854 1.00 68.92 ? 155 LYS B N     1 
ATOM   6171  C  CA    . LYS B  1 155 ? 91.296  66.365  121.776 1.00 68.92 ? 155 LYS B CA    1 
ATOM   6172  C  C     . LYS B  1 155 ? 89.849  66.547  122.210 1.00 68.92 ? 155 LYS B C     1 
ATOM   6173  O  O     . LYS B  1 155 ? 89.484  66.203  123.338 1.00 68.92 ? 155 LYS B O     1 
ATOM   6174  C  CB    . LYS B  1 155 ? 91.561  64.906  121.387 1.00 68.92 ? 155 LYS B CB    1 
ATOM   6175  C  CG    . LYS B  1 155 ? 90.538  64.274  120.458 1.00 68.92 ? 155 LYS B CG    1 
ATOM   6176  C  CD    . LYS B  1 155 ? 90.705  64.769  119.036 1.00 68.92 ? 155 LYS B CD    1 
ATOM   6177  C  CE    . LYS B  1 155 ? 89.819  63.994  118.079 1.00 68.92 ? 155 LYS B CE    1 
ATOM   6178  N  NZ    . LYS B  1 155 ? 89.773  64.628  116.734 1.00 68.92 ? 155 LYS B NZ    1 
ATOM   6179  N  N     . SER B  1 156 ? 89.038  67.115  121.318 1.00 61.10 ? 156 SER B N     1 
ATOM   6180  C  CA    . SER B  1 156 ? 87.622  67.314  121.594 1.00 61.10 ? 156 SER B CA    1 
ATOM   6181  C  C     . SER B  1 156 ? 86.900  65.979  121.712 1.00 61.10 ? 156 SER B C     1 
ATOM   6182  O  O     . SER B  1 156 ? 87.183  65.034  120.971 1.00 61.10 ? 156 SER B O     1 
ATOM   6183  C  CB    . SER B  1 156 ? 86.984  68.152  120.490 1.00 61.10 ? 156 SER B CB    1 
ATOM   6184  O  OG    . SER B  1 156 ? 85.594  68.300  120.707 1.00 61.10 ? 156 SER B OG    1 
ATOM   6185  N  N     . LEU B  1 157 ? 85.966  65.901  122.660 1.00 58.13 ? 157 LEU B N     1 
ATOM   6186  C  CA    . LEU B  1 157 ? 85.216  64.666  122.853 1.00 58.13 ? 157 LEU B CA    1 
ATOM   6187  C  C     . LEU B  1 157 ? 84.180  64.463  121.759 1.00 58.13 ? 157 LEU B C     1 
ATOM   6188  O  O     . LEU B  1 157 ? 84.001  63.340  121.276 1.00 58.13 ? 157 LEU B O     1 
ATOM   6189  C  CB    . LEU B  1 157 ? 84.535  64.663  124.219 1.00 58.13 ? 157 LEU B CB    1 
ATOM   6190  C  CG    . LEU B  1 157 ? 85.418  64.394  125.433 1.00 58.13 ? 157 LEU B CG    1 
ATOM   6191  C  CD1   . LEU B  1 157 ? 84.564  64.179  126.667 1.00 58.13 ? 157 LEU B CD1   1 
ATOM   6192  C  CD2   . LEU B  1 157 ? 86.313  63.199  125.185 1.00 58.13 ? 157 LEU B CD2   1 
ATOM   6193  N  N     . LEU B  1 158 ? 83.493  65.537  121.358 1.00 53.68 ? 158 LEU B N     1 
ATOM   6194  C  CA    . LEU B  1 158 ? 82.413  65.415  120.386 1.00 53.68 ? 158 LEU B CA    1 
ATOM   6195  C  C     . LEU B  1 158 ? 82.933  65.063  119.000 1.00 53.68 ? 158 LEU B C     1 
ATOM   6196  O  O     . LEU B  1 158 ? 82.264  64.333  118.262 1.00 53.68 ? 158 LEU B O     1 
ATOM   6197  C  CB    . LEU B  1 158 ? 81.604  66.707  120.332 1.00 53.68 ? 158 LEU B CB    1 
ATOM   6198  C  CG    . LEU B  1 158 ? 80.223  66.575  119.693 1.00 53.68 ? 158 LEU B CG    1 
ATOM   6199  C  CD1   . LEU B  1 158 ? 79.302  65.784  120.602 1.00 53.68 ? 158 LEU B CD1   1 
ATOM   6200  C  CD2   . LEU B  1 158 ? 79.640  67.940  119.384 1.00 53.68 ? 158 LEU B CD2   1 
ATOM   6201  N  N     . ARG B  1 159 ? 84.127  65.543  118.644 1.00 57.81 ? 159 ARG B N     1 
ATOM   6202  C  CA    . ARG B  1 159 ? 84.705  65.211  117.345 1.00 57.81 ? 159 ARG B CA    1 
ATOM   6203  C  C     . ARG B  1 159 ? 85.062  63.733  117.259 1.00 57.81 ? 159 ARG B C     1 
ATOM   6204  O  O     . ARG B  1 159 ? 84.785  63.078  116.245 1.00 57.81 ? 159 ARG B O     1 
ATOM   6205  C  CB    . ARG B  1 159 ? 85.936  66.075  117.089 1.00 57.81 ? 159 ARG B CB    1 
ATOM   6206  C  CG    . ARG B  1 159 ? 86.232  66.302  115.627 1.00 57.81 ? 159 ARG B CG    1 
ATOM   6207  C  CD    . ARG B  1 159 ? 85.317  67.363  115.053 1.00 57.81 ? 159 ARG B CD    1 
ATOM   6208  N  NE    . ARG B  1 159 ? 85.545  68.672  115.654 1.00 57.81 ? 159 ARG B NE    1 
ATOM   6209  C  CZ    . ARG B  1 159 ? 86.460  69.538  115.233 1.00 57.81 ? 159 ARG B CZ    1 
ATOM   6210  N  NH1   . ARG B  1 159 ? 87.241  69.235  114.207 1.00 57.81 ? 159 ARG B NH1   1 
ATOM   6211  N  NH2   . ARG B  1 159 ? 86.595  70.709  115.838 1.00 57.81 ? 159 ARG B NH2   1 
ATOM   6212  N  N     . ARG B  1 160 ? 85.653  63.183  118.322 1.00 66.44 ? 160 ARG B N     1 
ATOM   6213  C  CA    . ARG B  1 160 ? 85.982  61.764  118.327 1.00 66.44 ? 160 ARG B CA    1 
ATOM   6214  C  C     . ARG B  1 160 ? 84.739  60.899  118.483 1.00 66.44 ? 160 ARG B C     1 
ATOM   6215  O  O     . ARG B  1 160 ? 84.733  59.748  118.038 1.00 66.44 ? 160 ARG B O     1 
ATOM   6216  C  CB    . ARG B  1 160 ? 86.984  61.457  119.438 1.00 66.44 ? 160 ARG B CB    1 
ATOM   6217  C  CG    . ARG B  1 160 ? 87.893  60.281  119.131 1.00 66.44 ? 160 ARG B CG    1 
ATOM   6218  C  CD    . ARG B  1 160 ? 88.598  60.466  117.795 1.00 66.44 ? 160 ARG B CD    1 
ATOM   6219  N  NE    . ARG B  1 160 ? 89.728  59.557  117.636 1.00 66.44 ? 160 ARG B NE    1 
ATOM   6220  C  CZ    . ARG B  1 160 ? 89.627  58.309  117.191 1.00 66.44 ? 160 ARG B CZ    1 
ATOM   6221  N  NH1   . ARG B  1 160 ? 88.445  57.813  116.854 1.00 66.44 ? 160 ARG B NH1   1 
ATOM   6222  N  NH2   . ARG B  1 160 ? 90.712  57.556  117.081 1.00 66.44 ? 160 ARG B NH2   1 
ATOM   6223  N  N     . LEU B  1 161 ? 83.685  61.425  119.109 1.00 58.85 ? 161 LEU B N     1 
ATOM   6224  C  CA    . LEU B  1 161 ? 82.438  60.675  119.180 1.00 58.85 ? 161 LEU B CA    1 
ATOM   6225  C  C     . LEU B  1 161 ? 81.704  60.687  117.846 1.00 58.85 ? 161 LEU B C     1 
ATOM   6226  O  O     . LEU B  1 161 ? 80.964  59.747  117.537 1.00 58.85 ? 161 LEU B O     1 
ATOM   6227  C  CB    . LEU B  1 161 ? 81.545  61.238  120.283 1.00 58.85 ? 161 LEU B CB    1 
ATOM   6228  C  CG    . LEU B  1 161 ? 81.874  60.861  121.727 1.00 58.85 ? 161 LEU B CG    1 
ATOM   6229  C  CD1   . LEU B  1 161 ? 81.196  61.823  122.680 1.00 58.85 ? 161 LEU B CD1   1 
ATOM   6230  C  CD2   . LEU B  1 161 ? 81.459  59.443  122.033 1.00 58.85 ? 161 LEU B CD2   1 
ATOM   6231  N  N     . LEU B  1 162 ? 81.891  61.740  117.048 1.00 56.59 ? 162 LEU B N     1 
ATOM   6232  C  CA    . LEU B  1 162 ? 81.265  61.804  115.733 1.00 56.59 ? 162 LEU B CA    1 
ATOM   6233  C  C     . LEU B  1 162 ? 82.021  60.969  114.708 1.00 56.59 ? 162 LEU B C     1 
ATOM   6234  O  O     . LEU B  1 162 ? 81.401  60.308  113.867 1.00 56.59 ? 162 LEU B O     1 
ATOM   6235  C  CB    . LEU B  1 162 ? 81.176  63.256  115.263 1.00 56.59 ? 162 LEU B CB    1 
ATOM   6236  C  CG    . LEU B  1 162 ? 79.957  64.067  115.697 1.00 56.59 ? 162 LEU B CG    1 
ATOM   6237  C  CD1   . LEU B  1 162 ? 80.237  65.549  115.556 1.00 56.59 ? 162 LEU B CD1   1 
ATOM   6238  C  CD2   . LEU B  1 162 ? 78.751  63.680  114.872 1.00 56.59 ? 162 LEU B CD2   1 
ATOM   6239  N  N     . THR B  1 163 ? 83.356  60.989  114.755 1.00 62.83 ? 163 THR B N     1 
ATOM   6240  C  CA    . THR B  1 163 ? 84.134  60.283  113.741 1.00 62.83 ? 163 THR B CA    1 
ATOM   6241  C  C     . THR B  1 163 ? 84.130  58.777  113.973 1.00 62.83 ? 163 THR B C     1 
ATOM   6242  O  O     . THR B  1 163 ? 84.173  57.998  113.014 1.00 62.83 ? 163 THR B O     1 
ATOM   6243  C  CB    . THR B  1 163 ? 85.567  60.812  113.707 1.00 62.83 ? 163 THR B CB    1 
ATOM   6244  O  OG1   . THR B  1 163 ? 86.101  60.839  115.036 1.00 62.83 ? 163 THR B OG1   1 
ATOM   6245  C  CG2   . THR B  1 163 ? 85.603  62.212  113.114 1.00 62.83 ? 163 THR B CG2   1 
ATOM   6246  N  N     . SER B  1 164 ? 84.080  58.343  115.230 1.00 63.09 ? 164 SER B N     1 
ATOM   6247  C  CA    . SER B  1 164 ? 84.085  56.918  115.536 1.00 63.09 ? 164 SER B CA    1 
ATOM   6248  C  C     . SER B  1 164 ? 82.695  56.296  115.507 1.00 63.09 ? 164 SER B C     1 
ATOM   6249  O  O     . SER B  1 164 ? 82.565  55.100  115.785 1.00 63.09 ? 164 SER B O     1 
ATOM   6250  C  CB    . SER B  1 164 ? 84.735  56.669  116.898 1.00 63.09 ? 164 SER B CB    1 
ATOM   6251  O  OG    . SER B  1 164 ? 83.778  56.747  117.938 1.00 63.09 ? 164 SER B OG    1 
ATOM   6252  N  N     . GLY B  1 165 ? 81.664  57.068  115.185 1.00 60.34 ? 165 GLY B N     1 
ATOM   6253  C  CA    . GLY B  1 165 ? 80.333  56.511  115.024 1.00 60.34 ? 165 GLY B CA    1 
ATOM   6254  C  C     . GLY B  1 165 ? 79.611  56.166  116.309 1.00 60.34 ? 165 GLY B C     1 
ATOM   6255  O  O     . GLY B  1 165 ? 78.945  55.126  116.378 1.00 60.34 ? 165 GLY B O     1 
ATOM   6256  N  N     . ILE B  1 166 ? 79.722  57.009  117.328 1.00 61.96 ? 166 ILE B N     1 
ATOM   6257  C  CA    . ILE B  1 166 ? 78.972  56.856  118.567 1.00 61.96 ? 166 ILE B CA    1 
ATOM   6258  C  C     . ILE B  1 166 ? 77.882  57.915  118.683 1.00 61.96 ? 166 ILE B C     1 
ATOM   6259  O  O     . ILE B  1 166 ? 76.717  57.597  118.920 1.00 61.96 ? 166 ILE B O     1 
ATOM   6260  C  CB    . ILE B  1 166 ? 79.911  56.888  119.792 1.00 61.96 ? 166 ILE B CB    1 
ATOM   6261  C  CG1   . ILE B  1 166 ? 81.035  55.867  119.622 1.00 61.96 ? 166 ILE B CG1   1 
ATOM   6262  C  CG2   . ILE B  1 166 ? 79.130  56.615  121.064 1.00 61.96 ? 166 ILE B CG2   1 
ATOM   6263  C  CD1   . ILE B  1 166 ? 81.970  55.776  120.808 1.00 61.96 ? 166 ILE B CD1   1 
ATOM   6264  N  N     . VAL B  1 167 ? 78.245  59.182  118.518 1.00 54.27 ? 167 VAL B N     1 
ATOM   6265  C  CA    . VAL B  1 167 ? 77.272  60.257  118.369 1.00 54.27 ? 167 VAL B CA    1 
ATOM   6266  C  C     . VAL B  1 167 ? 76.970  60.373  116.881 1.00 54.27 ? 167 VAL B C     1 
ATOM   6267  O  O     . VAL B  1 167 ? 77.860  60.674  116.081 1.00 54.27 ? 167 VAL B O     1 
ATOM   6268  C  CB    . VAL B  1 167 ? 77.794  61.580  118.940 1.00 54.27 ? 167 VAL B CB    1 
ATOM   6269  C  CG1   . VAL B  1 167 ? 76.914  62.729  118.497 1.00 54.27 ? 167 VAL B CG1   1 
ATOM   6270  C  CG2   . VAL B  1 167 ? 77.845  61.519  120.450 1.00 54.27 ? 167 VAL B CG2   1 
ATOM   6271  N  N     . ILE B  1 168 ? 75.719  60.110  116.502 1.00 49.54 ? 168 ILE B N     1 
ATOM   6272  C  CA    . ILE B  1 168 ? 75.358  60.135  115.089 1.00 49.54 ? 168 ILE B CA    1 
ATOM   6273  C  C     . ILE B  1 168 ? 75.253  61.570  114.591 1.00 49.54 ? 168 ILE B C     1 
ATOM   6274  O  O     . ILE B  1 168 ? 75.910  61.954  113.617 1.00 49.54 ? 168 ILE B O     1 
ATOM   6275  C  CB    . ILE B  1 168 ? 74.053  59.356  114.851 1.00 49.54 ? 168 ILE B CB    1 
ATOM   6276  C  CG1   . ILE B  1 168 ? 74.240  57.886  115.232 1.00 49.54 ? 168 ILE B CG1   1 
ATOM   6277  C  CG2   . ILE B  1 168 ? 73.596  59.506  113.409 1.00 49.54 ? 168 ILE B CG2   1 
ATOM   6278  C  CD1   . ILE B  1 168 ? 75.064  57.088  114.244 1.00 49.54 ? 168 ILE B CD1   1 
ATOM   6279  N  N     . GLN B  1 169 ? 74.434  62.385  115.252 1.00 41.93 ? 169 GLN B N     1 
ATOM   6280  C  CA    . GLN B  1 169 ? 74.282  63.771  114.842 1.00 41.93 ? 169 GLN B CA    1 
ATOM   6281  C  C     . GLN B  1 169 ? 73.919  64.637  116.038 1.00 41.93 ? 169 GLN B C     1 
ATOM   6282  O  O     . GLN B  1 169 ? 73.253  64.194  116.979 1.00 41.93 ? 169 GLN B O     1 
ATOM   6283  C  CB    . GLN B  1 169 ? 73.225  63.924  113.744 1.00 41.93 ? 169 GLN B CB    1 
ATOM   6284  C  CG    . GLN B  1 169 ? 71.881  63.321  114.082 1.00 41.93 ? 169 GLN B CG    1 
ATOM   6285  C  CD    . GLN B  1 169 ? 71.019  63.118  112.857 1.00 41.93 ? 169 GLN B CD    1 
ATOM   6286  O  OE1   . GLN B  1 169 ? 71.243  63.737  111.819 1.00 41.93 ? 169 GLN B OE1   1 
ATOM   6287  N  NE2   . GLN B  1 169 ? 70.028  62.243  112.968 1.00 41.93 ? 169 GLN B NE2   1 
ATOM   6288  N  N     . VAL B  1 170 ? 74.368  65.885  115.979 1.00 33.98 ? 170 VAL B N     1 
ATOM   6289  C  CA    . VAL B  1 170 ? 74.050  66.911  116.960 1.00 33.98 ? 170 VAL B CA    1 
ATOM   6290  C  C     . VAL B  1 170 ? 73.344  68.021  116.198 1.00 33.98 ? 170 VAL B C     1 
ATOM   6291  O  O     . VAL B  1 170 ? 73.957  68.689  115.357 1.00 33.98 ? 170 VAL B O     1 
ATOM   6292  C  CB    . VAL B  1 170 ? 75.305  67.431  117.672 1.00 33.98 ? 170 VAL B CB    1 
ATOM   6293  C  CG1   . VAL B  1 170 ? 74.995  68.670  118.479 1.00 33.98 ? 170 VAL B CG1   1 
ATOM   6294  C  CG2   . VAL B  1 170 ? 75.885  66.356  118.561 1.00 33.98 ? 170 VAL B CG2   1 
ATOM   6295  N  N     . PHE B  1 171 ? 72.052  68.205  116.462 1.00 33.26 ? 171 PHE B N     1 
ATOM   6296  C  CA    . PHE B  1 171 ? 71.312  69.187  115.686 1.00 33.26 ? 171 PHE B CA    1 
ATOM   6297  C  C     . PHE B  1 171 ? 70.431  70.041  116.586 1.00 33.26 ? 171 PHE B C     1 
ATOM   6298  O  O     . PHE B  1 171 ? 69.877  69.541  117.566 1.00 33.26 ? 171 PHE B O     1 
ATOM   6299  C  CB    . PHE B  1 171 ? 70.455  68.513  114.595 1.00 33.26 ? 171 PHE B CB    1 
ATOM   6300  C  CG    . PHE B  1 171 ? 69.428  67.539  115.112 1.00 33.26 ? 171 PHE B CG    1 
ATOM   6301  C  CD1   . PHE B  1 171 ? 69.756  66.210  115.319 1.00 33.26 ? 171 PHE B CD1   1 
ATOM   6302  C  CD2   . PHE B  1 171 ? 68.120  67.940  115.333 1.00 33.26 ? 171 PHE B CD2   1 
ATOM   6303  C  CE1   . PHE B  1 171 ? 68.813  65.312  115.774 1.00 33.26 ? 171 PHE B CE1   1 
ATOM   6304  C  CE2   . PHE B  1 171 ? 67.175  67.047  115.789 1.00 33.26 ? 171 PHE B CE2   1 
ATOM   6305  C  CZ    . PHE B  1 171 ? 67.522  65.732  116.005 1.00 33.26 ? 171 PHE B CZ    1 
ATOM   6306  N  N     . PRO B  1 172 ? 70.284  71.324  116.285 1.00 31.50 ? 172 PRO B N     1 
ATOM   6307  C  CA    . PRO B  1 172 ? 69.384  72.168  117.069 1.00 31.50 ? 172 PRO B CA    1 
ATOM   6308  C  C     . PRO B  1 172 ? 67.933  71.934  116.674 1.00 31.50 ? 172 PRO B C     1 
ATOM   6309  O  O     . PRO B  1 172 ? 67.625  71.307  115.661 1.00 31.50 ? 172 PRO B O     1 
ATOM   6310  C  CB    . PRO B  1 172 ? 69.839  73.583  116.718 1.00 31.50 ? 172 PRO B CB    1 
ATOM   6311  C  CG    . PRO B  1 172 ? 70.399  73.463  115.378 1.00 31.50 ? 172 PRO B CG    1 
ATOM   6312  C  CD    . PRO B  1 172 ? 71.001  72.098  115.260 1.00 31.50 ? 172 PRO B CD    1 
ATOM   6313  N  N     . LEU B  1 173 ? 67.036  72.455  117.503 1.00 36.54 ? 173 LEU B N     1 
ATOM   6314  C  CA    . LEU B  1 173 ? 65.607  72.230  117.350 1.00 36.54 ? 173 LEU B CA    1 
ATOM   6315  C  C     . LEU B  1 173 ? 64.933  73.432  116.705 1.00 36.54 ? 173 LEU B C     1 
ATOM   6316  O  O     . LEU B  1 173 ? 65.247  74.581  117.027 1.00 36.54 ? 173 LEU B O     1 
ATOM   6317  C  CB    . LEU B  1 173 ? 64.955  71.949  118.704 1.00 36.54 ? 173 LEU B CB    1 
ATOM   6318  C  CG    . LEU B  1 173 ? 64.858  70.494  119.155 1.00 36.54 ? 173 LEU B CG    1 
ATOM   6319  C  CD1   . LEU B  1 173 ? 63.951  70.377  120.363 1.00 36.54 ? 173 LEU B CD1   1 
ATOM   6320  C  CD2   . LEU B  1 173 ? 64.362  69.607  118.031 1.00 36.54 ? 173 LEU B CD2   1 
ATOM   6321  N  N     . HIS B  1 174 ? 64.004  73.158  115.795 1.00 38.14 ? 174 HIS B N     1 
ATOM   6322  C  CA    . HIS B  1 174 ? 63.160  74.209  115.247 1.00 38.14 ? 174 HIS B CA    1 
ATOM   6323  C  C     . HIS B  1 174 ? 62.161  74.672  116.295 1.00 38.14 ? 174 HIS B C     1 
ATOM   6324  O  O     . HIS B  1 174 ? 61.700  73.887  117.127 1.00 38.14 ? 174 HIS B O     1 
ATOM   6325  C  CB    . HIS B  1 174 ? 62.410  73.711  114.014 1.00 38.14 ? 174 HIS B CB    1 
ATOM   6326  C  CG    . HIS B  1 174 ? 63.113  73.978  112.722 1.00 38.14 ? 174 HIS B CG    1 
ATOM   6327  N  ND1   . HIS B  1 174 ? 63.221  75.240  112.181 1.00 38.14 ? 174 HIS B ND1   1 
ATOM   6328  C  CD2   . HIS B  1 174 ? 63.726  73.142  111.853 1.00 38.14 ? 174 HIS B CD2   1 
ATOM   6329  C  CE1   . HIS B  1 174 ? 63.880  75.171  111.039 1.00 38.14 ? 174 HIS B CE1   1 
ATOM   6330  N  NE2   . HIS B  1 174 ? 64.197  73.909  110.816 1.00 38.14 ? 174 HIS B NE2   1 
ATOM   6331  N  N     . ASP B  1 175 ? 61.825  75.956  116.254 1.00 44.55 ? 175 ASP B N     1 
ATOM   6332  C  CA    . ASP B  1 175 ? 60.791  76.520  117.112 1.00 44.55 ? 175 ASP B CA    1 
ATOM   6333  C  C     . ASP B  1 175 ? 59.555  76.731  116.249 1.00 44.55 ? 175 ASP B C     1 
ATOM   6334  O  O     . ASP B  1 175 ? 59.516  77.649  115.425 1.00 44.55 ? 175 ASP B O     1 
ATOM   6335  C  CB    . ASP B  1 175 ? 61.258  77.825  117.752 1.00 44.55 ? 175 ASP B CB    1 
ATOM   6336  C  CG    . ASP B  1 175 ? 60.285  78.349  118.789 1.00 44.55 ? 175 ASP B CG    1 
ATOM   6337  O  OD1   . ASP B  1 175 ? 60.374  79.542  119.143 1.00 44.55 ? 175 ASP B OD1   1 
ATOM   6338  O  OD2   . ASP B  1 175 ? 59.435  77.566  119.261 1.00 44.55 ? 175 ASP B OD2   1 
ATOM   6339  N  N     . SER B  1 176 ? 58.545  75.888  116.446 1.00 49.93 ? 176 SER B N     1 
ATOM   6340  C  CA    . SER B  1 176 ? 57.376  75.851  115.575 1.00 49.93 ? 176 SER B CA    1 
ATOM   6341  C  C     . SER B  1 176 ? 56.442  77.042  115.752 1.00 49.93 ? 176 SER B C     1 
ATOM   6342  O  O     . SER B  1 176 ? 55.513  77.197  114.953 1.00 49.93 ? 176 SER B O     1 
ATOM   6343  C  CB    . SER B  1 176 ? 56.601  74.553  115.804 1.00 49.93 ? 176 SER B CB    1 
ATOM   6344  O  OG    . SER B  1 176 ? 56.065  74.504  117.114 1.00 49.93 ? 176 SER B OG    1 
ATOM   6345  N  N     . GLU B  1 177 ? 56.654  77.883  116.763 1.00 51.57 ? 177 GLU B N     1 
ATOM   6346  C  CA    . GLU B  1 177 ? 55.842  79.072  116.956 1.00 51.57 ? 177 GLU B CA    1 
ATOM   6347  C  C     . GLU B  1 177 ? 56.556  80.360  116.582 1.00 51.57 ? 177 GLU B C     1 
ATOM   6348  O  O     . GLU B  1 177 ? 55.893  81.392  116.441 1.00 51.57 ? 177 GLU B O     1 
ATOM   6349  C  CB    . GLU B  1 177 ? 55.365  79.167  118.412 1.00 51.57 ? 177 GLU B CB    1 
ATOM   6350  C  CG    . GLU B  1 177 ? 54.577  77.957  118.877 1.00 51.57 ? 177 GLU B CG    1 
ATOM   6351  C  CD    . GLU B  1 177 ? 54.698  77.723  120.367 1.00 51.57 ? 177 GLU B CD    1 
ATOM   6352  O  OE1   . GLU B  1 177 ? 55.756  78.066  120.938 1.00 51.57 ? 177 GLU B OE1   1 
ATOM   6353  O  OE2   . GLU B  1 177 ? 53.737  77.198  120.968 1.00 51.57 ? 177 GLU B OE2   1 
ATOM   6354  N  N     . ALA B  1 178 ? 57.879  80.338  116.428 1.00 44.29 ? 178 ALA B N     1 
ATOM   6355  C  CA    . ALA B  1 178 ? 58.605  81.479  115.892 1.00 44.29 ? 178 ALA B CA    1 
ATOM   6356  C  C     . ALA B  1 178 ? 58.962  81.309  114.426 1.00 44.29 ? 178 ALA B C     1 
ATOM   6357  O  O     . ALA B  1 178 ? 59.353  82.287  113.781 1.00 44.29 ? 178 ALA B O     1 
ATOM   6358  C  CB    . ALA B  1 178 ? 59.887  81.728  116.693 1.00 44.29 ? 178 ALA B CB    1 
ATOM   6359  N  N     . LEU B  1 179 ? 58.844  80.093  113.894 1.00 41.17 ? 179 LEU B N     1 
ATOM   6360  C  CA    . LEU B  1 179 ? 59.057  79.883  112.468 1.00 41.17 ? 179 LEU B CA    1 
ATOM   6361  C  C     . LEU B  1 179 ? 57.838  80.317  111.667 1.00 41.17 ? 179 LEU B C     1 
ATOM   6362  O  O     . LEU B  1 179 ? 57.970  80.787  110.532 1.00 41.17 ? 179 LEU B O     1 
ATOM   6363  C  CB    . LEU B  1 179 ? 59.389  78.415  112.206 1.00 41.17 ? 179 LEU B CB    1 
ATOM   6364  C  CG    . LEU B  1 179 ? 59.787  78.024  110.788 1.00 41.17 ? 179 LEU B CG    1 
ATOM   6365  C  CD1   . LEU B  1 179 ? 60.921  78.907  110.318 1.00 41.17 ? 179 LEU B CD1   1 
ATOM   6366  C  CD2   . LEU B  1 179 ? 60.185  76.564  110.741 1.00 41.17 ? 179 LEU B CD2   1 
ATOM   6367  N  N     . LYS B  1 180 ? 56.644  80.175  112.247 1.00 47.67 ? 180 LYS B N     1 
ATOM   6368  C  CA    . LYS B  1 180 ? 55.418  80.589  111.571 1.00 47.67 ? 180 LYS B CA    1 
ATOM   6369  C  C     . LYS B  1 180 ? 55.340  82.108  111.464 1.00 47.67 ? 180 LYS B C     1 
ATOM   6370  O  O     . LYS B  1 180 ? 54.943  82.648  110.422 1.00 47.67 ? 180 LYS B O     1 
ATOM   6371  C  CB    . LYS B  1 180 ? 54.212  80.033  112.331 1.00 47.67 ? 180 LYS B CB    1 
ATOM   6372  C  CG    . LYS B  1 180 ? 52.834  80.408  111.800 1.00 47.67 ? 180 LYS B CG    1 
ATOM   6373  C  CD    . LYS B  1 180 ? 52.674  80.158  110.310 1.00 47.67 ? 180 LYS B CD    1 
ATOM   6374  C  CE    . LYS B  1 180 ? 51.281  80.567  109.841 1.00 47.67 ? 180 LYS B CE    1 
ATOM   6375  N  NZ    . LYS B  1 180 ? 50.198  80.067  110.730 1.00 47.67 ? 180 LYS B NZ    1 
ATOM   6376  N  N     . LYS B  1 181 ? 55.744  82.813  112.519 1.00 46.17 ? 181 LYS B N     1 
ATOM   6377  C  CA    . LYS B  1 181 ? 55.768  84.267  112.501 1.00 46.17 ? 181 LYS B CA    1 
ATOM   6378  C  C     . LYS B  1 181 ? 56.897  84.828  111.650 1.00 46.17 ? 181 LYS B C     1 
ATOM   6379  O  O     . LYS B  1 181 ? 56.864  86.014  111.313 1.00 46.17 ? 181 LYS B O     1 
ATOM   6380  C  CB    . LYS B  1 181 ? 55.871  84.800  113.929 1.00 46.17 ? 181 LYS B CB    1 
ATOM   6381  C  CG    . LYS B  1 181 ? 54.851  84.176  114.863 1.00 46.17 ? 181 LYS B CG    1 
ATOM   6382  C  CD    . LYS B  1 181 ? 54.839  84.847  116.221 1.00 46.17 ? 181 LYS B CD    1 
ATOM   6383  C  CE    . LYS B  1 181 ? 54.000  84.053  117.208 1.00 46.17 ? 181 LYS B CE    1 
ATOM   6384  N  NZ    . LYS B  1 181 ? 52.816  83.440  116.547 1.00 46.17 ? 181 LYS B NZ    1 
ATOM   6385  N  N     . LEU B  1 182 ? 57.893  84.012  111.304 1.00 40.25 ? 182 LEU B N     1 
ATOM   6386  C  CA    . LEU B  1 182 ? 58.868  84.414  110.298 1.00 40.25 ? 182 LEU B CA    1 
ATOM   6387  C  C     . LEU B  1 182 ? 58.328  84.145  108.900 1.00 40.25 ? 182 LEU B C     1 
ATOM   6388  O  O     . LEU B  1 182 ? 58.508  84.952  107.983 1.00 40.25 ? 182 LEU B O     1 
ATOM   6389  C  CB    . LEU B  1 182 ? 60.189  83.678  110.528 1.00 40.25 ? 182 LEU B CB    1 
ATOM   6390  C  CG    . LEU B  1 182 ? 61.251  83.767  109.432 1.00 40.25 ? 182 LEU B CG    1 
ATOM   6391  C  CD1   . LEU B  1 182 ? 61.738  85.186  109.275 1.00 40.25 ? 182 LEU B CD1   1 
ATOM   6392  C  CD2   . LEU B  1 182 ? 62.408  82.841  109.736 1.00 40.25 ? 182 LEU B CD2   1 
ATOM   6393  N  N     . GLU B  1 183 ? 57.634  83.015  108.732 1.00 44.11 ? 183 GLU B N     1 
ATOM   6394  C  CA    . GLU B  1 183 ? 57.092  82.630  107.433 1.00 44.11 ? 183 GLU B CA    1 
ATOM   6395  C  C     . GLU B  1 183 ? 55.969  83.550  106.978 1.00 44.11 ? 183 GLU B C     1 
ATOM   6396  O  O     . GLU B  1 183 ? 55.716  83.659  105.773 1.00 44.11 ? 183 GLU B O     1 
ATOM   6397  C  CB    . GLU B  1 183 ? 56.578  81.194  107.484 1.00 44.11 ? 183 GLU B CB    1 
ATOM   6398  C  CG    . GLU B  1 183 ? 57.605  80.142  107.162 1.00 44.11 ? 183 GLU B CG    1 
ATOM   6399  C  CD    . GLU B  1 183 ? 56.986  78.770  107.008 1.00 44.11 ? 183 GLU B CD    1 
ATOM   6400  O  OE1   . GLU B  1 183 ? 55.896  78.672  106.407 1.00 44.11 ? 183 GLU B OE1   1 
ATOM   6401  O  OE2   . GLU B  1 183 ? 57.582  77.789  107.495 1.00 44.11 ? 183 GLU B OE2   1 
ATOM   6402  N  N     . ASP B  1 184 ? 55.270  84.191  107.918 1.00 47.42 ? 184 ASP B N     1 
ATOM   6403  C  CA    . ASP B  1 184 ? 54.196  85.106  107.538 1.00 47.42 ? 184 ASP B CA    1 
ATOM   6404  C  C     . ASP B  1 184 ? 54.741  86.356  106.856 1.00 47.42 ? 184 ASP B C     1 
ATOM   6405  O  O     . ASP B  1 184 ? 54.060  86.971  106.028 1.00 47.42 ? 184 ASP B O     1 
ATOM   6406  C  CB    . ASP B  1 184 ? 53.366  85.483  108.762 1.00 47.42 ? 184 ASP B CB    1 
ATOM   6407  C  CG    . ASP B  1 184 ? 52.537  84.330  109.271 1.00 47.42 ? 184 ASP B CG    1 
ATOM   6408  O  OD1   . ASP B  1 184 ? 51.991  84.430  110.390 1.00 47.42 ? 184 ASP B OD1   1 
ATOM   6409  O  OD2   . ASP B  1 184 ? 52.435  83.323  108.543 1.00 47.42 ? 184 ASP B OD2   1 
ATOM   6410  N  N     . THR B  1 185 ? 55.966  86.749  107.192 1.00 42.56 ? 185 THR B N     1 
ATOM   6411  C  CA    . THR B  1 185 ? 56.575  87.941  106.622 1.00 42.56 ? 185 THR B CA    1 
ATOM   6412  C  C     . THR B  1 185 ? 57.722  87.633  105.670 1.00 42.56 ? 185 THR B C     1 
ATOM   6413  O  O     . THR B  1 185 ? 58.476  88.545  105.321 1.00 42.56 ? 185 THR B O     1 
ATOM   6414  C  CB    . THR B  1 185 ? 57.081  88.864  107.735 1.00 42.56 ? 185 THR B CB    1 
ATOM   6415  O  OG1   . THR B  1 185 ? 58.349  88.394  108.205 1.00 42.56 ? 185 THR B OG1   1 
ATOM   6416  C  CG2   . THR B  1 185 ? 56.099  88.900  108.896 1.00 42.56 ? 185 THR B CG2   1 
ATOM   6417  N  N     . TRP B  1 186 ? 57.864  86.385  105.225 1.00 35.36 ? 186 TRP B N     1 
ATOM   6418  C  CA    . TRP B  1 186 ? 58.994  86.010  104.383 1.00 35.36 ? 186 TRP B CA    1 
ATOM   6419  C  C     . TRP B  1 186 ? 58.556  85.734  102.954 1.00 35.36 ? 186 TRP B C     1 
ATOM   6420  O  O     . TRP B  1 186 ? 59.196  86.195  102.005 1.00 35.36 ? 186 TRP B O     1 
ATOM   6421  C  CB    . TRP B  1 186 ? 59.698  84.780  104.955 1.00 35.36 ? 186 TRP B CB    1 
ATOM   6422  C  CG    . TRP B  1 186 ? 61.121  84.637  104.540 1.00 35.36 ? 186 TRP B CG    1 
ATOM   6423  C  CD1   . TRP B  1 186 ? 61.787  85.394  103.630 1.00 35.36 ? 186 TRP B CD1   1 
ATOM   6424  C  CD2   . TRP B  1 186 ? 62.064  83.682  105.035 1.00 35.36 ? 186 TRP B CD2   1 
ATOM   6425  N  NE1   . TRP B  1 186 ? 63.080  84.965  103.517 1.00 35.36 ? 186 TRP B NE1   1 
ATOM   6426  C  CE2   . TRP B  1 186 ? 63.278  83.916  104.373 1.00 35.36 ? 186 TRP B CE2   1 
ATOM   6427  C  CE3   . TRP B  1 186 ? 61.998  82.649  105.972 1.00 35.36 ? 186 TRP B CE3   1 
ATOM   6428  C  CZ2   . TRP B  1 186 ? 64.417  83.160  104.616 1.00 35.36 ? 186 TRP B CZ2   1 
ATOM   6429  C  CZ3   . TRP B  1 186 ? 63.130  81.901  106.212 1.00 35.36 ? 186 TRP B CZ3   1 
ATOM   6430  C  CH2   . TRP B  1 186 ? 64.322  82.158  105.537 1.00 35.36 ? 186 TRP B CH2   1 
ATOM   6431  N  N     . TYR B  1 187 ? 57.476  84.977  102.790 1.00 43.61 ? 187 TYR B N     1 
ATOM   6432  C  CA    . TYR B  1 187 ? 57.017  84.567  101.469 1.00 43.61 ? 187 TYR B CA    1 
ATOM   6433  C  C     . TYR B  1 187 ? 56.360  85.751  100.773 1.00 43.61 ? 187 TYR B C     1 
ATOM   6434  O  O     . TYR B  1 187 ? 55.207  86.088  101.057 1.00 43.61 ? 187 TYR B O     1 
ATOM   6435  C  CB    . TYR B  1 187 ? 56.054  83.393  101.588 1.00 43.61 ? 187 TYR B CB    1 
ATOM   6436  C  CG    . TYR B  1 187 ? 56.701  82.147  102.135 1.00 43.61 ? 187 TYR B CG    1 
ATOM   6437  C  CD1   . TYR B  1 187 ? 58.028  81.854  101.857 1.00 43.61 ? 187 TYR B CD1   1 
ATOM   6438  C  CD2   . TYR B  1 187 ? 55.988  81.266  102.934 1.00 43.61 ? 187 TYR B CD2   1 
ATOM   6439  C  CE1   . TYR B  1 187 ? 58.625  80.718  102.356 1.00 43.61 ? 187 TYR B CE1   1 
ATOM   6440  C  CE2   . TYR B  1 187 ? 56.577  80.127  103.439 1.00 43.61 ? 187 TYR B CE2   1 
ATOM   6441  C  CZ    . TYR B  1 187 ? 57.896  79.860  103.145 1.00 43.61 ? 187 TYR B CZ    1 
ATOM   6442  O  OH    . TYR B  1 187 ? 58.489  78.726  103.645 1.00 43.61 ? 187 TYR B OH    1 
ATOM   6443  N  N     . THR B  1 188 ? 57.089  86.381  99.858  1.00 51.36 ? 188 THR B N     1 
ATOM   6444  C  CA    . THR B  1 188 ? 56.565  87.494  99.067  1.00 51.36 ? 188 THR B CA    1 
ATOM   6445  C  C     . THR B  1 188 ? 55.836  86.971  97.831  1.00 51.36 ? 188 THR B C     1 
ATOM   6446  O  O     . THR B  1 188 ? 56.224  87.222  96.691  1.00 51.36 ? 188 THR B O     1 
ATOM   6447  C  CB    . THR B  1 188 ? 57.694  88.443  98.676  1.00 51.36 ? 188 THR B CB    1 
ATOM   6448  O  OG1   . THR B  1 188 ? 58.441  87.876  97.592  1.00 51.36 ? 188 THR B OG1   1 
ATOM   6449  C  CG2   . THR B  1 188 ? 58.627  88.680  99.852  1.00 51.36 ? 188 THR B CG2   1 
ATOM   6450  N  N     . ARG B  1 189 ? 54.760  86.224  98.078  1.00 61.81 ? 189 ARG B N     1 
ATOM   6451  C  CA    . ARG B  1 189 ? 54.021  85.599  96.988  1.00 61.81 ? 189 ARG B CA    1 
ATOM   6452  C  C     . ARG B  1 189 ? 53.164  86.601  96.226  1.00 61.81 ? 189 ARG B C     1 
ATOM   6453  O  O     . ARG B  1 189 ? 52.854  86.375  95.051  1.00 61.81 ? 189 ARG B O     1 
ATOM   6454  C  CB    . ARG B  1 189 ? 53.149  84.465  97.530  1.00 61.81 ? 189 ARG B CB    1 
ATOM   6455  C  CG    . ARG B  1 189 ? 53.934  83.276  98.061  1.00 61.81 ? 189 ARG B CG    1 
ATOM   6456  C  CD    . ARG B  1 189 ? 53.023  82.274  98.755  1.00 61.81 ? 189 ARG B CD    1 
ATOM   6457  N  NE    . ARG B  1 189 ? 52.519  82.784  100.027 1.00 61.81 ? 189 ARG B NE    1 
ATOM   6458  C  CZ    . ARG B  1 189 ? 51.724  82.103  100.845 1.00 61.81 ? 189 ARG B CZ    1 
ATOM   6459  N  NH1   . ARG B  1 189 ? 51.339  80.874  100.529 1.00 61.81 ? 189 ARG B NH1   1 
ATOM   6460  N  NH2   . ARG B  1 189 ? 51.314  82.649  101.981 1.00 61.81 ? 189 ARG B NH2   1 
ATOM   6461  N  N     . PHE B  1 190 ? 52.773  87.701  96.867  1.00 66.11 ? 190 PHE B N     1 
ATOM   6462  C  CA    . PHE B  1 190 ? 51.919  88.687  96.219  1.00 66.11 ? 190 PHE B CA    1 
ATOM   6463  C  C     . PHE B  1 190 ? 52.693  89.528  95.210  1.00 66.11 ? 190 PHE B C     1 
ATOM   6464  O  O     . PHE B  1 190 ? 52.415  89.473  94.008  1.00 66.11 ? 190 PHE B O     1 
ATOM   6465  C  CB    . PHE B  1 190 ? 51.265  89.592  97.266  1.00 66.11 ? 190 PHE B CB    1 
ATOM   6466  N  N     . ALA B  1 191 ? 53.676  90.288  95.684  1.00 61.82 ? 191 ALA B N     1 
ATOM   6467  C  CA    . ALA B  1 191 ? 54.380  91.252  94.848  1.00 61.82 ? 191 ALA B CA    1 
ATOM   6468  C  C     . ALA B  1 191 ? 55.744  91.532  95.467  1.00 61.82 ? 191 ALA B C     1 
ATOM   6469  O  O     . ALA B  1 191 ? 56.230  90.774  96.312  1.00 61.82 ? 191 ALA B O     1 
ATOM   6470  C  CB    . ALA B  1 191 ? 53.552  92.532  94.680  1.00 61.82 ? 191 ALA B CB    1 
ATOM   6471  N  N     . LEU B  1 192 ? 56.367  92.623  95.023  1.00 56.12 ? 192 LEU B N     1 
ATOM   6472  C  CA    . LEU B  1 192 ? 57.675  93.022  95.525  1.00 56.12 ? 192 LEU B CA    1 
ATOM   6473  C  C     . LEU B  1 192 ? 57.577  93.470  96.979  1.00 56.12 ? 192 LEU B C     1 
ATOM   6474  O  O     . LEU B  1 192 ? 56.635  94.165  97.371  1.00 56.12 ? 192 LEU B O     1 
ATOM   6475  C  CB    . LEU B  1 192 ? 58.245  94.145  94.655  1.00 56.12 ? 192 LEU B CB    1 
ATOM   6476  C  CG    . LEU B  1 192 ? 59.725  94.526  94.754  1.00 56.12 ? 192 LEU B CG    1 
ATOM   6477  C  CD1   . LEU B  1 192 ? 60.266  94.822  93.365  1.00 56.12 ? 192 LEU B CD1   1 
ATOM   6478  C  CD2   . LEU B  1 192 ? 59.940  95.729  95.664  1.00 56.12 ? 192 LEU B CD2   1 
ATOM   6479  N  N     . LYS B  1 193 ? 58.568  93.070  97.778  1.00 51.36 ? 193 LYS B N     1 
ATOM   6480  C  CA    . LYS B  1 193 ? 58.565  93.314  99.216  1.00 51.36 ? 193 LYS B CA    1 
ATOM   6481  C  C     . LYS B  1 193 ? 59.985  93.204  99.758  1.00 51.36 ? 193 LYS B C     1 
ATOM   6482  O  O     . LYS B  1 193 ? 60.729  92.301  99.361  1.00 51.36 ? 193 LYS B O     1 
ATOM   6483  C  CB    . LYS B  1 193 ? 57.630  92.320  99.913  1.00 51.36 ? 193 LYS B CB    1 
ATOM   6484  C  CG    . LYS B  1 193 ? 57.697  92.303  101.428 1.00 51.36 ? 193 LYS B CG    1 
ATOM   6485  C  CD    . LYS B  1 193 ? 56.779  91.234  101.993 1.00 51.36 ? 193 LYS B CD    1 
ATOM   6486  C  CE    . LYS B  1 193 ? 56.789  91.234  103.511 1.00 51.36 ? 193 LYS B CE    1 
ATOM   6487  N  NZ    . LYS B  1 193 ? 58.083  90.746  104.058 1.00 51.36 ? 193 LYS B NZ    1 
ATOM   6488  N  N     . TYR B  1 194 ? 60.379  94.125  100.639 1.00 42.83 ? 194 TYR B N     1 
ATOM   6489  C  CA    . TYR B  1 194 ? 61.710  94.074  101.234 1.00 42.83 ? 194 TYR B CA    1 
ATOM   6490  C  C     . TYR B  1 194 ? 61.823  92.892  102.186 1.00 42.83 ? 194 TYR B C     1 
ATOM   6491  O  O     . TYR B  1 194 ? 60.964  92.685  103.047 1.00 42.83 ? 194 TYR B O     1 
ATOM   6492  C  CB    . TYR B  1 194 ? 62.016  95.374  101.976 1.00 42.83 ? 194 TYR B CB    1 
ATOM   6493  C  CG    . TYR B  1 194 ? 62.240  96.573  101.083 1.00 42.83 ? 194 TYR B CG    1 
ATOM   6494  C  CD1   . TYR B  1 194 ? 62.525  96.418  99.732  1.00 42.83 ? 194 TYR B CD1   1 
ATOM   6495  C  CD2   . TYR B  1 194 ? 62.159  97.862  101.594 1.00 42.83 ? 194 TYR B CD2   1 
ATOM   6496  C  CE1   . TYR B  1 194 ? 62.726  97.514  98.914  1.00 42.83 ? 194 TYR B CE1   1 
ATOM   6497  C  CE2   . TYR B  1 194 ? 62.358  98.965  100.784 1.00 42.83 ? 194 TYR B CE2   1 
ATOM   6498  C  CZ    . TYR B  1 194 ? 62.641  98.783  99.446  1.00 42.83 ? 194 TYR B CZ    1 
ATOM   6499  O  OH    . TYR B  1 194 ? 62.839  99.876  98.635  1.00 42.83 ? 194 TYR B OH    1 
ATOM   6500  N  N     . GLN B  1 195 ? 62.889  92.117  102.023 1.00 34.62 ? 195 GLN B N     1 
ATOM   6501  C  CA    . GLN B  1 195 ? 63.058  90.900  102.793 1.00 34.62 ? 195 GLN B CA    1 
ATOM   6502  C  C     . GLN B  1 195 ? 63.469  91.233  104.228 1.00 34.62 ? 195 GLN B C     1 
ATOM   6503  O  O     . GLN B  1 195 ? 64.332  92.085  104.451 1.00 34.62 ? 195 GLN B O     1 
ATOM   6504  C  CB    . GLN B  1 195 ? 64.112  90.014  102.139 1.00 34.62 ? 195 GLN B CB    1 
ATOM   6505  C  CG    . GLN B  1 195 ? 63.884  88.531  102.303 1.00 34.62 ? 195 GLN B CG    1 
ATOM   6506  C  CD    . GLN B  1 195 ? 64.774  87.720  101.393 1.00 34.62 ? 195 GLN B CD    1 
ATOM   6507  O  OE1   . GLN B  1 195 ? 65.659  88.259  100.739 1.00 34.62 ? 195 GLN B OE1   1 
ATOM   6508  N  NE2   . GLN B  1 195 ? 64.537  86.422  101.334 1.00 34.62 ? 195 GLN B NE2   1 
ATOM   6509  N  N     . PRO B  1 196 ? 62.854  90.585  105.223 1.00 32.98 ? 196 PRO B N     1 
ATOM   6510  C  CA    . PRO B  1 196 ? 63.196  90.864  106.636 1.00 32.98 ? 196 PRO B CA    1 
ATOM   6511  C  C     . PRO B  1 196 ? 64.486  90.182  107.091 1.00 32.98 ? 196 PRO B C     1 
ATOM   6512  O  O     . PRO B  1 196 ? 64.492  89.114  107.699 1.00 32.98 ? 196 PRO B O     1 
ATOM   6513  C  CB    . PRO B  1 196 ? 61.978  90.327  107.388 1.00 32.98 ? 196 PRO B CB    1 
ATOM   6514  C  CG    . PRO B  1 196 ? 61.465  89.234  106.526 1.00 32.98 ? 196 PRO B CG    1 
ATOM   6515  C  CD    . PRO B  1 196 ? 61.731  89.639  105.106 1.00 32.98 ? 196 PRO B CD    1 
ATOM   6516  N  N     . ILE B  1 197 ? 65.615  90.836  106.801 1.00 29.61 ? 197 ILE B N     1 
ATOM   6517  C  CA    . ILE B  1 197 ? 66.924  90.229  107.036 1.00 29.61 ? 197 ILE B CA    1 
ATOM   6518  C  C     . ILE B  1 197 ? 67.231  90.130  108.528 1.00 29.61 ? 197 ILE B C     1 
ATOM   6519  O  O     . ILE B  1 197 ? 67.960  89.228  108.957 1.00 29.61 ? 197 ILE B O     1 
ATOM   6520  C  CB    . ILE B  1 197 ? 68.009  91.021  106.285 1.00 29.61 ? 197 ILE B CB    1 
ATOM   6521  C  CG1   . ILE B  1 197 ? 67.534  91.353  104.876 1.00 29.61 ? 197 ILE B CG1   1 
ATOM   6522  C  CG2   . ILE B  1 197 ? 69.283  90.216  106.163 1.00 29.61 ? 197 ILE B CG2   1 
ATOM   6523  C  CD1   . ILE B  1 197 ? 68.394  92.376  104.175 1.00 29.61 ? 197 ILE B CD1   1 
ATOM   6524  N  N     . ASP B  1 198 ? 66.654  91.009  109.348 1.00 30.97 ? 198 ASP B N     1 
ATOM   6525  C  CA    . ASP B  1 198 ? 66.930  90.951  110.780 1.00 30.97 ? 198 ASP B CA    1 
ATOM   6526  C  C     . ASP B  1 198 ? 66.217  89.784  111.454 1.00 30.97 ? 198 ASP B C     1 
ATOM   6527  O  O     . ASP B  1 198 ? 66.790  89.144  112.342 1.00 30.97 ? 198 ASP B O     1 
ATOM   6528  C  CB    . ASP B  1 198 ? 66.546  92.269  111.444 1.00 30.97 ? 198 ASP B CB    1 
ATOM   6529  C  CG    . ASP B  1 198 ? 67.703  93.246  111.504 1.00 30.97 ? 198 ASP B CG    1 
ATOM   6530  O  OD1   . ASP B  1 198 ? 67.509  94.370  112.009 1.00 30.97 ? 198 ASP B OD1   1 
ATOM   6531  O  OD2   . ASP B  1 198 ? 68.808  92.889  111.045 1.00 30.97 ? 198 ASP B OD2   1 
ATOM   6532  N  N     . SER B  1 199 ? 64.992  89.465  111.035 1.00 30.82 ? 199 SER B N     1 
ATOM   6533  C  CA    . SER B  1 199 ? 64.309  88.312  111.611 1.00 30.82 ? 199 SER B CA    1 
ATOM   6534  C  C     . SER B  1 199 ? 64.881  86.998  111.092 1.00 30.82 ? 199 SER B C     1 
ATOM   6535  O  O     . SER B  1 199 ? 64.968  86.021  111.853 1.00 30.82 ? 199 SER B O     1 
ATOM   6536  C  CB    . SER B  1 199 ? 62.813  88.387  111.323 1.00 30.82 ? 199 SER B CB    1 
ATOM   6537  O  OG    . SER B  1 199 ? 62.146  87.253  111.842 1.00 30.82 ? 199 SER B OG    1 
ATOM   6538  N  N     . ILE B  1 200 ? 65.281  86.969  109.813 1.00 27.53 ? 200 ILE B N     1 
ATOM   6539  C  CA    . ILE B  1 200 ? 66.036  85.847  109.259 1.00 27.53 ? 200 ILE B CA    1 
ATOM   6540  C  C     . ILE B  1 200 ? 67.324  85.638  110.041 1.00 27.53 ? 200 ILE B C     1 
ATOM   6541  O  O     . ILE B  1 200 ? 67.699  84.501  110.343 1.00 27.53 ? 200 ILE B O     1 
ATOM   6542  C  CB    . ILE B  1 200 ? 66.320  86.083  107.762 1.00 27.53 ? 200 ILE B CB    1 
ATOM   6543  C  CG1   . ILE B  1 200 ? 65.044  85.997  106.940 1.00 27.53 ? 200 ILE B CG1   1 
ATOM   6544  C  CG2   . ILE B  1 200 ? 67.293  85.066  107.206 1.00 27.53 ? 200 ILE B CG2   1 
ATOM   6545  C  CD1   . ILE B  1 200 ? 65.196  86.631  105.587 1.00 27.53 ? 200 ILE B CD1   1 
ATOM   6546  N  N     . ARG B  1 201 ? 67.993  86.732  110.420 1.00 26.95 ? 201 ARG B N     1 
ATOM   6547  C  CA    . ARG B  1 201 ? 69.199  86.634  111.234 1.00 26.95 ? 201 ARG B CA    1 
ATOM   6548  C  C     . ARG B  1 201 ? 68.898  86.070  112.612 1.00 26.95 ? 201 ARG B C     1 
ATOM   6549  O  O     . ARG B  1 201 ? 69.547  85.111  113.042 1.00 26.95 ? 201 ARG B O     1 
ATOM   6550  C  CB    . ARG B  1 201 ? 69.866  88.000  111.353 1.00 26.95 ? 201 ARG B CB    1 
ATOM   6551  C  CG    . ARG B  1 201 ? 71.100  87.996  112.228 1.00 26.95 ? 201 ARG B CG    1 
ATOM   6552  C  CD    . ARG B  1 201 ? 70.901  88.837  113.471 1.00 26.95 ? 201 ARG B CD    1 
ATOM   6553  N  NE    . ARG B  1 201 ? 71.978  88.644  114.432 1.00 26.95 ? 201 ARG B NE    1 
ATOM   6554  C  CZ    . ARG B  1 201 ? 71.969  89.140  115.662 1.00 26.95 ? 201 ARG B CZ    1 
ATOM   6555  N  NH1   . ARG B  1 201 ? 70.937  89.861  116.076 1.00 26.95 ? 201 ARG B NH1   1 
ATOM   6556  N  NH2   . ARG B  1 201 ? 72.990  88.919  116.478 1.00 26.95 ? 201 ARG B NH2   1 
ATOM   6557  N  N     . GLY B  1 202 ? 67.875  86.608  113.278 1.00 30.27 ? 202 GLY B N     1 
ATOM   6558  C  CA    . GLY B  1 202 ? 67.562  86.179  114.631 1.00 30.27 ? 202 GLY B CA    1 
ATOM   6559  C  C     . GLY B  1 202 ? 67.062  84.749  114.713 1.00 30.27 ? 202 GLY B C     1 
ATOM   6560  O  O     . GLY B  1 202 ? 67.114  84.127  115.776 1.00 30.27 ? 202 GLY B O     1 
ATOM   6561  N  N     . TYR B  1 203 ? 66.576  84.203  113.599 1.00 29.80 ? 203 TYR B N     1 
ATOM   6562  C  CA    . TYR B  1 203 ? 66.208  82.792  113.607 1.00 29.80 ? 203 TYR B CA    1 
ATOM   6563  C  C     . TYR B  1 203 ? 67.298  81.862  113.082 1.00 29.80 ? 203 TYR B C     1 
ATOM   6564  O  O     . TYR B  1 203 ? 67.443  80.752  113.600 1.00 29.80 ? 203 TYR B O     1 
ATOM   6565  C  CB    . TYR B  1 203 ? 64.928  82.558  112.806 1.00 29.80 ? 203 TYR B CB    1 
ATOM   6566  C  CG    . TYR B  1 203 ? 64.342  81.195  113.065 1.00 29.80 ? 203 TYR B CG    1 
ATOM   6567  C  CD1   . TYR B  1 203 ? 63.702  80.915  114.261 1.00 29.80 ? 203 TYR B CD1   1 
ATOM   6568  C  CD2   . TYR B  1 203 ? 64.451  80.181  112.128 1.00 29.80 ? 203 TYR B CD2   1 
ATOM   6569  C  CE1   . TYR B  1 203 ? 63.174  79.668  114.511 1.00 29.80 ? 203 TYR B CE1   1 
ATOM   6570  C  CE2   . TYR B  1 203 ? 63.928  78.931  112.369 1.00 29.80 ? 203 TYR B CE2   1 
ATOM   6571  C  CZ    . TYR B  1 203 ? 63.291  78.682  113.560 1.00 29.80 ? 203 TYR B CZ    1 
ATOM   6572  O  OH    . TYR B  1 203 ? 62.766  77.436  113.802 1.00 29.80 ? 203 TYR B OH    1 
ATOM   6573  N  N     . PHE B  1 204 ? 68.073  82.265  112.074 1.00 24.48 ? 204 PHE B N     1 
ATOM   6574  C  CA    . PHE B  1 204 ? 68.960  81.353  111.365 1.00 24.48 ? 204 PHE B CA    1 
ATOM   6575  C  C     . PHE B  1 204 ? 70.436  81.693  111.489 1.00 24.48 ? 204 PHE B C     1 
ATOM   6576  O  O     . PHE B  1 204 ? 71.237  81.138  110.732 1.00 24.48 ? 204 PHE B O     1 
ATOM   6577  C  CB    . PHE B  1 204 ? 68.604  81.321  109.875 1.00 24.48 ? 204 PHE B CB    1 
ATOM   6578  C  CG    . PHE B  1 204 ? 67.414  80.478  109.546 1.00 24.48 ? 204 PHE B CG    1 
ATOM   6579  C  CD1   . PHE B  1 204 ? 67.434  79.115  109.763 1.00 24.48 ? 204 PHE B CD1   1 
ATOM   6580  C  CD2   . PHE B  1 204 ? 66.284  81.049  108.992 1.00 24.48 ? 204 PHE B CD2   1 
ATOM   6581  C  CE1   . PHE B  1 204 ? 66.342  78.340  109.451 1.00 24.48 ? 204 PHE B CE1   1 
ATOM   6582  C  CE2   . PHE B  1 204 ? 65.191  80.280  108.679 1.00 24.48 ? 204 PHE B CE2   1 
ATOM   6583  C  CZ    . PHE B  1 204 ? 65.220  78.925  108.909 1.00 24.48 ? 204 PHE B CZ    1 
ATOM   6584  N  N     . GLY B  1 205 ? 70.829  82.579  112.398 1.00 24.30 ? 205 GLY B N     1 
ATOM   6585  C  CA    . GLY B  1 205 ? 72.237  82.890  112.381 1.00 24.30 ? 205 GLY B CA    1 
ATOM   6586  C  C     . GLY B  1 205 ? 72.537  83.948  111.335 1.00 24.30 ? 205 GLY B C     1 
ATOM   6587  O  O     . GLY B  1 205 ? 71.650  84.485  110.677 1.00 24.30 ? 205 GLY B O     1 
ATOM   6588  N  N     . GLU B  1 206 ? 73.824  84.235  111.175 1.00 23.55 ? 206 GLU B N     1 
ATOM   6589  C  CA    . GLU B  1 206 ? 74.240  85.336  110.320 1.00 23.55 ? 206 GLU B CA    1 
ATOM   6590  C  C     . GLU B  1 206 ? 74.640  84.911  108.917 1.00 23.55 ? 206 GLU B C     1 
ATOM   6591  O  O     . GLU B  1 206 ? 74.536  85.723  107.998 1.00 23.55 ? 206 GLU B O     1 
ATOM   6592  C  CB    . GLU B  1 206 ? 75.398  86.097  110.964 1.00 23.55 ? 206 GLU B CB    1 
ATOM   6593  C  CG    . GLU B  1 206 ? 74.947  87.047  112.049 1.00 23.55 ? 206 GLU B CG    1 
ATOM   6594  C  CD    . GLU B  1 206 ? 75.007  86.429  113.428 1.00 23.55 ? 206 GLU B CD    1 
ATOM   6595  O  OE1   . GLU B  1 206 ? 75.565  85.321  113.559 1.00 23.55 ? 206 GLU B OE1   1 
ATOM   6596  O  OE2   . GLU B  1 206 ? 74.496  87.050  114.383 1.00 23.55 ? 206 GLU B OE2   1 
ATOM   6597  N  N     . THR B  1 207 ? 75.064  83.662  108.716 1.00 19.61 ? 207 THR B N     1 
ATOM   6598  C  CA    . THR B  1 207 ? 75.481  83.229  107.383 1.00 19.61 ? 207 THR B CA    1 
ATOM   6599  C  C     . THR B  1 207 ? 74.287  83.094  106.442 1.00 19.61 ? 207 THR B C     1 
ATOM   6600  O  O     . THR B  1 207 ? 74.340  83.553  105.291 1.00 19.61 ? 207 THR B O     1 
ATOM   6601  C  CB    . THR B  1 207 ? 76.244  81.911  107.484 1.00 19.61 ? 207 THR B CB    1 
ATOM   6602  O  OG1   . THR B  1 207 ? 77.385  82.090  108.328 1.00 19.61 ? 207 THR B OG1   1 
ATOM   6603  C  CG2   . THR B  1 207 ? 76.722  81.459  106.120 1.00 19.61 ? 207 THR B CG2   1 
ATOM   6604  N  N     . ILE B  1 208 ? 73.194  82.499  106.923 1.00 18.90 ? 208 ILE B N     1 
ATOM   6605  C  CA    . ILE B  1 208 ? 71.986  82.368  106.114 1.00 18.90 ? 208 ILE B CA    1 
ATOM   6606  C  C     . ILE B  1 208 ? 71.366  83.734  105.854 1.00 18.90 ? 208 ILE B C     1 
ATOM   6607  O  O     . ILE B  1 208 ? 70.846  83.999  104.764 1.00 18.90 ? 208 ILE B O     1 
ATOM   6608  C  CB    . ILE B  1 208 ? 70.987  81.421  106.798 1.00 18.90 ? 208 ILE B CB    1 
ATOM   6609  C  CG1   . ILE B  1 208 ? 71.713  80.217  107.396 1.00 18.90 ? 208 ILE B CG1   1 
ATOM   6610  C  CG2   . ILE B  1 208 ? 69.925  80.975  105.818 1.00 18.90 ? 208 ILE B CG2   1 
ATOM   6611  C  CD1   . ILE B  1 208 ? 72.290  79.279  106.376 1.00 18.90 ? 208 ILE B CD1   1 
ATOM   6612  N  N     . ALA B  1 209 ? 71.437  84.630  106.838 1.00 17.41 ? 209 ALA B N     1 
ATOM   6613  C  CA    . ALA B  1 209 ? 70.921  85.977  106.642 1.00 17.41 ? 209 ALA B CA    1 
ATOM   6614  C  C     . ALA B  1 209 ? 71.776  86.773  105.673 1.00 17.41 ? 209 ALA B C     1 
ATOM   6615  O  O     . ALA B  1 209 ? 71.246  87.590  104.919 1.00 17.41 ? 209 ALA B O     1 
ATOM   6616  C  CB    . ALA B  1 209 ? 70.839  86.710  107.969 1.00 17.41 ? 209 ALA B CB    1 
ATOM   6617  N  N     . LEU B  1 210 ? 73.088  86.539  105.663 1.00 16.27 ? 210 LEU B N     1 
ATOM   6618  C  CA    . LEU B  1 210 ? 73.943  87.211  104.696 1.00 16.27 ? 210 LEU B CA    1 
ATOM   6619  C  C     . LEU B  1 210 ? 73.700  86.681  103.294 1.00 16.27 ? 210 LEU B C     1 
ATOM   6620  O  O     . LEU B  1 210 ? 73.745  87.447  102.325 1.00 16.27 ? 210 LEU B O     1 
ATOM   6621  C  CB    . LEU B  1 210 ? 75.405  87.048  105.087 1.00 16.27 ? 210 LEU B CB    1 
ATOM   6622  C  CG    . LEU B  1 210 ? 76.286  88.246  104.773 1.00 16.27 ? 210 LEU B CG    1 
ATOM   6623  C  CD1   . LEU B  1 210 ? 75.809  89.454  105.535 1.00 16.27 ? 210 LEU B CD1   1 
ATOM   6624  C  CD2   . LEU B  1 210 ? 77.695  87.918  105.153 1.00 16.27 ? 210 LEU B CD2   1 
ATOM   6625  N  N     . TYR B  1 211 ? 73.404  85.383  103.168 1.00 16.14 ? 211 TYR B N     1 
ATOM   6626  C  CA    . TYR B  1 211 ? 73.036  84.851  101.858 1.00 16.14 ? 211 TYR B CA    1 
ATOM   6627  C  C     . TYR B  1 211 ? 71.712  85.429  101.375 1.00 16.14 ? 211 TYR B C     1 
ATOM   6628  O  O     . TYR B  1 211 ? 71.589  85.797  100.203 1.00 16.14 ? 211 TYR B O     1 
ATOM   6629  C  CB    . TYR B  1 211 ? 72.961  83.324  101.879 1.00 16.14 ? 211 TYR B CB    1 
ATOM   6630  C  CG    . TYR B  1 211 ? 72.184  82.779  100.700 1.00 16.14 ? 211 TYR B CG    1 
ATOM   6631  C  CD1   . TYR B  1 211 ? 72.667  82.911  99.404  1.00 16.14 ? 211 TYR B CD1   1 
ATOM   6632  C  CD2   . TYR B  1 211 ? 70.959  82.156  100.880 1.00 16.14 ? 211 TYR B CD2   1 
ATOM   6633  C  CE1   . TYR B  1 211 ? 71.954  82.445  98.331  1.00 16.14 ? 211 TYR B CE1   1 
ATOM   6634  C  CE2   . TYR B  1 211 ? 70.242  81.680  99.807  1.00 16.14 ? 211 TYR B CE2   1 
ATOM   6635  C  CZ    . TYR B  1 211 ? 70.744  81.831  98.537  1.00 16.14 ? 211 TYR B CZ    1 
ATOM   6636  O  OH    . TYR B  1 211 ? 70.041  81.352  97.461  1.00 16.14 ? 211 TYR B OH    1 
ATOM   6637  N  N     . PHE B  1 212 ? 70.711  85.515  102.250 1.00 18.92 ? 212 PHE B N     1 
ATOM   6638  C  CA    . PHE B  1 212 ? 69.424  86.037  101.804 1.00 18.92 ? 212 PHE B CA    1 
ATOM   6639  C  C     . PHE B  1 212 ? 69.481  87.540  101.564 1.00 18.92 ? 212 PHE B C     1 
ATOM   6640  O  O     . PHE B  1 212 ? 68.786  88.046  100.678 1.00 18.92 ? 212 PHE B O     1 
ATOM   6641  C  CB    . PHE B  1 212 ? 68.332  85.677  102.802 1.00 18.92 ? 212 PHE B CB    1 
ATOM   6642  C  CG    . PHE B  1 212 ? 67.742  84.322  102.571 1.00 18.92 ? 212 PHE B CG    1 
ATOM   6643  C  CD1   . PHE B  1 212 ? 66.889  84.103  101.507 1.00 18.92 ? 212 PHE B CD1   1 
ATOM   6644  C  CD2   . PHE B  1 212 ? 68.052  83.265  103.405 1.00 18.92 ? 212 PHE B CD2   1 
ATOM   6645  C  CE1   . PHE B  1 212 ? 66.348  82.858  101.285 1.00 18.92 ? 212 PHE B CE1   1 
ATOM   6646  C  CE2   . PHE B  1 212 ? 67.516  82.018  103.188 1.00 18.92 ? 212 PHE B CE2   1 
ATOM   6647  C  CZ    . PHE B  1 212 ? 66.663  81.815  102.127 1.00 18.92 ? 212 PHE B CZ    1 
ATOM   6648  N  N     . GLY B  1 213 ? 70.344  88.254  102.288 1.00 17.98 ? 213 GLY B N     1 
ATOM   6649  C  CA    . GLY B  1 213 ? 70.577  89.652  101.977 1.00 17.98 ? 213 GLY B CA    1 
ATOM   6650  C  C     . GLY B  1 213 ? 71.297  89.841  100.657 1.00 17.98 ? 213 GLY B C     1 
ATOM   6651  O  O     . GLY B  1 213 ? 70.989  90.766  99.904  1.00 17.98 ? 213 GLY B O     1 
ATOM   6652  N  N     . PHE B  1 214 ? 72.243  88.950  100.341 1.00 15.47 ? 214 PHE B N     1 
ATOM   6653  C  CA    . PHE B  1 214 ? 72.915  89.018  99.049  1.00 15.47 ? 214 PHE B CA    1 
ATOM   6654  C  C     . PHE B  1 214 ? 71.981  88.653  97.909  1.00 15.47 ? 214 PHE B C     1 
ATOM   6655  O  O     . PHE B  1 214 ? 72.088  89.223  96.824  1.00 15.47 ? 214 PHE B O     1 
ATOM   6656  C  CB    . PHE B  1 214 ? 74.133  88.103  99.032  1.00 15.47 ? 214 PHE B CB    1 
ATOM   6657  C  CG    . PHE B  1 214 ? 74.881  88.119  97.735  1.00 15.47 ? 214 PHE B CG    1 
ATOM   6658  C  CD1   . PHE B  1 214 ? 75.591  89.239  97.349  1.00 15.47 ? 214 PHE B CD1   1 
ATOM   6659  C  CD2   . PHE B  1 214 ? 74.878  87.016  96.904  1.00 15.47 ? 214 PHE B CD2   1 
ATOM   6660  C  CE1   . PHE B  1 214 ? 76.283  89.259  96.160  1.00 15.47 ? 214 PHE B CE1   1 
ATOM   6661  C  CE2   . PHE B  1 214 ? 75.567  87.031  95.716  1.00 15.47 ? 214 PHE B CE2   1 
ATOM   6662  C  CZ    . PHE B  1 214 ? 76.270  88.155  95.345  1.00 15.47 ? 214 PHE B CZ    1 
ATOM   6663  N  N     . LEU B  1 215 ? 71.050  87.731  98.138  1.00 17.54 ? 215 LEU B N     1 
ATOM   6664  C  CA    . LEU B  1 215 ? 70.086  87.379  97.101  1.00 17.54 ? 215 LEU B CA    1 
ATOM   6665  C  C     . LEU B  1 215 ? 69.071  88.496  96.889  1.00 17.54 ? 215 LEU B C     1 
ATOM   6666  O  O     . LEU B  1 215 ? 68.686  88.785  95.750  1.00 17.54 ? 215 LEU B O     1 
ATOM   6667  C  CB    . LEU B  1 215 ? 69.392  86.072  97.470  1.00 17.54 ? 215 LEU B CB    1 
ATOM   6668  C  CG    . LEU B  1 215 ? 68.261  85.581  96.578  1.00 17.54 ? 215 LEU B CG    1 
ATOM   6669  C  CD1   . LEU B  1 215 ? 68.758  85.382  95.173  1.00 17.54 ? 215 LEU B CD1   1 
ATOM   6670  C  CD2   . LEU B  1 215 ? 67.694  84.292  97.126  1.00 17.54 ? 215 LEU B CD2   1 
ATOM   6671  N  N     . GLU B  1 216 ? 68.637  89.141  97.975  1.00 22.25 ? 216 GLU B N     1 
ATOM   6672  C  CA    . GLU B  1 216 ? 67.760  90.303  97.867  1.00 22.25 ? 216 GLU B CA    1 
ATOM   6673  C  C     . GLU B  1 216 ? 68.466  91.475  97.198  1.00 22.25 ? 216 GLU B C     1 
ATOM   6674  O  O     . GLU B  1 216 ? 67.838  92.258  96.480  1.00 22.25 ? 216 GLU B O     1 
ATOM   6675  C  CB    . GLU B  1 216 ? 67.257  90.683  99.259  1.00 22.25 ? 216 GLU B CB    1 
ATOM   6676  C  CG    . GLU B  1 216 ? 66.259  91.829  99.343  1.00 22.25 ? 216 GLU B CG    1 
ATOM   6677  C  CD    . GLU B  1 216 ? 66.925  93.160  99.643  1.00 22.25 ? 216 GLU B CD    1 
ATOM   6678  O  OE1   . GLU B  1 216 ? 67.987  93.151  100.299 1.00 22.25 ? 216 GLU B OE1   1 
ATOM   6679  O  OE2   . GLU B  1 216 ? 66.381  94.210  99.241  1.00 22.25 ? 216 GLU B OE2   1 
ATOM   6680  N  N     . TYR B  1 217 ? 69.773  91.611  97.419  1.00 20.37 ? 217 TYR B N     1 
ATOM   6681  C  CA    . TYR B  1 217 ? 70.513  92.674  96.753  1.00 20.37 ? 217 TYR B CA    1 
ATOM   6682  C  C     . TYR B  1 217 ? 70.731  92.361  95.280  1.00 20.37 ? 217 TYR B C     1 
ATOM   6683  O  O     . TYR B  1 217 ? 70.587  93.242  94.428  1.00 20.37 ? 217 TYR B O     1 
ATOM   6684  C  CB    . TYR B  1 217 ? 71.852  92.900  97.446  1.00 20.37 ? 217 TYR B CB    1 
ATOM   6685  C  CG    . TYR B  1 217 ? 72.645  93.986  96.792  1.00 20.37 ? 217 TYR B CG    1 
ATOM   6686  C  CD1   . TYR B  1 217 ? 72.300  95.313  96.977  1.00 20.37 ? 217 TYR B CD1   1 
ATOM   6687  C  CD2   . TYR B  1 217 ? 73.727  93.692  95.974  1.00 20.37 ? 217 TYR B CD2   1 
ATOM   6688  C  CE1   . TYR B  1 217 ? 73.007  96.317  96.373  1.00 20.37 ? 217 TYR B CE1   1 
ATOM   6689  C  CE2   . TYR B  1 217 ? 74.440  94.689  95.362  1.00 20.37 ? 217 TYR B CE2   1 
ATOM   6690  C  CZ    . TYR B  1 217 ? 74.075  95.999  95.568  1.00 20.37 ? 217 TYR B CZ    1 
ATOM   6691  O  OH    . TYR B  1 217 ? 74.778  97.005  94.964  1.00 20.37 ? 217 TYR B OH    1 
ATOM   6692  N  N     . PHE B  1 218 ? 71.086  91.115  94.966  1.00 20.82 ? 218 PHE B N     1 
ATOM   6693  C  CA    . PHE B  1 218 ? 71.364  90.715  93.593  1.00 20.82 ? 218 PHE B CA    1 
ATOM   6694  C  C     . PHE B  1 218 ? 70.098  90.670  92.751  1.00 20.82 ? 218 PHE B C     1 
ATOM   6695  O  O     . PHE B  1 218 ? 70.168  90.790  91.525  1.00 20.82 ? 218 PHE B O     1 
ATOM   6696  C  CB    . PHE B  1 218 ? 72.051  89.354  93.599  1.00 20.82 ? 218 PHE B CB    1 
ATOM   6697  C  CG    . PHE B  1 218 ? 72.702  88.993  92.307  1.00 20.82 ? 218 PHE B CG    1 
ATOM   6698  C  CD1   . PHE B  1 218 ? 73.792  89.705  91.845  1.00 20.82 ? 218 PHE B CD1   1 
ATOM   6699  C  CD2   . PHE B  1 218 ? 72.235  87.924  91.563  1.00 20.82 ? 218 PHE B CD2   1 
ATOM   6700  C  CE1   . PHE B  1 218 ? 74.398  89.366  90.654  1.00 20.82 ? 218 PHE B CE1   1 
ATOM   6701  C  CE2   . PHE B  1 218 ? 72.834  87.580  90.374  1.00 20.82 ? 218 PHE B CE2   1 
ATOM   6702  C  CZ    . PHE B  1 218 ? 73.916  88.301  89.918  1.00 20.82 ? 218 PHE B CZ    1 
ATOM   6703  N  N     . THR B  1 219 ? 68.940  90.488  93.386  1.00 24.01 ? 219 THR B N     1 
ATOM   6704  C  CA    . THR B  1 219 ? 67.683  90.608  92.660  1.00 24.01 ? 219 THR B CA    1 
ATOM   6705  C  C     . THR B  1 219 ? 67.415  92.059  92.283  1.00 24.01 ? 219 THR B C     1 
ATOM   6706  O  O     . THR B  1 219 ? 67.021  92.350  91.149  1.00 24.01 ? 219 THR B O     1 
ATOM   6707  C  CB    . THR B  1 219 ? 66.541  90.055  93.507  1.00 24.01 ? 219 THR B CB    1 
ATOM   6708  O  OG1   . THR B  1 219 ? 66.834  88.705  93.879  1.00 24.01 ? 219 THR B OG1   1 
ATOM   6709  C  CG2   . THR B  1 219 ? 65.251  90.066  92.722  1.00 24.01 ? 219 THR B CG2   1 
ATOM   6710  N  N     . PHE B  1 220 ? 67.654  92.986  93.211  1.00 26.34 ? 220 PHE B N     1 
ATOM   6711  C  CA    . PHE B  1 220 ? 67.449  94.408  92.956  1.00 26.34 ? 220 PHE B CA    1 
ATOM   6712  C  C     . PHE B  1 220 ? 68.652  95.073  92.306  1.00 26.34 ? 220 PHE B C     1 
ATOM   6713  O  O     . PHE B  1 220 ? 68.736  96.304  92.312  1.00 26.34 ? 220 PHE B O     1 
ATOM   6714  C  CB    . PHE B  1 220 ? 67.104  95.148  94.253  1.00 26.34 ? 220 PHE B CB    1 
ATOM   6715  C  CG    . PHE B  1 220 ? 65.787  94.748  94.855  1.00 26.34 ? 220 PHE B CG    1 
ATOM   6716  C  CD1   . PHE B  1 220 ? 64.779  94.211  94.068  1.00 26.34 ? 220 PHE B CD1   1 
ATOM   6717  C  CD2   . PHE B  1 220 ? 65.552  94.929  96.207  1.00 26.34 ? 220 PHE B CD2   1 
ATOM   6718  C  CE1   . PHE B  1 220 ? 63.570  93.843  94.616  1.00 26.34 ? 220 PHE B CE1   1 
ATOM   6719  C  CE2   . PHE B  1 220 ? 64.343  94.568  96.768  1.00 26.34 ? 220 PHE B CE2   1 
ATOM   6720  C  CZ    . PHE B  1 220 ? 63.348  94.024  95.969  1.00 26.34 ? 220 PHE B CZ    1 
ATOM   6721  N  N     . ALA B  1 221 ? 69.586  94.297  91.764  1.00 24.14 ? 221 ALA B N     1 
ATOM   6722  C  CA    . ALA B  1 221 ? 70.715  94.836  91.028  1.00 24.14 ? 221 ALA B CA    1 
ATOM   6723  C  C     . ALA B  1 221 ? 70.740  94.401  89.575  1.00 24.14 ? 221 ALA B C     1 
ATOM   6724  O  O     . ALA B  1 221 ? 71.501  94.972  88.789  1.00 24.14 ? 221 ALA B O     1 
ATOM   6725  C  CB    . ALA B  1 221 ? 72.029  94.422  91.696  1.00 24.14 ? 221 ALA B CB    1 
ATOM   6726  N  N     . LEU B  1 222 ? 69.941  93.406  89.205  1.00 26.26 ? 222 LEU B N     1 
ATOM   6727  C  CA    . LEU B  1 222 ? 69.740  93.028  87.817  1.00 26.26 ? 222 LEU B CA    1 
ATOM   6728  C  C     . LEU B  1 222 ? 68.484  93.649  87.227  1.00 26.26 ? 222 LEU B C     1 
ATOM   6729  O  O     . LEU B  1 222 ? 68.200  93.436  86.045  1.00 26.26 ? 222 LEU B O     1 
ATOM   6730  C  CB    . LEU B  1 222 ? 69.678  91.506  87.689  1.00 26.26 ? 222 LEU B CB    1 
ATOM   6731  C  CG    . LEU B  1 222 ? 70.947  90.758  88.089  1.00 26.26 ? 222 LEU B CG    1 
ATOM   6732  C  CD1   . LEU B  1 222 ? 70.777  89.279  87.849  1.00 26.26 ? 222 LEU B CD1   1 
ATOM   6733  C  CD2   . LEU B  1 222 ? 72.148  91.284  87.327  1.00 26.26 ? 222 LEU B CD2   1 
ATOM   6734  N  N     . ILE B  1 223 ? 67.731  94.406  88.017  1.00 28.94 ? 223 ILE B N     1 
ATOM   6735  C  CA    . ILE B  1 223 ? 66.532  95.087  87.530  1.00 28.94 ? 223 ILE B CA    1 
ATOM   6736  C  C     . ILE B  1 223 ? 66.887  96.244  86.591  1.00 28.94 ? 223 ILE B C     1 
ATOM   6737  O  O     . ILE B  1 223 ? 66.206  96.378  85.567  1.00 28.94 ? 223 ILE B O     1 
ATOM   6738  C  CB    . ILE B  1 223 ? 65.622  95.511  88.703  1.00 28.94 ? 223 ILE B CB    1 
ATOM   6739  C  CG1   . ILE B  1 223 ? 64.977  94.280  89.334  1.00 28.94 ? 223 ILE B CG1   1 
ATOM   6740  C  CG2   . ILE B  1 223 ? 64.535  96.493  88.285  1.00 28.94 ? 223 ILE B CG2   1 
ATOM   6741  C  CD1   . ILE B  1 223 ? 64.166  94.593  90.556  1.00 28.94 ? 223 ILE B CD1   1 
ATOM   6742  N  N     . PRO B  1 224 ? 67.920  97.080  86.823  1.00 30.16 ? 224 PRO B N     1 
ATOM   6743  C  CA    . PRO B  1 224 ? 68.322  97.998  85.740  1.00 30.16 ? 224 PRO B CA    1 
ATOM   6744  C  C     . PRO B  1 224 ? 68.837  97.306  84.489  1.00 30.16 ? 224 PRO B C     1 
ATOM   6745  O  O     . PRO B  1 224 ? 68.553  97.787  83.387  1.00 30.16 ? 224 PRO B O     1 
ATOM   6746  C  CB    . PRO B  1 224 ? 69.408  98.854  86.398  1.00 30.16 ? 224 PRO B CB    1 
ATOM   6747  C  CG    . PRO B  1 224 ? 68.971  98.933  87.780  1.00 30.16 ? 224 PRO B CG    1 
ATOM   6748  C  CD    . PRO B  1 224 ? 68.532  97.533  88.091  1.00 30.16 ? 224 PRO B CD    1 
ATOM   6749  N  N     . MET B  1 225 ? 69.538  96.175  84.621  1.00 33.45 ? 225 MET B N     1 
ATOM   6750  C  CA    . MET B  1 225 ? 69.982  95.429  83.446  1.00 33.45 ? 225 MET B CA    1 
ATOM   6751  C  C     . MET B  1 225 ? 68.801  94.871  82.660  1.00 33.45 ? 225 MET B C     1 
ATOM   6752  O  O     . MET B  1 225 ? 68.784  94.931  81.425  1.00 33.45 ? 225 MET B O     1 
ATOM   6753  C  CB    . MET B  1 225 ? 70.918  94.295  83.862  1.00 33.45 ? 225 MET B CB    1 
ATOM   6754  C  CG    . MET B  1 225 ? 72.312  94.733  84.264  1.00 33.45 ? 225 MET B CG    1 
ATOM   6755  S  SD    . MET B  1 225 ? 73.436  93.330  84.397  1.00 33.45 ? 225 MET B SD    1 
ATOM   6756  C  CE    . MET B  1 225 ? 74.842  94.092  85.198  1.00 33.45 ? 225 MET B CE    1 
ATOM   6757  N  N     . ALA B  1 226 ? 67.788  94.359  83.360  1.00 33.15 ? 226 ALA B N     1 
ATOM   6758  C  CA    . ALA B  1 226 ? 66.626  93.800  82.679  1.00 33.15 ? 226 ALA B CA    1 
ATOM   6759  C  C     . ALA B  1 226 ? 65.746  94.891  82.083  1.00 33.15 ? 226 ALA B C     1 
ATOM   6760  O  O     . ALA B  1 226 ? 65.211  94.727  80.983  1.00 33.15 ? 226 ALA B O     1 
ATOM   6761  C  CB    . ALA B  1 226 ? 65.819  92.935  83.643  1.00 33.15 ? 226 ALA B CB    1 
ATOM   6762  N  N     . VAL B  1 227 ? 65.583  96.009  82.794  1.00 34.07 ? 227 VAL B N     1 
ATOM   6763  C  CA    . VAL B  1 227 ? 64.748  97.103  82.305  1.00 34.07 ? 227 VAL B CA    1 
ATOM   6764  C  C     . VAL B  1 227 ? 65.388  97.831  81.128  1.00 34.07 ? 227 VAL B C     1 
ATOM   6765  O  O     . VAL B  1 227 ? 64.688  98.136  80.157  1.00 34.07 ? 227 VAL B O     1 
ATOM   6766  C  CB    . VAL B  1 227 ? 64.401  98.049  83.471  1.00 34.07 ? 227 VAL B CB    1 
ATOM   6767  C  CG1   . VAL B  1 227 ? 63.836  99.372  82.987  1.00 34.07 ? 227 VAL B CG1   1 
ATOM   6768  C  CG2   . VAL B  1 227 ? 63.360  97.393  84.363  1.00 34.07 ? 227 VAL B CG2   1 
ATOM   6769  N  N     . ILE B  1 228 ? 66.695  98.082  81.150  1.00 35.52 ? 228 ILE B N     1 
ATOM   6770  C  CA    . ILE B  1 228 ? 67.361  98.672  79.993  1.00 35.52 ? 228 ILE B CA    1 
ATOM   6771  C  C     . ILE B  1 228 ? 67.449  97.679  78.839  1.00 35.52 ? 228 ILE B C     1 
ATOM   6772  O  O     . ILE B  1 228 ? 67.199  98.027  77.682  1.00 35.52 ? 228 ILE B O     1 
ATOM   6773  C  CB    . ILE B  1 228 ? 68.752  99.205  80.404  1.00 35.52 ? 228 ILE B CB    1 
ATOM   6774  C  CG1   . ILE B  1 228 ? 68.604  100.364 81.390  1.00 35.52 ? 228 ILE B CG1   1 
ATOM   6775  C  CG2   . ILE B  1 228 ? 69.543  99.678  79.200  1.00 35.52 ? 228 ILE B CG2   1 
ATOM   6776  C  CD1   . ILE B  1 228 ? 67.822  101.533 80.847  1.00 35.52 ? 228 ILE B CD1   1 
ATOM   6777  N  N     . GLY B  1 229 ? 67.744  96.415  79.128  1.00 37.66 ? 229 GLY B N     1 
ATOM   6778  C  CA    . GLY B  1 229 ? 67.929  95.445  78.069  1.00 37.66 ? 229 GLY B CA    1 
ATOM   6779  C  C     . GLY B  1 229 ? 66.666  94.861  77.472  1.00 37.66 ? 229 GLY B C     1 
ATOM   6780  O  O     . GLY B  1 229 ? 66.748  94.060  76.538  1.00 37.66 ? 229 GLY B O     1 
ATOM   6781  N  N     . LEU B  1 230 ? 65.495  95.225  77.990  1.00 40.64 ? 230 LEU B N     1 
ATOM   6782  C  CA    . LEU B  1 230 ? 64.269  94.690  77.401  1.00 40.64 ? 230 LEU B CA    1 
ATOM   6783  C  C     . LEU B  1 230 ? 63.828  95.444  76.139  1.00 40.64 ? 230 LEU B C     1 
ATOM   6784  O  O     . LEU B  1 230 ? 63.459  94.777  75.165  1.00 40.64 ? 230 LEU B O     1 
ATOM   6785  C  CB    . LEU B  1 230 ? 63.143  94.623  78.443  1.00 40.64 ? 230 LEU B CB    1 
ATOM   6786  C  CG    . LEU B  1 230 ? 61.834  93.970  78.003  1.00 40.64 ? 230 LEU B CG    1 
ATOM   6787  C  CD1   . LEU B  1 230 ? 62.090  92.593  77.426  1.00 40.64 ? 230 LEU B CD1   1 
ATOM   6788  C  CD2   . LEU B  1 230 ? 60.868  93.889  79.170  1.00 40.64 ? 230 LEU B CD2   1 
ATOM   6789  N  N     . PRO B  1 231 ? 63.830  96.790  76.064  1.00 45.00 ? 231 PRO B N     1 
ATOM   6790  C  CA    . PRO B  1 231 ? 63.623  97.408  74.748  1.00 45.00 ? 231 PRO B CA    1 
ATOM   6791  C  C     . PRO B  1 231 ? 64.876  97.450  73.900  1.00 45.00 ? 231 PRO B C     1 
ATOM   6792  O  O     . PRO B  1 231 ? 64.772  97.691  72.693  1.00 45.00 ? 231 PRO B O     1 
ATOM   6793  C  CB    . PRO B  1 231 ? 63.140  98.819  75.093  1.00 45.00 ? 231 PRO B CB    1 
ATOM   6794  C  CG    . PRO B  1 231 ? 63.824  99.115  76.325  1.00 45.00 ? 231 PRO B CG    1 
ATOM   6795  C  CD    . PRO B  1 231 ? 63.762  97.839  77.102  1.00 45.00 ? 231 PRO B CD    1 
ATOM   6796  N  N     . TYR B  1 232 ? 66.054  97.233  74.487  1.00 44.33 ? 232 TYR B N     1 
ATOM   6797  C  CA    . TYR B  1 232 ? 67.282  97.190  73.703  1.00 44.33 ? 232 TYR B CA    1 
ATOM   6798  C  C     . TYR B  1 232 ? 67.340  95.967  72.800  1.00 44.33 ? 232 TYR B C     1 
ATOM   6799  O  O     . TYR B  1 232 ? 68.023  96.001  71.773  1.00 44.33 ? 232 TYR B O     1 
ATOM   6800  C  CB    . TYR B  1 232 ? 68.492  97.215  74.636  1.00 44.33 ? 232 TYR B CB    1 
ATOM   6801  C  CG    . TYR B  1 232 ? 69.794  97.577  73.965  1.00 44.33 ? 232 TYR B CG    1 
ATOM   6802  C  CD1   . TYR B  1 232 ? 70.181  98.903  73.833  1.00 44.33 ? 232 TYR B CD1   1 
ATOM   6803  C  CD2   . TYR B  1 232 ? 70.648  96.593  73.485  1.00 44.33 ? 232 TYR B CD2   1 
ATOM   6804  C  CE1   . TYR B  1 232 ? 71.373  99.239  73.228  1.00 44.33 ? 232 TYR B CE1   1 
ATOM   6805  C  CE2   . TYR B  1 232 ? 71.839  96.919  72.877  1.00 44.33 ? 232 TYR B CE2   1 
ATOM   6806  C  CZ    . TYR B  1 232 ? 72.195  98.242  72.751  1.00 44.33 ? 232 TYR B CZ    1 
ATOM   6807  O  OH    . TYR B  1 232 ? 73.385  98.572  72.149  1.00 44.33 ? 232 TYR B OH    1 
ATOM   6808  N  N     . TYR B  1 233 ? 66.634  94.898  73.153  1.00 44.06 ? 233 TYR B N     1 
ATOM   6809  C  CA    . TYR B  1 233 ? 66.573  93.691  72.342  1.00 44.06 ? 233 TYR B CA    1 
ATOM   6810  C  C     . TYR B  1 233 ? 65.324  93.628  71.477  1.00 44.06 ? 233 TYR B C     1 
ATOM   6811  O  O     . TYR B  1 233 ? 65.390  93.156  70.338  1.00 44.06 ? 233 TYR B O     1 
ATOM   6812  C  CB    . TYR B  1 233 ? 66.636  92.454  73.242  1.00 44.06 ? 233 TYR B CB    1 
ATOM   6813  C  CG    . TYR B  1 233 ? 66.330  91.154  72.542  1.00 44.06 ? 233 TYR B CG    1 
ATOM   6814  C  CD1   . TYR B  1 233 ? 67.197  90.637  71.590  1.00 44.06 ? 233 TYR B CD1   1 
ATOM   6815  C  CD2   . TYR B  1 233 ? 65.177  90.441  72.839  1.00 44.06 ? 233 TYR B CD2   1 
ATOM   6816  C  CE1   . TYR B  1 233 ? 66.922  89.446  70.948  1.00 44.06 ? 233 TYR B CE1   1 
ATOM   6817  C  CE2   . TYR B  1 233 ? 64.892  89.251  72.203  1.00 44.06 ? 233 TYR B CE2   1 
ATOM   6818  C  CZ    . TYR B  1 233 ? 65.767  88.757  71.260  1.00 44.06 ? 233 TYR B CZ    1 
ATOM   6819  O  OH    . TYR B  1 233 ? 65.483  87.569  70.626  1.00 44.06 ? 233 TYR B OH    1 
ATOM   6820  N  N     . LEU B  1 234 ? 64.186  94.102  71.987  1.00 48.51 ? 234 LEU B N     1 
ATOM   6821  C  CA    . LEU B  1 234 ? 62.949  94.034  71.217  1.00 48.51 ? 234 LEU B CA    1 
ATOM   6822  C  C     . LEU B  1 234 ? 62.916  95.090  70.121  1.00 48.51 ? 234 LEU B C     1 
ATOM   6823  O  O     . LEU B  1 234 ? 62.647  94.774  68.957  1.00 48.51 ? 234 LEU B O     1 
ATOM   6824  C  CB    . LEU B  1 234 ? 61.745  94.188  72.145  1.00 48.51 ? 234 LEU B CB    1 
ATOM   6825  C  CG    . LEU B  1 234 ? 61.464  93.023  73.093  1.00 48.51 ? 234 LEU B CG    1 
ATOM   6826  C  CD1   . LEU B  1 234 ? 60.249  93.319  73.953  1.00 48.51 ? 234 LEU B CD1   1 
ATOM   6827  C  CD2   . LEU B  1 234 ? 61.272  91.736  72.315  1.00 48.51 ? 234 LEU B CD2   1 
ATOM   6828  N  N     . PHE B  1 235 ? 63.191  96.345  70.468  1.00 51.68 ? 235 PHE B N     1 
ATOM   6829  C  CA    . PHE B  1 235 ? 63.144  97.446  69.514  1.00 51.68 ? 235 PHE B CA    1 
ATOM   6830  C  C     . PHE B  1 235 ? 64.422  97.584  68.702  1.00 51.68 ? 235 PHE B C     1 
ATOM   6831  O  O     . PHE B  1 235 ? 64.478  98.458  67.830  1.00 51.68 ? 235 PHE B O     1 
ATOM   6832  C  CB    . PHE B  1 235 ? 62.865  98.766  70.236  1.00 51.68 ? 235 PHE B CB    1 
ATOM   6833  C  CG    . PHE B  1 235 ? 61.476  98.881  70.788  1.00 51.68 ? 235 PHE B CG    1 
ATOM   6834  C  CD1   . PHE B  1 235 ? 60.442  98.097  70.296  1.00 51.68 ? 235 PHE B CD1   1 
ATOM   6835  C  CD2   . PHE B  1 235 ? 61.204  99.782  71.804  1.00 51.68 ? 235 PHE B CD2   1 
ATOM   6836  C  CE1   . PHE B  1 235 ? 59.166  98.210  70.810  1.00 51.68 ? 235 PHE B CE1   1 
ATOM   6837  C  CE2   . PHE B  1 235 ? 59.932  99.901  72.322  1.00 51.68 ? 235 PHE B CE2   1 
ATOM   6838  C  CZ    . PHE B  1 235 ? 58.911  99.115  71.825  1.00 51.68 ? 235 PHE B CZ    1 
ATOM   6839  N  N     . VAL B  1 236 ? 65.406  96.705  68.939  1.00 52.37 ? 236 VAL B N     1 
ATOM   6840  C  CA    . VAL B  1 236 ? 66.791  96.716  68.450  1.00 52.37 ? 236 VAL B CA    1 
ATOM   6841  C  C     . VAL B  1 236 ? 67.382  98.130  68.355  1.00 52.37 ? 236 VAL B C     1 
ATOM   6842  O  O     . VAL B  1 236 ? 67.374  98.785  67.306  1.00 52.37 ? 236 VAL B O     1 
ATOM   6843  C  CB    . VAL B  1 236 ? 66.932  95.860  67.155  1.00 52.37 ? 236 VAL B CB    1 
ATOM   6844  C  CG1   . VAL B  1 236 ? 66.052  96.287  65.945  1.00 52.37 ? 236 VAL B CG1   1 
ATOM   6845  C  CG2   . VAL B  1 236 ? 68.398  95.723  66.743  1.00 52.37 ? 236 VAL B CG2   1 
ATOM   6846  N  N     . TRP B  1 237 ? 67.877  98.623  69.490  1.00 53.25 ? 237 TRP B N     1 
ATOM   6847  C  CA    . TRP B  1 237 ? 68.563  99.905  69.564  1.00 53.25 ? 237 TRP B CA    1 
ATOM   6848  C  C     . TRP B  1 237 ? 70.064  99.760  69.371  1.00 53.25 ? 237 TRP B C     1 
ATOM   6849  O  O     . TRP B  1 237 ? 70.819  100.685 69.685  1.00 53.25 ? 237 TRP B O     1 
ATOM   6850  C  CB    . TRP B  1 237 ? 68.268  100.596 70.894  1.00 53.25 ? 237 TRP B CB    1 
ATOM   6851  C  CG    . TRP B  1 237 ? 66.870  101.088 71.011  1.00 53.25 ? 237 TRP B CG    1 
ATOM   6852  C  CD1   . TRP B  1 237 ? 65.933  101.134 70.025  1.00 53.25 ? 237 TRP B CD1   1 
ATOM   6853  C  CD2   . TRP B  1 237 ? 66.243  101.608 72.186  1.00 53.25 ? 237 TRP B CD2   1 
ATOM   6854  N  NE1   . TRP B  1 237 ? 64.758  101.648 70.512  1.00 53.25 ? 237 TRP B NE1   1 
ATOM   6855  C  CE2   . TRP B  1 237 ? 64.923  101.947 71.838  1.00 53.25 ? 237 TRP B CE2   1 
ATOM   6856  C  CE3   . TRP B  1 237 ? 66.669  101.818 73.500  1.00 53.25 ? 237 TRP B CE3   1 
ATOM   6857  C  CZ2   . TRP B  1 237 ? 64.025  102.486 72.754  1.00 53.25 ? 237 TRP B CZ2   1 
ATOM   6858  C  CZ3   . TRP B  1 237 ? 65.778  102.352 74.408  1.00 53.25 ? 237 TRP B CZ3   1 
ATOM   6859  C  CH2   . TRP B  1 237 ? 64.471  102.681 74.031  1.00 53.25 ? 237 TRP B CH2   1 
ATOM   6860  N  N     . GLU B  1 238 ? 70.506  98.618  68.856  1.00 56.02 ? 238 GLU B N     1 
ATOM   6861  C  CA    . GLU B  1 238 ? 71.899  98.376  68.523  1.00 56.02 ? 238 GLU B CA    1 
ATOM   6862  C  C     . GLU B  1 238 ? 72.351  99.158  67.299  1.00 56.02 ? 238 GLU B C     1 
ATOM   6863  O  O     . GLU B  1 238 ? 73.553  99.234  67.037  1.00 56.02 ? 238 GLU B O     1 
ATOM   6864  C  CB    . GLU B  1 238 ? 72.115  96.882  68.292  1.00 56.02 ? 238 GLU B CB    1 
ATOM   6865  C  CG    . GLU B  1 238 ? 71.253  96.015  69.190  1.00 56.02 ? 238 GLU B CG    1 
ATOM   6866  C  CD    . GLU B  1 238 ? 71.325  94.549  68.832  1.00 56.02 ? 238 GLU B CD    1 
ATOM   6867  O  OE1   . GLU B  1 238 ? 72.140  94.192  67.957  1.00 56.02 ? 238 GLU B OE1   1 
ATOM   6868  O  OE2   . GLU B  1 238 ? 70.570  93.750  69.425  1.00 56.02 ? 238 GLU B OE2   1 
ATOM   6869  N  N     . ASP B  1 239 ? 71.415  99.726  66.541  1.00 58.38 ? 239 ASP B N     1 
ATOM   6870  C  CA    . ASP B  1 239 ? 71.771  100.500 65.360  1.00 58.38 ? 239 ASP B CA    1 
ATOM   6871  C  C     . ASP B  1 239 ? 72.325  101.864 65.748  1.00 58.38 ? 239 ASP B C     1 
ATOM   6872  O  O     . ASP B  1 239 ? 73.226  102.393 65.088  1.00 58.38 ? 239 ASP B O     1 
ATOM   6873  C  CB    . ASP B  1 239 ? 70.542  100.661 64.469  1.00 58.38 ? 239 ASP B CB    1 
ATOM   6874  C  CG    . ASP B  1 239 ? 69.986  99.336  64.002  1.00 58.38 ? 239 ASP B CG    1 
ATOM   6875  O  OD1   . ASP B  1 239 ? 70.769  98.373  63.877  1.00 58.38 ? 239 ASP B OD1   1 
ATOM   6876  O  OD2   . ASP B  1 239 ? 68.761  99.254  63.772  1.00 58.38 ? 239 ASP B OD2   1 
ATOM   6877  N  N     . TYR B  1 240 ? 71.797  102.447 66.824  1.00 56.47 ? 240 TYR B N     1 
ATOM   6878  C  CA    . TYR B  1 240 ? 72.084  103.845 67.126  1.00 56.47 ? 240 TYR B CA    1 
ATOM   6879  C  C     . TYR B  1 240 ? 73.382  104.002 67.906  1.00 56.47 ? 240 TYR B C     1 
ATOM   6880  O  O     . TYR B  1 240 ? 74.221  104.836 67.550  1.00 56.47 ? 240 TYR B O     1 
ATOM   6881  C  CB    . TYR B  1 240 ? 70.918  104.461 67.901  1.00 56.47 ? 240 TYR B CB    1 
ATOM   6882  C  CG    . TYR B  1 240 ? 69.575  104.329 67.214  1.00 56.47 ? 240 TYR B CG    1 
ATOM   6883  C  CD1   . TYR B  1 240 ? 69.460  104.436 65.832  1.00 56.47 ? 240 TYR B CD1   1 
ATOM   6884  C  CD2   . TYR B  1 240 ? 68.422  104.088 67.949  1.00 56.47 ? 240 TYR B CD2   1 
ATOM   6885  C  CE1   . TYR B  1 240 ? 68.235  104.309 65.204  1.00 56.47 ? 240 TYR B CE1   1 
ATOM   6886  C  CE2   . TYR B  1 240 ? 67.192  103.960 67.330  1.00 56.47 ? 240 TYR B CE2   1 
ATOM   6887  C  CZ    . TYR B  1 240 ? 67.106  104.071 65.958  1.00 56.47 ? 240 TYR B CZ    1 
ATOM   6888  O  OH    . TYR B  1 240 ? 65.885  103.946 65.338  1.00 56.47 ? 240 TYR B OH    1 
ATOM   6889  N  N     . ASP B  1 241 ? 73.570  103.217 68.966  1.00 51.02 ? 241 ASP B N     1 
ATOM   6890  C  CA    . ASP B  1 241 ? 74.772  103.320 69.782  1.00 51.02 ? 241 ASP B CA    1 
ATOM   6891  C  C     . ASP B  1 241 ? 75.898  102.414 69.310  1.00 51.02 ? 241 ASP B C     1 
ATOM   6892  O  O     . ASP B  1 241 ? 77.057  102.679 69.650  1.00 51.02 ? 241 ASP B O     1 
ATOM   6893  C  CB    . ASP B  1 241 ? 74.458  102.995 71.247  1.00 51.02 ? 241 ASP B CB    1 
ATOM   6894  C  CG    . ASP B  1 241 ? 74.335  101.509 71.499  1.00 51.02 ? 241 ASP B CG    1 
ATOM   6895  O  OD1   . ASP B  1 241 ? 73.604  100.832 70.746  1.00 51.02 ? 241 ASP B OD1   1 
ATOM   6896  O  OD2   . ASP B  1 241 ? 74.981  101.011 72.442  1.00 51.02 ? 241 ASP B OD2   1 
ATOM   6897  N  N     . LYS B  1 242 ? 75.571  101.371 68.537  1.00 49.69 ? 242 LYS B N     1 
ATOM   6898  C  CA    . LYS B  1 242 ? 76.491  100.353 68.034  1.00 49.69 ? 242 LYS B CA    1 
ATOM   6899  C  C     . LYS B  1 242 ? 77.280  99.702  69.162  1.00 49.69 ? 242 LYS B C     1 
ATOM   6900  O  O     . LYS B  1 242 ? 78.515  99.715  69.149  1.00 49.69 ? 242 LYS B O     1 
ATOM   6901  C  CB    . LYS B  1 242 ? 77.417  100.944 66.969  1.00 49.69 ? 242 LYS B CB    1 
ATOM   6902  C  CG    . LYS B  1 242 ? 76.649  101.566 65.814  1.00 49.69 ? 242 LYS B CG    1 
ATOM   6903  C  CD    . LYS B  1 242 ? 77.562  102.218 64.801  1.00 49.69 ? 242 LYS B CD    1 
ATOM   6904  C  CE    . LYS B  1 242 ? 76.765  103.034 63.795  1.00 49.69 ? 242 LYS B CE    1 
ATOM   6905  N  NZ    . LYS B  1 242 ? 75.854  102.183 62.980  1.00 49.69 ? 242 LYS B NZ    1 
ATOM   6906  N  N     . TYR B  1 243 ? 76.550  99.199  70.167  1.00 44.92 ? 243 TYR B N     1 
ATOM   6907  C  CA    . TYR B  1 243 ? 77.028  98.333  71.245  1.00 44.92 ? 243 TYR B CA    1 
ATOM   6908  C  C     . TYR B  1 243 ? 78.034  98.988  72.188  1.00 44.92 ? 243 TYR B C     1 
ATOM   6909  O  O     . TYR B  1 243 ? 78.640  98.299  73.013  1.00 44.92 ? 243 TYR B O     1 
ATOM   6910  C  CB    . TYR B  1 243 ? 77.642  97.058  70.666  1.00 44.92 ? 243 TYR B CB    1 
ATOM   6911  C  CG    . TYR B  1 243 ? 76.657  95.983  70.295  1.00 44.92 ? 243 TYR B CG    1 
ATOM   6912  C  CD1   . TYR B  1 243 ? 75.551  95.720  71.087  1.00 44.92 ? 243 TYR B CD1   1 
ATOM   6913  C  CD2   . TYR B  1 243 ? 76.842  95.223  69.151  1.00 44.92 ? 243 TYR B CD2   1 
ATOM   6914  C  CE1   . TYR B  1 243 ? 74.655  94.728  70.744  1.00 44.92 ? 243 TYR B CE1   1 
ATOM   6915  C  CE2   . TYR B  1 243 ? 75.955  94.233  68.802  1.00 44.92 ? 243 TYR B CE2   1 
ATOM   6916  C  CZ    . TYR B  1 243 ? 74.865  93.988  69.599  1.00 44.92 ? 243 TYR B CZ    1 
ATOM   6917  O  OH    . TYR B  1 243 ? 73.984  92.995  69.242  1.00 44.92 ? 243 TYR B OH    1 
ATOM   6918  N  N     . VAL B  1 244 ? 78.220  100.300 72.095  1.00 41.05 ? 244 VAL B N     1 
ATOM   6919  C  CA    . VAL B  1 244 ? 79.167  100.997 72.954  1.00 41.05 ? 244 VAL B CA    1 
ATOM   6920  C  C     . VAL B  1 244 ? 78.540  101.484 74.254  1.00 41.05 ? 244 VAL B C     1 
ATOM   6921  O  O     . VAL B  1 244 ? 79.146  101.301 75.323  1.00 41.05 ? 244 VAL B O     1 
ATOM   6922  C  CB    . VAL B  1 244 ? 79.824  102.174 72.198  1.00 41.05 ? 244 VAL B CB    1 
ATOM   6923  C  CG1   . VAL B  1 244 ? 80.772  102.964 73.089  1.00 41.05 ? 244 VAL B CG1   1 
ATOM   6924  C  CG2   . VAL B  1 244 ? 80.563  101.662 70.975  1.00 41.05 ? 244 VAL B CG2   1 
ATOM   6925  N  N     . ILE B  1 245 ? 77.332  102.048 74.215  1.00 38.31 ? 245 ILE B N     1 
ATOM   6926  C  CA    . ILE B  1 245 ? 76.706  102.595 75.415  1.00 38.31 ? 245 ILE B CA    1 
ATOM   6927  C  C     . ILE B  1 245 ? 76.249  101.474 76.345  1.00 38.31 ? 245 ILE B C     1 
ATOM   6928  O  O     . ILE B  1 245 ? 76.492  101.513 77.558  1.00 38.31 ? 245 ILE B O     1 
ATOM   6929  C  CB    . ILE B  1 245 ? 75.540  103.519 75.017  1.00 38.31 ? 245 ILE B CB    1 
ATOM   6930  C  CG1   . ILE B  1 245 ? 76.080  104.808 74.396  1.00 38.31 ? 245 ILE B CG1   1 
ATOM   6931  C  CG2   . ILE B  1 245 ? 74.648  103.837 76.207  1.00 38.31 ? 245 ILE B CG2   1 
ATOM   6932  C  CD1   . ILE B  1 245 ? 75.003  105.751 73.914  1.00 38.31 ? 245 ILE B CD1   1 
ATOM   6933  N  N     . PHE B  1 246 ? 75.615  100.442 75.783  1.00 34.87 ? 246 PHE B N     1 
ATOM   6934  C  CA    . PHE B  1 246 ? 74.980  99.412  76.600  1.00 34.87 ? 246 PHE B CA    1 
ATOM   6935  C  C     . PHE B  1 246 ? 76.006  98.503  77.261  1.00 34.87 ? 246 PHE B C     1 
ATOM   6936  O  O     . PHE B  1 246 ? 75.833  98.096  78.417  1.00 34.87 ? 246 PHE B O     1 
ATOM   6937  C  CB    . PHE B  1 246 ? 74.020  98.596  75.745  1.00 34.87 ? 246 PHE B CB    1 
ATOM   6938  C  CG    . PHE B  1 246 ? 73.267  97.554  76.508  1.00 34.87 ? 246 PHE B CG    1 
ATOM   6939  C  CD1   . PHE B  1 246 ? 72.508  97.901  77.611  1.00 34.87 ? 246 PHE B CD1   1 
ATOM   6940  C  CD2   . PHE B  1 246 ? 73.301  96.230  76.111  1.00 34.87 ? 246 PHE B CD2   1 
ATOM   6941  C  CE1   . PHE B  1 246 ? 71.807  96.945  78.312  1.00 34.87 ? 246 PHE B CE1   1 
ATOM   6942  C  CE2   . PHE B  1 246 ? 72.600  95.272  76.805  1.00 34.87 ? 246 PHE B CE2   1 
ATOM   6943  C  CZ    . PHE B  1 246 ? 71.852  95.630  77.908  1.00 34.87 ? 246 PHE B CZ    1 
ATOM   6944  N  N     . ALA B  1 247 ? 77.087  98.180  76.549  1.00 33.35 ? 247 ALA B N     1 
ATOM   6945  C  CA    . ALA B  1 247 ? 78.136  97.345  77.124  1.00 33.35 ? 247 ALA B CA    1 
ATOM   6946  C  C     . ALA B  1 247 ? 78.862  98.070  78.248  1.00 33.35 ? 247 ALA B C     1 
ATOM   6947  O  O     . ALA B  1 247 ? 79.145  97.484  79.301  1.00 33.35 ? 247 ALA B O     1 
ATOM   6948  C  CB    . ALA B  1 247 ? 79.122  96.921  76.041  1.00 33.35 ? 247 ALA B CB    1 
ATOM   6949  N  N     . SER B  1 248 ? 79.149  99.359  78.045  1.00 31.64 ? 248 SER B N     1 
ATOM   6950  C  CA    . SER B  1 248 ? 79.781  100.161 79.086  1.00 31.64 ? 248 SER B CA    1 
ATOM   6951  C  C     . SER B  1 248 ? 78.868  100.306 80.295  1.00 31.64 ? 248 SER B C     1 
ATOM   6952  O  O     . SER B  1 248 ? 79.331  100.240 81.440  1.00 31.64 ? 248 SER B O     1 
ATOM   6953  C  CB    . SER B  1 248 ? 80.163  101.533 78.533  1.00 31.64 ? 248 SER B CB    1 
ATOM   6954  O  OG    . SER B  1 248 ? 80.797  101.414 77.273  1.00 31.64 ? 248 SER B OG    1 
ATOM   6955  N  N     . PHE B  1 249 ? 77.560  100.450 80.055  1.00 31.13 ? 249 PHE B N     1 
ATOM   6956  C  CA    . PHE B  1 249 ? 76.603  100.536 81.154  1.00 31.13 ? 249 PHE B CA    1 
ATOM   6957  C  C     . PHE B  1 249 ? 76.547  99.235  81.943  1.00 31.13 ? 249 PHE B C     1 
ATOM   6958  O  O     . PHE B  1 249 ? 76.514  99.257  83.176  1.00 31.13 ? 249 PHE B O     1 
ATOM   6959  C  CB    . PHE B  1 249 ? 75.215  100.893 80.630  1.00 31.13 ? 249 PHE B CB    1 
ATOM   6960  C  CG    . PHE B  1 249 ? 74.132  100.739 81.657  1.00 31.13 ? 249 PHE B CG    1 
ATOM   6961  C  CD1   . PHE B  1 249 ? 74.071  101.593 82.747  1.00 31.13 ? 249 PHE B CD1   1 
ATOM   6962  C  CD2   . PHE B  1 249 ? 73.183  99.737  81.541  1.00 31.13 ? 249 PHE B CD2   1 
ATOM   6963  C  CE1   . PHE B  1 249 ? 73.079  101.454 83.699  1.00 31.13 ? 249 PHE B CE1   1 
ATOM   6964  C  CE2   . PHE B  1 249 ? 72.190  99.592  82.490  1.00 31.13 ? 249 PHE B CE2   1 
ATOM   6965  C  CZ    . PHE B  1 249 ? 72.138  100.453 83.569  1.00 31.13 ? 249 PHE B CZ    1 
ATOM   6966  N  N     . ASN B  1 250 ? 76.586  98.093  81.246  1.00 29.86 ? 250 ASN B N     1 
ATOM   6967  C  CA    . ASN B  1 250 ? 76.556  96.800  81.927  1.00 29.86 ? 250 ASN B CA    1 
ATOM   6968  C  C     . ASN B  1 250 ? 77.801  96.570  82.773  1.00 29.86 ? 250 ASN B C     1 
ATOM   6969  O  O     . ASN B  1 250 ? 77.698  96.131  83.924  1.00 29.86 ? 250 ASN B O     1 
ATOM   6970  C  CB    . ASN B  1 250 ? 76.411  95.668  80.918  1.00 29.86 ? 250 ASN B CB    1 
ATOM   6971  C  CG    . ASN B  1 250 ? 75.001  95.502  80.434  1.00 29.86 ? 250 ASN B CG    1 
ATOM   6972  O  OD1   . ASN B  1 250 ? 74.048  95.643  81.197  1.00 29.86 ? 250 ASN B OD1   1 
ATOM   6973  N  ND2   . ASN B  1 250 ? 74.856  95.180  79.161  1.00 29.86 ? 250 ASN B ND2   1 
ATOM   6974  N  N     . LEU B  1 251 ? 78.983  96.879  82.235  1.00 25.81 ? 251 LEU B N     1 
ATOM   6975  C  CA    . LEU B  1 251 ? 80.206  96.583  82.979  1.00 25.81 ? 251 LEU B CA    1 
ATOM   6976  C  C     . LEU B  1 251 ? 80.407  97.547  84.148  1.00 25.81 ? 251 LEU B C     1 
ATOM   6977  O  O     . LEU B  1 251 ? 80.787  97.120  85.253  1.00 25.81 ? 251 LEU B O     1 
ATOM   6978  C  CB    . LEU B  1 251 ? 81.400  96.592  82.032  1.00 25.81 ? 251 LEU B CB    1 
ATOM   6979  C  CG    . LEU B  1 251 ? 81.166  95.570  80.916  1.00 25.81 ? 251 LEU B CG    1 
ATOM   6980  C  CD1   . LEU B  1 251 ? 82.115  95.762  79.746  1.00 25.81 ? 251 LEU B CD1   1 
ATOM   6981  C  CD2   . LEU B  1 251 ? 81.208  94.153  81.443  1.00 25.81 ? 251 LEU B CD2   1 
ATOM   6982  N  N     . ILE B  1 252 ? 80.123  98.839  83.940  1.00 25.49 ? 252 ILE B N     1 
ATOM   6983  C  CA    . ILE B  1 252 ? 80.181  99.801  85.037  1.00 25.49 ? 252 ILE B CA    1 
ATOM   6984  C  C     . ILE B  1 252 ? 79.124  99.494  86.091  1.00 25.49 ? 252 ILE B C     1 
ATOM   6985  O  O     . ILE B  1 252 ? 79.396  99.598  87.295  1.00 25.49 ? 252 ILE B O     1 
ATOM   6986  C  CB    . ILE B  1 252 ? 80.065  101.235 84.476  1.00 25.49 ? 252 ILE B CB    1 
ATOM   6987  C  CG1   . ILE B  1 252 ? 81.294  101.557 83.624  1.00 25.49 ? 252 ILE B CG1   1 
ATOM   6988  C  CG2   . ILE B  1 252 ? 79.891  102.273 85.574  1.00 25.49 ? 252 ILE B CG2   1 
ATOM   6989  C  CD1   . ILE B  1 252 ? 82.594  101.437 84.369  1.00 25.49 ? 252 ILE B CD1   1 
ATOM   6990  N  N     . TRP B  1 253 ? 77.942  99.028  85.675  1.00 24.01 ? 253 TRP B N     1 
ATOM   6991  C  CA    . TRP B  1 253 ? 76.911  98.679  86.641  1.00 24.01 ? 253 TRP B CA    1 
ATOM   6992  C  C     . TRP B  1 253 ? 77.268  97.431  87.433  1.00 24.01 ? 253 TRP B C     1 
ATOM   6993  O  O     . TRP B  1 253 ? 76.953  97.356  88.623  1.00 24.01 ? 253 TRP B O     1 
ATOM   6994  C  CB    . TRP B  1 253 ? 75.573  98.493  85.933  1.00 24.01 ? 253 TRP B CB    1 
ATOM   6995  C  CG    . TRP B  1 253 ? 74.446  98.209  86.859  1.00 24.01 ? 253 TRP B CG    1 
ATOM   6996  C  CD1   . TRP B  1 253 ? 73.716  97.064  86.925  1.00 24.01 ? 253 TRP B CD1   1 
ATOM   6997  C  CD2   . TRP B  1 253 ? 73.910  99.086  87.856  1.00 24.01 ? 253 TRP B CD2   1 
ATOM   6998  N  NE1   . TRP B  1 253 ? 72.759  97.169  87.902  1.00 24.01 ? 253 TRP B NE1   1 
ATOM   6999  C  CE2   . TRP B  1 253 ? 72.857  98.403  88.487  1.00 24.01 ? 253 TRP B CE2   1 
ATOM   7000  C  CE3   . TRP B  1 253 ? 74.218  100.384 88.274  1.00 24.01 ? 253 TRP B CE3   1 
ATOM   7001  C  CZ2   . TRP B  1 253 ? 72.115  98.967  89.518  1.00 24.01 ? 253 TRP B CZ2   1 
ATOM   7002  C  CZ3   . TRP B  1 253 ? 73.480  100.943 89.295  1.00 24.01 ? 253 TRP B CZ3   1 
ATOM   7003  C  CH2   . TRP B  1 253 ? 72.440  100.237 89.905  1.00 24.01 ? 253 TRP B CH2   1 
ATOM   7004  N  N     . SER B  1 254 ? 77.951  96.465  86.811  1.00 21.68 ? 254 SER B N     1 
ATOM   7005  C  CA    . SER B  1 254 ? 78.378  95.278  87.547  1.00 21.68 ? 254 SER B CA    1 
ATOM   7006  C  C     . SER B  1 254 ? 79.452  95.617  88.576  1.00 21.68 ? 254 SER B C     1 
ATOM   7007  O  O     . SER B  1 254 ? 79.421  95.102  89.703  1.00 21.68 ? 254 SER B O     1 
ATOM   7008  C  CB    . SER B  1 254 ? 78.880  94.210  86.581  1.00 21.68 ? 254 SER B CB    1 
ATOM   7009  O  OG    . SER B  1 254 ? 80.269  94.348  86.361  1.00 21.68 ? 254 SER B OG    1 
ATOM   7010  N  N     . THR B  1 255 ? 80.384  96.511  88.226  1.00 22.07 ? 255 THR B N     1 
ATOM   7011  C  CA    . THR B  1 255 ? 81.375  96.948  89.213  1.00 22.07 ? 255 THR B CA    1 
ATOM   7012  C  C     . THR B  1 255 ? 80.731  97.744  90.345  1.00 22.07 ? 255 THR B C     1 
ATOM   7013  O  O     . THR B  1 255 ? 81.098  97.578  91.520  1.00 22.07 ? 255 THR B O     1 
ATOM   7014  C  CB    . THR B  1 255 ? 82.458  97.783  88.546  1.00 22.07 ? 255 THR B CB    1 
ATOM   7015  O  OG1   . THR B  1 255 ? 82.802  97.195  87.290  1.00 22.07 ? 255 THR B OG1   1 
ATOM   7016  C  CG2   . THR B  1 255 ? 83.689  97.836  89.425  1.00 22.07 ? 255 THR B CG2   1 
ATOM   7017  N  N     . VAL B  1 256 ? 79.751  98.587  90.012  1.00 20.56 ? 256 VAL B N     1 
ATOM   7018  C  CA    . VAL B  1 256 ? 79.083  99.406  91.018  1.00 20.56 ? 256 VAL B CA    1 
ATOM   7019  C  C     . VAL B  1 256 ? 78.277  98.537  91.979  1.00 20.56 ? 256 VAL B C     1 
ATOM   7020  O  O     . VAL B  1 256 ? 78.319  98.749  93.197  1.00 20.56 ? 256 VAL B O     1 
ATOM   7021  C  CB    . VAL B  1 256 ? 78.224  100.482 90.326  1.00 20.56 ? 256 VAL B CB    1 
ATOM   7022  C  CG1   . VAL B  1 256 ? 77.137  101.016 91.239  1.00 20.56 ? 256 VAL B CG1   1 
ATOM   7023  C  CG2   . VAL B  1 256 ? 79.107  101.627 89.879  1.00 20.56 ? 256 VAL B CG2   1 
ATOM   7024  N  N     . ILE B  1 257 ? 77.590  97.510  91.471  1.00 19.63 ? 257 ILE B N     1 
ATOM   7025  C  CA    . ILE B  1 257 ? 76.830  96.668  92.391  1.00 19.63 ? 257 ILE B CA    1 
ATOM   7026  C  C     . ILE B  1 257 ? 77.749  95.755  93.200  1.00 19.63 ? 257 ILE B C     1 
ATOM   7027  O  O     . ILE B  1 257 ? 77.469  95.488  94.375  1.00 19.63 ? 257 ILE B O     1 
ATOM   7028  C  CB    . ILE B  1 257 ? 75.730  95.869  91.668  1.00 19.63 ? 257 ILE B CB    1 
ATOM   7029  C  CG1   . ILE B  1 257 ? 76.311  94.887  90.651  1.00 19.63 ? 257 ILE B CG1   1 
ATOM   7030  C  CG2   . ILE B  1 257 ? 74.757  96.817  91.017  1.00 19.63 ? 257 ILE B CG2   1 
ATOM   7031  C  CD1   . ILE B  1 257 ? 75.322  93.908  90.087  1.00 19.63 ? 257 ILE B CD1   1 
ATOM   7032  N  N     . LEU B  1 258 ? 78.886  95.326  92.643  1.00 19.97 ? 258 LEU B N     1 
ATOM   7033  C  CA    . LEU B  1 258 ? 79.794  94.507  93.434  1.00 19.97 ? 258 LEU B CA    1 
ATOM   7034  C  C     . LEU B  1 258 ? 80.591  95.312  94.452  1.00 19.97 ? 258 LEU B C     1 
ATOM   7035  O  O     . LEU B  1 258 ? 81.194  94.713  95.346  1.00 19.97 ? 258 LEU B O     1 
ATOM   7036  C  CB    . LEU B  1 258 ? 80.742  93.737  92.517  1.00 19.97 ? 258 LEU B CB    1 
ATOM   7037  C  CG    . LEU B  1 258 ? 80.096  92.520  91.858  1.00 19.97 ? 258 LEU B CG    1 
ATOM   7038  C  CD1   . LEU B  1 258 ? 81.078  91.826  90.938  1.00 19.97 ? 258 LEU B CD1   1 
ATOM   7039  C  CD2   . LEU B  1 258 ? 79.572  91.565  92.915  1.00 19.97 ? 258 LEU B CD2   1 
ATOM   7040  N  N     . GLU B  1 259 ? 80.618  96.640  94.342  1.00 24.21 ? 259 GLU B N     1 
ATOM   7041  C  CA    . GLU B  1 259 ? 81.191  97.437  95.423  1.00 24.21 ? 259 GLU B CA    1 
ATOM   7042  C  C     . GLU B  1 259 ? 80.142  97.878  96.447  1.00 24.21 ? 259 GLU B C     1 
ATOM   7043  O  O     . GLU B  1 259 ? 80.405  97.883  97.664  1.00 24.21 ? 259 GLU B O     1 
ATOM   7044  C  CB    . GLU B  1 259 ? 81.905  98.661  94.849  1.00 24.21 ? 259 GLU B CB    1 
ATOM   7045  C  CG    . GLU B  1 259 ? 82.654  99.481  95.883  1.00 24.21 ? 259 GLU B CG    1 
ATOM   7046  C  CD    . GLU B  1 259 ? 83.974  98.859  96.323  1.00 24.21 ? 259 GLU B CD    1 
ATOM   7047  O  OE1   . GLU B  1 259 ? 84.408  97.854  95.721  1.00 24.21 ? 259 GLU B OE1   1 
ATOM   7048  O  OE2   . GLU B  1 259 ? 84.576  99.371  97.290  1.00 24.21 ? 259 GLU B OE2   1 
ATOM   7049  N  N     . LEU B  1 260 ? 78.942  98.237  95.985  1.00 19.98 ? 260 LEU B N     1 
ATOM   7050  C  CA    . LEU B  1 260 ? 77.886  98.612  96.915  1.00 19.98 ? 260 LEU B CA    1 
ATOM   7051  C  C     . LEU B  1 260 ? 77.366  97.422  97.709  1.00 19.98 ? 260 LEU B C     1 
ATOM   7052  O  O     . LEU B  1 260 ? 76.814  97.624  98.797  1.00 19.98 ? 260 LEU B O     1 
ATOM   7053  C  CB    . LEU B  1 260 ? 76.731  99.291  96.180  1.00 19.98 ? 260 LEU B CB    1 
ATOM   7054  C  CG    . LEU B  1 260 ? 76.966  100.644 95.509  1.00 19.98 ? 260 LEU B CG    1 
ATOM   7055  C  CD1   . LEU B  1 260 ? 75.643  101.245 95.078  1.00 19.98 ? 260 LEU B CD1   1 
ATOM   7056  C  CD2   . LEU B  1 260 ? 77.707  101.584 96.427  1.00 19.98 ? 260 LEU B CD2   1 
ATOM   7057  N  N     . TRP B  1 261 ? 77.564  96.190  97.225  1.00 17.77 ? 261 TRP B N     1 
ATOM   7058  C  CA    . TRP B  1 261 ? 77.296  95.044  98.084  1.00 17.77 ? 261 TRP B CA    1 
ATOM   7059  C  C     . TRP B  1 261 ? 78.276  94.988  99.246  1.00 17.77 ? 261 TRP B C     1 
ATOM   7060  O  O     . TRP B  1 261 ? 77.881  94.659  100.365 1.00 17.77 ? 261 TRP B O     1 
ATOM   7061  C  CB    . TRP B  1 261 ? 77.339  93.728  97.308  1.00 17.77 ? 261 TRP B CB    1 
ATOM   7062  C  CG    . TRP B  1 261 ? 77.504  92.556  98.235  1.00 17.77 ? 261 TRP B CG    1 
ATOM   7063  C  CD1   . TRP B  1 261 ? 78.595  91.753  98.348  1.00 17.77 ? 261 TRP B CD1   1 
ATOM   7064  C  CD2   . TRP B  1 261 ? 76.572  92.106  99.228  1.00 17.77 ? 261 TRP B CD2   1 
ATOM   7065  N  NE1   . TRP B  1 261 ? 78.394  90.815  99.328  1.00 17.77 ? 261 TRP B NE1   1 
ATOM   7066  C  CE2   . TRP B  1 261 ? 77.160  91.014  99.886  1.00 17.77 ? 261 TRP B CE2   1 
ATOM   7067  C  CE3   . TRP B  1 261 ? 75.295  92.518  99.620  1.00 17.77 ? 261 TRP B CE3   1 
ATOM   7068  C  CZ2   . TRP B  1 261 ? 76.515  90.324  100.905 1.00 17.77 ? 261 TRP B CZ2   1 
ATOM   7069  C  CZ3   . TRP B  1 261 ? 74.659  91.834  100.632 1.00 17.77 ? 261 TRP B CZ3   1 
ATOM   7070  C  CH2   . TRP B  1 261 ? 75.268  90.750  101.262 1.00 17.77 ? 261 TRP B CH2   1 
ATOM   7071  N  N     . LYS B  1 262 ? 79.552  95.309  99.009  1.00 20.38 ? 262 LYS B N     1 
ATOM   7072  C  CA    . LYS B  1 262 ? 80.515  95.329  100.108 1.00 20.38 ? 262 LYS B CA    1 
ATOM   7073  C  C     . LYS B  1 262 ? 80.189  96.418  101.118 1.00 20.38 ? 262 LYS B C     1 
ATOM   7074  O  O     . LYS B  1 262 ? 80.325  96.197  102.328 1.00 20.38 ? 262 LYS B O     1 
ATOM   7075  C  CB    . LYS B  1 262 ? 81.933  95.511  99.578  1.00 20.38 ? 262 LYS B CB    1 
ATOM   7076  C  CG    . LYS B  1 262 ? 82.534  94.248  99.002  1.00 20.38 ? 262 LYS B CG    1 
ATOM   7077  C  CD    . LYS B  1 262 ? 84.042  94.349  98.924  1.00 20.38 ? 262 LYS B CD    1 
ATOM   7078  C  CE    . LYS B  1 262 ? 84.465  95.468  98.001  1.00 20.38 ? 262 LYS B CE    1 
ATOM   7079  N  NZ    . LYS B  1 262 ? 85.943  95.578  97.953  1.00 20.38 ? 262 LYS B NZ    1 
ATOM   7080  N  N     . ARG B  1 263 ? 79.704  97.569  100.642 1.00 25.21 ? 263 ARG B N     1 
ATOM   7081  C  CA    . ARG B  1 263 ? 79.263  98.615  101.569 1.00 25.21 ? 263 ARG B CA    1 
ATOM   7082  C  C     . ARG B  1 263 ? 78.037  98.183  102.378 1.00 25.21 ? 263 ARG B C     1 
ATOM   7083  O  O     . ARG B  1 263 ? 78.009  98.347  103.608 1.00 25.21 ? 263 ARG B O     1 
ATOM   7084  C  CB    . ARG B  1 263 ? 78.983  99.909  100.811 1.00 25.21 ? 263 ARG B CB    1 
ATOM   7085  C  CG    . ARG B  1 263 ? 80.238  100.609 100.330 1.00 25.21 ? 263 ARG B CG    1 
ATOM   7086  C  CD    . ARG B  1 263 ? 79.911  101.769 99.426  1.00 25.21 ? 263 ARG B CD    1 
ATOM   7087  N  NE    . ARG B  1 263 ? 79.265  102.853 100.152 1.00 25.21 ? 263 ARG B NE    1 
ATOM   7088  C  CZ    . ARG B  1 263 ? 79.915  103.887 100.669 1.00 25.21 ? 263 ARG B CZ    1 
ATOM   7089  N  NH1   . ARG B  1 263 ? 81.229  103.975 100.537 1.00 25.21 ? 263 ARG B NH1   1 
ATOM   7090  N  NH2   . ARG B  1 263 ? 79.252  104.834 101.316 1.00 25.21 ? 263 ARG B NH2   1 
ATOM   7091  N  N     . GLY B  1 264 ? 77.031  97.604  101.716 1.00 22.40 ? 264 GLY B N     1 
ATOM   7092  C  CA    . GLY B  1 264 ? 75.851  97.136  102.429 1.00 22.40 ? 264 GLY B CA    1 
ATOM   7093  C  C     . GLY B  1 264 ? 76.125  95.968  103.355 1.00 22.40 ? 264 GLY B C     1 
ATOM   7094  O  O     . GLY B  1 264 ? 75.492  95.844  104.406 1.00 22.40 ? 264 GLY B O     1 
ATOM   7095  N  N     . CYS B  1 265 ? 77.091  95.123  103.004 1.00 22.22 ? 265 CYS B N     1 
ATOM   7096  C  CA    . CYS B  1 265 ? 77.475  94.001  103.847 1.00 22.22 ? 265 CYS B CA    1 
ATOM   7097  C  C     . CYS B  1 265 ? 78.241  94.470  105.071 1.00 22.22 ? 265 CYS B C     1 
ATOM   7098  O  O     . CYS B  1 265 ? 78.064  93.912  106.158 1.00 22.22 ? 265 CYS B O     1 
ATOM   7099  C  CB    . CYS B  1 265 ? 78.307  93.006  103.038 1.00 22.22 ? 265 CYS B CB    1 
ATOM   7100  S  SG    . CYS B  1 265 ? 79.240  91.807  104.001 1.00 22.22 ? 265 CYS B SG    1 
ATOM   7101  N  N     . ALA B  1 266 ? 79.086  95.499  104.918 1.00 26.18 ? 266 ALA B N     1 
ATOM   7102  C  CA    . ALA B  1 266 ? 79.731  96.104  106.079 1.00 26.18 ? 266 ALA B CA    1 
ATOM   7103  C  C     . ALA B  1 266 ? 78.704  96.733  107.011 1.00 26.18 ? 266 ALA B C     1 
ATOM   7104  O  O     . ALA B  1 266 ? 78.806  96.595  108.236 1.00 26.18 ? 266 ALA B O     1 
ATOM   7105  C  CB    . ALA B  1 266 ? 80.754  97.144  105.632 1.00 26.18 ? 266 ALA B CB    1 
ATOM   7106  N  N     . ASN B  1 267 ? 77.677  97.373  106.443 1.00 28.69 ? 267 ASN B N     1 
ATOM   7107  C  CA    . ASN B  1 267 ? 76.615  97.959  107.261 1.00 28.69 ? 267 ASN B CA    1 
ATOM   7108  C  C     . ASN B  1 267 ? 75.814  96.890  108.004 1.00 28.69 ? 267 ASN B C     1 
ATOM   7109  O  O     . ASN B  1 267 ? 75.532  97.032  109.202 1.00 28.69 ? 267 ASN B O     1 
ATOM   7110  C  CB    . ASN B  1 267 ? 75.694  98.806  106.385 1.00 28.69 ? 267 ASN B CB    1 
ATOM   7111  C  CG    . ASN B  1 267 ? 74.591  99.467  107.173 1.00 28.69 ? 267 ASN B CG    1 
ATOM   7112  O  OD1   . ASN B  1 267 ? 74.769  99.818  108.338 1.00 28.69 ? 267 ASN B OD1   1 
ATOM   7113  N  ND2   . ASN B  1 267 ? 73.439  99.644  106.541 1.00 28.69 ? 267 ASN B ND2   1 
ATOM   7114  N  N     . MET B  1 268 ? 75.457  95.802  107.313 1.00 28.07 ? 268 MET B N     1 
ATOM   7115  C  CA    . MET B  1 268 ? 74.683  94.733  107.941 1.00 28.07 ? 268 MET B CA    1 
ATOM   7116  C  C     . MET B  1 268 ? 75.494  94.004  109.006 1.00 28.07 ? 268 MET B C     1 
ATOM   7117  O  O     . MET B  1 268 ? 74.998  93.752  110.108 1.00 28.07 ? 268 MET B O     1 
ATOM   7118  C  CB    . MET B  1 268 ? 74.193  93.742  106.888 1.00 28.07 ? 268 MET B CB    1 
ATOM   7119  C  CG    . MET B  1 268 ? 72.897  94.125  106.211 1.00 28.07 ? 268 MET B CG    1 
ATOM   7120  S  SD    . MET B  1 268 ? 72.132  92.704  105.415 1.00 28.07 ? 268 MET B SD    1 
ATOM   7121  C  CE    . MET B  1 268 ? 73.410  92.251  104.253 1.00 28.07 ? 268 MET B CE    1 
ATOM   7122  N  N     . THR B  1 269 ? 76.743  93.659  108.701 1.00 27.86 ? 269 THR B N     1 
ATOM   7123  C  CA    . THR B  1 269 ? 77.563  92.935  109.658 1.00 27.86 ? 269 THR B CA    1 
ATOM   7124  C  C     . THR B  1 269 ? 78.082  93.814  110.785 1.00 27.86 ? 269 THR B C     1 
ATOM   7125  O  O     . THR B  1 269 ? 78.572  93.276  111.782 1.00 27.86 ? 269 THR B O     1 
ATOM   7126  C  CB    . THR B  1 269 ? 78.731  92.261  108.946 1.00 27.86 ? 269 THR B CB    1 
ATOM   7127  O  OG1   . THR B  1 269 ? 79.326  93.181  108.027 1.00 27.86 ? 269 THR B OG1   1 
ATOM   7128  C  CG2   . THR B  1 269 ? 78.238  91.052  108.187 1.00 27.86 ? 269 THR B CG2   1 
ATOM   7129  N  N     . TYR B  1 270 ? 77.993  95.140  110.666 1.00 32.75 ? 270 TYR B N     1 
ATOM   7130  C  CA    . TYR B  1 270 ? 78.145  95.954  111.864 1.00 32.75 ? 270 TYR B CA    1 
ATOM   7131  C  C     . TYR B  1 270 ? 76.850  95.988  112.661 1.00 32.75 ? 270 TYR B C     1 
ATOM   7132  O  O     . TYR B  1 270 ? 76.882  96.051  113.893 1.00 32.75 ? 270 TYR B O     1 
ATOM   7133  C  CB    . TYR B  1 270 ? 78.584  97.373  111.508 1.00 32.75 ? 270 TYR B CB    1 
ATOM   7134  C  CG    . TYR B  1 270 ? 78.736  98.265  112.719 1.00 32.75 ? 270 TYR B CG    1 
ATOM   7135  C  CD1   . TYR B  1 270 ? 79.858  98.175  113.530 1.00 32.75 ? 270 TYR B CD1   1 
ATOM   7136  C  CD2   . TYR B  1 270 ? 77.754  99.190  113.057 1.00 32.75 ? 270 TYR B CD2   1 
ATOM   7137  C  CE1   . TYR B  1 270 ? 80.000  98.981  114.641 1.00 32.75 ? 270 TYR B CE1   1 
ATOM   7138  C  CE2   . TYR B  1 270 ? 77.884  99.993  114.166 1.00 32.75 ? 270 TYR B CE2   1 
ATOM   7139  C  CZ    . TYR B  1 270 ? 79.010  99.889  114.952 1.00 32.75 ? 270 TYR B CZ    1 
ATOM   7140  O  OH    . TYR B  1 270 ? 79.145  100.695 116.056 1.00 32.75 ? 270 TYR B OH    1 
ATOM   7141  N  N     . ARG B  1 271 ? 75.702  95.951  111.976 1.00 30.99 ? 271 ARG B N     1 
ATOM   7142  C  CA    . ARG B  1 271 ? 74.422  95.988  112.675 1.00 30.99 ? 271 ARG B CA    1 
ATOM   7143  C  C     . ARG B  1 271 ? 74.145  94.716  113.470 1.00 30.99 ? 271 ARG B C     1 
ATOM   7144  O  O     . ARG B  1 271 ? 73.330  94.750  114.396 1.00 30.99 ? 271 ARG B O     1 
ATOM   7145  C  CB    . ARG B  1 271 ? 73.289  96.233  111.681 1.00 30.99 ? 271 ARG B CB    1 
ATOM   7146  C  CG    . ARG B  1 271 ? 72.133  97.033  112.241 1.00 30.99 ? 271 ARG B CG    1 
ATOM   7147  C  CD    . ARG B  1 271 ? 71.184  97.466  111.139 1.00 30.99 ? 271 ARG B CD    1 
ATOM   7148  N  NE    . ARG B  1 271 ? 70.330  96.369  110.694 1.00 30.99 ? 271 ARG B NE    1 
ATOM   7149  C  CZ    . ARG B  1 271 ? 70.246  95.952  109.436 1.00 30.99 ? 271 ARG B CZ    1 
ATOM   7150  N  NH1   . ARG B  1 271 ? 70.965  96.540  108.491 1.00 30.99 ? 271 ARG B NH1   1 
ATOM   7151  N  NH2   . ARG B  1 271 ? 69.443  94.947  109.121 1.00 30.99 ? 271 ARG B NH2   1 
ATOM   7152  N  N     . TRP B  1 272 ? 74.797  93.603  113.135 1.00 25.83 ? 272 TRP B N     1 
ATOM   7153  C  CA    . TRP B  1 272 ? 74.633  92.370  113.895 1.00 25.83 ? 272 TRP B CA    1 
ATOM   7154  C  C     . TRP B  1 272 ? 75.769  92.125  114.874 1.00 25.83 ? 272 TRP B C     1 
ATOM   7155  O  O     . TRP B  1 272 ? 75.569  91.437  115.880 1.00 25.83 ? 272 TRP B O     1 
ATOM   7156  C  CB    . TRP B  1 272 ? 74.528  91.170  112.955 1.00 25.83 ? 272 TRP B CB    1 
ATOM   7157  C  CG    . TRP B  1 272 ? 73.413  91.254  111.976 1.00 25.83 ? 272 TRP B CG    1 
ATOM   7158  C  CD1   . TRP B  1 272 ? 72.224  91.892  112.139 1.00 25.83 ? 272 TRP B CD1   1 
ATOM   7159  C  CD2   . TRP B  1 272 ? 73.380  90.668  110.674 1.00 25.83 ? 272 TRP B CD2   1 
ATOM   7160  N  NE1   . TRP B  1 272 ? 71.450  91.744  111.016 1.00 25.83 ? 272 TRP B NE1   1 
ATOM   7161  C  CE2   . TRP B  1 272 ? 72.140  90.995  110.102 1.00 25.83 ? 272 TRP B CE2   1 
ATOM   7162  C  CE3   . TRP B  1 272 ? 74.282  89.900  109.936 1.00 25.83 ? 272 TRP B CE3   1 
ATOM   7163  C  CZ2   . TRP B  1 272 ? 71.780  90.582  108.829 1.00 25.83 ? 272 TRP B CZ2   1 
ATOM   7164  C  CZ3   . TRP B  1 272 ? 73.923  89.491  108.677 1.00 25.83 ? 272 TRP B CZ3   1 
ATOM   7165  C  CH2   . TRP B  1 272 ? 72.684  89.833  108.132 1.00 25.83 ? 272 TRP B CH2   1 
ATOM   7166  N  N     . GLY B  1 273 ? 76.955  92.654  114.602 1.00 33.15 ? 273 GLY B N     1 
ATOM   7167  C  CA    . GLY B  1 273 ? 78.086  92.516  115.495 1.00 33.15 ? 273 GLY B CA    1 
ATOM   7168  C  C     . GLY B  1 273 ? 79.184  91.606  114.999 1.00 33.15 ? 273 GLY B C     1 
ATOM   7169  O  O     . GLY B  1 273 ? 80.259  91.580  115.610 1.00 33.15 ? 273 GLY B O     1 
ATOM   7170  N  N     . THR B  1 274 ? 78.968  90.869  113.913 1.00 31.90 ? 274 THR B N     1 
ATOM   7171  C  CA    . THR B  1 274 ? 79.966  89.919  113.439 1.00 31.90 ? 274 THR B CA    1 
ATOM   7172  C  C     . THR B  1 274 ? 81.090  90.566  112.643 1.00 31.90 ? 274 THR B C     1 
ATOM   7173  O  O     . THR B  1 274 ? 82.012  89.860  112.225 1.00 31.90 ? 274 THR B O     1 
ATOM   7174  C  CB    . THR B  1 274 ? 79.300  88.836  112.598 1.00 31.90 ? 274 THR B CB    1 
ATOM   7175  O  OG1   . THR B  1 274 ? 78.791  89.413  111.392 1.00 31.90 ? 274 THR B OG1   1 
ATOM   7176  C  CG2   . THR B  1 274 ? 78.171  88.207  113.373 1.00 31.90 ? 274 THR B CG2   1 
ATOM   7177  N  N     . LEU B  1 275 ? 81.041  91.878  112.419 1.00 36.19 ? 275 LEU B N     1 
ATOM   7178  C  CA    . LEU B  1 275 ? 82.206  92.592  111.917 1.00 36.19 ? 275 LEU B CA    1 
ATOM   7179  C  C     . LEU B  1 275 ? 83.262  92.774  112.998 1.00 36.19 ? 275 LEU B C     1 
ATOM   7180  O  O     . LEU B  1 275 ? 84.442  92.951  112.678 1.00 36.19 ? 275 LEU B O     1 
ATOM   7181  C  CB    . LEU B  1 275 ? 81.779  93.953  111.359 1.00 36.19 ? 275 LEU B CB    1 
ATOM   7182  C  CG    . LEU B  1 275 ? 82.759  94.781  110.530 1.00 36.19 ? 275 LEU B CG    1 
ATOM   7183  C  CD1   . LEU B  1 275 ? 83.140  94.046  109.263 1.00 36.19 ? 275 LEU B CD1   1 
ATOM   7184  C  CD2   . LEU B  1 275 ? 82.156  96.130  110.205 1.00 36.19 ? 275 LEU B CD2   1 
ATOM   7185  N  N     . LEU B  1 276 ? 82.863  92.699  114.268 1.00 46.17 ? 276 LEU B N     1 
ATOM   7186  C  CA    . LEU B  1 276 ? 83.751  92.938  115.394 1.00 46.17 ? 276 LEU B CA    1 
ATOM   7187  C  C     . LEU B  1 276 ? 84.116  91.683  116.171 1.00 46.17 ? 276 LEU B C     1 
ATOM   7188  O  O     . LEU B  1 276 ? 84.957  91.763  117.073 1.00 46.17 ? 276 LEU B O     1 
ATOM   7189  C  CB    . LEU B  1 276 ? 83.115  93.951  116.351 1.00 46.17 ? 276 LEU B CB    1 
ATOM   7190  C  CG    . LEU B  1 276 ? 82.837  95.288  115.680 1.00 46.17 ? 276 LEU B CG    1 
ATOM   7191  C  CD1   . LEU B  1 276 ? 81.701  96.018  116.368 1.00 46.17 ? 276 LEU B CD1   1 
ATOM   7192  C  CD2   . LEU B  1 276 ? 84.107  96.106  115.694 1.00 46.17 ? 276 LEU B CD2   1 
ATOM   7193  N  N     . MET B  1 277 ? 83.499  90.543  115.869 1.00 55.94 ? 277 MET B N     1 
ATOM   7194  C  CA    . MET B  1 277 ? 83.881  89.296  116.517 1.00 55.94 ? 277 MET B CA    1 
ATOM   7195  C  C     . MET B  1 277 ? 85.259  88.867  116.034 1.00 55.94 ? 277 MET B C     1 
ATOM   7196  O  O     . MET B  1 277 ? 85.541  88.886  114.832 1.00 55.94 ? 277 MET B O     1 
ATOM   7197  C  CB    . MET B  1 277 ? 82.853  88.204  116.227 1.00 55.94 ? 277 MET B CB    1 
ATOM   7198  C  CG    . MET B  1 277 ? 81.652  88.218  117.153 1.00 55.94 ? 277 MET B CG    1 
ATOM   7199  S  SD    . MET B  1 277 ? 80.599  86.770  116.945 1.00 55.94 ? 277 MET B SD    1 
ATOM   7200  C  CE    . MET B  1 277 ? 81.818  85.461  117.022 1.00 55.94 ? 277 MET B CE    1 
ATOM   7201  N  N     . LYS B  1 278 ? 86.121  88.494  116.977 1.00 67.90 ? 278 LYS B N     1 
ATOM   7202  C  CA    . LYS B  1 278 ? 87.490  88.135  116.650 1.00 67.90 ? 278 LYS B CA    1 
ATOM   7203  C  C     . LYS B  1 278 ? 87.541  86.792  115.929 1.00 67.90 ? 278 LYS B C     1 
ATOM   7204  O  O     . LYS B  1 278 ? 86.628  85.966  116.024 1.00 67.90 ? 278 LYS B O     1 
ATOM   7205  C  CB    . LYS B  1 278 ? 88.345  88.079  117.915 1.00 67.90 ? 278 LYS B CB    1 
ATOM   7206  C  CG    . LYS B  1 278 ? 88.320  89.354  118.737 1.00 67.90 ? 278 LYS B CG    1 
ATOM   7207  C  CD    . LYS B  1 278 ? 89.276  89.267  119.913 1.00 67.90 ? 278 LYS B CD    1 
ATOM   7208  N  N     . ARG B  1 279 ? 88.628  86.585  115.192 1.00 76.62 ? 279 ARG B N     1 
ATOM   7209  C  CA    . ARG B  1 279 ? 88.823  85.334  114.472 1.00 76.62 ? 279 ARG B CA    1 
ATOM   7210  C  C     . ARG B  1 279 ? 89.171  84.227  115.457 1.00 76.62 ? 279 ARG B C     1 
ATOM   7211  O  O     . ARG B  1 279 ? 90.245  84.246  116.069 1.00 76.62 ? 279 ARG B O     1 
ATOM   7212  C  CB    . ARG B  1 279 ? 89.924  85.490  113.427 1.00 76.62 ? 279 ARG B CB    1 
ATOM   7213  C  CG    . ARG B  1 279 ? 89.604  86.497  112.336 1.00 76.62 ? 279 ARG B CG    1 
ATOM   7214  C  CD    . ARG B  1 279 ? 90.827  86.803  111.490 1.00 76.62 ? 279 ARG B CD    1 
ATOM   7215  N  N     . LYS B  1 280 ? 88.258  83.274  115.623 1.00 77.02 ? 280 LYS B N     1 
ATOM   7216  C  CA    . LYS B  1 280 ? 88.514  82.136  116.492 1.00 77.02 ? 280 LYS B CA    1 
ATOM   7217  C  C     . LYS B  1 280 ? 89.548  81.218  115.858 1.00 77.02 ? 280 LYS B C     1 
ATOM   7218  O  O     . LYS B  1 280 ? 89.564  81.024  114.640 1.00 77.02 ? 280 LYS B O     1 
ATOM   7219  C  CB    . LYS B  1 280 ? 87.222  81.367  116.759 1.00 77.02 ? 280 LYS B CB    1 
ATOM   7220  N  N     . PHE B  1 281 ? 90.425  80.666  116.692 1.00 76.51 ? 281 PHE B N     1 
ATOM   7221  C  CA    . PHE B  1 281 ? 91.453  79.763  116.198 1.00 76.51 ? 281 PHE B CA    1 
ATOM   7222  C  C     . PHE B  1 281 ? 90.818  78.442  115.788 1.00 76.51 ? 281 PHE B C     1 
ATOM   7223  O  O     . PHE B  1 281 ? 90.016  77.868  116.530 1.00 76.51 ? 281 PHE B O     1 
ATOM   7224  C  CB    . PHE B  1 281 ? 92.524  79.534  117.260 1.00 76.51 ? 281 PHE B CB    1 
ATOM   7225  C  CG    . PHE B  1 281 ? 93.717  78.783  116.755 1.00 76.51 ? 281 PHE B CG    1 
ATOM   7226  C  CD1   . PHE B  1 281 ? 94.703  79.437  116.032 1.00 76.51 ? 281 PHE B CD1   1 
ATOM   7227  C  CD2   . PHE B  1 281 ? 93.849  77.422  116.988 1.00 76.51 ? 281 PHE B CD2   1 
ATOM   7228  C  CE1   . PHE B  1 281 ? 95.805  78.749  115.557 1.00 76.51 ? 281 PHE B CE1   1 
ATOM   7229  C  CE2   . PHE B  1 281 ? 94.946  76.726  116.512 1.00 76.51 ? 281 PHE B CE2   1 
ATOM   7230  C  CZ    . PHE B  1 281 ? 95.927  77.392  115.798 1.00 76.51 ? 281 PHE B CZ    1 
ATOM   7231  N  N     . GLU B  1 282 ? 91.176  77.963  114.602 1.00 65.18 ? 282 GLU B N     1 
ATOM   7232  C  CA    . GLU B  1 282 ? 90.498  76.826  113.999 1.00 65.18 ? 282 GLU B CA    1 
ATOM   7233  C  C     . GLU B  1 282 ? 91.153  75.516  114.416 1.00 65.18 ? 282 GLU B C     1 
ATOM   7234  O  O     . GLU B  1 282 ? 92.369  75.348  114.289 1.00 65.18 ? 282 GLU B O     1 
ATOM   7235  C  CB    . GLU B  1 282 ? 90.495  76.952  112.477 1.00 65.18 ? 282 GLU B CB    1 
ATOM   7236  C  CG    . GLU B  1 282 ? 89.443  77.904  111.944 1.00 65.18 ? 282 GLU B CG    1 
ATOM   7237  C  CD    . GLU B  1 282 ? 88.808  77.411  110.660 1.00 65.18 ? 282 GLU B CD    1 
ATOM   7238  O  OE1   . GLU B  1 282 ? 88.066  76.407  110.712 1.00 65.18 ? 282 GLU B OE1   1 
ATOM   7239  O  OE2   . GLU B  1 282 ? 89.045  78.028  109.601 1.00 65.18 ? 282 GLU B OE2   1 
ATOM   7240  N  N     . GLU B  1 283 ? 90.333  74.596  114.905 1.00 59.80 ? 283 GLU B N     1 
ATOM   7241  C  CA    . GLU B  1 283 ? 90.726  73.227  115.177 1.00 59.80 ? 283 GLU B CA    1 
ATOM   7242  C  C     . GLU B  1 283 ? 90.934  72.500  113.849 1.00 59.80 ? 283 GLU B C     1 
ATOM   7243  O  O     . GLU B  1 283 ? 90.398  72.923  112.821 1.00 59.80 ? 283 GLU B O     1 
ATOM   7244  C  CB    . GLU B  1 283 ? 89.632  72.560  116.018 1.00 59.80 ? 283 GLU B CB    1 
ATOM   7245  C  CG    . GLU B  1 283 ? 89.895  71.163  116.585 1.00 59.80 ? 283 GLU B CG    1 
ATOM   7246  C  CD    . GLU B  1 283 ? 90.973  71.141  117.656 1.00 59.80 ? 283 GLU B CD    1 
ATOM   7247  O  OE1   . GLU B  1 283 ? 91.185  72.177  118.318 1.00 59.80 ? 283 GLU B OE1   1 
ATOM   7248  O  OE2   . GLU B  1 283 ? 91.605  70.080  117.841 1.00 59.80 ? 283 GLU B OE2   1 
ATOM   7249  N  N     . PRO B  1 284 ? 91.759  71.449  113.827 1.00 52.05 ? 284 PRO B N     1 
ATOM   7250  C  CA    . PRO B  1 284 ? 91.809  70.575  112.648 1.00 52.05 ? 284 PRO B CA    1 
ATOM   7251  C  C     . PRO B  1 284 ? 90.451  69.969  112.325 1.00 52.05 ? 284 PRO B C     1 
ATOM   7252  O  O     . PRO B  1 284 ? 89.680  69.614  113.218 1.00 52.05 ? 284 PRO B O     1 
ATOM   7253  C  CB    . PRO B  1 284 ? 92.820  69.502  113.056 1.00 52.05 ? 284 PRO B CB    1 
ATOM   7254  C  CG    . PRO B  1 284 ? 93.763  70.236  113.928 1.00 52.05 ? 284 PRO B CG    1 
ATOM   7255  C  CD    . PRO B  1 284 ? 92.955  71.273  114.672 1.00 52.05 ? 284 PRO B CD    1 
ATOM   7256  N  N     . ARG B  1 285 ? 90.166  69.870  111.027 1.00 43.53 ? 285 ARG B N     1 
ATOM   7257  C  CA    . ARG B  1 285 ? 88.834  69.529  110.556 1.00 43.53 ? 285 ARG B CA    1 
ATOM   7258  C  C     . ARG B  1 285 ? 88.526  68.054  110.823 1.00 43.53 ? 285 ARG B C     1 
ATOM   7259  O  O     . ARG B  1 285 ? 89.441  67.244  110.987 1.00 43.53 ? 285 ARG B O     1 
ATOM   7260  C  CB    . ARG B  1 285 ? 88.718  69.848  109.063 1.00 43.53 ? 285 ARG B CB    1 
ATOM   7261  C  CG    . ARG B  1 285 ? 89.566  68.993  108.154 1.00 43.53 ? 285 ARG B CG    1 
ATOM   7262  C  CD    . ARG B  1 285 ? 89.202  69.242  106.703 1.00 43.53 ? 285 ARG B CD    1 
ATOM   7263  N  NE    . ARG B  1 285 ? 87.804  68.929  106.435 1.00 43.53 ? 285 ARG B NE    1 
ATOM   7264  C  CZ    . ARG B  1 285 ? 87.392  67.800  105.871 1.00 43.53 ? 285 ARG B CZ    1 
ATOM   7265  N  NH1   . ARG B  1 285 ? 86.100  67.591  105.664 1.00 43.53 ? 285 ARG B NH1   1 
ATOM   7266  N  NH2   . ARG B  1 285 ? 88.274  66.881  105.512 1.00 43.53 ? 285 ARG B NH2   1 
ATOM   7267  N  N     . PRO B  1 286 ? 87.233  67.677  110.887 1.00 47.45 ? 286 PRO B N     1 
ATOM   7268  C  CA    . PRO B  1 286 ? 86.887  66.280  111.182 1.00 47.45 ? 286 PRO B CA    1 
ATOM   7269  C  C     . PRO B  1 286 ? 87.199  65.324  110.044 1.00 47.45 ? 286 PRO B C     1 
ATOM   7270  O  O     . PRO B  1 286 ? 86.353  65.067  109.183 1.00 47.45 ? 286 PRO B O     1 
ATOM   7271  C  CB    . PRO B  1 286 ? 85.377  66.341  111.450 1.00 47.45 ? 286 PRO B CB    1 
ATOM   7272  C  CG    . PRO B  1 286 ? 84.926  67.611  110.829 1.00 47.45 ? 286 PRO B CG    1 
ATOM   7273  C  CD    . PRO B  1 286 ? 86.056  68.549  111.056 1.00 47.45 ? 286 PRO B CD    1 
ATOM   7274  N  N     . GLY B  1 287 ? 88.416  64.787  110.042 1.00 47.02 ? 287 GLY B N     1 
ATOM   7275  C  CA    . GLY B  1 287 ? 88.886  63.958  108.953 1.00 47.02 ? 287 GLY B CA    1 
ATOM   7276  C  C     . GLY B  1 287 ? 90.273  64.331  108.479 1.00 47.02 ? 287 GLY B C     1 
ATOM   7277  O  O     . GLY B  1 287 ? 90.669  63.996  107.360 1.00 47.02 ? 287 GLY B O     1 
ATOM   7278  N  N     . PHE B  1 288 ? 91.018  65.035  109.327 1.00 44.65 ? 288 PHE B N     1 
ATOM   7279  C  CA    . PHE B  1 288 ? 92.429  65.328  109.100 1.00 44.65 ? 288 PHE B CA    1 
ATOM   7280  C  C     . PHE B  1 288 ? 93.245  64.409  109.996 1.00 44.65 ? 288 PHE B C     1 
ATOM   7281  O  O     . PHE B  1 288 ? 93.275  64.597  111.217 1.00 44.65 ? 288 PHE B O     1 
ATOM   7282  C  CB    . PHE B  1 288 ? 92.742  66.792  109.395 1.00 44.65 ? 288 PHE B CB    1 
ATOM   7283  C  CG    . PHE B  1 288 ? 94.208  67.089  109.495 1.00 44.65 ? 288 PHE B CG    1 
ATOM   7284  C  CD1   . PHE B  1 288 ? 95.030  66.960  108.391 1.00 44.65 ? 288 PHE B CD1   1 
ATOM   7285  C  CD2   . PHE B  1 288 ? 94.762  67.500  110.693 1.00 44.65 ? 288 PHE B CD2   1 
ATOM   7286  C  CE1   . PHE B  1 288 ? 96.377  67.237  108.479 1.00 44.65 ? 288 PHE B CE1   1 
ATOM   7287  C  CE2   . PHE B  1 288 ? 96.109  67.779  110.787 1.00 44.65 ? 288 PHE B CE2   1 
ATOM   7288  C  CZ    . PHE B  1 288 ? 96.916  67.646  109.678 1.00 44.65 ? 288 PHE B CZ    1 
ATOM   7289  N  N     . HIS B  1 289 ? 93.900  63.418  109.400 1.00 47.35 ? 289 HIS B N     1 
ATOM   7290  C  CA    . HIS B  1 289 ? 94.663  62.431  110.147 1.00 47.35 ? 289 HIS B CA    1 
ATOM   7291  C  C     . HIS B  1 289 ? 96.126  62.467  109.735 1.00 47.35 ? 289 HIS B C     1 
ATOM   7292  O  O     . HIS B  1 289 ? 96.447  62.476  108.543 1.00 47.35 ? 289 HIS B O     1 
ATOM   7293  C  CB    . HIS B  1 289 ? 94.094  61.021  109.944 1.00 47.35 ? 289 HIS B CB    1 
ATOM   7294  C  CG    . HIS B  1 289 ? 93.897  60.643  108.508 1.00 47.35 ? 289 HIS B CG    1 
ATOM   7295  N  ND1   . HIS B  1 289 ? 94.942  60.303  107.676 1.00 47.35 ? 289 HIS B ND1   1 
ATOM   7296  C  CD2   . HIS B  1 289 ? 92.773  60.539  107.761 1.00 47.35 ? 289 HIS B CD2   1 
ATOM   7297  C  CE1   . HIS B  1 289 ? 94.470  60.012  106.477 1.00 47.35 ? 289 HIS B CE1   1 
ATOM   7298  N  NE2   . HIS B  1 289 ? 93.157  60.147  106.502 1.00 47.35 ? 289 HIS B NE2   1 
ATOM   7299  N  N     . GLY B  1 290 ? 97.003  62.479  110.722 1.00 54.46 ? 290 GLY B N     1 
ATOM   7300  C  CA    . GLY B  1 290 ? 98.438  62.455  110.496 1.00 54.46 ? 290 GLY B CA    1 
ATOM   7301  C  C     . GLY B  1 290 ? 99.099  61.621  111.566 1.00 54.46 ? 290 GLY B C     1 
ATOM   7302  O  O     . GLY B  1 290 ? 98.542  60.616  112.017 1.00 54.46 ? 290 GLY B O     1 
ATOM   7303  N  N     . VAL B  1 291 ? 100.296 62.032  111.975 1.00 61.32 ? 291 VAL B N     1 
ATOM   7304  C  CA    . VAL B  1 291 ? 101.004 61.392  113.079 1.00 61.32 ? 291 VAL B CA    1 
ATOM   7305  C  C     . VAL B  1 291 ? 100.881 62.297  114.300 1.00 61.32 ? 291 VAL B C     1 
ATOM   7306  O  O     . VAL B  1 291 ? 100.764 63.519  114.165 1.00 61.32 ? 291 VAL B O     1 
ATOM   7307  C  CB    . VAL B  1 291 ? 102.472 61.092  112.704 1.00 61.32 ? 291 VAL B CB    1 
ATOM   7308  C  CG1   . VAL B  1 291 ? 103.336 62.352  112.651 1.00 61.32 ? 291 VAL B CG1   1 
ATOM   7309  C  CG2   . VAL B  1 291 ? 103.078 60.046  113.635 1.00 61.32 ? 291 VAL B CG2   1 
ATOM   7310  N  N     . LEU B  1 292 ? 100.823 61.703  115.488 1.00 67.95 ? 292 LEU B N     1 
ATOM   7311  C  CA    . LEU B  1 292 ? 100.670 62.500  116.700 1.00 67.95 ? 292 LEU B CA    1 
ATOM   7312  C  C     . LEU B  1 292 ? 101.965 63.240  117.005 1.00 67.95 ? 292 LEU B C     1 
ATOM   7313  O  O     . LEU B  1 292 ? 103.048 62.647  116.983 1.00 67.95 ? 292 LEU B O     1 
ATOM   7314  C  CB    . LEU B  1 292 ? 100.273 61.615  117.882 1.00 67.95 ? 292 LEU B CB    1 
ATOM   7315  C  CG    . LEU B  1 292 ? 98.789  61.343  118.161 1.00 67.95 ? 292 LEU B CG    1 
ATOM   7316  C  CD1   . LEU B  1 292 ? 98.070  62.644  118.472 1.00 67.95 ? 292 LEU B CD1   1 
ATOM   7317  C  CD2   . LEU B  1 292 ? 98.084  60.588  117.037 1.00 67.95 ? 292 LEU B CD2   1 
ATOM   7318  N  N     . GLY B  1 293 ? 101.864 64.533  117.288 1.00 68.66 ? 293 GLY B N     1 
ATOM   7319  C  CA    . GLY B  1 293 ? 103.060 65.296  117.550 1.00 68.66 ? 293 GLY B CA    1 
ATOM   7320  C  C     . GLY B  1 293 ? 102.749 66.612  118.225 1.00 68.66 ? 293 GLY B C     1 
ATOM   7321  O  O     . GLY B  1 293 ? 101.616 66.875  118.631 1.00 68.66 ? 293 GLY B O     1 
ATOM   7322  N  N     . ILE B  1 294 ? 103.786 67.433  118.348 1.00 71.84 ? 294 ILE B N     1 
ATOM   7323  C  CA    . ILE B  1 294 ? 103.681 68.738  118.988 1.00 71.84 ? 294 ILE B CA    1 
ATOM   7324  C  C     . ILE B  1 294 ? 103.338 69.770  117.924 1.00 71.84 ? 294 ILE B C     1 
ATOM   7325  O  O     . ILE B  1 294 ? 104.064 69.919  116.934 1.00 71.84 ? 294 ILE B O     1 
ATOM   7326  C  CB    . ILE B  1 294 ? 104.983 69.105  119.717 1.00 71.84 ? 294 ILE B CB    1 
ATOM   7327  C  CG1   . ILE B  1 294 ? 105.177 68.218  120.949 1.00 71.84 ? 294 ILE B CG1   1 
ATOM   7328  C  CG2   . ILE B  1 294 ? 104.986 70.575  120.115 1.00 71.84 ? 294 ILE B CG2   1 
ATOM   7329  C  CD1   . ILE B  1 294 ? 103.996 68.212  121.898 1.00 71.84 ? 294 ILE B CD1   1 
ATOM   7330  N  N     . ASN B  1 295 ? 102.225 70.472  118.119 1.00 71.99 ? 295 ASN B N     1 
ATOM   7331  C  CA    . ASN B  1 295 ? 101.862 71.569  117.235 1.00 71.99 ? 295 ASN B CA    1 
ATOM   7332  C  C     . ASN B  1 295 ? 102.813 72.738  117.455 1.00 71.99 ? 295 ASN B C     1 
ATOM   7333  O  O     . ASN B  1 295 ? 103.105 73.105  118.596 1.00 71.99 ? 295 ASN B O     1 
ATOM   7334  C  CB    . ASN B  1 295 ? 100.419 71.995  117.492 1.00 71.99 ? 295 ASN B CB    1 
ATOM   7335  C  CG    . ASN B  1 295 ? 99.809  72.720  116.317 1.00 71.99 ? 295 ASN B CG    1 
ATOM   7336  O  OD1   . ASN B  1 295 ? 100.373 72.741  115.224 1.00 71.99 ? 295 ASN B OD1   1 
ATOM   7337  N  ND2   . ASN B  1 295 ? 98.646  73.321  116.533 1.00 71.99 ? 295 ASN B ND2   1 
ATOM   7338  N  N     . SER B  1 296 ? 103.310 73.314  116.360 1.00 68.96 ? 296 SER B N     1 
ATOM   7339  C  CA    . SER B  1 296 ? 104.322 74.359  116.475 1.00 68.96 ? 296 SER B CA    1 
ATOM   7340  C  C     . SER B  1 296 ? 103.713 75.679  116.928 1.00 68.96 ? 296 SER B C     1 
ATOM   7341  O  O     . SER B  1 296 ? 104.338 76.429  117.686 1.00 68.96 ? 296 SER B O     1 
ATOM   7342  C  CB    . SER B  1 296 ? 105.046 74.535  115.143 1.00 68.96 ? 296 SER B CB    1 
ATOM   7343  O  OG    . SER B  1 296 ? 104.348 75.441  114.307 1.00 68.96 ? 296 SER B OG    1 
ATOM   7344  N  N     . ILE B  1 297 ? 102.499 75.981  116.474 1.00 68.52 ? 297 ILE B N     1 
ATOM   7345  C  CA    . ILE B  1 297 ? 101.844 77.244  116.793 1.00 68.52 ? 297 ILE B CA    1 
ATOM   7346  C  C     . ILE B  1 297 ? 101.359 77.238  118.235 1.00 68.52 ? 297 ILE B C     1 
ATOM   7347  O  O     . ILE B  1 297 ? 101.777 78.070  119.046 1.00 68.52 ? 297 ILE B O     1 
ATOM   7348  C  CB    . ILE B  1 297 ? 100.674 77.516  115.831 1.00 68.52 ? 297 ILE B CB    1 
ATOM   7349  C  CG1   . ILE B  1 297 ? 101.177 77.597  114.389 1.00 68.52 ? 297 ILE B CG1   1 
ATOM   7350  C  CG2   . ILE B  1 297 ? 99.945  78.785  116.229 1.00 68.52 ? 297 ILE B CG2   1 
ATOM   7351  C  CD1   . ILE B  1 297 ? 100.083 77.475  113.354 1.00 68.52 ? 297 ILE B CD1   1 
ATOM   7352  N  N     . THR B  1 298 ? 100.477 76.293  118.566 1.00 73.52 ? 298 THR B N     1 
ATOM   7353  C  CA    . THR B  1 298 ? 99.814  76.327  119.864 1.00 73.52 ? 298 THR B CA    1 
ATOM   7354  C  C     . THR B  1 298 ? 100.677 75.736  120.969 1.00 73.52 ? 298 THR B C     1 
ATOM   7355  O  O     . THR B  1 298 ? 100.588 76.175  122.121 1.00 73.52 ? 298 THR B O     1 
ATOM   7356  C  CB    . THR B  1 298 ? 98.485  75.584  119.789 1.00 73.52 ? 298 THR B CB    1 
ATOM   7357  O  OG1   . THR B  1 298 ? 98.661  74.367  119.055 1.00 73.52 ? 298 THR B OG1   1 
ATOM   7358  C  CG2   . THR B  1 298 ? 97.452  76.437  119.089 1.00 73.52 ? 298 THR B CG2   1 
ATOM   7359  N  N     . GLY B  1 299 ? 101.509 74.748  120.650 1.00 74.79 ? 299 GLY B N     1 
ATOM   7360  C  CA    . GLY B  1 299 ? 102.312 74.077  121.646 1.00 74.79 ? 299 GLY B CA    1 
ATOM   7361  C  C     . GLY B  1 299 ? 101.685 72.837  122.242 1.00 74.79 ? 299 GLY B C     1 
ATOM   7362  O  O     . GLY B  1 299 ? 102.368 72.109  122.973 1.00 74.79 ? 299 GLY B O     1 
ATOM   7363  N  N     . LYS B  1 300 ? 100.414 72.569  121.955 1.00 78.39 ? 300 LYS B N     1 
ATOM   7364  C  CA    . LYS B  1 300 ? 99.748  71.377  122.460 1.00 78.39 ? 300 LYS B CA    1 
ATOM   7365  C  C     . LYS B  1 300 ? 100.024 70.202  121.523 1.00 78.39 ? 300 LYS B C     1 
ATOM   7366  O  O     . LYS B  1 300 ? 100.856 70.277  120.615 1.00 78.39 ? 300 LYS B O     1 
ATOM   7367  C  CB    . LYS B  1 300 ? 98.254  71.636  122.630 1.00 78.39 ? 300 LYS B CB    1 
ATOM   7368  C  CG    . LYS B  1 300 ? 97.572  72.203  121.396 1.00 78.39 ? 300 LYS B CG    1 
ATOM   7369  C  CD    . LYS B  1 300 ? 96.052  72.154  121.511 1.00 78.39 ? 300 LYS B CD    1 
ATOM   7370  C  CE    . LYS B  1 300 ? 95.552  72.706  122.842 1.00 78.39 ? 300 LYS B CE    1 
ATOM   7371  N  NZ    . LYS B  1 300 ? 95.942  74.128  123.047 1.00 78.39 ? 300 LYS B NZ    1 
ATOM   7372  N  N     . GLU B  1 301 ? 99.322  69.094  121.735 1.00 78.47 ? 301 GLU B N     1 
ATOM   7373  C  CA    . GLU B  1 301 ? 99.496  67.887  120.939 1.00 78.47 ? 301 GLU B CA    1 
ATOM   7374  C  C     . GLU B  1 301 ? 98.402  67.818  119.884 1.00 78.47 ? 301 GLU B C     1 
ATOM   7375  O  O     . GLU B  1 301 ? 97.217  67.971  120.198 1.00 78.47 ? 301 GLU B O     1 
ATOM   7376  C  CB    . GLU B  1 301 ? 99.469  66.636  121.819 1.00 78.47 ? 301 GLU B CB    1 
ATOM   7377  C  CG    . GLU B  1 301 ? 100.812 66.303  122.444 1.00 78.47 ? 301 GLU B CG    1 
ATOM   7378  C  CD    . GLU B  1 301 ? 101.007 64.818  122.652 1.00 78.47 ? 301 GLU B CD    1 
ATOM   7379  O  OE1   . GLU B  1 301 ? 100.101 64.042  122.285 1.00 78.47 ? 301 GLU B OE1   1 
ATOM   7380  O  OE2   . GLU B  1 301 ? 102.068 64.426  123.180 1.00 78.47 ? 301 GLU B OE2   1 
ATOM   7381  N  N     . GLU B  1 302 ? 98.802  67.586  118.643 1.00 67.04 ? 302 GLU B N     1 
ATOM   7382  C  CA    . GLU B  1 302 ? 97.897  67.596  117.508 1.00 67.04 ? 302 GLU B CA    1 
ATOM   7383  C  C     . GLU B  1 302 ? 98.391  66.601  116.471 1.00 67.04 ? 302 GLU B C     1 
ATOM   7384  O  O     . GLU B  1 302 ? 99.551  66.174  116.515 1.00 67.04 ? 302 GLU B O     1 
ATOM   7385  C  CB    . GLU B  1 302 ? 97.804  69.001  116.894 1.00 67.04 ? 302 GLU B CB    1 
ATOM   7386  N  N     . PRO B  1 303 ? 97.527  66.183  115.549 1.00 59.49 ? 303 PRO B N     1 
ATOM   7387  C  CA    . PRO B  1 303 ? 98.020  65.476  114.367 1.00 59.49 ? 303 PRO B CA    1 
ATOM   7388  C  C     . PRO B  1 303 ? 98.789  66.418  113.458 1.00 59.49 ? 303 PRO B C     1 
ATOM   7389  O  O     . PRO B  1 303 ? 98.402  67.567  113.237 1.00 59.49 ? 303 PRO B O     1 
ATOM   7390  C  CB    . PRO B  1 303 ? 96.741  64.970  113.693 1.00 59.49 ? 303 PRO B CB    1 
ATOM   7391  C  CG    . PRO B  1 303 ? 95.745  64.909  114.784 1.00 59.49 ? 303 PRO B CG    1 
ATOM   7392  C  CD    . PRO B  1 303 ? 96.065  66.064  115.676 1.00 59.49 ? 303 PRO B CD    1 
ATOM   7393  N  N     . LEU B  1 304 ? 99.899  65.913  112.938 1.00 55.85 ? 304 LEU B N     1 
ATOM   7394  C  CA    . LEU B  1 304 ? 100.766 66.638  112.027 1.00 55.85 ? 304 LEU B CA    1 
ATOM   7395  C  C     . LEU B  1 304 ? 100.854 65.867  110.723 1.00 55.85 ? 304 LEU B C     1 
ATOM   7396  O  O     . LEU B  1 304 ? 100.851 64.630  110.719 1.00 55.85 ? 304 LEU B O     1 
ATOM   7397  C  CB    . LEU B  1 304 ? 102.170 66.828  112.613 1.00 55.85 ? 304 LEU B CB    1 
ATOM   7398  C  CG    . LEU B  1 304 ? 102.348 67.622  113.909 1.00 55.85 ? 304 LEU B CG    1 
ATOM   7399  C  CD1   . LEU B  1 304 ? 103.789 68.076  114.040 1.00 55.85 ? 304 LEU B CD1   1 
ATOM   7400  C  CD2   . LEU B  1 304 ? 101.419 68.822  113.954 1.00 55.85 ? 304 LEU B CD2   1 
ATOM   7401  N  N     . TYR B  1 305 ? 100.923 66.605  109.620 1.00 46.33 ? 305 TYR B N     1 
ATOM   7402  C  CA    . TYR B  1 305 ? 101.060 66.030  108.297 1.00 46.33 ? 305 TYR B CA    1 
ATOM   7403  C  C     . TYR B  1 305 ? 102.170 66.777  107.571 1.00 46.33 ? 305 TYR B C     1 
ATOM   7404  O  O     . TYR B  1 305 ? 102.255 68.013  107.676 1.00 46.33 ? 305 TYR B O     1 
ATOM   7405  C  CB    . TYR B  1 305 ? 99.749  66.121  107.510 1.00 46.33 ? 305 TYR B CB    1 
ATOM   7406  C  CG    . TYR B  1 305 ? 99.621  65.081  106.427 1.00 46.33 ? 305 TYR B CG    1 
ATOM   7407  C  CD1   . TYR B  1 305 ? 99.293  63.769  106.735 1.00 46.33 ? 305 TYR B CD1   1 
ATOM   7408  C  CD2   . TYR B  1 305 ? 99.828  65.410  105.096 1.00 46.33 ? 305 TYR B CD2   1 
ATOM   7409  C  CE1   . TYR B  1 305 ? 99.175  62.812  105.747 1.00 46.33 ? 305 TYR B CE1   1 
ATOM   7410  C  CE2   . TYR B  1 305 ? 99.713  64.461  104.101 1.00 46.33 ? 305 TYR B CE2   1 
ATOM   7411  C  CZ    . TYR B  1 305 ? 99.387  63.165  104.433 1.00 46.33 ? 305 TYR B CZ    1 
ATOM   7412  O  OH    . TYR B  1 305 ? 99.271  62.217  103.446 1.00 46.33 ? 305 TYR B OH    1 
ATOM   7413  N  N     . PRO B  1 306 ? 103.048 66.079  106.855 1.00 47.43 ? 306 PRO B N     1 
ATOM   7414  C  CA    . PRO B  1 306 ? 104.082 66.774  106.084 1.00 47.43 ? 306 PRO B CA    1 
ATOM   7415  C  C     . PRO B  1 306 ? 103.473 67.485  104.887 1.00 47.43 ? 306 PRO B C     1 
ATOM   7416  O  O     . PRO B  1 306 ? 102.611 66.941  104.194 1.00 47.43 ? 306 PRO B O     1 
ATOM   7417  C  CB    . PRO B  1 306 ? 105.024 65.645  105.647 1.00 47.43 ? 306 PRO B CB    1 
ATOM   7418  C  CG    . PRO B  1 306 ? 104.636 64.453  106.475 1.00 47.43 ? 306 PRO B CG    1 
ATOM   7419  C  CD    . PRO B  1 306 ? 103.187 64.618  106.768 1.00 47.43 ? 306 PRO B CD    1 
ATOM   7420  N  N     . SER B  1 307 ? 103.925 68.718  104.657 1.00 43.36 ? 307 SER B N     1 
ATOM   7421  C  CA    . SER B  1 307 ? 103.326 69.545  103.618 1.00 43.36 ? 307 SER B CA    1 
ATOM   7422  C  C     . SER B  1 307 ? 103.659 69.061  102.214 1.00 43.36 ? 307 SER B C     1 
ATOM   7423  O  O     . SER B  1 307 ? 102.857 69.273  101.298 1.00 43.36 ? 307 SER B O     1 
ATOM   7424  C  CB    . SER B  1 307 ? 103.768 70.998  103.781 1.00 43.36 ? 307 SER B CB    1 
ATOM   7425  O  OG    . SER B  1 307 ? 102.908 71.870  103.071 1.00 43.36 ? 307 SER B OG    1 
ATOM   7426  N  N     . TYR B  1 308 ? 104.810 68.406  102.025 1.00 46.72 ? 308 TYR B N     1 
ATOM   7427  C  CA    . TYR B  1 308 ? 105.164 67.936  100.691 1.00 46.72 ? 308 TYR B CA    1 
ATOM   7428  C  C     . TYR B  1 308 ? 104.287 66.772  100.255 1.00 46.72 ? 308 TYR B C     1 
ATOM   7429  O  O     . TYR B  1 308 ? 104.001 66.637  99.063  1.00 46.72 ? 308 TYR B O     1 
ATOM   7430  C  CB    . TYR B  1 308 ? 106.647 67.553  100.621 1.00 46.72 ? 308 TYR B CB    1 
ATOM   7431  C  CG    . TYR B  1 308 ? 107.099 66.453  101.559 1.00 46.72 ? 308 TYR B CG    1 
ATOM   7432  C  CD1   . TYR B  1 308 ? 107.588 66.754  102.824 1.00 46.72 ? 308 TYR B CD1   1 
ATOM   7433  C  CD2   . TYR B  1 308 ? 107.077 65.118  101.166 1.00 46.72 ? 308 TYR B CD2   1 
ATOM   7434  C  CE1   . TYR B  1 308 ? 108.018 65.757  103.680 1.00 46.72 ? 308 TYR B CE1   1 
ATOM   7435  C  CE2   . TYR B  1 308 ? 107.499 64.115  102.017 1.00 46.72 ? 308 TYR B CE2   1 
ATOM   7436  C  CZ    . TYR B  1 308 ? 107.969 64.441  103.272 1.00 46.72 ? 308 TYR B CZ    1 
ATOM   7437  O  OH    . TYR B  1 308 ? 108.395 63.448  104.124 1.00 46.72 ? 308 TYR B OH    1 
ATOM   7438  N  N     . LYS B  1 309 ? 103.826 65.947  101.200 1.00 45.22 ? 309 LYS B N     1 
ATOM   7439  C  CA    . LYS B  1 309 ? 102.900 64.873  100.854 1.00 45.22 ? 309 LYS B CA    1 
ATOM   7440  C  C     . LYS B  1 309 ? 101.547 65.427  100.429 1.00 45.22 ? 309 LYS B C     1 
ATOM   7441  O  O     . LYS B  1 309 ? 100.925 64.912  99.493  1.00 45.22 ? 309 LYS B O     1 
ATOM   7442  C  CB    . LYS B  1 309 ? 102.738 63.916  102.032 1.00 45.22 ? 309 LYS B CB    1 
ATOM   7443  C  CG    . LYS B  1 309 ? 103.985 63.116  102.359 1.00 45.22 ? 309 LYS B CG    1 
ATOM   7444  C  CD    . LYS B  1 309 ? 103.697 62.074  103.427 1.00 45.22 ? 309 LYS B CD    1 
ATOM   7445  C  CE    . LYS B  1 309 ? 104.881 61.145  103.630 1.00 45.22 ? 309 LYS B CE    1 
ATOM   7446  N  NZ    . LYS B  1 309 ? 104.555 60.054  104.587 1.00 45.22 ? 309 LYS B NZ    1 
ATOM   7447  N  N     . ARG B  1 310 ? 101.094 66.500  101.082 1.00 39.55 ? 310 ARG B N     1 
ATOM   7448  C  CA    . ARG B  1 310 ? 99.843  67.141  100.692 1.00 39.55 ? 310 ARG B CA    1 
ATOM   7449  C  C     . ARG B  1 310 ? 99.968  67.814  99.331  1.00 39.55 ? 310 ARG B C     1 
ATOM   7450  O  O     . ARG B  1 310 ? 99.059  67.715  98.498  1.00 39.55 ? 310 ARG B O     1 
ATOM   7451  C  CB    . ARG B  1 310 ? 99.424  68.149  101.763 1.00 39.55 ? 310 ARG B CB    1 
ATOM   7452  C  CG    . ARG B  1 310 ? 98.234  69.009  101.397 1.00 39.55 ? 310 ARG B CG    1 
ATOM   7453  C  CD    . ARG B  1 310 ? 97.454  69.409  102.629 1.00 39.55 ? 310 ARG B CD    1 
ATOM   7454  N  NE    . ARG B  1 310 ? 98.212  70.306  103.493 1.00 39.55 ? 310 ARG B NE    1 
ATOM   7455  C  CZ    . ARG B  1 310 ? 98.562  70.017  104.741 1.00 39.55 ? 310 ARG B CZ    1 
ATOM   7456  N  NH1   . ARG B  1 310 ? 98.224  68.851  105.269 1.00 39.55 ? 310 ARG B NH1   1 
ATOM   7457  N  NH2   . ARG B  1 310 ? 99.248  70.891  105.461 1.00 39.55 ? 310 ARG B NH2   1 
ATOM   7458  N  N     . GLN B  1 311 ? 101.103 68.475  99.074  1.00 38.95 ? 311 GLN B N     1 
ATOM   7459  C  CA    . GLN B  1 311 ? 101.305 69.105  97.773  1.00 38.95 ? 311 GLN B CA    1 
ATOM   7460  C  C     . GLN B  1 311 ? 101.462 68.074  96.662  1.00 38.95 ? 311 GLN B C     1 
ATOM   7461  O  O     . GLN B  1 311 ? 101.023 68.319  95.534  1.00 38.95 ? 311 GLN B O     1 
ATOM   7462  C  CB    . GLN B  1 311 ? 102.517 70.031  97.814  1.00 38.95 ? 311 GLN B CB    1 
ATOM   7463  C  CG    . GLN B  1 311 ? 102.334 71.245  98.705  1.00 38.95 ? 311 GLN B CG    1 
ATOM   7464  C  CD    . GLN B  1 311 ? 101.191 72.130  98.261  1.00 38.95 ? 311 GLN B CD    1 
ATOM   7465  O  OE1   . GLN B  1 311 ? 101.005 72.372  97.070  1.00 38.95 ? 311 GLN B OE1   1 
ATOM   7466  N  NE2   . GLN B  1 311 ? 100.417 72.622  99.220  1.00 38.95 ? 311 GLN B NE2   1 
ATOM   7467  N  N     . LEU B  1 312 ? 102.056 66.915  96.961  1.00 39.65 ? 312 LEU B N     1 
ATOM   7468  C  CA    . LEU B  1 312 ? 102.099 65.831  95.986  1.00 39.65 ? 312 LEU B CA    1 
ATOM   7469  C  C     . LEU B  1 312 ? 100.711 65.275  95.708  1.00 39.65 ? 312 LEU B C     1 
ATOM   7470  O  O     . LEU B  1 312 ? 100.353 65.074  94.541  1.00 39.65 ? 312 LEU B O     1 
ATOM   7471  C  CB    . LEU B  1 312 ? 103.013 64.709  96.477  1.00 39.65 ? 312 LEU B CB    1 
ATOM   7472  C  CG    . LEU B  1 312 ? 104.524 64.857  96.303  1.00 39.65 ? 312 LEU B CG    1 
ATOM   7473  C  CD1   . LEU B  1 312 ? 105.206 63.528  96.568  1.00 39.65 ? 312 LEU B CD1   1 
ATOM   7474  C  CD2   . LEU B  1 312 ? 104.872 65.381  94.922  1.00 39.65 ? 312 LEU B CD2   1 
ATOM   7475  N  N     . ARG B  1 313 ? 99.912  65.054  96.762  1.00 38.60 ? 313 ARG B N     1 
ATOM   7476  C  CA    . ARG B  1 313 ? 98.559  64.531  96.601  1.00 38.60 ? 313 ARG B CA    1 
ATOM   7477  C  C     . ARG B  1 313 ? 97.654  65.502  95.859  1.00 38.60 ? 313 ARG B C     1 
ATOM   7478  O  O     . ARG B  1 313 ? 96.689  65.075  95.217  1.00 38.60 ? 313 ARG B O     1 
ATOM   7479  C  CB    . ARG B  1 313 ? 97.956  64.199  97.963  1.00 38.60 ? 313 ARG B CB    1 
ATOM   7480  C  CG    . ARG B  1 313 ? 98.401  62.870  98.530  1.00 38.60 ? 313 ARG B CG    1 
ATOM   7481  C  CD    . ARG B  1 313 ? 97.907  62.689  99.948  1.00 38.60 ? 313 ARG B CD    1 
ATOM   7482  N  NE    . ARG B  1 313 ? 97.386  61.346  100.166 1.00 38.60 ? 313 ARG B NE    1 
ATOM   7483  C  CZ    . ARG B  1 313 ? 96.925  60.908  101.330 1.00 38.60 ? 313 ARG B CZ    1 
ATOM   7484  N  NH1   . ARG B  1 313 ? 96.922  61.710  102.384 1.00 38.60 ? 313 ARG B NH1   1 
ATOM   7485  N  NH2   . ARG B  1 313 ? 96.468  59.670  101.442 1.00 38.60 ? 313 ARG B NH2   1 
ATOM   7486  N  N     . ILE B  1 314 ? 97.936  66.801  95.933  1.00 37.29 ? 314 ILE B N     1 
ATOM   7487  C  CA    . ILE B  1 314 ? 97.218  67.745  95.083  1.00 37.29 ? 314 ILE B CA    1 
ATOM   7488  C  C     . ILE B  1 314 ? 97.747  67.685  93.655  1.00 37.29 ? 314 ILE B C     1 
ATOM   7489  O  O     . ILE B  1 314 ? 97.054  67.208  92.748  1.00 37.29 ? 314 ILE B O     1 
ATOM   7490  C  CB    . ILE B  1 314 ? 97.299  69.172  95.655  1.00 37.29 ? 314 ILE B CB    1 
ATOM   7491  C  CG1   . ILE B  1 314 ? 96.574  69.257  96.994  1.00 37.29 ? 314 ILE B CG1   1 
ATOM   7492  C  CG2   . ILE B  1 314 ? 96.666  70.155  94.697  1.00 37.29 ? 314 ILE B CG2   1 
ATOM   7493  C  CD1   . ILE B  1 314 ? 96.647  70.624  97.636  1.00 37.29 ? 314 ILE B CD1   1 
ATOM   7494  N  N     . TYR B  1 315 ? 99.013  68.062  93.453  1.00 38.37 ? 315 TYR B N     1 
ATOM   7495  C  CA    . TYR B  1 315 ? 99.549  68.366  92.133  1.00 38.37 ? 315 TYR B CA    1 
ATOM   7496  C  C     . TYR B  1 315 ? 99.916  67.133  91.315  1.00 38.37 ? 315 TYR B C     1 
ATOM   7497  O  O     . TYR B  1 315 ? 100.442 67.282  90.207  1.00 38.37 ? 315 TYR B O     1 
ATOM   7498  C  CB    . TYR B  1 315 ? 100.771 69.276  92.260  1.00 38.37 ? 315 TYR B CB    1 
ATOM   7499  C  CG    . TYR B  1 315 ? 100.437 70.691  92.657  1.00 38.37 ? 315 TYR B CG    1 
ATOM   7500  C  CD1   . TYR B  1 315 ? 99.218  71.256  92.312  1.00 38.37 ? 315 TYR B CD1   1 
ATOM   7501  C  CD2   . TYR B  1 315 ? 101.339 71.463  93.375  1.00 38.37 ? 315 TYR B CD2   1 
ATOM   7502  C  CE1   . TYR B  1 315 ? 98.905  72.550  92.672  1.00 38.37 ? 315 TYR B CE1   1 
ATOM   7503  C  CE2   . TYR B  1 315 ? 101.036 72.758  93.740  1.00 38.37 ? 315 TYR B CE2   1 
ATOM   7504  C  CZ    . TYR B  1 315 ? 99.817  73.296  93.386  1.00 38.37 ? 315 TYR B CZ    1 
ATOM   7505  O  OH    . TYR B  1 315 ? 99.506  74.586  93.746  1.00 38.37 ? 315 TYR B OH    1 
ATOM   7506  N  N     . LEU B  1 316 ? 99.668  65.926  91.818  1.00 39.32 ? 316 LEU B N     1 
ATOM   7507  C  CA    . LEU B  1 316 ? 99.835  64.747  90.975  1.00 39.32 ? 316 LEU B CA    1 
ATOM   7508  C  C     . LEU B  1 316 ? 98.586  63.897  90.840  1.00 39.32 ? 316 LEU B C     1 
ATOM   7509  O  O     . LEU B  1 316 ? 98.530  63.074  89.921  1.00 39.32 ? 316 LEU B O     1 
ATOM   7510  C  CB    . LEU B  1 316 ? 100.978 63.861  91.487  1.00 39.32 ? 316 LEU B CB    1 
ATOM   7511  C  CG    . LEU B  1 316 ? 102.411 64.150  91.028  1.00 39.32 ? 316 LEU B CG    1 
ATOM   7512  C  CD1   . LEU B  1 316 ? 103.000 65.403  91.658  1.00 39.32 ? 316 LEU B CD1   1 
ATOM   7513  C  CD2   . LEU B  1 316 ? 103.291 62.945  91.315  1.00 39.32 ? 316 LEU B CD2   1 
ATOM   7514  N  N     . VAL B  1 317 ? 97.583  64.048  91.704  1.00 37.54 ? 317 VAL B N     1 
ATOM   7515  C  CA    . VAL B  1 317 ? 96.364  63.260  91.634  1.00 37.54 ? 317 VAL B CA    1 
ATOM   7516  C  C     . VAL B  1 317 ? 95.146  64.124  91.339  1.00 37.54 ? 317 VAL B C     1 
ATOM   7517  O  O     . VAL B  1 317 ? 94.337  63.783  90.468  1.00 37.54 ? 317 VAL B O     1 
ATOM   7518  C  CB    . VAL B  1 317 ? 96.155  62.445  92.930  1.00 37.54 ? 317 VAL B CB    1 
ATOM   7519  C  CG1   . VAL B  1 317 ? 94.860  61.647  92.872  1.00 37.54 ? 317 VAL B CG1   1 
ATOM   7520  C  CG2   . VAL B  1 317 ? 97.333  61.519  93.169  1.00 37.54 ? 317 VAL B CG2   1 
ATOM   7521  N  N     . SER B  1 318 ? 95.000  65.259  92.031  1.00 37.44 ? 318 SER B N     1 
ATOM   7522  C  CA    . SER B  1 318 ? 93.790  66.056  91.879  1.00 37.44 ? 318 SER B CA    1 
ATOM   7523  C  C     . SER B  1 318 ? 93.772  66.812  90.558  1.00 37.44 ? 318 SER B C     1 
ATOM   7524  O  O     . SER B  1 318 ? 92.777  66.759  89.829  1.00 37.44 ? 318 SER B O     1 
ATOM   7525  C  CB    . SER B  1 318 ? 93.656  67.031  93.044  1.00 37.44 ? 318 SER B CB    1 
ATOM   7526  O  OG    . SER B  1 318 ? 94.467  68.171  92.833  1.00 37.44 ? 318 SER B OG    1 
ATOM   7527  N  N     . LEU B  1 319 ? 94.861  67.502  90.229  1.00 37.30 ? 319 LEU B N     1 
ATOM   7528  C  CA    . LEU B  1 319 ? 94.979  68.277  88.996  1.00 37.30 ? 319 LEU B CA    1 
ATOM   7529  C  C     . LEU B  1 319 ? 94.900  67.432  87.715  1.00 37.30 ? 319 LEU B C     1 
ATOM   7530  O  O     . LEU B  1 319 ? 94.260  67.890  86.754  1.00 37.30 ? 319 LEU B O     1 
ATOM   7531  C  CB    . LEU B  1 319 ? 96.266  69.114  89.037  1.00 37.30 ? 319 LEU B CB    1 
ATOM   7532  C  CG    . LEU B  1 319 ? 96.688  69.892  87.792  1.00 37.30 ? 319 LEU B CG    1 
ATOM   7533  C  CD1   . LEU B  1 319 ? 95.654  70.942  87.444  1.00 37.30 ? 319 LEU B CD1   1 
ATOM   7534  C  CD2   . LEU B  1 319 ? 98.048  70.529  88.004  1.00 37.30 ? 319 LEU B CD2   1 
ATOM   7535  N  N     . PRO B  1 320 ? 95.485  66.219  87.625  1.00 36.71 ? 320 PRO B N     1 
ATOM   7536  C  CA    . PRO B  1 320 ? 95.150  65.372  86.466  1.00 36.71 ? 320 PRO B CA    1 
ATOM   7537  C  C     . PRO B  1 320 ? 93.698  64.937  86.416  1.00 36.71 ? 320 PRO B C     1 
ATOM   7538  O  O     . PRO B  1 320 ? 93.150  64.806  85.315  1.00 36.71 ? 320 PRO B O     1 
ATOM   7539  C  CB    . PRO B  1 320 ? 96.088  64.171  86.629  1.00 36.71 ? 320 PRO B CB    1 
ATOM   7540  C  CG    . PRO B  1 320 ? 97.249  64.728  87.290  1.00 36.71 ? 320 PRO B CG    1 
ATOM   7541  C  CD    . PRO B  1 320 ? 96.671  65.655  88.309  1.00 36.71 ? 320 PRO B CD    1 
ATOM   7542  N  N     . PHE B  1 321 ? 93.044  64.741  87.564  1.00 34.35 ? 321 PHE B N     1 
ATOM   7543  C  CA    . PHE B  1 321 ? 91.627  64.391  87.541  1.00 34.35 ? 321 PHE B CA    1 
ATOM   7544  C  C     . PHE B  1 321 ? 90.773  65.570  87.094  1.00 34.35 ? 321 PHE B C     1 
ATOM   7545  O  O     . PHE B  1 321 ? 89.784  65.386  86.374  1.00 34.35 ? 321 PHE B O     1 
ATOM   7546  C  CB    . PHE B  1 321 ? 91.174  63.900  88.912  1.00 34.35 ? 321 PHE B CB    1 
ATOM   7547  C  CG    . PHE B  1 321 ? 89.751  63.428  88.939  1.00 34.35 ? 321 PHE B CG    1 
ATOM   7548  C  CD1   . PHE B  1 321 ? 89.412  62.191  88.419  1.00 34.35 ? 321 PHE B CD1   1 
ATOM   7549  C  CD2   . PHE B  1 321 ? 88.750  64.223  89.475  1.00 34.35 ? 321 PHE B CD2   1 
ATOM   7550  C  CE1   . PHE B  1 321 ? 88.103  61.751  88.436  1.00 34.35 ? 321 PHE B CE1   1 
ATOM   7551  C  CE2   . PHE B  1 321 ? 87.439  63.790  89.496  1.00 34.35 ? 321 PHE B CE2   1 
ATOM   7552  C  CZ    . PHE B  1 321 ? 87.115  62.552  88.975  1.00 34.35 ? 321 PHE B CZ    1 
ATOM   7553  N  N     . VAL B  1 322 ? 91.149  66.788  87.495  1.00 33.95 ? 322 VAL B N     1 
ATOM   7554  C  CA    . VAL B  1 322 ? 90.429  67.976  87.048  1.00 33.95 ? 322 VAL B CA    1 
ATOM   7555  C  C     . VAL B  1 322 ? 90.622  68.185  85.550  1.00 33.95 ? 322 VAL B C     1 
ATOM   7556  O  O     . VAL B  1 322 ? 89.667  68.508  84.833  1.00 33.95 ? 322 VAL B O     1 
ATOM   7557  C  CB    . VAL B  1 322 ? 90.871  69.204  87.867  1.00 33.95 ? 322 VAL B CB    1 
ATOM   7558  C  CG1   . VAL B  1 322 ? 90.249  70.482  87.330  1.00 33.95 ? 322 VAL B CG1   1 
ATOM   7559  C  CG2   . VAL B  1 322 ? 90.484  69.025  89.315  1.00 33.95 ? 322 VAL B CG2   1 
ATOM   7560  N  N     . CYS B  1 323 ? 91.840  67.949  85.045  1.00 34.53 ? 323 CYS B N     1 
ATOM   7561  C  CA    . CYS B  1 323 ? 92.084  68.081  83.609  1.00 34.53 ? 323 CYS B CA    1 
ATOM   7562  C  C     . CYS B  1 323 ? 91.342  67.012  82.810  1.00 34.53 ? 323 CYS B C     1 
ATOM   7563  O  O     . CYS B  1 323 ? 90.813  67.296  81.725  1.00 34.53 ? 323 CYS B O     1 
ATOM   7564  C  CB    . CYS B  1 323 ? 93.583  68.020  83.327  1.00 34.53 ? 323 CYS B CB    1 
ATOM   7565  S  SG    . CYS B  1 323 ? 94.484  69.512  83.799  1.00 34.53 ? 323 CYS B SG    1 
ATOM   7566  N  N     . LEU B  1 324 ? 91.262  65.791  83.348  1.00 32.14 ? 324 LEU B N     1 
ATOM   7567  C  CA    . LEU B  1 324 ? 90.492  64.733  82.701  1.00 32.14 ? 324 LEU B CA    1 
ATOM   7568  C  C     . LEU B  1 324 ? 89.002  65.058  82.689  1.00 32.14 ? 324 LEU B C     1 
ATOM   7569  O  O     . LEU B  1 324 ? 88.312  64.802  81.695  1.00 32.14 ? 324 LEU B O     1 
ATOM   7570  C  CB    . LEU B  1 324 ? 90.750  63.402  83.407  1.00 32.14 ? 324 LEU B CB    1 
ATOM   7571  C  CG    . LEU B  1 324 ? 89.781  62.249  83.151  1.00 32.14 ? 324 LEU B CG    1 
ATOM   7572  C  CD1   . LEU B  1 324 ? 90.018  61.656  81.776  1.00 32.14 ? 324 LEU B CD1   1 
ATOM   7573  C  CD2   . LEU B  1 324 ? 89.915  61.190  84.227  1.00 32.14 ? 324 LEU B CD2   1 
ATOM   7574  N  N     . CYS B  1 325 ? 88.496  65.659  83.769  1.00 29.45 ? 325 CYS B N     1 
ATOM   7575  C  CA    . CYS B  1 325 ? 87.085  66.027  83.808  1.00 29.45 ? 325 CYS B CA    1 
ATOM   7576  C  C     . CYS B  1 325 ? 86.772  67.189  82.871  1.00 29.45 ? 325 CYS B C     1 
ATOM   7577  O  O     . CYS B  1 325 ? 85.690  67.218  82.272  1.00 29.45 ? 325 CYS B O     1 
ATOM   7578  C  CB    . CYS B  1 325 ? 86.675  66.360  85.239  1.00 29.45 ? 325 CYS B CB    1 
ATOM   7579  S  SG    . CYS B  1 325 ? 86.325  64.900  86.237  1.00 29.45 ? 325 CYS B SG    1 
ATOM   7580  N  N     . LEU B  1 326 ? 87.706  68.132  82.704  1.00 27.90 ? 326 LEU B N     1 
ATOM   7581  C  CA    . LEU B  1 326 ? 87.506  69.196  81.722  1.00 27.90 ? 326 LEU B CA    1 
ATOM   7582  C  C     . LEU B  1 326 ? 87.523  68.647  80.300  1.00 27.90 ? 326 LEU B C     1 
ATOM   7583  O  O     . LEU B  1 326 ? 86.729  69.080  79.451  1.00 27.90 ? 326 LEU B O     1 
ATOM   7584  C  CB    . LEU B  1 326 ? 88.567  70.287  81.877  1.00 27.90 ? 326 LEU B CB    1 
ATOM   7585  C  CG    . LEU B  1 326 ? 88.638  71.107  83.168  1.00 27.90 ? 326 LEU B CG    1 
ATOM   7586  C  CD1   . LEU B  1 326 ? 89.511  72.336  82.982  1.00 27.90 ? 326 LEU B CD1   1 
ATOM   7587  C  CD2   . LEU B  1 326 ? 87.266  71.489  83.678  1.00 27.90 ? 326 LEU B CD2   1 
ATOM   7588  N  N     . TYR B  1 327 ? 88.405  67.677  80.027  1.00 31.23 ? 327 TYR B N     1 
ATOM   7589  C  CA    . TYR B  1 327 ? 88.420  67.045  78.709  1.00 31.23 ? 327 TYR B CA    1 
ATOM   7590  C  C     . TYR B  1 327 ? 87.139  66.257  78.454  1.00 31.23 ? 327 TYR B C     1 
ATOM   7591  O  O     . TYR B  1 327 ? 86.615  66.257  77.333  1.00 31.23 ? 327 TYR B O     1 
ATOM   7592  C  CB    . TYR B  1 327 ? 89.640  66.136  78.570  1.00 31.23 ? 327 TYR B CB    1 
ATOM   7593  C  CG    . TYR B  1 327 ? 89.553  65.197  77.391  1.00 31.23 ? 327 TYR B CG    1 
ATOM   7594  C  CD1   . TYR B  1 327 ? 89.653  65.676  76.093  1.00 31.23 ? 327 TYR B CD1   1 
ATOM   7595  C  CD2   . TYR B  1 327 ? 89.361  63.833  77.575  1.00 31.23 ? 327 TYR B CD2   1 
ATOM   7596  C  CE1   . TYR B  1 327 ? 89.567  64.824  75.010  1.00 31.23 ? 327 TYR B CE1   1 
ATOM   7597  C  CE2   . TYR B  1 327 ? 89.272  62.973  76.499  1.00 31.23 ? 327 TYR B CE2   1 
ATOM   7598  C  CZ    . TYR B  1 327 ? 89.376  63.474  75.220  1.00 31.23 ? 327 TYR B CZ    1 
ATOM   7599  O  OH    . TYR B  1 327 ? 89.291  62.620  74.146  1.00 31.23 ? 327 TYR B OH    1 
ATOM   7600  N  N     . PHE B  1 328 ? 86.607  65.600  79.487  1.00 30.22 ? 328 PHE B N     1 
ATOM   7601  C  CA    . PHE B  1 328 ? 85.351  64.875  79.327  1.00 30.22 ? 328 PHE B CA    1 
ATOM   7602  C  C     . PHE B  1 328 ? 84.176  65.822  79.126  1.00 30.22 ? 328 PHE B C     1 
ATOM   7603  O  O     . PHE B  1 328 ? 83.245  65.497  78.379  1.00 30.22 ? 328 PHE B O     1 
ATOM   7604  C  CB    . PHE B  1 328 ? 85.102  63.974  80.532  1.00 30.22 ? 328 PHE B CB    1 
ATOM   7605  C  CG    . PHE B  1 328 ? 83.915  63.075  80.375  1.00 30.22 ? 328 PHE B CG    1 
ATOM   7606  C  CD1   . PHE B  1 328 ? 83.934  62.040  79.456  1.00 30.22 ? 328 PHE B CD1   1 
ATOM   7607  C  CD2   . PHE B  1 328 ? 82.779  63.264  81.144  1.00 30.22 ? 328 PHE B CD2   1 
ATOM   7608  C  CE1   . PHE B  1 328 ? 82.841  61.206  79.305  1.00 30.22 ? 328 PHE B CE1   1 
ATOM   7609  C  CE2   . PHE B  1 328 ? 81.681  62.434  81.001  1.00 30.22 ? 328 PHE B CE2   1 
ATOM   7610  C  CZ    . PHE B  1 328 ? 81.712  61.404  80.080  1.00 30.22 ? 328 PHE B CZ    1 
ATOM   7611  N  N     . SER B  1 329 ? 84.212  66.998  79.760  1.00 27.45 ? 329 SER B N     1 
ATOM   7612  C  CA    . SER B  1 329 ? 83.181  68.004  79.522  1.00 27.45 ? 329 SER B CA    1 
ATOM   7613  C  C     . SER B  1 329 ? 83.236  68.526  78.091  1.00 27.45 ? 329 SER B C     1 
ATOM   7614  O  O     . SER B  1 329 ? 82.191  68.726  77.457  1.00 27.45 ? 329 SER B O     1 
ATOM   7615  C  CB    . SER B  1 329 ? 83.333  69.152  80.514  1.00 27.45 ? 329 SER B CB    1 
ATOM   7616  O  OG    . SER B  1 329 ? 82.372  70.159  80.267  1.00 27.45 ? 329 SER B OG    1 
ATOM   7617  N  N     . LEU B  1 330 ? 84.446  68.720  77.555  1.00 29.01 ? 330 LEU B N     1 
ATOM   7618  C  CA    . LEU B  1 330 ? 84.573  69.105  76.150  1.00 29.01 ? 330 LEU B CA    1 
ATOM   7619  C  C     . LEU B  1 330 ? 84.110  67.995  75.209  1.00 29.01 ? 330 LEU B C     1 
ATOM   7620  O  O     . LEU B  1 330 ? 83.542  68.280  74.146  1.00 29.01 ? 330 LEU B O     1 
ATOM   7621  C  CB    . LEU B  1 330 ? 86.016  69.493  75.834  1.00 29.01 ? 330 LEU B CB    1 
ATOM   7622  C  CG    . LEU B  1 330 ? 86.598  70.719  76.539  1.00 29.01 ? 330 LEU B CG    1 
ATOM   7623  C  CD1   . LEU B  1 330 ? 87.865  71.172  75.838  1.00 29.01 ? 330 LEU B CD1   1 
ATOM   7624  C  CD2   . LEU B  1 330 ? 85.590  71.852  76.613  1.00 29.01 ? 330 LEU B CD2   1 
ATOM   7625  N  N     . TYR B  1 331 ? 84.315  66.732  75.591  1.00 29.74 ? 331 TYR B N     1 
ATOM   7626  C  CA    . TYR B  1 331 ? 83.867  65.622  74.753  1.00 29.74 ? 331 TYR B CA    1 
ATOM   7627  C  C     . TYR B  1 331 ? 82.344  65.513  74.732  1.00 29.74 ? 331 TYR B C     1 
ATOM   7628  O  O     . TYR B  1 331 ? 81.748  65.253  73.677  1.00 29.74 ? 331 TYR B O     1 
ATOM   7629  C  CB    . TYR B  1 331 ? 84.501  64.322  75.238  1.00 29.74 ? 331 TYR B CB    1 
ATOM   7630  C  CG    . TYR B  1 331 ? 84.123  63.116  74.420  1.00 29.74 ? 331 TYR B CG    1 
ATOM   7631  C  CD1   . TYR B  1 331 ? 84.515  63.005  73.093  1.00 29.74 ? 331 TYR B CD1   1 
ATOM   7632  C  CD2   . TYR B  1 331 ? 83.393  62.078  74.979  1.00 29.74 ? 331 TYR B CD2   1 
ATOM   7633  C  CE1   . TYR B  1 331 ? 84.173  61.901  72.339  1.00 29.74 ? 331 TYR B CE1   1 
ATOM   7634  C  CE2   . TYR B  1 331 ? 83.049  60.968  74.235  1.00 29.74 ? 331 TYR B CE2   1 
ATOM   7635  C  CZ    . TYR B  1 331 ? 83.441  60.885  72.916  1.00 29.74 ? 331 TYR B CZ    1 
ATOM   7636  O  OH    . TYR B  1 331 ? 83.101  59.782  72.171  1.00 29.74 ? 331 TYR B OH    1 
ATOM   7637  N  N     . VAL B  1 332 ? 81.696  65.728  75.881  1.00 28.57 ? 332 VAL B N     1 
ATOM   7638  C  CA    . VAL B  1 332 ? 80.235  65.790  75.913  1.00 28.57 ? 332 VAL B CA    1 
ATOM   7639  C  C     . VAL B  1 332 ? 79.711  67.001  75.140  1.00 28.57 ? 332 VAL B C     1 
ATOM   7640  O  O     . VAL B  1 332 ? 78.661  66.907  74.485  1.00 28.57 ? 332 VAL B O     1 
ATOM   7641  C  CB    . VAL B  1 332 ? 79.751  65.767  77.378  1.00 28.57 ? 332 VAL B CB    1 
ATOM   7642  C  CG1   . VAL B  1 332 ? 78.247  65.887  77.477  1.00 28.57 ? 332 VAL B CG1   1 
ATOM   7643  C  CG2   . VAL B  1 332 ? 80.169  64.470  78.034  1.00 28.57 ? 332 VAL B CG2   1 
ATOM   7644  N  N     . MET B  1 333 ? 80.449  68.118  75.146  1.00 30.84 ? 333 MET B N     1 
ATOM   7645  C  CA    . MET B  1 333 ? 80.082  69.268  74.319  1.00 30.84 ? 333 MET B CA    1 
ATOM   7646  C  C     . MET B  1 333 ? 80.129  68.927  72.831  1.00 30.84 ? 333 MET B C     1 
ATOM   7647  O  O     . MET B  1 333 ? 79.229  69.305  72.069  1.00 30.84 ? 333 MET B O     1 
ATOM   7648  C  CB    . MET B  1 333 ? 81.006  70.444  74.624  1.00 30.84 ? 333 MET B CB    1 
ATOM   7649  C  CG    . MET B  1 333 ? 80.716  71.681  73.804  1.00 30.84 ? 333 MET B CG    1 
ATOM   7650  S  SD    . MET B  1 333 ? 82.012  72.921  73.919  1.00 30.84 ? 333 MET B SD    1 
ATOM   7651  C  CE    . MET B  1 333 ? 83.256  72.214  72.849  1.00 30.84 ? 333 MET B CE    1 
ATOM   7652  N  N     . MET B  1 334 ? 81.160  68.193  72.406  1.00 32.53 ? 334 MET B N     1 
ATOM   7653  C  CA    . MET B  1 334 ? 81.246  67.796  71.001  1.00 32.53 ? 334 MET B CA    1 
ATOM   7654  C  C     . MET B  1 334 ? 80.160  66.792  70.622  1.00 32.53 ? 334 MET B C     1 
ATOM   7655  O  O     . MET B  1 334 ? 79.657  66.828  69.489  1.00 32.53 ? 334 MET B O     1 
ATOM   7656  C  CB    . MET B  1 334 ? 82.628  67.226  70.693  1.00 32.53 ? 334 MET B CB    1 
ATOM   7657  C  CG    . MET B  1 334 ? 83.758  68.233  70.824  1.00 32.53 ? 334 MET B CG    1 
ATOM   7658  S  SD    . MET B  1 334 ? 83.421  69.798  69.996  1.00 32.53 ? 334 MET B SD    1 
ATOM   7659  C  CE    . MET B  1 334 ? 83.447  69.298  68.278  1.00 32.53 ? 334 MET B CE    1 
ATOM   7660  N  N     . ILE B  1 335 ? 79.777  65.910  71.554  1.00 33.30 ? 335 ILE B N     1 
ATOM   7661  C  CA    . ILE B  1 335 ? 78.636  65.020  71.324  1.00 33.30 ? 335 ILE B CA    1 
ATOM   7662  C  C     . ILE B  1 335 ? 77.350  65.824  71.147  1.00 33.30 ? 335 ILE B C     1 
ATOM   7663  O  O     . ILE B  1 335 ? 76.535  65.532  70.258  1.00 33.30 ? 335 ILE B O     1 
ATOM   7664  C  CB    . ILE B  1 335 ? 78.515  63.993  72.468  1.00 33.30 ? 335 ILE B CB    1 
ATOM   7665  C  CG1   . ILE B  1 335 ? 79.663  62.990  72.410  1.00 33.30 ? 335 ILE B CG1   1 
ATOM   7666  C  CG2   . ILE B  1 335 ? 77.188  63.251  72.437  1.00 33.30 ? 335 ILE B CG2   1 
ATOM   7667  C  CD1   . ILE B  1 335 ? 79.686  62.053  73.590  1.00 33.30 ? 335 ILE B CD1   1 
ATOM   7668  N  N     . TYR B  1 336 ? 77.172  66.873  71.959  1.00 34.83 ? 336 TYR B N     1 
ATOM   7669  C  CA    . TYR B  1 336 ? 75.993  67.729  71.828  1.00 34.83 ? 336 TYR B CA    1 
ATOM   7670  C  C     . TYR B  1 336 ? 75.985  68.472  70.498  1.00 34.83 ? 336 TYR B C     1 
ATOM   7671  O  O     . TYR B  1 336 ? 74.925  68.648  69.892  1.00 34.83 ? 336 TYR B O     1 
ATOM   7672  C  CB    . TYR B  1 336 ? 75.920  68.721  72.990  1.00 34.83 ? 336 TYR B CB    1 
ATOM   7673  C  CG    . TYR B  1 336 ? 75.121  69.976  72.693  1.00 34.83 ? 336 TYR B CG    1 
ATOM   7674  C  CD1   . TYR B  1 336 ? 73.738  69.930  72.544  1.00 34.83 ? 336 TYR B CD1   1 
ATOM   7675  C  CD2   . TYR B  1 336 ? 75.750  71.206  72.567  1.00 34.83 ? 336 TYR B CD2   1 
ATOM   7676  C  CE1   . TYR B  1 336 ? 73.012  71.071  72.271  1.00 34.83 ? 336 TYR B CE1   1 
ATOM   7677  C  CE2   . TYR B  1 336 ? 75.031  72.352  72.297  1.00 34.83 ? 336 TYR B CE2   1 
ATOM   7678  C  CZ    . TYR B  1 336 ? 73.665  72.278  72.150  1.00 34.83 ? 336 TYR B CZ    1 
ATOM   7679  O  OH    . TYR B  1 336 ? 72.948  73.418  71.881  1.00 34.83 ? 336 TYR B OH    1 
ATOM   7680  N  N     . PHE B  1 337 ? 77.150  68.895  70.015  1.00 35.92 ? 337 PHE B N     1 
ATOM   7681  C  CA    . PHE B  1 337 ? 77.166  69.599  68.736  1.00 35.92 ? 337 PHE B CA    1 
ATOM   7682  C  C     . PHE B  1 337 ? 76.930  68.663  67.556  1.00 35.92 ? 337 PHE B C     1 
ATOM   7683  O  O     . PHE B  1 337 ? 76.292  69.066  66.572  1.00 35.92 ? 337 PHE B O     1 
ATOM   7684  C  CB    . PHE B  1 337 ? 78.472  70.365  68.571  1.00 35.92 ? 337 PHE B CB    1 
ATOM   7685  C  CG    . PHE B  1 337 ? 78.439  71.714  69.207  1.00 35.92 ? 337 PHE B CG    1 
ATOM   7686  C  CD1   . PHE B  1 337 ? 77.654  72.718  68.674  1.00 35.92 ? 337 PHE B CD1   1 
ATOM   7687  C  CD2   . PHE B  1 337 ? 79.159  71.969  70.357  1.00 35.92 ? 337 PHE B CD2   1 
ATOM   7688  C  CE1   . PHE B  1 337 ? 77.605  73.955  69.266  1.00 35.92 ? 337 PHE B CE1   1 
ATOM   7689  C  CE2   . PHE B  1 337 ? 79.111  73.201  70.953  1.00 35.92 ? 337 PHE B CE2   1 
ATOM   7690  C  CZ    . PHE B  1 337 ? 78.336  74.194  70.408  1.00 35.92 ? 337 PHE B CZ    1 
ATOM   7691  N  N     . ASP B  1 338 ? 77.399  67.414  67.647  1.00 42.77 ? 338 ASP B N     1 
ATOM   7692  C  CA    . ASP B  1 338 ? 77.044  66.423  66.633  1.00 42.77 ? 338 ASP B CA    1 
ATOM   7693  C  C     . ASP B  1 338 ? 75.549  66.121  66.656  1.00 42.77 ? 338 ASP B C     1 
ATOM   7694  O  O     . ASP B  1 338 ? 74.926  65.953  65.600  1.00 42.77 ? 338 ASP B O     1 
ATOM   7695  C  CB    . ASP B  1 338 ? 77.855  65.146  66.839  1.00 42.77 ? 338 ASP B CB    1 
ATOM   7696  C  CG    . ASP B  1 338 ? 79.327  65.340  66.543  1.00 42.77 ? 338 ASP B CG    1 
ATOM   7697  O  OD1   . ASP B  1 338 ? 79.683  66.385  65.957  1.00 42.77 ? 338 ASP B OD1   1 
ATOM   7698  O  OD2   . ASP B  1 338 ? 80.129  64.449  66.895  1.00 42.77 ? 338 ASP B OD2   1 
ATOM   7699  N  N     . MET B  1 339 ? 74.952  66.088  67.851  1.00 50.33 ? 339 MET B N     1 
ATOM   7700  C  CA    . MET B  1 339 ? 73.506  65.918  67.967  1.00 50.33 ? 339 MET B CA    1 
ATOM   7701  C  C     . MET B  1 339 ? 72.749  67.119  67.406  1.00 50.33 ? 339 MET B C     1 
ATOM   7702  O  O     . MET B  1 339 ? 71.682  66.953  66.807  1.00 50.33 ? 339 MET B O     1 
ATOM   7703  C  CB    . MET B  1 339 ? 73.132  65.680  69.431  1.00 50.33 ? 339 MET B CB    1 
ATOM   7704  C  CG    . MET B  1 339 ? 71.650  65.473  69.698  1.00 50.33 ? 339 MET B CG    1 
ATOM   7705  S  SD    . MET B  1 339 ? 71.345  64.423  71.129  1.00 50.33 ? 339 MET B SD    1 
ATOM   7706  C  CE    . MET B  1 339 ? 72.221  62.939  70.645  1.00 50.33 ? 339 MET B CE    1 
ATOM   7707  N  N     . GLU B  1 340 ? 73.300  68.323  67.564  1.00 49.96 ? 340 GLU B N     1 
ATOM   7708  C  CA    . GLU B  1 340 ? 72.675  69.523  67.013  1.00 49.96 ? 340 GLU B CA    1 
ATOM   7709  C  C     . GLU B  1 340 ? 72.705  69.516  65.489  1.00 49.96 ? 340 GLU B C     1 
ATOM   7710  O  O     . GLU B  1 340 ? 71.712  69.875  64.842  1.00 49.96 ? 340 GLU B O     1 
ATOM   7711  C  CB    . GLU B  1 340 ? 73.378  70.767  67.557  1.00 49.96 ? 340 GLU B CB    1 
ATOM   7712  C  CG    . GLU B  1 340 ? 72.812  72.081  67.057  1.00 49.96 ? 340 GLU B CG    1 
ATOM   7713  C  CD    . GLU B  1 340 ? 71.677  72.586  67.918  1.00 49.96 ? 340 GLU B CD    1 
ATOM   7714  O  OE1   . GLU B  1 340 ? 71.642  72.237  69.115  1.00 49.96 ? 340 GLU B OE1   1 
ATOM   7715  O  OE2   . GLU B  1 340 ? 70.819  73.331  67.400  1.00 49.96 ? 340 GLU B OE2   1 
ATOM   7716  N  N     . VAL B  1 341 ? 73.832  69.099  64.902  1.00 55.03 ? 341 VAL B N     1 
ATOM   7717  C  CA    . VAL B  1 341 ? 73.925  68.986  63.446  1.00 55.03 ? 341 VAL B CA    1 
ATOM   7718  C  C     . VAL B  1 341 ? 72.994  67.890  62.924  1.00 55.03 ? 341 VAL B C     1 
ATOM   7719  O  O     . VAL B  1 341 ? 72.340  68.062  61.883  1.00 55.03 ? 341 VAL B O     1 
ATOM   7720  C  CB    . VAL B  1 341 ? 75.396  68.751  63.045  1.00 55.03 ? 341 VAL B CB    1 
ATOM   7721  C  CG1   . VAL B  1 341 ? 75.532  68.385  61.573  1.00 55.03 ? 341 VAL B CG1   1 
ATOM   7722  C  CG2   . VAL B  1 341 ? 76.220  69.989  63.353  1.00 55.03 ? 341 VAL B CG2   1 
ATOM   7723  N  N     . TRP B  1 342 ? 72.874  66.780  63.661  1.00 61.42 ? 342 TRP B N     1 
ATOM   7724  C  CA    . TRP B  1 342 ? 71.942  65.717  63.290  1.00 61.42 ? 342 TRP B CA    1 
ATOM   7725  C  C     . TRP B  1 342 ? 70.488  66.178  63.365  1.00 61.42 ? 342 TRP B C     1 
ATOM   7726  O  O     . TRP B  1 342 ? 69.687  65.837  62.488  1.00 61.42 ? 342 TRP B O     1 
ATOM   7727  C  CB    . TRP B  1 342 ? 72.177  64.504  64.191  1.00 61.42 ? 342 TRP B CB    1 
ATOM   7728  C  CG    . TRP B  1 342 ? 71.132  63.436  64.116  1.00 61.42 ? 342 TRP B CG    1 
ATOM   7729  C  CD1   . TRP B  1 342 ? 71.108  62.374  63.262  1.00 61.42 ? 342 TRP B CD1   1 
ATOM   7730  C  CD2   . TRP B  1 342 ? 69.977  63.304  64.953  1.00 61.42 ? 342 TRP B CD2   1 
ATOM   7731  N  NE1   . TRP B  1 342 ? 70.000  61.598  63.502  1.00 61.42 ? 342 TRP B NE1   1 
ATOM   7732  C  CE2   . TRP B  1 342 ? 69.289  62.148  64.536  1.00 61.42 ? 342 TRP B CE2   1 
ATOM   7733  C  CE3   . TRP B  1 342 ? 69.450  64.060  66.004  1.00 61.42 ? 342 TRP B CE3   1 
ATOM   7734  C  CZ2   . TRP B  1 342 ? 68.105  61.728  65.135  1.00 61.42 ? 342 TRP B CZ2   1 
ATOM   7735  C  CZ3   . TRP B  1 342 ? 68.275  63.641  66.599  1.00 61.42 ? 342 TRP B CZ3   1 
ATOM   7736  C  CH2   . TRP B  1 342 ? 67.615  62.486  66.163  1.00 61.42 ? 342 TRP B CH2   1 
ATOM   7737  N  N     . ALA B  1 343 ? 70.138  66.972  64.378  1.00 62.22 ? 343 ALA B N     1 
ATOM   7738  C  CA    . ALA B  1 343 ? 68.780  67.496  64.482  1.00 62.22 ? 343 ALA B CA    1 
ATOM   7739  C  C     . ALA B  1 343 ? 68.489  68.550  63.424  1.00 62.22 ? 343 ALA B C     1 
ATOM   7740  O  O     . ALA B  1 343 ? 67.353  68.643  62.948  1.00 62.22 ? 343 ALA B O     1 
ATOM   7741  C  CB    . ALA B  1 343 ? 68.541  68.075  65.876  1.00 62.22 ? 343 ALA B CB    1 
ATOM   7742  N  N     . LEU B  1 344 ? 69.494  69.335  63.027  1.00 66.03 ? 344 LEU B N     1 
ATOM   7743  C  CA    . LEU B  1 344 ? 69.308  70.270  61.922  1.00 66.03 ? 344 LEU B CA    1 
ATOM   7744  C  C     . LEU B  1 344 ? 69.114  69.548  60.595  1.00 66.03 ? 344 LEU B C     1 
ATOM   7745  O  O     . LEU B  1 344 ? 68.288  69.972  59.777  1.00 66.03 ? 344 LEU B O     1 
ATOM   7746  C  CB    . LEU B  1 344 ? 70.498  71.225  61.833  1.00 66.03 ? 344 LEU B CB    1 
ATOM   7747  C  CG    . LEU B  1 344 ? 70.297  72.456  60.950  1.00 66.03 ? 344 LEU B CG    1 
ATOM   7748  C  CD1   . LEU B  1 344 ? 69.197  73.338  61.517  1.00 66.03 ? 344 LEU B CD1   1 
ATOM   7749  C  CD2   . LEU B  1 344 ? 71.595  73.233  60.811  1.00 66.03 ? 344 LEU B CD2   1 
ATOM   7750  N  N     . GLY B  1 345 ? 69.841  68.449  60.375  1.00 70.59 ? 345 GLY B N     1 
ATOM   7751  C  CA    . GLY B  1 345 ? 69.597  67.633  59.196  1.00 70.59 ? 345 GLY B CA    1 
ATOM   7752  C  C     . GLY B  1 345 ? 68.241  66.952  59.211  1.00 70.59 ? 345 GLY B C     1 
ATOM   7753  O  O     . GLY B  1 345 ? 67.598  66.818  58.163  1.00 70.59 ? 345 GLY B O     1 
ATOM   7754  N  N     . LEU B  1 346 ? 67.782  66.528  60.392  1.00 71.66 ? 346 LEU B N     1 
ATOM   7755  C  CA    . LEU B  1 346 ? 66.441  65.962  60.516  1.00 71.66 ? 346 LEU B CA    1 
ATOM   7756  C  C     . LEU B  1 346 ? 65.361  67.011  60.276  1.00 71.66 ? 346 LEU B C     1 
ATOM   7757  O  O     . LEU B  1 346 ? 64.293  66.687  59.746  1.00 71.66 ? 346 LEU B O     1 
ATOM   7758  C  CB    . LEU B  1 346 ? 66.266  65.332  61.896  1.00 71.66 ? 346 LEU B CB    1 
ATOM   7759  C  CG    . LEU B  1 346 ? 65.379  64.090  61.974  1.00 71.66 ? 346 LEU B CG    1 
ATOM   7760  C  CD1   . LEU B  1 346 ? 65.860  63.033  60.995  1.00 71.66 ? 346 LEU B CD1   1 
ATOM   7761  C  CD2   . LEU B  1 346 ? 65.351  63.543  63.392  1.00 71.66 ? 346 LEU B CD2   1 
ATOM   7762  N  N     . HIS B  1 347 ? 65.618  68.262  60.663  1.00 77.54 ? 347 HIS B N     1 
ATOM   7763  C  CA    . HIS B  1 347 ? 64.696  69.346  60.344  1.00 77.54 ? 347 HIS B CA    1 
ATOM   7764  C  C     . HIS B  1 347 ? 64.697  69.655  58.853  1.00 77.54 ? 347 HIS B C     1 
ATOM   7765  O  O     . HIS B  1 347 ? 63.647  69.978  58.285  1.00 77.54 ? 347 HIS B O     1 
ATOM   7766  C  CB    . HIS B  1 347 ? 65.057  70.590  61.159  1.00 77.54 ? 347 HIS B CB    1 
ATOM   7767  C  CG    . HIS B  1 347 ? 64.620  71.881  60.537  1.00 77.54 ? 347 HIS B CG    1 
ATOM   7768  N  ND1   . HIS B  1 347 ? 63.341  72.376  60.671  1.00 77.54 ? 347 HIS B ND1   1 
ATOM   7769  C  CD2   . HIS B  1 347 ? 65.299  72.788  59.796  1.00 77.54 ? 347 HIS B CD2   1 
ATOM   7770  C  CE1   . HIS B  1 347 ? 63.248  73.527  60.028  1.00 77.54 ? 347 HIS B CE1   1 
ATOM   7771  N  NE2   . HIS B  1 347 ? 64.422  73.799  59.488  1.00 77.54 ? 347 HIS B NE2   1 
ATOM   7772  N  N     . GLU B  1 348 ? 65.861  69.554  58.208  1.00 78.96 ? 348 GLU B N     1 
ATOM   7773  C  CA    . GLU B  1 348 ? 65.937  69.705  56.758  1.00 78.96 ? 348 GLU B CA    1 
ATOM   7774  C  C     . GLU B  1 348 ? 65.246  68.562  56.023  1.00 78.96 ? 348 GLU B C     1 
ATOM   7775  O  O     . GLU B  1 348 ? 64.796  68.745  54.886  1.00 78.96 ? 348 GLU B O     1 
ATOM   7776  C  CB    . GLU B  1 348 ? 67.399  69.793  56.318  1.00 78.96 ? 348 GLU B CB    1 
ATOM   7777  C  CG    . GLU B  1 348 ? 67.622  70.572  55.035  1.00 78.96 ? 348 GLU B CG    1 
ATOM   7778  C  CD    . GLU B  1 348 ? 69.074  70.960  54.837  1.00 78.96 ? 348 GLU B CD    1 
ATOM   7779  O  OE1   . GLU B  1 348 ? 69.668  71.539  55.771  1.00 78.96 ? 348 GLU B OE1   1 
ATOM   7780  O  OE2   . GLU B  1 348 ? 69.622  70.685  53.749  1.00 78.96 ? 348 GLU B OE2   1 
ATOM   7781  N  N     . ASN B  1 349 ? 65.151  67.388  56.648  1.00 82.74 ? 349 ASN B N     1 
ATOM   7782  C  CA    . ASN B  1 349 ? 64.585  66.213  55.996  1.00 82.74 ? 349 ASN B CA    1 
ATOM   7783  C  C     . ASN B  1 349 ? 63.059  66.187  56.055  1.00 82.74 ? 349 ASN B C     1 
ATOM   7784  O  O     . ASN B  1 349 ? 62.398  66.149  55.013  1.00 82.74 ? 349 ASN B O     1 
ATOM   7785  C  CB    . ASN B  1 349 ? 65.154  64.942  56.637  1.00 82.74 ? 349 ASN B CB    1 
ATOM   7786  C  CG    . ASN B  1 349 ? 64.797  63.675  55.870  1.00 82.74 ? 349 ASN B CG    1 
ATOM   7787  O  OD1   . ASN B  1 349 ? 64.305  63.723  54.741  1.00 82.74 ? 349 ASN B OD1   1 
ATOM   7788  N  ND2   . ASN B  1 349 ? 65.042  62.527  56.492  1.00 82.74 ? 349 ASN B ND2   1 
ATOM   7789  N  N     . SER B  1 350 ? 62.491  66.205  57.262  1.00 84.68 ? 350 SER B N     1 
ATOM   7790  C  CA    . SER B  1 350 ? 61.125  65.728  57.460  1.00 84.68 ? 350 SER B CA    1 
ATOM   7791  C  C     . SER B  1 350 ? 60.038  66.712  57.035  1.00 84.68 ? 350 SER B C     1 
ATOM   7792  O  O     . SER B  1 350 ? 59.274  66.426  56.108  1.00 84.68 ? 350 SER B O     1 
ATOM   7793  C  CB    . SER B  1 350 ? 60.918  65.353  58.929  1.00 84.68 ? 350 SER B CB    1 
ATOM   7794  N  N     . GLY B  1 351 ? 59.950  67.860  57.694  1.00 86.35 ? 351 GLY B N     1 
ATOM   7795  C  CA    . GLY B  1 351 ? 58.821  68.733  57.470  1.00 86.35 ? 351 GLY B CA    1 
ATOM   7796  C  C     . GLY B  1 351 ? 59.021  70.104  58.075  1.00 86.35 ? 351 GLY B C     1 
ATOM   7797  O  O     . GLY B  1 351 ? 60.147  70.576  58.240  1.00 86.35 ? 351 GLY B O     1 
ATOM   7798  N  N     . SER B  1 352 ? 57.897  70.744  58.405  1.00 84.52 ? 352 SER B N     1 
ATOM   7799  C  CA    . SER B  1 352 ? 57.911  72.120  58.886  1.00 84.52 ? 352 SER B CA    1 
ATOM   7800  C  C     . SER B  1 352 ? 57.252  72.266  60.253  1.00 84.52 ? 352 SER B C     1 
ATOM   7801  O  O     . SER B  1 352 ? 57.709  73.059  61.082  1.00 84.52 ? 352 SER B O     1 
ATOM   7802  C  CB    . SER B  1 352 ? 57.219  73.036  57.875  1.00 84.52 ? 352 SER B CB    1 
ATOM   7803  N  N     . GLU B  1 353 ? 56.175  71.518  60.495  1.00 83.21 ? 353 GLU B N     1 
ATOM   7804  C  CA    . GLU B  1 353 ? 55.387  71.689  61.711  1.00 83.21 ? 353 GLU B CA    1 
ATOM   7805  C  C     . GLU B  1 353 ? 56.063  71.122  62.952  1.00 83.21 ? 353 GLU B C     1 
ATOM   7806  O  O     . GLU B  1 353 ? 56.147  71.817  63.971  1.00 83.21 ? 353 GLU B O     1 
ATOM   7807  C  CB    . GLU B  1 353 ? 54.012  71.038  61.540  1.00 83.21 ? 353 GLU B CB    1 
ATOM   7808  N  N     . TRP B  1 354 ? 56.545  69.882  62.896  1.00 85.12 ? 354 TRP B N     1 
ATOM   7809  C  CA    . TRP B  1 354 ? 57.197  69.246  64.032  1.00 85.12 ? 354 TRP B CA    1 
ATOM   7810  C  C     . TRP B  1 354 ? 58.709  69.393  64.006  1.00 85.12 ? 354 TRP B C     1 
ATOM   7811  O  O     . TRP B  1 354 ? 59.380  68.910  64.921  1.00 85.12 ? 354 TRP B O     1 
ATOM   7812  C  CB    . TRP B  1 354 ? 56.835  67.760  64.085  1.00 85.12 ? 354 TRP B CB    1 
ATOM   7813  C  CG    . TRP B  1 354 ? 55.426  67.497  64.501  1.00 85.12 ? 354 TRP B CG    1 
ATOM   7814  C  CD1   . TRP B  1 354 ? 54.594  68.348  65.166  1.00 85.12 ? 354 TRP B CD1   1 
ATOM   7815  C  CD2   . TRP B  1 354 ? 54.674  66.300  64.268  1.00 85.12 ? 354 TRP B CD2   1 
ATOM   7816  N  NE1   . TRP B  1 354 ? 53.372  67.754  65.368  1.00 85.12 ? 354 TRP B NE1   1 
ATOM   7817  C  CE2   . TRP B  1 354 ? 53.395  66.496  64.824  1.00 85.12 ? 354 TRP B CE2   1 
ATOM   7818  C  CE3   . TRP B  1 354 ? 54.959  65.082  63.643  1.00 85.12 ? 354 TRP B CE3   1 
ATOM   7819  C  CZ2   . TRP B  1 354 ? 52.403  65.519  64.776  1.00 85.12 ? 354 TRP B CZ2   1 
ATOM   7820  C  CZ3   . TRP B  1 354 ? 53.974  64.112  63.596  1.00 85.12 ? 354 TRP B CZ3   1 
ATOM   7821  C  CH2   . TRP B  1 354 ? 52.711  64.336  64.159  1.00 85.12 ? 354 TRP B CH2   1 
ATOM   7822  N  N     . THR B  1 355 ? 59.263  70.038  62.984  1.00 80.04 ? 355 THR B N     1 
ATOM   7823  C  CA    . THR B  1 355 ? 60.704  70.176  62.857  1.00 80.04 ? 355 THR B CA    1 
ATOM   7824  C  C     . THR B  1 355 ? 61.198  71.565  63.226  1.00 80.04 ? 355 THR B C     1 
ATOM   7825  O  O     . THR B  1 355 ? 62.329  71.919  62.882  1.00 80.04 ? 355 THR B O     1 
ATOM   7826  C  CB    . THR B  1 355 ? 61.148  69.820  61.438  1.00 80.04 ? 355 THR B CB    1 
ATOM   7827  O  OG1   . THR B  1 355 ? 60.835  70.900  60.551  1.00 80.04 ? 355 THR B OG1   1 
ATOM   7828  C  CG2   . THR B  1 355 ? 60.446  68.560  60.976  1.00 80.04 ? 355 THR B CG2   1 
ATOM   7829  N  N     . SER B  1 356 ? 60.371  72.367  63.893  1.00 75.56 ? 356 SER B N     1 
ATOM   7830  C  CA    . SER B  1 356 ? 60.833  73.585  64.546  1.00 75.56 ? 356 SER B CA    1 
ATOM   7831  C  C     . SER B  1 356 ? 60.932  73.400  66.054  1.00 75.56 ? 356 SER B C     1 
ATOM   7832  O  O     . SER B  1 356 ? 61.720  74.084  66.715  1.00 75.56 ? 356 SER B O     1 
ATOM   7833  C  CB    . SER B  1 356 ? 59.898  74.752  64.217  1.00 75.56 ? 356 SER B CB    1 
ATOM   7834  O  OG    . SER B  1 356 ? 60.295  75.928  64.902  1.00 75.56 ? 356 SER B OG    1 
ATOM   7835  N  N     . VAL B  1 357 ? 60.150  72.471  66.600  1.00 68.87 ? 357 VAL B N     1 
ATOM   7836  C  CA    . VAL B  1 357 ? 60.138  72.171  68.026  1.00 68.87 ? 357 VAL B CA    1 
ATOM   7837  C  C     . VAL B  1 357 ? 61.312  71.236  68.296  1.00 68.87 ? 357 VAL B C     1 
ATOM   7838  O  O     . VAL B  1 357 ? 61.885  71.223  69.392  1.00 68.87 ? 357 VAL B O     1 
ATOM   7839  C  CB    . VAL B  1 357 ? 58.776  71.560  68.423  1.00 68.87 ? 357 VAL B CB    1 
ATOM   7840  C  CG1   . VAL B  1 357 ? 58.731  71.105  69.880  1.00 68.87 ? 357 VAL B CG1   1 
ATOM   7841  C  CG2   . VAL B  1 357 ? 57.658  72.547  68.132  1.00 68.87 ? 357 VAL B CG2   1 
ATOM   7842  N  N     . LEU B  1 358 ? 61.730  70.508  67.262  1.00 65.66 ? 358 LEU B N     1 
ATOM   7843  C  CA    . LEU B  1 358 ? 62.828  69.556  67.349  1.00 65.66 ? 358 LEU B CA    1 
ATOM   7844  C  C     . LEU B  1 358 ? 64.186  70.220  67.548  1.00 65.66 ? 358 LEU B C     1 
ATOM   7845  O  O     . LEU B  1 358 ? 65.117  69.562  68.024  1.00 65.66 ? 358 LEU B O     1 
ATOM   7846  C  CB    . LEU B  1 358 ? 62.853  68.686  66.084  1.00 65.66 ? 358 LEU B CB    1 
ATOM   7847  C  CG    . LEU B  1 358 ? 63.658  67.386  66.068  1.00 65.66 ? 358 LEU B CG    1 
ATOM   7848  C  CD1   . LEU B  1 358 ? 63.258  66.503  67.235  1.00 65.66 ? 358 LEU B CD1   1 
ATOM   7849  C  CD2   . LEU B  1 358 ? 63.473  66.658  64.749  1.00 65.66 ? 358 LEU B CD2   1 
ATOM   7850  N  N     . LEU B  1 359 ? 64.320  71.507  67.228  1.00 64.04 ? 359 LEU B N     1 
ATOM   7851  C  CA    . LEU B  1 359 ? 65.572  72.219  67.453  1.00 64.04 ? 359 LEU B CA    1 
ATOM   7852  C  C     . LEU B  1 359 ? 65.805  72.583  68.912  1.00 64.04 ? 359 LEU B C     1 
ATOM   7853  O  O     . LEU B  1 359 ? 66.944  72.893  69.280  1.00 64.04 ? 359 LEU B O     1 
ATOM   7854  C  CB    . LEU B  1 359 ? 65.627  73.500  66.612  1.00 64.04 ? 359 LEU B CB    1 
ATOM   7855  C  CG    . LEU B  1 359 ? 66.171  73.448  65.181  1.00 64.04 ? 359 LEU B CG    1 
ATOM   7856  C  CD1   . LEU B  1 359 ? 65.240  72.719  64.227  1.00 64.04 ? 359 LEU B CD1   1 
ATOM   7857  C  CD2   . LEU B  1 359 ? 66.447  74.860  64.686  1.00 64.04 ? 359 LEU B CD2   1 
ATOM   7858  N  N     . TYR B  1 360 ? 64.769  72.559  69.748  1.00 54.53 ? 360 TYR B N     1 
ATOM   7859  C  CA    . TYR B  1 360 ? 64.920  72.901  71.155  1.00 54.53 ? 360 TYR B CA    1 
ATOM   7860  C  C     . TYR B  1 360 ? 65.168  71.687  72.038  1.00 54.53 ? 360 TYR B C     1 
ATOM   7861  O  O     . TYR B  1 360 ? 65.508  71.855  73.212  1.00 54.53 ? 360 TYR B O     1 
ATOM   7862  C  CB    . TYR B  1 360 ? 63.679  73.644  71.659  1.00 54.53 ? 360 TYR B CB    1 
ATOM   7863  C  CG    . TYR B  1 360 ? 63.368  74.918  70.909  1.00 54.53 ? 360 TYR B CG    1 
ATOM   7864  C  CD1   . TYR B  1 360 ? 64.386  75.740  70.440  1.00 54.53 ? 360 TYR B CD1   1 
ATOM   7865  C  CD2   . TYR B  1 360 ? 62.054  75.302  70.675  1.00 54.53 ? 360 TYR B CD2   1 
ATOM   7866  C  CE1   . TYR B  1 360 ? 64.102  76.905  69.753  1.00 54.53 ? 360 TYR B CE1   1 
ATOM   7867  C  CE2   . TYR B  1 360 ? 61.761  76.464  69.990  1.00 54.53 ? 360 TYR B CE2   1 
ATOM   7868  C  CZ    . TYR B  1 360 ? 62.789  77.261  69.532  1.00 54.53 ? 360 TYR B CZ    1 
ATOM   7869  O  OH    . TYR B  1 360 ? 62.500  78.420  68.850  1.00 54.53 ? 360 TYR B OH    1 
ATOM   7870  N  N     . VAL B  1 361 ? 65.006  70.482  71.507  1.00 48.52 ? 361 VAL B N     1 
ATOM   7871  C  CA    . VAL B  1 361 ? 65.221  69.240  72.250  1.00 48.52 ? 361 VAL B CA    1 
ATOM   7872  C  C     . VAL B  1 361 ? 66.692  68.976  72.604  1.00 48.52 ? 361 VAL B C     1 
ATOM   7873  O  O     . VAL B  1 361 ? 66.952  68.683  73.786  1.00 48.52 ? 361 VAL B O     1 
ATOM   7874  C  CB    . VAL B  1 361 ? 64.589  68.054  71.495  1.00 48.52 ? 361 VAL B CB    1 
ATOM   7875  C  CG1   . VAL B  1 361 ? 64.975  66.723  72.117  1.00 48.52 ? 361 VAL B CG1   1 
ATOM   7876  C  CG2   . VAL B  1 361 ? 63.079  68.204  71.469  1.00 48.52 ? 361 VAL B CG2   1 
ATOM   7877  N  N     . PRO B  1 362 ? 67.688  69.056  71.690  1.00 45.09 ? 362 PRO B N     1 
ATOM   7878  C  CA    . PRO B  1 362 ? 69.054  68.695  72.117  1.00 45.09 ? 362 PRO B CA    1 
ATOM   7879  C  C     . PRO B  1 362 ? 69.684  69.672  73.097  1.00 45.09 ? 362 PRO B C     1 
ATOM   7880  O  O     . PRO B  1 362 ? 70.523  69.253  73.901  1.00 45.09 ? 362 PRO B O     1 
ATOM   7881  C  CB    . PRO B  1 362 ? 69.834  68.648  70.798  1.00 45.09 ? 362 PRO B CB    1 
ATOM   7882  C  CG    . PRO B  1 362 ? 69.143  69.601  69.952  1.00 45.09 ? 362 PRO B CG    1 
ATOM   7883  C  CD    . PRO B  1 362 ? 67.703  69.349  70.238  1.00 45.09 ? 362 PRO B CD    1 
ATOM   7884  N  N     . SER B  1 363 ? 69.276  70.942  73.099  1.00 38.24 ? 363 SER B N     1 
ATOM   7885  C  CA    . SER B  1 363 ? 69.773  71.854  74.124  1.00 38.24 ? 363 SER B CA    1 
ATOM   7886  C  C     . SER B  1 363 ? 69.174  71.541  75.491  1.00 38.24 ? 363 SER B C     1 
ATOM   7887  O  O     . SER B  1 363 ? 69.853  71.697  76.511  1.00 38.24 ? 363 SER B O     1 
ATOM   7888  C  CB    . SER B  1 363 ? 69.486  73.297  73.725  1.00 38.24 ? 363 SER B CB    1 
ATOM   7889  O  OG    . SER B  1 363 ? 69.886  73.540  72.390  1.00 38.24 ? 363 SER B OG    1 
ATOM   7890  N  N     . ILE B  1 364 ? 67.930  71.058  75.529  1.00 34.09 ? 364 ILE B N     1 
ATOM   7891  C  CA    . ILE B  1 364 ? 67.324  70.628  76.788  1.00 34.09 ? 364 ILE B CA    1 
ATOM   7892  C  C     . ILE B  1 364 ? 68.013  69.370  77.309  1.00 34.09 ? 364 ILE B C     1 
ATOM   7893  O  O     . ILE B  1 364 ? 68.305  69.253  78.512  1.00 34.09 ? 364 ILE B O     1 
ATOM   7894  C  CB    . ILE B  1 364 ? 65.810  70.425  76.589  1.00 34.09 ? 364 ILE B CB    1 
ATOM   7895  C  CG1   . ILE B  1 364 ? 65.107  71.776  76.497  1.00 34.09 ? 364 ILE B CG1   1 
ATOM   7896  C  CG2   . ILE B  1 364 ? 65.194  69.610  77.711  1.00 34.09 ? 364 ILE B CG2   1 
ATOM   7897  C  CD1   . ILE B  1 364 ? 63.673  71.680  76.050  1.00 34.09 ? 364 ILE B CD1   1 
ATOM   7898  N  N     . ILE B  1 365 ? 68.321  68.431  76.407  1.00 32.28 ? 365 ILE B N     1 
ATOM   7899  C  CA    . ILE B  1 365 ? 69.049  67.220  76.789  1.00 32.28 ? 365 ILE B CA    1 
ATOM   7900  C  C     . ILE B  1 365 ? 70.452  67.569  77.279  1.00 32.28 ? 365 ILE B C     1 
ATOM   7901  O  O     . ILE B  1 365 ? 70.939  67.005  78.268  1.00 32.28 ? 365 ILE B O     1 
ATOM   7902  C  CB    . ILE B  1 365 ? 69.080  66.229  75.609  1.00 32.28 ? 365 ILE B CB    1 
ATOM   7903  C  CG1   . ILE B  1 365 ? 67.660  65.800  75.244  1.00 32.28 ? 365 ILE B CG1   1 
ATOM   7904  C  CG2   . ILE B  1 365 ? 69.909  65.000  75.938  1.00 32.28 ? 365 ILE B CG2   1 
ATOM   7905  C  CD1   . ILE B  1 365 ? 67.593  64.825  74.090  1.00 32.28 ? 365 ILE B CD1   1 
ATOM   7906  N  N     . TYR B  1 366 ? 71.094  68.552  76.641  1.00 29.38 ? 366 TYR B N     1 
ATOM   7907  C  CA    . TYR B  1 366 ? 72.411  68.989  77.088  1.00 29.38 ? 366 TYR B CA    1 
ATOM   7908  C  C     . TYR B  1 366 ? 72.351  69.699  78.433  1.00 29.38 ? 366 TYR B C     1 
ATOM   7909  O  O     . TYR B  1 366 ? 73.278  69.562  79.232  1.00 29.38 ? 366 TYR B O     1 
ATOM   7910  C  CB    . TYR B  1 366 ? 73.047  69.901  76.046  1.00 29.38 ? 366 TYR B CB    1 
ATOM   7911  C  CG    . TYR B  1 366 ? 74.477  70.271  76.351  1.00 29.38 ? 366 TYR B CG    1 
ATOM   7912  C  CD1   . TYR B  1 366 ? 75.382  69.315  76.785  1.00 29.38 ? 366 TYR B CD1   1 
ATOM   7913  C  CD2   . TYR B  1 366 ? 74.922  71.575  76.200  1.00 29.38 ? 366 TYR B CD2   1 
ATOM   7914  C  CE1   . TYR B  1 366 ? 76.690  69.649  77.067  1.00 29.38 ? 366 TYR B CE1   1 
ATOM   7915  C  CE2   . TYR B  1 366 ? 76.228  71.918  76.475  1.00 29.38 ? 366 TYR B CE2   1 
ATOM   7916  C  CZ    . TYR B  1 366 ? 77.107  70.952  76.910  1.00 29.38 ? 366 TYR B CZ    1 
ATOM   7917  O  OH    . TYR B  1 366 ? 78.410  71.290  77.187  1.00 29.38 ? 366 TYR B OH    1 
ATOM   7918  N  N     . ALA B  1 367 ? 71.272  70.435  78.712  1.00 27.74 ? 367 ALA B N     1 
ATOM   7919  C  CA    . ALA B  1 367 ? 71.142  71.076  80.018  1.00 27.74 ? 367 ALA B CA    1 
ATOM   7920  C  C     . ALA B  1 367 ? 70.940  70.048  81.126  1.00 27.74 ? 367 ALA B C     1 
ATOM   7921  O  O     . ALA B  1 367 ? 71.493  70.194  82.225  1.00 27.74 ? 367 ALA B O     1 
ATOM   7922  C  CB    . ALA B  1 367 ? 69.989  72.073  80.001  1.00 27.74 ? 367 ALA B CB    1 
ATOM   7923  N  N     . ILE B  1 368 ? 70.174  68.990  80.845  1.00 27.43 ? 368 ILE B N     1 
ATOM   7924  C  CA    . ILE B  1 368 ? 69.991  67.927  81.833  1.00 27.43 ? 368 ILE B CA    1 
ATOM   7925  C  C     . ILE B  1 368 ? 71.294  67.156  82.051  1.00 27.43 ? 368 ILE B C     1 
ATOM   7926  O  O     . ILE B  1 368 ? 71.643  66.810  83.190  1.00 27.43 ? 368 ILE B O     1 
ATOM   7927  C  CB    . ILE B  1 368 ? 68.832  67.010  81.400  1.00 27.43 ? 368 ILE B CB    1 
ATOM   7928  C  CG1   . ILE B  1 368 ? 67.525  67.801  81.389  1.00 27.43 ? 368 ILE B CG1   1 
ATOM   7929  C  CG2   . ILE B  1 368 ? 68.695  65.814  82.320  1.00 27.43 ? 368 ILE B CG2   1 
ATOM   7930  C  CD1   . ILE B  1 368 ? 66.326  66.999  80.946  1.00 27.43 ? 368 ILE B CD1   1 
ATOM   7931  N  N     . VAL B  1 369 ? 72.063  66.932  80.982  1.00 26.06 ? 369 VAL B N     1 
ATOM   7932  C  CA    . VAL B  1 369 ? 73.348  66.249  81.116  1.00 26.06 ? 369 VAL B CA    1 
ATOM   7933  C  C     . VAL B  1 369 ? 74.360  67.132  81.852  1.00 26.06 ? 369 VAL B C     1 
ATOM   7934  O  O     . VAL B  1 369 ? 75.178  66.628  82.633  1.00 26.06 ? 369 VAL B O     1 
ATOM   7935  C  CB    . VAL B  1 369 ? 73.826  65.802  79.718  1.00 26.06 ? 369 VAL B CB    1 
ATOM   7936  C  CG1   . VAL B  1 369 ? 75.291  65.419  79.697  1.00 26.06 ? 369 VAL B CG1   1 
ATOM   7937  C  CG2   . VAL B  1 369 ? 72.998  64.623  79.245  1.00 26.06 ? 369 VAL B CG2   1 
ATOM   7938  N  N     . ILE B  1 370 ? 74.272  68.455  81.679  1.00 26.27 ? 370 ILE B N     1 
ATOM   7939  C  CA    . ILE B  1 370 ? 75.114  69.383  82.436  1.00 26.27 ? 370 ILE B CA    1 
ATOM   7940  C  C     . ILE B  1 370 ? 74.775  69.318  83.922  1.00 26.27 ? 370 ILE B C     1 
ATOM   7941  O  O     . ILE B  1 370 ? 75.666  69.216  84.776  1.00 26.27 ? 370 ILE B O     1 
ATOM   7942  C  CB    . ILE B  1 370 ? 74.962  70.812  81.881  1.00 26.27 ? 370 ILE B CB    1 
ATOM   7943  C  CG1   . ILE B  1 370 ? 75.857  71.017  80.667  1.00 26.27 ? 370 ILE B CG1   1 
ATOM   7944  C  CG2   . ILE B  1 370 ? 75.307  71.869  82.920  1.00 26.27 ? 370 ILE B CG2   1 
ATOM   7945  C  CD1   . ILE B  1 370 ? 75.651  72.357  80.014  1.00 26.27 ? 370 ILE B CD1   1 
ATOM   7946  N  N     . GLU B  1 371 ? 73.481  69.341  84.253  1.00 28.67 ? 371 GLU B N     1 
ATOM   7947  C  CA    . GLU B  1 371 ? 73.092  69.290  85.658  1.00 28.67 ? 371 GLU B CA    1 
ATOM   7948  C  C     . GLU B  1 371 ? 73.288  67.916  86.289  1.00 28.67 ? 371 GLU B C     1 
ATOM   7949  O  O     . GLU B  1 371 ? 73.236  67.812  87.518  1.00 28.67 ? 371 GLU B O     1 
ATOM   7950  C  CB    . GLU B  1 371 ? 71.640  69.727  85.822  1.00 28.67 ? 371 GLU B CB    1 
ATOM   7951  C  CG    . GLU B  1 371 ? 71.457  71.231  85.948  1.00 28.67 ? 371 GLU B CG    1 
ATOM   7952  C  CD    . GLU B  1 371 ? 71.956  71.777  87.276  1.00 28.67 ? 371 GLU B CD    1 
ATOM   7953  O  OE1   . GLU B  1 371 ? 72.855  72.645  87.266  1.00 28.67 ? 371 GLU B OE1   1 
ATOM   7954  O  OE2   . GLU B  1 371 ? 71.449  71.341  88.331  1.00 28.67 ? 371 GLU B OE2   1 
ATOM   7955  N  N     . ILE B  1 372 ? 73.499  66.870  85.496  1.00 25.24 ? 372 ILE B N     1 
ATOM   7956  C  CA    . ILE B  1 372 ? 73.893  65.577  86.053  1.00 25.24 ? 372 ILE B CA    1 
ATOM   7957  C  C     . ILE B  1 372 ? 75.405  65.499  86.257  1.00 25.24 ? 372 ILE B C     1 
ATOM   7958  O  O     . ILE B  1 372 ? 75.877  65.070  87.321  1.00 25.24 ? 372 ILE B O     1 
ATOM   7959  C  CB    . ILE B  1 372 ? 73.372  64.445  85.141  1.00 25.24 ? 372 ILE B CB    1 
ATOM   7960  C  CG1   . ILE B  1 372 ? 71.900  64.168  85.439  1.00 25.24 ? 372 ILE B CG1   1 
ATOM   7961  C  CG2   . ILE B  1 372 ? 74.178  63.165  85.306  1.00 25.24 ? 372 ILE B CG2   1 
ATOM   7962  C  CD1   . ILE B  1 372 ? 71.298  63.078  84.583  1.00 25.24 ? 372 ILE B CD1   1 
ATOM   7963  N  N     . MET B  1 373 ? 76.174  65.941  85.254  1.00 27.64 ? 373 MET B N     1 
ATOM   7964  C  CA    . MET B  1 373 ? 77.630  65.909  85.330  1.00 27.64 ? 373 MET B CA    1 
ATOM   7965  C  C     . MET B  1 373 ? 78.167  66.839  86.407  1.00 27.64 ? 373 MET B C     1 
ATOM   7966  O  O     . MET B  1 373 ? 79.211  66.549  86.999  1.00 27.64 ? 373 MET B O     1 
ATOM   7967  C  CB    . MET B  1 373 ? 78.237  66.283  83.981  1.00 27.64 ? 373 MET B CB    1 
ATOM   7968  C  CG    . MET B  1 373 ? 78.221  65.173  82.956  1.00 27.64 ? 373 MET B CG    1 
ATOM   7969  S  SD    . MET B  1 373 ? 78.678  65.782  81.324  1.00 27.64 ? 373 MET B SD    1 
ATOM   7970  C  CE    . MET B  1 373 ? 80.360  66.305  81.626  1.00 27.64 ? 373 MET B CE    1 
ATOM   7971  N  N     . ASN B  1 374 ? 77.463  67.939  86.691  1.00 25.30 ? 374 ASN B N     1 
ATOM   7972  C  CA    . ASN B  1 374 ? 77.901  68.841  87.750  1.00 25.30 ? 374 ASN B CA    1 
ATOM   7973  C  C     . ASN B  1 374 ? 77.777  68.190  89.120  1.00 25.30 ? 374 ASN B C     1 
ATOM   7974  O  O     . ASN B  1 374 ? 78.672  68.330  89.957  1.00 25.30 ? 374 ASN B O     1 
ATOM   7975  C  CB    . ASN B  1 374 ? 77.103  70.139  87.696  1.00 25.30 ? 374 ASN B CB    1 
ATOM   7976  C  CG    . ASN B  1 374 ? 77.537  71.036  86.563  1.00 25.30 ? 374 ASN B CG    1 
ATOM   7977  O  OD1   . ASN B  1 374 ? 78.408  70.676  85.775  1.00 25.30 ? 374 ASN B OD1   1 
ATOM   7978  N  ND2   . ASN B  1 374 ? 76.935  72.214  86.476  1.00 25.30 ? 374 ASN B ND2   1 
ATOM   7979  N  N     . ARG B  1 375 ? 76.702  67.434  89.353  1.00 26.40 ? 375 ARG B N     1 
ATOM   7980  C  CA    . ARG B  1 375 ? 76.548  66.755  90.637  1.00 26.40 ? 375 ARG B CA    1 
ATOM   7981  C  C     . ARG B  1 375 ? 77.511  65.581  90.764  1.00 26.40 ? 375 ARG B C     1 
ATOM   7982  O  O     . ARG B  1 375 ? 78.028  65.310  91.859  1.00 26.40 ? 375 ARG B O     1 
ATOM   7983  C  CB    . ARG B  1 375 ? 75.105  66.296  90.814  1.00 26.40 ? 375 ARG B CB    1 
ATOM   7984  C  CG    . ARG B  1 375 ? 74.116  67.441  90.841  1.00 26.40 ? 375 ARG B CG    1 
ATOM   7985  C  CD    . ARG B  1 375 ? 72.735  66.980  91.252  1.00 26.40 ? 375 ARG B CD    1 
ATOM   7986  N  NE    . ARG B  1 375 ? 71.728  67.991  90.950  1.00 26.40 ? 375 ARG B NE    1 
ATOM   7987  C  CZ    . ARG B  1 375 ? 71.295  68.898  91.818  1.00 26.40 ? 375 ARG B CZ    1 
ATOM   7988  N  NH1   . ARG B  1 375 ? 71.780  68.924  93.051  1.00 26.40 ? 375 ARG B NH1   1 
ATOM   7989  N  NH2   . ARG B  1 375 ? 70.376  69.780  91.453  1.00 26.40 ? 375 ARG B NH2   1 
ATOM   7990  N  N     . LEU B  1 376 ? 77.782  64.887  89.651  1.00 26.15 ? 376 LEU B N     1 
ATOM   7991  C  CA    . LEU B  1 376 ? 78.765  63.804  89.688  1.00 26.15 ? 376 LEU B CA    1 
ATOM   7992  C  C     . LEU B  1 376 ? 80.169  64.333  89.963  1.00 26.15 ? 376 LEU B C     1 
ATOM   7993  O  O     . LEU B  1 376 ? 80.908  63.757  90.776  1.00 26.15 ? 376 LEU B O     1 
ATOM   7994  C  CB    . LEU B  1 376 ? 78.735  63.015  88.380  1.00 26.15 ? 376 LEU B CB    1 
ATOM   7995  C  CG    . LEU B  1 376 ? 77.471  62.211  88.073  1.00 26.15 ? 376 LEU B CG    1 
ATOM   7996  C  CD1   . LEU B  1 376 ? 77.716  61.273  86.908  1.00 26.15 ? 376 LEU B CD1   1 
ATOM   7997  C  CD2   . LEU B  1 376 ? 77.006  61.435  89.288  1.00 26.15 ? 376 LEU B CD2   1 
ATOM   7998  N  N     . TYR B  1 377 ? 80.543  65.450  89.329  1.00 22.99 ? 377 TYR B N     1 
ATOM   7999  C  CA    . TYR B  1 377 ? 81.822  66.074  89.639  1.00 22.99 ? 377 TYR B CA    1 
ATOM   8000  C  C     . TYR B  1 377 ? 81.841  66.645  91.048  1.00 22.99 ? 377 TYR B C     1 
ATOM   8001  O  O     . TYR B  1 377 ? 82.906  66.708  91.660  1.00 22.99 ? 377 TYR B O     1 
ATOM   8002  C  CB    . TYR B  1 377 ? 82.155  67.177  88.634  1.00 22.99 ? 377 TYR B CB    1 
ATOM   8003  C  CG    . TYR B  1 377 ? 83.515  67.810  88.859  1.00 22.99 ? 377 TYR B CG    1 
ATOM   8004  C  CD1   . TYR B  1 377 ? 84.662  67.218  88.360  1.00 22.99 ? 377 TYR B CD1   1 
ATOM   8005  C  CD2   . TYR B  1 377 ? 83.651  68.994  89.580  1.00 22.99 ? 377 TYR B CD2   1 
ATOM   8006  C  CE1   . TYR B  1 377 ? 85.900  67.780  88.568  1.00 22.99 ? 377 TYR B CE1   1 
ATOM   8007  C  CE2   . TYR B  1 377 ? 84.883  69.546  89.812  1.00 22.99 ? 377 TYR B CE2   1 
ATOM   8008  C  CZ    . TYR B  1 377 ? 86.001  68.947  89.290  1.00 22.99 ? 377 TYR B CZ    1 
ATOM   8009  O  OH    . TYR B  1 377 ? 87.227  69.518  89.505  1.00 22.99 ? 377 TYR B OH    1 
ATOM   8010  N  N     . ARG B  1 378 ? 80.694  67.077  91.571  1.00 25.65 ? 378 ARG B N     1 
ATOM   8011  C  CA    . ARG B  1 378 ? 80.658  67.588  92.935  1.00 25.65 ? 378 ARG B CA    1 
ATOM   8012  C  C     . ARG B  1 378 ? 80.944  66.483  93.943  1.00 25.65 ? 378 ARG B C     1 
ATOM   8013  O  O     . ARG B  1 378 ? 81.712  66.688  94.891  1.00 25.65 ? 378 ARG B O     1 
ATOM   8014  C  CB    . ARG B  1 378 ? 79.306  68.241  93.204  1.00 25.65 ? 378 ARG B CB    1 
ATOM   8015  C  CG    . ARG B  1 378 ? 79.080  68.624  94.641  1.00 25.65 ? 378 ARG B CG    1 
ATOM   8016  C  CD    . ARG B  1 378 ? 79.991  69.758  95.055  1.00 25.65 ? 378 ARG B CD    1 
ATOM   8017  N  NE    . ARG B  1 378 ? 79.897  70.003  96.488  1.00 25.65 ? 378 ARG B NE    1 
ATOM   8018  C  CZ    . ARG B  1 378 ? 78.971  70.768  97.053  1.00 25.65 ? 378 ARG B CZ    1 
ATOM   8019  N  NH1   . ARG B  1 378 ? 78.065  71.375  96.302  1.00 25.65 ? 378 ARG B NH1   1 
ATOM   8020  N  NH2   . ARG B  1 378 ? 78.958  70.934  98.367  1.00 25.65 ? 378 ARG B NH2   1 
ATOM   8021  N  N     . TYR B  1 379 ? 80.375  65.293  93.721  1.00 31.71 ? 379 TYR B N     1 
ATOM   8022  C  CA    . TYR B  1 379 ? 80.696  64.146  94.573  1.00 31.71 ? 379 TYR B CA    1 
ATOM   8023  C  C     . TYR B  1 379 ? 82.159  63.737  94.431  1.00 31.71 ? 379 TYR B C     1 
ATOM   8024  O  O     . TYR B  1 379 ? 82.833  63.462  95.437  1.00 31.71 ? 379 TYR B O     1 
ATOM   8025  C  CB    . TYR B  1 379 ? 79.787  62.963  94.245  1.00 31.71 ? 379 TYR B CB    1 
ATOM   8026  C  CG    . TYR B  1 379 ? 78.344  63.134  94.667  1.00 31.71 ? 379 TYR B CG    1 
ATOM   8027  C  CD1   . TYR B  1 379 ? 77.976  64.106  95.592  1.00 31.71 ? 379 TYR B CD1   1 
ATOM   8028  C  CD2   . TYR B  1 379 ? 77.348  62.321  94.137  1.00 31.71 ? 379 TYR B CD2   1 
ATOM   8029  C  CE1   . TYR B  1 379 ? 76.655  64.265  95.975  1.00 31.71 ? 379 TYR B CE1   1 
ATOM   8030  C  CE2   . TYR B  1 379 ? 76.026  62.472  94.514  1.00 31.71 ? 379 TYR B CE2   1 
ATOM   8031  C  CZ    . TYR B  1 379 ? 75.686  63.445  95.433  1.00 31.71 ? 379 TYR B CZ    1 
ATOM   8032  O  OH    . TYR B  1 379 ? 74.373  63.599  95.813  1.00 31.71 ? 379 TYR B OH    1 
ATOM   8033  N  N     . ALA B  1 380 ? 82.675  63.728  93.194  1.00 27.68 ? 380 ALA B N     1 
ATOM   8034  C  CA    . ALA B  1 380 ? 84.067  63.344  92.969  1.00 27.68 ? 380 ALA B CA    1 
ATOM   8035  C  C     . ALA B  1 380 ? 85.039  64.352  93.572  1.00 27.68 ? 380 ALA B C     1 
ATOM   8036  O  O     . ALA B  1 380 ? 86.066  63.966  94.136  1.00 27.68 ? 380 ALA B O     1 
ATOM   8037  C  CB    . ALA B  1 380 ? 84.334  63.179  91.476  1.00 27.68 ? 380 ALA B CB    1 
ATOM   8038  N  N     . ALA B  1 381 ? 84.713  65.642  93.510  1.00 28.00 ? 381 ALA B N     1 
ATOM   8039  C  CA    . ALA B  1 381 ? 85.585  66.667  94.064  1.00 28.00 ? 381 ALA B CA    1 
ATOM   8040  C  C     . ALA B  1 381 ? 85.511  66.720  95.580  1.00 28.00 ? 381 ALA B C     1 
ATOM   8041  O  O     . ALA B  1 381 ? 86.524  67.002  96.225  1.00 28.00 ? 381 ALA B O     1 
ATOM   8042  C  CB    . ALA B  1 381 ? 85.236  68.033  93.478  1.00 28.00 ? 381 ALA B CB    1 
ATOM   8043  N  N     . GLU B  1 382 ? 84.340  66.440  96.166  1.00 30.66 ? 382 GLU B N     1 
ATOM   8044  C  CA    . GLU B  1 382 ? 84.249  66.337  97.619  1.00 30.66 ? 382 GLU B CA    1 
ATOM   8045  C  C     . GLU B  1 382 ? 85.067  65.164  98.140  1.00 30.66 ? 382 GLU B C     1 
ATOM   8046  O  O     . GLU B  1 382 ? 85.771  65.293  99.151  1.00 30.66 ? 382 GLU B O     1 
ATOM   8047  C  CB    . GLU B  1 382 ? 82.791  66.196  98.048  1.00 30.66 ? 382 GLU B CB    1 
ATOM   8048  C  CG    . GLU B  1 382 ? 82.052  67.508  98.198  1.00 30.66 ? 382 GLU B CG    1 
ATOM   8049  C  CD    . GLU B  1 382 ? 80.610  67.311  98.619  1.00 30.66 ? 382 GLU B CD    1 
ATOM   8050  O  OE1   . GLU B  1 382 ? 80.187  66.145  98.762  1.00 30.66 ? 382 GLU B OE1   1 
ATOM   8051  O  OE2   . GLU B  1 382 ? 79.901  68.319  98.812  1.00 30.66 ? 382 GLU B OE2   1 
ATOM   8052  N  N     . PHE B  1 383 ? 85.011  64.020  97.446  1.00 33.04 ? 383 PHE B N     1 
ATOM   8053  C  CA    . PHE B  1 383 ? 85.844  62.888  97.844  1.00 33.04 ? 383 PHE B CA    1 
ATOM   8054  C  C     . PHE B  1 383 ? 87.326  63.180  97.631  1.00 33.04 ? 383 PHE B C     1 
ATOM   8055  O  O     . PHE B  1 383 ? 88.158  62.825  98.472  1.00 33.04 ? 383 PHE B O     1 
ATOM   8056  C  CB    . PHE B  1 383 ? 85.441  61.629  97.080  1.00 33.04 ? 383 PHE B CB    1 
ATOM   8057  C  CG    . PHE B  1 383 ? 86.493  60.554  97.094  1.00 33.04 ? 383 PHE B CG    1 
ATOM   8058  C  CD1   . PHE B  1 383 ? 86.777  59.863  98.262  1.00 33.04 ? 383 PHE B CD1   1 
ATOM   8059  C  CD2   . PHE B  1 383 ? 87.199  60.238  95.944  1.00 33.04 ? 383 PHE B CD2   1 
ATOM   8060  C  CE1   . PHE B  1 383 ? 87.747  58.879  98.283  1.00 33.04 ? 383 PHE B CE1   1 
ATOM   8061  C  CE2   . PHE B  1 383 ? 88.170  59.256  95.959  1.00 33.04 ? 383 PHE B CE2   1 
ATOM   8062  C  CZ    . PHE B  1 383 ? 88.443  58.575  97.130  1.00 33.04 ? 383 PHE B CZ    1 
ATOM   8063  N  N     . LEU B  1 384 ? 87.675  63.834  96.523  1.00 32.26 ? 384 LEU B N     1 
ATOM   8064  C  CA    . LEU B  1 384 ? 89.076  64.072  96.207  1.00 32.26 ? 384 LEU B CA    1 
ATOM   8065  C  C     . LEU B  1 384 ? 89.690  65.187  97.039  1.00 32.26 ? 384 LEU B C     1 
ATOM   8066  O  O     . LEU B  1 384 ? 90.916  65.246  97.155  1.00 32.26 ? 384 LEU B O     1 
ATOM   8067  C  CB    . LEU B  1 384 ? 89.215  64.398  94.725  1.00 32.26 ? 384 LEU B CB    1 
ATOM   8068  C  CG    . LEU B  1 384 ? 90.520  64.003  94.051  1.00 32.26 ? 384 LEU B CG    1 
ATOM   8069  C  CD1   . LEU B  1 384 ? 90.688  62.501  94.076  1.00 32.26 ? 384 LEU B CD1   1 
ATOM   8070  C  CD2   . LEU B  1 384 ? 90.501  64.506  92.635  1.00 32.26 ? 384 LEU B CD2   1 
ATOM   8071  N  N     . THR B  1 385 ? 88.878  66.074  97.613  1.00 32.51 ? 385 THR B N     1 
ATOM   8072  C  CA    . THR B  1 385 ? 89.399  67.121  98.476  1.00 32.51 ? 385 THR B CA    1 
ATOM   8073  C  C     . THR B  1 385 ? 89.350  66.723  99.945  1.00 32.51 ? 385 THR B C     1 
ATOM   8074  O  O     . THR B  1 385 ? 90.168  67.205  100.736 1.00 32.51 ? 385 THR B O     1 
ATOM   8075  C  CB    . THR B  1 385 ? 88.615  68.419  98.244  1.00 32.51 ? 385 THR B CB    1 
ATOM   8076  O  OG1   . THR B  1 385 ? 88.464  68.617  96.837  1.00 32.51 ? 385 THR B OG1   1 
ATOM   8077  C  CG2   . THR B  1 385 ? 89.382  69.613  98.760  1.00 32.51 ? 385 THR B CG2   1 
ATOM   8078  N  N     . SER B  1 386 ? 88.454  65.807  100.320 1.00 35.67 ? 386 SER B N     1 
ATOM   8079  C  CA    . SER B  1 386 ? 88.545  65.189  101.636 1.00 35.67 ? 386 SER B CA    1 
ATOM   8080  C  C     . SER B  1 386 ? 89.653  64.146  101.721 1.00 35.67 ? 386 SER B C     1 
ATOM   8081  O  O     . SER B  1 386 ? 89.928  63.646  102.815 1.00 35.67 ? 386 SER B O     1 
ATOM   8082  C  CB    . SER B  1 386 ? 87.209  64.549  102.010 1.00 35.67 ? 386 SER B CB    1 
ATOM   8083  O  OG    . SER B  1 386 ? 87.141  63.215  101.542 1.00 35.67 ? 386 SER B OG    1 
ATOM   8084  N  N     . TRP B  1 387 ? 90.287  63.809  100.597 1.00 38.06 ? 387 TRP B N     1 
ATOM   8085  C  CA    . TRP B  1 387 ? 91.366  62.832  100.546 1.00 38.06 ? 387 TRP B CA    1 
ATOM   8086  C  C     . TRP B  1 387 ? 92.743  63.463  100.695 1.00 38.06 ? 387 TRP B C     1 
ATOM   8087  O  O     . TRP B  1 387 ? 93.684  62.776  101.104 1.00 38.06 ? 387 TRP B O     1 
ATOM   8088  C  CB    . TRP B  1 387 ? 91.279  62.057  99.225  1.00 38.06 ? 387 TRP B CB    1 
ATOM   8089  C  CG    . TRP B  1 387 ? 92.347  61.041  98.988  1.00 38.06 ? 387 TRP B CG    1 
ATOM   8090  C  CD1   . TRP B  1 387 ? 92.449  59.810  99.561  1.00 38.06 ? 387 TRP B CD1   1 
ATOM   8091  C  CD2   . TRP B  1 387 ? 93.459  61.163  98.097  1.00 38.06 ? 387 TRP B CD2   1 
ATOM   8092  N  NE1   . TRP B  1 387 ? 93.561  59.159  99.088  1.00 38.06 ? 387 TRP B NE1   1 
ATOM   8093  C  CE2   . TRP B  1 387 ? 94.198  59.969  98.187  1.00 38.06 ? 387 TRP B CE2   1 
ATOM   8094  C  CE3   . TRP B  1 387 ? 93.904  62.168  97.235  1.00 38.06 ? 387 TRP B CE3   1 
ATOM   8095  C  CZ2   . TRP B  1 387 ? 95.357  59.754  97.448  1.00 38.06 ? 387 TRP B CZ2   1 
ATOM   8096  C  CZ3   . TRP B  1 387 ? 95.054  61.953  96.503  1.00 38.06 ? 387 TRP B CZ3   1 
ATOM   8097  C  CH2   . TRP B  1 387 ? 95.767  60.755  96.613  1.00 38.06 ? 387 TRP B CH2   1 
ATOM   8098  N  N     . GLU B  1 388 ? 92.879  64.757  100.417 1.00 38.18 ? 388 GLU B N     1 
ATOM   8099  C  CA    . GLU B  1 388 ? 94.172  65.427  100.457 1.00 38.18 ? 388 GLU B CA    1 
ATOM   8100  C  C     . GLU B  1 388 ? 94.629  65.789  101.862 1.00 38.18 ? 388 GLU B C     1 
ATOM   8101  O  O     . GLU B  1 388 ? 95.720  66.353  102.000 1.00 38.18 ? 388 GLU B O     1 
ATOM   8102  C  CB    . GLU B  1 388 ? 94.137  66.696  99.608  1.00 38.18 ? 388 GLU B CB    1 
ATOM   8103  C  CG    . GLU B  1 388 ? 93.832  66.458  98.154  1.00 38.18 ? 388 GLU B CG    1 
ATOM   8104  C  CD    . GLU B  1 388 ? 93.355  67.711  97.462  1.00 38.18 ? 388 GLU B CD    1 
ATOM   8105  O  OE1   . GLU B  1 388 ? 93.430  68.793  98.080  1.00 38.18 ? 388 GLU B OE1   1 
ATOM   8106  O  OE2   . GLU B  1 388 ? 92.903  67.616  96.304  1.00 38.18 ? 388 GLU B OE2   1 
ATOM   8107  N  N     . ASN B  1 389 ? 93.818  65.491  102.884 1.00 40.68 ? 389 ASN B N     1 
ATOM   8108  C  CA    . ASN B  1 389 ? 94.124  65.714  104.302 1.00 40.68 ? 389 ASN B CA    1 
ATOM   8109  C  C     . ASN B  1 389 ? 94.416  67.187  104.591 1.00 40.68 ? 389 ASN B C     1 
ATOM   8110  O  O     . ASN B  1 389 ? 95.482  67.554  105.085 1.00 40.68 ? 389 ASN B O     1 
ATOM   8111  C  CB    . ASN B  1 389 ? 95.277  64.821  104.773 1.00 40.68 ? 389 ASN B CB    1 
ATOM   8112  C  CG    . ASN B  1 389 ? 94.796  63.592  105.505 1.00 40.68 ? 389 ASN B CG    1 
ATOM   8113  O  OD1   . ASN B  1 389 ? 93.660  63.157  105.331 1.00 40.68 ? 389 ASN B OD1   1 
ATOM   8114  N  ND2   . ASN B  1 389 ? 95.662  63.021  106.331 1.00 40.68 ? 389 ASN B ND2   1 
ATOM   8115  N  N     . HIS B  1 390 ? 93.445  68.030  104.259 1.00 36.52 ? 390 HIS B N     1 
ATOM   8116  C  CA    . HIS B  1 390 ? 93.559  69.447  104.566 1.00 36.52 ? 390 HIS B CA    1 
ATOM   8117  C  C     . HIS B  1 390 ? 93.376  69.667  106.059 1.00 36.52 ? 390 HIS B C     1 
ATOM   8118  O  O     . HIS B  1 390 ? 92.556  69.010  106.702 1.00 36.52 ? 390 HIS B O     1 
ATOM   8119  C  CB    . HIS B  1 390 ? 92.524  70.243  103.780 1.00 36.52 ? 390 HIS B CB    1 
ATOM   8120  C  CG    . HIS B  1 390 ? 92.937  70.538  102.375 1.00 36.52 ? 390 HIS B CG    1 
ATOM   8121  N  ND1   . HIS B  1 390 ? 94.032  71.315  102.070 1.00 36.52 ? 390 HIS B ND1   1 
ATOM   8122  C  CD2   . HIS B  1 390 ? 92.405  70.156  101.191 1.00 36.52 ? 390 HIS B CD2   1 
ATOM   8123  C  CE1   . HIS B  1 390 ? 94.155  71.402  100.758 1.00 36.52 ? 390 HIS B CE1   1 
ATOM   8124  N  NE2   . HIS B  1 390 ? 93.180  70.708  100.202 1.00 36.52 ? 390 HIS B NE2   1 
ATOM   8125  N  N     . ARG B  1 391 ? 94.153  70.595  106.616 1.00 44.81 ? 391 ARG B N     1 
ATOM   8126  C  CA    . ARG B  1 391 ? 94.152  70.774  108.063 1.00 44.81 ? 391 ARG B CA    1 
ATOM   8127  C  C     . ARG B  1 391 ? 92.931  71.558  108.529 1.00 44.81 ? 391 ARG B C     1 
ATOM   8128  O  O     . ARG B  1 391 ? 92.097  71.041  109.278 1.00 44.81 ? 391 ARG B O     1 
ATOM   8129  C  CB    . ARG B  1 391 ? 95.435  71.472  108.509 1.00 44.81 ? 391 ARG B CB    1 
ATOM   8130  C  CG    . ARG B  1 391 ? 95.689  71.362  109.997 1.00 44.81 ? 391 ARG B CG    1 
ATOM   8131  C  CD    . ARG B  1 391 ? 96.934  72.118  110.410 1.00 44.81 ? 391 ARG B CD    1 
ATOM   8132  N  NE    . ARG B  1 391 ? 97.162  72.017  111.846 1.00 44.81 ? 391 ARG B NE    1 
ATOM   8133  C  CZ    . ARG B  1 391 ? 96.631  72.839  112.743 1.00 44.81 ? 391 ARG B CZ    1 
ATOM   8134  N  NH1   . ARG B  1 391 ? 95.843  73.829  112.353 1.00 44.81 ? 391 ARG B NH1   1 
ATOM   8135  N  NH2   . ARG B  1 391 ? 96.890  72.672  114.030 1.00 44.81 ? 391 ARG B NH2   1 
ATOM   8136  N  N     . LEU B  1 392 ? 92.807  72.806  108.095 1.00 43.47 ? 392 LEU B N     1 
ATOM   8137  C  CA    . LEU B  1 392 ? 91.687  73.627  108.516 1.00 43.47 ? 392 LEU B CA    1 
ATOM   8138  C  C     . LEU B  1 392 ? 90.468  73.340  107.646 1.00 43.47 ? 392 LEU B C     1 
ATOM   8139  O  O     . LEU B  1 392 ? 90.509  72.539  106.710 1.00 43.47 ? 392 LEU B O     1 
ATOM   8140  C  CB    . LEU B  1 392 ? 92.064  75.104  108.459 1.00 43.47 ? 392 LEU B CB    1 
ATOM   8141  C  CG    . LEU B  1 392 ? 93.410  75.476  109.075 1.00 43.47 ? 392 LEU B CG    1 
ATOM   8142  C  CD1   . LEU B  1 392 ? 93.834  76.863  108.626 1.00 43.47 ? 392 LEU B CD1   1 
ATOM   8143  C  CD2   . LEU B  1 392 ? 93.339  75.399  110.585 1.00 43.47 ? 392 LEU B CD2   1 
ATOM   8144  N  N     . GLU B  1 393 ? 89.360  74.003  107.962 1.00 37.30 ? 393 GLU B N     1 
ATOM   8145  C  CA    . GLU B  1 393 ? 88.174  73.938  107.123 1.00 37.30 ? 393 GLU B CA    1 
ATOM   8146  C  C     . GLU B  1 393 ? 88.187  75.001  106.036 1.00 37.30 ? 393 GLU B C     1 
ATOM   8147  O  O     . GLU B  1 393 ? 87.606  74.784  104.966 1.00 37.30 ? 393 GLU B O     1 
ATOM   8148  C  CB    . GLU B  1 393 ? 86.915  74.079  107.988 1.00 37.30 ? 393 GLU B CB    1 
ATOM   8149  C  CG    . GLU B  1 393 ? 85.590  73.810  107.281 1.00 37.30 ? 393 GLU B CG    1 
ATOM   8150  C  CD    . GLU B  1 393 ? 85.360  72.341  106.978 1.00 37.30 ? 393 GLU B CD    1 
ATOM   8151  O  OE1   . GLU B  1 393 ? 85.963  71.485  107.657 1.00 37.30 ? 393 GLU B OE1   1 
ATOM   8152  O  OE2   . GLU B  1 393 ? 84.571  72.040  106.059 1.00 37.30 ? 393 GLU B OE2   1 
ATOM   8153  N  N     . SER B  1 394 ? 88.869  76.124  106.273 1.00 35.44 ? 394 SER B N     1 
ATOM   8154  C  CA    . SER B  1 394 ? 88.942  77.185  105.276 1.00 35.44 ? 394 SER B CA    1 
ATOM   8155  C  C     . SER B  1 394 ? 89.748  76.754  104.058 1.00 35.44 ? 394 SER B C     1 
ATOM   8156  O  O     . SER B  1 394 ? 89.376  77.071  102.924 1.00 35.44 ? 394 SER B O     1 
ATOM   8157  C  CB    . SER B  1 394 ? 89.546  78.442  105.896 1.00 35.44 ? 394 SER B CB    1 
ATOM   8158  O  OG    . SER B  1 394 ? 90.959  78.418  105.809 1.00 35.44 ? 394 SER B OG    1 
ATOM   8159  N  N     . ALA B  1 395 ? 90.837  76.010  104.266 1.00 33.09 ? 395 ALA B N     1 
ATOM   8160  C  CA    . ALA B  1 395 ? 91.644  75.544  103.140 1.00 33.09 ? 395 ALA B CA    1 
ATOM   8161  C  C     . ALA B  1 395 ? 90.907  74.487  102.329 1.00 33.09 ? 395 ALA B C     1 
ATOM   8162  O  O     . ALA B  1 395 ? 90.977  74.485  101.091 1.00 33.09 ? 395 ALA B O     1 
ATOM   8163  C  CB    . ALA B  1 395 ? 92.979  74.999  103.641 1.00 33.09 ? 395 ALA B CB    1 
ATOM   8164  N  N     . TYR B  1 396 ? 90.186  73.592  103.011 1.00 31.16 ? 396 TYR B N     1 
ATOM   8165  C  CA    . TYR B  1 396 ? 89.372  72.590  102.330 1.00 31.16 ? 396 TYR B CA    1 
ATOM   8166  C  C     . TYR B  1 396 ? 88.261  73.241  101.521 1.00 31.16 ? 396 TYR B C     1 
ATOM   8167  O  O     . TYR B  1 396 ? 88.013  72.852  100.372 1.00 31.16 ? 396 TYR B O     1 
ATOM   8168  C  CB    . TYR B  1 396 ? 88.788  71.618  103.353 1.00 31.16 ? 396 TYR B CB    1 
ATOM   8169  C  CG    . TYR B  1 396 ? 87.600  70.823  102.864 1.00 31.16 ? 396 TYR B CG    1 
ATOM   8170  C  CD1   . TYR B  1 396 ? 87.761  69.788  101.959 1.00 31.16 ? 396 TYR B CD1   1 
ATOM   8171  C  CD2   . TYR B  1 396 ? 86.319  71.095  103.324 1.00 31.16 ? 396 TYR B CD2   1 
ATOM   8172  C  CE1   . TYR B  1 396 ? 86.681  69.053  101.513 1.00 31.16 ? 396 TYR B CE1   1 
ATOM   8173  C  CE2   . TYR B  1 396 ? 85.233  70.366  102.882 1.00 31.16 ? 396 TYR B CE2   1 
ATOM   8174  C  CZ    . TYR B  1 396 ? 85.422  69.348  101.978 1.00 31.16 ? 396 TYR B CZ    1 
ATOM   8175  O  OH    . TYR B  1 396 ? 84.349  68.617  101.537 1.00 31.16 ? 396 TYR B OH    1 
ATOM   8176  N  N     . GLN B  1 397 ? 87.605  74.252  102.097 1.00 28.80 ? 397 GLN B N     1 
ATOM   8177  C  CA    . GLN B  1 397 ? 86.567  74.975  101.376 1.00 28.80 ? 397 GLN B CA    1 
ATOM   8178  C  C     . GLN B  1 397 ? 87.133  75.742  100.192 1.00 28.80 ? 397 GLN B C     1 
ATOM   8179  O  O     . GLN B  1 397 ? 86.505  75.769  99.138  1.00 28.80 ? 397 GLN B O     1 
ATOM   8180  C  CB    . GLN B  1 397 ? 85.828  75.928  102.315 1.00 28.80 ? 397 GLN B CB    1 
ATOM   8181  C  CG    . GLN B  1 397 ? 84.805  75.250  103.204 1.00 28.80 ? 397 GLN B CG    1 
ATOM   8182  C  CD    . GLN B  1 397 ? 83.671  74.633  102.418 1.00 28.80 ? 397 GLN B CD    1 
ATOM   8183  O  OE1   . GLN B  1 397 ? 83.221  75.187  101.418 1.00 28.80 ? 397 GLN B OE1   1 
ATOM   8184  N  NE2   . GLN B  1 397 ? 83.202  73.476  102.865 1.00 28.80 ? 397 GLN B NE2   1 
ATOM   8185  N  N     . ASN B  1 398 ? 88.330  76.320  100.323 1.00 27.78 ? 398 ASN B N     1 
ATOM   8186  C  CA    . ASN B  1 398 ? 88.927  77.054  99.209  1.00 27.78 ? 398 ASN B CA    1 
ATOM   8187  C  C     . ASN B  1 398 ? 89.307  76.125  98.062  1.00 27.78 ? 398 ASN B C     1 
ATOM   8188  O  O     . ASN B  1 398 ? 89.078  76.457  96.892  1.00 27.78 ? 398 ASN B O     1 
ATOM   8189  C  CB    . ASN B  1 398 ? 90.149  77.832  99.689  1.00 27.78 ? 398 ASN B CB    1 
ATOM   8190  C  CG    . ASN B  1 398 ? 89.779  79.034  100.521 1.00 27.78 ? 398 ASN B CG    1 
ATOM   8191  O  OD1   . ASN B  1 398 ? 88.615  79.231  100.862 1.00 27.78 ? 398 ASN B OD1   1 
ATOM   8192  N  ND2   . ASN B  1 398 ? 90.770  79.846  100.857 1.00 27.78 ? 398 ASN B ND2   1 
ATOM   8193  N  N     . HIS B  1 399 ? 89.858  74.948  98.376  1.00 26.50 ? 399 HIS B N     1 
ATOM   8194  C  CA    . HIS B  1 399 ? 90.215  74.000  97.322  1.00 26.50 ? 399 HIS B CA    1 
ATOM   8195  C  C     . HIS B  1 399 ? 88.976  73.440  96.632  1.00 26.50 ? 399 HIS B C     1 
ATOM   8196  O  O     . HIS B  1 399 ? 88.953  73.306  95.397  1.00 26.50 ? 399 HIS B O     1 
ATOM   8197  C  CB    . HIS B  1 399 ? 91.061  72.870  97.898  1.00 26.50 ? 399 HIS B CB    1 
ATOM   8198  C  CG    . HIS B  1 399 ? 92.471  73.266  98.196  1.00 26.50 ? 399 HIS B CG    1 
ATOM   8199  N  ND1   . HIS B  1 399 ? 92.790  74.241  99.114  1.00 26.50 ? 399 HIS B ND1   1 
ATOM   8200  C  CD2   . HIS B  1 399 ? 93.646  72.821  97.695  1.00 26.50 ? 399 HIS B CD2   1 
ATOM   8201  C  CE1   . HIS B  1 399 ? 94.102  74.380  99.167  1.00 26.50 ? 399 HIS B CE1   1 
ATOM   8202  N  NE2   . HIS B  1 399 ? 94.645  73.530  98.316  1.00 26.50 ? 399 HIS B NE2   1 
ATOM   8203  N  N     . LEU B  1 400 ? 87.930  73.133  97.408  1.00 23.59 ? 400 LEU B N     1 
ATOM   8204  C  CA    . LEU B  1 400 ? 86.689  72.640  96.820  1.00 23.59 ? 400 LEU B CA    1 
ATOM   8205  C  C     . LEU B  1 400 ? 86.013  73.706  95.966  1.00 23.59 ? 400 LEU B C     1 
ATOM   8206  O  O     . LEU B  1 400 ? 85.492  73.396  94.888  1.00 23.59 ? 400 LEU B O     1 
ATOM   8207  C  CB    . LEU B  1 400 ? 85.747  72.162  97.919  1.00 23.59 ? 400 LEU B CB    1 
ATOM   8208  C  CG    . LEU B  1 400 ? 84.463  71.492  97.448  1.00 23.59 ? 400 LEU B CG    1 
ATOM   8209  C  CD1   . LEU B  1 400 ? 84.788  70.228  96.686  1.00 23.59 ? 400 LEU B CD1   1 
ATOM   8210  C  CD2   . LEU B  1 400 ? 83.566  71.192  98.631  1.00 23.59 ? 400 LEU B CD2   1 
ATOM   8211  N  N     . ILE B  1 401 ? 86.039  74.966  96.416  1.00 20.98 ? 401 ILE B N     1 
ATOM   8212  C  CA    . ILE B  1 401 ? 85.469  76.065  95.643  1.00 20.98 ? 401 ILE B CA    1 
ATOM   8213  C  C     . ILE B  1 401 ? 86.235  76.266  94.345  1.00 20.98 ? 401 ILE B C     1 
ATOM   8214  O  O     . ILE B  1 401 ? 85.624  76.467  93.294  1.00 20.98 ? 401 ILE B O     1 
ATOM   8215  C  CB    . ILE B  1 401 ? 85.404  77.345  96.502  1.00 20.98 ? 401 ILE B CB    1 
ATOM   8216  C  CG1   . ILE B  1 401 ? 84.236  77.247  97.483  1.00 20.98 ? 401 ILE B CG1   1 
ATOM   8217  C  CG2   . ILE B  1 401 ? 85.263  78.606  95.665  1.00 20.98 ? 401 ILE B CG2   1 
ATOM   8218  C  CD1   . ILE B  1 401 ? 84.252  78.254  98.584  1.00 20.98 ? 401 ILE B CD1   1 
ATOM   8219  N  N     . LEU B  1 402 ? 87.565  76.123  94.373  1.00 20.71 ? 402 LEU B N     1 
ATOM   8220  C  CA    . LEU B  1 402 ? 88.346  76.278  93.145  1.00 20.71 ? 402 LEU B CA    1 
ATOM   8221  C  C     . LEU B  1 402 ? 88.038  75.178  92.132  1.00 20.71 ? 402 LEU B C     1 
ATOM   8222  O  O     . LEU B  1 402 ? 87.801  75.468  90.949  1.00 20.71 ? 402 LEU B O     1 
ATOM   8223  C  CB    . LEU B  1 402 ? 89.838  76.300  93.459  1.00 20.71 ? 402 LEU B CB    1 
ATOM   8224  C  CG    . LEU B  1 402 ? 90.708  76.482  92.219  1.00 20.71 ? 402 LEU B CG    1 
ATOM   8225  C  CD1   . LEU B  1 402 ? 90.386  77.793  91.528  1.00 20.71 ? 402 LEU B CD1   1 
ATOM   8226  C  CD2   . LEU B  1 402 ? 92.163  76.429  92.593  1.00 20.71 ? 402 LEU B CD2   1 
ATOM   8227  N  N     . LYS B  1 403 ? 87.994  73.918  92.588  1.00 20.74 ? 403 LYS B N     1 
ATOM   8228  C  CA    . LYS B  1 403 ? 87.708  72.801  91.683  1.00 20.74 ? 403 LYS B CA    1 
ATOM   8229  C  C     . LYS B  1 403 ? 86.305  72.900  91.088  1.00 20.74 ? 403 LYS B C     1 
ATOM   8230  O  O     . LYS B  1 403 ? 86.123  72.794  89.863  1.00 20.74 ? 403 LYS B O     1 
ATOM   8231  C  CB    . LYS B  1 403 ? 87.869  71.472  92.420  1.00 20.74 ? 403 LYS B CB    1 
ATOM   8232  C  CG    . LYS B  1 403 ? 89.290  71.108  92.789  1.00 20.74 ? 403 LYS B CG    1 
ATOM   8233  C  CD    . LYS B  1 403 ? 89.317  69.808  93.573  1.00 20.74 ? 403 LYS B CD    1 
ATOM   8234  C  CE    . LYS B  1 403 ? 90.730  69.398  93.935  1.00 20.74 ? 403 LYS B CE    1 
ATOM   8235  N  NZ    . LYS B  1 403 ? 91.397  70.404  94.800  1.00 20.74 ? 403 LYS B NZ    1 
ATOM   8236  N  N     . VAL B  1 404 ? 85.304  73.142  91.942  1.00 18.37 ? 404 VAL B N     1 
ATOM   8237  C  CA    . VAL B  1 404 ? 83.921  73.183  91.483  1.00 18.37 ? 404 VAL B CA    1 
ATOM   8238  C  C     . VAL B  1 404 ? 83.667  74.415  90.620  1.00 18.37 ? 404 VAL B C     1 
ATOM   8239  O  O     . VAL B  1 404 ? 82.948  74.332  89.619  1.00 18.37 ? 404 VAL B O     1 
ATOM   8240  C  CB    . VAL B  1 404 ? 82.979  73.099  92.701  1.00 18.37 ? 404 VAL B CB    1 
ATOM   8241  C  CG1   . VAL B  1 404 ? 81.541  73.311  92.310  1.00 18.37 ? 404 VAL B CG1   1 
ATOM   8242  C  CG2   . VAL B  1 404 ? 83.112  71.743  93.358  1.00 18.37 ? 404 VAL B CG2   1 
ATOM   8243  N  N     . LEU B  1 405 ? 84.316  75.546  90.922  1.00 17.72 ? 405 LEU B N     1 
ATOM   8244  C  CA    . LEU B  1 405 ? 84.133  76.750  90.121  1.00 17.72 ? 405 LEU B CA    1 
ATOM   8245  C  C     . LEU B  1 405 ? 84.746  76.602  88.738  1.00 17.72 ? 405 LEU B C     1 
ATOM   8246  O  O     . LEU B  1 405 ? 84.125  76.998  87.746  1.00 17.72 ? 405 LEU B O     1 
ATOM   8247  C  CB    . LEU B  1 405 ? 84.739  77.956  90.832  1.00 17.72 ? 405 LEU B CB    1 
ATOM   8248  C  CG    . LEU B  1 405 ? 83.839  78.743  91.778  1.00 17.72 ? 405 LEU B CG    1 
ATOM   8249  C  CD1   . LEU B  1 405 ? 84.494  80.055  92.148  1.00 17.72 ? 405 LEU B CD1   1 
ATOM   8250  C  CD2   . LEU B  1 405 ? 82.497  78.970  91.153  1.00 17.72 ? 405 LEU B CD2   1 
ATOM   8251  N  N     . VAL B  1 406 ? 85.943  76.007  88.650  1.00 20.15 ? 406 VAL B N     1 
ATOM   8252  C  CA    . VAL B  1 406 ? 86.591  75.822  87.353  1.00 20.15 ? 406 VAL B CA    1 
ATOM   8253  C  C     . VAL B  1 406 ? 85.786  74.865  86.479  1.00 20.15 ? 406 VAL B C     1 
ATOM   8254  O  O     . VAL B  1 406 ? 85.481  75.176  85.315  1.00 20.15 ? 406 VAL B O     1 
ATOM   8255  C  CB    . VAL B  1 406 ? 88.040  75.342  87.545  1.00 20.15 ? 406 VAL B CB    1 
ATOM   8256  C  CG1   . VAL B  1 406 ? 88.578  74.699  86.283  1.00 20.15 ? 406 VAL B CG1   1 
ATOM   8257  C  CG2   . VAL B  1 406 ? 88.917  76.507  87.949  1.00 20.15 ? 406 VAL B CG2   1 
ATOM   8258  N  N     . PHE B  1 407 ? 85.371  73.720  87.040  1.00 20.67 ? 407 PHE B N     1 
ATOM   8259  C  CA    . PHE B  1 407 ? 84.615  72.777  86.220  1.00 20.67 ? 407 PHE B CA    1 
ATOM   8260  C  C     . PHE B  1 407 ? 83.220  73.284  85.885  1.00 20.67 ? 407 PHE B C     1 
ATOM   8261  O  O     . PHE B  1 407 ? 82.734  73.024  84.784  1.00 20.67 ? 407 PHE B O     1 
ATOM   8262  C  CB    . PHE B  1 407 ? 84.502  71.418  86.893  1.00 20.67 ? 407 PHE B CB    1 
ATOM   8263  C  CG    . PHE B  1 407 ? 83.746  70.400  86.077  1.00 20.67 ? 407 PHE B CG    1 
ATOM   8264  C  CD1   . PHE B  1 407 ? 84.341  69.792  84.988  1.00 20.67 ? 407 PHE B CD1   1 
ATOM   8265  C  CD2   . PHE B  1 407 ? 82.442  70.057  86.395  1.00 20.67 ? 407 PHE B CD2   1 
ATOM   8266  C  CE1   . PHE B  1 407 ? 83.655  68.862  84.234  1.00 20.67 ? 407 PHE B CE1   1 
ATOM   8267  C  CE2   . PHE B  1 407 ? 81.751  69.133  85.640  1.00 20.67 ? 407 PHE B CE2   1 
ATOM   8268  C  CZ    . PHE B  1 407 ? 82.360  68.533  84.563  1.00 20.67 ? 407 PHE B CZ    1 
ATOM   8269  N  N     . ASN B  1 408 ? 82.563  74.015  86.788  1.00 19.93 ? 408 ASN B N     1 
ATOM   8270  C  CA    . ASN B  1 408 ? 81.212  74.467  86.485  1.00 19.93 ? 408 ASN B CA    1 
ATOM   8271  C  C     . ASN B  1 408 ? 81.222  75.614  85.489  1.00 19.93 ? 408 ASN B C     1 
ATOM   8272  O  O     . ASN B  1 408 ? 80.343  75.680  84.623  1.00 19.93 ? 408 ASN B O     1 
ATOM   8273  C  CB    . ASN B  1 408 ? 80.481  74.860  87.760  1.00 19.93 ? 408 ASN B CB    1 
ATOM   8274  C  CG    . ASN B  1 408 ? 79.918  73.666  88.479  1.00 19.93 ? 408 ASN B CG    1 
ATOM   8275  O  OD1   . ASN B  1 408 ? 79.889  72.565  87.938  1.00 19.93 ? 408 ASN B OD1   1 
ATOM   8276  N  ND2   . ASN B  1 408 ? 79.447  73.874  89.691  1.00 19.93 ? 408 ASN B ND2   1 
ATOM   8277  N  N     . PHE B  1 409 ? 82.228  76.497  85.567  1.00 21.00 ? 409 PHE B N     1 
ATOM   8278  C  CA    . PHE B  1 409 ? 82.404  77.523  84.545  1.00 21.00 ? 409 PHE B CA    1 
ATOM   8279  C  C     . PHE B  1 409 ? 82.636  76.900  83.177  1.00 21.00 ? 409 PHE B C     1 
ATOM   8280  O  O     . PHE B  1 409 ? 81.964  77.271  82.204  1.00 21.00 ? 409 PHE B O     1 
ATOM   8281  C  CB    . PHE B  1 409 ? 83.566  78.445  84.921  1.00 21.00 ? 409 PHE B CB    1 
ATOM   8282  C  CG    . PHE B  1 409 ? 83.767  79.596  83.971  1.00 21.00 ? 409 PHE B CG    1 
ATOM   8283  C  CD1   . PHE B  1 409 ? 83.062  80.772  84.133  1.00 21.00 ? 409 PHE B CD1   1 
ATOM   8284  C  CD2   . PHE B  1 409 ? 84.684  79.513  82.933  1.00 21.00 ? 409 PHE B CD2   1 
ATOM   8285  C  CE1   . PHE B  1 409 ? 83.248  81.828  83.265  1.00 21.00 ? 409 PHE B CE1   1 
ATOM   8286  C  CE2   . PHE B  1 409 ? 84.868  80.564  82.064  1.00 21.00 ? 409 PHE B CE2   1 
ATOM   8287  C  CZ    . PHE B  1 409 ? 84.153  81.723  82.233  1.00 21.00 ? 409 PHE B CZ    1 
ATOM   8288  N  N     . LEU B  1 410 ? 83.551  75.924  83.089  1.00 22.35 ? 410 LEU B N     1 
ATOM   8289  C  CA    . LEU B  1 410 ? 83.836  75.312  81.793  1.00 22.35 ? 410 LEU B CA    1 
ATOM   8290  C  C     . LEU B  1 410 ? 82.639  74.530  81.266  1.00 22.35 ? 410 LEU B C     1 
ATOM   8291  O  O     . LEU B  1 410 ? 82.235  74.714  80.114  1.00 22.35 ? 410 LEU B O     1 
ATOM   8292  C  CB    . LEU B  1 410 ? 85.057  74.405  81.877  1.00 22.35 ? 410 LEU B CB    1 
ATOM   8293  C  CG    . LEU B  1 410 ? 85.555  74.091  80.468  1.00 22.35 ? 410 LEU B CG    1 
ATOM   8294  C  CD1   . LEU B  1 410 ? 86.566  75.133  80.024  1.00 22.35 ? 410 LEU B CD1   1 
ATOM   8295  C  CD2   . LEU B  1 410 ? 86.123  72.694  80.356  1.00 22.35 ? 410 LEU B CD2   1 
ATOM   8296  N  N     . ASN B  1 411 ? 82.017  73.710  82.113  1.00 22.91 ? 411 ASN B N     1 
ATOM   8297  C  CA    . ASN B  1 411 ? 80.916  72.859  81.687  1.00 22.91 ? 411 ASN B CA    1 
ATOM   8298  C  C     . ASN B  1 411 ? 79.651  73.644  81.373  1.00 22.91 ? 411 ASN B C     1 
ATOM   8299  O  O     . ASN B  1 411 ? 78.833  73.180  80.575  1.00 22.91 ? 411 ASN B O     1 
ATOM   8300  C  CB    . ASN B  1 411 ? 80.625  71.819  82.763  1.00 22.91 ? 411 ASN B CB    1 
ATOM   8301  C  CG    . ASN B  1 411 ? 79.871  70.631  82.230  1.00 22.91 ? 411 ASN B CG    1 
ATOM   8302  O  OD1   . ASN B  1 411 ? 79.915  70.340  81.037  1.00 22.91 ? 411 ASN B OD1   1 
ATOM   8303  N  ND2   . ASN B  1 411 ? 79.175  69.930  83.112  1.00 22.91 ? 411 ASN B ND2   1 
ATOM   8304  N  N     . CYS B  1 412 ? 79.465  74.826  81.965  1.00 22.30 ? 412 CYS B N     1 
ATOM   8305  C  CA    . CYS B  1 412 ? 78.274  75.594  81.633  1.00 22.30 ? 412 CYS B CA    1 
ATOM   8306  C  C     . CYS B  1 412 ? 78.491  76.500  80.428  1.00 22.30 ? 412 CYS B C     1 
ATOM   8307  O  O     . CYS B  1 412 ? 77.585  76.642  79.601  1.00 22.30 ? 412 CYS B O     1 
ATOM   8308  C  CB    . CYS B  1 412 ? 77.811  76.408  82.841  1.00 22.30 ? 412 CYS B CB    1 
ATOM   8309  S  SG    . CYS B  1 412 ? 77.129  75.419  84.187  1.00 22.30 ? 412 CYS B SG    1 
ATOM   8310  N  N     . PHE B  1 413 ? 79.664  77.122  80.292  1.00 22.02 ? 413 PHE B N     1 
ATOM   8311  C  CA    . PHE B  1 413 ? 79.843  78.124  79.251  1.00 22.02 ? 413 PHE B CA    1 
ATOM   8312  C  C     . PHE B  1 413 ? 80.703  77.657  78.082  1.00 22.02 ? 413 PHE B C     1 
ATOM   8313  O  O     . PHE B  1 413 ? 80.989  78.464  77.191  1.00 22.02 ? 413 PHE B O     1 
ATOM   8314  C  CB    . PHE B  1 413 ? 80.429  79.400  79.851  1.00 22.02 ? 413 PHE B CB    1 
ATOM   8315  C  CG    . PHE B  1 413 ? 79.657  79.921  81.023  1.00 22.02 ? 413 PHE B CG    1 
ATOM   8316  C  CD1   . PHE B  1 413 ? 78.378  80.412  80.861  1.00 22.02 ? 413 PHE B CD1   1 
ATOM   8317  C  CD2   . PHE B  1 413 ? 80.211  79.919  82.287  1.00 22.02 ? 413 PHE B CD2   1 
ATOM   8318  C  CE1   . PHE B  1 413 ? 77.670  80.889  81.941  1.00 22.02 ? 413 PHE B CE1   1 
ATOM   8319  C  CE2   . PHE B  1 413 ? 79.506  80.393  83.369  1.00 22.02 ? 413 PHE B CE2   1 
ATOM   8320  C  CZ    . PHE B  1 413 ? 78.236  80.875  83.195  1.00 22.02 ? 413 PHE B CZ    1 
ATOM   8321  N  N     . ALA B  1 414 ? 81.083  76.375  78.029  1.00 23.96 ? 414 ALA B N     1 
ATOM   8322  C  CA    . ALA B  1 414 ? 81.927  75.911  76.933  1.00 23.96 ? 414 ALA B CA    1 
ATOM   8323  C  C     . ALA B  1 414 ? 81.167  75.867  75.616  1.00 23.96 ? 414 ALA B C     1 
ATOM   8324  O  O     . ALA B  1 414 ? 81.709  76.252  74.574  1.00 23.96 ? 414 ALA B O     1 
ATOM   8325  C  CB    . ALA B  1 414 ? 82.503  74.538  77.263  1.00 23.96 ? 414 ALA B CB    1 
ATOM   8326  N  N     . SER B  1 415 ? 79.910  75.418  75.642  1.00 25.83 ? 415 SER B N     1 
ATOM   8327  C  CA    . SER B  1 415 ? 79.120  75.370  74.416  1.00 25.83 ? 415 SER B CA    1 
ATOM   8328  C  C     . SER B  1 415 ? 78.786  76.764  73.908  1.00 25.83 ? 415 SER B C     1 
ATOM   8329  O  O     . SER B  1 415 ? 78.797  76.999  72.695  1.00 25.83 ? 415 SER B O     1 
ATOM   8330  C  CB    . SER B  1 415 ? 77.838  74.578  74.644  1.00 25.83 ? 415 SER B CB    1 
ATOM   8331  O  OG    . SER B  1 415 ? 76.810  75.421  75.127  1.00 25.83 ? 415 SER B OG    1 
ATOM   8332  N  N     . LEU B  1 416 ? 78.532  77.707  74.815  1.00 24.65 ? 416 LEU B N     1 
ATOM   8333  C  CA    . LEU B  1 416 ? 78.259  79.073  74.392  1.00 24.65 ? 416 LEU B CA    1 
ATOM   8334  C  C     . LEU B  1 416 ? 79.512  79.764  73.871  1.00 24.65 ? 416 LEU B C     1 
ATOM   8335  O  O     . LEU B  1 416 ? 79.426  80.555  72.926  1.00 24.65 ? 416 LEU B O     1 
ATOM   8336  C  CB    . LEU B  1 416 ? 77.646  79.860  75.543  1.00 24.65 ? 416 LEU B CB    1 
ATOM   8337  C  CG    . LEU B  1 416 ? 76.427  79.181  76.160  1.00 24.65 ? 416 LEU B CG    1 
ATOM   8338  C  CD1   . LEU B  1 416 ? 75.936  79.962  77.354  1.00 24.65 ? 416 LEU B CD1   1 
ATOM   8339  C  CD2   . LEU B  1 416 ? 75.331  79.041  75.128  1.00 24.65 ? 416 LEU B CD2   1 
ATOM   8340  N  N     . PHE B  1 417 ? 80.683  79.454  74.436  1.00 26.17 ? 417 PHE B N     1 
ATOM   8341  C  CA    . PHE B  1 417 ? 81.920  80.000  73.890  1.00 26.17 ? 417 PHE B CA    1 
ATOM   8342  C  C     . PHE B  1 417 ? 82.236  79.402  72.526  1.00 26.17 ? 417 PHE B C     1 
ATOM   8343  O  O     . PHE B  1 417 ? 82.729  80.105  71.635  1.00 26.17 ? 417 PHE B O     1 
ATOM   8344  C  CB    . PHE B  1 417 ? 83.074  79.761  74.859  1.00 26.17 ? 417 PHE B CB    1 
ATOM   8345  C  CG    . PHE B  1 417 ? 83.121  80.735  75.999  1.00 26.17 ? 417 PHE B CG    1 
ATOM   8346  C  CD1   . PHE B  1 417 ? 82.545  81.987  75.882  1.00 26.17 ? 417 PHE B CD1   1 
ATOM   8347  C  CD2   . PHE B  1 417 ? 83.743  80.396  77.187  1.00 26.17 ? 417 PHE B CD2   1 
ATOM   8348  C  CE1   . PHE B  1 417 ? 82.589  82.883  76.929  1.00 26.17 ? 417 PHE B CE1   1 
ATOM   8349  C  CE2   . PHE B  1 417 ? 83.789  81.288  78.237  1.00 26.17 ? 417 PHE B CE2   1 
ATOM   8350  C  CZ    . PHE B  1 417 ? 83.212  82.532  78.107  1.00 26.17 ? 417 PHE B CZ    1 
ATOM   8351  N  N     . TYR B  1 418 ? 81.942  78.111  72.338  1.00 28.66 ? 418 TYR B N     1 
ATOM   8352  C  CA    . TYR B  1 418 ? 82.157  77.485  71.038  1.00 28.66 ? 418 TYR B CA    1 
ATOM   8353  C  C     . TYR B  1 418 ? 81.184  78.007  69.990  1.00 28.66 ? 418 TYR B C     1 
ATOM   8354  O  O     . TYR B  1 418 ? 81.530  78.064  68.807  1.00 28.66 ? 418 TYR B O     1 
ATOM   8355  C  CB    . TYR B  1 418 ? 82.039  75.967  71.152  1.00 28.66 ? 418 TYR B CB    1 
ATOM   8356  C  CG    . TYR B  1 418 ? 82.448  75.224  69.899  1.00 28.66 ? 418 TYR B CG    1 
ATOM   8357  C  CD1   . TYR B  1 418 ? 83.784  74.952  69.638  1.00 28.66 ? 418 TYR B CD1   1 
ATOM   8358  C  CD2   . TYR B  1 418 ? 81.500  74.794  68.978  1.00 28.66 ? 418 TYR B CD2   1 
ATOM   8359  C  CE1   . TYR B  1 418 ? 84.162  74.272  68.494  1.00 28.66 ? 418 TYR B CE1   1 
ATOM   8360  C  CE2   . TYR B  1 418 ? 81.867  74.118  67.834  1.00 28.66 ? 418 TYR B CE2   1 
ATOM   8361  C  CZ    . TYR B  1 418 ? 83.198  73.860  67.597  1.00 28.66 ? 418 TYR B CZ    1 
ATOM   8362  O  OH    . TYR B  1 418 ? 83.564  73.184  66.457  1.00 28.66 ? 418 TYR B OH    1 
ATOM   8363  N  N     . ILE B  1 419 ? 79.965  78.372  70.387  1.00 27.25 ? 419 ILE B N     1 
ATOM   8364  C  CA    . ILE B  1 419 ? 79.051  78.971  69.420  1.00 27.25 ? 419 ILE B CA    1 
ATOM   8365  C  C     . ILE B  1 419 ? 79.484  80.394  69.092  1.00 27.25 ? 419 ILE B C     1 
ATOM   8366  O  O     . ILE B  1 419 ? 79.525  80.791  67.921  1.00 27.25 ? 419 ILE B O     1 
ATOM   8367  C  CB    . ILE B  1 419 ? 77.605  78.920  69.939  1.00 27.25 ? 419 ILE B CB    1 
ATOM   8368  C  CG1   . ILE B  1 419 ? 77.090  77.489  69.934  1.00 27.25 ? 419 ILE B CG1   1 
ATOM   8369  C  CG2   . ILE B  1 419 ? 76.694  79.722  69.055  1.00 27.25 ? 419 ILE B CG2   1 
ATOM   8370  C  CD1   . ILE B  1 419 ? 75.762  77.319  70.623  1.00 27.25 ? 419 ILE B CD1   1 
ATOM   8371  N  N     . ALA B  1 420 ? 79.862  81.170  70.109  1.00 29.47 ? 420 ALA B N     1 
ATOM   8372  C  CA    . ALA B  1 420 ? 80.122  82.589  69.905  1.00 29.47 ? 420 ALA B CA    1 
ATOM   8373  C  C     . ALA B  1 420 ? 81.443  82.863  69.199  1.00 29.47 ? 420 ALA B C     1 
ATOM   8374  O  O     . ALA B  1 420 ? 81.520  83.806  68.405  1.00 29.47 ? 420 ALA B O     1 
ATOM   8375  C  CB    . ALA B  1 420 ? 80.099  83.321  71.246  1.00 29.47 ? 420 ALA B CB    1 
ATOM   8376  N  N     . PHE B  1 421 ? 82.486  82.075  69.456  1.00 31.16 ? 421 PHE B N     1 
ATOM   8377  C  CA    . PHE B  1 421 ? 83.814  82.426  68.972  1.00 31.16 ? 421 PHE B CA    1 
ATOM   8378  C  C     . PHE B  1 421 ? 84.391  81.450  67.958  1.00 31.16 ? 421 PHE B C     1 
ATOM   8379  O  O     . PHE B  1 421 ? 85.494  81.686  67.459  1.00 31.16 ? 421 PHE B O     1 
ATOM   8380  C  CB    . PHE B  1 421 ? 84.776  82.570  70.153  1.00 31.16 ? 421 PHE B CB    1 
ATOM   8381  C  CG    . PHE B  1 421 ? 84.323  83.568  71.170  1.00 31.16 ? 421 PHE B CG    1 
ATOM   8382  C  CD1   . PHE B  1 421 ? 83.923  84.832  70.780  1.00 31.16 ? 421 PHE B CD1   1 
ATOM   8383  C  CD2   . PHE B  1 421 ? 84.291  83.244  72.514  1.00 31.16 ? 421 PHE B CD2   1 
ATOM   8384  C  CE1   . PHE B  1 421 ? 83.499  85.756  71.710  1.00 31.16 ? 421 PHE B CE1   1 
ATOM   8385  C  CE2   . PHE B  1 421 ? 83.869  84.165  73.450  1.00 31.16 ? 421 PHE B CE2   1 
ATOM   8386  C  CZ    . PHE B  1 421 ? 83.472  85.422  73.046  1.00 31.16 ? 421 PHE B CZ    1 
ATOM   8387  N  N     . VAL B  1 422 ? 83.691  80.366  67.632  1.00 31.46 ? 422 VAL B N     1 
ATOM   8388  C  CA    . VAL B  1 422 ? 84.129  79.427  66.607  1.00 31.46 ? 422 VAL B CA    1 
ATOM   8389  C  C     . VAL B  1 422 ? 83.117  79.331  65.472  1.00 31.46 ? 422 VAL B C     1 
ATOM   8390  O  O     . VAL B  1 422 ? 83.456  79.542  64.304  1.00 31.46 ? 422 VAL B O     1 
ATOM   8391  C  CB    . VAL B  1 422 ? 84.418  78.034  67.205  1.00 31.46 ? 422 VAL B CB    1 
ATOM   8392  C  CG1   . VAL B  1 422 ? 84.623  77.013  66.104  1.00 31.46 ? 422 VAL B CG1   1 
ATOM   8393  C  CG2   . VAL B  1 422 ? 85.635  78.094  68.106  1.00 31.46 ? 422 VAL B CG2   1 
ATOM   8394  N  N     . LEU B  1 423 ? 81.860  79.023  65.797  1.00 32.10 ? 423 LEU B N     1 
ATOM   8395  C  CA    . LEU B  1 423 ? 80.830  78.984  64.764  1.00 32.10 ? 423 LEU B CA    1 
ATOM   8396  C  C     . LEU B  1 423 ? 80.433  80.382  64.312  1.00 32.10 ? 423 LEU B C     1 
ATOM   8397  O  O     . LEU B  1 423 ? 80.179  80.588  63.119  1.00 32.10 ? 423 LEU B O     1 
ATOM   8398  C  CB    . LEU B  1 423 ? 79.602  78.225  65.266  1.00 32.10 ? 423 LEU B CB    1 
ATOM   8399  C  CG    . LEU B  1 423 ? 79.768  76.773  65.715  1.00 32.10 ? 423 LEU B CG    1 
ATOM   8400  C  CD1   . LEU B  1 423 ? 78.413  76.101  65.818  1.00 32.10 ? 423 LEU B CD1   1 
ATOM   8401  C  CD2   . LEU B  1 423 ? 80.667  75.999  64.769  1.00 32.10 ? 423 LEU B CD2   1 
ATOM   8402  N  N     . LYS B  1 424 ? 80.395  81.339  65.245  1.00 36.68 ? 424 LYS B N     1 
ATOM   8403  C  CA    . LYS B  1 424 ? 80.000  82.738  65.034  1.00 36.68 ? 424 LYS B CA    1 
ATOM   8404  C  C     . LYS B  1 424 ? 78.608  82.835  64.402  1.00 36.68 ? 424 LYS B C     1 
ATOM   8405  O  O     . LYS B  1 424 ? 78.418  83.368  63.311  1.00 36.68 ? 424 LYS B O     1 
ATOM   8406  C  CB    . LYS B  1 424 ? 81.035  83.496  64.194  1.00 36.68 ? 424 LYS B CB    1 
ATOM   8407  C  CG    . LYS B  1 424 ? 82.479  83.276  64.605  1.00 36.68 ? 424 LYS B CG    1 
ATOM   8408  C  CD    . LYS B  1 424 ? 83.384  84.312  63.962  1.00 36.68 ? 424 LYS B CD    1 
ATOM   8409  C  CE    . LYS B  1 424 ? 84.849  83.957  64.134  1.00 36.68 ? 424 LYS B CE    1 
ATOM   8410  N  NZ    . LYS B  1 424 ? 85.197  82.699  63.422  1.00 36.68 ? 424 LYS B NZ    1 
ATOM   8411  N  N     . ASP B  1 425 ? 77.630  82.294  65.132  1.00 38.15 ? 425 ASP B N     1 
ATOM   8412  C  CA    . ASP B  1 425 ? 76.242  82.239  64.666  1.00 38.15 ? 425 ASP B CA    1 
ATOM   8413  C  C     . ASP B  1 425 ? 75.375  82.724  65.827  1.00 38.15 ? 425 ASP B C     1 
ATOM   8414  O  O     . ASP B  1 425 ? 75.129  81.982  66.781  1.00 38.15 ? 425 ASP B O     1 
ATOM   8415  C  CB    . ASP B  1 425 ? 75.868  80.833  64.210  1.00 38.15 ? 425 ASP B CB    1 
ATOM   8416  C  CG    . ASP B  1 425 ? 74.472  80.757  63.627  1.00 38.15 ? 425 ASP B CG    1 
ATOM   8417  O  OD1   . ASP B  1 425 ? 74.350  80.772  62.384  1.00 38.15 ? 425 ASP B OD1   1 
ATOM   8418  O  OD2   . ASP B  1 425 ? 73.498  80.685  64.400  1.00 38.15 ? 425 ASP B OD2   1 
ATOM   8419  N  N     . MET B  1 426 ? 74.913  83.975  65.735  1.00 37.52 ? 426 MET B N     1 
ATOM   8420  C  CA    . MET B  1 426 ? 74.274  84.617  66.879  1.00 37.52 ? 426 MET B CA    1 
ATOM   8421  C  C     . MET B  1 426 ? 72.859  84.108  67.121  1.00 37.52 ? 426 MET B C     1 
ATOM   8422  O  O     . MET B  1 426 ? 72.362  84.201  68.249  1.00 37.52 ? 426 MET B O     1 
ATOM   8423  C  CB    . MET B  1 426 ? 74.258  86.132  66.693  1.00 37.52 ? 426 MET B CB    1 
ATOM   8424  C  CG    . MET B  1 426 ? 75.638  86.760  66.665  1.00 37.52 ? 426 MET B CG    1 
ATOM   8425  S  SD    . MET B  1 426 ? 76.681  86.190  68.017  1.00 37.52 ? 426 MET B SD    1 
ATOM   8426  C  CE    . MET B  1 426 ? 78.196  87.072  67.664  1.00 37.52 ? 426 MET B CE    1 
ATOM   8427  N  N     . LYS B  1 427 ? 72.193  83.577  66.093  1.00 37.16 ? 427 LYS B N     1 
ATOM   8428  C  CA    . LYS B  1 427 ? 70.847  83.040  66.285  1.00 37.16 ? 427 LYS B CA    1 
ATOM   8429  C  C     . LYS B  1 427 ? 70.879  81.767  67.125  1.00 37.16 ? 427 LYS B C     1 
ATOM   8430  O  O     . LYS B  1 427 ? 70.090  81.613  68.070  1.00 37.16 ? 427 LYS B O     1 
ATOM   8431  C  CB    . LYS B  1 427 ? 70.193  82.779  64.929  1.00 37.16 ? 427 LYS B CB    1 
ATOM   8432  C  CG    . LYS B  1 427 ? 68.785  82.217  65.003  1.00 37.16 ? 427 LYS B CG    1 
ATOM   8433  C  CD    . LYS B  1 427 ? 68.100  82.269  63.645  1.00 37.16 ? 427 LYS B CD    1 
ATOM   8434  C  CE    . LYS B  1 427 ? 66.609  81.997  63.768  1.00 37.16 ? 427 LYS B CE    1 
ATOM   8435  N  NZ    . LYS B  1 427 ? 65.834  82.525  62.610  1.00 37.16 ? 427 LYS B NZ    1 
ATOM   8436  N  N     . LEU B  1 428 ? 71.807  80.858  66.808  1.00 35.73 ? 428 LEU B N     1 
ATOM   8437  C  CA    . LEU B  1 428 ? 72.013  79.672  67.629  1.00 35.73 ? 428 LEU B CA    1 
ATOM   8438  C  C     . LEU B  1 428 ? 72.535  80.035  69.012  1.00 35.73 ? 428 LEU B C     1 
ATOM   8439  O  O     . LEU B  1 428 ? 72.217  79.345  69.983  1.00 35.73 ? 428 LEU B O     1 
ATOM   8440  C  CB    . LEU B  1 428 ? 72.971  78.706  66.931  1.00 35.73 ? 428 LEU B CB    1 
ATOM   8441  C  CG    . LEU B  1 428 ? 73.302  77.373  67.598  1.00 35.73 ? 428 LEU B CG    1 
ATOM   8442  C  CD1   . LEU B  1 428 ? 72.042  76.569  67.863  1.00 35.73 ? 428 LEU B CD1   1 
ATOM   8443  C  CD2   . LEU B  1 428 ? 74.281  76.578  66.756  1.00 35.73 ? 428 LEU B CD2   1 
ATOM   8444  N  N     . LEU B  1 429 ? 73.294  81.129  69.129  1.00 30.54 ? 429 LEU B N     1 
ATOM   8445  C  CA    . LEU B  1 429 ? 73.760  81.569  70.441  1.00 30.54 ? 429 LEU B CA    1 
ATOM   8446  C  C     . LEU B  1 429 ? 72.607  82.056  71.303  1.00 30.54 ? 429 LEU B C     1 
ATOM   8447  O  O     . LEU B  1 429 ? 72.539  81.719  72.489  1.00 30.54 ? 429 LEU B O     1 
ATOM   8448  C  CB    . LEU B  1 429 ? 74.812  82.665  70.295  1.00 30.54 ? 429 LEU B CB    1 
ATOM   8449  C  CG    . LEU B  1 429 ? 75.391  83.235  71.590  1.00 30.54 ? 429 LEU B CG    1 
ATOM   8450  C  CD1   . LEU B  1 429 ? 75.955  82.136  72.463  1.00 30.54 ? 429 LEU B CD1   1 
ATOM   8451  C  CD2   . LEU B  1 429 ? 76.466  84.242  71.270  1.00 30.54 ? 429 LEU B CD2   1 
ATOM   8452  N  N     . ARG B  1 430 ? 71.680  82.823  70.717  1.00 34.14 ? 430 ARG B N     1 
ATOM   8453  C  CA    . ARG B  1 430 ? 70.500  83.268  71.453  1.00 34.14 ? 430 ARG B CA    1 
ATOM   8454  C  C     . ARG B  1 430 ? 69.629  82.092  71.873  1.00 34.14 ? 430 ARG B C     1 
ATOM   8455  O  O     . ARG B  1 430 ? 69.211  82.008  73.037  1.00 34.14 ? 430 ARG B O     1 
ATOM   8456  C  CB    . ARG B  1 430 ? 69.685  84.243  70.605  1.00 34.14 ? 430 ARG B CB    1 
ATOM   8457  C  CG    . ARG B  1 430 ? 70.309  85.609  70.417  1.00 34.14 ? 430 ARG B CG    1 
ATOM   8458  C  CD    . ARG B  1 430 ? 69.401  86.494  69.582  1.00 34.14 ? 430 ARG B CD    1 
ATOM   8459  N  NE    . ARG B  1 430 ? 70.154  87.336  68.660  1.00 34.14 ? 430 ARG B NE    1 
ATOM   8460  C  CZ    . ARG B  1 430 ? 70.483  88.599  68.903  1.00 34.14 ? 430 ARG B CZ    1 
ATOM   8461  N  NH1   . ARG B  1 430 ? 70.121  89.171  70.041  1.00 34.14 ? 430 ARG B NH1   1 
ATOM   8462  N  NH2   . ARG B  1 430 ? 71.173  89.291  68.008  1.00 34.14 ? 430 ARG B NH2   1 
ATOM   8463  N  N     . GLN B  1 431 ? 69.381  81.155  70.946  1.00 36.25 ? 431 GLN B N     1 
ATOM   8464  C  CA    . GLN B  1 431 ? 68.542  79.997  71.253  1.00 36.25 ? 431 GLN B CA    1 
ATOM   8465  C  C     . GLN B  1 431 ? 69.175  79.106  72.315  1.00 36.25 ? 431 GLN B C     1 
ATOM   8466  O  O     . GLN B  1 431 ? 68.505  78.712  73.279  1.00 36.25 ? 431 GLN B O     1 
ATOM   8467  C  CB    . GLN B  1 431 ? 68.273  79.189  69.985  1.00 36.25 ? 431 GLN B CB    1 
ATOM   8468  C  CG    . GLN B  1 431 ? 67.204  79.774  69.083  1.00 36.25 ? 431 GLN B CG    1 
ATOM   8469  C  CD    . GLN B  1 431 ? 66.844  78.845  67.943  1.00 36.25 ? 431 GLN B CD    1 
ATOM   8470  O  OE1   . GLN B  1 431 ? 67.364  77.734  67.848  1.00 36.25 ? 431 GLN B OE1   1 
ATOM   8471  N  NE2   . GLN B  1 431 ? 65.952  79.296  67.068  1.00 36.25 ? 431 GLN B NE2   1 
ATOM   8472  N  N     . SER B  1 432 ? 70.473  78.822  72.183  1.00 29.57 ? 432 SER B N     1 
ATOM   8473  C  CA    . SER B  1 432 ? 71.146  77.935  73.120  1.00 29.57 ? 432 SER B CA    1 
ATOM   8474  C  C     . SER B  1 432 ? 71.311  78.586  74.484  1.00 29.57 ? 432 SER B C     1 
ATOM   8475  O  O     . SER B  1 432 ? 71.162  77.914  75.507  1.00 29.57 ? 432 SER B O     1 
ATOM   8476  C  CB    . SER B  1 432 ? 72.501  77.515  72.557  1.00 29.57 ? 432 SER B CB    1 
ATOM   8477  O  OG    . SER B  1 432 ? 73.179  76.662  73.459  1.00 29.57 ? 432 SER B OG    1 
ATOM   8478  N  N     . LEU B  1 433 ? 71.577  79.897  74.524  1.00 26.02 ? 433 LEU B N     1 
ATOM   8479  C  CA    . LEU B  1 433 ? 71.732  80.582  75.802  1.00 26.02 ? 433 LEU B CA    1 
ATOM   8480  C  C     . LEU B  1 433 ? 70.410  80.664  76.549  1.00 26.02 ? 433 LEU B C     1 
ATOM   8481  O  O     . LEU B  1 433 ? 70.364  80.396  77.757  1.00 26.02 ? 433 LEU B O     1 
ATOM   8482  C  CB    . LEU B  1 433 ? 72.317  81.974  75.576  1.00 26.02 ? 433 LEU B CB    1 
ATOM   8483  C  CG    . LEU B  1 433 ? 72.324  82.960  76.740  1.00 26.02 ? 433 LEU B CG    1 
ATOM   8484  C  CD1   . LEU B  1 433 ? 73.157  82.434  77.883  1.00 26.02 ? 433 LEU B CD1   1 
ATOM   8485  C  CD2   . LEU B  1 433 ? 72.863  84.294  76.276  1.00 26.02 ? 433 LEU B CD2   1 
ATOM   8486  N  N     . ALA B  1 434 ? 69.318  80.989  75.843  1.00 27.84 ? 434 ALA B N     1 
ATOM   8487  C  CA    . ALA B  1 434 ? 68.013  81.047  76.492  1.00 27.84 ? 434 ALA B CA    1 
ATOM   8488  C  C     . ALA B  1 434 ? 67.561  79.670  76.961  1.00 27.84 ? 434 ALA B C     1 
ATOM   8489  O  O     . ALA B  1 434 ? 67.051  79.534  78.081  1.00 27.84 ? 434 ALA B O     1 
ATOM   8490  C  CB    . ALA B  1 434 ? 66.980  81.654  75.546  1.00 27.84 ? 434 ALA B CB    1 
ATOM   8491  N  N     . THR B  1 435 ? 67.790  78.632  76.147  1.00 29.26 ? 435 THR B N     1 
ATOM   8492  C  CA    . THR B  1 435 ? 67.355  77.292  76.526  1.00 29.26 ? 435 THR B CA    1 
ATOM   8493  C  C     . THR B  1 435 ? 68.182  76.744  77.684  1.00 29.26 ? 435 THR B C     1 
ATOM   8494  O  O     . THR B  1 435 ? 67.621  76.163  78.622  1.00 29.26 ? 435 THR B O     1 
ATOM   8495  C  CB    . THR B  1 435 ? 67.426  76.357  75.321  1.00 29.26 ? 435 THR B CB    1 
ATOM   8496  O  OG1   . THR B  1 435 ? 66.642  76.902  74.255  1.00 29.26 ? 435 THR B OG1   1 
ATOM   8497  C  CG2   . THR B  1 435 ? 66.858  75.000  75.674  1.00 29.26 ? 435 THR B CG2   1 
ATOM   8498  N  N     . LEU B  1 436 ? 69.504  76.964  77.664  1.00 26.64 ? 436 LEU B N     1 
ATOM   8499  C  CA    . LEU B  1 436 ? 70.367  76.511  78.750  1.00 26.64 ? 436 LEU B CA    1 
ATOM   8500  C  C     . LEU B  1 436 ? 70.034  77.217  80.056  1.00 26.64 ? 436 LEU B C     1 
ATOM   8501  O  O     . LEU B  1 436 ? 69.895  76.565  81.097  1.00 26.64 ? 436 LEU B O     1 
ATOM   8502  C  CB    . LEU B  1 436 ? 71.836  76.734  78.389  1.00 26.64 ? 436 LEU B CB    1 
ATOM   8503  C  CG    . LEU B  1 436 ? 72.560  75.684  77.545  1.00 26.64 ? 436 LEU B CG    1 
ATOM   8504  C  CD1   . LEU B  1 436 ? 74.053  75.938  77.562  1.00 26.64 ? 436 LEU B CD1   1 
ATOM   8505  C  CD2   . LEU B  1 436 ? 72.261  74.291  78.039  1.00 26.64 ? 436 LEU B CD2   1 
ATOM   8506  N  N     . LEU B  1 437 ? 69.847  78.544  80.010  1.00 24.62 ? 437 LEU B N     1 
ATOM   8507  C  CA    . LEU B  1 437 ? 69.532  79.297  81.219  1.00 24.62 ? 437 LEU B CA    1 
ATOM   8508  C  C     . LEU B  1 437 ? 68.173  78.920  81.797  1.00 24.62 ? 437 LEU B C     1 
ATOM   8509  O  O     . LEU B  1 437 ? 68.075  78.663  83.004  1.00 24.62 ? 437 LEU B O     1 
ATOM   8510  C  CB    . LEU B  1 437 ? 69.587  80.794  80.928  1.00 24.62 ? 437 LEU B CB    1 
ATOM   8511  C  CG    . LEU B  1 437 ? 69.254  81.728  82.088  1.00 24.62 ? 437 LEU B CG    1 
ATOM   8512  C  CD1   . LEU B  1 437 ? 70.172  81.463  83.261  1.00 24.62 ? 437 LEU B CD1   1 
ATOM   8513  C  CD2   . LEU B  1 437 ? 69.374  83.167  81.643  1.00 24.62 ? 437 LEU B CD2   1 
ATOM   8514  N  N     . ILE B  1 438 ? 67.137  78.830  80.963  1.00 24.51 ? 438 ILE B N     1 
ATOM   8515  C  CA    . ILE B  1 438 ? 65.801  78.509  81.455  1.00 24.51 ? 438 ILE B CA    1 
ATOM   8516  C  C     . ILE B  1 438 ? 65.709  77.067  81.947  1.00 24.51 ? 438 ILE B C     1 
ATOM   8517  O  O     . ILE B  1 438 ? 65.164  76.815  83.026  1.00 24.51 ? 438 ILE B O     1 
ATOM   8518  C  CB    . ILE B  1 438 ? 64.767  78.814  80.353  1.00 24.51 ? 438 ILE B CB    1 
ATOM   8519  C  CG1   . ILE B  1 438 ? 64.603  80.326  80.206  1.00 24.51 ? 438 ILE B CG1   1 
ATOM   8520  C  CG2   . ILE B  1 438 ? 63.424  78.179  80.658  1.00 24.51 ? 438 ILE B CG2   1 
ATOM   8521  C  CD1   . ILE B  1 438 ? 63.625  80.735  79.131  1.00 24.51 ? 438 ILE B CD1   1 
ATOM   8522  N  N     . THR B  1 439 ? 66.284  76.107  81.211  1.00 24.34 ? 439 THR B N     1 
ATOM   8523  C  CA    . THR B  1 439 ? 66.182  74.709  81.614  1.00 24.34 ? 439 THR B CA    1 
ATOM   8524  C  C     . THR B  1 439 ? 67.030  74.421  82.847  1.00 24.34 ? 439 THR B C     1 
ATOM   8525  O  O     . THR B  1 439 ? 66.595  73.681  83.739  1.00 24.34 ? 439 THR B O     1 
ATOM   8526  C  CB    . THR B  1 439 ? 66.587  73.806  80.451  1.00 24.34 ? 439 THR B CB    1 
ATOM   8527  O  OG1   . THR B  1 439 ? 65.782  74.123  79.312  1.00 24.34 ? 439 THR B OG1   1 
ATOM   8528  C  CG2   . THR B  1 439 ? 66.355  72.348  80.793  1.00 24.34 ? 439 THR B CG2   1 
ATOM   8529  N  N     . SER B  1 440 ? 68.219  75.032  82.946  1.00 23.55 ? 440 SER B N     1 
ATOM   8530  C  CA    . SER B  1 440 ? 69.039  74.848  84.135  1.00 23.55 ? 440 SER B CA    1 
ATOM   8531  C  C     . SER B  1 440 ? 68.405  75.484  85.362  1.00 23.55 ? 440 SER B C     1 
ATOM   8532  O  O     . SER B  1 440 ? 68.459  74.899  86.446  1.00 23.55 ? 440 SER B O     1 
ATOM   8533  C  CB    . SER B  1 440 ? 70.434  75.420  83.906  1.00 23.55 ? 440 SER B CB    1 
ATOM   8534  O  OG    . SER B  1 440 ? 71.097  75.628  85.139  1.00 23.55 ? 440 SER B OG    1 
ATOM   8535  N  N     . GLN B  1 441 ? 67.750  76.639  85.206  1.00 24.37 ? 441 GLN B N     1 
ATOM   8536  C  CA    . GLN B  1 441 ? 67.084  77.263  86.346  1.00 24.37 ? 441 GLN B CA    1 
ATOM   8537  C  C     . GLN B  1 441 ? 65.854  76.475  86.782  1.00 24.37 ? 441 GLN B C     1 
ATOM   8538  O  O     . GLN B  1 441 ? 65.596  76.340  87.984  1.00 24.37 ? 441 GLN B O     1 
ATOM   8539  C  CB    . GLN B  1 441 ? 66.702  78.697  86.007  1.00 24.37 ? 441 GLN B CB    1 
ATOM   8540  C  CG    . GLN B  1 441 ? 67.814  79.691  86.225  1.00 24.37 ? 441 GLN B CG    1 
ATOM   8541  C  CD    . GLN B  1 441 ? 67.422  81.079  85.784  1.00 24.37 ? 441 GLN B CD    1 
ATOM   8542  O  OE1   . GLN B  1 441 ? 66.346  81.280  85.225  1.00 24.37 ? 441 GLN B OE1   1 
ATOM   8543  N  NE2   . GLN B  1 441 ? 68.285  82.050  86.046  1.00 24.37 ? 441 GLN B NE2   1 
ATOM   8544  N  N     . ILE B  1 442 ? 65.095  75.933  85.826  1.00 23.60 ? 442 ILE B N     1 
ATOM   8545  C  CA    . ILE B  1 442 ? 63.904  75.160  86.168  1.00 23.60 ? 442 ILE B CA    1 
ATOM   8546  C  C     . ILE B  1 442 ? 64.290  73.849  86.847  1.00 23.60 ? 442 ILE B C     1 
ATOM   8547  O  O     . ILE B  1 442 ? 63.698  73.464  87.866  1.00 23.60 ? 442 ILE B O     1 
ATOM   8548  C  CB    . ILE B  1 442 ? 63.048  74.940  84.905  1.00 23.60 ? 442 ILE B CB    1 
ATOM   8549  C  CG1   . ILE B  1 442 ? 62.185  76.174  84.641  1.00 23.60 ? 442 ILE B CG1   1 
ATOM   8550  C  CG2   . ILE B  1 442 ? 62.168  73.704  85.019  1.00 23.60 ? 442 ILE B CG2   1 
ATOM   8551  C  CD1   . ILE B  1 442 ? 61.354  76.085  83.386  1.00 23.60 ? 442 ILE B CD1   1 
ATOM   8552  N  N     . LEU B  1 443 ? 65.322  73.173  86.334  1.00 26.97 ? 443 LEU B N     1 
ATOM   8553  C  CA    . LEU B  1 443 ? 65.762  71.927  86.950  1.00 26.97 ? 443 LEU B CA    1 
ATOM   8554  C  C     . LEU B  1 443 ? 66.433  72.179  88.296  1.00 26.97 ? 443 LEU B C     1 
ATOM   8555  O  O     . LEU B  1 443 ? 66.340  71.345  89.203  1.00 26.97 ? 443 LEU B O     1 
ATOM   8556  C  CB    . LEU B  1 443 ? 66.702  71.186  86.005  1.00 26.97 ? 443 LEU B CB    1 
ATOM   8557  C  CG    . LEU B  1 443 ? 66.753  69.680  86.223  1.00 26.97 ? 443 LEU B CG    1 
ATOM   8558  C  CD1   . LEU B  1 443 ? 65.514  69.044  85.628  1.00 26.97 ? 443 LEU B CD1   1 
ATOM   8559  C  CD2   . LEU B  1 443 ? 67.997  69.099  85.598  1.00 26.97 ? 443 LEU B CD2   1 
ATOM   8560  N  N     . ASN B  1 444 ? 67.081  73.339  88.451  1.00 28.27 ? 444 ASN B N     1 
ATOM   8561  C  CA    . ASN B  1 444 ? 67.618  73.752  89.742  1.00 28.27 ? 444 ASN B CA    1 
ATOM   8562  C  C     . ASN B  1 444 ? 66.508  73.968  90.759  1.00 28.27 ? 444 ASN B C     1 
ATOM   8563  O  O     . ASN B  1 444 ? 66.618  73.496  91.895  1.00 28.27 ? 444 ASN B O     1 
ATOM   8564  C  CB    . ASN B  1 444 ? 68.446  75.027  89.546  1.00 28.27 ? 444 ASN B CB    1 
ATOM   8565  C  CG    . ASN B  1 444 ? 69.376  75.340  90.710  1.00 28.27 ? 444 ASN B CG    1 
ATOM   8566  O  OD1   . ASN B  1 444 ? 69.101  75.033  91.868  1.00 28.27 ? 444 ASN B OD1   1 
ATOM   8567  N  ND2   . ASN B  1 444 ? 70.502  75.962  90.391  1.00 28.27 ? 444 ASN B ND2   1 
ATOM   8568  N  N     . GLN B  1 445 ? 65.430  74.652  90.373  1.00 29.77 ? 445 GLN B N     1 
ATOM   8569  C  CA    . GLN B  1 445 ? 64.340  74.889  91.312  1.00 29.77 ? 445 GLN B CA    1 
ATOM   8570  C  C     . GLN B  1 445 ? 63.540  73.627  91.600  1.00 29.77 ? 445 GLN B C     1 
ATOM   8571  O  O     . GLN B  1 445 ? 62.898  73.538  92.650  1.00 29.77 ? 445 GLN B O     1 
ATOM   8572  C  CB    . GLN B  1 445 ? 63.410  75.980  90.786  1.00 29.77 ? 445 GLN B CB    1 
ATOM   8573  C  CG    . GLN B  1 445 ? 64.021  77.367  90.774  1.00 29.77 ? 445 GLN B CG    1 
ATOM   8574  C  CD    . GLN B  1 445 ? 64.014  78.023  92.136  1.00 29.77 ? 445 GLN B CD    1 
ATOM   8575  O  OE1   . GLN B  1 445 ? 64.823  77.696  93.003  1.00 29.77 ? 445 GLN B OE1   1 
ATOM   8576  N  NE2   . GLN B  1 445 ? 63.093  78.957  92.335  1.00 29.77 ? 445 GLN B NE2   1 
ATOM   8577  N  N     . ILE B  1 446 ? 63.558  72.650  90.696  1.00 30.13 ? 446 ILE B N     1 
ATOM   8578  C  CA    . ILE B  1 446 ? 62.852  71.401  90.968  1.00 30.13 ? 446 ILE B CA    1 
ATOM   8579  C  C     . ILE B  1 446 ? 63.681  70.500  91.878  1.00 30.13 ? 446 ILE B C     1 
ATOM   8580  O  O     . ILE B  1 446 ? 63.195  70.032  92.913  1.00 30.13 ? 446 ILE B O     1 
ATOM   8581  C  CB    . ILE B  1 446 ? 62.467  70.701  89.651  1.00 30.13 ? 446 ILE B CB    1 
ATOM   8582  C  CG1   . ILE B  1 446 ? 61.229  71.369  89.055  1.00 30.13 ? 446 ILE B CG1   1 
ATOM   8583  C  CG2   . ILE B  1 446 ? 62.176  69.227  89.875  1.00 30.13 ? 446 ILE B CG2   1 
ATOM   8584  C  CD1   . ILE B  1 446 ? 60.773  70.764  87.751  1.00 30.13 ? 446 ILE B CD1   1 
ATOM   8585  N  N     . MET B  1 447 ? 64.946  70.256  91.531  1.00 34.11 ? 447 MET B N     1 
ATOM   8586  C  CA    . MET B  1 447 ? 65.775  69.359  92.328  1.00 34.11 ? 447 MET B CA    1 
ATOM   8587  C  C     . MET B  1 447 ? 66.294  69.993  93.611  1.00 34.11 ? 447 MET B C     1 
ATOM   8588  O  O     . MET B  1 447 ? 66.773  69.265  94.485  1.00 34.11 ? 447 MET B O     1 
ATOM   8589  C  CB    . MET B  1 447 ? 66.962  68.859  91.502  1.00 34.11 ? 447 MET B CB    1 
ATOM   8590  C  CG    . MET B  1 447 ? 66.579  68.065  90.269  1.00 34.11 ? 447 MET B CG    1 
ATOM   8591  S  SD    . MET B  1 447 ? 65.122  67.039  90.525  1.00 34.11 ? 447 MET B SD    1 
ATOM   8592  C  CE    . MET B  1 447 ? 64.924  66.318  88.897  1.00 34.11 ? 447 MET B CE    1 
ATOM   8593  N  N     . GLU B  1 448 ? 66.218  71.317  93.751  1.00 31.49 ? 448 GLU B N     1 
ATOM   8594  C  CA    . GLU B  1 448 ? 66.770  71.964  94.935  1.00 31.49 ? 448 GLU B CA    1 
ATOM   8595  C  C     . GLU B  1 448 ? 65.766  71.989  96.079  1.00 31.49 ? 448 GLU B C     1 
ATOM   8596  O  O     . GLU B  1 448 ? 66.082  71.574  97.199  1.00 31.49 ? 448 GLU B O     1 
ATOM   8597  C  CB    . GLU B  1 448 ? 67.228  73.384  94.594  1.00 31.49 ? 448 GLU B CB    1 
ATOM   8598  C  CG    . GLU B  1 448 ? 67.444  74.281  95.808  1.00 31.49 ? 448 GLU B CG    1 
ATOM   8599  C  CD    . GLU B  1 448 ? 67.928  75.675  95.444  1.00 31.49 ? 448 GLU B CD    1 
ATOM   8600  O  OE1   . GLU B  1 448 ? 67.505  76.203  94.397  1.00 31.49 ? 448 GLU B OE1   1 
ATOM   8601  O  OE2   . GLU B  1 448 ? 68.733  76.244  96.210  1.00 31.49 ? 448 GLU B OE2   1 
ATOM   8602  N  N     . SER B  1 449 ? 64.555  72.462  95.822  1.00 35.28 ? 449 SER B N     1 
ATOM   8603  C  CA    . SER B  1 449 ? 63.650  72.700  96.939  1.00 35.28 ? 449 SER B CA    1 
ATOM   8604  C  C     . SER B  1 449 ? 62.290  72.035  96.800  1.00 35.28 ? 449 SER B C     1 
ATOM   8605  O  O     . SER B  1 449 ? 61.753  71.572  97.803  1.00 35.28 ? 449 SER B O     1 
ATOM   8606  C  CB    . SER B  1 449 ? 63.459  74.203  97.134  1.00 35.28 ? 449 SER B CB    1 
ATOM   8607  O  OG    . SER B  1 449 ? 62.408  74.682  96.319  1.00 35.28 ? 449 SER B OG    1 
ATOM   8608  N  N     . PHE B  1 450 ? 61.721  71.973  95.593  1.00 37.70 ? 450 PHE B N     1 
ATOM   8609  C  CA    . PHE B  1 450 ? 60.321  71.575  95.448  1.00 37.70 ? 450 PHE B CA    1 
ATOM   8610  C  C     . PHE B  1 450 ? 60.122  70.074  95.640  1.00 37.70 ? 450 PHE B C     1 
ATOM   8611  O  O     . PHE B  1 450 ? 59.254  69.652  96.414  1.00 37.70 ? 450 PHE B O     1 
ATOM   8612  C  CB    . PHE B  1 450 ? 59.791  72.012  94.084  1.00 37.70 ? 450 PHE B CB    1 
ATOM   8613  C  CG    . PHE B  1 450 ? 59.556  73.487  93.976  1.00 37.70 ? 450 PHE B CG    1 
ATOM   8614  C  CD1   . PHE B  1 450 ? 59.178  74.222  95.086  1.00 37.70 ? 450 PHE B CD1   1 
ATOM   8615  C  CD2   . PHE B  1 450 ? 59.713  74.139  92.765  1.00 37.70 ? 450 PHE B CD2   1 
ATOM   8616  C  CE1   . PHE B  1 450 ? 58.961  75.583  94.992  1.00 37.70 ? 450 PHE B CE1   1 
ATOM   8617  C  CE2   . PHE B  1 450 ? 59.498  75.500  92.663  1.00 37.70 ? 450 PHE B CE2   1 
ATOM   8618  C  CZ    . PHE B  1 450 ? 59.122  76.221  93.779  1.00 37.70 ? 450 PHE B CZ    1 
ATOM   8619  N  N     . LEU B  1 451 ? 60.896  69.259  94.928  1.00 37.09 ? 451 LEU B N     1 
ATOM   8620  C  CA    . LEU B  1 451 ? 60.843  67.814  95.145  1.00 37.09 ? 451 LEU B CA    1 
ATOM   8621  C  C     . LEU B  1 451 ? 61.294  67.374  96.544  1.00 37.09 ? 451 LEU B C     1 
ATOM   8622  O  O     . LEU B  1 451 ? 60.638  66.472  97.102  1.00 37.09 ? 451 LEU B O     1 
ATOM   8623  C  CB    . LEU B  1 451 ? 61.635  67.101  94.036  1.00 37.09 ? 451 LEU B CB    1 
ATOM   8624  C  CG    . LEU B  1 451 ? 61.983  65.623  94.213  1.00 37.09 ? 451 LEU B CG    1 
ATOM   8625  C  CD1   . LEU B  1 451 ? 60.735  64.766  94.126  1.00 37.09 ? 451 LEU B CD1   1 
ATOM   8626  C  CD2   . LEU B  1 451 ? 63.008  65.186  93.183  1.00 37.09 ? 451 LEU B CD2   1 
ATOM   8627  N  N     . PRO B  1 452 ? 62.349  67.935  97.171  1.00 35.73 ? 452 PRO B N     1 
ATOM   8628  C  CA    . PRO B  1 452 ? 62.572  67.600  98.586  1.00 35.73 ? 452 PRO B CA    1 
ATOM   8629  C  C     . PRO B  1 452 ? 61.475  68.085  99.515  1.00 35.73 ? 452 PRO B C     1 
ATOM   8630  O  O     . PRO B  1 452 ? 61.229  67.425  100.529 1.00 35.73 ? 452 PRO B O     1 
ATOM   8631  C  CB    . PRO B  1 452 ? 63.913  68.273  98.899  1.00 35.73 ? 452 PRO B CB    1 
ATOM   8632  C  CG    . PRO B  1 452 ? 64.604  68.283  97.623  1.00 35.73 ? 452 PRO B CG    1 
ATOM   8633  C  CD    . PRO B  1 452 ? 63.539  68.637  96.645  1.00 35.73 ? 452 PRO B CD    1 
ATOM   8634  N  N     . TYR B  1 453 ? 60.782  69.183  99.195  1.00 40.58 ? 453 TYR B N     1 
ATOM   8635  C  CA    . TYR B  1 453 ? 59.645  69.587  100.019 1.00 40.58 ? 453 TYR B CA    1 
ATOM   8636  C  C     . TYR B  1 453 ? 58.483  68.618  99.885  1.00 40.58 ? 453 TYR B C     1 
ATOM   8637  O  O     . TYR B  1 453 ? 57.797  68.341  100.874 1.00 40.58 ? 453 TYR B O     1 
ATOM   8638  C  CB    . TYR B  1 453 ? 59.177  70.993  99.657  1.00 40.58 ? 453 TYR B CB    1 
ATOM   8639  C  CG    . TYR B  1 453 ? 57.877  71.380  100.315 1.00 40.58 ? 453 TYR B CG    1 
ATOM   8640  C  CD1   . TYR B  1 453 ? 57.782  71.486  101.695 1.00 40.58 ? 453 TYR B CD1   1 
ATOM   8641  C  CD2   . TYR B  1 453 ? 56.742  71.624  99.558  1.00 40.58 ? 453 TYR B CD2   1 
ATOM   8642  C  CE1   . TYR B  1 453 ? 56.594  71.833  102.302 1.00 40.58 ? 453 TYR B CE1   1 
ATOM   8643  C  CE2   . TYR B  1 453 ? 55.550  71.972  100.155 1.00 40.58 ? 453 TYR B CE2   1 
ATOM   8644  C  CZ    . TYR B  1 453 ? 55.483  72.076  101.527 1.00 40.58 ? 453 TYR B CZ    1 
ATOM   8645  O  OH    . TYR B  1 453 ? 54.295  72.422  102.124 1.00 40.58 ? 453 TYR B OH    1 
ATOM   8646  N  N     . TRP B  1 454 ? 58.261  68.078  98.686  1.00 46.37 ? 454 TRP B N     1 
ATOM   8647  C  CA    . TRP B  1 454 ? 57.200  67.091  98.507  1.00 46.37 ? 454 TRP B CA    1 
ATOM   8648  C  C     . TRP B  1 454 ? 57.528  65.789  99.231  1.00 46.37 ? 454 TRP B C     1 
ATOM   8649  O  O     . TRP B  1 454 ? 56.658  65.199  99.892  1.00 46.37 ? 454 TRP B O     1 
ATOM   8650  C  CB    . TRP B  1 454 ? 56.973  66.843  97.019  1.00 46.37 ? 454 TRP B CB    1 
ATOM   8651  C  CG    . TRP B  1 454 ? 55.872  65.889  96.731  1.00 46.37 ? 454 TRP B CG    1 
ATOM   8652  C  CD1   . TRP B  1 454 ? 54.540  66.094  96.922  1.00 46.37 ? 454 TRP B CD1   1 
ATOM   8653  C  CD2   . TRP B  1 454 ? 56.004  64.573  96.189  1.00 46.37 ? 454 TRP B CD2   1 
ATOM   8654  N  NE1   . TRP B  1 454 ? 53.831  64.984  96.536  1.00 46.37 ? 454 TRP B NE1   1 
ATOM   8655  C  CE2   . TRP B  1 454 ? 54.708  64.035  96.082  1.00 46.37 ? 454 TRP B CE2   1 
ATOM   8656  C  CE3   . TRP B  1 454 ? 57.093  63.795  95.787  1.00 46.37 ? 454 TRP B CE3   1 
ATOM   8657  C  CZ2   . TRP B  1 454 ? 54.471  62.756  95.589  1.00 46.37 ? 454 TRP B CZ2   1 
ATOM   8658  C  CZ3   . TRP B  1 454 ? 56.857  62.527  95.299  1.00 46.37 ? 454 TRP B CZ3   1 
ATOM   8659  C  CH2   . TRP B  1 454 ? 55.557  62.020  95.203  1.00 46.37 ? 454 TRP B CH2   1 
ATOM   8660  N  N     . LEU B  1 455 ? 58.787  65.344  99.143  1.00 43.66 ? 455 LEU B N     1 
ATOM   8661  C  CA    . LEU B  1 455 ? 59.208  64.158  99.883  1.00 43.66 ? 455 LEU B CA    1 
ATOM   8662  C  C     . LEU B  1 455 ? 59.162  64.385  101.390 1.00 43.66 ? 455 LEU B C     1 
ATOM   8663  O  O     . LEU B  1 455 ? 58.820  63.467  102.146 1.00 43.66 ? 455 LEU B O     1 
ATOM   8664  C  CB    . LEU B  1 455 ? 60.611  63.742  99.452  1.00 43.66 ? 455 LEU B CB    1 
ATOM   8665  C  CG    . LEU B  1 455 ? 60.678  62.895  98.184  1.00 43.66 ? 455 LEU B CG    1 
ATOM   8666  C  CD1   . LEU B  1 455 ? 62.110  62.772  97.700  1.00 43.66 ? 455 LEU B CD1   1 
ATOM   8667  C  CD2   . LEU B  1 455 ? 60.076  61.526  98.436  1.00 43.66 ? 455 LEU B CD2   1 
ATOM   8668  N  N     . GLN B  1 456 ? 59.459  65.606  101.841 1.00 43.16 ? 456 GLN B N     1 
ATOM   8669  C  CA    . GLN B  1 456 ? 59.391  65.912  103.263 1.00 43.16 ? 456 GLN B CA    1 
ATOM   8670  C  C     . GLN B  1 456 ? 57.950  65.976  103.748 1.00 43.16 ? 456 GLN B C     1 
ATOM   8671  O  O     . GLN B  1 456 ? 57.663  65.595  104.885 1.00 43.16 ? 456 GLN B O     1 
ATOM   8672  C  CB    . GLN B  1 456 ? 60.116  67.225  103.549 1.00 43.16 ? 456 GLN B CB    1 
ATOM   8673  C  CG    . GLN B  1 456 ? 60.331  67.503  105.020 1.00 43.16 ? 456 GLN B CG    1 
ATOM   8674  C  CD    . GLN B  1 456 ? 61.077  66.389  105.715 1.00 43.16 ? 456 GLN B CD    1 
ATOM   8675  O  OE1   . GLN B  1 456 ? 62.093  65.902  105.221 1.00 43.16 ? 456 GLN B OE1   1 
ATOM   8676  N  NE2   . GLN B  1 456 ? 60.573  65.973  106.869 1.00 43.16 ? 456 GLN B NE2   1 
ATOM   8677  N  N     . ARG B  1 457 ? 57.029  66.439  102.898 1.00 47.40 ? 457 ARG B N     1 
ATOM   8678  C  CA    . ARG B  1 457 ? 55.613  66.424  103.258 1.00 47.40 ? 457 ARG B CA    1 
ATOM   8679  C  C     . ARG B  1 457 ? 55.089  65.000  103.371 1.00 47.40 ? 457 ARG B C     1 
ATOM   8680  O  O     . ARG B  1 457 ? 54.324  64.688  104.293 1.00 47.40 ? 457 ARG B O     1 
ATOM   8681  C  CB    . ARG B  1 457 ? 54.794  67.204  102.232 1.00 47.40 ? 457 ARG B CB    1 
ATOM   8682  C  CG    . ARG B  1 457 ? 54.479  68.630  102.633 1.00 47.40 ? 457 ARG B CG    1 
ATOM   8683  C  CD    . ARG B  1 457 ? 53.393  69.213  101.745 1.00 47.40 ? 457 ARG B CD    1 
ATOM   8684  N  NE    . ARG B  1 457 ? 52.058  68.863  102.214 1.00 47.40 ? 457 ARG B NE    1 
ATOM   8685  C  CZ    . ARG B  1 457 ? 51.342  69.612  103.046 1.00 47.40 ? 457 ARG B CZ    1 
ATOM   8686  N  NH1   . ARG B  1 457 ? 51.834  70.756  103.499 1.00 47.40 ? 457 ARG B NH1   1 
ATOM   8687  N  NH2   . ARG B  1 457 ? 50.134  69.219  103.427 1.00 47.40 ? 457 ARG B NH2   1 
ATOM   8688  N  N     . LYS B  1 458 ? 55.507  64.125  102.449 1.00 52.69 ? 458 LYS B N     1 
ATOM   8689  C  CA    . LYS B  1 458 ? 55.124  62.716  102.520 1.00 52.69 ? 458 LYS B CA    1 
ATOM   8690  C  C     . LYS B  1 458 ? 55.678  62.051  103.778 1.00 52.69 ? 458 LYS B C     1 
ATOM   8691  O  O     . LYS B  1 458 ? 54.958  61.329  104.486 1.00 52.69 ? 458 LYS B O     1 
ATOM   8692  C  CB    . LYS B  1 458 ? 55.609  61.987  101.268 1.00 52.69 ? 458 LYS B CB    1 
ATOM   8693  C  CG    . LYS B  1 458 ? 55.239  60.520  101.218 1.00 52.69 ? 458 LYS B CG    1 
ATOM   8694  C  CD    . LYS B  1 458 ? 55.729  59.877  99.933  1.00 52.69 ? 458 LYS B CD    1 
ATOM   8695  C  CE    . LYS B  1 458 ? 55.301  58.422  99.847  1.00 52.69 ? 458 LYS B CE    1 
ATOM   8696  N  NZ    . LYS B  1 458 ? 55.981  57.580  100.870 1.00 52.69 ? 458 LYS B NZ    1 
ATOM   8697  N  N     . HIS B  1 459 ? 56.952  62.312  104.089 1.00 54.86 ? 459 HIS B N     1 
ATOM   8698  C  CA    . HIS B  1 459 ? 57.566  61.753  105.289 1.00 54.86 ? 459 HIS B CA    1 
ATOM   8699  C  C     . HIS B  1 459 ? 56.948  62.318  106.563 1.00 54.86 ? 459 HIS B C     1 
ATOM   8700  O  O     . HIS B  1 459 ? 56.806  61.592  107.550 1.00 54.86 ? 459 HIS B O     1 
ATOM   8701  C  CB    . HIS B  1 459 ? 59.070  62.013  105.271 1.00 54.86 ? 459 HIS B CB    1 
ATOM   8702  C  CG    . HIS B  1 459 ? 59.850  61.118  106.181 1.00 54.86 ? 459 HIS B CG    1 
ATOM   8703  N  ND1   . HIS B  1 459 ? 60.095  59.794  105.890 1.00 54.86 ? 459 HIS B ND1   1 
ATOM   8704  C  CD2   . HIS B  1 459 ? 60.444  61.358  107.373 1.00 54.86 ? 459 HIS B CD2   1 
ATOM   8705  C  CE1   . HIS B  1 459 ? 60.805  59.256  106.865 1.00 54.86 ? 459 HIS B CE1   1 
ATOM   8706  N  NE2   . HIS B  1 459 ? 61.030  60.184  107.778 1.00 54.86 ? 459 HIS B NE2   1 
ATOM   8707  N  N     . GLY B  1 460 ? 56.544  63.589  106.549 1.00 57.53 ? 460 GLY B N     1 
ATOM   8708  C  CA    . GLY B  1 460 ? 55.911  64.171  107.719 1.00 57.53 ? 460 GLY B CA    1 
ATOM   8709  C  C     . GLY B  1 460 ? 54.517  63.630  107.960 1.00 57.53 ? 460 GLY B C     1 
ATOM   8710  O  O     . GLY B  1 460 ? 54.121  63.416  109.108 1.00 57.53 ? 460 GLY B O     1 
ATOM   8711  N  N     . VAL B  1 461 ? 53.761  63.389  106.883 1.00 61.08 ? 461 VAL B N     1 
ATOM   8712  C  CA    . VAL B  1 461 ? 52.449  62.757  107.010 1.00 61.08 ? 461 VAL B CA    1 
ATOM   8713  C  C     . VAL B  1 461 ? 52.592  61.330  107.534 1.00 61.08 ? 461 VAL B C     1 
ATOM   8714  O  O     . VAL B  1 461 ? 51.828  60.894  108.409 1.00 61.08 ? 461 VAL B O     1 
ATOM   8715  C  CB    . VAL B  1 461 ? 51.707  62.815  105.658 1.00 61.08 ? 461 VAL B CB    1 
ATOM   8716  C  CG1   . VAL B  1 461 ? 50.543  61.835  105.603 1.00 61.08 ? 461 VAL B CG1   1 
ATOM   8717  C  CG2   . VAL B  1 461 ? 51.208  64.228  105.398 1.00 61.08 ? 461 VAL B CG2   1 
ATOM   8718  N  N     . ARG B  1 462 ? 53.614  60.607  107.059 1.00 64.92 ? 462 ARG B N     1 
ATOM   8719  C  CA    . ARG B  1 462 ? 53.842  59.243  107.535 1.00 64.92 ? 462 ARG B CA    1 
ATOM   8720  C  C     . ARG B  1 462 ? 54.265  59.214  109.004 1.00 64.92 ? 462 ARG B C     1 
ATOM   8721  O  O     . ARG B  1 462 ? 53.791  58.369  109.774 1.00 64.92 ? 462 ARG B O     1 
ATOM   8722  C  CB    . ARG B  1 462 ? 54.889  58.556  106.661 1.00 64.92 ? 462 ARG B CB    1 
ATOM   8723  C  CG    . ARG B  1 462 ? 54.964  57.055  106.855 1.00 64.92 ? 462 ARG B CG    1 
ATOM   8724  C  CD    . ARG B  1 462 ? 55.567  56.379  105.639 1.00 64.92 ? 462 ARG B CD    1 
ATOM   8725  N  NE    . ARG B  1 462 ? 56.749  57.084  105.158 1.00 64.92 ? 462 ARG B NE    1 
ATOM   8726  C  CZ    . ARG B  1 462 ? 57.588  56.599  104.250 1.00 64.92 ? 462 ARG B CZ    1 
ATOM   8727  N  NH1   . ARG B  1 462 ? 57.377  55.401  103.722 1.00 64.92 ? 462 ARG B NH1   1 
ATOM   8728  N  NH2   . ARG B  1 462 ? 58.640  57.311  103.870 1.00 64.92 ? 462 ARG B NH2   1 
ATOM   8729  N  N     . VAL B  1 463 ? 55.127  60.150  109.415 1.00 65.05 ? 463 VAL B N     1 
ATOM   8730  C  CA    . VAL B  1 463 ? 55.573  60.212  110.806 1.00 65.05 ? 463 VAL B CA    1 
ATOM   8731  C  C     . VAL B  1 463 ? 54.426  60.637  111.722 1.00 65.05 ? 463 VAL B C     1 
ATOM   8732  O  O     . VAL B  1 463 ? 54.274  60.109  112.830 1.00 65.05 ? 463 VAL B O     1 
ATOM   8733  C  CB    . VAL B  1 463 ? 56.800  61.142  110.913 1.00 65.05 ? 463 VAL B CB    1 
ATOM   8734  C  CG1   . VAL B  1 463 ? 57.041  61.631  112.337 1.00 65.05 ? 463 VAL B CG1   1 
ATOM   8735  C  CG2   . VAL B  1 463 ? 58.038  60.424  110.404 1.00 65.05 ? 463 VAL B CG2   1 
ATOM   8736  N  N     . LYS B  1 464 ? 53.571  61.553  111.251 1.00 68.76 ? 464 LYS B N     1 
ATOM   8737  C  CA    . LYS B  1 464 ? 52.387  61.957  112.006 1.00 68.76 ? 464 LYS B CA    1 
ATOM   8738  C  C     . LYS B  1 464 ? 51.412  60.804  112.200 1.00 68.76 ? 464 LYS B C     1 
ATOM   8739  O  O     . LYS B  1 464 ? 50.898  60.606  113.310 1.00 68.76 ? 464 LYS B O     1 
ATOM   8740  C  CB    . LYS B  1 464 ? 51.688  63.107  111.282 1.00 68.76 ? 464 LYS B CB    1 
ATOM   8741  C  CG    . LYS B  1 464 ? 50.865  64.017  112.172 1.00 68.76 ? 464 LYS B CG    1 
ATOM   8742  C  CD    . LYS B  1 464 ? 51.727  64.989  112.962 1.00 68.76 ? 464 LYS B CD    1 
ATOM   8743  C  CE    . LYS B  1 464 ? 52.825  65.639  112.123 1.00 68.76 ? 464 LYS B CE    1 
ATOM   8744  N  NZ    . LYS B  1 464 ? 53.536  66.707  112.878 1.00 68.76 ? 464 LYS B NZ    1 
ATOM   8745  N  N     . ARG B  1 465 ? 51.163  60.026  111.144 1.00 74.74 ? 465 ARG B N     1 
ATOM   8746  C  CA    . ARG B  1 465 ? 50.262  58.884  111.253 1.00 74.74 ? 465 ARG B CA    1 
ATOM   8747  C  C     . ARG B  1 465 ? 50.868  57.755  112.079 1.00 74.74 ? 465 ARG B C     1 
ATOM   8748  O  O     . ARG B  1 465 ? 50.128  56.960  112.668 1.00 74.74 ? 465 ARG B O     1 
ATOM   8749  C  CB    . ARG B  1 465 ? 49.887  58.387  109.857 1.00 74.74 ? 465 ARG B CB    1 
ATOM   8750  C  CG    . ARG B  1 465 ? 48.598  57.589  109.796 1.00 74.74 ? 465 ARG B CG    1 
ATOM   8751  C  CD    . ARG B  1 465 ? 48.418  56.957  108.427 1.00 74.74 ? 465 ARG B CD    1 
ATOM   8752  N  NE    . ARG B  1 465 ? 49.680  56.457  107.890 1.00 74.74 ? 465 ARG B NE    1 
ATOM   8753  C  CZ    . ARG B  1 465 ? 50.176  55.251  108.143 1.00 74.74 ? 465 ARG B CZ    1 
ATOM   8754  N  NH1   . ARG B  1 465 ? 49.516  54.411  108.928 1.00 74.74 ? 465 ARG B NH1   1 
ATOM   8755  N  NH2   . ARG B  1 465 ? 51.333  54.884  107.611 1.00 74.74 ? 465 ARG B NH2   1 
ATOM   8756  N  N     . LYS B  1 466 ? 52.200  57.670  112.140 1.00 74.58 ? 466 LYS B N     1 
ATOM   8757  C  CA    . LYS B  1 466 ? 52.829  56.707  113.039 1.00 74.58 ? 466 LYS B CA    1 
ATOM   8758  C  C     . LYS B  1 466 ? 52.734  57.155  114.494 1.00 74.58 ? 466 LYS B C     1 
ATOM   8759  O  O     . LYS B  1 466 ? 52.506  56.326  115.382 1.00 74.58 ? 466 LYS B O     1 
ATOM   8760  C  CB    . LYS B  1 466 ? 54.291  56.492  112.632 1.00 74.58 ? 466 LYS B CB    1 
ATOM   8761  C  CG    . LYS B  1 466 ? 55.057  55.469  113.469 1.00 74.58 ? 466 LYS B CG    1 
ATOM   8762  C  CD    . LYS B  1 466 ? 56.049  56.131  114.419 1.00 74.58 ? 466 LYS B CD    1 
ATOM   8763  C  CE    . LYS B  1 466 ? 56.904  55.100  115.136 1.00 74.58 ? 466 LYS B CE    1 
ATOM   8764  N  NZ    . LYS B  1 466 ? 57.605  55.687  116.312 1.00 74.58 ? 466 LYS B NZ    1 
ATOM   8765  N  N     . VAL B  1 467 ? 52.906  58.453  114.753 1.00 77.40 ? 467 VAL B N     1 
ATOM   8766  C  CA    . VAL B  1 467 ? 52.911  58.959  116.123 1.00 77.40 ? 467 VAL B CA    1 
ATOM   8767  C  C     . VAL B  1 467 ? 51.501  58.940  116.707 1.00 77.40 ? 467 VAL B C     1 
ATOM   8768  O  O     . VAL B  1 467 ? 51.309  58.614  117.886 1.00 77.40 ? 467 VAL B O     1 
ATOM   8769  C  CB    . VAL B  1 467 ? 53.554  60.363  116.152 1.00 77.40 ? 467 VAL B CB    1 
ATOM   8770  C  CG1   . VAL B  1 467 ? 53.187  61.153  117.403 1.00 77.40 ? 467 VAL B CG1   1 
ATOM   8771  C  CG2   . VAL B  1 467 ? 55.064  60.243  116.057 1.00 77.40 ? 467 VAL B CG2   1 
ATOM   8772  N  N     . GLN B  1 468 ? 50.486  59.219  115.880 1.00 83.63 ? 468 GLN B N     1 
ATOM   8773  C  CA    . GLN B  1 468 ? 49.109  59.228  116.371 1.00 83.63 ? 468 GLN B CA    1 
ATOM   8774  C  C     . GLN B  1 468 ? 48.595  57.839  116.744 1.00 83.63 ? 468 GLN B C     1 
ATOM   8775  O  O     . GLN B  1 468 ? 47.615  57.737  117.490 1.00 83.63 ? 468 GLN B O     1 
ATOM   8776  C  CB    . GLN B  1 468 ? 48.181  59.858  115.331 1.00 83.63 ? 468 GLN B CB    1 
ATOM   8777  C  CG    . GLN B  1 468 ? 48.247  61.374  115.282 1.00 83.63 ? 468 GLN B CG    1 
ATOM   8778  C  CD    . GLN B  1 468 ? 47.224  61.968  114.337 1.00 83.63 ? 468 GLN B CD    1 
ATOM   8779  O  OE1   . GLN B  1 468 ? 46.594  61.253  113.558 1.00 83.63 ? 468 GLN B OE1   1 
ATOM   8780  N  NE2   . GLN B  1 468 ? 47.050  63.282  114.403 1.00 83.63 ? 468 GLN B NE2   1 
ATOM   8781  N  N     . ALA B  1 469 ? 49.226  56.774  116.250 1.00 84.22 ? 469 ALA B N     1 
ATOM   8782  C  CA    . ALA B  1 469 ? 48.897  55.411  116.670 1.00 84.22 ? 469 ALA B CA    1 
ATOM   8783  C  C     . ALA B  1 469 ? 49.889  54.959  117.744 1.00 84.22 ? 469 ALA B C     1 
ATOM   8784  O  O     . ALA B  1 469 ? 50.799  54.162  117.512 1.00 84.22 ? 469 ALA B O     1 
ATOM   8785  C  CB    . ALA B  1 469 ? 48.891  54.471  115.472 1.00 84.22 ? 469 ALA B CB    1 
ATOM   8786  N  N     . LEU B  1 470 ? 49.695  55.495  118.944 1.00 85.80 ? 470 LEU B N     1 
ATOM   8787  C  CA    . LEU B  1 470 ? 50.608  55.287  120.061 1.00 85.80 ? 470 LEU B CA    1 
ATOM   8788  C  C     . LEU B  1 470 ? 49.869  54.627  121.223 1.00 85.80 ? 470 LEU B C     1 
ATOM   8789  O  O     . LEU B  1 470 ? 48.639  54.546  121.246 1.00 85.80 ? 470 LEU B O     1 
ATOM   8790  C  CB    . LEU B  1 470 ? 51.236  56.615  120.492 1.00 85.80 ? 470 LEU B CB    1 
ATOM   8791  C  CG    . LEU B  1 470 ? 52.682  56.605  120.983 1.00 85.80 ? 470 LEU B CG    1 
ATOM   8792  C  CD1   . LEU B  1 470 ? 53.582  55.899  119.987 1.00 85.80 ? 470 LEU B CD1   1 
ATOM   8793  C  CD2   . LEU B  1 470 ? 53.152  58.026  121.204 1.00 85.80 ? 470 LEU B CD2   1 
ATOM   8794  N  N     . LYS B  1 471 ? 50.644  54.148  122.202 1.00 87.45 ? 471 LYS B N     1 
ATOM   8795  C  CA    . LYS B  1 471 ? 50.089  53.475  123.370 1.00 87.45 ? 471 LYS B CA    1 
ATOM   8796  C  C     . LYS B  1 471 ? 50.757  53.942  124.659 1.00 87.45 ? 471 LYS B C     1 
ATOM   8797  O  O     . LYS B  1 471 ? 50.929  53.152  125.594 1.00 87.45 ? 471 LYS B O     1 
ATOM   8798  C  CB    . LYS B  1 471 ? 50.217  51.955  123.240 1.00 87.45 ? 471 LYS B CB    1 
ATOM   8799  N  N     . ALA B  1 472 ? 51.141  55.215  124.729 1.00 91.28 ? 472 ALA B N     1 
ATOM   8800  C  CA    . ALA B  1 472 ? 51.788  55.775  125.905 1.00 91.28 ? 472 ALA B CA    1 
ATOM   8801  C  C     . ALA B  1 472 ? 51.238  57.167  126.184 1.00 91.28 ? 472 ALA B C     1 
ATOM   8802  O  O     . ALA B  1 472 ? 50.560  57.774  125.350 1.00 91.28 ? 472 ALA B O     1 
ATOM   8803  C  CB    . ALA B  1 472 ? 53.312  55.829  125.734 1.00 91.28 ? 472 ALA B CB    1 
ATOM   8804  N  N     . ASP B  1 473 ? 51.542  57.673  127.376 1.00 90.74 ? 473 ASP B N     1 
ATOM   8805  C  CA    . ASP B  1 473 ? 51.153  59.023  127.786 1.00 90.74 ? 473 ASP B CA    1 
ATOM   8806  C  C     . ASP B  1 473 ? 52.226  60.042  127.416 1.00 90.74 ? 473 ASP B C     1 
ATOM   8807  O  O     . ASP B  1 473 ? 52.733  60.788  128.252 1.00 90.74 ? 473 ASP B O     1 
ATOM   8808  C  CB    . ASP B  1 473 ? 50.863  59.048  129.282 1.00 90.74 ? 473 ASP B CB    1 
ATOM   8809  N  N     . ILE B  1 474 ? 52.574  60.071  126.131 1.00 87.58 ? 474 ILE B N     1 
ATOM   8810  C  CA    . ILE B  1 474 ? 53.679  60.893  125.660 1.00 87.58 ? 474 ILE B CA    1 
ATOM   8811  C  C     . ILE B  1 474 ? 53.162  62.277  125.294 1.00 87.58 ? 474 ILE B C     1 
ATOM   8812  O  O     . ILE B  1 474 ? 52.164  62.414  124.575 1.00 87.58 ? 474 ILE B O     1 
ATOM   8813  C  CB    . ILE B  1 474 ? 54.366  60.207  124.467 1.00 87.58 ? 474 ILE B CB    1 
ATOM   8814  C  CG1   . ILE B  1 474 ? 55.232  59.046  124.957 1.00 87.58 ? 474 ILE B CG1   1 
ATOM   8815  C  CG2   . ILE B  1 474 ? 55.202  61.186  123.651 1.00 87.58 ? 474 ILE B CG2   1 
ATOM   8816  C  CD1   . ILE B  1 474 ? 55.779  58.186  123.847 1.00 87.58 ? 474 ILE B CD1   1 
ATOM   8817  N  N     . ASP B  1 475 ? 53.826  63.312  125.810 1.00 82.18 ? 475 ASP B N     1 
ATOM   8818  C  CA    . ASP B  1 475 ? 53.616  64.672  125.321 1.00 82.18 ? 475 ASP B CA    1 
ATOM   8819  C  C     . ASP B  1 475 ? 54.134  64.726  123.891 1.00 82.18 ? 475 ASP B C     1 
ATOM   8820  O  O     . ASP B  1 475 ? 55.344  64.745  123.653 1.00 82.18 ? 475 ASP B O     1 
ATOM   8821  C  CB    . ASP B  1 475 ? 54.328  65.683  126.212 1.00 82.18 ? 475 ASP B CB    1 
ATOM   8822  N  N     . ALA B  1 476 ? 53.210  64.739  122.930 1.00 76.20 ? 476 ALA B N     1 
ATOM   8823  C  CA    . ALA B  1 476 ? 53.560  64.506  121.537 1.00 76.20 ? 476 ALA B CA    1 
ATOM   8824  C  C     . ALA B  1 476 ? 54.258  65.688  120.883 1.00 76.20 ? 476 ALA B C     1 
ATOM   8825  O  O     . ALA B  1 476 ? 54.977  65.487  119.900 1.00 76.20 ? 476 ALA B O     1 
ATOM   8826  C  CB    . ALA B  1 476 ? 52.308  64.148  120.735 1.00 76.20 ? 476 ALA B CB    1 
ATOM   8827  N  N     . THR B  1 477 ? 54.094  66.898  121.419 1.00 72.37 ? 477 THR B N     1 
ATOM   8828  C  CA    . THR B  1 477 ? 54.615  68.110  120.797 1.00 72.37 ? 477 THR B CA    1 
ATOM   8829  C  C     . THR B  1 477 ? 56.141  68.169  120.789 1.00 72.37 ? 477 THR B C     1 
ATOM   8830  O  O     . THR B  1 477 ? 56.718  68.837  119.924 1.00 72.37 ? 477 THR B O     1 
ATOM   8831  C  CB    . THR B  1 477 ? 54.041  69.337  121.514 1.00 72.37 ? 477 THR B CB    1 
ATOM   8832  O  OG1   . THR B  1 477 ? 52.685  69.070  121.889 1.00 72.37 ? 477 THR B OG1   1 
ATOM   8833  C  CG2   . THR B  1 477 ? 54.041  70.555  120.597 1.00 72.37 ? 477 THR B CG2   1 
ATOM   8834  N  N     . LEU B  1 478 ? 56.808  67.463  121.694 1.00 62.85 ? 478 LEU B N     1 
ATOM   8835  C  CA    . LEU B  1 478 ? 58.265  67.413  121.721 1.00 62.85 ? 478 LEU B CA    1 
ATOM   8836  C  C     . LEU B  1 478 ? 58.836  66.144  121.110 1.00 62.85 ? 478 LEU B C     1 
ATOM   8837  O  O     . LEU B  1 478 ? 59.758  66.225  120.289 1.00 62.85 ? 478 LEU B O     1 
ATOM   8838  C  CB    . LEU B  1 478 ? 58.766  67.552  123.162 1.00 62.85 ? 478 LEU B CB    1 
ATOM   8839  C  CG    . LEU B  1 478 ? 60.278  67.532  123.357 1.00 62.85 ? 478 LEU B CG    1 
ATOM   8840  C  CD1   . LEU B  1 478 ? 60.921  68.699  122.636 1.00 62.85 ? 478 LEU B CD1   1 
ATOM   8841  C  CD2   . LEU B  1 478 ? 60.602  67.569  124.835 1.00 62.85 ? 478 LEU B CD2   1 
ATOM   8842  N  N     . TYR B  1 479 ? 58.312  64.975  121.492 1.00 65.04 ? 479 TYR B N     1 
ATOM   8843  C  CA    . TYR B  1 479 ? 58.806  63.710  120.953 1.00 65.04 ? 479 TYR B CA    1 
ATOM   8844  C  C     . TYR B  1 479 ? 58.511  63.588  119.465 1.00 65.04 ? 479 TYR B C     1 
ATOM   8845  O  O     . TYR B  1 479 ? 59.364  63.134  118.696 1.00 65.04 ? 479 TYR B O     1 
ATOM   8846  C  CB    . TYR B  1 479 ? 58.186  62.542  121.719 1.00 65.04 ? 479 TYR B CB    1 
ATOM   8847  C  CG    . TYR B  1 479 ? 58.414  61.185  121.089 1.00 65.04 ? 479 TYR B CG    1 
ATOM   8848  C  CD1   . TYR B  1 479 ? 59.644  60.553  121.188 1.00 65.04 ? 479 TYR B CD1   1 
ATOM   8849  C  CD2   . TYR B  1 479 ? 57.393  60.530  120.408 1.00 65.04 ? 479 TYR B CD2   1 
ATOM   8850  C  CE1   . TYR B  1 479 ? 59.858  59.312  120.620 1.00 65.04 ? 479 TYR B CE1   1 
ATOM   8851  C  CE2   . TYR B  1 479 ? 57.598  59.292  119.832 1.00 65.04 ? 479 TYR B CE2   1 
ATOM   8852  C  CZ    . TYR B  1 479 ? 58.833  58.688  119.943 1.00 65.04 ? 479 TYR B CZ    1 
ATOM   8853  O  OH    . TYR B  1 479 ? 59.044  57.454  119.374 1.00 65.04 ? 479 TYR B OH    1 
ATOM   8854  N  N     . GLU B  1 480 ? 57.313  64.004  119.050 1.00 64.71 ? 480 GLU B N     1 
ATOM   8855  C  CA    . GLU B  1 480 ? 56.934  64.006  117.642 1.00 64.71 ? 480 GLU B CA    1 
ATOM   8856  C  C     . GLU B  1 480 ? 57.822  64.940  116.831 1.00 64.71 ? 480 GLU B C     1 
ATOM   8857  O  O     . GLU B  1 480 ? 58.239  64.603  115.715 1.00 64.71 ? 480 GLU B O     1 
ATOM   8858  C  CB    . GLU B  1 480 ? 55.467  64.414  117.546 1.00 64.71 ? 480 GLU B CB    1 
ATOM   8859  C  CG    . GLU B  1 480 ? 54.940  64.772  116.188 1.00 64.71 ? 480 GLU B CG    1 
ATOM   8860  C  CD    . GLU B  1 480 ? 53.828  65.796  116.299 1.00 64.71 ? 480 GLU B CD    1 
ATOM   8861  O  OE1   . GLU B  1 480 ? 54.112  66.938  116.718 1.00 64.71 ? 480 GLU B OE1   1 
ATOM   8862  O  OE2   . GLU B  1 480 ? 52.663  65.451  116.024 1.00 64.71 ? 480 GLU B OE2   1 
ATOM   8863  N  N     . GLN B  1 481 ? 58.171  66.092  117.408 1.00 53.99 ? 481 GLN B N     1 
ATOM   8864  C  CA    . GLN B  1 481 ? 59.034  67.056  116.733 1.00 53.99 ? 481 GLN B CA    1 
ATOM   8865  C  C     . GLN B  1 481 ? 60.454  66.522  116.583 1.00 53.99 ? 481 GLN B C     1 
ATOM   8866  O  O     . GLN B  1 481 ? 61.070  66.668  115.521 1.00 53.99 ? 481 GLN B O     1 
ATOM   8867  C  CB    . GLN B  1 481 ? 59.027  68.374  117.507 1.00 53.99 ? 481 GLN B CB    1 
ATOM   8868  C  CG    . GLN B  1 481 ? 60.058  69.382  117.056 1.00 53.99 ? 481 GLN B CG    1 
ATOM   8869  C  CD    . GLN B  1 481 ? 59.984  70.669  117.844 1.00 53.99 ? 481 GLN B CD    1 
ATOM   8870  O  OE1   . GLN B  1 481 ? 59.154  70.812  118.740 1.00 53.99 ? 481 GLN B OE1   1 
ATOM   8871  N  NE2   . GLN B  1 481 ? 60.854  71.614  117.517 1.00 53.99 ? 481 GLN B NE2   1 
ATOM   8872  N  N     . VAL B  1 482 ? 60.981  65.881  117.631 1.00 50.79 ? 482 VAL B N     1 
ATOM   8873  C  CA    . VAL B  1 482 ? 62.337  65.340  117.565 1.00 50.79 ? 482 VAL B CA    1 
ATOM   8874  C  C     . VAL B  1 482 ? 62.408  64.152  116.604 1.00 50.79 ? 482 VAL B C     1 
ATOM   8875  O  O     . VAL B  1 482 ? 63.379  64.019  115.846 1.00 50.79 ? 482 VAL B O     1 
ATOM   8876  C  CB    . VAL B  1 482 ? 62.824  64.986  118.985 1.00 50.79 ? 482 VAL B CB    1 
ATOM   8877  C  CG1   . VAL B  1 482 ? 64.121  64.193  118.962 1.00 50.79 ? 482 VAL B CG1   1 
ATOM   8878  C  CG2   . VAL B  1 482 ? 63.028  66.252  119.789 1.00 50.79 ? 482 VAL B CG2   1 
ATOM   8879  N  N     . ILE B  1 483 ? 61.368  63.311  116.568 1.00 52.88 ? 483 ILE B N     1 
ATOM   8880  C  CA    . ILE B  1 483 ? 61.339  62.192  115.626 1.00 52.88 ? 483 ILE B CA    1 
ATOM   8881  C  C     . ILE B  1 483 ? 61.214  62.690  114.190 1.00 52.88 ? 483 ILE B C     1 
ATOM   8882  O  O     . ILE B  1 483 ? 61.856  62.152  113.278 1.00 52.88 ? 483 ILE B O     1 
ATOM   8883  C  CB    . ILE B  1 483 ? 60.214  61.210  116.009 1.00 52.88 ? 483 ILE B CB    1 
ATOM   8884  C  CG1   . ILE B  1 483 ? 60.576  60.496  117.307 1.00 52.88 ? 483 ILE B CG1   1 
ATOM   8885  C  CG2   . ILE B  1 483 ? 59.941  60.178  114.922 1.00 52.88 ? 483 ILE B CG2   1 
ATOM   8886  C  CD1   . ILE B  1 483 ? 61.852  59.709  117.218 1.00 52.88 ? 483 ILE B CD1   1 
ATOM   8887  N  N     . LEU B  1 484 ? 60.438  63.756  113.969 1.00 50.61 ? 484 LEU B N     1 
ATOM   8888  C  CA    . LEU B  1 484 ? 60.316  64.304  112.621 1.00 50.61 ? 484 LEU B CA    1 
ATOM   8889  C  C     . LEU B  1 484 ? 61.611  64.965  112.164 1.00 50.61 ? 484 LEU B C     1 
ATOM   8890  O  O     . LEU B  1 484 ? 62.037  64.775  111.020 1.00 50.61 ? 484 LEU B O     1 
ATOM   8891  C  CB    . LEU B  1 484 ? 59.158  65.296  112.560 1.00 50.61 ? 484 LEU B CB    1 
ATOM   8892  C  CG    . LEU B  1 484 ? 58.904  65.928  111.194 1.00 50.61 ? 484 LEU B CG    1 
ATOM   8893  C  CD1   . LEU B  1 484 ? 58.669  64.850  110.157 1.00 50.61 ? 484 LEU B CD1   1 
ATOM   8894  C  CD2   . LEU B  1 484 ? 57.722  66.874  111.263 1.00 50.61 ? 484 LEU B CD2   1 
ATOM   8895  N  N     . GLU B  1 485 ? 62.265  65.723  113.042 1.00 44.70 ? 485 GLU B N     1 
ATOM   8896  C  CA    . GLU B  1 485 ? 63.495  66.406  112.667 1.00 44.70 ? 485 GLU B CA    1 
ATOM   8897  C  C     . GLU B  1 485 ? 64.722  65.509  112.720 1.00 44.70 ? 485 GLU B C     1 
ATOM   8898  O  O     . GLU B  1 485 ? 65.802  65.950  112.315 1.00 44.70 ? 485 GLU B O     1 
ATOM   8899  C  CB    . GLU B  1 485 ? 63.717  67.622  113.562 1.00 44.70 ? 485 GLU B CB    1 
ATOM   8900  C  CG    . GLU B  1 485 ? 62.668  68.689  113.390 1.00 44.70 ? 485 GLU B CG    1 
ATOM   8901  C  CD    . GLU B  1 485 ? 63.034  69.971  114.091 1.00 44.70 ? 485 GLU B CD    1 
ATOM   8902  O  OE1   . GLU B  1 485 ? 64.196  70.410  113.962 1.00 44.70 ? 485 GLU B OE1   1 
ATOM   8903  O  OE2   . GLU B  1 485 ? 62.160  70.535  114.778 1.00 44.70 ? 485 GLU B OE2   1 
ATOM   8904  N  N     . LYS B  1 486 ? 64.597  64.280  113.221 1.00 45.70 ? 486 LYS B N     1 
ATOM   8905  C  CA    . LYS B  1 486 ? 65.720  63.352  113.171 1.00 45.70 ? 486 LYS B CA    1 
ATOM   8906  C  C     . LYS B  1 486 ? 65.999  62.909  111.742 1.00 45.70 ? 486 LYS B C     1 
ATOM   8907  O  O     . LYS B  1 486 ? 67.161  62.799  111.334 1.00 45.70 ? 486 LYS B O     1 
ATOM   8908  C  CB    . LYS B  1 486 ? 65.436  62.145  114.067 1.00 45.70 ? 486 LYS B CB    1 
ATOM   8909  C  CG    . LYS B  1 486 ? 66.468  61.035  113.992 1.00 45.70 ? 486 LYS B CG    1 
ATOM   8910  C  CD    . LYS B  1 486 ? 66.135  59.906  114.949 1.00 45.70 ? 486 LYS B CD    1 
ATOM   8911  C  CE    . LYS B  1 486 ? 64.831  59.230  114.571 1.00 45.70 ? 486 LYS B CE    1 
ATOM   8912  N  NZ    . LYS B  1 486 ? 64.944  58.481  113.292 1.00 45.70 ? 486 LYS B NZ    1 
ATOM   8913  N  N     . GLU B  1 487 ? 64.947  62.691  110.956 1.00 47.42 ? 487 GLU B N     1 
ATOM   8914  C  CA    . GLU B  1 487 ? 65.069  62.145  109.611 1.00 47.42 ? 487 GLU B CA    1 
ATOM   8915  C  C     . GLU B  1 487 ? 65.012  63.212  108.526 1.00 47.42 ? 487 GLU B C     1 
ATOM   8916  O  O     . GLU B  1 487 ? 64.895  62.872  107.345 1.00 47.42 ? 487 GLU B O     1 
ATOM   8917  C  CB    . GLU B  1 487 ? 63.983  61.095  109.374 1.00 47.42 ? 487 GLU B CB    1 
ATOM   8918  C  CG    . GLU B  1 487 ? 64.162  59.835  110.201 1.00 47.42 ? 487 GLU B CG    1 
ATOM   8919  C  CD    . GLU B  1 487 ? 62.846  59.260  110.682 1.00 47.42 ? 487 GLU B CD    1 
ATOM   8920  O  OE1   . GLU B  1 487 ? 61.797  59.613  110.106 1.00 47.42 ? 487 GLU B OE1   1 
ATOM   8921  O  OE2   . GLU B  1 487 ? 62.861  58.456  111.638 1.00 47.42 ? 487 GLU B OE2   1 
ATOM   8922  N  N     . MET B  1 488 ? 65.092  64.489  108.888 1.00 39.57 ? 488 MET B N     1 
ATOM   8923  C  CA    . MET B  1 488 ? 65.183  65.543  107.892 1.00 39.57 ? 488 MET B CA    1 
ATOM   8924  C  C     . MET B  1 488 ? 66.595  65.589  107.314 1.00 39.57 ? 488 MET B C     1 
ATOM   8925  O  O     . MET B  1 488 ? 67.519  64.934  107.802 1.00 39.57 ? 488 MET B O     1 
ATOM   8926  C  CB    . MET B  1 488 ? 64.805  66.892  108.498 1.00 39.57 ? 488 MET B CB    1 
ATOM   8927  C  CG    . MET B  1 488 ? 63.318  67.174  108.554 1.00 39.57 ? 488 MET B CG    1 
ATOM   8928  S  SD    . MET B  1 488 ? 62.983  68.817  109.215 1.00 39.57 ? 488 MET B SD    1 
ATOM   8929  C  CE    . MET B  1 488 ? 61.214  68.928  108.986 1.00 39.57 ? 488 MET B CE    1 
ATOM   8930  N  N     . GLY B  1 489 ? 66.770  66.374  106.258 1.00 34.76 ? 489 GLY B N     1 
ATOM   8931  C  CA    . GLY B  1 489 ? 68.079  66.561  105.672 1.00 34.76 ? 489 GLY B CA    1 
ATOM   8932  C  C     . GLY B  1 489 ? 68.818  67.711  106.329 1.00 34.76 ? 489 GLY B C     1 
ATOM   8933  O  O     . GLY B  1 489 ? 68.217  68.670  106.795 1.00 34.76 ? 489 GLY B O     1 
ATOM   8934  N  N     . THR B  1 490 ? 70.140  67.601  106.373 1.00 30.23 ? 490 THR B N     1 
ATOM   8935  C  CA    . THR B  1 490 ? 70.959  68.642  106.973 1.00 30.23 ? 490 THR B CA    1 
ATOM   8936  C  C     . THR B  1 490 ? 71.357  69.667  105.920 1.00 30.23 ? 490 THR B C     1 
ATOM   8937  O  O     . THR B  1 490 ? 71.329  69.387  104.719 1.00 30.23 ? 490 THR B O     1 
ATOM   8938  C  CB    . THR B  1 490 ? 72.199  68.047  107.646 1.00 30.23 ? 490 THR B CB    1 
ATOM   8939  O  OG1   . THR B  1 490 ? 72.841  69.051  108.442 1.00 30.23 ? 490 THR B OG1   1 
ATOM   8940  C  CG2   . THR B  1 490 ? 73.185  67.501  106.625 1.00 30.23 ? 490 THR B CG2   1 
ATOM   8941  N  N     . TYR B  1 491 ? 71.682  70.871  106.376 1.00 26.66 ? 491 TYR B N     1 
ATOM   8942  C  CA    . TYR B  1 491 ? 72.086  71.940  105.474 1.00 26.66 ? 491 TYR B CA    1 
ATOM   8943  C  C     . TYR B  1 491 ? 73.596  71.901  105.292 1.00 26.66 ? 491 TYR B C     1 
ATOM   8944  O  O     . TYR B  1 491 ? 74.347  72.056  106.260 1.00 26.66 ? 491 TYR B O     1 
ATOM   8945  C  CB    . TYR B  1 491 ? 71.641  73.295  106.014 1.00 26.66 ? 491 TYR B CB    1 
ATOM   8946  C  CG    . TYR B  1 491 ? 71.712  74.400  104.992 1.00 26.66 ? 491 TYR B CG    1 
ATOM   8947  C  CD1   . TYR B  1 491 ? 70.863  74.411  103.898 1.00 26.66 ? 491 TYR B CD1   1 
ATOM   8948  C  CD2   . TYR B  1 491 ? 72.630  75.431  105.119 1.00 26.66 ? 491 TYR B CD2   1 
ATOM   8949  C  CE1   . TYR B  1 491 ? 70.922  75.414  102.958 1.00 26.66 ? 491 TYR B CE1   1 
ATOM   8950  C  CE2   . TYR B  1 491 ? 72.697  76.441  104.182 1.00 26.66 ? 491 TYR B CE2   1 
ATOM   8951  C  CZ    . TYR B  1 491 ? 71.839  76.427  103.105 1.00 26.66 ? 491 TYR B CZ    1 
ATOM   8952  O  OH    . TYR B  1 491 ? 71.897  77.429  102.167 1.00 26.66 ? 491 TYR B OH    1 
ATOM   8953  N  N     . LEU B  1 492 ? 74.040  71.697  104.057 1.00 28.69 ? 492 LEU B N     1 
ATOM   8954  C  CA    . LEU B  1 492 ? 75.467  71.569  103.764 1.00 28.69 ? 492 LEU B CA    1 
ATOM   8955  C  C     . LEU B  1 492 ? 76.093  72.909  103.394 1.00 28.69 ? 492 LEU B C     1 
ATOM   8956  O  O     . LEU B  1 492 ? 76.756  73.044  102.368 1.00 28.69 ? 492 LEU B O     1 
ATOM   8957  C  CB    . LEU B  1 492 ? 75.672  70.545  102.656 1.00 28.69 ? 492 LEU B CB    1 
ATOM   8958  C  CG    . LEU B  1 492 ? 75.604  69.079  103.083 1.00 28.69 ? 492 LEU B CG    1 
ATOM   8959  C  CD1   . LEU B  1 492 ? 75.136  68.208  101.932 1.00 28.69 ? 492 LEU B CD1   1 
ATOM   8960  C  CD2   . LEU B  1 492 ? 76.956  68.611  103.597 1.00 28.69 ? 492 LEU B CD2   1 
ATOM   8961  N  N     . GLY B  1 493 ? 75.882  73.917  104.236 1.00 23.36 ? 493 GLY B N     1 
ATOM   8962  C  CA    . GLY B  1 493 ? 76.488  75.218  104.031 1.00 23.36 ? 493 GLY B CA    1 
ATOM   8963  C  C     . GLY B  1 493 ? 75.885  76.032  102.905 1.00 23.36 ? 493 GLY B C     1 
ATOM   8964  O  O     . GLY B  1 493 ? 75.085  75.526  102.114 1.00 23.36 ? 493 GLY B O     1 
ATOM   8965  N  N     . THR B  1 494 ? 76.253  77.309  102.831 1.00 19.74 ? 494 THR B N     1 
ATOM   8966  C  CA    . THR B  1 494 ? 75.829  78.169  101.728 1.00 19.74 ? 494 THR B CA    1 
ATOM   8967  C  C     . THR B  1 494 ? 76.923  78.185  100.663 1.00 19.74 ? 494 THR B C     1 
ATOM   8968  O  O     . THR B  1 494 ? 77.660  79.153  100.487 1.00 19.74 ? 494 THR B O     1 
ATOM   8969  C  CB    . THR B  1 494 ? 75.519  79.572  102.227 1.00 19.74 ? 494 THR B CB    1 
ATOM   8970  O  OG1   . THR B  1 494 ? 76.646  80.083  102.945 1.00 19.74 ? 494 THR B OG1   1 
ATOM   8971  C  CG2   . THR B  1 494 ? 74.315  79.555  103.139 1.00 19.74 ? 494 THR B CG2   1 
ATOM   8972  N  N     . PHE B  1 495 ? 77.034  77.062  99.960  1.00 20.63 ? 495 PHE B N     1 
ATOM   8973  C  CA    . PHE B  1 495 ? 77.958  76.944  98.843  1.00 20.63 ? 495 PHE B CA    1 
ATOM   8974  C  C     . PHE B  1 495 ? 77.243  76.731  97.520  1.00 20.63 ? 495 PHE B C     1 
ATOM   8975  O  O     . PHE B  1 495 ? 77.581  77.388  96.534  1.00 20.63 ? 495 PHE B O     1 
ATOM   8976  C  CB    . PHE B  1 495 ? 78.956  75.805  99.088  1.00 20.63 ? 495 PHE B CB    1 
ATOM   8977  C  CG    . PHE B  1 495 ? 79.740  75.418  97.868  1.00 20.63 ? 495 PHE B CG    1 
ATOM   8978  C  CD1   . PHE B  1 495 ? 80.560  76.333  97.230  1.00 20.63 ? 495 PHE B CD1   1 
ATOM   8979  C  CD2   . PHE B  1 495 ? 79.659  74.136  97.361  1.00 20.63 ? 495 PHE B CD2   1 
ATOM   8980  C  CE1   . PHE B  1 495 ? 81.263  75.979  96.103  1.00 20.63 ? 495 PHE B CE1   1 
ATOM   8981  C  CE2   . PHE B  1 495 ? 80.375  73.778  96.240  1.00 20.63 ? 495 PHE B CE2   1 
ATOM   8982  C  CZ    . PHE B  1 495 ? 81.179  74.701  95.616  1.00 20.63 ? 495 PHE B CZ    1 
ATOM   8983  N  N     . ASP B  1 496 ? 76.270  75.821  97.465  1.00 22.34 ? 496 ASP B N     1 
ATOM   8984  C  CA    . ASP B  1 496 ? 75.491  75.657  96.242  1.00 22.34 ? 496 ASP B CA    1 
ATOM   8985  C  C     . ASP B  1 496 ? 74.603  76.863  95.988  1.00 22.34 ? 496 ASP B C     1 
ATOM   8986  O  O     . ASP B  1 496 ? 74.355  77.222  94.830  1.00 22.34 ? 496 ASP B O     1 
ATOM   8987  C  CB    . ASP B  1 496 ? 74.639  74.394  96.322  1.00 22.34 ? 496 ASP B CB    1 
ATOM   8988  C  CG    . ASP B  1 496 ? 75.421  73.195  96.798  1.00 22.34 ? 496 ASP B CG    1 
ATOM   8989  O  OD1   . ASP B  1 496 ? 75.477  72.969  98.025  1.00 22.34 ? 496 ASP B OD1   1 
ATOM   8990  O  OD2   . ASP B  1 496 ? 75.978  72.475  95.945  1.00 22.34 ? 496 ASP B OD2   1 
ATOM   8991  N  N     . ASP B  1 497 ? 74.140  77.507  97.054  1.00 19.99 ? 497 ASP B N     1 
ATOM   8992  C  CA    . ASP B  1 497 ? 73.243  78.642  96.934  1.00 19.99 ? 497 ASP B CA    1 
ATOM   8993  C  C     . ASP B  1 497 ? 73.950  79.904  96.467  1.00 19.99 ? 497 ASP B C     1 
ATOM   8994  O  O     . ASP B  1 497 ? 73.295  80.793  95.919  1.00 19.99 ? 497 ASP B O     1 
ATOM   8995  C  CB    . ASP B  1 497 ? 72.554  78.878  98.272  1.00 19.99 ? 497 ASP B CB    1 
ATOM   8996  C  CG    . ASP B  1 497 ? 71.680  77.714  98.684  1.00 19.99 ? 497 ASP B CG    1 
ATOM   8997  O  OD1   . ASP B  1 497 ? 70.889  77.240  97.843  1.00 19.99 ? 497 ASP B OD1   1 
ATOM   8998  O  OD2   . ASP B  1 497 ? 71.782  77.268  99.845  1.00 19.99 ? 497 ASP B OD2   1 
ATOM   8999  N  N     . TYR B  1 498 ? 75.262  80.005  96.666  1.00 15.90 ? 498 TYR B N     1 
ATOM   9000  C  CA    . TYR B  1 498 ? 76.037  81.064  96.036  1.00 15.90 ? 498 TYR B CA    1 
ATOM   9001  C  C     . TYR B  1 498 ? 76.512  80.667  94.653  1.00 15.90 ? 498 TYR B C     1 
ATOM   9002  O  O     . TYR B  1 498 ? 76.714  81.534  93.797  1.00 15.90 ? 498 TYR B O     1 
ATOM   9003  C  CB    . TYR B  1 498 ? 77.256  81.424  96.884  1.00 15.90 ? 498 TYR B CB    1 
ATOM   9004  C  CG    . TYR B  1 498 ? 76.978  82.348  98.039  1.00 15.90 ? 498 TYR B CG    1 
ATOM   9005  C  CD1   . TYR B  1 498 ? 76.198  83.479  97.881  1.00 15.90 ? 498 TYR B CD1   1 
ATOM   9006  C  CD2   . TYR B  1 498 ? 77.517  82.092  99.286  1.00 15.90 ? 498 TYR B CD2   1 
ATOM   9007  C  CE1   . TYR B  1 498 ? 75.955  84.321  98.941  1.00 15.90 ? 498 TYR B CE1   1 
ATOM   9008  C  CE2   . TYR B  1 498 ? 77.279  82.922  100.347 1.00 15.90 ? 498 TYR B CE2   1 
ATOM   9009  C  CZ    . TYR B  1 498 ? 76.500  84.034  100.171 1.00 15.90 ? 498 TYR B CZ    1 
ATOM   9010  O  OH    . TYR B  1 498 ? 76.272  84.857  101.242 1.00 15.90 ? 498 TYR B OH    1 
ATOM   9011  N  N     . LEU B  1 499 ? 76.691  79.367  94.423  1.00 16.54 ? 499 LEU B N     1 
ATOM   9012  C  CA    . LEU B  1 499 ? 77.128  78.878  93.122  1.00 16.54 ? 499 LEU B CA    1 
ATOM   9013  C  C     . LEU B  1 499 ? 76.047  79.071  92.069  1.00 16.54 ? 499 LEU B C     1 
ATOM   9014  O  O     . LEU B  1 499 ? 76.352  79.360  90.905  1.00 16.54 ? 499 LEU B O     1 
ATOM   9015  C  CB    . LEU B  1 499 ? 77.512  77.410  93.247  1.00 16.54 ? 499 LEU B CB    1 
ATOM   9016  C  CG    . LEU B  1 499 ? 77.989  76.619  92.045  1.00 16.54 ? 499 LEU B CG    1 
ATOM   9017  C  CD1   . LEU B  1 499 ? 79.212  77.256  91.456  1.00 16.54 ? 499 LEU B CD1   1 
ATOM   9018  C  CD2   . LEU B  1 499 ? 78.289  75.226  92.523  1.00 16.54 ? 499 LEU B CD2   1 
ATOM   9019  N  N     . GLU B  1 500 ? 74.780  78.926  92.466  1.00 21.01 ? 500 GLU B N     1 
ATOM   9020  C  CA    . GLU B  1 500 ? 73.672  79.198  91.556  1.00 21.01 ? 500 GLU B CA    1 
ATOM   9021  C  C     . GLU B  1 500 ? 73.639  80.667  91.147  1.00 21.01 ? 500 GLU B C     1 
ATOM   9022  O  O     . GLU B  1 500 ? 73.424  80.986  89.972  1.00 21.01 ? 500 GLU B O     1 
ATOM   9023  C  CB    . GLU B  1 500 ? 72.355  78.786  92.210  1.00 21.01 ? 500 GLU B CB    1 
ATOM   9024  C  CG    . GLU B  1 500 ? 71.113  79.213  91.450  1.00 21.01 ? 500 GLU B CG    1 
ATOM   9025  C  CD    . GLU B  1 500 ? 69.836  78.673  92.061  1.00 21.01 ? 500 GLU B CD    1 
ATOM   9026  O  OE1   . GLU B  1 500 ? 69.925  77.828  92.977  1.00 21.01 ? 500 GLU B OE1   1 
ATOM   9027  O  OE2   . GLU B  1 500 ? 68.745  79.099  91.627  1.00 21.01 ? 500 GLU B OE2   1 
ATOM   9028  N  N     . LEU B  1 501 ? 73.898  81.574  92.092  1.00 16.70 ? 501 LEU B N     1 
ATOM   9029  C  CA    . LEU B  1 501 ? 73.951  82.996  91.767  1.00 16.70 ? 501 LEU B CA    1 
ATOM   9030  C  C     . LEU B  1 501 ? 75.172  83.339  90.928  1.00 16.70 ? 501 LEU B C     1 
ATOM   9031  O  O     . LEU B  1 501 ? 75.104  84.236  90.080  1.00 16.70 ? 501 LEU B O     1 
ATOM   9032  C  CB    . LEU B  1 501 ? 73.948  83.829  93.043  1.00 16.70 ? 501 LEU B CB    1 
ATOM   9033  C  CG    . LEU B  1 501 ? 72.644  83.802  93.827  1.00 16.70 ? 501 LEU B CG    1 
ATOM   9034  C  CD1   . LEU B  1 501 ? 72.751  84.690  95.042  1.00 16.70 ? 501 LEU B CD1   1 
ATOM   9035  C  CD2   . LEU B  1 501 ? 71.510  84.245  92.937  1.00 16.70 ? 501 LEU B CD2   1 
ATOM   9036  N  N     . PHE B  1 502 ? 76.285  82.636  91.143  1.00 15.44 ? 502 PHE B N     1 
ATOM   9037  C  CA    . PHE B  1 502 ? 77.470  82.834  90.314  1.00 15.44 ? 502 PHE B CA    1 
ATOM   9038  C  C     . PHE B  1 502 ? 77.211  82.414  88.874  1.00 15.44 ? 502 PHE B C     1 
ATOM   9039  O  O     . PHE B  1 502 ? 77.582  83.129  87.938  1.00 15.44 ? 502 PHE B O     1 
ATOM   9040  C  CB    . PHE B  1 502 ? 78.644  82.054  90.896  1.00 15.44 ? 502 PHE B CB    1 
ATOM   9041  C  CG    . PHE B  1 502 ? 79.905  82.160  90.095  1.00 15.44 ? 502 PHE B CG    1 
ATOM   9042  C  CD1   . PHE B  1 502 ? 80.699  83.283  90.185  1.00 15.44 ? 502 PHE B CD1   1 
ATOM   9043  C  CD2   . PHE B  1 502 ? 80.306  81.125  89.265  1.00 15.44 ? 502 PHE B CD2   1 
ATOM   9044  C  CE1   . PHE B  1 502 ? 81.861  83.379  89.458  1.00 15.44 ? 502 PHE B CE1   1 
ATOM   9045  C  CE2   . PHE B  1 502 ? 81.468  81.220  88.533  1.00 15.44 ? 502 PHE B CE2   1 
ATOM   9046  C  CZ    . PHE B  1 502 ? 82.248  82.346  88.637  1.00 15.44 ? 502 PHE B CZ    1 
ATOM   9047  N  N     . LEU B  1 503 ? 76.551  81.273  88.675  1.00 17.35 ? 503 LEU B N     1 
ATOM   9048  C  CA    . LEU B  1 503 ? 76.228  80.850  87.317  1.00 17.35 ? 503 LEU B CA    1 
ATOM   9049  C  C     . LEU B  1 503 ? 75.139  81.710  86.688  1.00 17.35 ? 503 LEU B C     1 
ATOM   9050  O  O     . LEU B  1 503 ? 75.132  81.886  85.466  1.00 17.35 ? 503 LEU B O     1 
ATOM   9051  C  CB    . LEU B  1 503 ? 75.819  79.380  87.304  1.00 17.35 ? 503 LEU B CB    1 
ATOM   9052  C  CG    . LEU B  1 503 ? 76.920  78.407  87.719  1.00 17.35 ? 503 LEU B CG    1 
ATOM   9053  C  CD1   . LEU B  1 503 ? 76.462  76.978  87.527  1.00 17.35 ? 503 LEU B CD1   1 
ATOM   9054  C  CD2   . LEU B  1 503 ? 78.194  78.669  86.940  1.00 17.35 ? 503 LEU B CD2   1 
ATOM   9055  N  N     . GLN B  1 504 ? 74.233  82.269  87.495  1.00 19.93 ? 504 GLN B N     1 
ATOM   9056  C  CA    . GLN B  1 504 ? 73.264  83.226  86.970  1.00 19.93 ? 504 GLN B CA    1 
ATOM   9057  C  C     . GLN B  1 504 ? 73.949  84.495  86.489  1.00 19.93 ? 504 GLN B C     1 
ATOM   9058  O  O     . GLN B  1 504 ? 73.637  85.003  85.407  1.00 19.93 ? 504 GLN B O     1 
ATOM   9059  C  CB    . GLN B  1 504 ? 72.233  83.572  88.035  1.00 19.93 ? 504 GLN B CB    1 
ATOM   9060  C  CG    . GLN B  1 504 ? 70.995  82.730  88.008  1.00 19.93 ? 504 GLN B CG    1 
ATOM   9061  C  CD    . GLN B  1 504 ? 69.987  83.203  89.022  1.00 19.93 ? 504 GLN B CD    1 
ATOM   9062  O  OE1   . GLN B  1 504 ? 69.641  84.381  89.061  1.00 19.93 ? 504 GLN B OE1   1 
ATOM   9063  N  NE2   . GLN B  1 504 ? 69.527  82.293  89.868  1.00 19.93 ? 504 GLN B NE2   1 
ATOM   9064  N  N     . PHE B  1 505 ? 74.892  85.017  87.280  1.00 19.53 ? 505 PHE B N     1 
ATOM   9065  C  CA    . PHE B  1 505 ? 75.667  86.180  86.863  1.00 19.53 ? 505 PHE B CA    1 
ATOM   9066  C  C     . PHE B  1 505 ? 76.536  85.870  85.653  1.00 19.53 ? 505 PHE B C     1 
ATOM   9067  O  O     . PHE B  1 505 ? 76.796  86.758  84.836  1.00 19.53 ? 505 PHE B O     1 
ATOM   9068  C  CB    . PHE B  1 505 ? 76.534  86.667  88.019  1.00 19.53 ? 505 PHE B CB    1 
ATOM   9069  C  CG    . PHE B  1 505 ? 77.109  88.031  87.811  1.00 19.53 ? 505 PHE B CG    1 
ATOM   9070  C  CD1   . PHE B  1 505 ? 76.304  89.080  87.409  1.00 19.53 ? 505 PHE B CD1   1 
ATOM   9071  C  CD2   . PHE B  1 505 ? 78.455  88.266  88.024  1.00 19.53 ? 505 PHE B CD2   1 
ATOM   9072  C  CE1   . PHE B  1 505 ? 76.831  90.340  87.222  1.00 19.53 ? 505 PHE B CE1   1 
ATOM   9073  C  CE2   . PHE B  1 505 ? 78.988  89.522  87.839  1.00 19.53 ? 505 PHE B CE2   1 
ATOM   9074  C  CZ    . PHE B  1 505 ? 78.176  90.560  87.437  1.00 19.53 ? 505 PHE B CZ    1 
ATOM   9075  N  N     . GLY B  1 506 ? 76.972  84.619  85.515  1.00 19.45 ? 506 GLY B N     1 
ATOM   9076  C  CA    . GLY B  1 506 ? 77.712  84.233  84.327  1.00 19.45 ? 506 GLY B CA    1 
ATOM   9077  C  C     . GLY B  1 506 ? 76.849  84.199  83.081  1.00 19.45 ? 506 GLY B C     1 
ATOM   9078  O  O     . GLY B  1 506 ? 77.252  84.688  82.026  1.00 19.45 ? 506 GLY B O     1 
ATOM   9079  N  N     . TYR B  1 507 ? 75.655  83.611  83.180  1.00 20.62 ? 507 TYR B N     1 
ATOM   9080  C  CA    . TYR B  1 507 ? 74.755  83.570  82.030  1.00 20.62 ? 507 TYR B CA    1 
ATOM   9081  C  C     . TYR B  1 507 ? 74.232  84.953  81.669  1.00 20.62 ? 507 TYR B C     1 
ATOM   9082  O  O     . TYR B  1 507 ? 73.922  85.209  80.502  1.00 20.62 ? 507 TYR B O     1 
ATOM   9083  C  CB    . TYR B  1 507 ? 73.581  82.633  82.299  1.00 20.62 ? 507 TYR B CB    1 
ATOM   9084  C  CG    . TYR B  1 507 ? 73.890  81.171  82.098  1.00 20.62 ? 507 TYR B CG    1 
ATOM   9085  C  CD1   . TYR B  1 507 ? 74.353  80.703  80.879  1.00 20.62 ? 507 TYR B CD1   1 
ATOM   9086  C  CD2   . TYR B  1 507 ? 73.702  80.257  83.124  1.00 20.62 ? 507 TYR B CD2   1 
ATOM   9087  C  CE1   . TYR B  1 507 ? 74.636  79.368  80.693  1.00 20.62 ? 507 TYR B CE1   1 
ATOM   9088  C  CE2   . TYR B  1 507 ? 73.981  78.921  82.948  1.00 20.62 ? 507 TYR B CE2   1 
ATOM   9089  C  CZ    . TYR B  1 507 ? 74.447  78.482  81.729  1.00 20.62 ? 507 TYR B CZ    1 
ATOM   9090  O  OH    . TYR B  1 507 ? 74.724  77.149  81.547  1.00 20.62 ? 507 TYR B OH    1 
ATOM   9091  N  N     . VAL B  1 508 ? 74.128  85.851  82.645  1.00 21.81 ? 508 VAL B N     1 
ATOM   9092  C  CA    . VAL B  1 508 ? 73.627  87.191  82.366  1.00 21.81 ? 508 VAL B CA    1 
ATOM   9093  C  C     . VAL B  1 508 ? 74.723  88.073  81.786  1.00 21.81 ? 508 VAL B C     1 
ATOM   9094  O  O     . VAL B  1 508 ? 74.543  88.698  80.735  1.00 21.81 ? 508 VAL B O     1 
ATOM   9095  C  CB    . VAL B  1 508 ? 73.024  87.802  83.643  1.00 21.81 ? 508 VAL B CB    1 
ATOM   9096  C  CG1   . VAL B  1 508 ? 72.878  89.310  83.514  1.00 21.81 ? 508 VAL B CG1   1 
ATOM   9097  C  CG2   . VAL B  1 508 ? 71.689  87.173  83.924  1.00 21.81 ? 508 VAL B CG2   1 
ATOM   9098  N  N     . SER B  1 509 ? 75.880  88.126  82.441  1.00 22.63 ? 509 SER B N     1 
ATOM   9099  C  CA    . SER B  1 509 ? 76.834  89.189  82.172  1.00 22.63 ? 509 SER B CA    1 
ATOM   9100  C  C     . SER B  1 509 ? 77.868  88.844  81.109  1.00 22.63 ? 509 SER B C     1 
ATOM   9101  O  O     . SER B  1 509 ? 78.481  89.762  80.557  1.00 22.63 ? 509 SER B O     1 
ATOM   9102  C  CB    . SER B  1 509 ? 77.549  89.581  83.467  1.00 22.63 ? 509 SER B CB    1 
ATOM   9103  O  OG    . SER B  1 509 ? 78.731  90.302  83.196  1.00 22.63 ? 509 SER B OG    1 
ATOM   9104  N  N     . LEU B  1 510 ? 78.082  87.561  80.803  1.00 22.82 ? 510 LEU B N     1 
ATOM   9105  C  CA    . LEU B  1 510 ? 79.075  87.209  79.789  1.00 22.82 ? 510 LEU B CA    1 
ATOM   9106  C  C     . LEU B  1 510 ? 78.581  87.542  78.388  1.00 22.82 ? 510 LEU B C     1 
ATOM   9107  O  O     . LEU B  1 510 ? 79.358  88.002  77.546  1.00 22.82 ? 510 LEU B O     1 
ATOM   9108  C  CB    . LEU B  1 510 ? 79.430  85.727  79.874  1.00 22.82 ? 510 LEU B CB    1 
ATOM   9109  C  CG    . LEU B  1 510 ? 80.416  85.262  80.943  1.00 22.82 ? 510 LEU B CG    1 
ATOM   9110  C  CD1   . LEU B  1 510 ? 80.477  83.756  80.961  1.00 22.82 ? 510 LEU B CD1   1 
ATOM   9111  C  CD2   . LEU B  1 510 ? 81.785  85.824  80.677  1.00 22.82 ? 510 LEU B CD2   1 
ATOM   9112  N  N     . PHE B  1 511 ? 77.298  87.320  78.118  1.00 26.02 ? 511 PHE B N     1 
ATOM   9113  C  CA    . PHE B  1 511 ? 76.752  87.569  76.791  1.00 26.02 ? 511 PHE B CA    1 
ATOM   9114  C  C     . PHE B  1 511 ? 75.574  88.528  76.864  1.00 26.02 ? 511 PHE B C     1 
ATOM   9115  O  O     . PHE B  1 511 ? 74.533  88.287  76.248  1.00 26.02 ? 511 PHE B O     1 
ATOM   9116  C  CB    . PHE B  1 511 ? 76.319  86.262  76.127  1.00 26.02 ? 511 PHE B CB    1 
ATOM   9117  C  CG    . PHE B  1 511 ? 77.262  85.120  76.359  1.00 26.02 ? 511 PHE B CG    1 
ATOM   9118  C  CD1   . PHE B  1 511 ? 78.442  85.023  75.642  1.00 26.02 ? 511 PHE B CD1   1 
ATOM   9119  C  CD2   . PHE B  1 511 ? 76.964  84.136  77.286  1.00 26.02 ? 511 PHE B CD2   1 
ATOM   9120  C  CE1   . PHE B  1 511 ? 79.310  83.974  75.850  1.00 26.02 ? 511 PHE B CE1   1 
ATOM   9121  C  CE2   . PHE B  1 511 ? 77.829  83.085  77.499  1.00 26.02 ? 511 PHE B CE2   1 
ATOM   9122  C  CZ    . PHE B  1 511 ? 79.003  83.004  76.779  1.00 26.02 ? 511 PHE B CZ    1 
ATOM   9123  N  N     . SER B  1 512 ? 75.724  89.617  77.615  1.00 30.98 ? 512 SER B N     1 
ATOM   9124  C  CA    . SER B  1 512 ? 74.676  90.621  77.706  1.00 30.98 ? 512 SER B CA    1 
ATOM   9125  C  C     . SER B  1 512 ? 74.605  91.516  76.479  1.00 30.98 ? 512 SER B C     1 
ATOM   9126  O  O     . SER B  1 512 ? 73.613  92.231  76.309  1.00 30.98 ? 512 SER B O     1 
ATOM   9127  C  CB    . SER B  1 512 ? 74.878  91.492  78.948  1.00 30.98 ? 512 SER B CB    1 
ATOM   9128  O  OG    . SER B  1 512 ? 76.128  92.154  78.905  1.00 30.98 ? 512 SER B OG    1 
ATOM   9129  N  N     . CYS B  1 513 ? 75.630  91.498  75.627  1.00 38.00 ? 513 CYS B N     1 
ATOM   9130  C  CA    . CYS B  1 513 ? 75.590  92.305  74.414  1.00 38.00 ? 513 CYS B CA    1 
ATOM   9131  C  C     . CYS B  1 513 ? 74.681  91.681  73.365  1.00 38.00 ? 513 CYS B C     1 
ATOM   9132  O  O     . CYS B  1 513 ? 73.841  92.368  72.773  1.00 38.00 ? 513 CYS B O     1 
ATOM   9133  C  CB    . CYS B  1 513 ? 76.999  92.481  73.856  1.00 38.00 ? 513 CYS B CB    1 
ATOM   9134  S  SG    . CYS B  1 513 ? 78.006  93.663  74.758  1.00 38.00 ? 513 CYS B SG    1 
ATOM   9135  N  N     . VAL B  1 514 ? 74.827  90.379  73.127  1.00 35.30 ? 514 VAL B N     1 
ATOM   9136  C  CA    . VAL B  1 514 ? 74.097  89.738  72.040  1.00 35.30 ? 514 VAL B CA    1 
ATOM   9137  C  C     . VAL B  1 514 ? 72.733  89.257  72.515  1.00 35.30 ? 514 VAL B C     1 
ATOM   9138  O  O     . VAL B  1 514 ? 71.873  88.894  71.704  1.00 35.30 ? 514 VAL B O     1 
ATOM   9139  C  CB    . VAL B  1 514 ? 74.926  88.588  71.448  1.00 35.30 ? 514 VAL B CB    1 
ATOM   9140  C  CG1   . VAL B  1 514 ? 76.313  89.077  71.094  1.00 35.30 ? 514 VAL B CG1   1 
ATOM   9141  C  CG2   . VAL B  1 514 ? 75.005  87.444  72.433  1.00 35.30 ? 514 VAL B CG2   1 
ATOM   9142  N  N     . TYR B  1 515 ? 72.509  89.242  73.827  1.00 32.83 ? 515 TYR B N     1 
ATOM   9143  C  CA    . TYR B  1 515 ? 71.265  88.732  74.405  1.00 32.83 ? 515 TYR B CA    1 
ATOM   9144  C  C     . TYR B  1 515 ? 71.050  89.335  75.784  1.00 32.83 ? 515 TYR B C     1 
ATOM   9145  O  O     . TYR B  1 515 ? 71.354  88.712  76.807  1.00 32.83 ? 515 TYR B O     1 
ATOM   9146  C  CB    . TYR B  1 515 ? 71.286  87.205  74.479  1.00 32.83 ? 515 TYR B CB    1 
ATOM   9147  C  CG    . TYR B  1 515 ? 69.921  86.571  74.533  1.00 32.83 ? 515 TYR B CG    1 
ATOM   9148  C  CD1   . TYR B  1 515 ? 68.983  86.822  73.544  1.00 32.83 ? 515 TYR B CD1   1 
ATOM   9149  C  CD2   . TYR B  1 515 ? 69.575  85.712  75.564  1.00 32.83 ? 515 TYR B CD2   1 
ATOM   9150  C  CE1   . TYR B  1 515 ? 67.735  86.240  73.584  1.00 32.83 ? 515 TYR B CE1   1 
ATOM   9151  C  CE2   . TYR B  1 515 ? 68.328  85.125  75.613  1.00 32.83 ? 515 TYR B CE2   1 
ATOM   9152  C  CZ    . TYR B  1 515 ? 67.414  85.394  74.620  1.00 32.83 ? 515 TYR B CZ    1 
ATOM   9153  O  OH    . TYR B  1 515 ? 66.170  84.813  74.663  1.00 32.83 ? 515 TYR B OH    1 
ATOM   9154  N  N     . PRO B  1 516 ? 70.518  90.560  75.853  1.00 32.36 ? 516 PRO B N     1 
ATOM   9155  C  CA    . PRO B  1 516 ? 70.254  91.164  77.166  1.00 32.36 ? 516 PRO B CA    1 
ATOM   9156  C  C     . PRO B  1 516 ? 69.007  90.631  77.842  1.00 32.36 ? 516 PRO B C     1 
ATOM   9157  O  O     . PRO B  1 516 ? 68.894  90.755  79.071  1.00 32.36 ? 516 PRO B O     1 
ATOM   9158  C  CB    . PRO B  1 516 ? 70.105  92.652  76.839  1.00 32.36 ? 516 PRO B CB    1 
ATOM   9159  C  CG    . PRO B  1 516 ? 69.605  92.670  75.449  1.00 32.36 ? 516 PRO B CG    1 
ATOM   9160  C  CD    . PRO B  1 516 ? 70.171  91.470  74.748  1.00 32.36 ? 516 PRO B CD    1 
ATOM   9161  N  N     . LEU B  1 517 ? 68.093  90.022  77.078  1.00 32.98 ? 517 LEU B N     1 
ATOM   9162  C  CA    . LEU B  1 517 ? 66.838  89.482  77.596  1.00 32.98 ? 517 LEU B CA    1 
ATOM   9163  C  C     . LEU B  1 517 ? 67.054  88.415  78.661  1.00 32.98 ? 517 LEU B C     1 
ATOM   9164  O  O     . LEU B  1 517 ? 66.214  88.275  79.560  1.00 32.98 ? 517 LEU B O     1 
ATOM   9165  C  CB    . LEU B  1 517 ? 66.021  88.916  76.431  1.00 32.98 ? 517 LEU B CB    1 
ATOM   9166  C  CG    . LEU B  1 517 ? 64.680  88.228  76.672  1.00 32.98 ? 517 LEU B CG    1 
ATOM   9167  C  CD1   . LEU B  1 517 ? 63.676  89.211  77.227  1.00 32.98 ? 517 LEU B CD1   1 
ATOM   9168  C  CD2   . LEU B  1 517 ? 64.165  87.600  75.392  1.00 32.98 ? 517 LEU B CD2   1 
ATOM   9169  N  N     . ALA B  1 518 ? 68.189  87.706  78.604  1.00 31.47 ? 518 ALA B N     1 
ATOM   9170  C  CA    . ALA B  1 518 ? 68.543  86.708  79.609  1.00 31.47 ? 518 ALA B CA    1 
ATOM   9171  C  C     . ALA B  1 518 ? 68.660  87.302  81.005  1.00 31.47 ? 518 ALA B C     1 
ATOM   9172  O  O     . ALA B  1 518 ? 68.430  86.593  81.993  1.00 31.47 ? 518 ALA B O     1 
ATOM   9173  C  CB    . ALA B  1 518 ? 69.856  86.027  79.225  1.00 31.47 ? 518 ALA B CB    1 
ATOM   9174  N  N     . ALA B  1 519 ? 69.000  88.596  81.105  1.00 28.76 ? 519 ALA B N     1 
ATOM   9175  C  CA    . ALA B  1 519 ? 69.014  89.269  82.402  1.00 28.76 ? 519 ALA B CA    1 
ATOM   9176  C  C     . ALA B  1 519 ? 67.632  89.264  83.040  1.00 28.76 ? 519 ALA B C     1 
ATOM   9177  O  O     . ALA B  1 519 ? 67.503  89.015  84.246  1.00 28.76 ? 519 ALA B O     1 
ATOM   9178  C  CB    . ALA B  1 519 ? 69.530  90.698  82.253  1.00 28.76 ? 519 ALA B CB    1 
ATOM   9179  N  N     . ALA B  1 520 ? 66.587  89.472  82.229  1.00 30.09 ? 520 ALA B N     1 
ATOM   9180  C  CA    . ALA B  1 520 ? 65.219  89.335  82.720  1.00 30.09 ? 520 ALA B CA    1 
ATOM   9181  C  C     . ALA B  1 520 ? 64.942  87.909  83.168  1.00 30.09 ? 520 ALA B C     1 
ATOM   9182  O  O     . ALA B  1 520 ? 64.293  87.690  84.199  1.00 30.09 ? 520 ALA B O     1 
ATOM   9183  C  CB    . ALA B  1 520 ? 64.225  89.762  81.642  1.00 30.09 ? 520 ALA B CB    1 
ATOM   9184  N  N     . PHE B  1 521 ? 65.517  86.928  82.462  1.00 29.92 ? 521 PHE B N     1 
ATOM   9185  C  CA    . PHE B  1 521 ? 65.381  85.529  82.848  1.00 29.92 ? 521 PHE B CA    1 
ATOM   9186  C  C     . PHE B  1 521 ? 66.096  85.206  84.151  1.00 29.92 ? 521 PHE B C     1 
ATOM   9187  O  O     . PHE B  1 521 ? 65.859  84.131  84.711  1.00 29.92 ? 521 PHE B O     1 
ATOM   9188  C  CB    . PHE B  1 521 ? 65.908  84.614  81.744  1.00 29.92 ? 521 PHE B CB    1 
ATOM   9189  C  CG    . PHE B  1 521 ? 65.063  84.601  80.505  1.00 29.92 ? 521 PHE B CG    1 
ATOM   9190  C  CD1   . PHE B  1 521 ? 63.726  84.963  80.552  1.00 29.92 ? 521 PHE B CD1   1 
ATOM   9191  C  CD2   . PHE B  1 521 ? 65.608  84.218  79.291  1.00 29.92 ? 521 PHE B CD2   1 
ATOM   9192  C  CE1   . PHE B  1 521 ? 62.951  84.951  79.410  1.00 29.92 ? 521 PHE B CE1   1 
ATOM   9193  C  CE2   . PHE B  1 521 ? 64.839  84.202  78.146  1.00 29.92 ? 521 PHE B CE2   1 
ATOM   9194  C  CZ    . PHE B  1 521 ? 63.509  84.569  78.205  1.00 29.92 ? 521 PHE B CZ    1 
ATOM   9195  N  N     . ALA B  1 522 ? 66.961  86.093  84.645  1.00 27.89 ? 522 ALA B N     1 
ATOM   9196  C  CA    . ALA B  1 522 ? 67.450  85.914  86.000  1.00 27.89 ? 522 ALA B CA    1 
ATOM   9197  C  C     . ALA B  1 522 ? 66.471  86.466  87.022  1.00 27.89 ? 522 ALA B C     1 
ATOM   9198  O  O     . ALA B  1 522 ? 66.227  85.816  88.047  1.00 27.89 ? 522 ALA B O     1 
ATOM   9199  C  CB    . ALA B  1 522 ? 68.810  86.584  86.169  1.00 27.89 ? 522 ALA B CB    1 
ATOM   9200  N  N     . VAL B  1 523 ? 65.875  87.630  86.738  1.00 27.30 ? 523 VAL B N     1 
ATOM   9201  C  CA    . VAL B  1 523 ? 65.061  88.317  87.739  1.00 27.30 ? 523 VAL B CA    1 
ATOM   9202  C  C     . VAL B  1 523 ? 63.780  87.543  88.005  1.00 27.30 ? 523 VAL B C     1 
ATOM   9203  O  O     . VAL B  1 523 ? 63.423  87.287  89.163  1.00 27.30 ? 523 VAL B O     1 
ATOM   9204  C  CB    . VAL B  1 523 ? 64.777  89.761  87.295  1.00 27.30 ? 523 VAL B CB    1 
ATOM   9205  C  CG1   . VAL B  1 523 ? 63.893  90.462  88.304  1.00 27.30 ? 523 VAL B CG1   1 
ATOM   9206  C  CG2   . VAL B  1 523 ? 66.077  90.516  87.120  1.00 27.30 ? 523 VAL B CG2   1 
ATOM   9207  N  N     . LEU B  1 524 ? 63.124  87.072  86.941  1.00 27.43 ? 524 LEU B N     1 
ATOM   9208  C  CA    . LEU B  1 524 ? 61.977  86.181  87.061  1.00 27.43 ? 524 LEU B CA    1 
ATOM   9209  C  C     . LEU B  1 524 ? 62.328  84.842  87.692  1.00 27.43 ? 524 LEU B C     1 
ATOM   9210  O  O     . LEU B  1 524 ? 61.421  84.137  88.142  1.00 27.43 ? 524 LEU B O     1 
ATOM   9211  C  CB    . LEU B  1 524 ? 61.348  85.945  85.689  1.00 27.43 ? 524 LEU B CB    1 
ATOM   9212  C  CG    . LEU B  1 524 ? 60.555  87.110  85.103  1.00 27.43 ? 524 LEU B CG    1 
ATOM   9213  C  CD1   . LEU B  1 524 ? 60.028  86.746  83.731  1.00 27.43 ? 524 LEU B CD1   1 
ATOM   9214  C  CD2   . LEU B  1 524 ? 59.418  87.497  86.027  1.00 27.43 ? 524 LEU B CD2   1 
ATOM   9215  N  N     . ASN B  1 525 ? 63.608  84.471  87.735  1.00 27.39 ? 525 ASN B N     1 
ATOM   9216  C  CA    . ASN B  1 525 ? 63.996  83.327  88.544  1.00 27.39 ? 525 ASN B CA    1 
ATOM   9217  C  C     . ASN B  1 525 ? 64.119  83.716  90.008  1.00 27.39 ? 525 ASN B C     1 
ATOM   9218  O  O     . ASN B  1 525 ? 63.640  82.993  90.889  1.00 27.39 ? 525 ASN B O     1 
ATOM   9219  C  CB    . ASN B  1 525 ? 65.311  82.741  88.046  1.00 27.39 ? 525 ASN B CB    1 
ATOM   9220  C  CG    . ASN B  1 525 ? 65.704  81.491  88.795  1.00 27.39 ? 525 ASN B CG    1 
ATOM   9221  O  OD1   . ASN B  1 525 ? 65.253  80.396  88.471  1.00 27.39 ? 525 ASN B OD1   1 
ATOM   9222  N  ND2   . ASN B  1 525 ? 66.545  81.646  89.806  1.00 27.39 ? 525 ASN B ND2   1 
ATOM   9223  N  N     . ASN B  1 526 ? 64.745  84.869  90.279  1.00 26.56 ? 526 ASN B N     1 
ATOM   9224  C  CA    . ASN B  1 526 ? 65.079  85.230  91.653  1.00 26.56 ? 526 ASN B CA    1 
ATOM   9225  C  C     . ASN B  1 526 ? 63.839  85.564  92.464  1.00 26.56 ? 526 ASN B C     1 
ATOM   9226  O  O     . ASN B  1 526 ? 63.791  85.264  93.662  1.00 26.56 ? 526 ASN B O     1 
ATOM   9227  C  CB    . ASN B  1 526 ? 66.060  86.396  91.666  1.00 26.56 ? 526 ASN B CB    1 
ATOM   9228  C  CG    . ASN B  1 526 ? 67.466  85.968  91.326  1.00 26.56 ? 526 ASN B CG    1 
ATOM   9229  O  OD1   . ASN B  1 526 ? 67.760  84.778  91.259  1.00 26.56 ? 526 ASN B OD1   1 
ATOM   9230  N  ND2   . ASN B  1 526 ? 68.346  86.936  91.112  1.00 26.56 ? 526 ASN B ND2   1 
ATOM   9231  N  N     . PHE B  1 527 ? 62.806  86.108  91.810  1.00 29.49 ? 527 PHE B N     1 
ATOM   9232  C  CA    . PHE B  1 527 ? 61.509  86.319  92.444  1.00 29.49 ? 527 PHE B CA    1 
ATOM   9233  C  C     . PHE B  1 527 ? 60.871  85.019  92.917  1.00 29.49 ? 527 PHE B C     1 
ATOM   9234  O  O     . PHE B  1 527 ? 60.035  85.050  93.826  1.00 29.49 ? 527 PHE B O     1 
ATOM   9235  C  CB    . PHE B  1 527 ? 60.560  87.025  91.476  1.00 29.49 ? 527 PHE B CB    1 
ATOM   9236  C  CG    . PHE B  1 527 ? 60.814  88.497  91.337  1.00 29.49 ? 527 PHE B CG    1 
ATOM   9237  C  CD1   . PHE B  1 527 ? 61.490  89.198  92.322  1.00 29.49 ? 527 PHE B CD1   1 
ATOM   9238  C  CD2   . PHE B  1 527 ? 60.372  89.180  90.215  1.00 29.49 ? 527 PHE B CD2   1 
ATOM   9239  C  CE1   . PHE B  1 527 ? 61.718  90.557  92.191  1.00 29.49 ? 527 PHE B CE1   1 
ATOM   9240  C  CE2   . PHE B  1 527 ? 60.600  90.536  90.078  1.00 29.49 ? 527 PHE B CE2   1 
ATOM   9241  C  CZ    . PHE B  1 527 ? 61.275  91.225  91.067  1.00 29.49 ? 527 PHE B CZ    1 
ATOM   9242  N  N     . THR B  1 528 ? 61.236  83.883  92.325  1.00 30.13 ? 528 THR B N     1 
ATOM   9243  C  CA    . THR B  1 528 ? 60.857  82.604  92.900  1.00 30.13 ? 528 THR B CA    1 
ATOM   9244  C  C     . THR B  1 528 ? 61.871  82.109  93.917  1.00 30.13 ? 528 THR B C     1 
ATOM   9245  O  O     . THR B  1 528 ? 61.472  81.538  94.940  1.00 30.13 ? 528 THR B O     1 
ATOM   9246  C  CB    . THR B  1 528 ? 60.691  81.549  91.805  1.00 30.13 ? 528 THR B CB    1 
ATOM   9247  O  OG1   . THR B  1 528 ? 61.980  81.070  91.407  1.00 30.13 ? 528 THR B OG1   1 
ATOM   9248  C  CG2   . THR B  1 528 ? 59.984  82.140  90.602  1.00 30.13 ? 528 THR B CG2   1 
ATOM   9249  N  N     . GLU B  1 529 ? 63.166  82.356  93.677  1.00 28.96 ? 529 GLU B N     1 
ATOM   9250  C  CA    . GLU B  1 529 ? 64.211  81.741  94.494  1.00 28.96 ? 529 GLU B CA    1 
ATOM   9251  C  C     . GLU B  1 529 ? 64.220  82.315  95.904  1.00 28.96 ? 529 GLU B C     1 
ATOM   9252  O  O     . GLU B  1 529 ? 64.441  81.576  96.872  1.00 28.96 ? 529 GLU B O     1 
ATOM   9253  C  CB    . GLU B  1 529 ? 65.573  81.914  93.822  1.00 28.96 ? 529 GLU B CB    1 
ATOM   9254  C  CG    . GLU B  1 529 ? 66.677  81.049  94.406  1.00 28.96 ? 529 GLU B CG    1 
ATOM   9255  C  CD    . GLU B  1 529 ? 66.898  79.741  93.653  1.00 28.96 ? 529 GLU B CD    1 
ATOM   9256  O  OE1   . GLU B  1 529 ? 66.482  79.622  92.480  1.00 28.96 ? 529 GLU B OE1   1 
ATOM   9257  O  OE2   . GLU B  1 529 ? 67.495  78.818  94.245  1.00 28.96 ? 529 GLU B OE2   1 
ATOM   9258  N  N     . VAL B  1 530 ? 63.933  83.619  96.029  1.00 29.08 ? 530 VAL B N     1 
ATOM   9259  C  CA    . VAL B  1 530 ? 63.725  84.273  97.322  1.00 29.08 ? 530 VAL B CA    1 
ATOM   9260  C  C     . VAL B  1 530 ? 62.630  83.567  98.112  1.00 29.08 ? 530 VAL B C     1 
ATOM   9261  O  O     . VAL B  1 530 ? 62.754  83.357  99.325  1.00 29.08 ? 530 VAL B O     1 
ATOM   9262  C  CB    . VAL B  1 530 ? 63.401  85.765  97.103  1.00 29.08 ? 530 VAL B CB    1 
ATOM   9263  C  CG1   . VAL B  1 530 ? 62.868  86.423  98.363  1.00 29.08 ? 530 VAL B CG1   1 
ATOM   9264  C  CG2   . VAL B  1 530 ? 64.628  86.507  96.618  1.00 29.08 ? 530 VAL B CG2   1 
ATOM   9265  N  N     . ASN B  1 531 ? 61.570  83.133  97.430  1.00 33.81 ? 531 ASN B N     1 
ATOM   9266  C  CA    . ASN B  1 531 ? 60.596  82.273  98.087  1.00 33.81 ? 531 ASN B CA    1 
ATOM   9267  C  C     . ASN B  1 531 ? 61.161  80.874  98.289  1.00 33.81 ? 531 ASN B C     1 
ATOM   9268  O  O     . ASN B  1 531 ? 61.133  80.343  99.407  1.00 33.81 ? 531 ASN B O     1 
ATOM   9269  C  CB    . ASN B  1 531 ? 59.306  82.222  97.273  1.00 33.81 ? 531 ASN B CB    1 
ATOM   9270  C  CG    . ASN B  1 531 ? 58.706  83.589  97.059  1.00 33.81 ? 531 ASN B CG    1 
ATOM   9271  O  OD1   . ASN B  1 531 ? 59.275  84.598  97.467  1.00 33.81 ? 531 ASN B OD1   1 
ATOM   9272  N  ND2   . ASN B  1 531 ? 57.550  83.633  96.411  1.00 33.81 ? 531 ASN B ND2   1 
ATOM   9273  N  N     . SER B  1 532 ? 61.748  80.299  97.229  1.00 31.11 ? 532 SER B N     1 
ATOM   9274  C  CA    . SER B  1 532 ? 61.984  78.857  97.175  1.00 31.11 ? 532 SER B CA    1 
ATOM   9275  C  C     . SER B  1 532 ? 63.045  78.421  98.171  1.00 31.11 ? 532 SER B C     1 
ATOM   9276  O  O     . SER B  1 532 ? 62.812  77.495  98.959  1.00 31.11 ? 532 SER B O     1 
ATOM   9277  C  CB    . SER B  1 532 ? 62.386  78.442  95.764  1.00 31.11 ? 532 SER B CB    1 
ATOM   9278  O  OG    . SER B  1 532 ? 63.101  77.221  95.791  1.00 31.11 ? 532 SER B OG    1 
ATOM   9279  N  N     . ASP B  1 533 ? 64.194  79.109  98.172  1.00 28.43 ? 533 ASP B N     1 
ATOM   9280  C  CA    . ASP B  1 533 ? 65.228  78.886  99.176  1.00 28.43 ? 533 ASP B CA    1 
ATOM   9281  C  C     . ASP B  1 533 ? 64.702  79.106  100.587 1.00 28.43 ? 533 ASP B C     1 
ATOM   9282  O  O     . ASP B  1 533 ? 65.096  78.374  101.503 1.00 28.43 ? 533 ASP B O     1 
ATOM   9283  C  CB    . ASP B  1 533 ? 66.420  79.804  98.918  1.00 28.43 ? 533 ASP B CB    1 
ATOM   9284  C  CG    . ASP B  1 533 ? 67.318  79.299  97.809  1.00 28.43 ? 533 ASP B CG    1 
ATOM   9285  O  OD1   . ASP B  1 533 ? 67.240  78.101  97.468  1.00 28.43 ? 533 ASP B OD1   1 
ATOM   9286  O  OD2   . ASP B  1 533 ? 68.106  80.102  97.274  1.00 28.43 ? 533 ASP B OD2   1 
ATOM   9287  N  N     . ALA B  1 534 ? 63.777  80.062  100.761 1.00 29.41 ? 534 ALA B N     1 
ATOM   9288  C  CA    . ALA B  1 534 ? 63.144  80.267  102.059 1.00 29.41 ? 534 ALA B CA    1 
ATOM   9289  C  C     . ALA B  1 534 ? 62.373  79.031  102.490 1.00 29.41 ? 534 ALA B C     1 
ATOM   9290  O  O     . ALA B  1 534 ? 62.497  78.588  103.639 1.00 29.41 ? 534 ALA B O     1 
ATOM   9291  C  CB    . ALA B  1 534 ? 62.220  81.479  102.012 1.00 29.41 ? 534 ALA B CB    1 
ATOM   9292  N  N     . LEU B  1 535 ? 61.634  78.422  101.554 1.00 30.73 ? 535 LEU B N     1 
ATOM   9293  C  CA    . LEU B  1 535 ? 60.954  77.164  101.841 1.00 30.73 ? 535 LEU B CA    1 
ATOM   9294  C  C     . LEU B  1 535 ? 61.962  76.066  102.145 1.00 30.73 ? 535 LEU B C     1 
ATOM   9295  O  O     . LEU B  1 535 ? 61.739  75.239  103.038 1.00 30.73 ? 535 LEU B O     1 
ATOM   9296  C  CB    . LEU B  1 535 ? 60.060  76.778  100.665 1.00 30.73 ? 535 LEU B CB    1 
ATOM   9297  C  CG    . LEU B  1 535 ? 59.462  75.375  100.636 1.00 30.73 ? 535 LEU B CG    1 
ATOM   9298  C  CD1   . LEU B  1 535 ? 58.457  75.214  101.753 1.00 30.73 ? 535 LEU B CD1   1 
ATOM   9299  C  CD2   . LEU B  1 535 ? 58.815  75.112  99.295  1.00 30.73 ? 535 LEU B CD2   1 
ATOM   9300  N  N     . LYS B  1 536 ? 63.123  76.120  101.482 1.00 27.34 ? 536 LYS B N     1 
ATOM   9301  C  CA    . LYS B  1 536 ? 64.179  75.146  101.727 1.00 27.34 ? 536 LYS B CA    1 
ATOM   9302  C  C     . LYS B  1 536 ? 64.756  75.303  103.127 1.00 27.34 ? 536 LYS B C     1 
ATOM   9303  O  O     . LYS B  1 536 ? 65.262  74.338  103.709 1.00 27.34 ? 536 LYS B O     1 
ATOM   9304  C  CB    . LYS B  1 536 ? 65.268  75.302  100.670 1.00 27.34 ? 536 LYS B CB    1 
ATOM   9305  C  CG    . LYS B  1 536 ? 66.238  74.153  100.590 1.00 27.34 ? 536 LYS B CG    1 
ATOM   9306  C  CD    . LYS B  1 536 ? 67.285  74.406  99.530  1.00 27.34 ? 536 LYS B CD    1 
ATOM   9307  C  CE    . LYS B  1 536 ? 68.042  75.689  99.795  1.00 27.34 ? 536 LYS B CE    1 
ATOM   9308  N  NZ    . LYS B  1 536 ? 68.940  76.019  98.660  1.00 27.34 ? 536 LYS B NZ    1 
ATOM   9309  N  N     . MET B  1 537 ? 64.666  76.505  103.699 1.00 26.39 ? 537 MET B N     1 
ATOM   9310  C  CA    . MET B  1 537 ? 65.132  76.667  105.067 1.00 26.39 ? 537 MET B CA    1 
ATOM   9311  C  C     . MET B  1 537 ? 64.023  76.412  106.073 1.00 26.39 ? 537 MET B C     1 
ATOM   9312  O  O     . MET B  1 537 ? 64.300  76.269  107.268 1.00 26.39 ? 537 MET B O     1 
ATOM   9313  C  CB    . MET B  1 537 ? 65.713  78.065  105.270 1.00 26.39 ? 537 MET B CB    1 
ATOM   9314  C  CG    . MET B  1 537 ? 66.851  78.400  104.339 1.00 26.39 ? 537 MET B CG    1 
ATOM   9315  S  SD    . MET B  1 537 ? 68.097  77.112  104.330 1.00 26.39 ? 537 MET B SD    1 
ATOM   9316  C  CE    . MET B  1 537 ? 68.732  77.256  105.992 1.00 26.39 ? 537 MET B CE    1 
ATOM   9317  N  N     . CYS B  1 538 ? 62.773  76.337  105.622 1.00 32.19 ? 538 CYS B N     1 
ATOM   9318  C  CA    . CYS B  1 538 ? 61.690  76.358  106.594 1.00 32.19 ? 538 CYS B CA    1 
ATOM   9319  C  C     . CYS B  1 538 ? 61.044  74.996  106.795 1.00 32.19 ? 538 CYS B C     1 
ATOM   9320  O  O     . CYS B  1 538 ? 60.853  74.567  107.937 1.00 32.19 ? 538 CYS B O     1 
ATOM   9321  C  CB    . CYS B  1 538 ? 60.635  77.377  106.169 1.00 32.19 ? 538 CYS B CB    1 
ATOM   9322  S  SG    . CYS B  1 538 ? 61.044  79.063  106.635 1.00 32.19 ? 538 CYS B SG    1 
ATOM   9323  N  N     . ARG B  1 539 ? 60.702  74.302  105.714 1.00 38.14 ? 539 ARG B N     1 
ATOM   9324  C  CA    . ARG B  1 539 ? 59.960  73.059  105.819 1.00 38.14 ? 539 ARG B CA    1 
ATOM   9325  C  C     . ARG B  1 539 ? 60.662  71.869  105.187 1.00 38.14 ? 539 ARG B C     1 
ATOM   9326  O  O     . ARG B  1 539 ? 60.037  70.815  105.043 1.00 38.14 ? 539 ARG B O     1 
ATOM   9327  C  CB    . ARG B  1 539 ? 58.573  73.217  105.183 1.00 38.14 ? 539 ARG B CB    1 
ATOM   9328  C  CG    . ARG B  1 539 ? 57.714  74.289  105.828 1.00 38.14 ? 539 ARG B CG    1 
ATOM   9329  C  CD    . ARG B  1 539 ? 57.405  73.949  107.274 1.00 38.14 ? 539 ARG B CD    1 
ATOM   9330  N  NE    . ARG B  1 539 ? 56.965  75.117  108.030 1.00 38.14 ? 539 ARG B NE    1 
ATOM   9331  C  CZ    . ARG B  1 539 ? 56.632  75.090  109.316 1.00 38.14 ? 539 ARG B CZ    1 
ATOM   9332  N  NH1   . ARG B  1 539 ? 56.687  73.952  109.991 1.00 38.14 ? 539 ARG B NH1   1 
ATOM   9333  N  NH2   . ARG B  1 539 ? 56.244  76.200  109.927 1.00 38.14 ? 539 ARG B NH2   1 
ATOM   9334  N  N     . VAL B  1 540 ? 61.932  71.998  104.805 1.00 31.11 ? 540 VAL B N     1 
ATOM   9335  C  CA    . VAL B  1 540 ? 62.661  70.950  104.102 1.00 31.11 ? 540 VAL B CA    1 
ATOM   9336  C  C     . VAL B  1 540 ? 63.815  70.414  104.939 1.00 31.11 ? 540 VAL B C     1 
ATOM   9337  O  O     . VAL B  1 540 ? 63.963  69.202  105.111 1.00 31.11 ? 540 VAL B O     1 
ATOM   9338  C  CB    . VAL B  1 540 ? 63.174  71.447  102.734 1.00 31.11 ? 540 VAL B CB    1 
ATOM   9339  C  CG1   . VAL B  1 540 ? 63.933  70.349  102.020 1.00 31.11 ? 540 VAL B CG1   1 
ATOM   9340  C  CG2   . VAL B  1 540 ? 62.026  71.942  101.887 1.00 31.11 ? 540 VAL B CG2   1 
ATOM   9341  N  N     . PHE B  1 541 ? 64.638  71.306  105.474 1.00 29.72 ? 541 PHE B N     1 
ATOM   9342  C  CA    . PHE B  1 541 ? 65.877  70.940  106.140 1.00 29.72 ? 541 PHE B CA    1 
ATOM   9343  C  C     . PHE B  1 541 ? 65.734  71.056  107.650 1.00 29.72 ? 541 PHE B C     1 
ATOM   9344  O  O     . PHE B  1 541 ? 64.755  71.591  108.172 1.00 29.72 ? 541 PHE B O     1 
ATOM   9345  C  CB    . PHE B  1 541 ? 67.028  71.826  105.657 1.00 29.72 ? 541 PHE B CB    1 
ATOM   9346  C  CG    . PHE B  1 541 ? 67.585  71.426  104.326 1.00 29.72 ? 541 PHE B CG    1 
ATOM   9347  C  CD1   . PHE B  1 541 ? 67.604  70.099  103.937 1.00 29.72 ? 541 PHE B CD1   1 
ATOM   9348  C  CD2   . PHE B  1 541 ? 68.093  72.376  103.465 1.00 29.72 ? 541 PHE B CD2   1 
ATOM   9349  C  CE1   . PHE B  1 541 ? 68.121  69.731  102.709 1.00 29.72 ? 541 PHE B CE1   1 
ATOM   9350  C  CE2   . PHE B  1 541 ? 68.614  72.014  102.241 1.00 29.72 ? 541 PHE B CE2   1 
ATOM   9351  C  CZ    . PHE B  1 541 ? 68.624  70.691  101.862 1.00 29.72 ? 541 PHE B CZ    1 
ATOM   9352  N  N     . LYS B  1 542 ? 66.741  70.541  108.352 1.00 34.55 ? 542 LYS B N     1 
ATOM   9353  C  CA    . LYS B  1 542 ? 66.885  70.812  109.771 1.00 34.55 ? 542 LYS B CA    1 
ATOM   9354  C  C     . LYS B  1 542 ? 67.285  72.267  109.984 1.00 34.55 ? 542 LYS B C     1 
ATOM   9355  O  O     . LYS B  1 542 ? 67.661  72.984  109.052 1.00 34.55 ? 542 LYS B O     1 
ATOM   9356  C  CB    . LYS B  1 542 ? 67.943  69.911  110.402 1.00 34.55 ? 542 LYS B CB    1 
ATOM   9357  C  CG    . LYS B  1 542 ? 67.578  68.455  110.516 1.00 34.55 ? 542 LYS B CG    1 
ATOM   9358  C  CD    . LYS B  1 542 ? 68.760  67.673  111.054 1.00 34.55 ? 542 LYS B CD    1 
ATOM   9359  C  CE    . LYS B  1 542 ? 68.691  66.216  110.657 1.00 34.55 ? 542 LYS B CE    1 
ATOM   9360  N  NZ    . LYS B  1 542 ? 69.999  65.540  110.853 1.00 34.55 ? 542 LYS B NZ    1 
ATOM   9361  N  N     . ARG B  1 543 ? 67.215  72.698  111.229 1.00 31.84 ? 543 ARG B N     1 
ATOM   9362  C  CA    . ARG B  1 543 ? 67.718  74.016  111.576 1.00 31.84 ? 543 ARG B CA    1 
ATOM   9363  C  C     . ARG B  1 543 ? 69.237  73.999  111.508 1.00 31.84 ? 543 ARG B C     1 
ATOM   9364  O  O     . ARG B  1 543 ? 69.864  73.158  112.161 1.00 31.84 ? 543 ARG B O     1 
ATOM   9365  C  CB    . ARG B  1 543 ? 67.252  74.415  112.964 1.00 31.84 ? 543 ARG B CB    1 
ATOM   9366  C  CG    . ARG B  1 543 ? 67.641  75.818  113.359 1.00 31.84 ? 543 ARG B CG    1 
ATOM   9367  C  CD    . ARG B  1 543 ? 66.920  76.226  114.618 1.00 31.84 ? 543 ARG B CD    1 
ATOM   9368  N  NE    . ARG B  1 543 ? 67.202  77.602  114.992 1.00 31.84 ? 543 ARG B NE    1 
ATOM   9369  C  CZ    . ARG B  1 543 ? 66.485  78.289  115.872 1.00 31.84 ? 543 ARG B CZ    1 
ATOM   9370  N  NH1   . ARG B  1 543 ? 65.444  77.723  116.464 1.00 31.84 ? 543 ARG B NH1   1 
ATOM   9371  N  NH2   . ARG B  1 543 ? 66.807  79.540  116.160 1.00 31.84 ? 543 ARG B NH2   1 
ATOM   9372  N  N     . PRO B  1 544 ? 69.864  74.858  110.715 1.00 29.26 ? 544 PRO B N     1 
ATOM   9373  C  CA    . PRO B  1 544 ? 71.326  74.912  110.714 1.00 29.26 ? 544 PRO B CA    1 
ATOM   9374  C  C     . PRO B  1 544 ? 71.839  75.597  111.965 1.00 29.26 ? 544 PRO B C     1 
ATOM   9375  O  O     . PRO B  1 544 ? 71.156  76.423  112.574 1.00 29.26 ? 544 PRO B O     1 
ATOM   9376  C  CB    . PRO B  1 544 ? 71.646  75.731  109.462 1.00 29.26 ? 544 PRO B CB    1 
ATOM   9377  C  CG    . PRO B  1 544 ? 70.461  76.605  109.296 1.00 29.26 ? 544 PRO B CG    1 
ATOM   9378  C  CD    . PRO B  1 544 ? 69.280  75.792  109.738 1.00 29.26 ? 544 PRO B CD    1 
ATOM   9379  N  N     . PHE B  1 545 ? 73.055  75.233  112.359 1.00 30.62 ? 545 PHE B N     1 
ATOM   9380  C  CA    . PHE B  1 545 ? 73.696  75.912  113.473 1.00 30.62 ? 545 PHE B CA    1 
ATOM   9381  C  C     . PHE B  1 545 ? 74.102  77.316  113.052 1.00 30.62 ? 545 PHE B C     1 
ATOM   9382  O  O     . PHE B  1 545 ? 74.530  77.534  111.915 1.00 30.62 ? 545 PHE B O     1 
ATOM   9383  C  CB    . PHE B  1 545 ? 74.913  75.132  113.957 1.00 30.62 ? 545 PHE B CB    1 
ATOM   9384  C  CG    . PHE B  1 545 ? 74.608  74.157  115.051 1.00 30.62 ? 545 PHE B CG    1 
ATOM   9385  C  CD1   . PHE B  1 545 ? 73.993  74.579  116.215 1.00 30.62 ? 545 PHE B CD1   1 
ATOM   9386  C  CD2   . PHE B  1 545 ? 74.955  72.825  114.926 1.00 30.62 ? 545 PHE B CD2   1 
ATOM   9387  C  CE1   . PHE B  1 545 ? 73.712  73.687  117.228 1.00 30.62 ? 545 PHE B CE1   1 
ATOM   9388  C  CE2   . PHE B  1 545 ? 74.680  71.928  115.938 1.00 30.62 ? 545 PHE B CE2   1 
ATOM   9389  C  CZ    . PHE B  1 545 ? 74.063  72.362  117.093 1.00 30.62 ? 545 PHE B CZ    1 
ATOM   9390  N  N     . SER B  1 546 ? 73.948  78.266  113.967 1.00 31.12 ? 546 SER B N     1 
ATOM   9391  C  CA    . SER B  1 546 ? 74.275  79.654  113.679 1.00 31.12 ? 546 SER B CA    1 
ATOM   9392  C  C     . SER B  1 546 ? 75.780  79.821  113.546 1.00 31.12 ? 546 SER B C     1 
ATOM   9393  O  O     . SER B  1 546 ? 76.540  79.404  114.422 1.00 31.12 ? 546 SER B O     1 
ATOM   9394  C  CB    . SER B  1 546 ? 73.742  80.553  114.787 1.00 31.12 ? 546 SER B CB    1 
ATOM   9395  O  OG    . SER B  1 546 ? 72.431  80.165  115.144 1.00 31.12 ? 546 SER B OG    1 
ATOM   9396  N  N     . GLU B  1 547 ? 76.213  80.413  112.440 1.00 25.86 ? 547 GLU B N     1 
ATOM   9397  C  CA    . GLU B  1 547 ? 77.621  80.649  112.213 1.00 25.86 ? 547 GLU B CA    1 
ATOM   9398  C  C     . GLU B  1 547 ? 77.853  82.128  111.947 1.00 25.86 ? 547 GLU B C     1 
ATOM   9399  O  O     . GLU B  1 547 ? 77.237  82.689  111.031 1.00 25.86 ? 547 GLU B O     1 
ATOM   9400  C  CB    . GLU B  1 547 ? 78.136  79.820  111.032 1.00 25.86 ? 547 GLU B CB    1 
ATOM   9401  C  CG    . GLU B  1 547 ? 78.267  78.339  111.331 1.00 25.86 ? 547 GLU B CG    1 
ATOM   9402  N  N     . PRO B  1 548 ? 78.708  82.794  112.718 1.00 24.61 ? 548 PRO B N     1 
ATOM   9403  C  CA    . PRO B  1 548 ? 79.007  84.201  112.441 1.00 24.61 ? 548 PRO B CA    1 
ATOM   9404  C  C     . PRO B  1 548 ? 79.876  84.347  111.204 1.00 24.61 ? 548 PRO B C     1 
ATOM   9405  O  O     . PRO B  1 548 ? 80.842  83.607  111.005 1.00 24.61 ? 548 PRO B O     1 
ATOM   9406  C  CB    . PRO B  1 548 ? 79.754  84.660  113.700 1.00 24.61 ? 548 PRO B CB    1 
ATOM   9407  C  CG    . PRO B  1 548 ? 79.473  83.609  114.728 1.00 24.61 ? 548 PRO B CG    1 
ATOM   9408  C  CD    . PRO B  1 548 ? 79.340  82.341  113.964 1.00 24.61 ? 548 PRO B CD    1 
ATOM   9409  N  N     . SER B  1 549 ? 79.518  85.315  110.366 1.00 23.90 ? 549 SER B N     1 
ATOM   9410  C  CA    . SER B  1 549 ? 80.265  85.591  109.150 1.00 23.90 ? 549 SER B CA    1 
ATOM   9411  C  C     . SER B  1 549 ? 80.221  87.084  108.881 1.00 23.90 ? 549 SER B C     1 
ATOM   9412  O  O     . SER B  1 549 ? 79.168  87.712  109.000 1.00 23.90 ? 549 SER B O     1 
ATOM   9413  C  CB    . SER B  1 549 ? 79.699  84.819  107.956 1.00 23.90 ? 549 SER B CB    1 
ATOM   9414  O  OG    . SER B  1 549 ? 80.200  83.494  107.929 1.00 23.90 ? 549 SER B OG    1 
ATOM   9415  N  N     . ALA B  1 550 ? 81.371  87.644  108.515 1.00 23.04 ? 550 ALA B N     1 
ATOM   9416  C  CA    . ALA B  1 550 ? 81.484  89.073  108.273 1.00 23.04 ? 550 ALA B CA    1 
ATOM   9417  C  C     . ALA B  1 550 ? 81.326  89.450  106.809 1.00 23.04 ? 550 ALA B C     1 
ATOM   9418  O  O     . ALA B  1 550 ? 81.081  90.624  106.513 1.00 23.04 ? 550 ALA B O     1 
ATOM   9419  C  CB    . ALA B  1 550 ? 82.834  89.591  108.781 1.00 23.04 ? 550 ALA B CB    1 
ATOM   9420  N  N     . ASN B  1 551 ? 81.467  88.496  105.895 1.00 19.40 ? 551 ASN B N     1 
ATOM   9421  C  CA    . ASN B  1 551 ? 81.338  88.753  104.469 1.00 19.40 ? 551 ASN B CA    1 
ATOM   9422  C  C     . ASN B  1 551 ? 80.898  87.471  103.775 1.00 19.40 ? 551 ASN B C     1 
ATOM   9423  O  O     . ASN B  1 551 ? 80.712  86.431  104.412 1.00 19.40 ? 551 ASN B O     1 
ATOM   9424  C  CB    . ASN B  1 551 ? 82.647  89.309  103.902 1.00 19.40 ? 551 ASN B CB    1 
ATOM   9425  C  CG    . ASN B  1 551 ? 83.857  88.466  104.269 1.00 19.40 ? 551 ASN B CG    1 
ATOM   9426  O  OD1   . ASN B  1 551 ? 83.740  87.412  104.892 1.00 19.40 ? 551 ASN B OD1   1 
ATOM   9427  N  ND2   . ASN B  1 551 ? 85.036  88.943  103.891 1.00 19.40 ? 551 ASN B ND2   1 
ATOM   9428  N  N     . ILE B  1 552 ? 80.720  87.551  102.456 1.00 14.91 ? 552 ILE B N     1 
ATOM   9429  C  CA    . ILE B  1 552 ? 80.429  86.343  101.695 1.00 14.91 ? 552 ILE B CA    1 
ATOM   9430  C  C     . ILE B  1 552 ? 81.676  85.496  101.510 1.00 14.91 ? 552 ILE B C     1 
ATOM   9431  O  O     . ILE B  1 552 ? 81.569  84.303  101.207 1.00 14.91 ? 552 ILE B O     1 
ATOM   9432  C  CB    . ILE B  1 552 ? 79.797  86.672  100.334 1.00 14.91 ? 552 ILE B CB    1 
ATOM   9433  C  CG1   . ILE B  1 552 ? 80.661  87.660  99.559  1.00 14.91 ? 552 ILE B CG1   1 
ATOM   9434  C  CG2   . ILE B  1 552 ? 78.425  87.252  100.523 1.00 14.91 ? 552 ILE B CG2   1 
ATOM   9435  C  CD1   . ILE B  1 552 ? 80.163  87.912  98.158  1.00 14.91 ? 552 ILE B CD1   1 
ATOM   9436  N  N     . GLY B  1 553 ? 82.856  86.079  101.687 1.00 15.81 ? 553 GLY B N     1 
ATOM   9437  C  CA    . GLY B  1 553 ? 84.081  85.313  101.715 1.00 15.81 ? 553 GLY B CA    1 
ATOM   9438  C  C     . GLY B  1 553 ? 84.859  85.377  100.424 1.00 15.81 ? 553 GLY B C     1 
ATOM   9439  O  O     . GLY B  1 553 ? 85.219  86.458  99.952  1.00 15.81 ? 553 GLY B O     1 
ATOM   9440  N  N     . VAL B  1 554 ? 85.122  84.206  99.842  1.00 16.14 ? 554 VAL B N     1 
ATOM   9441  C  CA    . VAL B  1 554 ? 85.877  84.131  98.596  1.00 16.14 ? 554 VAL B CA    1 
ATOM   9442  C  C     . VAL B  1 554 ? 84.982  84.360  97.390  1.00 16.14 ? 554 VAL B C     1 
ATOM   9443  O  O     . VAL B  1 554 ? 85.478  84.483  96.264  1.00 16.14 ? 554 VAL B O     1 
ATOM   9444  C  CB    . VAL B  1 554 ? 86.583  82.762  98.554  1.00 16.14 ? 554 VAL B CB    1 
ATOM   9445  C  CG1   . VAL B  1 554 ? 85.590  81.668  98.252  1.00 16.14 ? 554 VAL B CG1   1 
ATOM   9446  C  CG2   . VAL B  1 554 ? 87.787  82.749  97.617  1.00 16.14 ? 554 VAL B CG2   1 
ATOM   9447  N  N     . TRP B  1 555 ? 83.669  84.457  97.596  1.00 14.75 ? 555 TRP B N     1 
ATOM   9448  C  CA    . TRP B  1 555 ? 82.755  84.664  96.484  1.00 14.75 ? 555 TRP B CA    1 
ATOM   9449  C  C     . TRP B  1 555 ? 82.833  86.069  95.911  1.00 14.75 ? 555 TRP B C     1 
ATOM   9450  O  O     . TRP B  1 555 ? 82.437  86.268  94.761  1.00 14.75 ? 555 TRP B O     1 
ATOM   9451  C  CB    . TRP B  1 555 ? 81.326  84.358  96.916  1.00 14.75 ? 555 TRP B CB    1 
ATOM   9452  C  CG    . TRP B  1 555 ? 81.070  82.907  97.056  1.00 14.75 ? 555 TRP B CG    1 
ATOM   9453  C  CD1   . TRP B  1 555 ? 80.873  82.219  98.211  1.00 14.75 ? 555 TRP B CD1   1 
ATOM   9454  C  CD2   . TRP B  1 555 ? 80.991  81.950  95.999  1.00 14.75 ? 555 TRP B CD2   1 
ATOM   9455  N  NE1   . TRP B  1 555 ? 80.671  80.891  97.942  1.00 14.75 ? 555 TRP B NE1   1 
ATOM   9456  C  CE2   . TRP B  1 555 ? 80.740  80.701  96.588  1.00 14.75 ? 555 TRP B CE2   1 
ATOM   9457  C  CE3   . TRP B  1 555 ? 81.108  82.028  94.610  1.00 14.75 ? 555 TRP B CE3   1 
ATOM   9458  C  CZ2   . TRP B  1 555 ? 80.603  79.543  95.839  1.00 14.75 ? 555 TRP B CZ2   1 
ATOM   9459  C  CZ3   . TRP B  1 555 ? 80.972  80.880  93.871  1.00 14.75 ? 555 TRP B CZ3   1 
ATOM   9460  C  CH2   . TRP B  1 555 ? 80.722  79.653  94.484  1.00 14.75 ? 555 TRP B CH2   1 
ATOM   9461  N  N     . GLN B  1 556 ? 83.335  87.040  96.677  1.00 16.29 ? 556 GLN B N     1 
ATOM   9462  C  CA    . GLN B  1 556 ? 83.543  88.379  96.136  1.00 16.29 ? 556 GLN B CA    1 
ATOM   9463  C  C     . GLN B  1 556 ? 84.592  88.367  95.034  1.00 16.29 ? 556 GLN B C     1 
ATOM   9464  O  O     . GLN B  1 556 ? 84.421  89.014  93.992  1.00 16.29 ? 556 GLN B O     1 
ATOM   9465  C  CB    . GLN B  1 556 ? 83.956  89.334  97.253  1.00 16.29 ? 556 GLN B CB    1 
ATOM   9466  C  CG    . GLN B  1 556 ? 83.896  90.788  96.863  1.00 16.29 ? 556 GLN B CG    1 
ATOM   9467  C  CD    . GLN B  1 556 ? 82.495  91.336  96.929  1.00 16.29 ? 556 GLN B CD    1 
ATOM   9468  O  OE1   . GLN B  1 556 ? 81.676  90.874  97.719  1.00 16.29 ? 556 GLN B OE1   1 
ATOM   9469  N  NE2   . GLN B  1 556 ? 82.207  92.327  96.099  1.00 16.29 ? 556 GLN B NE2   1 
ATOM   9470  N  N     . LEU B  1 557 ? 85.666  87.601  95.234  1.00 16.93 ? 557 LEU B N     1 
ATOM   9471  C  CA    . LEU B  1 557 ? 86.691  87.453  94.208  1.00 16.93 ? 557 LEU B CA    1 
ATOM   9472  C  C     . LEU B  1 557 ? 86.150  86.718  92.988  1.00 16.93 ? 557 LEU B C     1 
ATOM   9473  O  O     . LEU B  1 557 ? 86.502  87.054  91.854  1.00 16.93 ? 557 LEU B O     1 
ATOM   9474  C  CB    . LEU B  1 557 ? 87.897  86.720  94.789  1.00 16.93 ? 557 LEU B CB    1 
ATOM   9475  C  CG    . LEU B  1 557 ? 89.047  86.417  93.834  1.00 16.93 ? 557 LEU B CG    1 
ATOM   9476  C  CD1   . LEU B  1 557 ? 89.704  87.704  93.378  1.00 16.93 ? 557 LEU B CD1   1 
ATOM   9477  C  CD2   . LEU B  1 557 ? 90.050  85.495  94.490  1.00 16.93 ? 557 LEU B CD2   1 
ATOM   9478  N  N     . ALA B  1 558 ? 85.257  85.747  93.199  1.00 15.70 ? 558 ALA B N     1 
ATOM   9479  C  CA    . ALA B  1 558 ? 84.685  85.007  92.079  1.00 15.70 ? 558 ALA B CA    1 
ATOM   9480  C  C     . ALA B  1 558 ? 83.748  85.880  91.254  1.00 15.70 ? 558 ALA B C     1 
ATOM   9481  O  O     . ALA B  1 558 ? 83.793  85.849  90.019  1.00 15.70 ? 558 ALA B O     1 
ATOM   9482  C  CB    . ALA B  1 558 ? 83.954  83.769  92.590  1.00 15.70 ? 558 ALA B CB    1 
ATOM   9483  N  N     . PHE B  1 559 ? 82.917  86.688  91.916  1.00 15.73 ? 559 PHE B N     1 
ATOM   9484  C  CA    . PHE B  1 559 ? 82.029  87.589  91.190  1.00 15.73 ? 559 PHE B CA    1 
ATOM   9485  C  C     . PHE B  1 559 ? 82.801  88.699  90.483  1.00 15.73 ? 559 PHE B C     1 
ATOM   9486  O  O     . PHE B  1 559 ? 82.444  89.079  89.361  1.00 15.73 ? 559 PHE B O     1 
ATOM   9487  C  CB    . PHE B  1 559 ? 80.989  88.177  92.142  1.00 15.73 ? 559 PHE B CB    1 
ATOM   9488  C  CG    . PHE B  1 559 ? 79.762  87.324  92.303  1.00 15.73 ? 559 PHE B CG    1 
ATOM   9489  C  CD1   . PHE B  1 559 ? 78.712  87.428  91.413  1.00 15.73 ? 559 PHE B CD1   1 
ATOM   9490  C  CD2   . PHE B  1 559 ? 79.656  86.426  93.348  1.00 15.73 ? 559 PHE B CD2   1 
ATOM   9491  C  CE1   . PHE B  1 559 ? 77.585  86.648  91.560  1.00 15.73 ? 559 PHE B CE1   1 
ATOM   9492  C  CE2   . PHE B  1 559 ? 78.536  85.643  93.501  1.00 15.73 ? 559 PHE B CE2   1 
ATOM   9493  C  CZ    . PHE B  1 559 ? 77.500  85.754  92.607  1.00 15.73 ? 559 PHE B CZ    1 
ATOM   9494  N  N     . GLU B  1 560 ? 83.883  89.198  91.089  1.00 17.85 ? 560 GLU B N     1 
ATOM   9495  C  CA    . GLU B  1 560 ? 84.699  90.197  90.405  1.00 17.85 ? 560 GLU B CA    1 
ATOM   9496  C  C     . GLU B  1 560 ? 85.472  89.597  89.235  1.00 17.85 ? 560 GLU B C     1 
ATOM   9497  O  O     . GLU B  1 560 ? 85.649  90.262  88.209  1.00 17.85 ? 560 GLU B O     1 
ATOM   9498  C  CB    . GLU B  1 560 ? 85.652  90.862  91.393  1.00 17.85 ? 560 GLU B CB    1 
ATOM   9499  C  CG    . GLU B  1 560 ? 84.969  91.849  92.321  1.00 17.85 ? 560 GLU B CG    1 
ATOM   9500  C  CD    . GLU B  1 560 ? 85.889  92.369  93.405  1.00 17.85 ? 560 GLU B CD    1 
ATOM   9501  O  OE1   . GLU B  1 560 ? 87.008  91.834  93.548  1.00 17.85 ? 560 GLU B OE1   1 
ATOM   9502  O  OE2   . GLU B  1 560 ? 85.491  93.315  94.118  1.00 17.85 ? 560 GLU B OE2   1 
ATOM   9503  N  N     . THR B  1 561 ? 85.907  88.339  89.348  1.00 17.65 ? 561 THR B N     1 
ATOM   9504  C  CA    . THR B  1 561 ? 86.579  87.682  88.233  1.00 17.65 ? 561 THR B CA    1 
ATOM   9505  C  C     . THR B  1 561 ? 85.608  87.414  87.091  1.00 17.65 ? 561 THR B C     1 
ATOM   9506  O  O     . THR B  1 561 ? 85.978  87.523  85.915  1.00 17.65 ? 561 THR B O     1 
ATOM   9507  C  CB    . THR B  1 561 ? 87.230  86.386  88.716  1.00 17.65 ? 561 THR B CB    1 
ATOM   9508  O  OG1   . THR B  1 561 ? 88.053  86.670  89.852  1.00 17.65 ? 561 THR B OG1   1 
ATOM   9509  C  CG2   . THR B  1 561 ? 88.102  85.775  87.638  1.00 17.65 ? 561 THR B CG2   1 
ATOM   9510  N  N     . MET B  1 562 ? 84.353  87.092  87.418  1.00 17.75 ? 562 MET B N     1 
ATOM   9511  C  CA    . MET B  1 562 ? 83.323  86.968  86.390  1.00 17.75 ? 562 MET B CA    1 
ATOM   9512  C  C     . MET B  1 562 ? 83.070  88.302  85.699  1.00 17.75 ? 562 MET B C     1 
ATOM   9513  O  O     . MET B  1 562 ? 82.971  88.364  84.466  1.00 17.75 ? 562 MET B O     1 
ATOM   9514  C  CB    . MET B  1 562 ? 82.035  86.432  87.007  1.00 17.75 ? 562 MET B CB    1 
ATOM   9515  C  CG    . MET B  1 562 ? 80.876  86.369  86.048  1.00 17.75 ? 562 MET B CG    1 
ATOM   9516  S  SD    . MET B  1 562 ? 81.239  85.276  84.673  1.00 17.75 ? 562 MET B SD    1 
ATOM   9517  C  CE    . MET B  1 562 ? 81.162  83.699  85.500  1.00 17.75 ? 562 MET B CE    1 
ATOM   9518  N  N     . SER B  1 563 ? 83.010  89.389  86.472  1.00 18.28 ? 563 SER B N     1 
ATOM   9519  C  CA    . SER B  1 563 ? 82.813  90.713  85.893  1.00 18.28 ? 563 SER B CA    1 
ATOM   9520  C  C     . SER B  1 563 ? 84.019  91.216  85.109  1.00 18.28 ? 563 SER B C     1 
ATOM   9521  O  O     . SER B  1 563 ? 83.863  92.136  84.301  1.00 18.28 ? 563 SER B O     1 
ATOM   9522  C  CB    . SER B  1 563 ? 82.468  91.716  86.989  1.00 18.28 ? 563 SER B CB    1 
ATOM   9523  O  OG    . SER B  1 563 ? 82.764  93.033  86.567  1.00 18.28 ? 563 SER B OG    1 
ATOM   9524  N  N     . VAL B  1 564 ? 85.206  90.661  85.334  1.00 17.56 ? 564 VAL B N     1 
ATOM   9525  C  CA    . VAL B  1 564 ? 86.385  91.000  84.543  1.00 17.56 ? 564 VAL B CA    1 
ATOM   9526  C  C     . VAL B  1 564 ? 86.460  90.178  83.258  1.00 17.56 ? 564 VAL B C     1 
ATOM   9527  O  O     . VAL B  1 564 ? 86.764  90.720  82.194  1.00 17.56 ? 564 VAL B O     1 
ATOM   9528  C  CB    . VAL B  1 564 ? 87.658  90.840  85.405  1.00 17.56 ? 564 VAL B CB    1 
ATOM   9529  C  CG1   . VAL B  1 564 ? 88.919  90.784  84.563  1.00 17.56 ? 564 VAL B CG1   1 
ATOM   9530  C  CG2   . VAL B  1 564 ? 87.764  91.997  86.375  1.00 17.56 ? 564 VAL B CG2   1 
ATOM   9531  N  N     . ILE B  1 565 ? 86.146  88.879  83.334  1.00 18.65 ? 565 ILE B N     1 
ATOM   9532  C  CA    . ILE B  1 565 ? 86.100  88.019  82.149  1.00 18.65 ? 565 ILE B CA    1 
ATOM   9533  C  C     . ILE B  1 565 ? 85.009  88.476  81.185  1.00 18.65 ? 565 ILE B C     1 
ATOM   9534  O  O     . ILE B  1 565 ? 85.188  88.443  79.953  1.00 18.65 ? 565 ILE B O     1 
ATOM   9535  C  CB    . ILE B  1 565 ? 85.911  86.553  82.600  1.00 18.65 ? 565 ILE B CB    1 
ATOM   9536  C  CG1   . ILE B  1 565 ? 87.193  86.028  83.240  1.00 18.65 ? 565 ILE B CG1   1 
ATOM   9537  C  CG2   . ILE B  1 565 ? 85.513  85.637  81.458  1.00 18.65 ? 565 ILE B CG2   1 
ATOM   9538  C  CD1   . ILE B  1 565 ? 87.036  84.673  83.878  1.00 18.65 ? 565 ILE B CD1   1 
ATOM   9539  N  N     . SER B  1 566 ? 83.896  88.979  81.723  1.00 21.11 ? 566 SER B N     1 
ATOM   9540  C  CA    . SER B  1 566 ? 82.802  89.431  80.877  1.00 21.11 ? 566 SER B CA    1 
ATOM   9541  C  C     . SER B  1 566 ? 83.132  90.695  80.094  1.00 21.11 ? 566 SER B C     1 
ATOM   9542  O  O     . SER B  1 566 ? 82.486  90.942  79.077  1.00 21.11 ? 566 SER B O     1 
ATOM   9543  C  CB    . SER B  1 566 ? 81.557  89.652  81.722  1.00 21.11 ? 566 SER B CB    1 
ATOM   9544  O  OG    . SER B  1 566 ? 81.519  90.968  82.230  1.00 21.11 ? 566 SER B OG    1 
ATOM   9545  N  N     . VAL B  1 567 ? 84.143  91.464  80.507  1.00 21.87 ? 567 VAL B N     1 
ATOM   9546  C  CA    . VAL B  1 567 ? 84.595  92.607  79.712  1.00 21.87 ? 567 VAL B CA    1 
ATOM   9547  C  C     . VAL B  1 567 ? 85.192  92.135  78.393  1.00 21.87 ? 567 VAL B C     1 
ATOM   9548  O  O     . VAL B  1 567 ? 84.820  92.616  77.314  1.00 21.87 ? 567 VAL B O     1 
ATOM   9549  C  CB    . VAL B  1 567 ? 85.610  93.446  80.509  1.00 21.87 ? 567 VAL B CB    1 
ATOM   9550  C  CG1   . VAL B  1 567 ? 86.334  94.420  79.605  1.00 21.87 ? 567 VAL B CG1   1 
ATOM   9551  C  CG2   . VAL B  1 567 ? 84.928  94.182  81.620  1.00 21.87 ? 567 VAL B CG2   1 
ATOM   9552  N  N     . VAL B  1 568 ? 86.112  91.168  78.467  1.00 24.21 ? 568 VAL B N     1 
ATOM   9553  C  CA    . VAL B  1 568 ? 86.751  90.619  77.274  1.00 24.21 ? 568 VAL B CA    1 
ATOM   9554  C  C     . VAL B  1 568 ? 85.735  89.887  76.410  1.00 24.21 ? 568 VAL B C     1 
ATOM   9555  O  O     . VAL B  1 568 ? 85.752  90.003  75.177  1.00 24.21 ? 568 VAL B O     1 
ATOM   9556  C  CB    . VAL B  1 568 ? 87.919  89.701  77.678  1.00 24.21 ? 568 VAL B CB    1 
ATOM   9557  C  CG1   . VAL B  1 568 ? 88.689  89.244  76.460  1.00 24.21 ? 568 VAL B CG1   1 
ATOM   9558  C  CG2   . VAL B  1 568 ? 88.835  90.415  78.645  1.00 24.21 ? 568 VAL B CG2   1 
ATOM   9559  N  N     . THR B  1 569 ? 84.801  89.166  77.040  1.00 25.20 ? 569 THR B N     1 
ATOM   9560  C  CA    . THR B  1 569 ? 83.806  88.428  76.264  1.00 25.20 ? 569 THR B CA    1 
ATOM   9561  C  C     . THR B  1 569 ? 82.816  89.371  75.577  1.00 25.20 ? 569 THR B C     1 
ATOM   9562  O  O     . THR B  1 569 ? 82.473  89.171  74.404  1.00 25.20 ? 569 THR B O     1 
ATOM   9563  C  CB    . THR B  1 569 ? 83.084  87.431  77.164  1.00 25.20 ? 569 THR B CB    1 
ATOM   9564  O  OG1   . THR B  1 569 ? 84.048  86.562  77.765  1.00 25.20 ? 569 THR B OG1   1 
ATOM   9565  C  CG2   . THR B  1 569 ? 82.128  86.582  76.359  1.00 25.20 ? 569 THR B CG2   1 
ATOM   9566  N  N     . ASN B  1 570 ? 82.398  90.439  76.265  1.00 27.42 ? 570 ASN B N     1 
ATOM   9567  C  CA    . ASN B  1 570 ? 81.488  91.409  75.668  1.00 27.42 ? 570 ASN B CA    1 
ATOM   9568  C  C     . ASN B  1 570 ? 82.159  92.195  74.552  1.00 27.42 ? 570 ASN B C     1 
ATOM   9569  O  O     . ASN B  1 570 ? 81.528  92.484  73.533  1.00 27.42 ? 570 ASN B O     1 
ATOM   9570  C  CB    . ASN B  1 570 ? 80.959  92.360  76.736  1.00 27.42 ? 570 ASN B CB    1 
ATOM   9571  C  CG    . ASN B  1 570 ? 79.713  91.842  77.403  1.00 27.42 ? 570 ASN B CG    1 
ATOM   9572  O  OD1   . ASN B  1 570 ? 79.137  90.847  76.971  1.00 27.42 ? 570 ASN B OD1   1 
ATOM   9573  N  ND2   . ASN B  1 570 ? 79.283  92.514  78.462  1.00 27.42 ? 570 ASN B ND2   1 
ATOM   9574  N  N     . CYS B  1 571 ? 83.443  92.528  74.703  1.00 29.32 ? 571 CYS B N     1 
ATOM   9575  C  CA    . CYS B  1 571 ? 84.117  93.253  73.631  1.00 29.32 ? 571 CYS B CA    1 
ATOM   9576  C  C     . CYS B  1 571 ? 84.407  92.353  72.435  1.00 29.32 ? 571 CYS B C     1 
ATOM   9577  O  O     . CYS B  1 571 ? 84.339  92.812  71.287  1.00 29.32 ? 571 CYS B O     1 
ATOM   9578  C  CB    . CYS B  1 571 ? 85.393  93.898  74.159  1.00 29.32 ? 571 CYS B CB    1 
ATOM   9579  S  SG    . CYS B  1 571 ? 85.060  95.351  75.175  1.00 29.32 ? 571 CYS B SG    1 
ATOM   9580  N  N     . ALA B  1 572 ? 84.687  91.068  72.670  1.00 29.69 ? 572 ALA B N     1 
ATOM   9581  C  CA    . ALA B  1 572 ? 84.837  90.140  71.558  1.00 29.69 ? 572 ALA B CA    1 
ATOM   9582  C  C     . ALA B  1 572 ? 83.516  89.853  70.861  1.00 29.69 ? 572 ALA B C     1 
ATOM   9583  O  O     . ALA B  1 572 ? 83.520  89.502  69.679  1.00 29.69 ? 572 ALA B O     1 
ATOM   9584  C  CB    . ALA B  1 572 ? 85.461  88.836  72.042  1.00 29.69 ? 572 ALA B CB    1 
ATOM   9585  N  N     . LEU B  1 573 ? 82.390  89.986  71.561  1.00 31.68 ? 573 LEU B N     1 
ATOM   9586  C  CA    . LEU B  1 573 ? 81.094  89.899  70.903  1.00 31.68 ? 573 LEU B CA    1 
ATOM   9587  C  C     . LEU B  1 573 ? 80.689  91.195  70.216  1.00 31.68 ? 573 LEU B C     1 
ATOM   9588  O  O     . LEU B  1 573 ? 79.871  91.159  69.291  1.00 31.68 ? 573 LEU B O     1 
ATOM   9589  C  CB    . LEU B  1 573 ? 80.012  89.504  71.907  1.00 31.68 ? 573 LEU B CB    1 
ATOM   9590  C  CG    . LEU B  1 573 ? 80.033  88.039  72.326  1.00 31.68 ? 573 LEU B CG    1 
ATOM   9591  C  CD1   . LEU B  1 573 ? 79.041  87.812  73.435  1.00 31.68 ? 573 LEU B CD1   1 
ATOM   9592  C  CD2   . LEU B  1 573 ? 79.723  87.153  71.142  1.00 31.68 ? 573 LEU B CD2   1 
ATOM   9593  N  N     . ILE B  1 574 ? 81.221  92.333  70.662  1.00 34.13 ? 574 ILE B N     1 
ATOM   9594  C  CA    . ILE B  1 574 ? 81.030  93.587  69.938  1.00 34.13 ? 574 ILE B CA    1 
ATOM   9595  C  C     . ILE B  1 574 ? 81.785  93.547  68.617  1.00 34.13 ? 574 ILE B C     1 
ATOM   9596  O  O     . ILE B  1 574 ? 81.239  93.877  67.557  1.00 34.13 ? 574 ILE B O     1 
ATOM   9597  C  CB    . ILE B  1 574 ? 81.474  94.779  70.804  1.00 34.13 ? 574 ILE B CB    1 
ATOM   9598  C  CG1   . ILE B  1 574 ? 80.452  95.059  71.896  1.00 34.13 ? 574 ILE B CG1   1 
ATOM   9599  C  CG2   . ILE B  1 574 ? 81.666  96.031  69.971  1.00 34.13 ? 574 ILE B CG2   1 
ATOM   9600  C  CD1   . ILE B  1 574 ? 80.991  95.939  72.981  1.00 34.13 ? 574 ILE B CD1   1 
ATOM   9601  N  N     . GLY B  1 575 ? 83.035  93.093  68.652  1.00 39.30 ? 575 GLY B N     1 
ATOM   9602  C  CA    . GLY B  1 575 ? 83.856  93.048  67.455  1.00 39.30 ? 575 GLY B CA    1 
ATOM   9603  C  C     . GLY B  1 575 ? 83.587  91.899  66.499  1.00 39.30 ? 575 GLY B C     1 
ATOM   9604  O  O     . GLY B  1 575 ? 84.452  91.550  65.692  1.00 39.30 ? 575 GLY B O     1 
ATOM   9605  N  N     . MET B  1 576 ? 82.399  91.300  66.575  1.00 42.48 ? 576 MET B N     1 
ATOM   9606  C  CA    . MET B  1 576 ? 81.973  90.272  65.636  1.00 42.48 ? 576 MET B CA    1 
ATOM   9607  C  C     . MET B  1 576 ? 80.579  90.506  65.085  1.00 42.48 ? 576 MET B C     1 
ATOM   9608  O  O     . MET B  1 576 ? 80.154  89.755  64.203  1.00 42.48 ? 576 MET B O     1 
ATOM   9609  C  CB    . MET B  1 576 ? 82.007  88.888  66.295  1.00 42.48 ? 576 MET B CB    1 
ATOM   9610  C  CG    . MET B  1 576 ? 83.390  88.346  66.539  1.00 42.48 ? 576 MET B CG    1 
ATOM   9611  S  SD    . MET B  1 576 ? 83.323  86.686  67.218  1.00 42.48 ? 576 MET B SD    1 
ATOM   9612  C  CE    . MET B  1 576 ? 85.059  86.399  67.513  1.00 42.48 ? 576 MET B CE    1 
ATOM   9613  N  N     . SER B  1 577 ? 79.853  91.502  65.577  1.00 45.82 ? 577 SER B N     1 
ATOM   9614  C  CA    . SER B  1 577 ? 78.498  91.746  65.126  1.00 45.82 ? 577 SER B CA    1 
ATOM   9615  C  C     . SER B  1 577 ? 78.511  92.404  63.747  1.00 45.82 ? 577 SER B C     1 
ATOM   9616  O  O     . SER B  1 577 ? 79.496  93.041  63.365  1.00 45.82 ? 577 SER B O     1 
ATOM   9617  C  CB    . SER B  1 577 ? 77.775  92.642  66.125  1.00 45.82 ? 577 SER B CB    1 
ATOM   9618  O  OG    . SER B  1 577 ? 78.602  93.724  66.514  1.00 45.82 ? 577 SER B OG    1 
ATOM   9619  N  N     . PRO B  1 578 ? 77.430  92.262  62.971  1.00 52.31 ? 578 PRO B N     1 
ATOM   9620  C  CA    . PRO B  1 578 ? 77.344  93.001  61.702  1.00 52.31 ? 578 PRO B CA    1 
ATOM   9621  C  C     . PRO B  1 578 ? 77.088  94.489  61.872  1.00 52.31 ? 578 PRO B C     1 
ATOM   9622  O  O     . PRO B  1 578 ? 77.175  95.225  60.882  1.00 52.31 ? 578 PRO B O     1 
ATOM   9623  C  CB    . PRO B  1 578 ? 76.178  92.319  60.977  1.00 52.31 ? 578 PRO B CB    1 
ATOM   9624  C  CG    . PRO B  1 578 ? 75.371  91.698  62.060  1.00 52.31 ? 578 PRO B CG    1 
ATOM   9625  C  CD    . PRO B  1 578 ? 76.360  91.256  63.087  1.00 52.31 ? 578 PRO B CD    1 
ATOM   9626  N  N     . GLN B  1 579 ? 76.779  94.957  63.082  1.00 54.46 ? 579 GLN B N     1 
ATOM   9627  C  CA    . GLN B  1 579 ? 76.555  96.381  63.297  1.00 54.46 ? 579 GLN B CA    1 
ATOM   9628  C  C     . GLN B  1 579 ? 77.864  97.154  63.368  1.00 54.46 ? 579 GLN B C     1 
ATOM   9629  O  O     . GLN B  1 579 ? 77.997  98.212  62.744  1.00 54.46 ? 579 GLN B O     1 
ATOM   9630  C  CB    . GLN B  1 579 ? 75.754  96.599  64.579  1.00 54.46 ? 579 GLN B CB    1 
ATOM   9631  C  CG    . GLN B  1 579 ? 74.358  96.016  64.550  1.00 54.46 ? 579 GLN B CG    1 
ATOM   9632  C  CD    . GLN B  1 579 ? 73.478  96.692  63.526  1.00 54.46 ? 579 GLN B CD    1 
ATOM   9633  O  OE1   . GLN B  1 579 ? 73.570  97.902  63.315  1.00 54.46 ? 579 GLN B OE1   1 
ATOM   9634  N  NE2   . GLN B  1 579 ? 72.611  95.917  62.885  1.00 54.46 ? 579 GLN B NE2   1 
ATOM   9635  N  N     . VAL B  1 580 ? 78.837  96.647  64.124  1.00 50.11 ? 580 VAL B N     1 
ATOM   9636  C  CA    . VAL B  1 580 ? 80.087  97.373  64.299  1.00 50.11 ? 580 VAL B CA    1 
ATOM   9637  C  C     . VAL B  1 580 ? 80.978  97.201  63.071  1.00 50.11 ? 580 VAL B C     1 
ATOM   9638  O  O     . VAL B  1 580 ? 81.741  98.108  62.718  1.00 50.11 ? 580 VAL B O     1 
ATOM   9639  C  CB    . VAL B  1 580 ? 80.775  96.904  65.595  1.00 50.11 ? 580 VAL B CB    1 
ATOM   9640  C  CG1   . VAL B  1 580 ? 82.019  97.719  65.901  1.00 50.11 ? 580 VAL B CG1   1 
ATOM   9641  C  CG2   . VAL B  1 580 ? 79.801  96.964  66.757  1.00 50.11 ? 580 VAL B CG2   1 
ATOM   9642  N  N     . ASN B  1 581 ? 80.860  96.070  62.370  1.00 52.86 ? 581 ASN B N     1 
ATOM   9643  C  CA    . ASN B  1 581 ? 81.661  95.837  61.174  1.00 52.86 ? 581 ASN B CA    1 
ATOM   9644  C  C     . ASN B  1 581 ? 81.237  96.708  59.998  1.00 52.86 ? 581 ASN B C     1 
ATOM   9645  O  O     . ASN B  1 581 ? 82.006  96.849  59.042  1.00 52.86 ? 581 ASN B O     1 
ATOM   9646  C  CB    . ASN B  1 581 ? 81.593  94.366  60.773  1.00 52.86 ? 581 ASN B CB    1 
ATOM   9647  C  CG    . ASN B  1 581 ? 82.532  93.505  61.578  1.00 52.86 ? 581 ASN B CG    1 
ATOM   9648  O  OD1   . ASN B  1 581 ? 83.671  93.274  61.182  1.00 52.86 ? 581 ASN B OD1   1 
ATOM   9649  N  ND2   . ASN B  1 581 ? 82.061  93.028  62.721  1.00 52.86 ? 581 ASN B ND2   1 
ATOM   9650  N  N     . ALA B  1 582 ? 80.038  97.293  60.040  1.00 55.45 ? 582 ALA B N     1 
ATOM   9651  C  CA    . ALA B  1 582 ? 79.637  98.241  59.008  1.00 55.45 ? 582 ALA B CA    1 
ATOM   9652  C  C     . ALA B  1 582 ? 80.351  99.578  59.146  1.00 55.45 ? 582 ALA B C     1 
ATOM   9653  O  O     . ALA B  1 582 ? 80.372  100.357 58.188  1.00 55.45 ? 582 ALA B O     1 
ATOM   9654  C  CB    . ALA B  1 582 ? 78.124  98.454  59.044  1.00 55.45 ? 582 ALA B CB    1 
ATOM   9655  N  N     . VAL B  1 583 ? 80.932  99.861  60.313  1.00 52.90 ? 583 VAL B N     1 
ATOM   9656  C  CA    . VAL B  1 583 ? 81.699  101.089 60.489  1.00 52.90 ? 583 VAL B CA    1 
ATOM   9657  C  C     . VAL B  1 583 ? 83.044  100.979 59.782  1.00 52.90 ? 583 VAL B C     1 
ATOM   9658  O  O     . VAL B  1 583 ? 83.488  101.918 59.109  1.00 52.90 ? 583 VAL B O     1 
ATOM   9659  C  CB    . VAL B  1 583 ? 81.861  101.392 61.990  1.00 52.90 ? 583 VAL B CB    1 
ATOM   9660  C  CG1   . VAL B  1 583 ? 82.744  102.605 62.214  1.00 52.90 ? 583 VAL B CG1   1 
ATOM   9661  C  CG2   . VAL B  1 583 ? 80.507  101.596 62.628  1.00 52.90 ? 583 VAL B CG2   1 
ATOM   9662  N  N     . PHE B  1 584 ? 83.703  99.825  59.903  1.00 54.56 ? 584 PHE B N     1 
ATOM   9663  C  CA    . PHE B  1 584 ? 85.003  99.563  59.287  1.00 54.56 ? 584 PHE B CA    1 
ATOM   9664  C  C     . PHE B  1 584 ? 84.836  98.399  58.316  1.00 54.56 ? 584 PHE B C     1 
ATOM   9665  O  O     . PHE B  1 584 ? 85.144  97.248  58.657  1.00 54.56 ? 584 PHE B O     1 
ATOM   9666  C  CB    . PHE B  1 584 ? 86.071  99.244  60.334  1.00 54.56 ? 584 PHE B CB    1 
ATOM   9667  C  CG    . PHE B  1 584 ? 85.968  100.065 61.588  1.00 54.56 ? 584 PHE B CG    1 
ATOM   9668  C  CD1   . PHE B  1 584 ? 86.575  101.305 61.670  1.00 54.56 ? 584 PHE B CD1   1 
ATOM   9669  C  CD2   . PHE B  1 584 ? 85.287  99.583  62.697  1.00 54.56 ? 584 PHE B CD2   1 
ATOM   9670  C  CE1   . PHE B  1 584 ? 86.489  102.060 62.826  1.00 54.56 ? 584 PHE B CE1   1 
ATOM   9671  C  CE2   . PHE B  1 584 ? 85.195  100.333 63.853  1.00 54.56 ? 584 PHE B CE2   1 
ATOM   9672  C  CZ    . PHE B  1 584 ? 85.797  101.570 63.918  1.00 54.56 ? 584 PHE B CZ    1 
ATOM   9673  N  N     . PRO B  1 585 ? 84.349  98.656  57.099  1.00 57.31 ? 585 PRO B N     1 
ATOM   9674  C  CA    . PRO B  1 585 ? 84.058  97.548  56.179  1.00 57.31 ? 585 PRO B CA    1 
ATOM   9675  C  C     . PRO B  1 585 ? 85.301  96.971  55.521  1.00 57.31 ? 585 PRO B C     1 
ATOM   9676  O  O     . PRO B  1 585 ? 85.382  95.759  55.297  1.00 57.31 ? 585 PRO B O     1 
ATOM   9677  C  CB    . PRO B  1 585 ? 83.127  98.188  55.137  1.00 57.31 ? 585 PRO B CB    1 
ATOM   9678  C  CG    . PRO B  1 585 ? 82.839  99.587  55.635  1.00 57.31 ? 585 PRO B CG    1 
ATOM   9679  C  CD    . PRO B  1 585 ? 83.984  99.952  56.511  1.00 57.31 ? 585 PRO B CD    1 
ATOM   9680  N  N     . GLU B  1 586 ? 86.275  97.823  55.208  1.00 58.05 ? 586 GLU B N     1 
ATOM   9681  C  CA    . GLU B  1 586 ? 87.452  97.383  54.469  1.00 58.05 ? 586 GLU B CA    1 
ATOM   9682  C  C     . GLU B  1 586 ? 88.652  97.127  55.371  1.00 58.05 ? 586 GLU B C     1 
ATOM   9683  O  O     . GLU B  1 586 ? 89.420  96.190  55.126  1.00 58.05 ? 586 GLU B O     1 
ATOM   9684  C  CB    . GLU B  1 586 ? 87.819  98.419  53.403  1.00 58.05 ? 586 GLU B CB    1 
ATOM   9685  N  N     . SER B  1 587 ? 88.829  97.935  56.411  1.00 55.42 ? 587 SER B N     1 
ATOM   9686  C  CA    . SER B  1 587 ? 89.991  97.856  57.294  1.00 55.42 ? 587 SER B CA    1 
ATOM   9687  C  C     . SER B  1 587 ? 89.564  97.181  58.595  1.00 55.42 ? 587 SER B C     1 
ATOM   9688  O  O     . SER B  1 587 ? 89.082  97.833  59.521  1.00 55.42 ? 587 SER B O     1 
ATOM   9689  C  CB    . SER B  1 587 ? 90.569  99.241  57.553  1.00 55.42 ? 587 SER B CB    1 
ATOM   9690  O  OG    . SER B  1 587 ? 89.698  100.006 58.367  1.00 55.42 ? 587 SER B OG    1 
ATOM   9691  N  N     . LYS B  1 588 ? 89.754  95.863  58.660  1.00 51.38 ? 588 LYS B N     1 
ATOM   9692  C  CA    . LYS B  1 588 ? 89.469  95.091  59.860  1.00 51.38 ? 588 LYS B CA    1 
ATOM   9693  C  C     . LYS B  1 588 ? 90.648  95.048  60.823  1.00 51.38 ? 588 LYS B C     1 
ATOM   9694  O  O     . LYS B  1 588 ? 90.619  94.280  61.790  1.00 51.38 ? 588 LYS B O     1 
ATOM   9695  C  CB    . LYS B  1 588 ? 89.052  93.667  59.489  1.00 51.38 ? 588 LYS B CB    1 
ATOM   9696  C  CG    . LYS B  1 588 ? 87.896  93.593  58.514  1.00 51.38 ? 588 LYS B CG    1 
ATOM   9697  C  CD    . LYS B  1 588 ? 86.659  94.251  59.086  1.00 51.38 ? 588 LYS B CD    1 
ATOM   9698  C  CE    . LYS B  1 588 ? 85.442  93.953  58.234  1.00 51.38 ? 588 LYS B CE    1 
ATOM   9699  N  NZ    . LYS B  1 588 ? 84.274  94.770  58.653  1.00 51.38 ? 588 LYS B NZ    1 
ATOM   9700  N  N     . ALA B  1 589 ? 91.687  95.844  60.578  1.00 50.71 ? 589 ALA B N     1 
ATOM   9701  C  CA    . ALA B  1 589 ? 92.814  95.947  61.489  1.00 50.71 ? 589 ALA B CA    1 
ATOM   9702  C  C     . ALA B  1 589 ? 92.717  97.145  62.417  1.00 50.71 ? 589 ALA B C     1 
ATOM   9703  O  O     . ALA B  1 589 ? 93.427  97.183  63.427  1.00 50.71 ? 589 ALA B O     1 
ATOM   9704  C  CB    . ALA B  1 589 ? 94.131  96.017  60.704  1.00 50.71 ? 589 ALA B CB    1 
ATOM   9705  N  N     . ASP B  1 590 ? 91.866  98.118  62.105  1.00 47.73 ? 590 ASP B N     1 
ATOM   9706  C  CA    . ASP B  1 590 ? 91.609  99.235  63.002  1.00 47.73 ? 590 ASP B CA    1 
ATOM   9707  C  C     . ASP B  1 590 ? 90.431  98.943  63.919  1.00 47.73 ? 590 ASP B C     1 
ATOM   9708  O  O     . ASP B  1 590 ? 90.345  99.508  65.017  1.00 47.73 ? 590 ASP B O     1 
ATOM   9709  C  CB    . ASP B  1 590 ? 91.347  100.504 62.183  1.00 47.73 ? 590 ASP B CB    1 
ATOM   9710  C  CG    . ASP B  1 590 ? 91.534  101.782 62.986  1.00 47.73 ? 590 ASP B CG    1 
ATOM   9711  O  OD1   . ASP B  1 590 ? 91.919  101.713 64.170  1.00 47.73 ? 590 ASP B OD1   1 
ATOM   9712  O  OD2   . ASP B  1 590 ? 91.296  102.869 62.419  1.00 47.73 ? 590 ASP B OD2   1 
ATOM   9713  N  N     . LEU B  1 591 ? 89.537  98.046  63.491  1.00 44.14 ? 591 LEU B N     1 
ATOM   9714  C  CA    . LEU B  1 591 ? 88.412  97.636  64.325  1.00 44.14 ? 591 LEU B CA    1 
ATOM   9715  C  C     . LEU B  1 591 ? 88.886  96.882  65.558  1.00 44.14 ? 591 LEU B C     1 
ATOM   9716  O  O     . LEU B  1 591 ? 88.398  97.126  66.668  1.00 44.14 ? 591 LEU B O     1 
ATOM   9717  C  CB    . LEU B  1 591 ? 87.450  96.774  63.506  1.00 44.14 ? 591 LEU B CB    1 
ATOM   9718  C  CG    . LEU B  1 591 ? 86.519  95.827  64.260  1.00 44.14 ? 591 LEU B CG    1 
ATOM   9719  C  CD1   . LEU B  1 591 ? 85.419  96.602  64.944  1.00 44.14 ? 591 LEU B CD1   1 
ATOM   9720  C  CD2   . LEU B  1 591 ? 85.937  94.788  63.326  1.00 44.14 ? 591 LEU B CD2   1 
ATOM   9721  N  N     . ILE B  1 592 ? 89.853  95.977  65.381  1.00 39.36 ? 592 ILE B N     1 
ATOM   9722  C  CA    . ILE B  1 592 ? 90.394  95.214  66.501  1.00 39.36 ? 592 ILE B CA    1 
ATOM   9723  C  C     . ILE B  1 592 ? 91.141  96.129  67.461  1.00 39.36 ? 592 ILE B C     1 
ATOM   9724  O  O     . ILE B  1 592 ? 91.035  95.980  68.682  1.00 39.36 ? 592 ILE B O     1 
ATOM   9725  C  CB    . ILE B  1 592 ? 91.292  94.081  65.977  1.00 39.36 ? 592 ILE B CB    1 
ATOM   9726  C  CG1   . ILE B  1 592 ? 90.528  93.243  64.957  1.00 39.36 ? 592 ILE B CG1   1 
ATOM   9727  C  CG2   . ILE B  1 592 ? 91.777  93.204  67.113  1.00 39.36 ? 592 ILE B CG2   1 
ATOM   9728  C  CD1   . ILE B  1 592 ? 91.360  92.165  64.322  1.00 39.36 ? 592 ILE B CD1   1 
ATOM   9729  N  N     . LEU B  1 593 ? 91.857  97.122  66.929  1.00 38.35 ? 593 LEU B N     1 
ATOM   9730  C  CA    . LEU B  1 593 ? 92.583  98.056  67.784  1.00 38.35 ? 593 LEU B CA    1 
ATOM   9731  C  C     . LEU B  1 593 ? 91.634  98.953  68.569  1.00 38.35 ? 593 LEU B C     1 
ATOM   9732  O  O     . LEU B  1 593 ? 91.865  99.216  69.753  1.00 38.35 ? 593 LEU B O     1 
ATOM   9733  C  CB    . LEU B  1 593 ? 93.540  98.898  66.946  1.00 38.35 ? 593 LEU B CB    1 
ATOM   9734  C  CG    . LEU B  1 593 ? 94.899  98.260  66.673  1.00 38.35 ? 593 LEU B CG    1 
ATOM   9735  C  CD1   . LEU B  1 593 ? 95.747  99.181  65.822  1.00 38.35 ? 593 LEU B CD1   1 
ATOM   9736  C  CD2   . LEU B  1 593 ? 95.600  97.938  67.978  1.00 38.35 ? 593 LEU B CD2   1 
ATOM   9737  N  N     . ILE B  1 594 ? 90.542  99.398  67.941  1.00 32.99 ? 594 ILE B N     1 
ATOM   9738  C  CA    . ILE B  1 594 ? 89.578  100.240 68.644  1.00 32.99 ? 594 ILE B CA    1 
ATOM   9739  C  C     . ILE B  1 594 ? 88.815  99.436  69.694  1.00 32.99 ? 594 ILE B C     1 
ATOM   9740  O  O     . ILE B  1 594 ? 88.587  99.924  70.811  1.00 32.99 ? 594 ILE B O     1 
ATOM   9741  C  CB    . ILE B  1 594 ? 88.650  100.920 67.617  1.00 32.99 ? 594 ILE B CB    1 
ATOM   9742  C  CG1   . ILE B  1 594 ? 89.394  102.071 66.941  1.00 32.99 ? 594 ILE B CG1   1 
ATOM   9743  C  CG2   . ILE B  1 594 ? 87.368  101.438 68.251  1.00 32.99 ? 594 ILE B CG2   1 
ATOM   9744  C  CD1   . ILE B  1 594 ? 88.607  102.765 65.866  1.00 32.99 ? 594 ILE B CD1   1 
ATOM   9745  N  N     . VAL B  1 595 ? 88.474  98.179  69.390  1.00 29.87 ? 595 VAL B N     1 
ATOM   9746  C  CA    . VAL B  1 595 ? 87.774  97.333  70.355  1.00 29.87 ? 595 VAL B CA    1 
ATOM   9747  C  C     . VAL B  1 595 ? 88.685  96.983  71.530  1.00 29.87 ? 595 VAL B C     1 
ATOM   9748  O  O     . VAL B  1 595 ? 88.256  97.008  72.690  1.00 29.87 ? 595 VAL B O     1 
ATOM   9749  C  CB    . VAL B  1 595 ? 87.220  96.083  69.643  1.00 29.87 ? 595 VAL B CB    1 
ATOM   9750  C  CG1   . VAL B  1 595 ? 86.895  94.972  70.619  1.00 29.87 ? 595 VAL B CG1   1 
ATOM   9751  C  CG2   . VAL B  1 595 ? 85.979  96.445  68.854  1.00 29.87 ? 595 VAL B CG2   1 
ATOM   9752  N  N     . VAL B  1 596 ? 89.968  96.724  71.262  1.00 26.95 ? 596 VAL B N     1 
ATOM   9753  C  CA    . VAL B  1 596 ? 90.920  96.432  72.331  1.00 26.95 ? 596 VAL B CA    1 
ATOM   9754  C  C     . VAL B  1 596 ? 91.196  97.676  73.175  1.00 26.95 ? 596 VAL B C     1 
ATOM   9755  O  O     . VAL B  1 596 ? 91.341  97.581  74.401  1.00 26.95 ? 596 VAL B O     1 
ATOM   9756  C  CB    . VAL B  1 596 ? 92.194  95.822  71.710  1.00 26.95 ? 596 VAL B CB    1 
ATOM   9757  C  CG1   . VAL B  1 596 ? 93.408  95.951  72.613  1.00 26.95 ? 596 VAL B CG1   1 
ATOM   9758  C  CG2   . VAL B  1 596 ? 91.951  94.363  71.387  1.00 26.95 ? 596 VAL B CG2   1 
ATOM   9759  N  N     . ALA B  1 597 ? 91.201  98.863  72.559  1.00 24.62 ? 597 ALA B N     1 
ATOM   9760  C  CA    . ALA B  1 597 ? 91.369  100.093 73.326  1.00 24.62 ? 597 ALA B CA    1 
ATOM   9761  C  C     . ALA B  1 597 ? 90.159  100.371 74.210  1.00 24.62 ? 597 ALA B C     1 
ATOM   9762  O  O     . ALA B  1 597 ? 90.314  100.800 75.359  1.00 24.62 ? 597 ALA B O     1 
ATOM   9763  C  CB    . ALA B  1 597 ? 91.624  101.267 72.384  1.00 24.62 ? 597 ALA B CB    1 
ATOM   9764  N  N     . VAL B  1 598 ? 88.952  100.104 73.704  1.00 24.34 ? 598 VAL B N     1 
ATOM   9765  C  CA    . VAL B  1 598 ? 87.741  100.257 74.509  1.00 24.34 ? 598 VAL B CA    1 
ATOM   9766  C  C     . VAL B  1 598 ? 87.720  99.235  75.643  1.00 24.34 ? 598 VAL B C     1 
ATOM   9767  O  O     . VAL B  1 598 ? 87.338  99.551  76.776  1.00 24.34 ? 598 VAL B O     1 
ATOM   9768  C  CB    . VAL B  1 598 ? 86.499  100.157 73.599  1.00 24.34 ? 598 VAL B CB    1 
ATOM   9769  C  CG1   . VAL B  1 598 ? 85.223  99.898  74.386  1.00 24.34 ? 598 VAL B CG1   1 
ATOM   9770  C  CG2   . VAL B  1 598 ? 86.349  101.427 72.781  1.00 24.34 ? 598 VAL B CG2   1 
ATOM   9771  N  N     . GLU B  1 599 ? 88.208  98.021  75.375  1.00 24.70 ? 599 GLU B N     1 
ATOM   9772  C  CA    . GLU B  1 599 ? 88.269  96.971  76.389  1.00 24.70 ? 599 GLU B CA    1 
ATOM   9773  C  C     . GLU B  1 599 ? 89.261  97.307  77.498  1.00 24.70 ? 599 GLU B C     1 
ATOM   9774  O  O     . GLU B  1 599 ? 88.959  97.127  78.684  1.00 24.70 ? 599 GLU B O     1 
ATOM   9775  C  CB    . GLU B  1 599 ? 88.629  95.650  75.712  1.00 24.70 ? 599 GLU B CB    1 
ATOM   9776  C  CG    . GLU B  1 599 ? 88.679  94.449  76.615  1.00 24.70 ? 599 GLU B CG    1 
ATOM   9777  C  CD    . GLU B  1 599 ? 90.093  94.058  76.959  1.00 24.70 ? 599 GLU B CD    1 
ATOM   9778  O  OE1   . GLU B  1 599 ? 90.997  94.343  76.150  1.00 24.70 ? 599 GLU B OE1   1 
ATOM   9779  O  OE2   . GLU B  1 599 ? 90.304  93.454  78.029  1.00 24.70 ? 599 GLU B OE2   1 
ATOM   9780  N  N     . HIS B  1 600 ? 90.438  97.821  77.136  1.00 23.36 ? 600 HIS B N     1 
ATOM   9781  C  CA    . HIS B  1 600 ? 91.415  98.211  78.145  1.00 23.36 ? 600 HIS B CA    1 
ATOM   9782  C  C     . HIS B  1 600 ? 90.974  99.453  78.909  1.00 23.36 ? 600 HIS B C     1 
ATOM   9783  O  O     . HIS B  1 600 ? 91.239  99.559  80.111  1.00 23.36 ? 600 HIS B O     1 
ATOM   9784  C  CB    . HIS B  1 600 ? 92.778  98.441  77.500  1.00 23.36 ? 600 HIS B CB    1 
ATOM   9785  C  CG    . HIS B  1 600 ? 93.521  97.179  77.196  1.00 23.36 ? 600 HIS B CG    1 
ATOM   9786  N  ND1   . HIS B  1 600 ? 94.194  96.979  76.011  1.00 23.36 ? 600 HIS B ND1   1 
ATOM   9787  C  CD2   . HIS B  1 600 ? 93.699  96.053  77.925  1.00 23.36 ? 600 HIS B CD2   1 
ATOM   9788  C  CE1   . HIS B  1 600 ? 94.754  95.783  76.022  1.00 23.36 ? 600 HIS B CE1   1 
ATOM   9789  N  NE2   . HIS B  1 600 ? 94.469  95.201  77.172  1.00 23.36 ? 600 HIS B NE2   1 
ATOM   9790  N  N     . ALA B  1 601 ? 90.279  100.384 78.246  1.00 22.50 ? 601 ALA B N     1 
ATOM   9791  C  CA    . ALA B  1 601 ? 89.741  101.542 78.950  1.00 22.50 ? 601 ALA B CA    1 
ATOM   9792  C  C     . ALA B  1 601 ? 88.638  101.137 79.916  1.00 22.50 ? 601 ALA B C     1 
ATOM   9793  O  O     . ALA B  1 601 ? 88.528  101.702 81.009  1.00 22.50 ? 601 ALA B O     1 
ATOM   9794  C  CB    . ALA B  1 601 ? 89.223  102.573 77.950  1.00 22.50 ? 601 ALA B CB    1 
ATOM   9795  N  N     . LEU B  1 602 ? 87.839  100.132 79.550  1.00 23.36 ? 602 LEU B N     1 
ATOM   9796  C  CA    . LEU B  1 602 ? 86.791  99.655  80.445  1.00 23.36 ? 602 LEU B CA    1 
ATOM   9797  C  C     . LEU B  1 602 ? 87.376  98.895  81.628  1.00 23.36 ? 602 LEU B C     1 
ATOM   9798  O  O     . LEU B  1 602 ? 86.878  99.021  82.750  1.00 23.36 ? 602 LEU B O     1 
ATOM   9799  C  CB    . LEU B  1 602 ? 85.802  98.783  79.679  1.00 23.36 ? 602 LEU B CB    1 
ATOM   9800  C  CG    . LEU B  1 602 ? 84.709  99.573  78.964  1.00 23.36 ? 602 LEU B CG    1 
ATOM   9801  C  CD1   . LEU B  1 602 ? 83.855  98.660  78.110  1.00 23.36 ? 602 LEU B CD1   1 
ATOM   9802  C  CD2   . LEU B  1 602 ? 83.860  100.314 79.975  1.00 23.36 ? 602 LEU B CD2   1 
ATOM   9803  N  N     . LEU B  1 603 ? 88.446  98.125  81.404  1.00 22.20 ? 603 LEU B N     1 
ATOM   9804  C  CA    . LEU B  1 603 ? 89.117  97.454  82.516  1.00 22.20 ? 603 LEU B CA    1 
ATOM   9805  C  C     . LEU B  1 603 ? 89.775  98.455  83.459  1.00 22.20 ? 603 LEU B C     1 
ATOM   9806  O  O     . LEU B  1 603 ? 89.712  98.295  84.686  1.00 22.20 ? 603 LEU B O     1 
ATOM   9807  C  CB    . LEU B  1 603 ? 90.156  96.466  81.994  1.00 22.20 ? 603 LEU B CB    1 
ATOM   9808  C  CG    . LEU B  1 603 ? 89.665  95.099  81.529  1.00 22.20 ? 603 LEU B CG    1 
ATOM   9809  C  CD1   . LEU B  1 603 ? 90.846  94.210  81.215  1.00 22.20 ? 603 LEU B CD1   1 
ATOM   9810  C  CD2   . LEU B  1 603 ? 88.790  94.466  82.585  1.00 22.20 ? 603 LEU B CD2   1 
ATOM   9811  N  N     . ALA B  1 604 ? 90.389  99.507  82.907  1.00 22.15 ? 604 ALA B N     1 
ATOM   9812  C  CA    . ALA B  1 604 ? 91.016  100.524 83.742  1.00 22.15 ? 604 ALA B CA    1 
ATOM   9813  C  C     . ALA B  1 604 ? 89.979  101.318 84.524  1.00 22.15 ? 604 ALA B C     1 
ATOM   9814  O  O     . ALA B  1 604 ? 90.178  101.600 85.710  1.00 22.15 ? 604 ALA B O     1 
ATOM   9815  C  CB    . ALA B  1 604 ? 91.869  101.456 82.885  1.00 22.15 ? 604 ALA B CB    1 
ATOM   9816  N  N     . LEU B  1 605 ? 88.854  101.661 83.888  1.00 23.86 ? 605 LEU B N     1 
ATOM   9817  C  CA    . LEU B  1 605 ? 87.801  102.390 84.584  1.00 23.86 ? 605 LEU B CA    1 
ATOM   9818  C  C     . LEU B  1 605 ? 87.109  101.517 85.624  1.00 23.86 ? 605 LEU B C     1 
ATOM   9819  O  O     . LEU B  1 605 ? 86.711  102.016 86.681  1.00 23.86 ? 605 LEU B O     1 
ATOM   9820  C  CB    . LEU B  1 605 ? 86.796  102.936 83.570  1.00 23.86 ? 605 LEU B CB    1 
ATOM   9821  C  CG    . LEU B  1 605 ? 85.576  103.700 84.083  1.00 23.86 ? 605 LEU B CG    1 
ATOM   9822  C  CD1   . LEU B  1 605 ? 86.004  104.867 84.952  1.00 23.86 ? 605 LEU B CD1   1 
ATOM   9823  C  CD2   . LEU B  1 605 ? 84.732  104.186 82.920  1.00 23.86 ? 605 LEU B CD2   1 
ATOM   9824  N  N     . LYS B  1 606 ? 87.007  100.211 85.370  1.00 23.44 ? 606 LYS B N     1 
ATOM   9825  C  CA    . LYS B  1 606 ? 86.458  99.281  86.349  1.00 23.44 ? 606 LYS B CA    1 
ATOM   9826  C  C     . LYS B  1 606 ? 87.363  99.142  87.569  1.00 23.44 ? 606 LYS B C     1 
ATOM   9827  O  O     . LYS B  1 606 ? 86.878  99.152  88.706  1.00 23.44 ? 606 LYS B O     1 
ATOM   9828  C  CB    . LYS B  1 606 ? 86.230  97.926  85.683  1.00 23.44 ? 606 LYS B CB    1 
ATOM   9829  C  CG    . LYS B  1 606 ? 85.990  96.775  86.627  1.00 23.44 ? 606 LYS B CG    1 
ATOM   9830  C  CD    . LYS B  1 606 ? 85.775  95.497  85.850  1.00 23.44 ? 606 LYS B CD    1 
ATOM   9831  C  CE    . LYS B  1 606 ? 84.545  95.597  84.978  1.00 23.44 ? 606 LYS B CE    1 
ATOM   9832  N  NZ    . LYS B  1 606 ? 83.300  95.438  85.763  1.00 23.44 ? 606 LYS B NZ    1 
ATOM   9833  N  N     . PHE B  1 607 ? 88.678  99.039  87.359  1.00 26.42 ? 607 PHE B N     1 
ATOM   9834  C  CA    . PHE B  1 607 ? 89.587  98.964  88.499  1.00 26.42 ? 607 PHE B CA    1 
ATOM   9835  C  C     . PHE B  1 607 ? 89.676  100.292 89.244  1.00 26.42 ? 607 PHE B C     1 
ATOM   9836  O  O     . PHE B  1 607 ? 89.831  100.299 90.471  1.00 26.42 ? 607 PHE B O     1 
ATOM   9837  C  CB    . PHE B  1 607 ? 90.970  98.506  88.042  1.00 26.42 ? 607 PHE B CB    1 
ATOM   9838  C  CG    . PHE B  1 607 ? 91.051  97.033  87.747  1.00 26.42 ? 607 PHE B CG    1 
ATOM   9839  C  CD1   . PHE B  1 607 ? 90.148  96.148  88.316  1.00 26.42 ? 607 PHE B CD1   1 
ATOM   9840  C  CD2   . PHE B  1 607 ? 92.027  96.535  86.898  1.00 26.42 ? 607 PHE B CD2   1 
ATOM   9841  C  CE1   . PHE B  1 607 ? 90.217  94.795  88.046  1.00 26.42 ? 607 PHE B CE1   1 
ATOM   9842  C  CE2   . PHE B  1 607 ? 92.101  95.181  86.625  1.00 26.42 ? 607 PHE B CE2   1 
ATOM   9843  C  CZ    . PHE B  1 607 ? 91.195  94.312  87.200  1.00 26.42 ? 607 PHE B CZ    1 
ATOM   9844  N  N     . ILE B  1 608 ? 89.534  101.415 88.536  1.00 23.59 ? 608 ILE B N     1 
ATOM   9845  C  CA    . ILE B  1 608 ? 89.508  102.721 89.189  1.00 23.59 ? 608 ILE B CA    1 
ATOM   9846  C  C     . ILE B  1 608 ? 88.237  102.881 90.020  1.00 23.59 ? 608 ILE B C     1 
ATOM   9847  O  O     . ILE B  1 608 ? 88.278  103.404 91.140  1.00 23.59 ? 608 ILE B O     1 
ATOM   9848  C  CB    . ILE B  1 608 ? 89.670  103.829 88.128  1.00 23.59 ? 608 ILE B CB    1 
ATOM   9849  C  CG1   . ILE B  1 608 ? 91.147  103.999 87.774  1.00 23.59 ? 608 ILE B CG1   1 
ATOM   9850  C  CG2   . ILE B  1 608 ? 89.093  105.161 88.579  1.00 23.59 ? 608 ILE B CG2   1 
ATOM   9851  C  CD1   . ILE B  1 608 ? 91.382  104.825 86.535  1.00 23.59 ? 608 ILE B CD1   1 
ATOM   9852  N  N     . LEU B  1 609 ? 87.101  102.390 89.514  1.00 24.17 ? 609 LEU B N     1 
ATOM   9853  C  CA    . LEU B  1 609 ? 85.865  102.417 90.292  1.00 24.17 ? 609 LEU B CA    1 
ATOM   9854  C  C     . LEU B  1 609 ? 85.918  101.479 91.490  1.00 24.17 ? 609 LEU B C     1 
ATOM   9855  O  O     . LEU B  1 609 ? 85.337  101.783 92.535  1.00 24.17 ? 609 LEU B O     1 
ATOM   9856  C  CB    . LEU B  1 609 ? 84.673  102.056 89.412  1.00 24.17 ? 609 LEU B CB    1 
ATOM   9857  C  CG    . LEU B  1 609 ? 83.860  103.220 88.860  1.00 24.17 ? 609 LEU B CG    1 
ATOM   9858  C  CD1   . LEU B  1 609 ? 82.752  102.699 87.978  1.00 24.17 ? 609 LEU B CD1   1 
ATOM   9859  C  CD2   . LEU B  1 609 ? 83.292  104.042 89.997  1.00 24.17 ? 609 LEU B CD2   1 
ATOM   9860  N  N     . ALA B  1 610 ? 86.595  100.339 91.363  1.00 25.27 ? 610 ALA B N     1 
ATOM   9861  C  CA    . ALA B  1 610 ? 86.712  99.432  92.497  1.00 25.27 ? 610 ALA B CA    1 
ATOM   9862  C  C     . ALA B  1 610 ? 87.703  99.924  93.542  1.00 25.27 ? 610 ALA B C     1 
ATOM   9863  O  O     . ALA B  1 610 ? 87.548  99.596  94.723  1.00 25.27 ? 610 ALA B O     1 
ATOM   9864  C  CB    . ALA B  1 610 ? 87.118  98.038  92.021  1.00 25.27 ? 610 ALA B CB    1 
ATOM   9865  N  N     . PHE B  1 611 ? 88.708  100.701 93.141  1.00 28.39 ? 611 PHE B N     1 
ATOM   9866  C  CA    . PHE B  1 611 ? 89.674  101.243 94.086  1.00 28.39 ? 611 PHE B CA    1 
ATOM   9867  C  C     . PHE B  1 611 ? 89.239  102.569 94.697  1.00 28.39 ? 611 PHE B C     1 
ATOM   9868  O  O     . PHE B  1 611 ? 89.652  102.883 95.818  1.00 28.39 ? 611 PHE B O     1 
ATOM   9869  C  CB    . PHE B  1 611 ? 91.032  101.416 93.396  1.00 28.39 ? 611 PHE B CB    1 
ATOM   9870  C  CG    . PHE B  1 611 ? 92.132  101.849 94.317  1.00 28.39 ? 611 PHE B CG    1 
ATOM   9871  C  CD1   . PHE B  1 611 ? 92.673  100.964 95.235  1.00 28.39 ? 611 PHE B CD1   1 
ATOM   9872  C  CD2   . PHE B  1 611 ? 92.625  103.144 94.267  1.00 28.39 ? 611 PHE B CD2   1 
ATOM   9873  C  CE1   . PHE B  1 611 ? 93.687  101.363 96.088  1.00 28.39 ? 611 PHE B CE1   1 
ATOM   9874  C  CE2   . PHE B  1 611 ? 93.639  103.551 95.115  1.00 28.39 ? 611 PHE B CE2   1 
ATOM   9875  C  CZ    . PHE B  1 611 ? 94.169  102.659 96.028  1.00 28.39 ? 611 PHE B CZ    1 
ATOM   9876  N  N     . ALA B  1 612 ? 88.402  103.342 94.005  1.00 27.62 ? 612 ALA B N     1 
ATOM   9877  C  CA    . ALA B  1 612 ? 88.062  104.680 94.474  1.00 27.62 ? 612 ALA B CA    1 
ATOM   9878  C  C     . ALA B  1 612 ? 87.009  104.644 95.573  1.00 27.62 ? 612 ALA B C     1 
ATOM   9879  O  O     . ALA B  1 612 ? 87.128  105.352 96.577  1.00 27.62 ? 612 ALA B O     1 
ATOM   9880  C  CB    . ALA B  1 612 ? 87.582  105.538 93.304  1.00 27.62 ? 612 ALA B CB    1 
ATOM   9881  N  N     . ILE B  1 613 ? 85.968  103.837 95.395  1.00 26.96 ? 613 ILE B N     1 
ATOM   9882  C  CA    . ILE B  1 613 ? 84.891  103.721 96.375  1.00 26.96 ? 613 ILE B CA    1 
ATOM   9883  C  C     . ILE B  1 613 ? 85.406  102.952 97.587  1.00 26.96 ? 613 ILE B C     1 
ATOM   9884  O  O     . ILE B  1 613 ? 86.003  101.878 97.424  1.00 26.96 ? 613 ILE B O     1 
ATOM   9885  C  CB    . ILE B  1 613 ? 83.660  103.034 95.766  1.00 26.96 ? 613 ILE B CB    1 
ATOM   9886  C  CG1   . ILE B  1 613 ? 83.325  103.636 94.405  1.00 26.96 ? 613 ILE B CG1   1 
ATOM   9887  C  CG2   . ILE B  1 613 ? 82.465  103.153 96.689  1.00 26.96 ? 613 ILE B CG2   1 
ATOM   9888  C  CD1   . ILE B  1 613 ? 82.219  102.909 93.686  1.00 26.96 ? 613 ILE B CD1   1 
ATOM   9889  N  N     . PRO B  1 614 ? 85.224  103.460 98.804  1.00 30.70 ? 614 PRO B N     1 
ATOM   9890  C  CA    . PRO B  1 614 ? 85.682  102.719 99.983  1.00 30.70 ? 614 PRO B CA    1 
ATOM   9891  C  C     . PRO B  1 614 ? 84.784  101.532 100.287 1.00 30.70 ? 614 PRO B C     1 
ATOM   9892  O  O     . PRO B  1 614 ? 83.593  101.523 99.971  1.00 30.70 ? 614 PRO B O     1 
ATOM   9893  C  CB    . PRO B  1 614 ? 85.619  103.763 101.101 1.00 30.70 ? 614 PRO B CB    1 
ATOM   9894  C  CG    . PRO B  1 614 ? 84.577  104.711 100.655 1.00 30.70 ? 614 PRO B CG    1 
ATOM   9895  C  CD    . PRO B  1 614 ? 84.694  104.785 99.163  1.00 30.70 ? 614 PRO B CD    1 
ATOM   9896  N  N     . ASP B  1 615 ? 85.381  100.516 100.914 1.00 35.55 ? 615 ASP B N     1 
ATOM   9897  C  CA    . ASP B  1 615 ? 84.667  99.275  101.196 1.00 35.55 ? 615 ASP B CA    1 
ATOM   9898  C  C     . ASP B  1 615 ? 83.674  99.451  102.339 1.00 35.55 ? 615 ASP B C     1 
ATOM   9899  O  O     . ASP B  1 615 ? 82.501  99.090  102.215 1.00 35.55 ? 615 ASP B O     1 
ATOM   9900  C  CB    . ASP B  1 615 ? 85.665  98.160  101.511 1.00 35.55 ? 615 ASP B CB    1 
ATOM   9901  C  CG    . ASP B  1 615 ? 86.674  97.954  100.401 1.00 35.55 ? 615 ASP B CG    1 
ATOM   9902  O  OD1   . ASP B  1 615 ? 86.642  98.723  99.415  1.00 35.55 ? 615 ASP B OD1   1 
ATOM   9903  O  OD2   . ASP B  1 615 ? 87.500  97.024  100.512 1.00 35.55 ? 615 ASP B OD2   1 
ATOM   9904  N  N     . LYS B  1 616 ? 84.129  99.986  103.462 1.00 35.98 ? 616 LYS B N     1 
ATOM   9905  C  CA    . LYS B  1 616 ? 83.214  100.308 104.543 1.00 35.98 ? 616 LYS B CA    1 
ATOM   9906  C  C     . LYS B  1 616 ? 82.627  101.701 104.332 1.00 35.98 ? 616 LYS B C     1 
ATOM   9907  O  O     . LYS B  1 616 ? 83.277  102.570 103.748 1.00 35.98 ? 616 LYS B O     1 
ATOM   9908  C  CB    . LYS B  1 616 ? 83.933  100.250 105.885 1.00 35.98 ? 616 LYS B CB    1 
ATOM   9909  C  CG    . LYS B  1 616 ? 84.589  98.919  106.181 1.00 35.98 ? 616 LYS B CG    1 
ATOM   9910  C  CD    . LYS B  1 616 ? 85.420  98.993  107.447 1.00 35.98 ? 616 LYS B CD    1 
ATOM   9911  C  CE    . LYS B  1 616 ? 86.349  97.801  107.556 1.00 35.98 ? 616 LYS B CE    1 
ATOM   9912  N  NZ    . LYS B  1 616 ? 85.646  96.535  107.221 1.00 35.98 ? 616 LYS B NZ    1 
ATOM   9913  N  N     . PRO B  1 617 ? 81.400  101.947 104.806 1.00 36.70 ? 617 PRO B N     1 
ATOM   9914  C  CA    . PRO B  1 617 ? 80.819  103.290 104.668 1.00 36.70 ? 617 PRO B CA    1 
ATOM   9915  C  C     . PRO B  1 617 ? 81.454  104.310 105.601 1.00 36.70 ? 617 PRO B C     1 
ATOM   9916  O  O     . PRO B  1 617 ? 82.415  104.006 106.312 1.00 36.70 ? 617 PRO B O     1 
ATOM   9917  C  CB    . PRO B  1 617 ? 79.339  103.072 105.009 1.00 36.70 ? 617 PRO B CB    1 
ATOM   9918  C  CG    . PRO B  1 617 ? 79.117  101.617 104.882 1.00 36.70 ? 617 PRO B CG    1 
ATOM   9919  C  CD    . PRO B  1 617 ? 80.401  100.973 105.267 1.00 36.70 ? 617 PRO B CD    1 
ATOM   9920  N  N     . ARG B  1 618 ? 80.924  105.532 105.603 1.00 44.31 ? 618 ARG B N     1 
ATOM   9921  C  CA    . ARG B  1 618 ? 81.519  106.591 106.408 1.00 44.31 ? 618 ARG B CA    1 
ATOM   9922  C  C     . ARG B  1 618 ? 81.238  106.395 107.892 1.00 44.31 ? 618 ARG B C     1 
ATOM   9923  O  O     . ARG B  1 618 ? 82.163  106.418 108.713 1.00 44.31 ? 618 ARG B O     1 
ATOM   9924  C  CB    . ARG B  1 618 ? 81.009  107.954 105.943 1.00 44.31 ? 618 ARG B CB    1 
ATOM   9925  C  CG    . ARG B  1 618 ? 81.753  109.130 106.548 1.00 44.31 ? 618 ARG B CG    1 
ATOM   9926  C  CD    . ARG B  1 618 ? 83.246  109.031 106.287 1.00 44.31 ? 618 ARG B CD    1 
ATOM   9927  N  NE    . ARG B  1 618 ? 83.953  110.244 106.686 1.00 44.31 ? 618 ARG B NE    1 
ATOM   9928  C  CZ    . ARG B  1 618 ? 85.269  110.406 106.596 1.00 44.31 ? 618 ARG B CZ    1 
ATOM   9929  N  NH1   . ARG B  1 618 ? 86.028  109.429 106.119 1.00 44.31 ? 618 ARG B NH1   1 
ATOM   9930  N  NH2   . ARG B  1 618 ? 85.826  111.544 106.983 1.00 44.31 ? 618 ARG B NH2   1 
ATOM   9931  N  N     . HIS B  1 619 ? 79.970  106.186 108.255 1.00 47.54 ? 619 HIS B N     1 
ATOM   9932  C  CA    . HIS B  1 619 ? 79.609  106.117 109.666 1.00 47.54 ? 619 HIS B CA    1 
ATOM   9933  C  C     . HIS B  1 619 ? 80.067  104.820 110.317 1.00 47.54 ? 619 HIS B C     1 
ATOM   9934  O  O     . HIS B  1 619 ? 80.388  104.818 111.511 1.00 47.54 ? 619 HIS B O     1 
ATOM   9935  C  CB    . HIS B  1 619 ? 78.101  106.298 109.838 1.00 47.54 ? 619 HIS B CB    1 
ATOM   9936  C  CG    . HIS B  1 619 ? 77.279  105.319 109.063 1.00 47.54 ? 619 HIS B CG    1 
ATOM   9937  N  ND1   . HIS B  1 619 ? 77.012  105.469 107.720 1.00 47.54 ? 619 HIS B ND1   1 
ATOM   9938  C  CD2   . HIS B  1 619 ? 76.647  104.186 109.449 1.00 47.54 ? 619 HIS B CD2   1 
ATOM   9939  C  CE1   . HIS B  1 619 ? 76.259  104.464 107.309 1.00 47.54 ? 619 HIS B CE1   1 
ATOM   9940  N  NE2   . HIS B  1 619 ? 76.024  103.671 108.338 1.00 47.54 ? 619 HIS B NE2   1 
ATOM   9941  N  N     . ILE B  1 620 ? 80.143  103.728 109.553 1.00 42.21 ? 620 ILE B N     1 
ATOM   9942  C  CA    . ILE B  1 620 ? 80.715  102.493 110.079 1.00 42.21 ? 620 ILE B CA    1 
ATOM   9943  C  C     . ILE B  1 620 ? 82.200  102.670 110.356 1.00 42.21 ? 620 ILE B C     1 
ATOM   9944  O  O     . ILE B  1 620 ? 82.712  102.184 111.372 1.00 42.21 ? 620 ILE B O     1 
ATOM   9945  C  CB    . ILE B  1 620 ? 80.458  101.329 109.106 1.00 42.21 ? 620 ILE B CB    1 
ATOM   9946  C  CG1   . ILE B  1 620 ? 78.978  101.263 108.734 1.00 42.21 ? 620 ILE B CG1   1 
ATOM   9947  C  CG2   . ILE B  1 620 ? 80.902  100.011 109.709 1.00 42.21 ? 620 ILE B CG2   1 
ATOM   9948  C  CD1   . ILE B  1 620 ? 78.073  100.968 109.894 1.00 42.21 ? 620 ILE B CD1   1 
ATOM   9949  N  N     . GLN B  1 621 ? 82.903  103.406 109.493 1.00 47.01 ? 621 GLN B N     1 
ATOM   9950  C  CA    . GLN B  1 621 ? 84.322  103.663 109.714 1.00 47.01 ? 621 GLN B CA    1 
ATOM   9951  C  C     . GLN B  1 621 ? 84.538  104.583 110.909 1.00 47.01 ? 621 GLN B C     1 
ATOM   9952  O  O     . GLN B  1 621 ? 85.489  104.393 111.678 1.00 47.01 ? 621 GLN B O     1 
ATOM   9953  C  CB    . GLN B  1 621 ? 84.939  104.259 108.453 1.00 47.01 ? 621 GLN B CB    1 
ATOM   9954  C  CG    . GLN B  1 621 ? 86.448  104.279 108.441 1.00 47.01 ? 621 GLN B CG    1 
ATOM   9955  C  CD    . GLN B  1 621 ? 87.000  104.552 107.059 1.00 47.01 ? 621 GLN B CD    1 
ATOM   9956  O  OE1   . GLN B  1 621 ? 86.246  104.739 106.105 1.00 47.01 ? 621 GLN B OE1   1 
ATOM   9957  N  NE2   . GLN B  1 621 ? 88.321  104.572 106.942 1.00 47.01 ? 621 GLN B NE2   1 
ATOM   9958  N  N     . MET B  1 622 ? 83.647  105.564 111.098 1.00 49.52 ? 622 MET B N     1 
ATOM   9959  C  CA    . MET B  1 622 ? 83.716  106.419 112.282 1.00 49.52 ? 622 MET B CA    1 
ATOM   9960  C  C     . MET B  1 622 ? 83.447  105.630 113.559 1.00 49.52 ? 622 MET B C     1 
ATOM   9961  O  O     . MET B  1 622 ? 84.097  105.864 114.585 1.00 49.52 ? 622 MET B O     1 
ATOM   9962  C  CB    . MET B  1 622 ? 82.727  107.576 112.160 1.00 49.52 ? 622 MET B CB    1 
ATOM   9963  C  CG    . MET B  1 622 ? 83.054  108.565 111.059 1.00 49.52 ? 622 MET B CG    1 
ATOM   9964  S  SD    . MET B  1 622 ? 82.323  110.189 111.340 1.00 49.52 ? 622 MET B SD    1 
ATOM   9965  C  CE    . MET B  1 622 ? 80.651  109.922 110.754 1.00 49.52 ? 622 MET B CE    1 
ATOM   9966  N  N     . LYS B  1 623 ? 82.516  104.675 113.509 1.00 46.41 ? 623 LYS B N     1 
ATOM   9967  C  CA    . LYS B  1 623 ? 82.216  103.882 114.697 1.00 46.41 ? 623 LYS B CA    1 
ATOM   9968  C  C     . LYS B  1 623 ? 83.345  102.910 115.022 1.00 46.41 ? 623 LYS B C     1 
ATOM   9969  O  O     . LYS B  1 623 ? 83.653  102.686 116.200 1.00 46.41 ? 623 LYS B O     1 
ATOM   9970  C  CB    . LYS B  1 623 ? 80.894  103.144 114.510 1.00 46.41 ? 623 LYS B CB    1 
ATOM   9971  C  CG    . LYS B  1 623 ? 79.683  104.037 114.696 1.00 46.41 ? 623 LYS B CG    1 
ATOM   9972  C  CD    . LYS B  1 623 ? 78.490  103.507 113.934 1.00 46.41 ? 623 LYS B CD    1 
ATOM   9973  C  CE    . LYS B  1 623 ? 77.286  104.408 114.089 1.00 46.41 ? 623 LYS B CE    1 
ATOM   9974  N  NZ    . LYS B  1 623 ? 76.090  103.826 113.424 1.00 46.41 ? 623 LYS B NZ    1 
ATOM   9975  N  N     . LEU B  1 624 ? 83.997  102.348 113.999 1.00 50.31 ? 624 LEU B N     1 
ATOM   9976  C  CA    . LEU B  1 624 ? 85.162  101.505 114.262 1.00 50.31 ? 624 LEU B CA    1 
ATOM   9977  C  C     . LEU B  1 624 ? 86.342  102.323 114.774 1.00 50.31 ? 624 LEU B C     1 
ATOM   9978  O  O     . LEU B  1 624 ? 87.103  101.842 115.624 1.00 50.31 ? 624 LEU B O     1 
ATOM   9979  C  CB    . LEU B  1 624 ? 85.575  100.728 113.011 1.00 50.31 ? 624 LEU B CB    1 
ATOM   9980  C  CG    . LEU B  1 624 ? 84.622  99.717  112.369 1.00 50.31 ? 624 LEU B CG    1 
ATOM   9981  C  CD1   . LEU B  1 624 ? 85.402  98.724  111.524 1.00 50.31 ? 624 LEU B CD1   1 
ATOM   9982  C  CD2   . LEU B  1 624 ? 83.763  99.002  113.394 1.00 50.31 ? 624 LEU B CD2   1 
ATOM   9983  N  N     . ALA B  1 625 ? 86.493  103.563 114.299 1.00 55.19 ? 625 ALA B N     1 
ATOM   9984  C  CA    . ALA B  1 625 ? 87.553  104.424 114.813 1.00 55.19 ? 625 ALA B CA    1 
ATOM   9985  C  C     . ALA B  1 625 ? 87.291  104.823 116.260 1.00 55.19 ? 625 ALA B C     1 
ATOM   9986  O  O     . ALA B  1 625 ? 88.228  104.908 117.063 1.00 55.19 ? 625 ALA B O     1 
ATOM   9987  C  CB    . ALA B  1 625 ? 87.697  105.661 113.929 1.00 55.19 ? 625 ALA B CB    1 
ATOM   9988  N  N     . ARG B  1 626 ? 86.023  105.048 116.616 1.00 56.47 ? 626 ARG B N     1 
ATOM   9989  C  CA    . ARG B  1 626 ? 85.677  105.336 118.005 1.00 56.47 ? 626 ARG B CA    1 
ATOM   9990  C  C     . ARG B  1 626 ? 85.916  104.124 118.900 1.00 56.47 ? 626 ARG B C     1 
ATOM   9991  O  O     . ARG B  1 626 ? 86.418  104.263 120.023 1.00 56.47 ? 626 ARG B O     1 
ATOM   9992  C  CB    . ARG B  1 626 ? 84.223  105.793 118.096 1.00 56.47 ? 626 ARG B CB    1 
ATOM   9993  C  CG    . ARG B  1 626 ? 83.790  106.211 119.486 1.00 56.47 ? 626 ARG B CG    1 
ATOM   9994  C  CD    . ARG B  1 626 ? 82.342  106.662 119.500 1.00 56.47 ? 626 ARG B CD    1 
ATOM   9995  N  NE    . ARG B  1 626 ? 82.077  107.669 118.478 1.00 56.47 ? 626 ARG B NE    1 
ATOM   9996  C  CZ    . ARG B  1 626 ? 80.995  107.682 117.708 1.00 56.47 ? 626 ARG B CZ    1 
ATOM   9997  N  NH1   . ARG B  1 626 ? 80.071  106.742 117.846 1.00 56.47 ? 626 ARG B NH1   1 
ATOM   9998  N  NH2   . ARG B  1 626 ? 80.834  108.636 116.801 1.00 56.47 ? 626 ARG B NH2   1 
ATOM   9999  N  N     . LEU B  1 627 ? 85.577  102.926 118.409 1.00 57.85 ? 627 LEU B N     1 
ATOM   10000 C  CA    . LEU B  1 627 ? 85.821  101.707 119.173 1.00 57.85 ? 627 LEU B CA    1 
ATOM   10001 C  C     . LEU B  1 627 ? 87.308  101.418 119.333 1.00 57.85 ? 627 LEU B C     1 
ATOM   10002 O  O     . LEU B  1 627 ? 87.713  100.810 120.329 1.00 57.85 ? 627 LEU B O     1 
ATOM   10003 C  CB    . LEU B  1 627 ? 85.124  100.523 118.504 1.00 57.85 ? 627 LEU B CB    1 
ATOM   10004 C  CG    . LEU B  1 627 ? 84.668  99.400  119.433 1.00 57.85 ? 627 LEU B CG    1 
ATOM   10005 C  CD1   . LEU B  1 627 ? 83.837  99.956  120.569 1.00 57.85 ? 627 LEU B CD1   1 
ATOM   10006 C  CD2   . LEU B  1 627 ? 83.883  98.356  118.664 1.00 57.85 ? 627 LEU B CD2   1 
ATOM   10007 N  N     . GLU B  1 628 ? 88.131  101.837 118.370 1.00 67.62 ? 628 GLU B N     1 
ATOM   10008 C  CA    . GLU B  1 628 ? 89.575  101.694 118.525 1.00 67.62 ? 628 GLU B CA    1 
ATOM   10009 C  C     . GLU B  1 628 ? 90.126  102.729 119.501 1.00 67.62 ? 628 GLU B C     1 
ATOM   10010 O  O     . GLU B  1 628 ? 91.014  102.421 120.310 1.00 67.62 ? 628 GLU B O     1 
ATOM   10011 C  CB    . GLU B  1 628 ? 90.247  101.788 117.148 1.00 67.62 ? 628 GLU B CB    1 
ATOM   10012 C  CG    . GLU B  1 628 ? 91.784  101.810 117.105 1.00 67.62 ? 628 GLU B CG    1 
ATOM   10013 C  CD    . GLU B  1 628 ? 92.389  103.203 117.223 1.00 67.62 ? 628 GLU B CD    1 
ATOM   10014 O  OE1   . GLU B  1 628 ? 91.628  104.190 117.150 1.00 67.62 ? 628 GLU B OE1   1 
ATOM   10015 O  OE2   . GLU B  1 628 ? 93.623  103.308 117.387 1.00 67.62 ? 628 GLU B OE2   1 
ATOM   10016 N  N     . PHE B  1 629 ? 89.613  103.962 119.439 1.00 70.65 ? 629 PHE B N     1 
ATOM   10017 C  CA    . PHE B  1 629 ? 90.116  105.024 120.303 1.00 70.65 ? 629 PHE B CA    1 
ATOM   10018 C  C     . PHE B  1 629 ? 89.752  104.795 121.763 1.00 70.65 ? 629 PHE B C     1 
ATOM   10019 O  O     . PHE B  1 629 ? 90.530  105.160 122.650 1.00 70.65 ? 629 PHE B O     1 
ATOM   10020 C  CB    . PHE B  1 629 ? 89.589  106.382 119.841 1.00 70.65 ? 629 PHE B CB    1 
ATOM   10021 C  CG    . PHE B  1 629 ? 89.988  107.518 120.737 1.00 70.65 ? 629 PHE B CG    1 
ATOM   10022 C  CD1   . PHE B  1 629 ? 91.303  107.950 120.780 1.00 70.65 ? 629 PHE B CD1   1 
ATOM   10023 C  CD2   . PHE B  1 629 ? 89.053  108.143 121.548 1.00 70.65 ? 629 PHE B CD2   1 
ATOM   10024 C  CE1   . PHE B  1 629 ? 91.679  108.989 121.610 1.00 70.65 ? 629 PHE B CE1   1 
ATOM   10025 C  CE2   . PHE B  1 629 ? 89.421  109.182 122.381 1.00 70.65 ? 629 PHE B CE2   1 
ATOM   10026 C  CZ    . PHE B  1 629 ? 90.736  109.607 122.410 1.00 70.65 ? 629 PHE B CZ    1 
ATOM   10027 N  N     . GLU B  1 630 ? 88.589  104.193 122.034 1.00 72.05 ? 630 GLU B N     1 
ATOM   10028 C  CA    . GLU B  1 630 ? 88.235  103.894 123.420 1.00 72.05 ? 630 GLU B CA    1 
ATOM   10029 C  C     . GLU B  1 630 ? 89.152  102.833 124.021 1.00 72.05 ? 630 GLU B C     1 
ATOM   10030 O  O     . GLU B  1 630 ? 89.545  102.944 125.189 1.00 72.05 ? 630 GLU B O     1 
ATOM   10031 C  CB    . GLU B  1 630 ? 86.770  103.456 123.515 1.00 72.05 ? 630 GLU B CB    1 
ATOM   10032 C  CG    . GLU B  1 630 ? 85.711  104.543 123.228 1.00 72.05 ? 630 GLU B CG    1 
ATOM   10033 C  CD    . GLU B  1 630 ? 85.968  105.897 123.888 1.00 72.05 ? 630 GLU B CD    1 
ATOM   10034 O  OE1   . GLU B  1 630 ? 86.392  105.948 125.064 1.00 72.05 ? 630 GLU B OE1   1 
ATOM   10035 O  OE2   . GLU B  1 630 ? 85.743  106.926 123.215 1.00 72.05 ? 630 GLU B OE2   1 
ATOM   10036 N  N     . SER B  1 631 ? 89.546  101.831 123.230 1.00 74.28 ? 631 SER B N     1 
ATOM   10037 C  CA    . SER B  1 631 ? 90.499  100.837 123.715 1.00 74.28 ? 631 SER B CA    1 
ATOM   10038 C  C     . SER B  1 631 ? 91.896  101.426 123.875 1.00 74.28 ? 631 SER B C     1 
ATOM   10039 O  O     . SER B  1 631 ? 92.619  101.055 124.810 1.00 74.28 ? 631 SER B O     1 
ATOM   10040 C  CB    . SER B  1 631 ? 90.533  99.636  122.772 1.00 74.28 ? 631 SER B CB    1 
ATOM   10041 O  OG    . SER B  1 631 ? 91.676  98.834  123.010 1.00 74.28 ? 631 SER B OG    1 
ATOM   10042 N  N     . LEU B  1 632 ? 92.284  102.353 122.993 1.00 77.27 ? 632 LEU B N     1 
ATOM   10043 C  CA    . LEU B  1 632 ? 93.576  103.019 123.148 1.00 77.27 ? 632 LEU B CA    1 
ATOM   10044 C  C     . LEU B  1 632 ? 93.597  103.905 124.391 1.00 77.27 ? 632 LEU B C     1 
ATOM   10045 O  O     . LEU B  1 632 ? 94.613  103.976 125.094 1.00 77.27 ? 632 LEU B O     1 
ATOM   10046 C  CB    . LEU B  1 632 ? 93.907  103.817 121.882 1.00 77.27 ? 632 LEU B CB    1 
ATOM   10047 C  CG    . LEU B  1 632 ? 95.119  104.755 121.804 1.00 77.27 ? 632 LEU B CG    1 
ATOM   10048 C  CD1   . LEU B  1 632 ? 95.718  104.666 120.418 1.00 77.27 ? 632 LEU B CD1   1 
ATOM   10049 C  CD2   . LEU B  1 632 ? 94.751  106.209 122.085 1.00 77.27 ? 632 LEU B CD2   1 
ATOM   10050 N  N     . GLU B  1 633 ? 92.476  104.568 124.692 1.00 80.50 ? 633 GLU B N     1 
ATOM   10051 C  CA    . GLU B  1 633 ? 92.390  105.358 125.915 1.00 80.50 ? 633 GLU B CA    1 
ATOM   10052 C  C     . GLU B  1 633 ? 92.377  104.476 127.156 1.00 80.50 ? 633 GLU B C     1 
ATOM   10053 O  O     . GLU B  1 633 ? 92.924  104.869 128.192 1.00 80.50 ? 633 GLU B O     1 
ATOM   10054 C  CB    . GLU B  1 633 ? 91.148  106.247 125.887 1.00 80.50 ? 633 GLU B CB    1 
ATOM   10055 C  CG    . GLU B  1 633 ? 91.306  107.542 126.664 1.00 80.50 ? 633 GLU B CG    1 
ATOM   10056 C  CD    . GLU B  1 633 ? 89.978  108.203 126.980 1.00 80.50 ? 633 GLU B CD    1 
ATOM   10057 O  OE1   . GLU B  1 633 ? 88.927  107.659 126.579 1.00 80.50 ? 633 GLU B OE1   1 
ATOM   10058 O  OE2   . GLU B  1 633 ? 89.984  109.266 127.635 1.00 80.50 ? 633 GLU B OE2   1 
ATOM   10059 N  N     . ALA B  1 634 ? 91.776  103.284 127.068 1.00 81.89 ? 634 ALA B N     1 
ATOM   10060 C  CA    . ALA B  1 634 ? 91.842  102.333 128.176 1.00 81.89 ? 634 ALA B CA    1 
ATOM   10061 C  C     . ALA B  1 634 ? 93.271  101.858 128.413 1.00 81.89 ? 634 ALA B C     1 
ATOM   10062 O  O     . ALA B  1 634 ? 93.704  101.714 129.564 1.00 81.89 ? 634 ALA B O     1 
ATOM   10063 C  CB    . ALA B  1 634 ? 90.921  101.145 127.904 1.00 81.89 ? 634 ALA B CB    1 
ATOM   10064 N  N     . LEU B  1 635 ? 94.025  101.634 127.331 1.00 84.63 ? 635 LEU B N     1 
ATOM   10065 C  CA    . LEU B  1 635 ? 95.432  101.261 127.460 1.00 84.63 ? 635 LEU B CA    1 
ATOM   10066 C  C     . LEU B  1 635 ? 96.256  102.398 128.060 1.00 84.63 ? 635 LEU B C     1 
ATOM   10067 O  O     . LEU B  1 635 ? 97.141  102.160 128.891 1.00 84.63 ? 635 LEU B O     1 
ATOM   10068 C  CB    . LEU B  1 635 ? 95.984  100.854 126.092 1.00 84.63 ? 635 LEU B CB    1 
ATOM   10069 C  CG    . LEU B  1 635 ? 97.495  100.730 125.869 1.00 84.63 ? 635 LEU B CG    1 
ATOM   10070 C  CD1   . LEU B  1 635 ? 98.126  99.707  126.810 1.00 84.63 ? 635 LEU B CD1   1 
ATOM   10071 C  CD2   . LEU B  1 635 ? 97.793  100.385 124.417 1.00 84.63 ? 635 LEU B CD2   1 
ATOM   10072 N  N     . LYS B  1 636 ? 95.957  103.641 127.671 1.00 84.75 ? 636 LYS B N     1 
ATOM   10073 C  CA    . LYS B  1 636 ? 96.683  104.788 128.212 1.00 84.75 ? 636 LYS B CA    1 
ATOM   10074 C  C     . LYS B  1 636 ? 96.369  105.007 129.689 1.00 84.75 ? 636 LYS B C     1 
ATOM   10075 O  O     . LYS B  1 636 ? 97.253  105.379 130.470 1.00 84.75 ? 636 LYS B O     1 
ATOM   10076 C  CB    . LYS B  1 636 ? 96.355  106.043 127.405 1.00 84.75 ? 636 LYS B CB    1 
ATOM   10077 N  N     . GLN B  1 637 ? 95.117  104.773 130.092 1.00 85.99 ? 637 GLN B N     1 
ATOM   10078 C  CA    . GLN B  1 637 ? 94.767  104.913 131.502 1.00 85.99 ? 637 GLN B CA    1 
ATOM   10079 C  C     . GLN B  1 637 ? 95.321  103.767 132.337 1.00 85.99 ? 637 GLN B C     1 
ATOM   10080 O  O     . GLN B  1 637 ? 95.612  103.956 133.524 1.00 85.99 ? 637 GLN B O     1 
ATOM   10081 C  CB    . GLN B  1 637 ? 93.247  105.012 131.669 1.00 85.99 ? 637 GLN B CB    1 
ATOM   10082 C  CG    . GLN B  1 637 ? 92.582  106.292 131.122 1.00 85.99 ? 637 GLN B CG    1 
ATOM   10083 C  CD    . GLN B  1 637 ? 93.238  107.611 131.538 1.00 85.99 ? 637 GLN B CD    1 
ATOM   10084 O  OE1   . GLN B  1 637 ? 93.800  107.745 132.630 1.00 85.99 ? 637 GLN B OE1   1 
ATOM   10085 N  NE2   . GLN B  1 637 ? 93.168  108.596 130.648 1.00 85.99 ? 637 GLN B NE2   1 
ATOM   10086 N  N     . GLN B  1 638 ? 95.466  102.576 131.748 1.00 87.95 ? 638 GLN B N     1 
ATOM   10087 C  CA    . GLN B  1 638 ? 96.170  101.499 132.436 1.00 87.95 ? 638 GLN B CA    1 
ATOM   10088 C  C     . GLN B  1 638 ? 97.657  101.794 132.582 1.00 87.95 ? 638 GLN B C     1 
ATOM   10089 O  O     . GLN B  1 638 ? 98.250  101.446 133.608 1.00 87.95 ? 638 GLN B O     1 
ATOM   10090 C  CB    . GLN B  1 638 ? 95.973  100.176 131.693 1.00 87.95 ? 638 GLN B CB    1 
ATOM   10091 C  CG    . GLN B  1 638 ? 96.430  98.947  132.467 1.00 87.95 ? 638 GLN B CG    1 
ATOM   10092 C  CD    . GLN B  1 638 ? 96.209  97.661  131.699 1.00 87.95 ? 638 GLN B CD    1 
ATOM   10093 O  OE1   . GLN B  1 638 ? 95.584  97.658  130.640 1.00 87.95 ? 638 GLN B OE1   1 
ATOM   10094 N  NE2   . GLN B  1 638 ? 96.719  96.557  132.232 1.00 87.95 ? 638 GLN B NE2   1 
ATOM   10095 N  N     . GLN B  1 639 ? 98.264  102.437 131.581 1.00 86.55 ? 639 GLN B N     1 
ATOM   10096 C  CA    . GLN B  1 639 ? 99.667  102.827 131.670 1.00 86.55 ? 639 GLN B CA    1 
ATOM   10097 C  C     . GLN B  1 639 ? 99.887  103.939 132.691 1.00 86.55 ? 639 GLN B C     1 
ATOM   10098 O  O     . GLN B  1 639 ? 100.906 103.937 133.392 1.00 86.55 ? 639 GLN B O     1 
ATOM   10099 C  CB    . GLN B  1 639 ? 100.169 103.245 130.279 1.00 86.55 ? 639 GLN B CB    1 
ATOM   10100 C  CG    . GLN B  1 639 ? 101.591 103.809 130.199 1.00 86.55 ? 639 GLN B CG    1 
ATOM   10101 C  CD    . GLN B  1 639 ? 101.645 105.327 130.282 1.00 86.55 ? 639 GLN B CD    1 
ATOM   10102 O  OE1   . GLN B  1 639 ? 100.615 105.990 130.389 1.00 86.55 ? 639 GLN B OE1   1 
ATOM   10103 N  NE2   . GLN B  1 639 ? 102.852 105.881 130.236 1.00 86.55 ? 639 GLN B NE2   1 
ATOM   10104 N  N     . MET B  1 640 ? 98.944  104.879 132.801 1.00 89.34 ? 640 MET B N     1 
ATOM   10105 C  CA    . MET B  1 640 ? 99.146  106.044 133.659 1.00 89.34 ? 640 MET B CA    1 
ATOM   10106 C  C     . MET B  1 640 ? 99.045  105.697 135.142 1.00 89.34 ? 640 MET B C     1 
ATOM   10107 O  O     . MET B  1 640 ? 99.729  106.309 135.969 1.00 89.34 ? 640 MET B O     1 
ATOM   10108 C  CB    . MET B  1 640 ? 98.139  107.136 133.300 1.00 89.34 ? 640 MET B CB    1 
ATOM   10109 C  CG    . MET B  1 640 ? 98.710  108.228 132.415 1.00 89.34 ? 640 MET B CG    1 
ATOM   10110 S  SD    . MET B  1 640 ? 100.119 109.066 133.165 1.00 89.34 ? 640 MET B SD    1 
ATOM   10111 C  CE    . MET B  1 640 ? 99.395  109.660 134.693 1.00 89.34 ? 640 MET B CE    1 
ATOM   10112 N  N     . LYS B  1 641 ? 98.205  104.731 135.500 1.00 87.18 ? 641 LYS B N     1 
ATOM   10113 C  CA    . LYS B  1 641 ? 98.068  104.334 136.898 1.00 87.18 ? 641 LYS B CA    1 
ATOM   10114 C  C     . LYS B  1 641 ? 99.250  103.482 137.346 1.00 87.18 ? 641 LYS B C     1 
ATOM   10115 O  O     . LYS B  1 641 ? 100.153 103.967 138.028 1.00 87.18 ? 641 LYS B O     1 
ATOM   10116 C  CB    . LYS B  1 641 ? 96.758  103.575 137.121 1.00 87.18 ? 641 LYS B CB    1 
ATOM   10117 C  CG    . LYS B  1 641 ? 95.514  104.430 136.960 1.00 87.18 ? 641 LYS B CG    1 
ATOM   10118 C  CD    . LYS B  1 641 ? 94.301  103.580 136.625 1.00 87.18 ? 641 LYS B CD    1 
ATOM   10119 C  CE    . LYS B  1 641 ? 93.115  104.445 136.231 1.00 87.18 ? 641 LYS B CE    1 
ATOM   10120 N  NZ    . LYS B  1 641 ? 91.987  103.634 135.698 1.00 87.18 ? 641 LYS B NZ    1 
HETATM 10121 CA CA    . CA  C  2 .   ? 120.114 110.062 91.888  1.00 29.02 ? 701 CA  A CA    1 
HETATM 10122 CA CA    . CA  D  2 .   ? 118.001 108.981 95.859  1.00 19.84 ? 702 CA  A CA    1 
HETATM 10123 CA CA    . CA  E  2 .   ? 100.295 87.765  97.122  1.00 25.05 ? 703 CA  A CA    1 
HETATM 10124 O  O12   . PC1 F  3 .   ? 91.740  110.213 100.441 1.00 30.24 ? 704 PC1 A O12   1 
HETATM 10125 P  P     . PC1 F  3 .   ? 92.734  109.156 100.160 1.00 30.24 ? 704 PC1 A P     1 
HETATM 10126 O  O14   . PC1 F  3 .   ? 93.782  108.858 101.161 1.00 30.24 ? 704 PC1 A O14   1 
HETATM 10127 O  O13   . PC1 F  3 .   ? 91.943  107.822 99.788  1.00 30.24 ? 704 PC1 A O13   1 
HETATM 10128 C  C11   . PC1 F  3 .   ? 92.023  106.629 100.609 1.00 30.24 ? 704 PC1 A C11   1 
HETATM 10129 C  C12   . PC1 F  3 .   ? 90.862  105.769 100.162 1.00 30.24 ? 704 PC1 A C12   1 
HETATM 10130 N  N     . PC1 F  3 .   ? 91.183  104.660 99.177  1.00 30.24 ? 704 PC1 A N     1 
HETATM 10131 C  C13   . PC1 F  3 .   ? 91.480  105.223 97.822  1.00 30.24 ? 704 PC1 A C13   1 
HETATM 10132 C  C14   . PC1 F  3 .   ? 92.369  103.877 99.648  1.00 30.24 ? 704 PC1 A C14   1 
HETATM 10133 C  C15   . PC1 F  3 .   ? 90.008  103.739 99.072  1.00 30.24 ? 704 PC1 A C15   1 
HETATM 10134 O  O11   . PC1 F  3 .   ? 93.388  109.458 98.736  1.00 30.24 ? 704 PC1 A O11   1 
HETATM 10135 C  C1    . PC1 F  3 .   ? 93.902  108.363 97.953  1.00 30.24 ? 704 PC1 A C1    1 
HETATM 10136 C  C2    . PC1 F  3 .   ? 94.455  108.833 96.635  1.00 30.24 ? 704 PC1 A C2    1 
HETATM 10137 O  O21   . PC1 F  3 .   ? 93.402  109.558 95.928  1.00 30.24 ? 704 PC1 A O21   1 
HETATM 10138 C  C21   . PC1 F  3 .   ? 93.433  110.897 95.964  1.00 30.24 ? 704 PC1 A C21   1 
HETATM 10139 O  O22   . PC1 F  3 .   ? 94.259  111.528 96.558  1.00 30.24 ? 704 PC1 A O22   1 
HETATM 10140 C  C22   . PC1 F  3 .   ? 92.310  111.487 95.167  1.00 30.24 ? 704 PC1 A C22   1 
HETATM 10141 C  C23   . PC1 F  3 .   ? 92.679  112.812 94.518  1.00 30.24 ? 704 PC1 A C23   1 
HETATM 10142 C  C24   . PC1 F  3 .   ? 91.699  113.231 93.449  1.00 30.24 ? 704 PC1 A C24   1 
HETATM 10143 C  C25   . PC1 F  3 .   ? 92.138  114.442 92.655  1.00 30.24 ? 704 PC1 A C25   1 
HETATM 10144 C  C26   . PC1 F  3 .   ? 93.481  114.278 91.976  1.00 30.24 ? 704 PC1 A C26   1 
HETATM 10145 C  C27   . PC1 F  3 .   ? 93.840  115.411 91.034  1.00 30.24 ? 704 PC1 A C27   1 
HETATM 10146 C  C28   . PC1 F  3 .   ? 95.180  115.238 90.348  1.00 30.24 ? 704 PC1 A C28   1 
HETATM 10147 C  C29   . PC1 F  3 .   ? 95.300  113.963 89.535  1.00 30.24 ? 704 PC1 A C29   1 
HETATM 10148 C  C2A   . PC1 F  3 .   ? 94.342  113.882 88.367  1.00 30.24 ? 704 PC1 A C2A   1 
HETATM 10149 C  C2B   . PC1 F  3 .   ? 94.362  112.553 87.646  1.00 30.24 ? 704 PC1 A C2B   1 
HETATM 10150 C  C2C   . PC1 F  3 .   ? 93.391  112.474 86.486  1.00 30.24 ? 704 PC1 A C2C   1 
HETATM 10151 C  C2D   . PC1 F  3 .   ? 93.695  113.445 85.361  1.00 30.24 ? 704 PC1 A C2D   1 
HETATM 10152 C  C2E   . PC1 F  3 .   ? 95.025  113.192 84.678  1.00 30.24 ? 704 PC1 A C2E   1 
HETATM 10153 C  C3    . PC1 F  3 .   ? 94.825  107.654 95.779  1.00 30.24 ? 704 PC1 A C3    1 
HETATM 10154 O  O31   . PC1 F  3 .   ? 96.099  107.826 95.120  1.00 30.24 ? 704 PC1 A O31   1 
HETATM 10155 C  C31   . PC1 F  3 .   ? 97.107  107.084 95.579  1.00 30.24 ? 704 PC1 A C31   1 
HETATM 10156 O  O32   . PC1 F  3 .   ? 97.059  106.460 96.600  1.00 30.24 ? 704 PC1 A O32   1 
HETATM 10157 C  C32   . PC1 F  3 .   ? 98.271  107.100 94.637  1.00 30.24 ? 704 PC1 A C32   1 
HETATM 10158 C  C33   . PC1 F  3 .   ? 98.143  105.997 93.597  1.00 30.24 ? 704 PC1 A C33   1 
HETATM 10159 C  C34   . PC1 F  3 .   ? 99.223  106.010 92.534  1.00 30.24 ? 704 PC1 A C34   1 
HETATM 10160 C  C35   . PC1 F  3 .   ? 99.042  104.912 91.506  1.00 30.24 ? 704 PC1 A C35   1 
HETATM 10161 C  C36   . PC1 F  3 .   ? 100.167 104.780 90.503  1.00 30.24 ? 704 PC1 A C36   1 
HETATM 10162 C  C37   . PC1 F  3 .   ? 100.155 105.805 89.392  1.00 30.24 ? 704 PC1 A C37   1 
HETATM 10163 C  C38   . PC1 F  3 .   ? 101.250 105.589 88.364  1.00 30.24 ? 704 PC1 A C38   1 
HETATM 10164 C  C39   . PC1 F  3 .   ? 101.243 106.590 87.230  1.00 30.24 ? 704 PC1 A C39   1 
HETATM 10165 C  C3A   . PC1 F  3 .   ? 100.059 106.463 86.297  1.00 30.24 ? 704 PC1 A C3A   1 
HETATM 10166 C  C3B   . PC1 F  3 .   ? 99.895  107.642 85.361  1.00 30.24 ? 704 PC1 A C3B   1 
HETATM 10167 C  C3C   . PC1 F  3 .   ? 98.733  107.514 84.401  1.00 30.24 ? 704 PC1 A C3C   1 
HETATM 10168 C  C3D   . PC1 F  3 .   ? 98.174  108.846 83.939  1.00 30.24 ? 704 PC1 A C3D   1 
HETATM 10169 C  C3E   . PC1 F  3 .   ? 99.172  109.736 83.228  1.00 30.24 ? 704 PC1 A C3E   1 
HETATM 10170 C  C3F   . PC1 F  3 .   ? 99.565  109.245 81.853  1.00 30.24 ? 704 PC1 A C3F   1 
HETATM 10171 C  C2    . UMQ G  4 .   ? 106.123 99.892  56.576  1.00 54.34 ? 705 UMQ A C2    1 
HETATM 10172 C  C4    . UMQ G  4 .   ? 107.729 97.963  56.405  1.00 54.34 ? 705 UMQ A C4    1 
HETATM 10173 C  C5    . UMQ G  4 .   ? 107.066 97.323  57.624  1.00 54.34 ? 705 UMQ A C5    1 
HETATM 10174 C  C6    . UMQ G  4 .   ? 107.832 97.551  58.909  1.00 54.34 ? 705 UMQ A C6    1 
HETATM 10175 O  O2    . UMQ G  4 .   ? 105.017 100.517 55.935  1.00 54.34 ? 705 UMQ A O2    1 
HETATM 10176 O  O4    . UMQ G  4 .   ? 108.221 96.939  55.549  1.00 54.34 ? 705 UMQ A O4    1 
HETATM 10177 C  C1    . UMQ G  4 .   ? 105.672 99.268  57.893  1.00 54.34 ? 705 UMQ A C1    1 
HETATM 10178 C  C3    . UMQ G  4 .   ? 106.723 98.832  55.657  1.00 54.34 ? 705 UMQ A C3    1 
HETATM 10179 O  O1    . UMQ G  4 .   ? 104.376 99.774  58.185  1.00 54.34 ? 705 UMQ A O1    1 
HETATM 10180 O  O3    . UMQ G  4 .   ? 107.348 99.453  54.540  1.00 54.34 ? 705 UMQ A O3    1 
HETATM 10181 O  O5    . UMQ G  4 .   ? 105.739 97.850  57.817  1.00 54.34 ? 705 UMQ A O5    1 
HETATM 10182 O  O6    . UMQ G  4 .   ? 109.186 97.138  58.783  1.00 54.34 ? 705 UMQ A O6    1 
HETATM 10183 C  "C1'" . UMQ G  4 .   ? 102.911 97.366  61.273  1.00 54.34 ? 705 UMQ A "C1'" 1 
HETATM 10184 C  "C2'" . UMQ G  4 .   ? 101.957 97.654  60.122  1.00 54.34 ? 705 UMQ A "C2'" 1 
HETATM 10185 C  "C3'" . UMQ G  4 .   ? 102.748 98.196  58.942  1.00 54.34 ? 705 UMQ A "C3'" 1 
HETATM 10186 C  "C4'" . UMQ G  4 .   ? 103.608 99.391  59.348  1.00 54.34 ? 705 UMQ A "C4'" 1 
HETATM 10187 C  "C5'" . UMQ G  4 .   ? 104.421 99.120  60.619  1.00 54.34 ? 705 UMQ A "C5'" 1 
HETATM 10188 C  "C6'" . UMQ G  4 .   ? 105.026 100.363 61.239  1.00 54.34 ? 705 UMQ A "C6'" 1 
HETATM 10189 O  "O1'" . UMQ G  4 .   ? 102.163 96.867  62.346  1.00 54.34 ? 705 UMQ A "O1'" 1 
HETATM 10190 O  "O3'" . UMQ G  4 .   ? 101.859 98.564  57.893  1.00 54.34 ? 705 UMQ A "O3'" 1 
HETATM 10191 O  "O5'" . UMQ G  4 .   ? 103.581 98.556  61.644  1.00 54.34 ? 705 UMQ A "O5'" 1 
HETATM 10192 O  "O6'" . UMQ G  4 .   ? 105.875 100.034 62.330  1.00 54.34 ? 705 UMQ A "O6'" 1 
HETATM 10193 O  "O2'" . UMQ G  4 .   ? 101.272 96.465  59.748  1.00 54.34 ? 705 UMQ A "O2'" 1 
HETATM 10194 C  CA    . UMQ G  4 .   ? 101.293 97.827  62.945  1.00 54.34 ? 705 UMQ A CA    1 
HETATM 10195 C  CB    . UMQ G  4 .   ? 99.977  97.165  63.262  1.00 54.34 ? 705 UMQ A CB    1 
HETATM 10196 C  CC    . UMQ G  4 .   ? 99.878  96.657  64.686  1.00 54.34 ? 705 UMQ A CC    1 
HETATM 10197 C  CD    . UMQ G  4 .   ? 100.158 97.729  65.722  1.00 54.34 ? 705 UMQ A CD    1 
HETATM 10198 C  CF    . UMQ G  4 .   ? 99.719  97.370  67.127  1.00 54.34 ? 705 UMQ A CF    1 
HETATM 10199 C  CG    . UMQ G  4 .   ? 100.149 95.990  67.576  1.00 54.34 ? 705 UMQ A CG    1 
HETATM 10200 C  CH    . UMQ G  4 .   ? 100.038 95.784  69.072  1.00 54.34 ? 705 UMQ A CH    1 
HETATM 10201 C  CI    . UMQ G  4 .   ? 98.683  96.137  69.653  1.00 54.34 ? 705 UMQ A CI    1 
HETATM 10202 C  CJ    . UMQ G  4 .   ? 98.637  96.051  71.167  1.00 54.34 ? 705 UMQ A CJ    1 
HETATM 10203 C  CK    . UMQ G  4 .   ? 97.344  96.540  71.776  1.00 54.34 ? 705 UMQ A CK    1 
HETATM 10204 C  CL    . UMQ G  4 .   ? 97.365  96.540  73.282  1.00 54.34 ? 705 UMQ A CL    1 
HETATM 10205 O  O1    . UMQ H  4 .   ? 105.209 78.489  101.270 1.00 43.99 ? 706 UMQ A O1    1 
HETATM 10206 C  "C1'" . UMQ H  4 .   ? 104.616 78.922  97.184  1.00 43.99 ? 706 UMQ A "C1'" 1 
HETATM 10207 C  "C2'" . UMQ H  4 .   ? 105.901 79.524  97.739  1.00 43.99 ? 706 UMQ A "C2'" 1 
HETATM 10208 C  "C3'" . UMQ H  4 .   ? 106.173 78.967  99.131  1.00 43.99 ? 706 UMQ A "C3'" 1 
HETATM 10209 C  "C4'" . UMQ H  4 .   ? 104.960 79.165  100.029 1.00 43.99 ? 706 UMQ A "C4'" 1 
HETATM 10210 C  "C5'" . UMQ H  4 .   ? 103.712 78.584  99.375  1.00 43.99 ? 706 UMQ A "C5'" 1 
HETATM 10211 C  "C6'" . UMQ H  4 .   ? 102.442 78.849  100.150 1.00 43.99 ? 706 UMQ A "C6'" 1 
HETATM 10212 O  "O1'" . UMQ H  4 .   ? 104.375 79.493  95.931  1.00 43.99 ? 706 UMQ A "O1'" 1 
HETATM 10213 O  "O3'" . UMQ H  4 .   ? 107.319 79.595  99.692  1.00 43.99 ? 706 UMQ A "O3'" 1 
HETATM 10214 O  "O5'" . UMQ H  4 .   ? 103.535 79.168  98.071  1.00 43.99 ? 706 UMQ A "O5'" 1 
HETATM 10215 O  "O6'" . UMQ H  4 .   ? 101.316 78.246  99.525  1.00 43.99 ? 706 UMQ A "O6'" 1 
HETATM 10216 O  "O2'" . UMQ H  4 .   ? 106.986 79.216  96.875  1.00 43.99 ? 706 UMQ A "O2'" 1 
HETATM 10217 C  CA    . UMQ H  4 .   ? 104.393 78.551  94.858  1.00 43.99 ? 706 UMQ A CA    1 
HETATM 10218 C  CB    . UMQ H  4 .   ? 102.980 78.332  94.390  1.00 43.99 ? 706 UMQ A CB    1 
HETATM 10219 C  CC    . UMQ H  4 .   ? 102.574 79.238  93.244  1.00 43.99 ? 706 UMQ A CC    1 
HETATM 10220 C  CD    . UMQ H  4 .   ? 103.045 78.753  91.884  1.00 43.99 ? 706 UMQ A CD    1 
HETATM 10221 C  CF    . UMQ H  4 .   ? 102.388 79.479  90.724  1.00 43.99 ? 706 UMQ A CF    1 
HETATM 10222 C  CG    . UMQ H  4 .   ? 102.479 78.740  89.401  1.00 43.99 ? 706 UMQ A CG    1 
HETATM 10223 C  CH    . UMQ H  4 .   ? 101.595 79.332  88.316  1.00 43.99 ? 706 UMQ A CH    1 
HETATM 10224 C  CI    . UMQ H  4 .   ? 101.422 78.437  87.102  1.00 43.99 ? 706 UMQ A CI    1 
HETATM 10225 C  CJ    . UMQ H  4 .   ? 100.329 78.903  86.157  1.00 43.99 ? 706 UMQ A CJ    1 
HETATM 10226 C  CK    . UMQ H  4 .   ? 100.014 77.928  85.044  1.00 43.99 ? 706 UMQ A CK    1 
HETATM 10227 C  CL    . UMQ H  4 .   ? 98.857  78.369  84.179  1.00 43.99 ? 706 UMQ A CL    1 
HETATM 10228 C  C2    . UMQ I  4 .   ? 134.890 115.854 109.247 1.00 50.19 ? 707 UMQ A C2    1 
HETATM 10229 C  C4    . UMQ I  4 .   ? 136.085 114.793 111.182 1.00 50.19 ? 707 UMQ A C4    1 
HETATM 10230 C  C5    . UMQ I  4 .   ? 135.322 113.506 110.879 1.00 50.19 ? 707 UMQ A C5    1 
HETATM 10231 C  C6    . UMQ I  4 .   ? 135.016 112.692 112.115 1.00 50.19 ? 707 UMQ A C6    1 
HETATM 10232 O  O2    . UMQ I  4 .   ? 135.067 116.512 107.999 1.00 50.19 ? 707 UMQ A O2    1 
HETATM 10233 O  O4    . UMQ I  4 .   ? 137.365 114.467 111.711 1.00 50.19 ? 707 UMQ A O4    1 
HETATM 10234 C  C1    . UMQ I  4 .   ? 134.166 114.529 109.038 1.00 50.19 ? 707 UMQ A C1    1 
HETATM 10235 C  C3    . UMQ I  4 .   ? 136.243 115.610 109.905 1.00 50.19 ? 707 UMQ A C3    1 
HETATM 10236 O  O1    . UMQ I  4 .   ? 134.876 113.781 108.076 1.00 50.19 ? 707 UMQ A O1    1 
HETATM 10237 O  O3    . UMQ I  4 .   ? 136.874 116.852 110.197 1.00 50.19 ? 707 UMQ A O3    1 
HETATM 10238 O  O5    . UMQ I  4 .   ? 134.060 113.819 110.263 1.00 50.19 ? 707 UMQ A O5    1 
HETATM 10239 O  O6    . UMQ I  4 .   ? 134.214 113.422 113.035 1.00 50.19 ? 707 UMQ A O6    1 
HETATM 10240 C  "C1'" . UMQ I  4 .   ? 134.068 111.292 104.831 1.00 50.19 ? 707 UMQ A "C1'" 1 
HETATM 10241 C  "C2'" . UMQ I  4 .   ? 133.301 112.608 104.857 1.00 50.19 ? 707 UMQ A "C2'" 1 
HETATM 10242 C  "C3'" . UMQ I  4 .   ? 133.966 113.575 105.831 1.00 50.19 ? 707 UMQ A "C3'" 1 
HETATM 10243 C  "C4'" . UMQ I  4 .   ? 134.121 112.924 107.202 1.00 50.19 ? 707 UMQ A "C4'" 1 
HETATM 10244 C  "C5'" . UMQ I  4 .   ? 134.843 111.588 107.069 1.00 50.19 ? 707 UMQ A "C5'" 1 
HETATM 10245 C  "C6'" . UMQ I  4 .   ? 134.946 110.812 108.359 1.00 50.19 ? 707 UMQ A "C6'" 1 
HETATM 10246 O  "O1'" . UMQ I  4 .   ? 133.414 110.418 103.957 1.00 50.19 ? 707 UMQ A "O1'" 1 
HETATM 10247 O  "O3'" . UMQ I  4 .   ? 133.203 114.774 105.910 1.00 50.19 ? 707 UMQ A "O3'" 1 
HETATM 10248 O  "O5'" . UMQ I  4 .   ? 134.140 110.747 106.137 1.00 50.19 ? 707 UMQ A "O5'" 1 
HETATM 10249 O  "O6'" . UMQ I  4 .   ? 135.732 109.643 108.182 1.00 50.19 ? 707 UMQ A "O6'" 1 
HETATM 10250 O  "O2'" . UMQ I  4 .   ? 133.270 113.172 103.552 1.00 50.19 ? 707 UMQ A "O2'" 1 
HETATM 10251 C  CA    . UMQ I  4 .   ? 134.301 109.602 103.190 1.00 50.19 ? 707 UMQ A CA    1 
HETATM 10252 C  CB    . UMQ I  4 .   ? 133.627 109.193 101.904 1.00 50.19 ? 707 UMQ A CB    1 
HETATM 10253 C  CC    . UMQ I  4 .   ? 133.240 110.367 101.019 1.00 50.19 ? 707 UMQ A CC    1 
HETATM 10254 C  CD    . UMQ I  4 .   ? 132.641 109.966 99.678  1.00 50.19 ? 707 UMQ A CD    1 
HETATM 10255 C  CF    . UMQ I  4 .   ? 131.498 108.972 99.788  1.00 50.19 ? 707 UMQ A CF    1 
HETATM 10256 C  CG    . UMQ I  4 .   ? 130.564 108.954 98.590  1.00 50.19 ? 707 UMQ A CG    1 
HETATM 10257 C  CH    . UMQ I  4 .   ? 131.191 108.486 97.293  1.00 50.19 ? 707 UMQ A CH    1 
HETATM 10258 C  CI    . UMQ I  4 .   ? 130.202 108.453 96.141  1.00 50.19 ? 707 UMQ A CI    1 
HETATM 10259 C  CJ    . UMQ I  4 .   ? 130.772 107.923 94.839  1.00 50.19 ? 707 UMQ A CJ    1 
HETATM 10260 C  CK    . UMQ I  4 .   ? 129.756 107.852 93.715  1.00 50.19 ? 707 UMQ A CK    1 
HETATM 10261 C  CL    . UMQ I  4 .   ? 130.336 107.348 92.414  1.00 50.19 ? 707 UMQ A CL    1 
HETATM 10262 O  O1    . UMQ J  4 .   ? 111.863 82.043  98.767  1.00 35.93 ? 708 UMQ A O1    1 
HETATM 10263 C  "C1'" . UMQ J  4 .   ? 110.256 81.983  94.940  1.00 35.93 ? 708 UMQ A "C1'" 1 
HETATM 10264 C  "C2'" . UMQ J  4 .   ? 109.556 81.106  95.970  1.00 35.93 ? 708 UMQ A "C2'" 1 
HETATM 10265 C  "C3'" . UMQ J  4 .   ? 109.992 81.496  97.377  1.00 35.93 ? 708 UMQ A "C3'" 1 
HETATM 10266 C  "C4'" . UMQ J  4 .   ? 111.511 81.502  97.485  1.00 35.93 ? 708 UMQ A "C4'" 1 
HETATM 10267 C  "C5'" . UMQ J  4 .   ? 112.126 82.361  96.387  1.00 35.93 ? 708 UMQ A "C5'" 1 
HETATM 10268 C  "C6'" . UMQ J  4 .   ? 113.636 82.305  96.353  1.00 35.93 ? 708 UMQ A "C6'" 1 
HETATM 10269 O  "O1'" . UMQ J  4 .   ? 109.894 81.522  93.674  1.00 35.93 ? 708 UMQ A "O1'" 1 
HETATM 10270 O  "O3'" . UMQ J  4 .   ? 109.437 80.588  98.321  1.00 35.93 ? 708 UMQ A "O3'" 1 
HETATM 10271 O  "O5'" . UMQ J  4 .   ? 111.663 81.905  95.104  1.00 35.93 ? 708 UMQ A "O5'" 1 
HETATM 10272 O  "O6'" . UMQ J  4 .   ? 114.168 83.146  95.336  1.00 35.93 ? 708 UMQ A "O6'" 1 
HETATM 10273 O  "O2'" . UMQ J  4 .   ? 108.146 81.243  95.842  1.00 35.93 ? 708 UMQ A "O2'" 1 
HETATM 10274 C  CA    . UMQ J  4 .   ? 109.770 82.552  92.694  1.00 35.93 ? 708 UMQ A CA    1 
HETATM 10275 C  CB    . UMQ J  4 .   ? 109.282 81.923  91.416  1.00 35.93 ? 708 UMQ A CB    1 
HETATM 10276 C  CC    . UMQ J  4 .   ? 107.945 81.231  91.583  1.00 35.93 ? 708 UMQ A CC    1 
HETATM 10277 C  CD    . UMQ J  4 .   ? 107.519 80.418  90.377  1.00 35.93 ? 708 UMQ A CD    1 
HETATM 10278 C  CF    . UMQ J  4 .   ? 107.430 81.215  89.088  1.00 35.93 ? 708 UMQ A CF    1 
HETATM 10279 C  CG    . UMQ J  4 .   ? 106.920 80.398  87.914  1.00 35.93 ? 708 UMQ A CG    1 
HETATM 10280 C  CH    . UMQ J  4 .   ? 106.815 81.169  86.611  1.00 35.93 ? 708 UMQ A CH    1 
HETATM 10281 C  CI    . UMQ J  4 .   ? 106.245 80.348  85.467  1.00 35.93 ? 708 UMQ A CI    1 
HETATM 10282 C  CJ    . UMQ J  4 .   ? 106.161 81.098  84.150  1.00 35.93 ? 708 UMQ A CJ    1 
HETATM 10283 C  CK    . UMQ J  4 .   ? 105.579 80.279  83.016  1.00 35.93 ? 708 UMQ A CK    1 
HETATM 10284 C  CL    . UMQ J  4 .   ? 105.537 81.025  81.703  1.00 35.93 ? 708 UMQ A CL    1 
HETATM 10285 C  CA    . UMQ K  4 .   ? 100.669 107.783 63.140  1.00 37.03 ? 709 UMQ A CA    1 
HETATM 10286 C  CB    . UMQ K  4 .   ? 99.583  106.951 63.774  1.00 37.03 ? 709 UMQ A CB    1 
HETATM 10287 C  CC    . UMQ K  4 .   ? 98.424  107.781 64.298  1.00 37.03 ? 709 UMQ A CC    1 
HETATM 10288 C  CD    . UMQ K  4 .   ? 97.271  106.955 64.846  1.00 37.03 ? 709 UMQ A CD    1 
HETATM 10289 C  CF    . UMQ K  4 .   ? 97.611  106.157 66.093  1.00 37.03 ? 709 UMQ A CF    1 
HETATM 10290 C  CG    . UMQ K  4 .   ? 97.936  107.015 67.302  1.00 37.03 ? 709 UMQ A CG    1 
HETATM 10291 C  CH    . UMQ K  4 .   ? 98.216  106.217 68.563  1.00 37.03 ? 709 UMQ A CH    1 
HETATM 10292 C  CI    . UMQ K  4 .   ? 98.528  107.075 69.775  1.00 37.03 ? 709 UMQ A CI    1 
HETATM 10293 C  CJ    . UMQ K  4 .   ? 98.807  106.275 71.034  1.00 37.03 ? 709 UMQ A CJ    1 
HETATM 10294 C  CK    . UMQ K  4 .   ? 99.167  107.124 72.233  1.00 37.03 ? 709 UMQ A CK    1 
HETATM 10295 C  CL    . UMQ K  4 .   ? 99.452  106.310 73.469  1.00 37.03 ? 709 UMQ A CL    1 
HETATM 10296 C  "C1'" . UMQ L  4 .   ? 100.530 113.795 71.579  1.00 35.23 ? 710 UMQ A "C1'" 1 
HETATM 10297 O  "O1'" . UMQ L  4 .   ? 100.561 113.296 72.883  1.00 35.23 ? 710 UMQ A "O1'" 1 
HETATM 10298 C  CA    . UMQ L  4 .   ? 100.646 111.873 72.957  1.00 35.23 ? 710 UMQ A CA    1 
HETATM 10299 C  CB    . UMQ L  4 .   ? 100.878 111.471 74.390  1.00 35.23 ? 710 UMQ A CB    1 
HETATM 10300 C  CC    . UMQ L  4 .   ? 100.996 109.970 74.577  1.00 35.23 ? 710 UMQ A CC    1 
HETATM 10301 C  CD    . UMQ L  4 .   ? 101.277 109.548 76.010  1.00 35.23 ? 710 UMQ A CD    1 
HETATM 10302 C  CF    . UMQ L  4 .   ? 100.150 109.855 76.980  1.00 35.23 ? 710 UMQ A CF    1 
HETATM 10303 C  CG    . UMQ L  4 .   ? 98.880  109.066 76.715  1.00 35.23 ? 710 UMQ A CG    1 
HETATM 10304 C  CH    . UMQ L  4 .   ? 99.003  107.576 76.993  1.00 35.23 ? 710 UMQ A CH    1 
HETATM 10305 C  CI    . UMQ L  4 .   ? 99.137  107.230 78.467  1.00 35.23 ? 710 UMQ A CI    1 
HETATM 10306 C  CJ    . UMQ L  4 .   ? 99.192  105.736 78.744  1.00 35.23 ? 710 UMQ A CJ    1 
HETATM 10307 C  CK    . UMQ L  4 .   ? 99.196  105.379 80.215  1.00 35.23 ? 710 UMQ A CK    1 
HETATM 10308 C  CL    . UMQ L  4 .   ? 97.960  105.846 80.943  1.00 35.23 ? 710 UMQ A CL    1 
HETATM 10309 C  CA    . UMQ M  4 .   ? 97.101  96.117  92.195  1.00 20.55 ? 711 UMQ A CA    1 
HETATM 10310 C  CB    . UMQ M  4 .   ? 98.080  95.926  91.066  1.00 20.55 ? 711 UMQ A CB    1 
HETATM 10311 C  CC    . UMQ M  4 .   ? 97.450  96.075  89.695  1.00 20.55 ? 711 UMQ A CC    1 
HETATM 10312 C  CD    . UMQ M  4 .   ? 96.759  97.407  89.484  1.00 20.55 ? 711 UMQ A CD    1 
HETATM 10313 C  CF    . UMQ M  4 .   ? 96.386  97.686  88.039  1.00 20.55 ? 711 UMQ A CF    1 
HETATM 10314 C  CG    . UMQ M  4 .   ? 95.799  99.069  87.827  1.00 20.55 ? 711 UMQ A CG    1 
HETATM 10315 C  CH    . UMQ M  4 .   ? 95.899  99.577  86.402  1.00 20.55 ? 711 UMQ A CH    1 
HETATM 10316 C  CI    . UMQ M  4 .   ? 95.545  101.046 86.269  1.00 20.55 ? 711 UMQ A CI    1 
HETATM 10317 C  CJ    . UMQ M  4 .   ? 95.930  101.662 84.938  1.00 20.55 ? 711 UMQ A CJ    1 
HETATM 10318 C  CK    . UMQ M  4 .   ? 95.703  103.158 84.879  1.00 20.55 ? 711 UMQ A CK    1 
HETATM 10319 C  CL    . UMQ M  4 .   ? 96.156  103.778 83.582  1.00 20.55 ? 711 UMQ A CL    1 
HETATM 10320 C  CB    . UMQ N  4 .   ? 108.231 128.843 91.660  1.00 28.97 ? 712 UMQ A CB    1 
HETATM 10321 C  CC    . UMQ N  4 .   ? 106.895 128.529 92.312  1.00 28.97 ? 712 UMQ A CC    1 
HETATM 10322 C  CD    . UMQ N  4 .   ? 105.897 127.867 91.379  1.00 28.97 ? 712 UMQ A CD    1 
HETATM 10323 C  CF    . UMQ N  4 .   ? 105.465 128.742 90.218  1.00 28.97 ? 712 UMQ A CF    1 
HETATM 10324 C  CG    . UMQ N  4 .   ? 104.549 128.041 89.233  1.00 28.97 ? 712 UMQ A CG    1 
HETATM 10325 C  CH    . UMQ N  4 .   ? 105.193 126.847 88.555  1.00 28.97 ? 712 UMQ A CH    1 
HETATM 10326 C  CI    . UMQ N  4 .   ? 104.324 126.185 87.499  1.00 28.97 ? 712 UMQ A CI    1 
HETATM 10327 C  CJ    . UMQ N  4 .   ? 105.030 125.069 86.748  1.00 28.97 ? 712 UMQ A CJ    1 
HETATM 10328 C  CK    . UMQ N  4 .   ? 104.207 124.438 85.653  1.00 28.97 ? 712 UMQ A CK    1 
HETATM 10329 C  CL    . UMQ N  4 .   ? 104.946 123.358 84.907  1.00 28.97 ? 712 UMQ A CL    1 
HETATM 10330 O  "O1'" . UMQ O  4 .   ? 123.792 105.938 72.507  1.00 34.09 ? 713 UMQ A "O1'" 1 
HETATM 10331 C  CA    . UMQ O  4 .   ? 123.833 106.290 73.890  1.00 34.09 ? 713 UMQ A CA    1 
HETATM 10332 C  CB    . UMQ O  4 .   ? 124.362 107.696 74.023  1.00 34.09 ? 713 UMQ A CB    1 
HETATM 10333 C  CC    . UMQ O  4 .   ? 124.368 108.197 75.456  1.00 34.09 ? 713 UMQ A CC    1 
HETATM 10334 C  CD    . UMQ O  4 .   ? 124.788 109.649 75.598  1.00 34.09 ? 713 UMQ A CD    1 
HETATM 10335 C  CF    . UMQ O  4 .   ? 124.599 110.203 76.998  1.00 34.09 ? 713 UMQ A CF    1 
HETATM 10336 C  CG    . UMQ O  4 .   ? 124.821 111.699 77.099  1.00 34.09 ? 713 UMQ A CG    1 
HETATM 10337 C  CH    . UMQ O  4 .   ? 126.267 112.125 76.944  1.00 34.09 ? 713 UMQ A CH    1 
HETATM 10338 C  CI    . UMQ O  4 .   ? 126.879 112.648 78.229  1.00 34.09 ? 713 UMQ A CI    1 
HETATM 10339 C  CJ    . UMQ O  4 .   ? 126.120 113.820 78.823  1.00 34.09 ? 713 UMQ A CJ    1 
HETATM 10340 C  CK    . UMQ O  4 .   ? 126.705 114.352 80.111  1.00 34.09 ? 713 UMQ A CK    1 
HETATM 10341 C  CL    . UMQ O  4 .   ? 125.924 115.511 80.681  1.00 34.09 ? 713 UMQ A CL    1 
HETATM 10342 C  C2    . UMQ P  4 .   ? 91.746  86.665  57.198  1.00 53.56 ? 714 UMQ A C2    1 
HETATM 10343 C  C4    . UMQ P  4 .   ? 91.834  89.165  57.028  1.00 53.56 ? 714 UMQ A C4    1 
HETATM 10344 C  C5    . UMQ P  4 .   ? 90.631  89.222  57.965  1.00 53.56 ? 714 UMQ A C5    1 
HETATM 10345 C  C6    . UMQ P  4 .   ? 89.716  90.390  57.686  1.00 53.56 ? 714 UMQ A C6    1 
HETATM 10346 O  O2    . UMQ P  4 .   ? 92.479  85.504  57.571  1.00 53.56 ? 714 UMQ A O2    1 
HETATM 10347 O  O4    . UMQ P  4 .   ? 92.646  90.313  57.241  1.00 53.56 ? 714 UMQ A O4    1 
HETATM 10348 C  C1    . UMQ P  4 .   ? 90.521  86.816  58.094  1.00 53.56 ? 714 UMQ A C1    1 
HETATM 10349 C  C3    . UMQ P  4 .   ? 92.634  87.899  57.302  1.00 53.56 ? 714 UMQ A C3    1 
HETATM 10350 O  O1    . UMQ P  4 .   ? 90.926  86.718  59.444  1.00 53.56 ? 714 UMQ A O1    1 
HETATM 10351 O  O3    . UMQ P  4 .   ? 93.713  87.799  56.380  1.00 53.56 ? 714 UMQ A O3    1 
HETATM 10352 O  O5    . UMQ P  4 .   ? 89.836  88.032  57.823  1.00 53.56 ? 714 UMQ A O5    1 
HETATM 10353 O  O6    . UMQ P  4 .   ? 89.088  90.264  56.417  1.00 53.56 ? 714 UMQ A O6    1 
HETATM 10354 C  "C1'" . UMQ P  4 .   ? 89.197  85.496  63.076  1.00 53.56 ? 714 UMQ A "C1'" 1 
HETATM 10355 C  "C2'" . UMQ P  4 .   ? 88.883  84.630  61.861  1.00 53.56 ? 714 UMQ A "C2'" 1 
HETATM 10356 C  "C3'" . UMQ P  4 .   ? 89.867  84.908  60.727  1.00 53.56 ? 714 UMQ A "C3'" 1 
HETATM 10357 C  "C4'" . UMQ P  4 .   ? 89.930  86.405  60.435  1.00 53.56 ? 714 UMQ A "C4'" 1 
HETATM 10358 C  "C5'" . UMQ P  4 .   ? 90.260  87.158  61.718  1.00 53.56 ? 714 UMQ A "C5'" 1 
HETATM 10359 C  "C6'" . UMQ P  4 .   ? 90.289  88.659  61.563  1.00 53.56 ? 714 UMQ A "C6'" 1 
HETATM 10360 O  "O1'" . UMQ P  4 .   ? 88.168  85.318  64.005  1.00 53.56 ? 714 UMQ A "O1'" 1 
HETATM 10361 O  "O3'" . UMQ P  4 .   ? 89.484  84.147  59.587  1.00 53.56 ? 714 UMQ A "O3'" 1 
HETATM 10362 O  "O5'" . UMQ P  4 .   ? 89.261  86.865  62.709  1.00 53.56 ? 714 UMQ A "O5'" 1 
HETATM 10363 O  "O6'" . UMQ P  4 .   ? 90.635  89.297  62.783  1.00 53.56 ? 714 UMQ A "O6'" 1 
HETATM 10364 O  "O2'" . UMQ P  4 .   ? 88.939  83.253  62.218  1.00 53.56 ? 714 UMQ A "O2'" 1 
HETATM 10365 C  CA    . UMQ P  4 .   ? 88.578  84.688  65.219  1.00 53.56 ? 714 UMQ A CA    1 
HETATM 10366 C  CB    . UMQ P  4 .   ? 88.540  85.705  66.329  1.00 53.56 ? 714 UMQ A CB    1 
HETATM 10367 C  CC    . UMQ P  4 .   ? 88.553  85.088  67.717  1.00 53.56 ? 714 UMQ A CC    1 
HETATM 10368 C  CD    . UMQ P  4 .   ? 88.557  86.118  68.831  1.00 53.56 ? 714 UMQ A CD    1 
HETATM 10369 C  CF    . UMQ P  4 .   ? 88.276  85.557  70.213  1.00 53.56 ? 714 UMQ A CF    1 
HETATM 10370 C  CG    . UMQ P  4 .   ? 88.420  86.595  71.311  1.00 53.56 ? 714 UMQ A CG    1 
HETATM 10371 C  CH    . UMQ P  4 .   ? 87.957  86.146  72.686  1.00 53.56 ? 714 UMQ A CH    1 
HETATM 10372 C  CI    . UMQ P  4 .   ? 88.628  84.889  73.197  1.00 53.56 ? 714 UMQ A CI    1 
HETATM 10373 C  CJ    . UMQ P  4 .   ? 88.624  84.778  74.711  1.00 53.56 ? 714 UMQ A CJ    1 
HETATM 10374 C  CK    . UMQ P  4 .   ? 87.271  84.981  75.345  1.00 53.56 ? 714 UMQ A CK    1 
HETATM 10375 C  CL    . UMQ P  4 .   ? 87.318  84.953  76.851  1.00 53.56 ? 714 UMQ A CL    1 
HETATM 10376 C  C2    . UMQ Q  4 .   ? 95.658  100.744 57.198  1.00 54.11 ? 901 UMQ B C2    1 
HETATM 10377 C  C4    . UMQ Q  4 .   ? 95.569  98.244  57.029  1.00 54.11 ? 901 UMQ B C4    1 
HETATM 10378 C  C5    . UMQ Q  4 .   ? 96.772  98.187  57.966  1.00 54.11 ? 901 UMQ B C5    1 
HETATM 10379 C  C6    . UMQ Q  4 .   ? 97.687  97.018  57.687  1.00 54.11 ? 901 UMQ B C6    1 
HETATM 10380 O  O2    . UMQ Q  4 .   ? 94.925  101.905 57.571  1.00 54.11 ? 901 UMQ B O2    1 
HETATM 10381 O  O4    . UMQ Q  4 .   ? 94.756  97.096  57.242  1.00 54.11 ? 901 UMQ B O4    1 
HETATM 10382 C  C1    . UMQ Q  4 .   ? 96.883  100.592 58.094  1.00 54.11 ? 901 UMQ B C1    1 
HETATM 10383 C  C3    . UMQ Q  4 .   ? 94.769  99.510  57.303  1.00 54.11 ? 901 UMQ B C3    1 
HETATM 10384 O  O1    . UMQ Q  4 .   ? 96.478  100.690 59.444  1.00 54.11 ? 901 UMQ B O1    1 
HETATM 10385 O  O3    . UMQ Q  4 .   ? 93.690  99.610  56.381  1.00 54.11 ? 901 UMQ B O3    1 
HETATM 10386 O  O5    . UMQ Q  4 .   ? 97.568  99.377  57.823  1.00 54.11 ? 901 UMQ B O5    1 
HETATM 10387 O  O6    . UMQ Q  4 .   ? 98.315  97.144  56.417  1.00 54.11 ? 901 UMQ B O6    1 
HETATM 10388 C  "C1'" . UMQ Q  4 .   ? 98.208  101.912 63.076  1.00 54.11 ? 901 UMQ B "C1'" 1 
HETATM 10389 C  "C2'" . UMQ Q  4 .   ? 98.522  102.779 61.860  1.00 54.11 ? 901 UMQ B "C2'" 1 
HETATM 10390 C  "C3'" . UMQ Q  4 .   ? 97.537  102.500 60.727  1.00 54.11 ? 901 UMQ B "C3'" 1 
HETATM 10391 C  "C4'" . UMQ Q  4 .   ? 97.474  101.004 60.435  1.00 54.11 ? 901 UMQ B "C4'" 1 
HETATM 10392 C  "C5'" . UMQ Q  4 .   ? 97.145  100.250 61.718  1.00 54.11 ? 901 UMQ B "C5'" 1 
HETATM 10393 C  "C6'" . UMQ Q  4 .   ? 97.115  98.750  61.563  1.00 54.11 ? 901 UMQ B "C6'" 1 
HETATM 10394 O  "O1'" . UMQ Q  4 .   ? 99.237  102.090 64.005  1.00 54.11 ? 901 UMQ B "O1'" 1 
HETATM 10395 O  "O3'" . UMQ Q  4 .   ? 97.921  103.262 59.587  1.00 54.11 ? 901 UMQ B "O3'" 1 
HETATM 10396 O  "O5'" . UMQ Q  4 .   ? 98.144  100.544 62.709  1.00 54.11 ? 901 UMQ B "O5'" 1 
HETATM 10397 O  "O6'" . UMQ Q  4 .   ? 96.770  98.112  62.783  1.00 54.11 ? 901 UMQ B "O6'" 1 
HETATM 10398 O  "O2'" . UMQ Q  4 .   ? 98.466  104.155 62.218  1.00 54.11 ? 901 UMQ B "O2'" 1 
HETATM 10399 C  CA    . UMQ Q  4 .   ? 98.828  102.721 65.219  1.00 54.11 ? 901 UMQ B CA    1 
HETATM 10400 C  CB    . UMQ Q  4 .   ? 98.866  101.704 66.329  1.00 54.11 ? 901 UMQ B CB    1 
HETATM 10401 C  CC    . UMQ Q  4 .   ? 98.853  102.321 67.717  1.00 54.11 ? 901 UMQ B CC    1 
HETATM 10402 C  CD    . UMQ Q  4 .   ? 98.850  101.291 68.831  1.00 54.11 ? 901 UMQ B CD    1 
HETATM 10403 C  CF    . UMQ Q  4 .   ? 99.131  101.852 70.213  1.00 54.11 ? 901 UMQ B CF    1 
HETATM 10404 C  CG    . UMQ Q  4 .   ? 98.987  100.814 71.310  1.00 54.11 ? 901 UMQ B CG    1 
HETATM 10405 C  CH    . UMQ Q  4 .   ? 99.451  101.263 72.685  1.00 54.11 ? 901 UMQ B CH    1 
HETATM 10406 C  CI    . UMQ Q  4 .   ? 98.779  102.520 73.197  1.00 54.11 ? 901 UMQ B CI    1 
HETATM 10407 C  CJ    . UMQ Q  4 .   ? 98.784  102.631 74.711  1.00 54.11 ? 901 UMQ B CJ    1 
HETATM 10408 C  CK    . UMQ Q  4 .   ? 100.137 102.428 75.344  1.00 54.11 ? 901 UMQ B CK    1 
HETATM 10409 C  CL    . UMQ Q  4 .   ? 100.090 102.456 76.850  1.00 54.11 ? 901 UMQ B CL    1 
HETATM 10410 CA CA    . CA  R  2 .   ? 67.299  77.345  91.894  1.00 28.63 ? 902 CA  B CA    1 
HETATM 10411 CA CA    . CA  S  2 .   ? 69.413  78.427  95.865  1.00 19.90 ? 903 CA  B CA    1 
HETATM 10412 CA CA    . CA  T  2 .   ? 87.115  99.646  97.122  1.00 24.69 ? 904 CA  B CA    1 
HETATM 10413 O  O12   . PC1 U  3 .   ? 95.674  77.199  100.440 1.00 30.74 ? 905 PC1 B O12   1 
HETATM 10414 P  P     . PC1 U  3 .   ? 94.680  78.257  100.159 1.00 30.74 ? 905 PC1 B P     1 
HETATM 10415 O  O14   . PC1 U  3 .   ? 93.633  78.555  101.160 1.00 30.74 ? 905 PC1 B O14   1 
HETATM 10416 O  O13   . PC1 U  3 .   ? 95.471  79.590  99.787  1.00 30.74 ? 905 PC1 B O13   1 
HETATM 10417 C  C11   . PC1 U  3 .   ? 95.391  80.784  100.608 1.00 30.74 ? 905 PC1 B C11   1 
HETATM 10418 C  C12   . PC1 U  3 .   ? 96.552  81.644  100.161 1.00 30.74 ? 905 PC1 B C12   1 
HETATM 10419 N  N     . PC1 U  3 .   ? 96.231  82.753  99.176  1.00 30.74 ? 905 PC1 B N     1 
HETATM 10420 C  C13   . PC1 U  3 .   ? 95.933  82.189  97.821  1.00 30.74 ? 905 PC1 B C13   1 
HETATM 10421 C  C14   . PC1 U  3 .   ? 95.045  83.536  99.647  1.00 30.74 ? 905 PC1 B C14   1 
HETATM 10422 C  C15   . PC1 U  3 .   ? 97.406  83.674  99.071  1.00 30.74 ? 905 PC1 B C15   1 
HETATM 10423 O  O11   . PC1 U  3 .   ? 94.026  77.954  98.736  1.00 30.74 ? 905 PC1 B O11   1 
HETATM 10424 C  C1    . PC1 U  3 .   ? 93.512  79.049  97.953  1.00 30.74 ? 905 PC1 B C1    1 
HETATM 10425 C  C2    . PC1 U  3 .   ? 92.959  78.579  96.635  1.00 30.74 ? 905 PC1 B C2    1 
HETATM 10426 O  O21   . PC1 U  3 .   ? 94.012  77.854  95.927  1.00 30.74 ? 905 PC1 B O21   1 
HETATM 10427 C  C21   . PC1 U  3 .   ? 93.981  76.515  95.963  1.00 30.74 ? 905 PC1 B C21   1 
HETATM 10428 O  O22   . PC1 U  3 .   ? 93.155  75.884  96.558  1.00 30.74 ? 905 PC1 B O22   1 
HETATM 10429 C  C22   . PC1 U  3 .   ? 95.104  75.925  95.167  1.00 30.74 ? 905 PC1 B C22   1 
HETATM 10430 C  C23   . PC1 U  3 .   ? 94.735  74.600  94.518  1.00 30.74 ? 905 PC1 B C23   1 
HETATM 10431 C  C24   . PC1 U  3 .   ? 95.715  74.181  93.449  1.00 30.74 ? 905 PC1 B C24   1 
HETATM 10432 C  C25   . PC1 U  3 .   ? 95.275  72.970  92.655  1.00 30.74 ? 905 PC1 B C25   1 
HETATM 10433 C  C26   . PC1 U  3 .   ? 93.933  73.134  91.976  1.00 30.74 ? 905 PC1 B C26   1 
HETATM 10434 C  C27   . PC1 U  3 .   ? 93.574  72.000  91.034  1.00 30.74 ? 905 PC1 B C27   1 
HETATM 10435 C  C28   . PC1 U  3 .   ? 92.234  72.173  90.348  1.00 30.74 ? 905 PC1 B C28   1 
HETATM 10436 C  C29   . PC1 U  3 .   ? 92.113  73.448  89.535  1.00 30.74 ? 905 PC1 B C29   1 
HETATM 10437 C  C2A   . PC1 U  3 .   ? 93.071  73.529  88.368  1.00 30.74 ? 905 PC1 B C2A   1 
HETATM 10438 C  C2B   . PC1 U  3 .   ? 93.051  74.859  87.646  1.00 30.74 ? 905 PC1 B C2B   1 
HETATM 10439 C  C2C   . PC1 U  3 .   ? 94.021  74.937  86.485  1.00 30.74 ? 905 PC1 B C2C   1 
HETATM 10440 C  C2D   . PC1 U  3 .   ? 93.717  73.967  85.361  1.00 30.74 ? 905 PC1 B C2D   1 
HETATM 10441 C  C2E   . PC1 U  3 .   ? 92.387  74.219  84.678  1.00 30.74 ? 905 PC1 B C2E   1 
HETATM 10442 C  C3    . PC1 U  3 .   ? 92.589  79.758  95.779  1.00 30.74 ? 905 PC1 B C3    1 
HETATM 10443 O  O31   . PC1 U  3 .   ? 91.314  79.586  95.120  1.00 30.74 ? 905 PC1 B O31   1 
HETATM 10444 C  C31   . PC1 U  3 .   ? 90.306  80.327  95.579  1.00 30.74 ? 905 PC1 B C31   1 
HETATM 10445 O  O32   . PC1 U  3 .   ? 90.355  80.952  96.600  1.00 30.74 ? 905 PC1 B O32   1 
HETATM 10446 C  C32   . PC1 U  3 .   ? 89.142  80.311  94.637  1.00 30.74 ? 905 PC1 B C32   1 
HETATM 10447 C  C33   . PC1 U  3 .   ? 89.270  81.414  93.597  1.00 30.74 ? 905 PC1 B C33   1 
HETATM 10448 C  C34   . PC1 U  3 .   ? 88.190  81.400  92.535  1.00 30.74 ? 905 PC1 B C34   1 
HETATM 10449 C  C35   . PC1 U  3 .   ? 88.370  82.499  91.507  1.00 30.74 ? 905 PC1 B C35   1 
HETATM 10450 C  C36   . PC1 U  3 .   ? 87.245  82.631  90.503  1.00 30.74 ? 905 PC1 B C36   1 
HETATM 10451 C  C37   . PC1 U  3 .   ? 87.257  81.605  89.393  1.00 30.74 ? 905 PC1 B C37   1 
HETATM 10452 C  C38   . PC1 U  3 .   ? 86.161  81.821  88.365  1.00 30.74 ? 905 PC1 B C38   1 
HETATM 10453 C  C39   . PC1 U  3 .   ? 86.168  80.820  87.231  1.00 30.74 ? 905 PC1 B C39   1 
HETATM 10454 C  C3A   . PC1 U  3 .   ? 87.352  80.947  86.298  1.00 30.74 ? 905 PC1 B C3A   1 
HETATM 10455 C  C3B   . PC1 U  3 .   ? 87.516  79.768  85.362  1.00 30.74 ? 905 PC1 B C3B   1 
HETATM 10456 C  C3C   . PC1 U  3 .   ? 88.678  79.896  84.401  1.00 30.74 ? 905 PC1 B C3C   1 
HETATM 10457 C  C3D   . PC1 U  3 .   ? 89.237  78.564  83.939  1.00 30.74 ? 905 PC1 B C3D   1 
HETATM 10458 C  C3E   . PC1 U  3 .   ? 88.239  77.674  83.229  1.00 30.74 ? 905 PC1 B C3E   1 
HETATM 10459 C  C3F   . PC1 U  3 .   ? 87.845  78.165  81.854  1.00 30.74 ? 905 PC1 B C3F   1 
HETATM 10460 C  C2    . UMQ V  4 .   ? 81.280  87.515  56.578  1.00 53.71 ? 906 UMQ B C2    1 
HETATM 10461 C  C4    . UMQ V  4 .   ? 79.674  89.443  56.407  1.00 53.71 ? 906 UMQ B C4    1 
HETATM 10462 C  C5    . UMQ V  4 .   ? 80.337  90.084  57.626  1.00 53.71 ? 906 UMQ B C5    1 
HETATM 10463 C  C6    . UMQ V  4 .   ? 79.572  89.856  58.911  1.00 53.71 ? 906 UMQ B C6    1 
HETATM 10464 O  O2    . UMQ V  4 .   ? 82.386  86.890  55.937  1.00 53.71 ? 906 UMQ B O2    1 
HETATM 10465 O  O4    . UMQ V  4 .   ? 79.182  90.467  55.551  1.00 53.71 ? 906 UMQ B O4    1 
HETATM 10466 C  C1    . UMQ V  4 .   ? 81.731  88.139  57.894  1.00 53.71 ? 906 UMQ B C1    1 
HETATM 10467 C  C3    . UMQ V  4 .   ? 80.680  88.575  55.659  1.00 53.71 ? 906 UMQ B C3    1 
HETATM 10468 O  O1    . UMQ V  4 .   ? 83.027  87.633  58.186  1.00 53.71 ? 906 UMQ B O1    1 
HETATM 10469 O  O3    . UMQ V  4 .   ? 80.054  87.954  54.542  1.00 53.71 ? 906 UMQ B O3    1 
HETATM 10470 O  O5    . UMQ V  4 .   ? 81.665  89.557  57.819  1.00 53.71 ? 906 UMQ B O5    1 
HETATM 10471 O  O6    . UMQ V  4 .   ? 78.217  90.269  58.785  1.00 53.71 ? 906 UMQ B O6    1 
HETATM 10472 C  "C1'" . UMQ V  4 .   ? 84.493  90.042  61.274  1.00 53.71 ? 906 UMQ B "C1'" 1 
HETATM 10473 C  "C2'" . UMQ V  4 .   ? 85.446  89.754  60.123  1.00 53.71 ? 906 UMQ B "C2'" 1 
HETATM 10474 C  "C3'" . UMQ V  4 .   ? 84.655  89.211  58.942  1.00 53.71 ? 906 UMQ B "C3'" 1 
HETATM 10475 C  "C4'" . UMQ V  4 .   ? 83.796  88.016  59.349  1.00 53.71 ? 906 UMQ B "C4'" 1 
HETATM 10476 C  "C5'" . UMQ V  4 .   ? 82.983  88.287  60.620  1.00 53.71 ? 906 UMQ B "C5'" 1 
HETATM 10477 C  "C6'" . UMQ V  4 .   ? 82.378  87.044  61.240  1.00 53.71 ? 906 UMQ B "C6'" 1 
HETATM 10478 O  "O1'" . UMQ V  4 .   ? 85.241  90.541  62.346  1.00 53.71 ? 906 UMQ B "O1'" 1 
HETATM 10479 O  "O3'" . UMQ V  4 .   ? 85.544  88.844  57.894  1.00 53.71 ? 906 UMQ B "O3'" 1 
HETATM 10480 O  "O5'" . UMQ V  4 .   ? 83.823  88.852  61.645  1.00 53.71 ? 906 UMQ B "O5'" 1 
HETATM 10481 O  "O6'" . UMQ V  4 .   ? 81.530  87.373  62.331  1.00 53.71 ? 906 UMQ B "O6'" 1 
HETATM 10482 O  "O2'" . UMQ V  4 .   ? 86.131  90.943  59.748  1.00 53.71 ? 906 UMQ B "O2'" 1 
HETATM 10483 C  CA    . UMQ V  4 .   ? 86.112  89.581  62.946  1.00 53.71 ? 906 UMQ B CA    1 
HETATM 10484 C  CB    . UMQ V  4 .   ? 87.427  90.244  63.262  1.00 53.71 ? 906 UMQ B CB    1 
HETATM 10485 C  CC    . UMQ V  4 .   ? 87.526  90.752  64.686  1.00 53.71 ? 906 UMQ B CC    1 
HETATM 10486 C  CD    . UMQ V  4 .   ? 87.246  89.680  65.722  1.00 53.71 ? 906 UMQ B CD    1 
HETATM 10487 C  CF    . UMQ V  4 .   ? 87.686  90.038  67.127  1.00 53.71 ? 906 UMQ B CF    1 
HETATM 10488 C  CG    . UMQ V  4 .   ? 87.256  91.419  67.576  1.00 53.71 ? 906 UMQ B CG    1 
HETATM 10489 C  CH    . UMQ V  4 .   ? 87.368  91.625  69.072  1.00 53.71 ? 906 UMQ B CH    1 
HETATM 10490 C  CI    . UMQ V  4 .   ? 88.723  91.273  69.653  1.00 53.71 ? 906 UMQ B CI    1 
HETATM 10491 C  CJ    . UMQ V  4 .   ? 88.769  91.359  71.167  1.00 53.71 ? 906 UMQ B CJ    1 
HETATM 10492 C  CK    . UMQ V  4 .   ? 90.062  90.869  71.775  1.00 53.71 ? 906 UMQ B CK    1 
HETATM 10493 C  CL    . UMQ V  4 .   ? 90.042  90.870  73.282  1.00 53.71 ? 906 UMQ B CL    1 
HETATM 10494 O  O1    . UMQ W  4 .   ? 82.201  108.922 101.270 1.00 42.33 ? 907 UMQ B O1    1 
HETATM 10495 C  "C1'" . UMQ W  4 .   ? 82.793  108.488 97.184  1.00 42.33 ? 907 UMQ B "C1'" 1 
HETATM 10496 C  "C2'" . UMQ W  4 .   ? 81.508  107.885 97.739  1.00 42.33 ? 907 UMQ B "C2'" 1 
HETATM 10497 C  "C3'" . UMQ W  4 .   ? 81.236  108.443 99.131  1.00 42.33 ? 907 UMQ B "C3'" 1 
HETATM 10498 C  "C4'" . UMQ W  4 .   ? 82.449  108.245 100.029 1.00 42.33 ? 907 UMQ B "C4'" 1 
HETATM 10499 C  "C5'" . UMQ W  4 .   ? 83.698  108.826 99.374  1.00 42.33 ? 907 UMQ B "C5'" 1 
HETATM 10500 C  "C6'" . UMQ W  4 .   ? 84.967  108.561 100.150 1.00 42.33 ? 907 UMQ B "C6'" 1 
HETATM 10501 O  "O1'" . UMQ W  4 .   ? 83.033  107.918 95.931  1.00 42.33 ? 907 UMQ B "O1'" 1 
HETATM 10502 O  "O3'" . UMQ W  4 .   ? 80.090  107.815 99.693  1.00 42.33 ? 907 UMQ B "O3'" 1 
HETATM 10503 O  "O5'" . UMQ W  4 .   ? 83.874  108.242 98.070  1.00 42.33 ? 907 UMQ B "O5'" 1 
HETATM 10504 O  "O6'" . UMQ W  4 .   ? 86.093  109.165 99.524  1.00 42.33 ? 907 UMQ B "O6'" 1 
HETATM 10505 O  "O2'" . UMQ W  4 .   ? 80.422  108.193 96.875  1.00 42.33 ? 907 UMQ B "O2'" 1 
HETATM 10506 C  CA    . UMQ W  4 .   ? 83.015  108.859 94.858  1.00 42.33 ? 907 UMQ B CA    1 
HETATM 10507 C  CB    . UMQ W  4 .   ? 84.428  109.078 94.390  1.00 42.33 ? 907 UMQ B CB    1 
HETATM 10508 C  CC    . UMQ W  4 .   ? 84.834  108.172 93.244  1.00 42.33 ? 907 UMQ B CC    1 
HETATM 10509 C  CD    . UMQ W  4 .   ? 84.363  108.657 91.884  1.00 42.33 ? 907 UMQ B CD    1 
HETATM 10510 C  CF    . UMQ W  4 .   ? 85.019  107.931 90.723  1.00 42.33 ? 907 UMQ B CF    1 
HETATM 10511 C  CG    . UMQ W  4 .   ? 84.928  108.670 89.400  1.00 42.33 ? 907 UMQ B CG    1 
HETATM 10512 C  CH    . UMQ W  4 .   ? 85.812  108.078 88.316  1.00 42.33 ? 907 UMQ B CH    1 
HETATM 10513 C  CI    . UMQ W  4 .   ? 85.985  108.973 87.101  1.00 42.33 ? 907 UMQ B CI    1 
HETATM 10514 C  CJ    . UMQ W  4 .   ? 87.078  108.507 86.156  1.00 42.33 ? 907 UMQ B CJ    1 
HETATM 10515 C  CK    . UMQ W  4 .   ? 87.392  109.482 85.043  1.00 42.33 ? 907 UMQ B CK    1 
HETATM 10516 C  CL    . UMQ W  4 .   ? 88.548  109.041 84.177  1.00 42.33 ? 907 UMQ B CL    1 
HETATM 10517 C  C2    . UMQ X  4 .   ? 52.528  71.552  109.257 1.00 50.08 ? 908 UMQ B C2    1 
HETATM 10518 C  C4    . UMQ X  4 .   ? 51.333  72.612  111.191 1.00 50.08 ? 908 UMQ B C4    1 
HETATM 10519 C  C5    . UMQ X  4 .   ? 52.096  73.900  110.888 1.00 50.08 ? 908 UMQ B C5    1 
HETATM 10520 C  C6    . UMQ X  4 .   ? 52.402  74.714  112.124 1.00 50.08 ? 908 UMQ B C6    1 
HETATM 10521 O  O2    . UMQ X  4 .   ? 52.351  70.894  108.008 1.00 50.08 ? 908 UMQ B O2    1 
HETATM 10522 O  O4    . UMQ X  4 .   ? 50.053  72.939  111.721 1.00 50.08 ? 908 UMQ B O4    1 
HETATM 10523 C  C1    . UMQ X  4 .   ? 53.251  72.877  109.047 1.00 50.08 ? 908 UMQ B C1    1 
HETATM 10524 C  C3    . UMQ X  4 .   ? 51.175  71.795  109.915 1.00 50.08 ? 908 UMQ B C3    1 
HETATM 10525 O  O1    . UMQ X  4 .   ? 52.541  73.625  108.085 1.00 50.08 ? 908 UMQ B O1    1 
HETATM 10526 O  O3    . UMQ X  4 .   ? 50.544  70.554  110.207 1.00 50.08 ? 908 UMQ B O3    1 
HETATM 10527 O  O5