data_6R7Y
# 
_entry.id   6R7Y 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6R7Y         
WWPDB D_1292101486 
EMDB  EMD-4747     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'CryoEM structure of calcium-bound human TMEM16K / Anoctamin 10 in detergent (low Ca2+, closed form)' 
_pdbx_database_related.db_id          EMD-4747 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6R7Y 
_pdbx_database_status.recvd_initial_deposition_date   2019-03-29 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pike, A.C.W.'                         1  0000-0001-9661-2607 
'Bushell, S.R.'                        2  ?                   
'Shintre, C.A.'                        3  ?                   
'Tessitore, A.'                        4  ?                   
'Chu, A.'                              5  ?                   
'Mukhopadhyay, S.'                     6  ?                   
'Shrestha, L.'                         7  ?                   
'Chalk, R.'                            8  ?                   
'Burgess-Brown, N.A.'                  9  ?                   
'Love, J.'                             10 ?                   
'Huiskonen, J.T.'                      11 ?                   
'Edwards, A.M.'                        12 ?                   
'Arrowsmith, C.H.'                     13 ?                   
'Bountra, C.'                          14 ?                   
'Carpenter, E.P.'                      15 0000-0001-9138-2937 
'Structural Genomics Consortium (SGC)' 16 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                3956 
_citation.page_last                 3956 
_citation.title                     
'The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-11753-1 
_citation.pdbx_database_id_PubMed   31477691 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bushell, S.R.'        1  0000-0001-5477-6777 
primary 'Pike, A.C.W.'         2  0000-0001-9661-2607 
primary 'Falzone, M.E.'        3  ?                   
primary 'Rorsman, N.J.G.'      4  ?                   
primary 'Ta, C.M.'             5  ?                   
primary 'Corey, R.A.'          6  ?                   
primary 'Newport, T.D.'        7  ?                   
primary 'Christianson, J.C.'   8  0000-0002-0474-1207 
primary 'Scofano, L.F.'        9  0000-0002-5670-7983 
primary 'Shintre, C.A.'        10 0000-0001-7225-7970 
primary 'Tessitore, A.'        11 ?                   
primary 'Chu, A.'              12 ?                   
primary 'Wang, Q.'             13 ?                   
primary 'Shrestha, L.'         14 ?                   
primary 'Mukhopadhyay, S.M.M.' 15 0000-0003-1430-5529 
primary 'Love, J.D.'           16 ?                   
primary 'Burgess-Brown, N.A.'  17 ?                   
primary 'Sitsapesan, R.'       18 ?                   
primary 'Stansfeld, P.J.'      19 0000-0001-8800-7669 
primary 'Huiskonen, J.T.'      20 0000-0002-0348-7323 
primary 'Tammaro, P.'          21 ?                   
primary 'Accardi, A.'          22 0000-0002-6584-0102 
primary 'Carpenter, E.P.'      23 0000-0001-9138-2937 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6R7Y 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6R7Y 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Anoctamin-10  77276.016 2 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION' 40.078    6 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Transmembrane protein 16K' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKATAENLYFQ
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LYS n 
1 3   VAL n 
1 4   THR n 
1 5   LEU n 
1 6   SER n 
1 7   ALA n 
1 8   LEU n 
1 9   ASP n 
1 10  THR n 
1 11  SER n 
1 12  GLU n 
1 13  SER n 
1 14  SER n 
1 15  PHE n 
1 16  THR n 
1 17  PRO n 
1 18  LEU n 
1 19  VAL n 
1 20  VAL n 
1 21  ILE n 
1 22  GLU n 
1 23  LEU n 
1 24  ALA n 
1 25  GLN n 
1 26  ASP n 
1 27  VAL n 
1 28  LYS n 
1 29  GLU n 
1 30  GLU n 
1 31  THR n 
1 32  LYS n 
1 33  GLU n 
1 34  TRP n 
1 35  LEU n 
1 36  LYS n 
1 37  ASN n 
1 38  ARG n 
1 39  ILE n 
1 40  ILE n 
1 41  ALA n 
1 42  LYS n 
1 43  LYS n 
1 44  LYS n 
1 45  ASP n 
1 46  GLY n 
1 47  GLY n 
1 48  ALA n 
1 49  GLN n 
1 50  LEU n 
1 51  LEU n 
1 52  PHE n 
1 53  ARG n 
1 54  PRO n 
1 55  LEU n 
1 56  LEU n 
1 57  ASN n 
1 58  LYS n 
1 59  TYR n 
1 60  GLU n 
1 61  GLN n 
1 62  GLU n 
1 63  THR n 
1 64  LEU n 
1 65  GLU n 
1 66  ASN n 
1 67  GLN n 
1 68  ASN n 
1 69  LEU n 
1 70  TYR n 
1 71  LEU n 
1 72  VAL n 
1 73  GLY n 
1 74  ALA n 
1 75  SER n 
1 76  LYS n 
1 77  ILE n 
1 78  ARG n 
1 79  MET n 
1 80  LEU n 
1 81  LEU n 
1 82  GLY n 
1 83  ALA n 
1 84  GLU n 
1 85  ALA n 
1 86  VAL n 
1 87  GLY n 
1 88  LEU n 
1 89  VAL n 
1 90  LYS n 
1 91  GLU n 
1 92  CYS n 
1 93  ASN n 
1 94  ASP n 
1 95  ASN n 
1 96  THR n 
1 97  MET n 
1 98  ARG n 
1 99  ALA n 
1 100 PHE n 
1 101 THR n 
1 102 TYR n 
1 103 ARG n 
1 104 THR n 
1 105 ARG n 
1 106 GLN n 
1 107 ASN n 
1 108 PHE n 
1 109 LYS n 
1 110 GLY n 
1 111 PHE n 
1 112 ASP n 
1 113 ASP n 
1 114 ASN n 
1 115 ASN n 
1 116 ASP n 
1 117 ASP n 
1 118 PHE n 
1 119 LEU n 
1 120 THR n 
1 121 MET n 
1 122 ALA n 
1 123 GLU n 
1 124 CYS n 
1 125 GLN n 
1 126 PHE n 
1 127 ILE n 
1 128 ILE n 
1 129 LYS n 
1 130 HIS n 
1 131 GLU n 
1 132 LEU n 
1 133 GLU n 
1 134 ASN n 
1 135 LEU n 
1 136 ARG n 
1 137 ALA n 
1 138 LYS n 
1 139 ASP n 
1 140 GLU n 
1 141 LYS n 
1 142 MET n 
1 143 ILE n 
1 144 PRO n 
1 145 GLY n 
1 146 TYR n 
1 147 PRO n 
1 148 GLN n 
1 149 ALA n 
1 150 LYS n 
1 151 LEU n 
1 152 TYR n 
1 153 PRO n 
1 154 GLY n 
1 155 LYS n 
1 156 SER n 
1 157 LEU n 
1 158 LEU n 
1 159 ARG n 
1 160 ARG n 
1 161 LEU n 
1 162 LEU n 
1 163 THR n 
1 164 SER n 
1 165 GLY n 
1 166 ILE n 
1 167 VAL n 
1 168 ILE n 
1 169 GLN n 
1 170 VAL n 
1 171 PHE n 
1 172 PRO n 
1 173 LEU n 
1 174 HIS n 
1 175 ASP n 
1 176 SER n 
1 177 GLU n 
1 178 ALA n 
1 179 LEU n 
1 180 LYS n 
1 181 LYS n 
1 182 LEU n 
1 183 GLU n 
1 184 ASP n 
1 185 THR n 
1 186 TRP n 
1 187 TYR n 
1 188 THR n 
1 189 ARG n 
1 190 PHE n 
1 191 ALA n 
1 192 LEU n 
1 193 LYS n 
1 194 TYR n 
1 195 GLN n 
1 196 PRO n 
1 197 ILE n 
1 198 ASP n 
1 199 SER n 
1 200 ILE n 
1 201 ARG n 
1 202 GLY n 
1 203 TYR n 
1 204 PHE n 
1 205 GLY n 
1 206 GLU n 
1 207 THR n 
1 208 ILE n 
1 209 ALA n 
1 210 LEU n 
1 211 TYR n 
1 212 PHE n 
1 213 GLY n 
1 214 PHE n 
1 215 LEU n 
1 216 GLU n 
1 217 TYR n 
1 218 PHE n 
1 219 THR n 
1 220 PHE n 
1 221 ALA n 
1 222 LEU n 
1 223 ILE n 
1 224 PRO n 
1 225 MET n 
1 226 ALA n 
1 227 VAL n 
1 228 ILE n 
1 229 GLY n 
1 230 LEU n 
1 231 PRO n 
1 232 TYR n 
1 233 TYR n 
1 234 LEU n 
1 235 PHE n 
1 236 VAL n 
1 237 TRP n 
1 238 GLU n 
1 239 ASP n 
1 240 TYR n 
1 241 ASP n 
1 242 LYS n 
1 243 TYR n 
1 244 VAL n 
1 245 ILE n 
1 246 PHE n 
1 247 ALA n 
1 248 SER n 
1 249 PHE n 
1 250 ASN n 
1 251 LEU n 
1 252 ILE n 
1 253 TRP n 
1 254 SER n 
1 255 THR n 
1 256 VAL n 
1 257 ILE n 
1 258 LEU n 
1 259 GLU n 
1 260 LEU n 
1 261 TRP n 
1 262 LYS n 
1 263 ARG n 
1 264 GLY n 
1 265 CYS n 
1 266 ALA n 
1 267 ASN n 
1 268 MET n 
1 269 THR n 
1 270 TYR n 
1 271 ARG n 
1 272 TRP n 
1 273 GLY n 
1 274 THR n 
1 275 LEU n 
1 276 LEU n 
1 277 MET n 
1 278 LYS n 
1 279 ARG n 
1 280 LYS n 
1 281 PHE n 
1 282 GLU n 
1 283 GLU n 
1 284 PRO n 
1 285 ARG n 
1 286 PRO n 
1 287 GLY n 
1 288 PHE n 
1 289 HIS n 
1 290 GLY n 
1 291 VAL n 
1 292 LEU n 
1 293 GLY n 
1 294 ILE n 
1 295 ASN n 
1 296 SER n 
1 297 ILE n 
1 298 THR n 
1 299 GLY n 
1 300 LYS n 
1 301 GLU n 
1 302 GLU n 
1 303 PRO n 
1 304 LEU n 
1 305 TYR n 
1 306 PRO n 
1 307 SER n 
1 308 TYR n 
1 309 LYS n 
1 310 ARG n 
1 311 GLN n 
1 312 LEU n 
1 313 ARG n 
1 314 ILE n 
1 315 TYR n 
1 316 LEU n 
1 317 VAL n 
1 318 SER n 
1 319 LEU n 
1 320 PRO n 
1 321 PHE n 
1 322 VAL n 
1 323 CYS n 
1 324 LEU n 
1 325 CYS n 
1 326 LEU n 
1 327 TYR n 
1 328 PHE n 
1 329 SER n 
1 330 LEU n 
1 331 TYR n 
1 332 VAL n 
1 333 MET n 
1 334 MET n 
1 335 ILE n 
1 336 TYR n 
1 337 PHE n 
1 338 ASP n 
1 339 MET n 
1 340 GLU n 
1 341 VAL n 
1 342 TRP n 
1 343 ALA n 
1 344 LEU n 
1 345 GLY n 
1 346 LEU n 
1 347 HIS n 
1 348 GLU n 
1 349 ASN n 
1 350 SER n 
1 351 GLY n 
1 352 SER n 
1 353 GLU n 
1 354 TRP n 
1 355 THR n 
1 356 SER n 
1 357 VAL n 
1 358 LEU n 
1 359 LEU n 
1 360 TYR n 
1 361 VAL n 
1 362 PRO n 
1 363 SER n 
1 364 ILE n 
1 365 ILE n 
1 366 TYR n 
1 367 ALA n 
1 368 ILE n 
1 369 VAL n 
1 370 ILE n 
1 371 GLU n 
1 372 ILE n 
1 373 MET n 
1 374 ASN n 
1 375 ARG n 
1 376 LEU n 
1 377 TYR n 
1 378 ARG n 
1 379 TYR n 
1 380 ALA n 
1 381 ALA n 
1 382 GLU n 
1 383 PHE n 
1 384 LEU n 
1 385 THR n 
1 386 SER n 
1 387 TRP n 
1 388 GLU n 
1 389 ASN n 
1 390 HIS n 
1 391 ARG n 
1 392 LEU n 
1 393 GLU n 
1 394 SER n 
1 395 ALA n 
1 396 TYR n 
1 397 GLN n 
1 398 ASN n 
1 399 HIS n 
1 400 LEU n 
1 401 ILE n 
1 402 LEU n 
1 403 LYS n 
1 404 VAL n 
1 405 LEU n 
1 406 VAL n 
1 407 PHE n 
1 408 ASN n 
1 409 PHE n 
1 410 LEU n 
1 411 ASN n 
1 412 CYS n 
1 413 PHE n 
1 414 ALA n 
1 415 SER n 
1 416 LEU n 
1 417 PHE n 
1 418 TYR n 
1 419 ILE n 
1 420 ALA n 
1 421 PHE n 
1 422 VAL n 
1 423 LEU n 
1 424 LYS n 
1 425 ASP n 
1 426 MET n 
1 427 LYS n 
1 428 LEU n 
1 429 LEU n 
1 430 ARG n 
1 431 GLN n 
1 432 SER n 
1 433 LEU n 
1 434 ALA n 
1 435 THR n 
1 436 LEU n 
1 437 LEU n 
1 438 ILE n 
1 439 THR n 
1 440 SER n 
1 441 GLN n 
1 442 ILE n 
1 443 LEU n 
1 444 ASN n 
1 445 GLN n 
1 446 ILE n 
1 447 MET n 
1 448 GLU n 
1 449 SER n 
1 450 PHE n 
1 451 LEU n 
1 452 PRO n 
1 453 TYR n 
1 454 TRP n 
1 455 LEU n 
1 456 GLN n 
1 457 ARG n 
1 458 LYS n 
1 459 HIS n 
1 460 GLY n 
1 461 VAL n 
1 462 ARG n 
1 463 VAL n 
1 464 LYS n 
1 465 ARG n 
1 466 LYS n 
1 467 VAL n 
1 468 GLN n 
1 469 ALA n 
1 470 LEU n 
1 471 LYS n 
1 472 ALA n 
1 473 ASP n 
1 474 ILE n 
1 475 ASP n 
1 476 ALA n 
1 477 THR n 
1 478 LEU n 
1 479 TYR n 
1 480 GLU n 
1 481 GLN n 
1 482 VAL n 
1 483 ILE n 
1 484 LEU n 
1 485 GLU n 
1 486 LYS n 
1 487 GLU n 
1 488 MET n 
1 489 GLY n 
1 490 THR n 
1 491 TYR n 
1 492 LEU n 
1 493 GLY n 
1 494 THR n 
1 495 PHE n 
1 496 ASP n 
1 497 ASP n 
1 498 TYR n 
1 499 LEU n 
1 500 GLU n 
1 501 LEU n 
1 502 PHE n 
1 503 LEU n 
1 504 GLN n 
1 505 PHE n 
1 506 GLY n 
1 507 TYR n 
1 508 VAL n 
1 509 SER n 
1 510 LEU n 
1 511 PHE n 
1 512 SER n 
1 513 CYS n 
1 514 VAL n 
1 515 TYR n 
1 516 PRO n 
1 517 LEU n 
1 518 ALA n 
1 519 ALA n 
1 520 ALA n 
1 521 PHE n 
1 522 ALA n 
1 523 VAL n 
1 524 LEU n 
1 525 ASN n 
1 526 ASN n 
1 527 PHE n 
1 528 THR n 
1 529 GLU n 
1 530 VAL n 
1 531 ASN n 
1 532 SER n 
1 533 ASP n 
1 534 ALA n 
1 535 LEU n 
1 536 LYS n 
1 537 MET n 
1 538 CYS n 
1 539 ARG n 
1 540 VAL n 
1 541 PHE n 
1 542 LYS n 
1 543 ARG n 
1 544 PRO n 
1 545 PHE n 
1 546 SER n 
1 547 GLU n 
1 548 PRO n 
1 549 SER n 
1 550 ALA n 
1 551 ASN n 
1 552 ILE n 
1 553 GLY n 
1 554 VAL n 
1 555 TRP n 
1 556 GLN n 
1 557 LEU n 
1 558 ALA n 
1 559 PHE n 
1 560 GLU n 
1 561 THR n 
1 562 MET n 
1 563 SER n 
1 564 VAL n 
1 565 ILE n 
1 566 SER n 
1 567 VAL n 
1 568 VAL n 
1 569 THR n 
1 570 ASN n 
1 571 CYS n 
1 572 ALA n 
1 573 LEU n 
1 574 ILE n 
1 575 GLY n 
1 576 MET n 
1 577 SER n 
1 578 PRO n 
1 579 GLN n 
1 580 VAL n 
1 581 ASN n 
1 582 ALA n 
1 583 VAL n 
1 584 PHE n 
1 585 PRO n 
1 586 GLU n 
1 587 SER n 
1 588 LYS n 
1 589 ALA n 
1 590 ASP n 
1 591 LEU n 
1 592 ILE n 
1 593 LEU n 
1 594 ILE n 
1 595 VAL n 
1 596 VAL n 
1 597 ALA n 
1 598 VAL n 
1 599 GLU n 
1 600 HIS n 
1 601 ALA n 
1 602 LEU n 
1 603 LEU n 
1 604 ALA n 
1 605 LEU n 
1 606 LYS n 
1 607 PHE n 
1 608 ILE n 
1 609 LEU n 
1 610 ALA n 
1 611 PHE n 
1 612 ALA n 
1 613 ILE n 
1 614 PRO n 
1 615 ASP n 
1 616 LYS n 
1 617 PRO n 
1 618 ARG n 
1 619 HIS n 
1 620 ILE n 
1 621 GLN n 
1 622 MET n 
1 623 LYS n 
1 624 LEU n 
1 625 ALA n 
1 626 ARG n 
1 627 LEU n 
1 628 GLU n 
1 629 PHE n 
1 630 GLU n 
1 631 SER n 
1 632 LEU n 
1 633 GLU n 
1 634 ALA n 
1 635 LEU n 
1 636 LYS n 
1 637 GLN n 
1 638 GLN n 
1 639 GLN n 
1 640 MET n 
1 641 LYS n 
1 642 LEU n 
1 643 VAL n 
1 644 THR n 
1 645 GLU n 
1 646 ASN n 
1 647 LEU n 
1 648 LYS n 
1 649 GLU n 
1 650 GLU n 
1 651 PRO n 
1 652 MET n 
1 653 GLU n 
1 654 SER n 
1 655 GLY n 
1 656 LYS n 
1 657 GLU n 
1 658 LYS n 
1 659 ALA n 
1 660 THR n 
1 661 ALA n 
1 662 GLU n 
1 663 ASN n 
1 664 LEU n 
1 665 TYR n 
1 666 PHE n 
1 667 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   667 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ANO10, TMEM16K' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PFB-CT10HF-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ANO10_HUMAN 
_struct_ref.pdbx_db_accession          Q9NW15 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MKVTLSALDTSESSFTPLVVIELAQDVKEETKEWLKNRIIAKKKDGGAQLLFRPLLNKYEQETLENQNLYLVGASKIRML
LGAEAVGLVKECNDNTMRAFTYRTRQNFKGFDDNNDDFLTMAECQFIIKHELENLRAKDEKMIPGYPQAKLYPGKSLLRR
LLTSGIVIQVFPLHDSEALKKLEDTWYTRFALKYQPIDSIRGYFGETIALYFGFLEYFTFALIPMAVIGLPYYLFVWEDY
DKYVIFASFNLIWSTVILELWKRGCANMTYRWGTLLMKRKFEEPRPGFHGVLGINSITGKEEPLYPSYKRQLRIYLVSLP
FVCLCLYFSLYVMMIYFDMEVWALGLHENSGSEWTSVLLYVPSIIYAIVIEIMNRLYRYAAEFLTSWENHRLESAYQNHL
ILKVLVFNFLNCFASLFYIAFVLKDMKLLRQSLATLLITSQILNQIMESFLPYWLQRKHGVRVKRKVQALKADIDATLYE
QVILEKEMGTYLGTFDDYLELFLQFGYVSLFSCVYPLAAAFAVLNNFTEVNSDALKMCRVFKRPFSEPSANIGVWQLAFE
TMSVISVVTNCALIGMSPQVNAVFPESKADLILIVVAVEHALLALKFILAFAIPDKPRHIQMKLARLEFESLEALKQQQM
KLVTENLKEEPMESGKEKAT
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6R7Y A 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
2 1 6R7Y B 1 ? 660 ? Q9NW15 1 ? 660 ? 1 660 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6R7Y ALA A 661 ? UNP Q9NW15 ? ? 'expression tag' 661 1  
1 6R7Y GLU A 662 ? UNP Q9NW15 ? ? 'expression tag' 662 2  
1 6R7Y ASN A 663 ? UNP Q9NW15 ? ? 'expression tag' 663 3  
1 6R7Y LEU A 664 ? UNP Q9NW15 ? ? 'expression tag' 664 4  
1 6R7Y TYR A 665 ? UNP Q9NW15 ? ? 'expression tag' 665 5  
1 6R7Y PHE A 666 ? UNP Q9NW15 ? ? 'expression tag' 666 6  
1 6R7Y GLN A 667 ? UNP Q9NW15 ? ? 'expression tag' 667 7  
2 6R7Y ALA B 661 ? UNP Q9NW15 ? ? 'expression tag' 661 8  
2 6R7Y GLU B 662 ? UNP Q9NW15 ? ? 'expression tag' 662 9  
2 6R7Y ASN B 663 ? UNP Q9NW15 ? ? 'expression tag' 663 10 
2 6R7Y LEU B 664 ? UNP Q9NW15 ? ? 'expression tag' 664 11 
2 6R7Y TYR B 665 ? UNP Q9NW15 ? ? 'expression tag' 665 12 
2 6R7Y PHE B 666 ? UNP Q9NW15 ? ? 'expression tag' 666 13 
2 6R7Y GLN B 667 ? UNP Q9NW15 ? ? 'expression tag' 667 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6R7Y 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6R7Y 
_struct.title                        
'CryoEM structure of calcium-bound human TMEM16K / Anoctamin 10 in detergent (low Ca2+, closed form)' 
_struct.pdbx_descriptor              Anoctamin-10 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6R7Y 
_struct_keywords.text            
'MEMBRANE PROTEIN, CALCIUM ACTIVATION, TRANSPORT PROTEIN, LIPID TRANSPORT, Structural Genomics, Structural Genomics Consortium, SGC' 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LYS A 28  ? ALA A 41  ? LYS A 28  ALA A 41  1 ? 14 
HELX_P HELX_P2  AA2 THR A 63  ? GLN A 67  ? THR A 63  GLN A 67  5 ? 5  
HELX_P HELX_P3  AA3 SER A 75  ? GLY A 87  ? SER A 75  GLY A 87  1 ? 13 
HELX_P HELX_P4  AA4 THR A 104 ? PHE A 108 ? THR A 104 PHE A 108 5 ? 5  
HELX_P HELX_P5  AA5 THR A 120 ? ASN A 134 ? THR A 120 ASN A 134 1 ? 15 
HELX_P HELX_P6  AA6 SER A 156 ? SER A 164 ? SER A 156 SER A 164 1 ? 9  
HELX_P HELX_P7  AA7 LEU A 179 ? ASP A 184 ? LEU A 179 ASP A 184 1 ? 6  
HELX_P HELX_P8  AA8 PRO A 196 ? GLY A 205 ? PRO A 196 GLY A 205 1 ? 10 
HELX_P HELX_P9  AA9 GLU A 206 ? PHE A 220 ? GLU A 206 PHE A 220 1 ? 15 
HELX_P HELX_P10 AB1 LEU A 222 ? LEU A 230 ? LEU A 222 LEU A 230 1 ? 9  
HELX_P HELX_P11 AB2 LEU A 230 ? PHE A 235 ? LEU A 230 PHE A 235 1 ? 6  
HELX_P HELX_P12 AB3 VAL A 236 ? TYR A 240 ? VAL A 236 TYR A 240 5 ? 5  
HELX_P HELX_P13 AB4 TYR A 243 ? GLY A 273 ? TYR A 243 GLY A 273 1 ? 31 
HELX_P HELX_P14 AB5 PRO A 306 ? LEU A 316 ? PRO A 306 LEU A 316 1 ? 11 
HELX_P HELX_P15 AB6 VAL A 317 ? SER A 350 ? VAL A 317 SER A 350 1 ? 34 
HELX_P HELX_P16 AB7 SER A 352 ? THR A 355 ? SER A 352 THR A 355 5 ? 4  
HELX_P HELX_P17 AB8 SER A 356 ? TRP A 387 ? SER A 356 TRP A 387 1 ? 32 
HELX_P HELX_P18 AB9 LEU A 392 ? VAL A 422 ? LEU A 392 VAL A 422 1 ? 31 
HELX_P HELX_P19 AC1 ASP A 425 ? SER A 449 ? ASP A 425 SER A 449 1 ? 25 
HELX_P HELX_P20 AC2 SER A 449 ? ALA A 469 ? SER A 449 ALA A 469 1 ? 21 
HELX_P HELX_P21 AC3 ASP A 475 ? GLU A 487 ? ASP A 475 GLU A 487 1 ? 13 
HELX_P HELX_P22 AC4 PHE A 495 ? LEU A 510 ? PHE A 495 LEU A 510 1 ? 16 
HELX_P HELX_P23 AC5 LEU A 517 ? ARG A 539 ? LEU A 517 ARG A 539 1 ? 23 
HELX_P HELX_P24 AC6 VAL A 554 ? GLY A 575 ? VAL A 554 GLY A 575 1 ? 22 
HELX_P HELX_P25 AC7 ALA A 589 ? ILE A 613 ? ALA A 589 ILE A 613 1 ? 25 
HELX_P HELX_P26 AC8 PRO A 617 ? MET A 640 ? PRO A 617 MET A 640 1 ? 24 
HELX_P HELX_P27 AC9 LYS B 28  ? ALA B 41  ? LYS B 28  ALA B 41  1 ? 14 
HELX_P HELX_P28 AD1 THR B 63  ? GLN B 67  ? THR B 63  GLN B 67  5 ? 5  
HELX_P HELX_P29 AD2 SER B 75  ? GLY B 87  ? SER B 75  GLY B 87  1 ? 13 
HELX_P HELX_P30 AD3 THR B 104 ? PHE B 108 ? THR B 104 PHE B 108 5 ? 5  
HELX_P HELX_P31 AD4 THR B 120 ? ASN B 134 ? THR B 120 ASN B 134 1 ? 15 
HELX_P HELX_P32 AD5 SER B 156 ? SER B 164 ? SER B 156 SER B 164 1 ? 9  
HELX_P HELX_P33 AD6 LEU B 179 ? ASP B 184 ? LEU B 179 ASP B 184 1 ? 6  
HELX_P HELX_P34 AD7 PRO B 196 ? GLY B 205 ? PRO B 196 GLY B 205 1 ? 10 
HELX_P HELX_P35 AD8 GLU B 206 ? PHE B 220 ? GLU B 206 PHE B 220 1 ? 15 
HELX_P HELX_P36 AD9 LEU B 222 ? LEU B 230 ? LEU B 222 LEU B 230 1 ? 9  
HELX_P HELX_P37 AE1 LEU B 230 ? PHE B 235 ? LEU B 230 PHE B 235 1 ? 6  
HELX_P HELX_P38 AE2 VAL B 236 ? TYR B 240 ? VAL B 236 TYR B 240 5 ? 5  
HELX_P HELX_P39 AE3 TYR B 243 ? GLY B 273 ? TYR B 243 GLY B 273 1 ? 31 
HELX_P HELX_P40 AE4 PRO B 306 ? LEU B 316 ? PRO B 306 LEU B 316 1 ? 11 
HELX_P HELX_P41 AE5 VAL B 317 ? SER B 350 ? VAL B 317 SER B 350 1 ? 34 
HELX_P HELX_P42 AE6 SER B 352 ? THR B 355 ? SER B 352 THR B 355 5 ? 4  
HELX_P HELX_P43 AE7 SER B 356 ? TRP B 387 ? SER B 356 TRP B 387 1 ? 32 
HELX_P HELX_P44 AE8 LEU B 392 ? VAL B 422 ? LEU B 392 VAL B 422 1 ? 31 
HELX_P HELX_P45 AE9 ASP B 425 ? SER B 449 ? ASP B 425 SER B 449 1 ? 25 
HELX_P HELX_P46 AF1 SER B 449 ? ALA B 469 ? SER B 449 ALA B 469 1 ? 21 
HELX_P HELX_P47 AF2 ASP B 475 ? GLU B 487 ? ASP B 475 GLU B 487 1 ? 13 
HELX_P HELX_P48 AF3 PHE B 495 ? LEU B 510 ? PHE B 495 LEU B 510 1 ? 16 
HELX_P HELX_P49 AF4 LEU B 517 ? ARG B 539 ? LEU B 517 ARG B 539 1 ? 23 
HELX_P HELX_P50 AF5 VAL B 554 ? GLY B 575 ? VAL B 554 GLY B 575 1 ? 22 
HELX_P HELX_P51 AF6 ALA B 589 ? ILE B 613 ? ALA B 589 ILE B 613 1 ? 25 
HELX_P HELX_P52 AF7 PRO B 617 ? MET B 640 ? PRO B 617 MET B 640 1 ? 24 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A GLU 259 OE2 ? ? ? 1_555 E CA . CA ? ? A GLU 259 A CA 703 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc2  metalc ? ? A ASN 444 OD1 ? ? ? 1_555 C CA . CA ? ? A ASN 444 A CA 701 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc3  metalc ? ? A GLN 445 OE1 ? ? ? 1_555 C CA . CA ? ? A GLN 445 A CA 701 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc4  metalc ? ? A GLU 448 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 448 A CA 702 1_555 ? ? ? ? ? ? ? 3.025 ? 
metalc5  metalc ? ? A GLU 448 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 448 A CA 701 1_555 ? ? ? ? ? ? ? 2.761 ? 
metalc6  metalc ? ? A GLU 448 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 448 A CA 702 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc7  metalc ? ? A ASP 497 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 497 A CA 702 1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc8  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 500 A CA 702 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc9  metalc ? ? A GLU 500 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 500 A CA 701 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc10 metalc ? ? A GLU 500 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 500 A CA 701 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc11 metalc ? ? A GLU 529 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 529 A CA 701 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc12 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 529 A CA 702 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc13 metalc ? ? A GLU 529 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 529 A CA 701 1_555 ? ? ? ? ? ? ? 2.721 ? 
metalc14 metalc ? ? A ASP 533 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 533 A CA 702 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc15 metalc ? ? A ASP 533 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 533 A CA 702 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc16 metalc ? ? A ALA 610 O   ? ? ? 1_555 E CA . CA ? ? A ALA 610 A CA 703 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc17 metalc ? ? A ILE 613 O   ? ? ? 1_555 E CA . CA ? ? A ILE 613 A CA 703 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc18 metalc ? ? A ASP 615 OD1 ? ? ? 1_555 E CA . CA ? ? A ASP 615 A CA 703 1_555 ? ? ? ? ? ? ? 2.555 ? 
metalc19 metalc ? ? B GLU 259 OE2 ? ? ? 1_555 H CA . CA ? ? B GLU 259 B CA 703 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc20 metalc ? ? B ASN 444 OD1 ? ? ? 1_555 F CA . CA ? ? B ASN 444 B CA 701 1_555 ? ? ? ? ? ? ? 2.619 ? 
metalc21 metalc ? ? B GLN 445 OE1 ? ? ? 1_555 F CA . CA ? ? B GLN 445 B CA 701 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc22 metalc ? ? B GLU 448 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 448 B CA 701 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc23 metalc ? ? B GLU 448 OE1 ? ? ? 1_555 G CA . CA ? ? B GLU 448 B CA 702 1_555 ? ? ? ? ? ? ? 3.026 ? 
metalc24 metalc ? ? B GLU 448 OE2 ? ? ? 1_555 G CA . CA ? ? B GLU 448 B CA 702 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc25 metalc ? ? B ASP 497 OD1 ? ? ? 1_555 G CA . CA ? ? B ASP 497 B CA 702 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc26 metalc ? ? B GLU 500 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 500 B CA 701 1_555 ? ? ? ? ? ? ? 2.643 ? 
metalc27 metalc ? ? B GLU 500 OE1 ? ? ? 1_555 G CA . CA ? ? B GLU 500 B CA 702 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc28 metalc ? ? B GLU 500 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 500 B CA 701 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc29 metalc ? ? B GLU 529 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 529 B CA 701 1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc30 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 529 B CA 701 1_555 ? ? ? ? ? ? ? 2.721 ? 
metalc31 metalc ? ? B GLU 529 OE2 ? ? ? 1_555 G CA . CA ? ? B GLU 529 B CA 702 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc32 metalc ? ? B ASP 533 OD1 ? ? ? 1_555 G CA . CA ? ? B ASP 533 B CA 702 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc33 metalc ? ? B ASP 533 OD2 ? ? ? 1_555 G CA . CA ? ? B ASP 533 B CA 702 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc34 metalc ? ? B ALA 610 O   ? ? ? 1_555 H CA . CA ? ? B ALA 610 B CA 703 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc35 metalc ? ? B ILE 613 O   ? ? ? 1_555 H CA . CA ? ? B ILE 613 B CA 703 1_555 ? ? ? ? ? ? ? 2.634 ? 
metalc36 metalc ? ? B ASP 615 OD1 ? ? ? 1_555 H CA . CA ? ? B ASP 615 B CA 703 1_555 ? ? ? ? ? ? ? 2.556 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 51  ? PRO A 54  ? LEU A 51  PRO A 54  
AA1 2 LEU A 69  ? GLY A 73  ? LEU A 69  GLY A 73  
AA1 3 VAL A 19  ? LEU A 23  ? VAL A 19  LEU A 23  
AA1 4 VAL A 167 ? PRO A 172 ? VAL A 167 PRO A 172 
AA2 1 VAL A 89  ? GLU A 91  ? VAL A 89  GLU A 91  
AA2 2 MET A 97  ? ALA A 99  ? MET A 97  ALA A 99  
AA3 1 VAL A 291 ? ILE A 294 ? VAL A 291 ILE A 294 
AA3 2 GLU A 301 ? LEU A 304 ? GLU A 301 LEU A 304 
AA4 1 LEU B 51  ? PRO B 54  ? LEU B 51  PRO B 54  
AA4 2 LEU B 69  ? GLY B 73  ? LEU B 69  GLY B 73  
AA4 3 VAL B 19  ? LEU B 23  ? VAL B 19  LEU B 23  
AA4 4 VAL B 167 ? PRO B 172 ? VAL B 167 PRO B 172 
AA5 1 VAL B 89  ? GLU B 91  ? VAL B 89  GLU B 91  
AA5 2 MET B 97  ? ALA B 99  ? MET B 97  ALA B 99  
AA6 1 VAL B 291 ? ILE B 294 ? VAL B 291 ILE B 294 
AA6 2 GLU B 301 ? LEU B 304 ? GLU B 301 LEU B 304 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 53  ? N ARG A 53  O LEU A 71  ? O LEU A 71  
AA1 2 3 O VAL A 72  ? O VAL A 72  N VAL A 19  ? N VAL A 19  
AA1 3 4 N VAL A 20  ? N VAL A 20  O PHE A 171 ? O PHE A 171 
AA2 1 2 N LYS A 90  ? N LYS A 90  O ARG A 98  ? O ARG A 98  
AA3 1 2 N VAL A 291 ? N VAL A 291 O LEU A 304 ? O LEU A 304 
AA4 1 2 N ARG B 53  ? N ARG B 53  O LEU B 71  ? O LEU B 71  
AA4 2 3 O VAL B 72  ? O VAL B 72  N VAL B 19  ? N VAL B 19  
AA4 3 4 N VAL B 20  ? N VAL B 20  O PHE B 171 ? O PHE B 171 
AA5 1 2 N LYS B 90  ? N LYS B 90  O ARG B 98  ? O ARG B 98  
AA6 1 2 N VAL B 291 ? N VAL B 291 O LEU B 304 ? O LEU B 304 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 701 ? 5 'binding site for residue CA A 701' 
AC2 Software A CA 702 ? 6 'binding site for residue CA A 702' 
AC3 Software A CA 703 ? 4 'binding site for residue CA A 703' 
AC4 Software B CA 701 ? 5 'binding site for residue CA B 701' 
AC5 Software B CA 702 ? 6 'binding site for residue CA B 702' 
AC6 Software B CA 703 ? 4 'binding site for residue CA B 703' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASN A 444 ? ASN A 444 . ? 1_555 ? 
2  AC1 5 GLN A 445 ? GLN A 445 . ? 1_555 ? 
3  AC1 5 GLU A 448 ? GLU A 448 . ? 1_555 ? 
4  AC1 5 GLU A 500 ? GLU A 500 . ? 1_555 ? 
5  AC1 5 GLU A 529 ? GLU A 529 . ? 1_555 ? 
6  AC2 6 TYR A 211 ? TYR A 211 . ? 1_555 ? 
7  AC2 6 GLU A 448 ? GLU A 448 . ? 1_555 ? 
8  AC2 6 ASP A 497 ? ASP A 497 . ? 1_555 ? 
9  AC2 6 GLU A 500 ? GLU A 500 . ? 1_555 ? 
10 AC2 6 GLU A 529 ? GLU A 529 . ? 1_555 ? 
11 AC2 6 ASP A 533 ? ASP A 533 . ? 1_555 ? 
12 AC3 4 GLU A 259 ? GLU A 259 . ? 1_555 ? 
13 AC3 4 ALA A 610 ? ALA A 610 . ? 1_555 ? 
14 AC3 4 ILE A 613 ? ILE A 613 . ? 1_555 ? 
15 AC3 4 ASP A 615 ? ASP A 615 . ? 1_555 ? 
16 AC4 5 ASN B 444 ? ASN B 444 . ? 1_555 ? 
17 AC4 5 GLN B 445 ? GLN B 445 . ? 1_555 ? 
18 AC4 5 GLU B 448 ? GLU B 448 . ? 1_555 ? 
19 AC4 5 GLU B 500 ? GLU B 500 . ? 1_555 ? 
20 AC4 5 GLU B 529 ? GLU B 529 . ? 1_555 ? 
21 AC5 6 TYR B 211 ? TYR B 211 . ? 1_555 ? 
22 AC5 6 GLU B 448 ? GLU B 448 . ? 1_555 ? 
23 AC5 6 ASP B 497 ? ASP B 497 . ? 1_555 ? 
24 AC5 6 GLU B 500 ? GLU B 500 . ? 1_555 ? 
25 AC5 6 GLU B 529 ? GLU B 529 . ? 1_555 ? 
26 AC5 6 ASP B 533 ? ASP B 533 . ? 1_555 ? 
27 AC6 4 GLU B 259 ? GLU B 259 . ? 1_555 ? 
28 AC6 4 ALA B 610 ? ALA B 610 . ? 1_555 ? 
29 AC6 4 ILE B 613 ? ILE B 613 . ? 1_555 ? 
30 AC6 4 ASP B 615 ? ASP B 615 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6R7Y 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 14  ? 98.947  132.359 50.866  1.00 76.28  ? 14  SER A N   1 
ATOM   2     C  CA  . SER A 1 14  ? 97.800  133.122 51.342  1.00 76.28  ? 14  SER A CA  1 
ATOM   3     C  C   . SER A 1 14  ? 96.898  132.236 52.184  1.00 76.28  ? 14  SER A C   1 
ATOM   4     O  O   . SER A 1 14  ? 95.712  132.504 52.355  1.00 76.28  ? 14  SER A O   1 
ATOM   5     C  CB  . SER A 1 14  ? 97.026  133.713 50.163  1.00 76.28  ? 14  SER A CB  1 
ATOM   6     O  OG  . SER A 1 14  ? 96.411  132.694 49.397  1.00 76.28  ? 14  SER A OG  1 
ATOM   7     N  N   . PHE A 1 15  ? 97.493  131.175 52.710  1.00 63.29  ? 15  PHE A N   1 
ATOM   8     C  CA  . PHE A 1 15  ? 96.799  130.165 53.489  1.00 63.29  ? 15  PHE A CA  1 
ATOM   9     C  C   . PHE A 1 15  ? 96.575  130.628 54.926  1.00 63.29  ? 15  PHE A C   1 
ATOM   10    O  O   . PHE A 1 15  ? 96.923  131.744 55.321  1.00 63.29  ? 15  PHE A O   1 
ATOM   11    C  CB  . PHE A 1 15  ? 97.578  128.850 53.459  1.00 63.29  ? 15  PHE A CB  1 
ATOM   12    C  CG  . PHE A 1 15  ? 98.934  128.925 54.109  1.00 63.29  ? 15  PHE A CG  1 
ATOM   13    C  CD1 . PHE A 1 15  ? 100.032 129.376 53.397  1.00 63.29  ? 15  PHE A CD1 1 
ATOM   14    C  CD2 . PHE A 1 15  ? 99.116  128.514 55.415  1.00 63.29  ? 15  PHE A CD2 1 
ATOM   15    C  CE1 . PHE A 1 15  ? 101.264 129.442 53.978  1.00 63.29  ? 15  PHE A CE1 1 
ATOM   16    C  CE2 . PHE A 1 15  ? 100.351 128.583 56.001  1.00 63.29  ? 15  PHE A CE2 1 
ATOM   17    C  CZ  . PHE A 1 15  ? 101.428 129.047 55.278  1.00 63.29  ? 15  PHE A CZ  1 
ATOM   18    N  N   . THR A 1 16  ? 95.985  129.734 55.717  1.00 57.44  ? 16  THR A N   1 
ATOM   19    C  CA  . THR A 1 16  ? 95.738  129.963 57.129  1.00 57.44  ? 16  THR A CA  1 
ATOM   20    C  C   . THR A 1 16  ? 96.850  129.303 57.920  1.00 57.44  ? 16  THR A C   1 
ATOM   21    O  O   . THR A 1 16  ? 97.040  128.086 57.798  1.00 57.44  ? 16  THR A O   1 
ATOM   22    C  CB  . THR A 1 16  ? 94.389  129.399 57.547  1.00 57.44  ? 16  THR A CB  1 
ATOM   23    O  OG1 . THR A 1 16  ? 94.239  128.082 57.008  1.00 57.44  ? 16  THR A OG1 1 
ATOM   24    C  CG2 . THR A 1 16  ? 93.268  130.279 57.033  1.00 57.44  ? 16  THR A CG2 1 
ATOM   25    N  N   . PRO A 1 17  ? 97.592  130.042 58.732  1.00 55.83  ? 17  PRO A N   1 
ATOM   26    C  CA  . PRO A 1 17  ? 98.694  129.440 59.487  1.00 55.83  ? 17  PRO A CA  1 
ATOM   27    C  C   . PRO A 1 17  ? 98.196  128.573 60.623  1.00 55.83  ? 17  PRO A C   1 
ATOM   28    O  O   . PRO A 1 17  ? 97.254  128.927 61.331  1.00 55.83  ? 17  PRO A O   1 
ATOM   29    C  CB  . PRO A 1 17  ? 99.458  130.652 60.028  1.00 55.83  ? 17  PRO A CB  1 
ATOM   30    C  CG  . PRO A 1 17  ? 98.845  131.846 59.378  1.00 55.83  ? 17  PRO A CG  1 
ATOM   31    C  CD  . PRO A 1 17  ? 97.458  131.473 59.014  1.00 55.83  ? 17  PRO A CD  1 
ATOM   32    N  N   . LEU A 1 18  ? 98.815  127.409 60.770  1.00 47.45  ? 18  LEU A N   1 
ATOM   33    C  CA  . LEU A 1 18  ? 98.405  126.472 61.800  1.00 47.45  ? 18  LEU A CA  1 
ATOM   34    C  C   . LEU A 1 18  ? 99.494  126.185 62.819  1.00 47.45  ? 18  LEU A C   1 
ATOM   35    O  O   . LEU A 1 18  ? 99.206  126.115 64.013  1.00 47.45  ? 18  LEU A O   1 
ATOM   36    C  CB  . LEU A 1 18  ? 97.959  125.164 61.144  1.00 47.45  ? 18  LEU A CB  1 
ATOM   37    C  CG  . LEU A 1 18  ? 96.779  125.295 60.188  1.00 47.45  ? 18  LEU A CG  1 
ATOM   38    C  CD1 . LEU A 1 18  ? 96.334  123.929 59.700  1.00 47.45  ? 18  LEU A CD1 1 
ATOM   39    C  CD2 . LEU A 1 18  ? 95.633  126.041 60.830  1.00 47.45  ? 18  LEU A CD2 1 
ATOM   40    N  N   . VAL A 1 19  ? 100.737 126.032 62.394  1.00 40.12  ? 19  VAL A N   1 
ATOM   41    C  CA  . VAL A 1 19  ? 101.834 125.669 63.279  1.00 40.12  ? 19  VAL A CA  1 
ATOM   42    C  C   . VAL A 1 19  ? 102.968 126.656 63.073  1.00 40.12  ? 19  VAL A C   1 
ATOM   43    O  O   . VAL A 1 19  ? 103.320 126.967 61.934  1.00 40.12  ? 19  VAL A O   1 
ATOM   44    C  CB  . VAL A 1 19  ? 102.277 124.222 62.999  1.00 40.12  ? 19  VAL A CB  1 
ATOM   45    C  CG1 . VAL A 1 19  ? 103.680 123.958 63.468  1.00 40.12  ? 19  VAL A CG1 1 
ATOM   46    C  CG2 . VAL A 1 19  ? 101.323 123.270 63.645  1.00 40.12  ? 19  VAL A CG2 1 
ATOM   47    N  N   . VAL A 1 20  ? 103.552 127.137 64.163  1.00 38.49  ? 20  VAL A N   1 
ATOM   48    C  CA  . VAL A 1 20  ? 104.665 128.071 64.110  1.00 38.49  ? 20  VAL A CA  1 
ATOM   49    C  C   . VAL A 1 20  ? 105.938 127.346 64.487  1.00 38.49  ? 20  VAL A C   1 
ATOM   50    O  O   . VAL A 1 20  ? 105.986 126.659 65.510  1.00 38.49  ? 20  VAL A O   1 
ATOM   51    C  CB  . VAL A 1 20  ? 104.444 129.255 65.056  1.00 38.49  ? 20  VAL A CB  1 
ATOM   52    C  CG1 . VAL A 1 20  ? 105.556 130.242 64.912  1.00 38.49  ? 20  VAL A CG1 1 
ATOM   53    C  CG2 . VAL A 1 20  ? 103.148 129.910 64.738  1.00 38.49  ? 20  VAL A CG2 1 
ATOM   54    N  N   . ILE A 1 21  ? 106.962 127.487 63.658  1.00 43.20  ? 21  ILE A N   1 
ATOM   55    C  CA  . ILE A 1 21  ? 108.288 126.964 63.937  1.00 43.20  ? 21  ILE A CA  1 
ATOM   56    C  C   . ILE A 1 21  ? 109.194 128.142 64.216  1.00 43.20  ? 21  ILE A C   1 
ATOM   57    O  O   . ILE A 1 21  ? 109.284 129.058 63.396  1.00 43.20  ? 21  ILE A O   1 
ATOM   58    C  CB  . ILE A 1 21  ? 108.829 126.153 62.757  1.00 43.20  ? 21  ILE A CB  1 
ATOM   59    C  CG1 . ILE A 1 21  ? 107.938 124.957 62.480  1.00 43.20  ? 21  ILE A CG1 1 
ATOM   60    C  CG2 . ILE A 1 21  ? 110.243 125.734 63.010  1.00 43.20  ? 21  ILE A CG2 1 
ATOM   61    C  CD1 . ILE A 1 21  ? 108.405 124.152 61.315  1.00 43.20  ? 21  ILE A CD1 1 
ATOM   62    N  N   . GLU A 1 22  ? 109.841 128.150 65.367  1.00 57.80  ? 22  GLU A N   1 
ATOM   63    C  CA  . GLU A 1 22  ? 110.755 129.231 65.695  1.00 57.80  ? 22  GLU A CA  1 
ATOM   64    C  C   . GLU A 1 22  ? 112.164 128.680 65.576  1.00 57.80  ? 22  GLU A C   1 
ATOM   65    O  O   . GLU A 1 22  ? 112.560 127.809 66.355  1.00 57.80  ? 22  GLU A O   1 
ATOM   66    C  CB  . GLU A 1 22  ? 110.507 129.783 67.091  1.00 57.80  ? 22  GLU A CB  1 
ATOM   67    C  CG  . GLU A 1 22  ? 111.401 130.973 67.408  1.00 57.80  ? 22  GLU A CG  1 
ATOM   68    C  CD  . GLU A 1 22  ? 111.411 131.345 68.879  1.00 57.80  ? 22  GLU A CD  1 
ATOM   69    O  OE1 . GLU A 1 22  ? 110.799 130.617 69.687  1.00 57.80  ? 22  GLU A OE1 1 
ATOM   70    O  OE2 . GLU A 1 22  ? 112.032 132.373 69.229  1.00 57.80  ? 22  GLU A OE2 1 
ATOM   71    N  N   . LEU A 1 23  ? 112.913 129.167 64.599  1.00 65.31  ? 23  LEU A N   1 
ATOM   72    C  CA  . LEU A 1 23  ? 114.305 128.780 64.485  1.00 65.31  ? 23  LEU A CA  1 
ATOM   73    C  C   . LEU A 1 23  ? 115.158 129.579 65.460  1.00 65.31  ? 23  LEU A C   1 
ATOM   74    O  O   . LEU A 1 23  ? 114.705 130.543 66.078  1.00 65.31  ? 23  LEU A O   1 
ATOM   75    C  CB  . LEU A 1 23  ? 114.796 128.984 63.055  1.00 65.31  ? 23  LEU A CB  1 
ATOM   76    C  CG  . LEU A 1 23  ? 114.163 128.126 61.956  1.00 65.31  ? 23  LEU A CG  1 
ATOM   77    C  CD1 . LEU A 1 23  ? 115.035 128.085 60.734  1.00 65.31  ? 23  LEU A CD1 1 
ATOM   78    C  CD2 . LEU A 1 23  ? 113.925 126.724 62.431  1.00 65.31  ? 23  LEU A CD2 1 
ATOM   79    N  N   . ALA A 1 24  ? 116.414 129.168 65.595  1.00 79.72  ? 24  ALA A N   1 
ATOM   80    C  CA  . ALA A 1 24  ? 117.342 129.918 66.421  1.00 79.72  ? 24  ALA A CA  1 
ATOM   81    C  C   . ALA A 1 24  ? 117.870 131.109 65.625  1.00 79.72  ? 24  ALA A C   1 
ATOM   82    O  O   . ALA A 1 24  ? 117.540 131.304 64.453  1.00 79.72  ? 24  ALA A O   1 
ATOM   83    C  CB  . ALA A 1 24  ? 118.484 129.029 66.900  1.00 79.72  ? 24  ALA A CB  1 
ATOM   84    N  N   . GLN A 1 25  ? 118.727 131.907 66.253  1.00 89.22  ? 25  GLN A N   1 
ATOM   85    C  CA  . GLN A 1 25  ? 119.304 133.061 65.563  1.00 89.22  ? 25  GLN A CA  1 
ATOM   86    C  C   . GLN A 1 25  ? 120.432 132.662 64.616  1.00 89.22  ? 25  GLN A C   1 
ATOM   87    O  O   . GLN A 1 25  ? 120.359 132.903 63.408  1.00 89.22  ? 25  GLN A O   1 
ATOM   88    C  CB  . GLN A 1 25  ? 119.753 134.110 66.580  1.00 89.22  ? 25  GLN A CB  1 
ATOM   89    C  CG  . GLN A 1 25  ? 118.567 134.726 67.285  1.00 89.22  ? 25  GLN A CG  1 
ATOM   90    C  CD  . GLN A 1 25  ? 117.760 135.628 66.364  1.00 89.22  ? 25  GLN A CD  1 
ATOM   91    O  OE1 . GLN A 1 25  ? 118.288 136.194 65.408  1.00 89.22  ? 25  GLN A OE1 1 
ATOM   92    N  NE2 . GLN A 1 25  ? 116.465 135.741 66.634  1.00 89.22  ? 25  GLN A NE2 1 
ATOM   93    N  N   . ASP A 1 26  ? 121.474 132.028 65.151  1.00 96.75  ? 26  ASP A N   1 
ATOM   94    C  CA  . ASP A 1 26  ? 122.664 131.649 64.385  1.00 96.75  ? 26  ASP A CA  1 
ATOM   95    C  C   . ASP A 1 26  ? 122.380 130.342 63.647  1.00 96.75  ? 26  ASP A C   1 
ATOM   96    O  O   . ASP A 1 26  ? 122.823 129.254 64.023  1.00 96.75  ? 26  ASP A O   1 
ATOM   97    C  CB  . ASP A 1 26  ? 123.876 131.530 65.299  1.00 96.75  ? 26  ASP A CB  1 
ATOM   98    N  N   . VAL A 1 27  ? 121.634 130.474 62.556  1.00 93.67  ? 27  VAL A N   1 
ATOM   99    C  CA  . VAL A 1 27  ? 121.294 129.371 61.670  1.00 93.67  ? 27  VAL A CA  1 
ATOM   100   C  C   . VAL A 1 27  ? 121.752 129.749 60.272  1.00 93.67  ? 27  VAL A C   1 
ATOM   101   O  O   . VAL A 1 27  ? 121.364 130.804 59.758  1.00 93.67  ? 27  VAL A O   1 
ATOM   102   C  CB  . VAL A 1 27  ? 119.783 129.102 61.677  1.00 93.67  ? 27  VAL A CB  1 
ATOM   103   C  CG1 . VAL A 1 27  ? 119.385 128.211 60.519  1.00 93.67  ? 27  VAL A CG1 1 
ATOM   104   C  CG2 . VAL A 1 27  ? 119.356 128.523 63.002  1.00 93.67  ? 27  VAL A CG2 1 
ATOM   105   N  N   . LYS A 1 28  ? 122.596 128.910 59.669  1.00 101.84 ? 28  LYS A N   1 
ATOM   106   C  CA  . LYS A 1 28  ? 123.139 129.228 58.356  1.00 101.84 ? 28  LYS A CA  1 
ATOM   107   C  C   . LYS A 1 28  ? 122.076 129.076 57.272  1.00 101.84 ? 28  LYS A C   1 
ATOM   108   O  O   . LYS A 1 28  ? 121.023 128.461 57.466  1.00 101.84 ? 28  LYS A O   1 
ATOM   109   C  CB  . LYS A 1 28  ? 124.322 128.320 58.044  1.00 101.84 ? 28  LYS A CB  1 
ATOM   110   C  CG  . LYS A 1 28  ? 125.304 128.252 59.177  1.00 101.84 ? 28  LYS A CG  1 
ATOM   111   C  CD  . LYS A 1 28  ? 126.383 127.223 58.945  1.00 101.84 ? 28  LYS A CD  1 
ATOM   112   C  CE  . LYS A 1 28  ? 126.866 126.686 60.282  1.00 101.84 ? 28  LYS A CE  1 
ATOM   113   N  NZ  . LYS A 1 28  ? 128.066 125.821 60.150  1.00 101.84 ? 28  LYS A NZ  1 
ATOM   114   N  N   . GLU A 1 29  ? 122.380 129.640 56.101  1.00 105.42 ? 29  GLU A N   1 
ATOM   115   C  CA  . GLU A 1 29  ? 121.402 129.665 55.021  1.00 105.42 ? 29  GLU A CA  1 
ATOM   116   C  C   . GLU A 1 29  ? 121.210 128.303 54.381  1.00 105.42 ? 29  GLU A C   1 
ATOM   117   O  O   . GLU A 1 29  ? 120.124 128.019 53.864  1.00 105.42 ? 29  GLU A O   1 
ATOM   118   C  CB  . GLU A 1 29  ? 121.805 130.701 53.982  1.00 105.42 ? 29  GLU A CB  1 
ATOM   119   C  CG  . GLU A 1 29  ? 121.564 132.106 54.472  1.00 105.42 ? 29  GLU A CG  1 
ATOM   120   C  CD  . GLU A 1 29  ? 120.155 132.280 54.996  1.00 105.42 ? 29  GLU A CD  1 
ATOM   121   O  OE1 . GLU A 1 29  ? 119.202 132.040 54.225  1.00 105.42 ? 29  GLU A OE1 1 
ATOM   122   O  OE2 . GLU A 1 29  ? 120.000 132.638 56.180  1.00 105.42 ? 29  GLU A OE2 1 
ATOM   123   N  N   . GLU A 1 30  ? 122.249 127.466 54.382  1.00 102.10 ? 30  GLU A N   1 
ATOM   124   C  CA  . GLU A 1 30  ? 122.154 126.161 53.738  1.00 102.10 ? 30  GLU A CA  1 
ATOM   125   C  C   . GLU A 1 30  ? 121.186 125.255 54.484  1.00 102.10 ? 30  GLU A C   1 
ATOM   126   O  O   . GLU A 1 30  ? 120.403 124.528 53.864  1.00 102.10 ? 30  GLU A O   1 
ATOM   127   C  CB  . GLU A 1 30  ? 123.536 125.516 53.652  1.00 102.10 ? 30  GLU A CB  1 
ATOM   128   C  CG  . GLU A 1 30  ? 123.546 124.141 53.010  1.00 102.10 ? 30  GLU A CG  1 
ATOM   129   N  N   . THR A 1 31  ? 121.209 125.318 55.816  1.00 98.17  ? 31  THR A N   1 
ATOM   130   C  CA  . THR A 1 31  ? 120.265 124.567 56.632  1.00 98.17  ? 31  THR A CA  1 
ATOM   131   C  C   . THR A 1 31  ? 118.834 125.063 56.460  1.00 98.17  ? 31  THR A C   1 
ATOM   132   O  O   . THR A 1 31  ? 117.898 124.256 56.503  1.00 98.17  ? 31  THR A O   1 
ATOM   133   C  CB  . THR A 1 31  ? 120.686 124.642 58.097  1.00 98.17  ? 31  THR A CB  1 
ATOM   134   O  OG1 . THR A 1 31  ? 122.107 124.487 58.186  1.00 98.17  ? 31  THR A OG1 1 
ATOM   135   C  CG2 . THR A 1 31  ? 120.037 123.537 58.893  1.00 98.17  ? 31  THR A CG2 1 
ATOM   136   N  N   . LYS A 1 32  ? 118.643 126.372 56.260  1.00 93.13  ? 32  LYS A N   1 
ATOM   137   C  CA  . LYS A 1 32  ? 117.298 126.895 56.038  1.00 93.13  ? 32  LYS A CA  1 
ATOM   138   C  C   . LYS A 1 32  ? 116.714 126.394 54.726  1.00 93.13  ? 32  LYS A C   1 
ATOM   139   O  O   . LYS A 1 32  ? 115.561 125.955 54.685  1.00 93.13  ? 32  LYS A O   1 
ATOM   140   C  CB  . LYS A 1 32  ? 117.320 128.419 56.049  1.00 93.13  ? 32  LYS A CB  1 
ATOM   141   C  CG  . LYS A 1 32  ? 117.364 129.023 57.431  1.00 93.13  ? 32  LYS A CG  1 
ATOM   142   C  CD  . LYS A 1 32  ? 117.282 130.538 57.383  1.00 93.13  ? 32  LYS A CD  1 
ATOM   143   C  CE  . LYS A 1 32  ? 117.345 131.130 58.780  1.00 93.13  ? 32  LYS A CE  1 
ATOM   144   N  NZ  . LYS A 1 32  ? 117.248 132.610 58.771  1.00 93.13  ? 32  LYS A NZ  1 
ATOM   145   N  N   . GLU A 1 33  ? 117.496 126.445 53.647  1.00 96.15  ? 33  GLU A N   1 
ATOM   146   C  CA  . GLU A 1 33  ? 117.015 125.951 52.362  1.00 96.15  ? 33  GLU A CA  1 
ATOM   147   C  C   . GLU A 1 33  ? 116.882 124.439 52.349  1.00 96.15  ? 33  GLU A C   1 
ATOM   148   O  O   . GLU A 1 33  ? 116.017 123.905 51.646  1.00 96.15  ? 33  GLU A O   1 
ATOM   149   C  CB  . GLU A 1 33  ? 117.916 126.429 51.225  1.00 96.15  ? 33  GLU A CB  1 
ATOM   150   C  CG  . GLU A 1 33  ? 118.192 127.934 51.191  1.00 96.15  ? 33  GLU A CG  1 
ATOM   151   C  CD  . GLU A 1 33  ? 116.951 128.835 51.122  1.00 96.15  ? 33  GLU A CD  1 
ATOM   152   O  OE1 . GLU A 1 33  ? 115.853 128.394 50.709  1.00 96.15  ? 33  GLU A OE1 1 
ATOM   153   O  OE2 . GLU A 1 33  ? 117.084 130.020 51.491  1.00 96.15  ? 33  GLU A OE2 1 
ATOM   154   N  N   . TRP A 1 34  ? 117.722 123.735 53.104  1.00 89.86  ? 34  TRP A N   1 
ATOM   155   C  CA  . TRP A 1 34  ? 117.595 122.286 53.160  1.00 89.86  ? 34  TRP A CA  1 
ATOM   156   C  C   . TRP A 1 34  ? 116.350 121.883 53.927  1.00 89.86  ? 34  TRP A C   1 
ATOM   157   O  O   . TRP A 1 34  ? 115.668 120.924 53.550  1.00 89.86  ? 34  TRP A O   1 
ATOM   158   C  CB  . TRP A 1 34  ? 118.835 121.677 53.797  1.00 89.86  ? 34  TRP A CB  1 
ATOM   159   C  CG  . TRP A 1 34  ? 118.691 120.250 54.098  1.00 89.86  ? 34  TRP A CG  1 
ATOM   160   C  CD1 . TRP A 1 34  ? 118.812 119.220 53.229  1.00 89.86  ? 34  TRP A CD1 1 
ATOM   161   C  CD2 . TRP A 1 34  ? 118.428 119.674 55.375  1.00 89.86  ? 34  TRP A CD2 1 
ATOM   162   N  NE1 . TRP A 1 34  ? 118.624 118.030 53.879  1.00 89.86  ? 34  TRP A NE1 1 
ATOM   163   C  CE2 . TRP A 1 34  ? 118.388 118.283 55.202  1.00 89.86  ? 34  TRP A CE2 1 
ATOM   164   C  CE3 . TRP A 1 34  ? 118.214 120.201 56.647  1.00 89.86  ? 34  TRP A CE3 1 
ATOM   165   C  CZ2 . TRP A 1 34  ? 118.142 117.411 56.251  1.00 89.86  ? 34  TRP A CZ2 1 
ATOM   166   C  CZ3 . TRP A 1 34  ? 117.973 119.334 57.688  1.00 89.86  ? 34  TRP A CZ3 1 
ATOM   167   C  CH2 . TRP A 1 34  ? 117.940 117.955 57.485  1.00 89.86  ? 34  TRP A CH2 1 
ATOM   168   N  N   . LEU A 1 35  ? 116.045 122.598 55.009  1.00 84.87  ? 35  LEU A N   1 
ATOM   169   C  CA  . LEU A 1 35  ? 114.814 122.337 55.744  1.00 84.87  ? 35  LEU A CA  1 
ATOM   170   C  C   . LEU A 1 35  ? 113.587 122.718 54.929  1.00 84.87  ? 35  LEU A C   1 
ATOM   171   O  O   . LEU A 1 35  ? 112.599 121.975 54.902  1.00 84.87  ? 35  LEU A O   1 
ATOM   172   C  CB  . LEU A 1 35  ? 114.818 123.100 57.062  1.00 84.87  ? 35  LEU A CB  1 
ATOM   173   C  CG  . LEU A 1 35  ? 113.551 122.882 57.880  1.00 84.87  ? 35  LEU A CG  1 
ATOM   174   C  CD1 . LEU A 1 35  ? 113.478 121.444 58.332  1.00 84.87  ? 35  LEU A CD1 1 
ATOM   175   C  CD2 . LEU A 1 35  ? 113.480 123.832 59.050  1.00 84.87  ? 35  LEU A CD2 1 
ATOM   176   N  N   . LYS A 1 36  ? 113.656 123.844 54.218  1.00 80.04  ? 36  LYS A N   1 
ATOM   177   C  CA  . LYS A 1 36  ? 112.542 124.279 53.384  1.00 80.04  ? 36  LYS A CA  1 
ATOM   178   C  C   . LYS A 1 36  ? 112.306 123.340 52.210  1.00 80.04  ? 36  LYS A C   1 
ATOM   179   O  O   . LYS A 1 36  ? 111.163 123.141 51.788  1.00 80.04  ? 36  LYS A O   1 
ATOM   180   C  CB  . LYS A 1 36  ? 112.782 125.700 52.894  1.00 80.04  ? 36  LYS A CB  1 
ATOM   181   C  CG  . LYS A 1 36  ? 111.546 126.343 52.336  1.00 80.04  ? 36  LYS A CG  1 
ATOM   182   C  CD  . LYS A 1 36  ? 111.808 127.724 51.797  1.00 80.04  ? 36  LYS A CD  1 
ATOM   183   C  CE  . LYS A 1 36  ? 110.505 128.390 51.403  1.00 80.04  ? 36  LYS A CE  1 
ATOM   184   N  NZ  . LYS A 1 36  ? 110.645 129.862 51.263  1.00 80.04  ? 36  LYS A NZ  1 
ATOM   185   N  N   . ASN A 1 37  ? 113.358 122.727 51.695  1.00 84.90  ? 37  ASN A N   1 
ATOM   186   C  CA  . ASN A 1 37  ? 113.205 121.748 50.632  1.00 84.90  ? 37  ASN A CA  1 
ATOM   187   C  C   . ASN A 1 37  ? 112.731 120.397 51.132  1.00 84.90  ? 37  ASN A C   1 
ATOM   188   O  O   . ASN A 1 37  ? 112.212 119.611 50.336  1.00 84.90  ? 37  ASN A O   1 
ATOM   189   C  CB  . ASN A 1 37  ? 114.511 121.581 49.862  1.00 84.90  ? 37  ASN A CB  1 
ATOM   190   C  CG  . ASN A 1 37  ? 114.594 122.509 48.680  1.00 84.90  ? 37  ASN A CG  1 
ATOM   191   O  OD1 . ASN A 1 37  ? 113.589 122.790 48.029  1.00 84.90  ? 37  ASN A OD1 1 
ATOM   192   N  ND2 . ASN A 1 37  ? 115.791 123.001 48.397  1.00 84.90  ? 37  ASN A ND2 1 
ATOM   193   N  N   . ARG A 1 38  ? 112.888 120.101 52.420  1.00 81.05  ? 38  ARG A N   1 
ATOM   194   C  CA  . ARG A 1 38  ? 112.330 118.871 52.955  1.00 81.05  ? 38  ARG A CA  1 
ATOM   195   C  C   . ARG A 1 38  ? 110.908 119.040 53.453  1.00 81.05  ? 38  ARG A C   1 
ATOM   196   O  O   . ARG A 1 38  ? 110.270 118.042 53.799  1.00 81.05  ? 38  ARG A O   1 
ATOM   197   C  CB  . ARG A 1 38  ? 113.196 118.327 54.094  1.00 81.05  ? 38  ARG A CB  1 
ATOM   198   C  CG  . ARG A 1 38  ? 114.407 117.579 53.589  1.00 81.05  ? 38  ARG A CG  1 
ATOM   199   C  CD  . ARG A 1 38  ? 114.024 116.498 52.598  1.00 81.05  ? 38  ARG A CD  1 
ATOM   200   N  NE  . ARG A 1 38  ? 113.311 115.384 53.204  1.00 81.05  ? 38  ARG A NE  1 
ATOM   201   C  CZ  . ARG A 1 38  ? 113.916 114.331 53.742  1.00 81.05  ? 38  ARG A CZ  1 
ATOM   202   N  NH1 . ARG A 1 38  ? 115.241 114.258 53.747  1.00 81.05  ? 38  ARG A NH1 1 
ATOM   203   N  NH2 . ARG A 1 38  ? 113.200 113.347 54.266  1.00 81.05  ? 38  ARG A NH2 1 
ATOM   204   N  N   . ILE A 1 39  ? 110.406 120.265 53.521  1.00 74.86  ? 39  ILE A N   1 
ATOM   205   C  CA  . ILE A 1 39  ? 109.021 120.482 53.910  1.00 74.86  ? 39  ILE A CA  1 
ATOM   206   C  C   . ILE A 1 39  ? 108.116 120.588 52.691  1.00 74.86  ? 39  ILE A C   1 
ATOM   207   O  O   . ILE A 1 39  ? 107.078 119.925 52.622  1.00 74.86  ? 39  ILE A O   1 
ATOM   208   C  CB  . ILE A 1 39  ? 108.908 121.728 54.810  1.00 74.86  ? 39  ILE A CB  1 
ATOM   209   C  CG1 . ILE A 1 39  ? 109.331 121.389 56.231  1.00 74.86  ? 39  ILE A CG1 1 
ATOM   210   C  CG2 . ILE A 1 39  ? 107.486 122.239 54.860  1.00 74.86  ? 39  ILE A CG2 1 
ATOM   211   C  CD1 . ILE A 1 39  ? 109.272 122.572 57.168  1.00 74.86  ? 39  ILE A CD1 1 
ATOM   212   N  N   . ILE A 1 40  ? 108.513 121.374 51.685  1.00 74.19  ? 40  ILE A N   1 
ATOM   213   C  CA  . ILE A 1 40  ? 107.598 121.668 50.584  1.00 74.19  ? 40  ILE A CA  1 
ATOM   214   C  C   . ILE A 1 40  ? 107.507 120.490 49.620  1.00 74.19  ? 40  ILE A C   1 
ATOM   215   O  O   . ILE A 1 40  ? 106.482 120.307 48.949  1.00 74.19  ? 40  ILE A O   1 
ATOM   216   C  CB  . ILE A 1 40  ? 108.029 122.959 49.868  1.00 74.19  ? 40  ILE A CB  1 
ATOM   217   C  CG1 . ILE A 1 40  ? 108.151 124.090 50.867  1.00 74.19  ? 40  ILE A CG1 1 
ATOM   218   C  CG2 . ILE A 1 40  ? 106.986 123.429 48.857  1.00 74.19  ? 40  ILE A CG2 1 
ATOM   219   C  CD1 . ILE A 1 40  ? 108.737 125.326 50.255  1.00 74.19  ? 40  ILE A CD1 1 
ATOM   220   N  N   . ALA A 1 41  ? 108.550 119.664 49.548  1.00 77.25  ? 41  ALA A N   1 
ATOM   221   C  CA  . ALA A 1 41  ? 108.581 118.595 48.559  1.00 77.25  ? 41  ALA A CA  1 
ATOM   222   C  C   . ALA A 1 41  ? 107.528 117.541 48.882  1.00 77.25  ? 41  ALA A C   1 
ATOM   223   O  O   . ALA A 1 41  ? 107.133 117.364 50.037  1.00 77.25  ? 41  ALA A O   1 
ATOM   224   C  CB  . ALA A 1 41  ? 109.963 117.952 48.502  1.00 77.25  ? 41  ALA A CB  1 
ATOM   225   N  N   . LYS A 1 42  ? 107.060 116.856 47.840  1.00 77.77  ? 42  LYS A N   1 
ATOM   226   C  CA  . LYS A 1 42  ? 105.865 116.036 47.961  1.00 77.77  ? 42  LYS A CA  1 
ATOM   227   C  C   . LYS A 1 42  ? 106.146 114.769 48.767  1.00 77.77  ? 42  LYS A C   1 
ATOM   228   O  O   . LYS A 1 42  ? 107.288 114.451 49.114  1.00 77.77  ? 42  LYS A O   1 
ATOM   229   C  CB  . LYS A 1 42  ? 105.324 115.698 46.576  1.00 77.77  ? 42  LYS A CB  1 
ATOM   230   C  CG  . LYS A 1 42  ? 105.277 116.901 45.657  1.00 77.77  ? 42  LYS A CG  1 
ATOM   231   C  CD  . LYS A 1 42  ? 104.888 116.511 44.249  1.00 77.77  ? 42  LYS A CD  1 
ATOM   232   C  CE  . LYS A 1 42  ? 103.391 116.335 44.117  1.00 77.77  ? 42  LYS A CE  1 
ATOM   233   N  NZ  . LYS A 1 42  ? 102.691 117.641 44.160  1.00 77.77  ? 42  LYS A NZ  1 
ATOM   234   N  N   . LYS A 1 43  ? 105.071 114.034 49.054  1.00 74.54  ? 43  LYS A N   1 
ATOM   235   C  CA  . LYS A 1 43  ? 105.197 112.873 49.921  1.00 74.54  ? 43  LYS A CA  1 
ATOM   236   C  C   . LYS A 1 43  ? 105.884 111.716 49.221  1.00 74.54  ? 43  LYS A C   1 
ATOM   237   O  O   . LYS A 1 43  ? 106.500 110.870 49.878  1.00 74.54  ? 43  LYS A O   1 
ATOM   238   C  CB  . LYS A 1 43  ? 103.812 112.447 50.394  1.00 74.54  ? 43  LYS A CB  1 
ATOM   239   C  CG  . LYS A 1 43  ? 103.801 111.709 51.706  1.00 74.54  ? 43  LYS A CG  1 
ATOM   240   C  CD  . LYS A 1 43  ? 104.255 112.604 52.843  1.00 74.54  ? 43  LYS A CD  1 
ATOM   241   C  CE  . LYS A 1 43  ? 104.063 111.905 54.174  1.00 74.54  ? 43  LYS A CE  1 
ATOM   242   N  NZ  . LYS A 1 43  ? 102.632 111.590 54.406  1.00 74.54  ? 43  LYS A NZ  1 
ATOM   243   N  N   . LYS A 1 44  ? 105.796 111.667 47.896  1.00 79.82  ? 44  LYS A N   1 
ATOM   244   C  CA  . LYS A 1 44  ? 106.464 110.641 47.110  1.00 79.82  ? 44  LYS A CA  1 
ATOM   245   C  C   . LYS A 1 44  ? 107.928 110.955 46.832  1.00 79.82  ? 44  LYS A C   1 
ATOM   246   O  O   . LYS A 1 44  ? 108.699 110.038 46.531  1.00 79.82  ? 44  LYS A O   1 
ATOM   247   C  CB  . LYS A 1 44  ? 105.677 110.423 45.819  1.00 79.82  ? 44  LYS A CB  1 
ATOM   248   C  CG  . LYS A 1 44  ? 105.488 111.676 45.002  1.00 79.82  ? 44  LYS A CG  1 
ATOM   249   C  CD  . LYS A 1 44  ? 104.392 111.478 43.978  1.00 79.82  ? 44  LYS A CD  1 
ATOM   250   C  CE  . LYS A 1 44  ? 103.032 111.537 44.665  1.00 79.82  ? 44  LYS A CE  1 
ATOM   251   N  NZ  . LYS A 1 44  ? 101.885 111.478 43.720  1.00 79.82  ? 44  LYS A NZ  1 
ATOM   252   N  N   . ASP A 1 45  ? 108.329 112.219 46.935  1.00 79.32  ? 45  ASP A N   1 
ATOM   253   C  CA  . ASP A 1 45  ? 109.716 112.608 46.733  1.00 79.32  ? 45  ASP A CA  1 
ATOM   254   C  C   . ASP A 1 45  ? 110.509 112.664 48.028  1.00 79.32  ? 45  ASP A C   1 
ATOM   255   O  O   . ASP A 1 45  ? 111.612 113.217 48.042  1.00 79.32  ? 45  ASP A O   1 
ATOM   256   C  CB  . ASP A 1 45  ? 109.770 113.972 46.046  1.00 79.32  ? 45  ASP A CB  1 
ATOM   257   C  CG  . ASP A 1 45  ? 108.814 114.071 44.874  1.00 79.32  ? 45  ASP A CG  1 
ATOM   258   O  OD1 . ASP A 1 45  ? 108.514 113.028 44.260  1.00 79.32  ? 45  ASP A OD1 1 
ATOM   259   O  OD2 . ASP A 1 45  ? 108.357 115.192 44.573  1.00 79.32  ? 45  ASP A OD2 1 
ATOM   260   N  N   . GLY A 1 46  ? 109.980 112.101 49.106  1.00 80.16  ? 46  GLY A N   1 
ATOM   261   C  CA  . GLY A 1 46  ? 110.665 112.080 50.383  1.00 80.16  ? 46  GLY A CA  1 
ATOM   262   C  C   . GLY A 1 46  ? 110.568 113.387 51.143  1.00 80.16  ? 46  GLY A C   1 
ATOM   263   O  O   . GLY A 1 46  ? 111.414 113.683 51.990  1.00 80.16  ? 46  GLY A O   1 
ATOM   264   N  N   . GLY A 1 47  ? 109.530 114.167 50.868  1.00 81.04  ? 47  GLY A N   1 
ATOM   265   C  CA  . GLY A 1 47  ? 109.340 115.422 51.564  1.00 81.04  ? 47  GLY A CA  1 
ATOM   266   C  C   . GLY A 1 47  ? 108.153 115.339 52.496  1.00 81.04  ? 47  GLY A C   1 
ATOM   267   O  O   . GLY A 1 47  ? 107.884 114.278 53.064  1.00 81.04  ? 47  GLY A O   1 
ATOM   268   N  N   . ALA A 1 48  ? 107.442 116.447 52.684  1.00 73.70  ? 48  ALA A N   1 
ATOM   269   C  CA  . ALA A 1 48  ? 106.265 116.408 53.533  1.00 73.70  ? 48  ALA A CA  1 
ATOM   270   C  C   . ALA A 1 48  ? 105.055 117.082 52.913  1.00 73.70  ? 48  ALA A C   1 
ATOM   271   O  O   . ALA A 1 48  ? 103.954 116.893 53.436  1.00 73.70  ? 48  ALA A O   1 
ATOM   272   C  CB  . ALA A 1 48  ? 106.563 117.057 54.887  1.00 73.70  ? 48  ALA A CB  1 
ATOM   273   N  N   . GLN A 1 49  ? 105.224 117.856 51.830  1.00 72.08  ? 49  GLN A N   1 
ATOM   274   C  CA  . GLN A 1 49  ? 104.141 118.480 51.059  1.00 72.08  ? 49  GLN A CA  1 
ATOM   275   C  C   . GLN A 1 49  ? 103.292 119.412 51.919  1.00 72.08  ? 49  GLN A C   1 
ATOM   276   O  O   . GLN A 1 49  ? 102.065 119.332 51.935  1.00 72.08  ? 49  GLN A O   1 
ATOM   277   C  CB  . GLN A 1 49  ? 103.278 117.430 50.358  1.00 72.08  ? 49  GLN A CB  1 
ATOM   278   C  CG  . GLN A 1 49  ? 102.714 117.886 49.030  1.00 72.08  ? 49  GLN A CG  1 
ATOM   279   C  CD  . GLN A 1 49  ? 101.860 116.823 48.375  1.00 72.08  ? 49  GLN A CD  1 
ATOM   280   O  OE1 . GLN A 1 49  ? 102.217 115.647 48.370  1.00 72.08  ? 49  GLN A OE1 1 
ATOM   281   N  NE2 . GLN A 1 49  ? 100.718 117.228 47.831  1.00 72.08  ? 49  GLN A NE2 1 
ATOM   282   N  N   . LEU A 1 50  ? 103.954 120.278 52.668  1.00 66.32  ? 50  LEU A N   1 
ATOM   283   C  CA  . LEU A 1 50  ? 103.273 121.263 53.487  1.00 66.32  ? 50  LEU A CA  1 
ATOM   284   C  C   . LEU A 1 50  ? 103.500 122.663 52.941  1.00 66.32  ? 50  LEU A C   1 
ATOM   285   O  O   . LEU A 1 50  ? 104.599 122.989 52.486  1.00 66.32  ? 50  LEU A O   1 
ATOM   286   C  CB  . LEU A 1 50  ? 103.766 121.169 54.914  1.00 66.32  ? 50  LEU A CB  1 
ATOM   287   C  CG  . LEU A 1 50  ? 103.501 119.766 55.441  1.00 66.32  ? 50  LEU A CG  1 
ATOM   288   C  CD1 . LEU A 1 50  ? 104.292 119.501 56.697  1.00 66.32  ? 50  LEU A CD1 1 
ATOM   289   C  CD2 . LEU A 1 50  ? 102.024 119.574 55.678  1.00 66.32  ? 50  LEU A CD2 1 
ATOM   290   N  N   . LEU A 1 51  ? 102.457 123.483 52.979  1.00 59.37  ? 51  LEU A N   1 
ATOM   291   C  CA  . LEU A 1 51  ? 102.588 124.879 52.590  1.00 59.37  ? 51  LEU A CA  1 
ATOM   292   C  C   . LEU A 1 51  ? 103.418 125.629 53.618  1.00 59.37  ? 51  LEU A C   1 
ATOM   293   O  O   . LEU A 1 51  ? 103.138 125.572 54.815  1.00 59.37  ? 51  LEU A O   1 
ATOM   294   C  CB  . LEU A 1 51  ? 101.215 125.509 52.445  1.00 59.37  ? 51  LEU A CB  1 
ATOM   295   C  CG  . LEU A 1 51  ? 100.345 124.662 51.525  1.00 59.37  ? 51  LEU A CG  1 
ATOM   296   C  CD1 . LEU A 1 51  ? 98.945  125.212 51.468  1.00 59.37  ? 51  LEU A CD1 1 
ATOM   297   C  CD2 . LEU A 1 51  ? 100.938 124.600 50.135  1.00 59.37  ? 51  LEU A CD2 1 
ATOM   298   N  N   . PHE A 1 52  ? 104.435 126.333 53.150  1.00 60.30  ? 52  PHE A N   1 
ATOM   299   C  CA  . PHE A 1 52  ? 105.398 127.000 54.006  1.00 60.30  ? 52  PHE A CA  1 
ATOM   300   C  C   . PHE A 1 52  ? 105.412 128.486 53.692  1.00 60.30  ? 52  PHE A C   1 
ATOM   301   O  O   . PHE A 1 52  ? 105.225 128.883 52.544  1.00 60.30  ? 52  PHE A O   1 
ATOM   302   C  CB  . PHE A 1 52  ? 106.772 126.416 53.760  1.00 60.30  ? 52  PHE A CB  1 
ATOM   303   C  CG  . PHE A 1 52  ? 107.800 126.799 54.767  1.00 60.30  ? 52  PHE A CG  1 
ATOM   304   C  CD1 . PHE A 1 52  ? 107.964 126.042 55.911  1.00 60.30  ? 52  PHE A CD1 1 
ATOM   305   C  CD2 . PHE A 1 52  ? 108.622 127.890 54.567  1.00 60.30  ? 52  PHE A CD2 1 
ATOM   306   C  CE1 . PHE A 1 52  ? 108.922 126.367 56.834  1.00 60.30  ? 52  PHE A CE1 1 
ATOM   307   C  CE2 . PHE A 1 52  ? 109.575 128.224 55.496  1.00 60.30  ? 52  PHE A CE2 1 
ATOM   308   C  CZ  . PHE A 1 52  ? 109.726 127.454 56.623  1.00 60.30  ? 52  PHE A CZ  1 
ATOM   309   N  N   . ARG A 1 53  ? 105.650 129.313 54.706  1.00 61.25  ? 53  ARG A N   1 
ATOM   310   C  CA  . ARG A 1 53  ? 105.627 130.755 54.498  1.00 61.25  ? 53  ARG A CA  1 
ATOM   311   C  C   . ARG A 1 53  ? 106.500 131.402 55.552  1.00 61.25  ? 53  ARG A C   1 
ATOM   312   O  O   . ARG A 1 53  ? 106.559 130.911 56.681  1.00 61.25  ? 53  ARG A O   1 
ATOM   313   C  CB  . ARG A 1 53  ? 104.201 131.305 54.600  1.00 61.25  ? 53  ARG A CB  1 
ATOM   314   C  CG  . ARG A 1 53  ? 104.046 132.699 54.059  1.00 61.25  ? 53  ARG A CG  1 
ATOM   315   C  CD  . ARG A 1 53  ? 102.624 133.005 53.618  1.00 61.25  ? 53  ARG A CD  1 
ATOM   316   N  NE  . ARG A 1 53  ? 101.636 132.906 54.688  1.00 61.25  ? 53  ARG A NE  1 
ATOM   317   C  CZ  . ARG A 1 53  ? 101.303 133.917 55.485  1.00 61.25  ? 53  ARG A CZ  1 
ATOM   318   N  NH1 . ARG A 1 53  ? 101.885 135.097 55.340  1.00 61.25  ? 53  ARG A NH1 1 
ATOM   319   N  NH2 . ARG A 1 53  ? 100.388 133.752 56.426  1.00 61.25  ? 53  ARG A NH2 1 
ATOM   320   N  N   . PRO A 1 54  ? 107.184 132.489 55.230  1.00 60.21  ? 54  PRO A N   1 
ATOM   321   C  CA  . PRO A 1 54  ? 107.753 133.338 56.276  1.00 60.21  ? 54  PRO A CA  1 
ATOM   322   C  C   . PRO A 1 54  ? 106.663 134.110 56.997  1.00 60.21  ? 54  PRO A C   1 
ATOM   323   O  O   . PRO A 1 54  ? 105.524 134.214 56.543  1.00 60.21  ? 54  PRO A O   1 
ATOM   324   C  CB  . PRO A 1 54  ? 108.694 134.267 55.517  1.00 60.21  ? 54  PRO A CB  1 
ATOM   325   C  CG  . PRO A 1 54  ? 108.951 133.574 54.238  1.00 60.21  ? 54  PRO A CG  1 
ATOM   326   C  CD  . PRO A 1 54  ? 107.710 132.829 53.906  1.00 60.21  ? 54  PRO A CD  1 
ATOM   327   N  N   . LEU A 1 55  ? 107.034 134.663 58.151  1.00 69.97  ? 55  LEU A N   1 
ATOM   328   C  CA  . LEU A 1 55  ? 106.095 135.481 58.907  1.00 69.97  ? 55  LEU A CA  1 
ATOM   329   C  C   . LEU A 1 55  ? 105.842 136.819 58.224  1.00 69.97  ? 55  LEU A C   1 
ATOM   330   O  O   . LEU A 1 55  ? 104.713 137.322 58.220  1.00 69.97  ? 55  LEU A O   1 
ATOM   331   C  CB  . LEU A 1 55  ? 106.598 135.690 60.328  1.00 69.97  ? 55  LEU A CB  1 
ATOM   332   C  CG  . LEU A 1 55  ? 105.554 136.358 61.221  1.00 69.97  ? 55  LEU A CG  1 
ATOM   333   C  CD1 . LEU A 1 55  ? 104.236 135.607 61.172  1.00 69.97  ? 55  LEU A CD1 1 
ATOM   334   C  CD2 . LEU A 1 55  ? 106.044 136.472 62.637  1.00 69.97  ? 55  LEU A CD2 1 
ATOM   335   N  N   . LEU A 1 56  ? 106.869 137.397 57.607  1.00 81.61  ? 56  LEU A N   1 
ATOM   336   C  CA  . LEU A 1 56  ? 106.720 138.686 56.948  1.00 81.61  ? 56  LEU A CA  1 
ATOM   337   C  C   . LEU A 1 56  ? 107.441 138.690 55.610  1.00 81.61  ? 56  LEU A C   1 
ATOM   338   O  O   . LEU A 1 56  ? 108.587 138.256 55.496  1.00 81.61  ? 56  LEU A O   1 
ATOM   339   C  CB  . LEU A 1 56  ? 107.258 139.829 57.814  1.00 81.61  ? 56  LEU A CB  1 
ATOM   340   C  CG  . LEU A 1 56  ? 106.464 140.207 59.063  1.00 81.61  ? 56  LEU A CG  1 
ATOM   341   C  CD1 . LEU A 1 56  ? 107.279 141.122 59.954  1.00 81.61  ? 56  LEU A CD1 1 
ATOM   342   C  CD2 . LEU A 1 56  ? 105.157 140.866 58.682  1.00 81.61  ? 56  LEU A CD2 1 
ATOM   343   N  N   . ASN A 1 57  ? 106.731 139.151 54.586  1.00 89.59  ? 57  ASN A N   1 
ATOM   344   C  CA  . ASN A 1 57  ? 107.291 139.261 53.248  1.00 89.59  ? 57  ASN A CA  1 
ATOM   345   C  C   . ASN A 1 57  ? 108.334 140.369 53.133  1.00 89.59  ? 57  ASN A C   1 
ATOM   346   O  O   . ASN A 1 57  ? 109.217 140.299 52.271  1.00 89.59  ? 57  ASN A O   1 
ATOM   347   C  CB  . ASN A 1 57  ? 106.165 139.507 52.243  1.00 89.59  ? 57  ASN A CB  1 
ATOM   348   C  CG  . ASN A 1 57  ? 104.828 138.945 52.706  1.00 89.59  ? 57  ASN A CG  1 
ATOM   349   O  OD1 . ASN A 1 57  ? 104.709 138.397 53.799  1.00 89.59  ? 57  ASN A OD1 1 
ATOM   350   N  ND2 . ASN A 1 57  ? 103.809 139.097 51.872  1.00 89.59  ? 57  ASN A ND2 1 
ATOM   351   N  N   . LYS A 1 58  ? 108.252 141.392 53.980  1.00 90.59  ? 58  LYS A N   1 
ATOM   352   C  CA  . LYS A 1 58  ? 109.226 142.470 54.010  1.00 90.59  ? 58  LYS A CA  1 
ATOM   353   C  C   . LYS A 1 58  ? 109.778 142.595 55.425  1.00 90.59  ? 58  LYS A C   1 
ATOM   354   O  O   . LYS A 1 58  ? 109.130 142.195 56.395  1.00 90.59  ? 58  LYS A O   1 
ATOM   355   C  CB  . LYS A 1 58  ? 108.571 143.792 53.574  1.00 90.59  ? 58  LYS A CB  1 
ATOM   356   C  CG  . LYS A 1 58  ? 109.526 144.910 53.184  1.00 90.59  ? 58  LYS A CG  1 
ATOM   357   C  CD  . LYS A 1 58  ? 108.785 146.168 52.784  1.00 90.59  ? 58  LYS A CD  1 
ATOM   358   C  CE  . LYS A 1 58  ? 109.725 147.357 52.766  1.00 90.59  ? 58  LYS A CE  1 
ATOM   359   N  NZ  . LYS A 1 58  ? 109.169 148.493 51.994  1.00 90.59  ? 58  LYS A NZ  1 
ATOM   360   N  N   . TYR A 1 59  ? 110.971 143.171 55.557  1.00 92.91  ? 59  TYR A N   1 
ATOM   361   C  CA  . TYR A 1 59  ? 111.547 143.367 56.876  1.00 92.91  ? 59  TYR A CA  1 
ATOM   362   C  C   . TYR A 1 59  ? 112.231 144.724 56.951  1.00 92.91  ? 59  TYR A C   1 
ATOM   363   O  O   . TYR A 1 59  ? 112.818 145.198 55.975  1.00 92.91  ? 59  TYR A O   1 
ATOM   364   C  CB  . TYR A 1 59  ? 112.540 142.269 57.236  1.00 92.91  ? 59  TYR A CB  1 
ATOM   365   C  CG  . TYR A 1 59  ? 111.865 141.076 57.842  1.00 92.91  ? 59  TYR A CG  1 
ATOM   366   C  CD1 . TYR A 1 59  ? 111.735 140.952 59.214  1.00 92.91  ? 59  TYR A CD1 1 
ATOM   367   C  CD2 . TYR A 1 59  ? 111.397 140.046 57.045  1.00 92.91  ? 59  TYR A CD2 1 
ATOM   368   C  CE1 . TYR A 1 59  ? 111.117 139.848 59.777  1.00 92.91  ? 59  TYR A CE1 1 
ATOM   369   C  CE2 . TYR A 1 59  ? 110.787 138.938 57.597  1.00 92.91  ? 59  TYR A CE2 1 
ATOM   370   C  CZ  . TYR A 1 59  ? 110.650 138.841 58.961  1.00 92.91  ? 59  TYR A CZ  1 
ATOM   371   O  OH  . TYR A 1 59  ? 110.038 137.735 59.502  1.00 92.91  ? 59  TYR A OH  1 
ATOM   372   N  N   . GLU A 1 60  ? 112.158 145.336 58.131  1.00 106.78 ? 60  GLU A N   1 
ATOM   373   C  CA  . GLU A 1 60  ? 112.883 146.565 58.425  1.00 106.78 ? 60  GLU A CA  1 
ATOM   374   C  C   . GLU A 1 60  ? 113.884 146.305 59.538  1.00 106.78 ? 60  GLU A C   1 
ATOM   375   O  O   . GLU A 1 60  ? 113.947 145.191 60.061  1.00 106.78 ? 60  GLU A O   1 
ATOM   376   C  CB  . GLU A 1 60  ? 111.928 147.683 58.833  1.00 106.78 ? 60  GLU A CB  1 
ATOM   377   C  CG  . GLU A 1 60  ? 111.308 147.470 60.196  1.00 106.78 ? 60  GLU A CG  1 
ATOM   378   C  CD  . GLU A 1 60  ? 110.037 148.251 60.363  1.00 106.78 ? 60  GLU A CD  1 
ATOM   379   O  OE1 . GLU A 1 60  ? 109.680 148.983 59.419  1.00 106.78 ? 60  GLU A OE1 1 
ATOM   380   O  OE2 . GLU A 1 60  ? 109.394 148.127 61.424  1.00 106.78 ? 60  GLU A OE2 1 
ATOM   381   N  N   . GLN A 1 61  ? 114.649 147.326 59.926  1.00 111.72 ? 61  GLN A N   1 
ATOM   382   C  CA  . GLN A 1 61  ? 115.681 147.150 60.944  1.00 111.72 ? 61  GLN A CA  1 
ATOM   383   C  C   . GLN A 1 61  ? 115.085 146.924 62.332  1.00 111.72 ? 61  GLN A C   1 
ATOM   384   O  O   . GLN A 1 61  ? 115.775 146.462 63.248  1.00 111.72 ? 61  GLN A O   1 
ATOM   385   C  CB  . GLN A 1 61  ? 116.612 148.363 60.954  1.00 111.72 ? 61  GLN A CB  1 
ATOM   386   N  N   . GLU A 1 62  ? 113.806 147.248 62.515  1.00 108.95 ? 62  GLU A N   1 
ATOM   387   C  CA  . GLU A 1 62  ? 113.197 147.050 63.822  1.00 108.95 ? 62  GLU A CA  1 
ATOM   388   C  C   . GLU A 1 62  ? 112.813 145.599 64.085  1.00 108.95 ? 62  GLU A C   1 
ATOM   389   O  O   . GLU A 1 62  ? 113.052 145.103 65.190  1.00 108.95 ? 62  GLU A O   1 
ATOM   390   C  CB  . GLU A 1 62  ? 111.963 147.941 63.967  1.00 108.95 ? 62  GLU A CB  1 
ATOM   391   N  N   . THR A 1 63  ? 112.243 144.902 63.101  1.00 105.98 ? 63  THR A N   1 
ATOM   392   C  CA  . THR A 1 63  ? 111.735 143.554 63.309  1.00 105.98 ? 63  THR A CA  1 
ATOM   393   C  C   . THR A 1 63  ? 112.683 142.486 62.789  1.00 105.98 ? 63  THR A C   1 
ATOM   394   O  O   . THR A 1 63  ? 112.233 141.406 62.399  1.00 105.98 ? 63  THR A O   1 
ATOM   395   C  CB  . THR A 1 63  ? 110.368 143.393 62.654  1.00 105.98 ? 63  THR A CB  1 
ATOM   396   O  OG1 . THR A 1 63  ? 110.537 143.223 61.244  1.00 105.98 ? 63  THR A OG1 1 
ATOM   397   C  CG2 . THR A 1 63  ? 109.524 144.627 62.903  1.00 105.98 ? 63  THR A CG2 1 
ATOM   398   N  N   . LEU A 1 64  ? 113.985 142.759 62.785  1.00 100.33 ? 64  LEU A N   1 
ATOM   399   C  CA  . LEU A 1 64  ? 114.952 141.774 62.322  1.00 100.33 ? 64  LEU A CA  1 
ATOM   400   C  C   . LEU A 1 64  ? 115.159 140.656 63.320  1.00 100.33 ? 64  LEU A C   1 
ATOM   401   O  O   . LEU A 1 64  ? 115.650 139.592 62.939  1.00 100.33 ? 64  LEU A O   1 
ATOM   402   C  CB  . LEU A 1 64  ? 116.301 142.419 62.003  1.00 100.33 ? 64  LEU A CB  1 
ATOM   403   C  CG  . LEU A 1 64  ? 116.463 143.196 60.698  1.00 100.33 ? 64  LEU A CG  1 
ATOM   404   C  CD1 . LEU A 1 64  ? 117.931 143.352 60.368  1.00 100.33 ? 64  LEU A CD1 1 
ATOM   405   C  CD2 . LEU A 1 64  ? 115.754 142.483 59.560  1.00 100.33 ? 64  LEU A CD2 1 
ATOM   406   N  N   . GLU A 1 65  ? 114.813 140.868 64.588  1.00 95.39  ? 65  GLU A N   1 
ATOM   407   C  CA  . GLU A 1 65  ? 115.001 139.805 65.562  1.00 95.39  ? 65  GLU A CA  1 
ATOM   408   C  C   . GLU A 1 65  ? 113.842 138.821 65.583  1.00 95.39  ? 65  GLU A C   1 
ATOM   409   O  O   . GLU A 1 65  ? 113.860 137.872 66.375  1.00 95.39  ? 65  GLU A O   1 
ATOM   410   C  CB  . GLU A 1 65  ? 115.173 140.420 66.948  1.00 95.39  ? 65  GLU A CB  1 
ATOM   411   C  CG  . GLU A 1 65  ? 114.462 141.750 67.092  1.00 95.39  ? 65  GLU A CG  1 
ATOM   412   C  CD  . GLU A 1 65  ? 114.281 142.154 68.528  1.00 95.39  ? 65  GLU A CD  1 
ATOM   413   O  OE1 . GLU A 1 65  ? 113.588 141.424 69.264  1.00 95.39  ? 65  GLU A OE1 1 
ATOM   414   O  OE2 . GLU A 1 65  ? 114.838 143.194 68.925  1.00 95.39  ? 65  GLU A OE2 1 
ATOM   415   N  N   . ASN A 1 66  ? 112.830 139.028 64.744  1.00 89.63  ? 66  ASN A N   1 
ATOM   416   C  CA  . ASN A 1 66  ? 111.711 138.105 64.676  1.00 89.63  ? 66  ASN A CA  1 
ATOM   417   C  C   . ASN A 1 66  ? 111.651 137.585 63.250  1.00 89.63  ? 66  ASN A C   1 
ATOM   418   O  O   . ASN A 1 66  ? 110.564 137.430 62.688  1.00 89.63  ? 66  ASN A O   1 
ATOM   419   C  CB  . ASN A 1 66  ? 110.406 138.807 65.048  1.00 89.63  ? 66  ASN A CB  1 
ATOM   420   C  CG  . ASN A 1 66  ? 110.417 139.368 66.455  1.00 89.63  ? 66  ASN A CG  1 
ATOM   421   O  OD1 . ASN A 1 66  ? 111.339 139.137 67.231  1.00 89.63  ? 66  ASN A OD1 1 
ATOM   422   N  ND2 . ASN A 1 66  ? 109.428 140.195 66.756  1.00 89.63  ? 66  ASN A ND2 1 
ATOM   423   N  N   . GLN A 1 67  ? 112.810 137.335 62.647  1.00 85.46  ? 67  GLN A N   1 
ATOM   424   C  CA  . GLN A 1 67  ? 112.875 137.062 61.220  1.00 85.46  ? 67  GLN A CA  1 
ATOM   425   C  C   . GLN A 1 67  ? 112.973 135.575 60.950  1.00 85.46  ? 67  GLN A C   1 
ATOM   426   O  O   . GLN A 1 67  ? 113.102 135.160 59.794  1.00 85.46  ? 67  GLN A O   1 
ATOM   427   C  CB  . GLN A 1 67  ? 114.038 137.809 60.566  1.00 85.46  ? 67  GLN A CB  1 
ATOM   428   C  CG  . GLN A 1 67  ? 115.410 137.197 60.760  1.00 85.46  ? 67  GLN A CG  1 
ATOM   429   C  CD  . GLN A 1 67  ? 116.505 138.065 60.175  1.00 85.46  ? 67  GLN A CD  1 
ATOM   430   O  OE1 . GLN A 1 67  ? 116.340 138.652 59.106  1.00 85.46  ? 67  GLN A OE1 1 
ATOM   431   N  NE2 . GLN A 1 67  ? 117.631 138.150 60.872  1.00 85.46  ? 67  GLN A NE2 1 
ATOM   432   N  N   . ASN A 1 68  ? 112.848 134.770 61.994  1.00 71.91  ? 68  ASN A N   1 
ATOM   433   C  CA  . ASN A 1 68  ? 113.035 133.336 61.941  1.00 71.91  ? 68  ASN A CA  1 
ATOM   434   C  C   . ASN A 1 68  ? 111.750 132.579 62.184  1.00 71.91  ? 68  ASN A C   1 
ATOM   435   O  O   . ASN A 1 68  ? 111.758 131.348 62.148  1.00 71.91  ? 68  ASN A O   1 
ATOM   436   C  CB  . ASN A 1 68  ? 114.065 132.929 62.990  1.00 71.91  ? 68  ASN A CB  1 
ATOM   437   C  CG  . ASN A 1 68  ? 113.827 133.628 64.311  1.00 71.91  ? 68  ASN A CG  1 
ATOM   438   O  OD1 . ASN A 1 68  ? 112.895 134.420 64.442  1.00 71.91  ? 68  ASN A OD1 1 
ATOM   439   N  ND2 . ASN A 1 68  ? 114.665 133.341 65.297  1.00 71.91  ? 68  ASN A ND2 1 
ATOM   440   N  N   . LEU A 1 69  ? 110.649 133.284 62.369  1.00 61.40  ? 69  LEU A N   1 
ATOM   441   C  CA  . LEU A 1 69  ? 109.377 132.643 62.628  1.00 61.40  ? 69  LEU A CA  1 
ATOM   442   C  C   . LEU A 1 69  ? 108.761 132.229 61.307  1.00 61.40  ? 69  LEU A C   1 
ATOM   443   O  O   . LEU A 1 69  ? 108.646 133.035 60.383  1.00 61.40  ? 69  LEU A O   1 
ATOM   444   C  CB  . LEU A 1 69  ? 108.458 133.603 63.369  1.00 61.40  ? 69  LEU A CB  1 
ATOM   445   C  CG  . LEU A 1 69  ? 108.900 133.867 64.800  1.00 61.40  ? 69  LEU A CG  1 
ATOM   446   C  CD1 . LEU A 1 69  ? 108.192 135.065 65.359  1.00 61.40  ? 69  LEU A CD1 1 
ATOM   447   C  CD2 . LEU A 1 69  ? 108.605 132.663 65.634  1.00 61.40  ? 69  LEU A CD2 1 
ATOM   448   N  N   . TYR A 1 70  ? 108.345 130.980 61.225  1.00 57.73  ? 70  TYR A N   1 
ATOM   449   C  CA  . TYR A 1 70  ? 107.772 130.439 60.012  1.00 57.73  ? 70  TYR A CA  1 
ATOM   450   C  C   . TYR A 1 70  ? 106.444 129.793 60.329  1.00 57.73  ? 70  TYR A C   1 
ATOM   451   O  O   . TYR A 1 70  ? 106.240 129.262 61.418  1.00 57.73  ? 70  TYR A O   1 
ATOM   452   C  CB  . TYR A 1 70  ? 108.682 129.392 59.421  1.00 57.73  ? 70  TYR A CB  1 
ATOM   453   C  CG  . TYR A 1 70  ? 109.988 129.922 58.910  1.00 57.73  ? 70  TYR A CG  1 
ATOM   454   C  CD1 . TYR A 1 70  ? 110.043 131.077 58.146  1.00 57.73  ? 70  TYR A CD1 1 
ATOM   455   C  CD2 . TYR A 1 70  ? 111.177 129.279 59.217  1.00 57.73  ? 70  TYR A CD2 1 
ATOM   456   C  CE1 . TYR A 1 70  ? 111.250 131.564 57.674  1.00 57.73  ? 70  TYR A CE1 1 
ATOM   457   C  CE2 . TYR A 1 70  ? 112.385 129.753 58.758  1.00 57.73  ? 70  TYR A CE2 1 
ATOM   458   C  CZ  . TYR A 1 70  ? 112.419 130.897 57.988  1.00 57.73  ? 70  TYR A CZ  1 
ATOM   459   O  OH  . TYR A 1 70  ? 113.627 131.370 57.528  1.00 57.73  ? 70  TYR A OH  1 
ATOM   460   N  N   . LEU A 1 71  ? 105.537 129.861 59.376  1.00 49.96  ? 71  LEU A N   1 
ATOM   461   C  CA  . LEU A 1 71  ? 104.205 129.316 59.535  1.00 49.96  ? 71  LEU A CA  1 
ATOM   462   C  C   . LEU A 1 71  ? 104.078 128.104 58.639  1.00 49.96  ? 71  LEU A C   1 
ATOM   463   O  O   . LEU A 1 71  ? 104.579 128.101 57.516  1.00 49.96  ? 71  LEU A O   1 
ATOM   464   C  CB  . LEU A 1 71  ? 103.151 130.351 59.189  1.00 49.96  ? 71  LEU A CB  1 
ATOM   465   C  CG  . LEU A 1 71  ? 103.448 131.679 59.874  1.00 49.96  ? 71  LEU A CG  1 
ATOM   466   C  CD1 . LEU A 1 71  ? 102.441 132.713 59.476  1.00 49.96  ? 71  LEU A CD1 1 
ATOM   467   C  CD2 . LEU A 1 71  ? 103.426 131.514 61.367  1.00 49.96  ? 71  LEU A CD2 1 
ATOM   468   N  N   . VAL A 1 72  ? 103.427 127.069 59.136  1.00 48.67  ? 72  VAL A N   1 
ATOM   469   C  CA  . VAL A 1 72  ? 103.258 125.832 58.395  1.00 48.67  ? 72  VAL A CA  1 
ATOM   470   C  C   . VAL A 1 72  ? 101.783 125.495 58.407  1.00 48.67  ? 72  VAL A C   1 
ATOM   471   O  O   . VAL A 1 72  ? 101.169 125.407 59.473  1.00 48.67  ? 72  VAL A O   1 
ATOM   472   C  CB  . VAL A 1 72  ? 104.083 124.683 58.991  1.00 48.67  ? 72  VAL A CB  1 
ATOM   473   C  CG1 . VAL A 1 72  ? 103.724 123.397 58.314  1.00 48.67  ? 72  VAL A CG1 1 
ATOM   474   C  CG2 . VAL A 1 72  ? 105.547 124.946 58.822  1.00 48.67  ? 72  VAL A CG2 1 
ATOM   475   N  N   . GLY A 1 73  ? 101.215 125.335 57.227  1.00 57.62  ? 73  GLY A N   1 
ATOM   476   C  CA  . GLY A 1 73  ? 99.864  124.851 57.081  1.00 57.62  ? 73  GLY A CA  1 
ATOM   477   C  C   . GLY A 1 73  ? 99.851  123.825 55.980  1.00 57.62  ? 73  GLY A C   1 
ATOM   478   O  O   . GLY A 1 73  ? 100.918 123.346 55.586  1.00 57.62  ? 73  GLY A O   1 
ATOM   479   N  N   . ALA A 1 74  ? 98.676  123.504 55.453  1.00 66.80  ? 74  ALA A N   1 
ATOM   480   C  CA  . ALA A 1 74  ? 98.584  122.644 54.284  1.00 66.80  ? 74  ALA A CA  1 
ATOM   481   C  C   . ALA A 1 74  ? 97.242  122.875 53.617  1.00 66.80  ? 74  ALA A C   1 
ATOM   482   O  O   . ALA A 1 74  ? 96.431  123.691 54.060  1.00 66.80  ? 74  ALA A O   1 
ATOM   483   C  CB  . ALA A 1 74  ? 98.745  121.168 54.647  1.00 66.80  ? 74  ALA A CB  1 
ATOM   484   N  N   . SER A 1 75  ? 97.013  122.132 52.551  1.00 74.14  ? 75  SER A N   1 
ATOM   485   C  CA  . SER A 1 75  ? 95.778  122.193 51.803  1.00 74.14  ? 75  SER A CA  1 
ATOM   486   C  C   . SER A 1 75  ? 94.846  121.081 52.247  1.00 74.14  ? 75  SER A C   1 
ATOM   487   O  O   . SER A 1 75  ? 95.215  120.204 53.027  1.00 74.14  ? 75  SER A O   1 
ATOM   488   C  CB  . SER A 1 75  ? 96.077  122.093 50.310  1.00 74.14  ? 75  SER A CB  1 
ATOM   489   O  OG  . SER A 1 75  ? 97.065  121.105 50.074  1.00 74.14  ? 75  SER A OG  1 
ATOM   490   N  N   . LYS A 1 76  ? 93.625  121.121 51.720  1.00 73.56  ? 76  LYS A N   1 
ATOM   491   C  CA  . LYS A 1 76  ? 92.558  120.280 52.236  1.00 73.56  ? 76  LYS A CA  1 
ATOM   492   C  C   . LYS A 1 76  ? 92.797  118.822 51.883  1.00 73.56  ? 76  LYS A C   1 
ATOM   493   O  O   . LYS A 1 76  ? 92.564  117.938 52.711  1.00 73.56  ? 76  LYS A O   1 
ATOM   494   C  CB  . LYS A 1 76  ? 91.213  120.788 51.732  1.00 73.56  ? 76  LYS A CB  1 
ATOM   495   C  CG  . LYS A 1 76  ? 90.859  122.111 52.394  1.00 73.56  ? 76  LYS A CG  1 
ATOM   496   C  CD  . LYS A 1 76  ? 89.589  122.758 51.869  1.00 73.56  ? 76  LYS A CD  1 
ATOM   497   C  CE  . LYS A 1 76  ? 88.394  121.837 51.954  1.00 73.56  ? 76  LYS A CE  1 
ATOM   498   N  NZ  . LYS A 1 76  ? 87.158  122.516 51.471  1.00 73.56  ? 76  LYS A NZ  1 
ATOM   499   N  N   . ILE A 1 77  ? 93.238  118.551 50.654  1.00 70.87  ? 77  ILE A N   1 
ATOM   500   C  CA  . ILE A 1 77  ? 93.522  117.178 50.254  1.00 70.87  ? 77  ILE A CA  1 
ATOM   501   C  C   . ILE A 1 77  ? 94.720  116.642 51.024  1.00 70.87  ? 77  ILE A C   1 
ATOM   502   O  O   . ILE A 1 77  ? 94.783  115.449 51.349  1.00 70.87  ? 77  ILE A O   1 
ATOM   503   C  CB  . ILE A 1 77  ? 93.767  117.103 48.739  1.00 70.87  ? 77  ILE A CB  1 
ATOM   504   C  CG1 . ILE A 1 77  ? 92.685  117.863 47.972  1.00 70.87  ? 77  ILE A CG1 1 
ATOM   505   C  CG2 . ILE A 1 77  ? 93.826  115.656 48.272  1.00 70.87  ? 77  ILE A CG2 1 
ATOM   506   C  CD1 . ILE A 1 77  ? 91.344  117.163 47.917  1.00 70.87  ? 77  ILE A CD1 1 
ATOM   507   N  N   . ARG A 1 78  ? 95.669  117.518 51.360  1.00 72.25  ? 78  ARG A N   1 
ATOM   508   C  CA  . ARG A 1 78  ? 96.804  117.135 52.195  1.00 72.25  ? 78  ARG A CA  1 
ATOM   509   C  C   . ARG A 1 78  ? 96.390  116.746 53.612  1.00 72.25  ? 78  ARG A C   1 
ATOM   510   O  O   . ARG A 1 78  ? 96.929  115.784 54.172  1.00 72.25  ? 78  ARG A O   1 
ATOM   511   C  CB  . ARG A 1 78  ? 97.827  118.269 52.217  1.00 72.25  ? 78  ARG A CB  1 
ATOM   512   C  CG  . ARG A 1 78  ? 99.114  117.875 52.881  1.00 72.25  ? 78  ARG A CG  1 
ATOM   513   C  CD  . ARG A 1 78  ? 99.687  116.647 52.242  1.00 72.25  ? 78  ARG A CD  1 
ATOM   514   N  NE  . ARG A 1 78  ? 100.669 116.054 53.125  1.00 72.25  ? 78  ARG A NE  1 
ATOM   515   C  CZ  . ARG A 1 78  ? 100.361 115.113 54.005  1.00 72.25  ? 78  ARG A CZ  1 
ATOM   516   N  NH1 . ARG A 1 78  ? 99.108  114.690 54.098  1.00 72.25  ? 78  ARG A NH1 1 
ATOM   517   N  NH2 . ARG A 1 78  ? 101.292 114.602 54.795  1.00 72.25  ? 78  ARG A NH2 1 
ATOM   518   N  N   . MET A 1 79  ? 95.430  117.463 54.203  1.00 70.24  ? 79  MET A N   1 
ATOM   519   C  CA  . MET A 1 79  ? 94.994  117.123 55.553  1.00 70.24  ? 79  MET A CA  1 
ATOM   520   C  C   . MET A 1 79  ? 94.210  115.828 55.569  1.00 70.24  ? 79  MET A C   1 
ATOM   521   O  O   . MET A 1 79  ? 94.267  115.077 56.546  1.00 70.24  ? 79  MET A O   1 
ATOM   522   C  CB  . MET A 1 79  ? 94.138  118.237 56.142  1.00 70.24  ? 79  MET A CB  1 
ATOM   523   C  CG  . MET A 1 79  ? 94.815  119.560 56.191  1.00 70.24  ? 79  MET A CG  1 
ATOM   524   S  SD  . MET A 1 79  ? 96.465  119.390 56.858  1.00 70.24  ? 79  MET A SD  1 
ATOM   525   C  CE  . MET A 1 79  ? 96.093  118.995 58.559  1.00 70.24  ? 79  MET A CE  1 
ATOM   526   N  N   . LEU A 1 80  ? 93.475  115.549 54.502  1.00 70.47  ? 80  LEU A N   1 
ATOM   527   C  CA  . LEU A 1 80  ? 92.744  114.296 54.437  1.00 70.47  ? 80  LEU A CA  1 
ATOM   528   C  C   . LEU A 1 80  ? 93.688  113.121 54.262  1.00 70.47  ? 80  LEU A C   1 
ATOM   529   O  O   . LEU A 1 80  ? 93.477  112.062 54.860  1.00 70.47  ? 80  LEU A O   1 
ATOM   530   C  CB  . LEU A 1 80  ? 91.719  114.363 53.319  1.00 70.47  ? 80  LEU A CB  1 
ATOM   531   C  CG  . LEU A 1 80  ? 90.662  115.409 53.647  1.00 70.47  ? 80  LEU A CG  1 
ATOM   532   C  CD1 . LEU A 1 80  ? 89.614  115.455 52.572  1.00 70.47  ? 80  LEU A CD1 1 
ATOM   533   C  CD2 . LEU A 1 80  ? 90.017  115.089 54.977  1.00 70.47  ? 80  LEU A CD2 1 
ATOM   534   N  N   . LEU A 1 81  ? 94.740  113.289 53.460  1.00 69.79  ? 81  LEU A N   1 
ATOM   535   C  CA  . LEU A 1 81  ? 95.732  112.228 53.345  1.00 69.79  ? 81  LEU A CA  1 
ATOM   536   C  C   . LEU A 1 81  ? 96.512  112.054 54.638  1.00 69.79  ? 81  LEU A C   1 
ATOM   537   O  O   . LEU A 1 81  ? 96.871  110.929 55.001  1.00 69.79  ? 81  LEU A O   1 
ATOM   538   C  CB  . LEU A 1 81  ? 96.685  112.520 52.192  1.00 69.79  ? 81  LEU A CB  1 
ATOM   539   C  CG  . LEU A 1 81  ? 96.060  112.412 50.806  1.00 69.79  ? 81  LEU A CG  1 
ATOM   540   C  CD1 . LEU A 1 81  ? 97.040  112.843 49.728  1.00 69.79  ? 81  LEU A CD1 1 
ATOM   541   C  CD2 . LEU A 1 81  ? 95.596  110.985 50.581  1.00 69.79  ? 81  LEU A CD2 1 
ATOM   542   N  N   . GLY A 1 82  ? 96.766  113.148 55.350  1.00 62.79  ? 82  GLY A N   1 
ATOM   543   C  CA  . GLY A 1 82  ? 97.382  113.046 56.657  1.00 62.79  ? 82  GLY A CA  1 
ATOM   544   C  C   . GLY A 1 82  ? 96.464  112.423 57.686  1.00 62.79  ? 82  GLY A C   1 
ATOM   545   O  O   . GLY A 1 82  ? 96.922  111.715 58.585  1.00 62.79  ? 82  GLY A O   1 
ATOM   546   N  N   . ALA A 1 83  ? 95.156  112.631 57.534  1.00 60.69  ? 83  ALA A N   1 
ATOM   547   C  CA  . ALA A 1 83  ? 94.187  111.991 58.410  1.00 60.69  ? 83  ALA A CA  1 
ATOM   548   C  C   . ALA A 1 83  ? 94.113  110.501 58.167  1.00 60.69  ? 83  ALA A C   1 
ATOM   549   O  O   . ALA A 1 83  ? 93.790  109.746 59.086  1.00 60.69  ? 83  ALA A O   1 
ATOM   550   C  CB  . ALA A 1 83  ? 92.809  112.614 58.226  1.00 60.69  ? 83  ALA A CB  1 
ATOM   551   N  N   . GLU A 1 84  ? 94.363  110.063 56.944  1.00 54.18  ? 84  GLU A N   1 
ATOM   552   C  CA  . GLU A 1 84  ? 94.506  108.634 56.726  1.00 54.18  ? 84  GLU A CA  1 
ATOM   553   C  C   . GLU A 1 84  ? 95.725  108.077 57.445  1.00 54.18  ? 84  GLU A C   1 
ATOM   554   O  O   . GLU A 1 84  ? 95.668  106.973 57.994  1.00 54.18  ? 84  GLU A O   1 
ATOM   555   C  CB  . GLU A 1 84  ? 94.594  108.345 55.231  1.00 54.18  ? 84  GLU A CB  1 
ATOM   556   N  N   . ALA A 1 85  ? 96.832  108.819 57.458  1.00 49.92  ? 85  ALA A N   1 
ATOM   557   C  CA  . ALA A 1 85  ? 98.046  108.301 58.083  1.00 49.92  ? 85  ALA A CA  1 
ATOM   558   C  C   . ALA A 1 85  ? 97.950  108.253 59.603  1.00 49.92  ? 85  ALA A C   1 
ATOM   559   O  O   . ALA A 1 85  ? 98.466  107.321 60.227  1.00 49.92  ? 85  ALA A O   1 
ATOM   560   C  CB  . ALA A 1 85  ? 99.247  109.142 57.663  1.00 49.92  ? 85  ALA A CB  1 
ATOM   561   N  N   . VAL A 1 86  ? 97.306  109.243 60.219  1.00 47.34  ? 86  VAL A N   1 
ATOM   562   C  CA  . VAL A 1 86  ? 97.202  109.246 61.674  1.00 47.34  ? 86  VAL A CA  1 
ATOM   563   C  C   . VAL A 1 86  ? 96.192  108.217 62.149  1.00 47.34  ? 86  VAL A C   1 
ATOM   564   O  O   . VAL A 1 86  ? 96.486  107.395 63.022  1.00 47.34  ? 86  VAL A O   1 
ATOM   565   C  CB  . VAL A 1 86  ? 96.850  110.653 62.174  1.00 47.34  ? 86  VAL A CB  1 
ATOM   566   C  CG1 . VAL A 1 86  ? 96.318  110.608 63.575  1.00 47.34  ? 86  VAL A CG1 1 
ATOM   567   C  CG2 . VAL A 1 86  ? 98.074  111.505 62.133  1.00 47.34  ? 86  VAL A CG2 1 
ATOM   568   N  N   . GLY A 1 87  ? 95.009  108.206 61.553  1.00 51.41  ? 87  GLY A N   1 
ATOM   569   C  CA  . GLY A 1 87  ? 94.024  107.257 62.011  1.00 51.41  ? 87  GLY A CA  1 
ATOM   570   C  C   . GLY A 1 87  ? 92.984  107.941 62.867  1.00 51.41  ? 87  GLY A C   1 
ATOM   571   O  O   . GLY A 1 87  ? 92.650  107.436 63.940  1.00 51.41  ? 87  GLY A O   1 
ATOM   572   N  N   . LEU A 1 88  ? 92.492  109.097 62.431  1.00 57.08  ? 88  LEU A N   1 
ATOM   573   C  CA  . LEU A 1 88  ? 91.403  109.756 63.132  1.00 57.08  ? 88  LEU A CA  1 
ATOM   574   C  C   . LEU A 1 88  ? 90.154  108.902 63.093  1.00 57.08  ? 88  LEU A C   1 
ATOM   575   O  O   . LEU A 1 88  ? 89.870  108.220 62.111  1.00 57.08  ? 88  LEU A O   1 
ATOM   576   C  CB  . LEU A 1 88  ? 91.080  111.095 62.493  1.00 57.08  ? 88  LEU A CB  1 
ATOM   577   C  CG  . LEU A 1 88  ? 92.132  112.180 62.554  1.00 57.08  ? 88  LEU A CG  1 
ATOM   578   C  CD1 . LEU A 1 88  ? 91.579  113.436 61.930  1.00 57.08  ? 88  LEU A CD1 1 
ATOM   579   C  CD2 . LEU A 1 88  ? 92.503  112.420 63.990  1.00 57.08  ? 88  LEU A CD2 1 
ATOM   580   N  N   . VAL A 1 89  ? 89.426  108.907 64.194  1.00 57.30  ? 89  VAL A N   1 
ATOM   581   C  CA  . VAL A 1 89  ? 88.208  108.123 64.256  1.00 57.30  ? 89  VAL A CA  1 
ATOM   582   C  C   . VAL A 1 89  ? 87.002  109.041 64.236  1.00 57.30  ? 89  VAL A C   1 
ATOM   583   O  O   . VAL A 1 89  ? 86.738  109.753 65.206  1.00 57.30  ? 89  VAL A O   1 
ATOM   584   C  CB  . VAL A 1 89  ? 88.196  107.215 65.493  1.00 57.30  ? 89  VAL A CB  1 
ATOM   585   C  CG1 . VAL A 1 89  ? 86.903  106.448 65.550  1.00 57.30  ? 89  VAL A CG1 1 
ATOM   586   C  CG2 . VAL A 1 89  ? 89.371  106.266 65.456  1.00 57.30  ? 89  VAL A CG2 1 
ATOM   587   N  N   . LYS A 1 90  ? 86.302  109.083 63.119  1.00 65.02  ? 90  LYS A N   1 
ATOM   588   C  CA  . LYS A 1 90  ? 85.148  109.951 62.991  1.00 65.02  ? 90  LYS A CA  1 
ATOM   589   C  C   . LYS A 1 90  ? 83.888  109.097 62.928  1.00 65.02  ? 90  LYS A C   1 
ATOM   590   O  O   . LYS A 1 90  ? 83.945  107.875 62.794  1.00 65.02  ? 90  LYS A O   1 
ATOM   591   C  CB  . LYS A 1 90  ? 85.260  110.826 61.751  1.00 65.02  ? 90  LYS A CB  1 
ATOM   592   C  CG  . LYS A 1 90  ? 86.585  111.511 61.611  1.00 65.02  ? 90  LYS A CG  1 
ATOM   593   C  CD  . LYS A 1 90  ? 86.688  112.686 62.536  1.00 65.02  ? 90  LYS A CD  1 
ATOM   594   C  CE  . LYS A 1 90  ? 85.733  113.780 62.135  1.00 65.02  ? 90  LYS A CE  1 
ATOM   595   N  NZ  . LYS A 1 90  ? 85.905  114.968 63.014  1.00 65.02  ? 90  LYS A NZ  1 
ATOM   596   N  N   . GLU A 1 91  ? 82.740  109.748 63.051  1.00 74.91  ? 91  GLU A N   1 
ATOM   597   C  CA  . GLU A 1 91  ? 81.458  109.055 63.071  1.00 74.91  ? 91  GLU A CA  1 
ATOM   598   C  C   . GLU A 1 91  ? 81.018  108.827 61.630  1.00 74.91  ? 91  GLU A C   1 
ATOM   599   O  O   . GLU A 1 91  ? 81.194  109.703 60.777  1.00 74.91  ? 91  GLU A O   1 
ATOM   600   C  CB  . GLU A 1 91  ? 80.391  109.827 63.852  1.00 74.91  ? 91  GLU A CB  1 
ATOM   601   C  CG  . GLU A 1 91  ? 79.984  111.213 63.344  1.00 74.91  ? 91  GLU A CG  1 
ATOM   602   C  CD  . GLU A 1 91  ? 81.016  112.298 63.577  1.00 74.91  ? 91  GLU A CD  1 
ATOM   603   O  OE1 . GLU A 1 91  ? 82.030  112.032 64.256  1.00 74.91  ? 91  GLU A OE1 1 
ATOM   604   O  OE2 . GLU A 1 91  ? 80.806  113.428 63.087  1.00 74.91  ? 91  GLU A OE2 1 
ATOM   605   N  N   . CYS A 1 92  ? 80.486  107.646 61.345  1.00 82.10  ? 92  CYS A N   1 
ATOM   606   C  CA  . CYS A 1 92  ? 79.933  107.429 60.020  1.00 82.10  ? 92  CYS A CA  1 
ATOM   607   C  C   . CYS A 1 92  ? 78.490  107.915 59.965  1.00 82.10  ? 92  CYS A C   1 
ATOM   608   O  O   . CYS A 1 92  ? 77.941  108.424 60.943  1.00 82.10  ? 92  CYS A O   1 
ATOM   609   C  CB  . CYS A 1 92  ? 80.014  105.951 59.649  1.00 82.10  ? 92  CYS A CB  1 
ATOM   610   S  SG  . CYS A 1 92  ? 79.235  105.522 58.081  1.00 82.10  ? 92  CYS A SG  1 
ATOM   611   N  N   . ASN A 1 93  ? 77.863  107.745 58.801  1.00 80.58  ? 93  ASN A N   1 
ATOM   612   C  CA  . ASN A 1 93  ? 76.478  108.164 58.657  1.00 80.58  ? 93  ASN A CA  1 
ATOM   613   C  C   . ASN A 1 93  ? 75.513  107.230 59.361  1.00 80.58  ? 93  ASN A C   1 
ATOM   614   O  O   . ASN A 1 93  ? 74.393  107.640 59.677  1.00 80.58  ? 93  ASN A O   1 
ATOM   615   C  CB  . ASN A 1 93  ? 76.106  108.253 57.175  1.00 80.58  ? 93  ASN A CB  1 
ATOM   616   C  CG  . ASN A 1 93  ? 76.256  109.654 56.618  1.00 80.58  ? 93  ASN A CG  1 
ATOM   617   O  OD1 . ASN A 1 93  ? 76.387  110.617 57.367  1.00 80.58  ? 93  ASN A OD1 1 
ATOM   618   N  ND2 . ASN A 1 93  ? 76.243  109.773 55.298  1.00 80.58  ? 93  ASN A ND2 1 
ATOM   619   N  N   . ASP A 1 94  ? 75.924  106.000 59.641  1.00 85.73  ? 94  ASP A N   1 
ATOM   620   C  CA  . ASP A 1 94  ? 75.080  105.047 60.352  1.00 85.73  ? 94  ASP A CA  1 
ATOM   621   C  C   . ASP A 1 94  ? 75.386  104.987 61.846  1.00 85.73  ? 94  ASP A C   1 
ATOM   622   O  O   . ASP A 1 94  ? 75.200  103.940 62.476  1.00 85.73  ? 94  ASP A O   1 
ATOM   623   C  CB  . ASP A 1 94  ? 75.193  103.677 59.685  1.00 85.73  ? 94  ASP A CB  1 
ATOM   624   C  CG  . ASP A 1 94  ? 76.618  103.118 59.678  1.00 85.73  ? 94  ASP A CG  1 
ATOM   625   O  OD1 . ASP A 1 94  ? 77.561  103.741 60.207  1.00 85.73  ? 94  ASP A OD1 1 
ATOM   626   O  OD2 . ASP A 1 94  ? 76.799  102.022 59.116  1.00 85.73  ? 94  ASP A OD2 1 
ATOM   627   N  N   . ASN A 1 95  ? 75.841  106.117 62.412  1.00 85.41  ? 95  ASN A N   1 
ATOM   628   C  CA  . ASN A 1 95  ? 76.108  106.299 63.848  1.00 85.41  ? 95  ASN A CA  1 
ATOM   629   C  C   . ASN A 1 95  ? 77.139  105.304 64.380  1.00 85.41  ? 95  ASN A C   1 
ATOM   630   O  O   . ASN A 1 95  ? 76.979  104.724 65.453  1.00 85.41  ? 95  ASN A O   1 
ATOM   631   C  CB  . ASN A 1 95  ? 74.821  106.254 64.669  1.00 85.41  ? 95  ASN A CB  1 
ATOM   632   C  CG  . ASN A 1 95  ? 74.123  107.590 64.701  1.00 85.41  ? 95  ASN A CG  1 
ATOM   633   O  OD1 . ASN A 1 95  ? 74.264  108.352 65.654  1.00 85.41  ? 95  ASN A OD1 1 
ATOM   634   N  ND2 . ASN A 1 95  ? 73.381  107.893 63.645  1.00 85.41  ? 95  ASN A ND2 1 
ATOM   635   N  N   . THR A 1 96  ? 78.198  105.096 63.608  1.00 72.47  ? 96  THR A N   1 
ATOM   636   C  CA  . THR A 1 96  ? 79.232  104.142 63.961  1.00 72.47  ? 96  THR A CA  1 
ATOM   637   C  C   . THR A 1 96  ? 80.584  104.817 63.788  1.00 72.47  ? 96  THR A C   1 
ATOM   638   O  O   . THR A 1 96  ? 80.816  105.558 62.831  1.00 72.47  ? 96  THR A O   1 
ATOM   639   C  CB  . THR A 1 96  ? 79.121  102.876 63.112  1.00 72.47  ? 96  THR A CB  1 
ATOM   640   O  OG1 . THR A 1 96  ? 77.778  102.393 63.185  1.00 72.47  ? 96  THR A OG1 1 
ATOM   641   C  CG2 . THR A 1 96  ? 80.032  101.790 63.646  1.00 72.47  ? 96  THR A CG2 1 
ATOM   642   N  N   . MET A 1 97  ? 81.475  104.561 64.738  1.00 62.57  ? 97  MET A N   1 
ATOM   643   C  CA  . MET A 1 97  ? 82.805  105.154 64.783  1.00 62.57  ? 97  MET A CA  1 
ATOM   644   C  C   . MET A 1 97  ? 83.755  104.209 64.063  1.00 62.57  ? 97  MET A C   1 
ATOM   645   O  O   . MET A 1 97  ? 84.080  103.139 64.577  1.00 62.57  ? 97  MET A O   1 
ATOM   646   C  CB  . MET A 1 97  ? 83.237  105.393 66.223  1.00 62.57  ? 97  MET A CB  1 
ATOM   647   C  CG  . MET A 1 97  ? 82.169  106.049 67.068  1.00 62.57  ? 97  MET A CG  1 
ATOM   648   S  SD  . MET A 1 97  ? 81.770  107.730 66.575  1.00 62.57  ? 97  MET A SD  1 
ATOM   649   C  CE  . MET A 1 97  ? 83.303  108.565 66.927  1.00 62.57  ? 97  MET A CE  1 
ATOM   650   N  N   . ARG A 1 98  ? 84.185  104.595 62.870  1.00 61.61  ? 98  ARG A N   1 
ATOM   651   C  CA  . ARG A 1 98  ? 85.155  103.828 62.108  1.00 61.61  ? 98  ARG A CA  1 
ATOM   652   C  C   . ARG A 1 98  ? 86.406  104.648 61.846  1.00 61.61  ? 98  ARG A C   1 
ATOM   653   O  O   . ARG A 1 98  ? 86.416  105.871 62.006  1.00 61.61  ? 98  ARG A O   1 
ATOM   654   C  CB  . ARG A 1 98  ? 84.578  103.404 60.757  1.00 61.61  ? 98  ARG A CB  1 
ATOM   655   C  CG  . ARG A 1 98  ? 83.379  102.494 60.807  1.00 61.61  ? 98  ARG A CG  1 
ATOM   656   C  CD  . ARG A 1 98  ? 83.794  101.049 60.667  1.00 61.61  ? 98  ARG A CD  1 
ATOM   657   N  NE  . ARG A 1 98  ? 84.942  100.890 59.783  1.00 61.61  ? 98  ARG A NE  1 
ATOM   658   C  CZ  . ARG A 1 98  ? 84.861  100.782 58.462  1.00 61.61  ? 98  ARG A CZ  1 
ATOM   659   N  NH1 . ARG A 1 98  ? 83.679  100.806 57.867  1.00 61.61  ? 98  ARG A NH1 1 
ATOM   660   N  NH2 . ARG A 1 98  ? 85.962  100.642 57.739  1.00 61.61  ? 98  ARG A NH2 1 
ATOM   661   N  N   . ALA A 1 99  ? 87.484  103.947 61.503  1.00 61.13  ? 99  ALA A N   1 
ATOM   662   C  CA  . ALA A 1 99  ? 88.726  104.618 61.165  1.00 61.13  ? 99  ALA A CA  1 
ATOM   663   C  C   . ALA A 1 99  ? 88.555  105.357 59.844  1.00 61.13  ? 99  ALA A C   1 
ATOM   664   O  O   . ALA A 1 99  ? 87.822  104.922 58.957  1.00 61.13  ? 99  ALA A O   1 
ATOM   665   C  CB  . ALA A 1 99  ? 89.871  103.618 61.074  1.00 61.13  ? 99  ALA A CB  1 
ATOM   666   N  N   . PHE A 1 100 ? 89.243  106.478 59.713  1.00 67.19  ? 100 PHE A N   1 
ATOM   667   C  CA  . PHE A 1 100 ? 89.094  107.341 58.551  1.00 67.19  ? 100 PHE A CA  1 
ATOM   668   C  C   . PHE A 1 100 ? 90.035  106.907 57.438  1.00 67.19  ? 100 PHE A C   1 
ATOM   669   O  O   . PHE A 1 100 ? 91.245  106.798 57.650  1.00 67.19  ? 100 PHE A O   1 
ATOM   670   C  CB  . PHE A 1 100 ? 89.351  108.796 58.902  1.00 67.19  ? 100 PHE A CB  1 
ATOM   671   C  CG  . PHE A 1 100 ? 89.117  109.720 57.769  1.00 67.19  ? 100 PHE A CG  1 
ATOM   672   C  CD1 . PHE A 1 100 ? 87.830  110.029 57.397  1.00 67.19  ? 100 PHE A CD1 1 
ATOM   673   C  CD2 . PHE A 1 100 ? 90.166  110.268 57.065  1.00 67.19  ? 100 PHE A CD2 1 
ATOM   674   C  CE1 . PHE A 1 100 ? 87.585  110.883 56.355  1.00 67.19  ? 100 PHE A CE1 1 
ATOM   675   C  CE2 . PHE A 1 100 ? 89.926  111.122 56.012  1.00 67.19  ? 100 PHE A CE2 1 
ATOM   676   C  CZ  . PHE A 1 100 ? 88.634  111.430 55.658  1.00 67.19  ? 100 PHE A CZ  1 
ATOM   677   N  N   . THR A 1 101 ? 89.482  106.670 56.258  1.00 77.40  ? 101 THR A N   1 
ATOM   678   C  CA  . THR A 1 101 ? 90.258  106.390 55.061  1.00 77.40  ? 101 THR A CA  1 
ATOM   679   C  C   . THR A 1 101 ? 89.807  107.325 53.951  1.00 77.40  ? 101 THR A C   1 
ATOM   680   O  O   . THR A 1 101 ? 88.648  107.741 53.901  1.00 77.40  ? 101 THR A O   1 
ATOM   681   C  CB  . THR A 1 101 ? 90.099  104.940 54.605  1.00 77.40  ? 101 THR A CB  1 
ATOM   682   O  OG1 . THR A 1 101 ? 88.720  104.558 54.690  1.00 77.40  ? 101 THR A OG1 1 
ATOM   683   C  CG2 . THR A 1 101 ? 90.927  104.022 55.473  1.00 77.40  ? 101 THR A CG2 1 
ATOM   684   N  N   . TYR A 1 102 ? 90.727  107.646 53.053  1.00 74.02  ? 102 TYR A N   1 
ATOM   685   C  CA  . TYR A 1 102 ? 90.409  108.607 52.009  1.00 74.02  ? 102 TYR A CA  1 
ATOM   686   C  C   . TYR A 1 102 ? 89.512  108.016 50.933  1.00 74.02  ? 102 TYR A C   1 
ATOM   687   O  O   . TYR A 1 102 ? 88.743  108.749 50.302  1.00 74.02  ? 102 TYR A O   1 
ATOM   688   C  CB  . TYR A 1 102 ? 91.688  109.143 51.372  1.00 74.02  ? 102 TYR A CB  1 
ATOM   689   C  CG  . TYR A 1 102 ? 91.414  110.321 50.485  1.00 74.02  ? 102 TYR A CG  1 
ATOM   690   C  CD1 . TYR A 1 102 ? 91.089  111.549 51.024  1.00 74.02  ? 102 TYR A CD1 1 
ATOM   691   C  CD2 . TYR A 1 102 ? 91.435  110.193 49.110  1.00 74.02  ? 102 TYR A CD2 1 
ATOM   692   C  CE1 . TYR A 1 102 ? 90.823  112.628 50.221  1.00 74.02  ? 102 TYR A CE1 1 
ATOM   693   C  CE2 . TYR A 1 102 ? 91.165  111.263 48.299  1.00 74.02  ? 102 TYR A CE2 1 
ATOM   694   C  CZ  . TYR A 1 102 ? 90.853  112.478 48.862  1.00 74.02  ? 102 TYR A CZ  1 
ATOM   695   O  OH  . TYR A 1 102 ? 90.582  113.561 48.064  1.00 74.02  ? 102 TYR A OH  1 
ATOM   696   N  N   . ARG A 1 103 ? 89.582  106.705 50.719  1.00 82.79  ? 103 ARG A N   1 
ATOM   697   C  CA  . ARG A 1 103 ? 88.746  106.073 49.708  1.00 82.79  ? 103 ARG A CA  1 
ATOM   698   C  C   . ARG A 1 103 ? 87.296  105.988 50.147  1.00 82.79  ? 103 ARG A C   1 
ATOM   699   O  O   . ARG A 1 103 ? 86.396  106.006 49.303  1.00 82.79  ? 103 ARG A O   1 
ATOM   700   C  CB  . ARG A 1 103 ? 89.278  104.684 49.377  1.00 82.79  ? 103 ARG A CB  1 
ATOM   701   C  CG  . ARG A 1 103 ? 90.669  104.699 48.792  1.00 82.79  ? 103 ARG A CG  1 
ATOM   702   C  CD  . ARG A 1 103 ? 90.753  105.653 47.620  1.00 82.79  ? 103 ARG A CD  1 
ATOM   703   N  NE  . ARG A 1 103 ? 92.057  105.597 46.976  1.00 82.79  ? 103 ARG A NE  1 
ATOM   704   C  CZ  . ARG A 1 103 ? 92.365  104.751 46.001  1.00 82.79  ? 103 ARG A CZ  1 
ATOM   705   N  NH1 . ARG A 1 103 ? 91.460  103.890 45.556  1.00 82.79  ? 103 ARG A NH1 1 
ATOM   706   N  NH2 . ARG A 1 103 ? 93.578  104.766 45.469  1.00 82.79  ? 103 ARG A NH2 1 
ATOM   707   N  N   . THR A 1 104 ? 87.044  105.899 51.447  1.00 74.72  ? 104 THR A N   1 
ATOM   708   C  CA  . THR A 1 104 ? 85.686  105.794 51.959  1.00 74.72  ? 104 THR A CA  1 
ATOM   709   C  C   . THR A 1 104 ? 85.233  107.095 52.599  1.00 74.72  ? 104 THR A C   1 
ATOM   710   O  O   . THR A 1 104 ? 84.453  107.088 53.551  1.00 74.72  ? 104 THR A O   1 
ATOM   711   C  CB  . THR A 1 104 ? 85.579  104.661 52.975  1.00 74.72  ? 104 THR A CB  1 
ATOM   712   O  OG1 . THR A 1 104 ? 86.110  105.099 54.231  1.00 74.72  ? 104 THR A OG1 1 
ATOM   713   C  CG2 . THR A 1 104 ? 86.361  103.455 52.504  1.00 74.72  ? 104 THR A CG2 1 
ATOM   714   N  N   . ARG A 1 105 ? 85.715  108.218 52.076  1.00 77.96  ? 105 ARG A N   1 
ATOM   715   C  CA  . ARG A 1 105 ? 85.523  109.481 52.765  1.00 77.96  ? 105 ARG A CA  1 
ATOM   716   C  C   . ARG A 1 105 ? 84.115  110.021 52.610  1.00 77.96  ? 105 ARG A C   1 
ATOM   717   O  O   . ARG A 1 105 ? 83.726  110.912 53.363  1.00 77.96  ? 105 ARG A O   1 
ATOM   718   C  CB  . ARG A 1 105 ? 86.532  110.501 52.265  1.00 77.96  ? 105 ARG A CB  1 
ATOM   719   C  CG  . ARG A 1 105 ? 86.312  110.933 50.849  1.00 77.96  ? 105 ARG A CG  1 
ATOM   720   C  CD  . ARG A 1 105 ? 87.388  111.909 50.459  1.00 77.96  ? 105 ARG A CD  1 
ATOM   721   N  NE  . ARG A 1 105 ? 86.979  112.836 49.416  1.00 77.96  ? 105 ARG A NE  1 
ATOM   722   C  CZ  . ARG A 1 105 ? 87.271  112.678 48.134  1.00 77.96  ? 105 ARG A CZ  1 
ATOM   723   N  NH1 . ARG A 1 105 ? 87.972  111.628 47.738  1.00 77.96  ? 105 ARG A NH1 1 
ATOM   724   N  NH2 . ARG A 1 105 ? 86.861  113.572 47.250  1.00 77.96  ? 105 ARG A NH2 1 
ATOM   725   N  N   . GLN A 1 106 ? 83.338  109.510 51.664  1.00 80.22  ? 106 GLN A N   1 
ATOM   726   C  CA  . GLN A 1 106 ? 82.005  110.054 51.466  1.00 80.22  ? 106 GLN A CA  1 
ATOM   727   C  C   . GLN A 1 106 ? 80.979  109.505 52.451  1.00 80.22  ? 106 GLN A C   1 
ATOM   728   O  O   . GLN A 1 106 ? 79.863  110.031 52.510  1.00 80.22  ? 106 GLN A O   1 
ATOM   729   C  CB  . GLN A 1 106 ? 81.548  109.750 50.037  1.00 80.22  ? 106 GLN A CB  1 
ATOM   730   C  CG  . GLN A 1 106 ? 82.310  110.512 48.962  1.00 80.22  ? 106 GLN A CG  1 
ATOM   731   C  CD  . GLN A 1 106 ? 81.770  111.898 48.714  1.00 80.22  ? 106 GLN A CD  1 
ATOM   732   O  OE1 . GLN A 1 106 ? 80.778  112.307 49.313  1.00 80.22  ? 106 GLN A OE1 1 
ATOM   733   N  NE2 . GLN A 1 106 ? 82.430  112.637 47.832  1.00 80.22  ? 106 GLN A NE2 1 
ATOM   734   N  N   . ASN A 1 107 ? 81.330  108.484 53.234  1.00 76.32  ? 107 ASN A N   1 
ATOM   735   C  CA  . ASN A 1 107 ? 80.406  107.859 54.172  1.00 76.32  ? 107 ASN A CA  1 
ATOM   736   C  C   . ASN A 1 107 ? 80.184  108.636 55.460  1.00 76.32  ? 107 ASN A C   1 
ATOM   737   O  O   . ASN A 1 107 ? 79.234  108.325 56.182  1.00 76.32  ? 107 ASN A O   1 
ATOM   738   C  CB  . ASN A 1 107 ? 80.895  106.460 54.520  1.00 76.32  ? 107 ASN A CB  1 
ATOM   739   C  CG  . ASN A 1 107 ? 80.820  105.521 53.351  1.00 76.32  ? 107 ASN A CG  1 
ATOM   740   O  OD1 . ASN A 1 107 ? 80.781  105.951 52.201  1.00 76.32  ? 107 ASN A OD1 1 
ATOM   741   N  ND2 . ASN A 1 107 ? 80.803  104.226 53.633  1.00 76.32  ? 107 ASN A ND2 1 
ATOM   742   N  N   . PHE A 1 108 ? 81.021  109.611 55.780  1.00 76.00  ? 108 PHE A N   1 
ATOM   743   C  CA  . PHE A 1 108 ? 81.063  110.190 57.116  1.00 76.00  ? 108 PHE A CA  1 
ATOM   744   C  C   . PHE A 1 108 ? 80.167  111.418 57.223  1.00 76.00  ? 108 PHE A C   1 
ATOM   745   O  O   . PHE A 1 108 ? 79.955  112.143 56.250  1.00 76.00  ? 108 PHE A O   1 
ATOM   746   C  CB  . PHE A 1 108 ? 82.496  110.512 57.505  1.00 76.00  ? 108 PHE A CB  1 
ATOM   747   C  CG  . PHE A 1 108 ? 83.366  109.304 57.536  1.00 76.00  ? 108 PHE A CG  1 
ATOM   748   C  CD1 . PHE A 1 108 ? 83.180  108.341 58.506  1.00 76.00  ? 108 PHE A CD1 1 
ATOM   749   C  CD2 . PHE A 1 108 ? 84.352  109.115 56.595  1.00 76.00  ? 108 PHE A CD2 1 
ATOM   750   C  CE1 . PHE A 1 108 ? 83.968  107.215 58.540  1.00 76.00  ? 108 PHE A CE1 1 
ATOM   751   C  CE2 . PHE A 1 108 ? 85.145  107.990 56.625  1.00 76.00  ? 108 PHE A CE2 1 
ATOM   752   C  CZ  . PHE A 1 108 ? 84.956  107.045 57.600  1.00 76.00  ? 108 PHE A CZ  1 
ATOM   753   N  N   . LYS A 1 109 ? 79.687  111.673 58.438  1.00 74.57  ? 109 LYS A N   1 
ATOM   754   C  CA  . LYS A 1 109 ? 78.638  112.660 58.656  1.00 74.57  ? 109 LYS A CA  1 
ATOM   755   C  C   . LYS A 1 109 ? 79.160  114.083 58.550  1.00 74.57  ? 109 LYS A C   1 
ATOM   756   O  O   . LYS A 1 109 ? 80.241  114.407 59.045  1.00 74.57  ? 109 LYS A O   1 
ATOM   757   C  CB  . LYS A 1 109 ? 78.019  112.474 60.040  1.00 74.57  ? 109 LYS A CB  1 
ATOM   758   C  CG  . LYS A 1 109 ? 76.761  113.302 60.262  1.00 74.57  ? 109 LYS A CG  1 
ATOM   759   C  CD  . LYS A 1 109 ? 76.139  113.115 61.636  1.00 74.57  ? 109 LYS A CD  1 
ATOM   760   C  CE  . LYS A 1 109 ? 75.778  111.679 61.922  1.00 74.57  ? 109 LYS A CE  1 
ATOM   761   N  NZ  . LYS A 1 109 ? 75.229  111.544 63.302  1.00 74.57  ? 109 LYS A NZ  1 
ATOM   762   N  N   . GLY A 1 110 ? 78.382  114.931 57.877  1.00 83.51  ? 110 GLY A N   1 
ATOM   763   C  CA  . GLY A 1 110 ? 78.729  116.328 57.739  1.00 83.51  ? 110 GLY A CA  1 
ATOM   764   C  C   . GLY A 1 110 ? 79.864  116.600 56.789  1.00 83.51  ? 110 GLY A C   1 
ATOM   765   O  O   . GLY A 1 110 ? 80.473  117.669 56.854  1.00 83.51  ? 110 GLY A O   1 
ATOM   766   N  N   . PHE A 1 111 ? 80.143  115.679 55.880  1.00 85.65  ? 111 PHE A N   1 
ATOM   767   C  CA  . PHE A 1 111 ? 81.257  115.814 54.960  1.00 85.65  ? 111 PHE A CA  1 
ATOM   768   C  C   . PHE A 1 111 ? 80.789  116.157 53.558  1.00 85.65  ? 111 PHE A C   1 
ATOM   769   O  O   . PHE A 1 111 ? 79.958  115.457 52.975  1.00 85.65  ? 111 PHE A O   1 
ATOM   770   C  CB  . PHE A 1 111 ? 82.072  114.527 54.919  1.00 85.65  ? 111 PHE A CB  1 
ATOM   771   C  CG  . PHE A 1 111 ? 83.238  114.595 53.997  1.00 85.65  ? 111 PHE A CG  1 
ATOM   772   C  CD1 . PHE A 1 111 ? 84.368  115.300 54.347  1.00 85.65  ? 111 PHE A CD1 1 
ATOM   773   C  CD2 . PHE A 1 111 ? 83.215  113.939 52.785  1.00 85.65  ? 111 PHE A CD2 1 
ATOM   774   C  CE1 . PHE A 1 111 ? 85.449  115.362 53.501  1.00 85.65  ? 111 PHE A CE1 1 
ATOM   775   C  CE2 . PHE A 1 111 ? 84.295  113.989 51.939  1.00 85.65  ? 111 PHE A CE2 1 
ATOM   776   C  CZ  . PHE A 1 111 ? 85.411  114.704 52.296  1.00 85.65  ? 111 PHE A CZ  1 
ATOM   777   N  N   . ASP A 1 112 ? 81.346  117.238 53.020  1.00 96.75  ? 112 ASP A N   1 
ATOM   778   C  CA  . ASP A 1 112 ? 81.256  117.568 51.607  1.00 96.75  ? 112 ASP A CA  1 
ATOM   779   C  C   . ASP A 1 112 ? 82.662  117.549 51.036  1.00 96.75  ? 112 ASP A C   1 
ATOM   780   O  O   . ASP A 1 112 ? 83.644  117.325 51.748  1.00 96.75  ? 112 ASP A O   1 
ATOM   781   C  CB  . ASP A 1 112 ? 80.635  118.949 51.346  1.00 96.75  ? 112 ASP A CB  1 
ATOM   782   C  CG  . ASP A 1 112 ? 79.221  119.069 51.852  1.00 96.75  ? 112 ASP A CG  1 
ATOM   783   O  OD1 . ASP A 1 112 ? 78.666  118.063 52.330  1.00 96.75  ? 112 ASP A OD1 1 
ATOM   784   O  OD2 . ASP A 1 112 ? 78.656  120.178 51.749  1.00 96.75  ? 112 ASP A OD2 1 
ATOM   785   N  N   . ASP A 1 113 ? 82.757  117.800 49.741  1.00 102.22 ? 113 ASP A N   1 
ATOM   786   C  CA  . ASP A 1 113 ? 84.053  118.076 49.148  1.00 102.22 ? 113 ASP A CA  1 
ATOM   787   C  C   . ASP A 1 113 ? 84.418  119.551 49.204  1.00 102.22 ? 113 ASP A C   1 
ATOM   788   O  O   . ASP A 1 113 ? 85.559  119.900 48.886  1.00 102.22 ? 113 ASP A O   1 
ATOM   789   C  CB  . ASP A 1 113 ? 84.093  117.553 47.713  1.00 102.22 ? 113 ASP A CB  1 
ATOM   790   C  CG  . ASP A 1 113 ? 84.217  116.038 47.657  1.00 102.22 ? 113 ASP A CG  1 
ATOM   791   O  OD1 . ASP A 1 113 ? 85.188  115.492 48.220  1.00 102.22 ? 113 ASP A OD1 1 
ATOM   792   O  OD2 . ASP A 1 113 ? 83.334  115.387 47.065  1.00 102.22 ? 113 ASP A OD2 1 
ATOM   793   N  N   . ASN A 1 114 ? 83.485  120.420 49.581  1.00 98.19  ? 114 ASN A N   1 
ATOM   794   C  CA  . ASN A 1 114 ? 83.760  121.835 49.799  1.00 98.19  ? 114 ASN A CA  1 
ATOM   795   C  C   . ASN A 1 114 ? 83.468  122.227 51.241  1.00 98.19  ? 114 ASN A C   1 
ATOM   796   O  O   . ASN A 1 114 ? 82.861  123.261 51.519  1.00 98.19  ? 114 ASN A O   1 
ATOM   797   C  CB  . ASN A 1 114 ? 82.960  122.698 48.829  1.00 98.19  ? 114 ASN A CB  1 
ATOM   798   C  CG  . ASN A 1 114 ? 83.348  122.457 47.390  1.00 98.19  ? 114 ASN A CG  1 
ATOM   799   O  OD1 . ASN A 1 114 ? 84.174  123.179 46.832  1.00 98.19  ? 114 ASN A OD1 1 
ATOM   800   N  ND2 . ASN A 1 114 ? 82.759  121.436 46.779  1.00 98.19  ? 114 ASN A ND2 1 
ATOM   801   N  N   . ASN A 1 115 ? 83.905  121.393 52.178  1.00 92.86  ? 115 ASN A N   1 
ATOM   802   C  CA  . ASN A 1 115 ? 83.622  121.580 53.594  1.00 92.86  ? 115 ASN A CA  1 
ATOM   803   C  C   . ASN A 1 115 ? 84.948  121.625 54.339  1.00 92.86  ? 115 ASN A C   1 
ATOM   804   O  O   . ASN A 1 115 ? 85.581  120.584 54.538  1.00 92.86  ? 115 ASN A O   1 
ATOM   805   C  CB  . ASN A 1 115 ? 82.727  120.452 54.113  1.00 92.86  ? 115 ASN A CB  1 
ATOM   806   C  CG  . ASN A 1 115 ? 82.213  120.707 55.508  1.00 92.86  ? 115 ASN A CG  1 
ATOM   807   O  OD1 . ASN A 1 115 ? 82.332  121.811 56.036  1.00 92.86  ? 115 ASN A OD1 1 
ATOM   808   N  ND2 . ASN A 1 115 ? 81.616  119.687 56.109  1.00 92.86  ? 115 ASN A ND2 1 
ATOM   809   N  N   . ASP A 1 116 ? 85.360  122.818 54.764  1.00 93.43  ? 116 ASP A N   1 
ATOM   810   C  CA  . ASP A 1 116 ? 86.554  122.989 55.586  1.00 93.43  ? 116 ASP A CA  1 
ATOM   811   C  C   . ASP A 1 116 ? 86.290  122.847 57.079  1.00 93.43  ? 116 ASP A C   1 
ATOM   812   O  O   . ASP A 1 116 ? 87.202  123.063 57.881  1.00 93.43  ? 116 ASP A O   1 
ATOM   813   C  CB  . ASP A 1 116 ? 87.217  124.342 55.299  1.00 93.43  ? 116 ASP A CB  1 
ATOM   814   C  CG  . ASP A 1 116 ? 86.254  125.510 55.394  1.00 93.43  ? 116 ASP A CG  1 
ATOM   815   O  OD1 . ASP A 1 116 ? 85.065  125.299 55.713  1.00 93.43  ? 116 ASP A OD1 1 
ATOM   816   O  OD2 . ASP A 1 116 ? 86.699  126.653 55.151  1.00 93.43  ? 116 ASP A OD2 1 
ATOM   817   N  N   . ASP A 1 117 ? 85.078  122.481 57.468  1.00 88.87  ? 117 ASP A N   1 
ATOM   818   C  CA  . ASP A 1 117 ? 84.725  122.355 58.871  1.00 88.87  ? 117 ASP A CA  1 
ATOM   819   C  C   . ASP A 1 117 ? 84.650  120.902 59.313  1.00 88.87  ? 117 ASP A C   1 
ATOM   820   O  O   . ASP A 1 117 ? 84.169  120.619 60.414  1.00 88.87  ? 117 ASP A O   1 
ATOM   821   C  CB  . ASP A 1 117 ? 83.409  123.078 59.131  1.00 88.87  ? 117 ASP A CB  1 
ATOM   822   C  CG  . ASP A 1 117 ? 83.357  124.428 58.445  1.00 88.87  ? 117 ASP A CG  1 
ATOM   823   O  OD1 . ASP A 1 117 ? 84.358  125.165 58.524  1.00 88.87  ? 117 ASP A OD1 1 
ATOM   824   O  OD2 . ASP A 1 117 ? 82.328  124.747 57.817  1.00 88.87  ? 117 ASP A OD2 1 
ATOM   825   N  N   . PHE A 1 118 ? 85.110  119.982 58.471  1.00 76.37  ? 118 PHE A N   1 
ATOM   826   C  CA  . PHE A 1 118 ? 85.118  118.561 58.777  1.00 76.37  ? 118 PHE A CA  1 
ATOM   827   C  C   . PHE A 1 118 ? 86.204  118.242 59.783  1.00 76.37  ? 118 PHE A C   1 
ATOM   828   O  O   . PHE A 1 118 ? 85.925  117.759 60.881  1.00 76.37  ? 118 PHE A O   1 
ATOM   829   C  CB  . PHE A 1 118 ? 85.353  117.708 57.545  1.00 76.37  ? 118 PHE A CB  1 
ATOM   830   C  CG  . PHE A 1 118 ? 85.297  116.252 57.838  1.00 76.37  ? 118 PHE A CG  1 
ATOM   831   C  CD1 . PHE A 1 118 ? 84.238  115.717 58.538  1.00 76.37  ? 118 PHE A CD1 1 
ATOM   832   C  CD2 . PHE A 1 118 ? 86.346  115.427 57.481  1.00 76.37  ? 118 PHE A CD2 1 
ATOM   833   C  CE1 . PHE A 1 118 ? 84.202  114.371 58.832  1.00 76.37  ? 118 PHE A CE1 1 
ATOM   834   C  CE2 . PHE A 1 118 ? 86.316  114.083 57.772  1.00 76.37  ? 118 PHE A CE2 1 
ATOM   835   C  CZ  . PHE A 1 118 ? 85.243  113.555 58.451  1.00 76.37  ? 118 PHE A CZ  1 
ATOM   836   N  N   . LEU A 1 119 ? 87.447  118.512 59.415  1.00 71.82  ? 119 LEU A N   1 
ATOM   837   C  CA  . LEU A 1 119 ? 88.538  118.334 60.353  1.00 71.82  ? 119 LEU A CA  1 
ATOM   838   C  C   . LEU A 1 119 ? 88.660  119.583 61.195  1.00 71.82  ? 119 LEU A C   1 
ATOM   839   O  O   . LEU A 1 119 ? 88.871  120.679 60.672  1.00 71.82  ? 119 LEU A O   1 
ATOM   840   C  CB  . LEU A 1 119 ? 89.832  118.096 59.597  1.00 71.82  ? 119 LEU A CB  1 
ATOM   841   C  CG  . LEU A 1 119 ? 89.913  116.772 58.861  1.00 71.82  ? 119 LEU A CG  1 
ATOM   842   C  CD1 . LEU A 1 119 ? 91.333  116.549 58.415  1.00 71.82  ? 119 LEU A CD1 1 
ATOM   843   C  CD2 . LEU A 1 119 ? 89.427  115.633 59.721  1.00 71.82  ? 119 LEU A CD2 1 
ATOM   844   N  N   . THR A 1 120 ? 88.514  119.420 62.503  1.00 65.99  ? 120 THR A N   1 
ATOM   845   C  CA  . THR A 1 120 ? 88.603  120.560 63.387  1.00 65.99  ? 120 THR A CA  1 
ATOM   846   C  C   . THR A 1 120 ? 90.046  121.033 63.491  1.00 65.99  ? 120 THR A C   1 
ATOM   847   O  O   . THR A 1 120 ? 90.985  120.349 63.080  1.00 65.99  ? 120 THR A O   1 
ATOM   848   C  CB  . THR A 1 120 ? 88.062  120.183 64.752  1.00 65.99  ? 120 THR A CB  1 
ATOM   849   O  OG1 . THR A 1 120 ? 88.841  119.100 65.267  1.00 65.99  ? 120 THR A OG1 1 
ATOM   850   C  CG2 . THR A 1 120 ? 86.639  119.711 64.607  1.00 65.99  ? 120 THR A CG2 1 
ATOM   851   N  N   . MET A 1 121 ? 90.220  122.210 64.089  1.00 58.61  ? 121 MET A N   1 
ATOM   852   C  CA  . MET A 1 121 ? 91.543  122.812 64.177  1.00 58.61  ? 121 MET A CA  1 
ATOM   853   C  C   . MET A 1 121 ? 92.480  122.034 65.086  1.00 58.61  ? 121 MET A C   1 
ATOM   854   O  O   . MET A 1 121 ? 93.698  122.075 64.890  1.00 58.61  ? 121 MET A O   1 
ATOM   855   C  CB  . MET A 1 121 ? 91.430  124.255 64.638  1.00 58.61  ? 121 MET A CB  1 
ATOM   856   C  CG  . MET A 1 121 ? 92.504  125.118 64.046  1.00 58.61  ? 121 MET A CG  1 
ATOM   857   S  SD  . MET A 1 121 ? 92.618  126.722 64.832  1.00 58.61  ? 121 MET A SD  1 
ATOM   858   C  CE  . MET A 1 121 ? 93.748  127.546 63.713  1.00 58.61  ? 121 MET A CE  1 
ATOM   859   N  N   . ALA A 1 122 ? 91.941  121.336 66.084  1.00 53.69  ? 122 ALA A N   1 
ATOM   860   C  CA  . ALA A 1 122 ? 92.781  120.499 66.931  1.00 53.69  ? 122 ALA A CA  1 
ATOM   861   C  C   . ALA A 1 122 ? 93.351  119.312 66.170  1.00 53.69  ? 122 ALA A C   1 
ATOM   862   O  O   . ALA A 1 122 ? 94.545  119.020 66.283  1.00 53.69  ? 122 ALA A O   1 
ATOM   863   C  CB  . ALA A 1 122 ? 91.984  120.016 68.134  1.00 53.69  ? 122 ALA A CB  1 
ATOM   864   N  N   . GLU A 1 123 ? 92.517  118.613 65.400  1.00 59.11  ? 123 GLU A N   1 
ATOM   865   C  CA  . GLU A 1 123 ? 93.013  117.508 64.588  1.00 59.11  ? 123 GLU A CA  1 
ATOM   866   C  C   . GLU A 1 123 ? 93.936  117.984 63.479  1.00 59.11  ? 123 GLU A C   1 
ATOM   867   O  O   . GLU A 1 123 ? 94.870  117.264 63.115  1.00 59.11  ? 123 GLU A O   1 
ATOM   868   C  CB  . GLU A 1 123 ? 91.861  116.689 64.018  1.00 59.11  ? 123 GLU A CB  1 
ATOM   869   C  CG  . GLU A 1 123 ? 91.203  115.788 65.037  1.00 59.11  ? 123 GLU A CG  1 
ATOM   870   C  CD  . GLU A 1 123 ? 89.753  115.491 64.716  1.00 59.11  ? 123 GLU A CD  1 
ATOM   871   O  OE1 . GLU A 1 123 ? 89.103  116.321 64.051  1.00 59.11  ? 123 GLU A OE1 1 
ATOM   872   O  OE2 . GLU A 1 123 ? 89.261  114.420 65.120  1.00 59.11  ? 123 GLU A OE2 1 
ATOM   873   N  N   . CYS A 1 124 ? 93.685  119.167 62.916  1.00 61.05  ? 124 CYS A N   1 
ATOM   874   C  CA  . CYS A 1 124 ? 94.585  119.675 61.891  1.00 61.05  ? 124 CYS A CA  1 
ATOM   875   C  C   . CYS A 1 124 ? 95.948  120.008 62.466  1.00 61.05  ? 124 CYS A C   1 
ATOM   876   O  O   . CYS A 1 124 ? 96.970  119.729 61.833  1.00 61.05  ? 124 CYS A O   1 
ATOM   877   C  CB  . CYS A 1 124 ? 93.994  120.896 61.203  1.00 61.05  ? 124 CYS A CB  1 
ATOM   878   S  SG  . CYS A 1 124 ? 92.501  120.558 60.270  1.00 61.05  ? 124 CYS A SG  1 
ATOM   879   N  N   . GLN A 1 125 ? 95.993  120.606 63.653  1.00 51.37  ? 125 GLN A N   1 
ATOM   880   C  CA  . GLN A 1 125 ? 97.288  120.880 64.258  1.00 51.37  ? 125 GLN A CA  1 
ATOM   881   C  C   . GLN A 1 125 ? 97.967  119.607 64.725  1.00 51.37  ? 125 GLN A C   1 
ATOM   882   O  O   . GLN A 1 125 ? 99.197  119.529 64.723  1.00 51.37  ? 125 GLN A O   1 
ATOM   883   C  CB  . GLN A 1 125 ? 97.154  121.852 65.418  1.00 51.37  ? 125 GLN A CB  1 
ATOM   884   C  CG  . GLN A 1 125 ? 97.048  123.281 64.981  1.00 51.37  ? 125 GLN A CG  1 
ATOM   885   C  CD  . GLN A 1 125 ? 96.168  124.093 65.893  1.00 51.37  ? 125 GLN A CD  1 
ATOM   886   O  OE1 . GLN A 1 125 ? 95.565  123.561 66.821  1.00 51.37  ? 125 GLN A OE1 1 
ATOM   887   N  NE2 . GLN A 1 125 ? 96.093  125.393 65.644  1.00 51.37  ? 125 GLN A NE2 1 
ATOM   888   N  N   . PHE A 1 126 ? 97.193  118.607 65.125  1.00 44.86  ? 126 PHE A N   1 
ATOM   889   C  CA  . PHE A 1 126 ? 97.771  117.316 65.468  1.00 44.86  ? 126 PHE A CA  1 
ATOM   890   C  C   . PHE A 1 126 ? 98.382  116.612 64.267  1.00 44.86  ? 126 PHE A C   1 
ATOM   891   O  O   . PHE A 1 126 ? 99.447  116.003 64.389  1.00 44.86  ? 126 PHE A O   1 
ATOM   892   C  CB  . PHE A 1 126 ? 96.694  116.450 66.103  1.00 44.86  ? 126 PHE A CB  1 
ATOM   893   C  CG  . PHE A 1 126 ? 97.131  115.070 66.443  1.00 44.86  ? 126 PHE A CG  1 
ATOM   894   C  CD1 . PHE A 1 126 ? 98.312  114.841 67.112  1.00 44.86  ? 126 PHE A CD1 1 
ATOM   895   C  CD2 . PHE A 1 126 ? 96.308  114.002 66.158  1.00 44.86  ? 126 PHE A CD2 1 
ATOM   896   C  CE1 . PHE A 1 126 ? 98.688  113.572 67.434  1.00 44.86  ? 126 PHE A CE1 1 
ATOM   897   C  CE2 . PHE A 1 126 ? 96.672  112.736 66.487  1.00 44.86  ? 126 PHE A CE2 1 
ATOM   898   C  CZ  . PHE A 1 126 ? 97.864  112.517 67.125  1.00 44.86  ? 126 PHE A CZ  1 
ATOM   899   N  N   . ILE A 1 127 ? 97.742  116.691 63.103  1.00 47.85  ? 127 ILE A N   1 
ATOM   900   C  CA  . ILE A 1 127 ? 98.285  116.023 61.924  1.00 47.85  ? 127 ILE A CA  1 
ATOM   901   C  C   . ILE A 1 127 ? 99.563  116.688 61.430  1.00 47.85  ? 127 ILE A C   1 
ATOM   902   O  O   . ILE A 1 127 ? 100.537 116.002 61.101  1.00 47.85  ? 127 ILE A O   1 
ATOM   903   C  CB  . ILE A 1 127 ? 97.214  115.951 60.822  1.00 47.85  ? 127 ILE A CB  1 
ATOM   904   C  CG1 . ILE A 1 127 ? 96.182  114.897 61.166  1.00 47.85  ? 127 ILE A CG1 1 
ATOM   905   C  CG2 . ILE A 1 127 ? 97.792  115.596 59.494  1.00 47.85  ? 127 ILE A CG2 1 
ATOM   906   C  CD1 . ILE A 1 127 ? 94.888  115.111 60.477  1.00 47.85  ? 127 ILE A CD1 1 
ATOM   907   N  N   . ILE A 1 128 ? 99.626  118.017 61.474  1.00 45.02  ? 128 ILE A N   1 
ATOM   908   C  CA  . ILE A 1 128 ? 100.831 118.699 61.021  1.00 45.02  ? 128 ILE A CA  1 
ATOM   909   C  C   . ILE A 1 128 ? 102.011 118.464 61.951  1.00 45.02  ? 128 ILE A C   1 
ATOM   910   O  O   . ILE A 1 128 ? 103.140 118.271 61.482  1.00 45.02  ? 128 ILE A O   1 
ATOM   911   C  CB  . ILE A 1 128 ? 100.498 120.179 60.814  1.00 45.02  ? 128 ILE A CB  1 
ATOM   912   C  CG1 . ILE A 1 128 ? 99.608  120.286 59.578  1.00 45.02  ? 128 ILE A CG1 1 
ATOM   913   C  CG2 . ILE A 1 128 ? 101.736 121.015 60.674  1.00 45.02  ? 128 ILE A CG2 1 
ATOM   914   C  CD1 . ILE A 1 128 ? 99.313  121.690 59.126  1.00 45.02  ? 128 ILE A CD1 1 
ATOM   915   N  N   . LYS A 1 129 ? 101.778 118.393 63.258  1.00 42.63  ? 129 LYS A N   1 
ATOM   916   C  CA  . LYS A 1 129 ? 102.865 118.025 64.159  1.00 42.63  ? 129 LYS A CA  1 
ATOM   917   C  C   . LYS A 1 129 ? 103.278 116.580 63.939  1.00 42.63  ? 129 LYS A C   1 
ATOM   918   O  O   . LYS A 1 129 ? 104.465 116.251 64.012  1.00 42.63  ? 129 LYS A O   1 
ATOM   919   C  CB  . LYS A 1 129 ? 102.474 118.263 65.619  1.00 42.63  ? 129 LYS A CB  1 
ATOM   920   C  CG  . LYS A 1 129 ? 103.589 117.954 66.608  1.00 42.63  ? 129 LYS A CG  1 
ATOM   921   C  CD  . LYS A 1 129 ? 104.856 118.708 66.295  1.00 42.63  ? 129 LYS A CD  1 
ATOM   922   C  CE  . LYS A 1 129 ? 106.025 118.179 67.117  1.00 42.63  ? 129 LYS A CE  1 
ATOM   923   N  NZ  . LYS A 1 129 ? 105.806 118.201 68.580  1.00 42.63  ? 129 LYS A NZ  1 
ATOM   924   N  N   . HIS A 1 130 ? 102.321 115.726 63.606  1.00 44.96  ? 130 HIS A N   1 
ATOM   925   C  CA  . HIS A 1 130 ? 102.641 114.338 63.335  1.00 44.96  ? 130 HIS A CA  1 
ATOM   926   C  C   . HIS A 1 130 ? 103.381 114.169 62.017  1.00 44.96  ? 130 HIS A C   1 
ATOM   927   O  O   . HIS A 1 130 ? 104.189 113.247 61.883  1.00 44.96  ? 130 HIS A O   1 
ATOM   928   C  CB  . HIS A 1 130 ? 101.373 113.510 63.350  1.00 44.96  ? 130 HIS A CB  1 
ATOM   929   C  CG  . HIS A 1 130 ? 101.618 112.062 63.139  1.00 44.96  ? 130 HIS A CG  1 
ATOM   930   N  ND1 . HIS A 1 130 ? 101.886 111.203 64.178  1.00 44.96  ? 130 HIS A ND1 1 
ATOM   931   C  CD2 . HIS A 1 130 ? 101.642 111.316 62.013  1.00 44.96  ? 130 HIS A CD2 1 
ATOM   932   C  CE1 . HIS A 1 130 ? 102.066 109.986 63.702  1.00 44.96  ? 130 HIS A CE1 1 
ATOM   933   N  NE2 . HIS A 1 130 ? 101.923 110.027 62.390  1.00 44.96  ? 130 HIS A NE2 1 
ATOM   934   N  N   . GLU A 1 131 ? 103.149 115.042 61.044  1.00 51.61  ? 131 GLU A N   1 
ATOM   935   C  CA  . GLU A 1 131 ? 103.897 114.919 59.800  1.00 51.61  ? 131 GLU A CA  1 
ATOM   936   C  C   . GLU A 1 131 ? 105.298 115.479 59.924  1.00 51.61  ? 131 GLU A C   1 
ATOM   937   O  O   . GLU A 1 131 ? 106.209 115.001 59.247  1.00 51.61  ? 131 GLU A O   1 
ATOM   938   C  CB  . GLU A 1 131 ? 103.176 115.621 58.654  1.00 51.61  ? 131 GLU A CB  1 
ATOM   939   C  CG  . GLU A 1 131 ? 101.871 114.982 58.209  1.00 51.61  ? 131 GLU A CG  1 
ATOM   940   C  CD  . GLU A 1 131 ? 101.979 113.519 57.831  1.00 51.61  ? 131 GLU A CD  1 
ATOM   941   O  OE1 . GLU A 1 131 ? 103.037 113.080 57.332  1.00 51.61  ? 131 GLU A OE1 1 
ATOM   942   O  OE2 . GLU A 1 131 ? 100.985 112.796 58.038  1.00 51.61  ? 131 GLU A OE2 1 
ATOM   943   N  N   . LEU A 1 132 ? 105.498 116.459 60.792  1.00 50.31  ? 132 LEU A N   1 
ATOM   944   C  CA  . LEU A 1 132 ? 106.852 116.917 61.054  1.00 50.31  ? 132 LEU A CA  1 
ATOM   945   C  C   . LEU A 1 132 ? 107.620 115.910 61.895  1.00 50.31  ? 132 LEU A C   1 
ATOM   946   O  O   . LEU A 1 132 ? 108.848 115.848 61.810  1.00 50.31  ? 132 LEU A O   1 
ATOM   947   C  CB  . LEU A 1 132 ? 106.829 118.285 61.714  1.00 50.31  ? 132 LEU A CB  1 
ATOM   948   C  CG  . LEU A 1 132 ? 106.467 119.370 60.716  1.00 50.31  ? 132 LEU A CG  1 
ATOM   949   C  CD1 . LEU A 1 132 ? 106.396 120.693 61.412  1.00 50.31  ? 132 LEU A CD1 1 
ATOM   950   C  CD2 . LEU A 1 132 ? 107.516 119.406 59.650  1.00 50.31  ? 132 LEU A CD2 1 
ATOM   951   N  N   . GLU A 1 133 ? 106.932 115.144 62.736  1.00 49.04  ? 133 GLU A N   1 
ATOM   952   C  CA  . GLU A 1 133 ? 107.611 114.114 63.510  1.00 49.04  ? 133 GLU A CA  1 
ATOM   953   C  C   . GLU A 1 133 ? 108.050 112.973 62.602  1.00 49.04  ? 133 GLU A C   1 
ATOM   954   O  O   . GLU A 1 133 ? 109.171 112.470 62.719  1.00 49.04  ? 133 GLU A O   1 
ATOM   955   C  CB  . GLU A 1 133 ? 106.701 113.603 64.623  1.00 49.04  ? 133 GLU A CB  1 
ATOM   956   N  N   . ASN A 1 134 ? 107.179 112.554 61.682  1.00 53.43  ? 134 ASN A N   1 
ATOM   957   C  CA  . ASN A 1 134 ? 107.513 111.506 60.718  1.00 53.43  ? 134 ASN A CA  1 
ATOM   958   C  C   . ASN A 1 134 ? 108.186 112.110 59.491  1.00 53.43  ? 134 ASN A C   1 
ATOM   959   O  O   . ASN A 1 134 ? 107.697 111.998 58.366  1.00 53.43  ? 134 ASN A O   1 
ATOM   960   C  CB  . ASN A 1 134 ? 106.259 110.756 60.286  1.00 53.43  ? 134 ASN A CB  1 
ATOM   961   C  CG  . ASN A 1 134 ? 105.783 109.772 61.316  1.00 53.43  ? 134 ASN A CG  1 
ATOM   962   O  OD1 . ASN A 1 134 ? 105.701 110.089 62.498  1.00 53.43  ? 134 ASN A OD1 1 
ATOM   963   N  ND2 . ASN A 1 134 ? 105.423 108.577 60.868  1.00 53.43  ? 134 ASN A ND2 1 
ATOM   964   N  N   . LEU A 1 135 ? 109.327 112.757 59.713  1.00 61.20  ? 135 LEU A N   1 
ATOM   965   C  CA  . LEU A 1 135 ? 110.128 113.336 58.635  1.00 61.20  ? 135 LEU A CA  1 
ATOM   966   C  C   . LEU A 1 135 ? 111.548 112.801 58.793  1.00 61.20  ? 135 LEU A C   1 
ATOM   967   O  O   . LEU A 1 135 ? 112.370 113.398 59.489  1.00 61.20  ? 135 LEU A O   1 
ATOM   968   C  CB  . LEU A 1 135 ? 110.091 114.846 58.707  1.00 61.20  ? 135 LEU A CB  1 
ATOM   969   C  CG  . LEU A 1 135 ? 110.594 115.563 57.479  1.00 61.20  ? 135 LEU A CG  1 
ATOM   970   C  CD1 . LEU A 1 135 ? 109.777 115.122 56.285  1.00 61.20  ? 135 LEU A CD1 1 
ATOM   971   C  CD2 . LEU A 1 135 ? 110.502 117.047 57.698  1.00 61.20  ? 135 LEU A CD2 1 
ATOM   972   N  N   . ARG A 1 136 ? 111.836 111.686 58.147  1.00 68.56  ? 136 ARG A N   1 
ATOM   973   C  CA  . ARG A 1 136 ? 113.064 110.959 58.407  1.00 68.56  ? 136 ARG A CA  1 
ATOM   974   C  C   . ARG A 1 136 ? 114.099 111.190 57.315  1.00 68.56  ? 136 ARG A C   1 
ATOM   975   O  O   . ARG A 1 136 ? 113.781 111.516 56.171  1.00 68.56  ? 136 ARG A O   1 
ATOM   976   C  CB  . ARG A 1 136 ? 112.760 109.479 58.583  1.00 68.56  ? 136 ARG A CB  1 
ATOM   977   C  CG  . ARG A 1 136 ? 111.574 109.235 59.481  1.00 68.56  ? 136 ARG A CG  1 
ATOM   978   C  CD  . ARG A 1 136 ? 111.262 107.764 59.562  1.00 68.56  ? 136 ARG A CD  1 
ATOM   979   N  NE  . ARG A 1 136 ? 110.146 107.504 60.454  1.00 68.56  ? 136 ARG A NE  1 
ATOM   980   C  CZ  . ARG A 1 136 ? 110.291 107.307 61.756  1.00 68.56  ? 136 ARG A CZ  1 
ATOM   981   N  NH1 . ARG A 1 136 ? 111.502 107.344 62.292  1.00 68.56  ? 136 ARG A NH1 1 
ATOM   982   N  NH2 . ARG A 1 136 ? 109.237 107.071 62.522  1.00 68.56  ? 136 ARG A NH2 1 
ATOM   983   N  N   . ALA A 1 137 ? 115.363 111.006 57.691  1.00 86.48  ? 137 ALA A N   1 
ATOM   984   C  CA  . ALA A 1 137 ? 116.513 111.124 56.807  1.00 86.48  ? 137 ALA A CA  1 
ATOM   985   C  C   . ALA A 1 137 ? 116.896 109.750 56.279  1.00 86.48  ? 137 ALA A C   1 
ATOM   986   O  O   . ALA A 1 137 ? 116.896 108.766 57.020  1.00 86.48  ? 137 ALA A O   1 
ATOM   987   C  CB  . ALA A 1 137 ? 117.711 111.745 57.523  1.00 86.48  ? 137 ALA A CB  1 
ATOM   988   N  N   . LYS A 1 138 ? 117.221 109.688 54.988  1.00 89.82  ? 138 LYS A N   1 
ATOM   989   C  CA  . LYS A 1 138 ? 117.565 108.412 54.373  1.00 89.82  ? 138 LYS A CA  1 
ATOM   990   C  C   . LYS A 1 138 ? 118.997 108.371 53.853  1.00 89.82  ? 138 LYS A C   1 
ATOM   991   O  O   . LYS A 1 138 ? 119.725 107.406 54.112  1.00 89.82  ? 138 LYS A O   1 
ATOM   992   C  CB  . LYS A 1 138 ? 116.598 108.118 53.227  1.00 89.82  ? 138 LYS A CB  1 
ATOM   993   C  CG  . LYS A 1 138 ? 116.932 106.870 52.445  1.00 89.82  ? 138 LYS A CG  1 
ATOM   994   C  CD  . LYS A 1 138 ? 115.954 106.659 51.310  1.00 89.82  ? 138 LYS A CD  1 
ATOM   995   N  N   . ASP A 1 139 ? 119.422 109.414 53.139  1.00 99.54  ? 139 ASP A N   1 
ATOM   996   C  CA  . ASP A 1 139 ? 120.746 109.391 52.523  1.00 99.54  ? 139 ASP A CA  1 
ATOM   997   C  C   . ASP A 1 139 ? 121.744 110.213 53.320  1.00 99.54  ? 139 ASP A C   1 
ATOM   998   O  O   . ASP A 1 139 ? 122.928 109.868 53.378  1.00 99.54  ? 139 ASP A O   1 
ATOM   999   C  CB  . ASP A 1 139 ? 120.684 109.931 51.091  1.00 99.54  ? 139 ASP A CB  1 
ATOM   1000  C  CG  . ASP A 1 139 ? 119.691 109.189 50.224  1.00 99.54  ? 139 ASP A CG  1 
ATOM   1001  O  OD1 . ASP A 1 139 ? 119.375 108.027 50.539  1.00 99.54  ? 139 ASP A OD1 1 
ATOM   1002  O  OD2 . ASP A 1 139 ? 119.227 109.772 49.222  1.00 99.54  ? 139 ASP A OD2 1 
ATOM   1003  N  N   . GLU A 1 140 ? 121.276 111.292 53.928  1.00 101.69 ? 140 GLU A N   1 
ATOM   1004  C  CA  . GLU A 1 140 ? 122.138 112.283 54.541  1.00 101.69 ? 140 GLU A CA  1 
ATOM   1005  C  C   . GLU A 1 140 ? 122.713 111.735 55.838  1.00 101.69 ? 140 GLU A C   1 
ATOM   1006  O  O   . GLU A 1 140 ? 121.972 111.278 56.709  1.00 101.69 ? 140 GLU A O   1 
ATOM   1007  C  CB  . GLU A 1 140 ? 121.303 113.528 54.801  1.00 101.69 ? 140 GLU A CB  1 
ATOM   1008  C  CG  . GLU A 1 140 ? 120.687 114.056 53.518  1.00 101.69 ? 140 GLU A CG  1 
ATOM   1009  C  CD  . GLU A 1 140 ? 119.167 113.956 53.518  1.00 101.69 ? 140 GLU A CD  1 
ATOM   1010  O  OE1 . GLU A 1 140 ? 118.634 113.061 54.207  1.00 101.69 ? 140 GLU A OE1 1 
ATOM   1011  O  OE2 . GLU A 1 140 ? 118.503 114.746 52.814  1.00 101.69 ? 140 GLU A OE2 1 
ATOM   1012  N  N   . LYS A 1 141 ? 124.037 111.742 55.959  1.00 100.74 ? 141 LYS A N   1 
ATOM   1013  C  CA  . LYS A 1 141 ? 124.644 111.329 57.215  1.00 100.74 ? 141 LYS A CA  1 
ATOM   1014  C  C   . LYS A 1 141 ? 124.740 112.435 58.252  1.00 100.74 ? 141 LYS A C   1 
ATOM   1015  O  O   . LYS A 1 141 ? 124.830 112.137 59.445  1.00 100.74 ? 141 LYS A O   1 
ATOM   1016  C  CB  . LYS A 1 141 ? 126.048 110.770 56.961  1.00 100.74 ? 141 LYS A CB  1 
ATOM   1017  C  CG  . LYS A 1 141 ? 126.060 109.520 56.113  1.00 100.74 ? 141 LYS A CG  1 
ATOM   1018  C  CD  . LYS A 1 141 ? 127.472 109.166 55.694  1.00 100.74 ? 141 LYS A CD  1 
ATOM   1019  N  N   . MET A 1 142 ? 124.733 113.699 57.841  1.00 107.66 ? 142 MET A N   1 
ATOM   1020  C  CA  . MET A 1 142 ? 124.726 114.801 58.787  1.00 107.66 ? 142 MET A CA  1 
ATOM   1021  C  C   . MET A 1 142 ? 123.899 115.943 58.223  1.00 107.66 ? 142 MET A C   1 
ATOM   1022  O  O   . MET A 1 142 ? 123.596 115.989 57.029  1.00 107.66 ? 142 MET A O   1 
ATOM   1023  C  CB  . MET A 1 142 ? 126.142 115.256 59.154  1.00 107.66 ? 142 MET A CB  1 
ATOM   1024  C  CG  . MET A 1 142 ? 126.861 116.046 58.104  1.00 107.66 ? 142 MET A CG  1 
ATOM   1025  S  SD  . MET A 1 142 ? 128.401 116.690 58.778  1.00 107.66 ? 142 MET A SD  1 
ATOM   1026  C  CE  . MET A 1 142 ? 129.018 115.259 59.656  1.00 107.66 ? 142 MET A CE  1 
ATOM   1027  N  N   . ILE A 1 143 ? 123.527 116.864 59.105  1.00 101.35 ? 143 ILE A N   1 
ATOM   1028  C  CA  . ILE A 1 143 ? 122.852 118.090 58.698  1.00 101.35 ? 143 ILE A CA  1 
ATOM   1029  C  C   . ILE A 1 143 ? 123.874 118.978 58.001  1.00 101.35 ? 143 ILE A C   1 
ATOM   1030  O  O   . ILE A 1 143 ? 124.976 119.176 58.530  1.00 101.35 ? 143 ILE A O   1 
ATOM   1031  C  CB  . ILE A 1 143 ? 122.203 118.781 59.906  1.00 101.35 ? 143 ILE A CB  1 
ATOM   1032  C  CG1 . ILE A 1 143 ? 120.927 118.037 60.293  1.00 101.35 ? 143 ILE A CG1 1 
ATOM   1033  C  CG2 . ILE A 1 143 ? 121.910 120.242 59.622  1.00 101.35 ? 143 ILE A CG2 1 
ATOM   1034  C  CD1 . ILE A 1 143 ? 120.199 118.634 61.452  1.00 101.35 ? 143 ILE A CD1 1 
ATOM   1035  N  N   . PRO A 1 144 ? 123.566 119.496 56.804  1.00 101.15 ? 144 PRO A N   1 
ATOM   1036  C  CA  . PRO A 1 144 ? 124.556 120.268 56.041  1.00 101.15 ? 144 PRO A CA  1 
ATOM   1037  C  C   . PRO A 1 144 ? 124.918 121.592 56.687  1.00 101.15 ? 144 PRO A C   1 
ATOM   1038  O  O   . PRO A 1 144 ? 124.084 122.500 56.734  1.00 101.15 ? 144 PRO A O   1 
ATOM   1039  C  CB  . PRO A 1 144 ? 123.856 120.501 54.696  1.00 101.15 ? 144 PRO A CB  1 
ATOM   1040  C  CG  . PRO A 1 144 ? 122.763 119.492 54.639  1.00 101.15 ? 144 PRO A CG  1 
ATOM   1041  C  CD  . PRO A 1 144 ? 122.320 119.304 56.046  1.00 101.15 ? 144 PRO A CD  1 
ATOM   1042  N  N   . GLY A 1 145 ? 126.144 121.718 57.189  1.00 100.64 ? 145 GLY A N   1 
ATOM   1043  C  CA  . GLY A 1 145 ? 126.577 122.901 57.906  1.00 100.64 ? 145 GLY A CA  1 
ATOM   1044  C  C   . GLY A 1 145 ? 126.845 122.687 59.378  1.00 100.64 ? 145 GLY A C   1 
ATOM   1045  O  O   . GLY A 1 145 ? 127.524 123.511 60.000  1.00 100.64 ? 145 GLY A O   1 
ATOM   1046  N  N   . TYR A 1 146 ? 126.349 121.609 59.960  1.00 101.35 ? 146 TYR A N   1 
ATOM   1047  C  CA  . TYR A 1 146 ? 126.525 121.375 61.374  1.00 101.35 ? 146 TYR A CA  1 
ATOM   1048  C  C   . TYR A 1 146 ? 127.220 120.045 61.611  1.00 101.35 ? 146 TYR A C   1 
ATOM   1049  O  O   . TYR A 1 146 ? 126.743 119.005 61.137  1.00 101.35 ? 146 TYR A O   1 
ATOM   1050  C  CB  . TYR A 1 146 ? 125.181 121.409 62.106  1.00 101.35 ? 146 TYR A CB  1 
ATOM   1051  C  CG  . TYR A 1 146 ? 124.738 122.804 62.469  1.00 101.35 ? 146 TYR A CG  1 
ATOM   1052  C  CD1 . TYR A 1 146 ? 124.333 123.696 61.490  1.00 101.35 ? 146 TYR A CD1 1 
ATOM   1053  C  CD2 . TYR A 1 146 ? 124.727 123.225 63.790  1.00 101.35 ? 146 TYR A CD2 1 
ATOM   1054  C  CE1 . TYR A 1 146 ? 123.934 124.966 61.809  1.00 101.35 ? 146 TYR A CE1 1 
ATOM   1055  C  CE2 . TYR A 1 146 ? 124.327 124.496 64.122  1.00 101.35 ? 146 TYR A CE2 1 
ATOM   1056  C  CZ  . TYR A 1 146 ? 123.932 125.363 63.125  1.00 101.35 ? 146 TYR A CZ  1 
ATOM   1057  O  OH  . TYR A 1 146 ? 123.529 126.641 63.438  1.00 101.35 ? 146 TYR A OH  1 
ATOM   1058  N  N   . PRO A 1 147 ? 128.344 120.040 62.303  1.00 100.21 ? 147 PRO A N   1 
ATOM   1059  C  CA  . PRO A 1 147 ? 129.109 118.804 62.475  1.00 100.21 ? 147 PRO A CA  1 
ATOM   1060  C  C   . PRO A 1 147 ? 128.455 117.855 63.459  1.00 100.21 ? 147 PRO A C   1 
ATOM   1061  O  O   . PRO A 1 147 ? 128.399 116.648 63.209  1.00 100.21 ? 147 PRO A O   1 
ATOM   1062  C  CB  . PRO A 1 147 ? 130.465 119.299 62.998  1.00 100.21 ? 147 PRO A CB  1 
ATOM   1063  C  CG  . PRO A 1 147 ? 130.453 120.789 62.827  1.00 100.21 ? 147 PRO A CG  1 
ATOM   1064  C  CD  . PRO A 1 147 ? 129.026 121.190 62.909  1.00 100.21 ? 147 PRO A CD  1 
ATOM   1065  N  N   . GLN A 1 148 ? 127.950 118.376 64.573  1.00 91.98  ? 148 GLN A N   1 
ATOM   1066  C  CA  . GLN A 1 148 ? 127.530 117.502 65.657  1.00 91.98  ? 148 GLN A CA  1 
ATOM   1067  C  C   . GLN A 1 148 ? 126.181 116.839 65.417  1.00 91.98  ? 148 GLN A C   1 
ATOM   1068  O  O   . GLN A 1 148 ? 125.801 115.958 66.197  1.00 91.98  ? 148 GLN A O   1 
ATOM   1069  C  CB  . GLN A 1 148 ? 127.481 118.291 66.963  1.00 91.98  ? 148 GLN A CB  1 
ATOM   1070  C  CG  . GLN A 1 148 ? 128.843 118.693 67.475  1.00 91.98  ? 148 GLN A CG  1 
ATOM   1071  C  CD  . GLN A 1 148 ? 128.762 119.568 68.703  1.00 91.98  ? 148 GLN A CD  1 
ATOM   1072  O  OE1 . GLN A 1 148 ? 127.743 120.210 68.955  1.00 91.98  ? 148 GLN A OE1 1 
ATOM   1073  N  NE2 . GLN A 1 148 ? 129.835 119.593 69.482  1.00 91.98  ? 148 GLN A NE2 1 
ATOM   1074  N  N   . ALA A 1 149 ? 125.443 117.239 64.385  1.00 96.30  ? 149 ALA A N   1 
ATOM   1075  C  CA  . ALA A 1 149 ? 124.148 116.623 64.137  1.00 96.30  ? 149 ALA A CA  1 
ATOM   1076  C  C   . ALA A 1 149 ? 124.323 115.244 63.516  1.00 96.30  ? 149 ALA A C   1 
ATOM   1077  O  O   . ALA A 1 149 ? 124.316 115.105 62.290  1.00 96.30  ? 149 ALA A O   1 
ATOM   1078  C  CB  . ALA A 1 149 ? 123.302 117.510 63.230  1.00 96.30  ? 149 ALA A CB  1 
ATOM   1079  N  N   . LYS A 1 150 ? 124.474 114.222 64.350  1.00 91.73  ? 150 LYS A N   1 
ATOM   1080  C  CA  . LYS A 1 150 ? 124.710 112.865 63.874  1.00 91.73  ? 150 LYS A CA  1 
ATOM   1081  C  C   . LYS A 1 150 ? 123.410 112.306 63.320  1.00 91.73  ? 150 LYS A C   1 
ATOM   1082  O  O   . LYS A 1 150 ? 122.478 112.044 64.085  1.00 91.73  ? 150 LYS A O   1 
ATOM   1083  C  CB  . LYS A 1 150 ? 125.238 111.988 65.005  1.00 91.73  ? 150 LYS A CB  1 
ATOM   1084  N  N   . LEU A 1 151 ? 123.330 112.104 62.009  1.00 94.93  ? 151 LEU A N   1 
ATOM   1085  C  CA  . LEU A 1 151 ? 122.081 111.621 61.433  1.00 94.93  ? 151 LEU A CA  1 
ATOM   1086  C  C   . LEU A 1 151 ? 122.256 110.201 60.908  1.00 94.93  ? 151 LEU A C   1 
ATOM   1087  O  O   . LEU A 1 151 ? 123.074 109.954 60.018  1.00 94.93  ? 151 LEU A O   1 
ATOM   1088  C  CB  . LEU A 1 151 ? 121.666 112.553 60.302  1.00 94.93  ? 151 LEU A CB  1 
ATOM   1089  C  CG  . LEU A 1 151 ? 120.863 113.813 60.607  1.00 94.93  ? 151 LEU A CG  1 
ATOM   1090  C  CD1 . LEU A 1 151 ? 120.399 114.445 59.317  1.00 94.93  ? 151 LEU A CD1 1 
ATOM   1091  C  CD2 . LEU A 1 151 ? 119.690 113.513 61.485  1.00 94.93  ? 151 LEU A CD2 1 
ATOM   1092  N  N   . TYR A 1 152 ? 121.476 109.268 61.443  1.00 91.42  ? 152 TYR A N   1 
ATOM   1093  C  CA  . TYR A 1 152 ? 121.439 107.910 60.923  1.00 91.42  ? 152 TYR A CA  1 
ATOM   1094  C  C   . TYR A 1 152 ? 120.105 107.709 60.219  1.00 91.42  ? 152 TYR A C   1 
ATOM   1095  O  O   . TYR A 1 152 ? 119.144 108.429 60.495  1.00 91.42  ? 152 TYR A O   1 
ATOM   1096  C  CB  . TYR A 1 152 ? 121.635 106.880 62.034  1.00 91.42  ? 152 TYR A CB  1 
ATOM   1097  C  CG  . TYR A 1 152 ? 120.695 106.963 63.196  1.00 91.42  ? 152 TYR A CG  1 
ATOM   1098  C  CD1 . TYR A 1 152 ? 120.955 107.776 64.282  1.00 91.42  ? 152 TYR A CD1 1 
ATOM   1099  C  CD2 . TYR A 1 152 ? 119.558 106.168 63.222  1.00 91.42  ? 152 TYR A CD2 1 
ATOM   1100  C  CE1 . TYR A 1 152 ? 120.088 107.822 65.343  1.00 91.42  ? 152 TYR A CE1 1 
ATOM   1101  C  CE2 . TYR A 1 152 ? 118.691 106.206 64.274  1.00 91.42  ? 152 TYR A CE2 1 
ATOM   1102  C  CZ  . TYR A 1 152 ? 118.958 107.035 65.333  1.00 91.42  ? 152 TYR A CZ  1 
ATOM   1103  O  OH  . TYR A 1 152 ? 118.087 107.075 66.391  1.00 91.42  ? 152 TYR A OH  1 
ATOM   1104  N  N   . PRO A 1 153 ? 120.018 106.776 59.268  1.00 95.17  ? 153 PRO A N   1 
ATOM   1105  C  CA  . PRO A 1 153 ? 118.732 106.524 58.596  1.00 95.17  ? 153 PRO A CA  1 
ATOM   1106  C  C   . PRO A 1 153 ? 117.700 105.943 59.554  1.00 95.17  ? 153 PRO A C   1 
ATOM   1107  O  O   . PRO A 1 153 ? 117.960 104.953 60.240  1.00 95.17  ? 153 PRO A O   1 
ATOM   1108  C  CB  . PRO A 1 153 ? 119.098 105.525 57.491  1.00 95.17  ? 153 PRO A CB  1 
ATOM   1109  C  CG  . PRO A 1 153 ? 120.433 104.996 57.865  1.00 95.17  ? 153 PRO A CG  1 
ATOM   1110  C  CD  . PRO A 1 153 ? 121.124 106.116 58.558  1.00 95.17  ? 153 PRO A CD  1 
ATOM   1111  N  N   . GLY A 1 154 ? 116.530 106.578 59.603  1.00 86.83  ? 154 GLY A N   1 
ATOM   1112  C  CA  . GLY A 1 154 ? 115.460 106.259 60.542  1.00 86.83  ? 154 GLY A CA  1 
ATOM   1113  C  C   . GLY A 1 154 ? 115.312 107.209 61.718  1.00 86.83  ? 154 GLY A C   1 
ATOM   1114  O  O   . GLY A 1 154 ? 114.496 106.940 62.611  1.00 86.83  ? 154 GLY A O   1 
ATOM   1115  N  N   . LYS A 1 155 ? 116.058 108.304 61.762  1.00 83.50  ? 155 LYS A N   1 
ATOM   1116  C  CA  . LYS A 1 155 ? 116.012 109.259 62.858  1.00 83.50  ? 155 LYS A CA  1 
ATOM   1117  C  C   . LYS A 1 155 ? 115.177 110.458 62.430  1.00 83.50  ? 155 LYS A C   1 
ATOM   1118  O  O   . LYS A 1 155 ? 115.290 110.918 61.291  1.00 83.50  ? 155 LYS A O   1 
ATOM   1119  C  CB  . LYS A 1 155 ? 117.427 109.684 63.239  1.00 83.50  ? 155 LYS A CB  1 
ATOM   1120  C  CG  . LYS A 1 155 ? 117.536 110.861 64.167  1.00 83.50  ? 155 LYS A CG  1 
ATOM   1121  C  CD  . LYS A 1 155 ? 118.990 111.244 64.293  1.00 83.50  ? 155 LYS A CD  1 
ATOM   1122  C  CE  . LYS A 1 155 ? 119.447 111.263 65.723  1.00 83.50  ? 155 LYS A CE  1 
ATOM   1123  N  NZ  . LYS A 1 155 ? 120.927 111.349 65.785  1.00 83.50  ? 155 LYS A NZ  1 
ATOM   1124  N  N   . SER A 1 156 ? 114.298 110.924 63.318  1.00 71.44  ? 156 SER A N   1 
ATOM   1125  C  CA  . SER A 1 156 ? 113.473 112.084 63.000  1.00 71.44  ? 156 SER A CA  1 
ATOM   1126  C  C   . SER A 1 156 ? 114.325 113.337 62.849  1.00 71.44  ? 156 SER A C   1 
ATOM   1127  O  O   . SER A 1 156 ? 115.267 113.564 63.609  1.00 71.44  ? 156 SER A O   1 
ATOM   1128  C  CB  . SER A 1 156 ? 112.424 112.300 64.086  1.00 71.44  ? 156 SER A CB  1 
ATOM   1129  O  OG  . SER A 1 156 ? 111.986 113.645 64.093  1.00 71.44  ? 156 SER A OG  1 
ATOM   1130  N  N   . LEU A 1 157 ? 113.974 114.163 61.863  1.00 68.40  ? 157 LEU A N   1 
ATOM   1131  C  CA  . LEU A 1 157 ? 114.716 115.396 61.633  1.00 68.40  ? 157 LEU A CA  1 
ATOM   1132  C  C   . LEU A 1 157 ? 114.388 116.444 62.683  1.00 68.40  ? 157 LEU A C   1 
ATOM   1133  O  O   . LEU A 1 157 ? 115.275 117.171 63.140  1.00 68.40  ? 157 LEU A O   1 
ATOM   1134  C  CB  . LEU A 1 157 ? 114.430 115.916 60.229  1.00 68.40  ? 157 LEU A CB  1 
ATOM   1135  C  CG  . LEU A 1 157 ? 115.150 115.144 59.116  1.00 68.40  ? 157 LEU A CG  1 
ATOM   1136  C  CD1 . LEU A 1 157 ? 115.024 115.843 57.779  1.00 68.40  ? 157 LEU A CD1 1 
ATOM   1137  C  CD2 . LEU A 1 157 ? 116.615 114.941 59.444  1.00 68.40  ? 157 LEU A CD2 1 
ATOM   1138  N  N   . LEU A 1 158 ? 113.115 116.552 63.055  1.00 62.82  ? 158 LEU A N   1 
ATOM   1139  C  CA  . LEU A 1 158 ? 112.695 117.589 63.987  1.00 62.82  ? 158 LEU A CA  1 
ATOM   1140  C  C   . LEU A 1 158 ? 113.217 117.333 65.390  1.00 62.82  ? 158 LEU A C   1 
ATOM   1141  O  O   . LEU A 1 158 ? 113.511 118.279 66.127  1.00 62.82  ? 158 LEU A O   1 
ATOM   1142  C  CB  . LEU A 1 158 ? 111.178 117.685 64.016  1.00 62.82  ? 158 LEU A CB  1 
ATOM   1143  C  CG  . LEU A 1 158 ? 110.701 118.992 64.622  1.00 62.82  ? 158 LEU A CG  1 
ATOM   1144  C  CD1 . LEU A 1 158 ? 111.001 120.122 63.680  1.00 62.82  ? 158 LEU A CD1 1 
ATOM   1145  C  CD2 . LEU A 1 158 ? 109.236 118.896 64.894  1.00 62.82  ? 158 LEU A CD2 1 
ATOM   1146  N  N   . ARG A 1 159 ? 113.338 116.067 65.768  1.00 65.12  ? 159 ARG A N   1 
ATOM   1147  C  CA  . ARG A 1 159 ? 113.856 115.729 67.085  1.00 65.12  ? 159 ARG A CA  1 
ATOM   1148  C  C   . ARG A 1 159 ? 115.321 116.110 67.223  1.00 65.12  ? 159 ARG A C   1 
ATOM   1149  O  O   . ARG A 1 159 ? 115.726 116.653 68.255  1.00 65.12  ? 159 ARG A O   1 
ATOM   1150  C  CB  . ARG A 1 159 ? 113.611 114.253 67.356  1.00 65.12  ? 159 ARG A CB  1 
ATOM   1151  C  CG  . ARG A 1 159 ? 113.503 113.932 68.812  1.00 65.12  ? 159 ARG A CG  1 
ATOM   1152  C  CD  . ARG A 1 159 ? 112.133 114.353 69.295  1.00 65.12  ? 159 ARG A CD  1 
ATOM   1153  N  NE  . ARG A 1 159 ? 111.042 113.611 68.682  1.00 65.12  ? 159 ARG A NE  1 
ATOM   1154  C  CZ  . ARG A 1 159 ? 110.584 112.450 69.123  1.00 65.12  ? 159 ARG A CZ  1 
ATOM   1155  N  NH1 . ARG A 1 159 ? 111.128 111.885 70.186  1.00 65.12  ? 159 ARG A NH1 1 
ATOM   1156  N  NH2 . ARG A 1 159 ? 109.577 111.858 68.504  1.00 65.12  ? 159 ARG A NH2 1 
ATOM   1157  N  N   . ARG A 1 160 ? 116.126 115.860 66.194  1.00 71.61  ? 160 ARG A N   1 
ATOM   1158  C  CA  . ARG A 1 160 ? 117.530 116.245 66.261  1.00 71.61  ? 160 ARG A CA  1 
ATOM   1159  C  C   . ARG A 1 160 ? 117.711 117.747 66.145  1.00 71.61  ? 160 ARG A C   1 
ATOM   1160  O  O   . ARG A 1 160 ? 118.697 118.295 66.645  1.00 71.61  ? 160 ARG A O   1 
ATOM   1161  C  CB  . ARG A 1 160 ? 118.338 115.525 65.192  1.00 71.61  ? 160 ARG A CB  1 
ATOM   1162  C  CG  . ARG A 1 160 ? 119.772 115.323 65.606  1.00 71.61  ? 160 ARG A CG  1 
ATOM   1163  C  CD  . ARG A 1 160 ? 119.894 114.656 66.953  1.00 71.61  ? 160 ARG A CD  1 
ATOM   1164  N  NE  . ARG A 1 160 ? 121.238 114.137 67.152  1.00 71.61  ? 160 ARG A NE  1 
ATOM   1165  C  CZ  . ARG A 1 160 ? 122.253 114.863 67.606  1.00 71.61  ? 160 ARG A CZ  1 
ATOM   1166  N  NH1 . ARG A 1 160 ? 122.073 116.140 67.909  1.00 71.61  ? 160 ARG A NH1 1 
ATOM   1167  N  NH2 . ARG A 1 160 ? 123.450 114.315 67.756  1.00 71.61  ? 160 ARG A NH2 1 
ATOM   1168  N  N   . LEU A 1 161 ? 116.774 118.434 65.509  1.00 65.67  ? 161 LEU A N   1 
ATOM   1169  C  CA  . LEU A 1 161 ? 116.864 119.884 65.475  1.00 65.67  ? 161 LEU A CA  1 
ATOM   1170  C  C   . LEU A 1 161 ? 116.483 120.491 66.815  1.00 65.67  ? 161 LEU A C   1 
ATOM   1171  O  O   . LEU A 1 161 ? 116.966 121.573 67.162  1.00 65.67  ? 161 LEU A O   1 
ATOM   1172  C  CB  . LEU A 1 161 ? 115.983 120.441 64.368  1.00 65.67  ? 161 LEU A CB  1 
ATOM   1173  C  CG  . LEU A 1 161 ? 116.583 120.311 62.977  1.00 65.67  ? 161 LEU A CG  1 
ATOM   1174  C  CD1 . LEU A 1 161 ? 115.515 120.481 61.920  1.00 65.67  ? 161 LEU A CD1 1 
ATOM   1175  C  CD2 . LEU A 1 161 ? 117.671 121.333 62.805  1.00 65.67  ? 161 LEU A CD2 1 
ATOM   1176  N  N   . LEU A 1 162 ? 115.641 119.808 67.587  1.00 68.47  ? 162 LEU A N   1 
ATOM   1177  C  CA  . LEU A 1 162 ? 115.270 120.322 68.898  1.00 68.47  ? 162 LEU A CA  1 
ATOM   1178  C  C   . LEU A 1 162 ? 116.359 120.071 69.926  1.00 68.47  ? 162 LEU A C   1 
ATOM   1179  O  O   . LEU A 1 162 ? 116.645 120.942 70.753  1.00 68.47  ? 162 LEU A O   1 
ATOM   1180  C  CB  . LEU A 1 162 ? 113.974 119.674 69.360  1.00 68.47  ? 162 LEU A CB  1 
ATOM   1181  C  CG  . LEU A 1 162 ? 112.696 120.355 68.908  1.00 68.47  ? 162 LEU A CG  1 
ATOM   1182  C  CD1 . LEU A 1 162 ? 111.547 119.386 69.024  1.00 68.47  ? 162 LEU A CD1 1 
ATOM   1183  C  CD2 . LEU A 1 162 ? 112.453 121.563 69.768  1.00 68.47  ? 162 LEU A CD2 1 
ATOM   1184  N  N   . THR A 1 163 ? 116.980 118.895 69.891  1.00 71.39  ? 163 THR A N   1 
ATOM   1185  C  CA  . THR A 1 163 ? 117.963 118.555 70.914  1.00 71.39  ? 163 THR A CA  1 
ATOM   1186  C  C   . THR A 1 163 ? 119.278 119.287 70.674  1.00 71.39  ? 163 THR A C   1 
ATOM   1187  O  O   . THR A 1 163 ? 119.992 119.621 71.625  1.00 71.39  ? 163 THR A O   1 
ATOM   1188  C  CB  . THR A 1 163 ? 118.168 117.044 70.961  1.00 71.39  ? 163 THR A CB  1 
ATOM   1189  O  OG1 . THR A 1 163 ? 116.894 116.397 70.901  1.00 71.39  ? 163 THR A OG1 1 
ATOM   1190  C  CG2 . THR A 1 163 ? 118.833 116.638 72.255  1.00 71.39  ? 163 THR A CG2 1 
ATOM   1191  N  N   . SER A 1 164 ? 119.606 119.572 69.421  1.00 68.41  ? 164 SER A N   1 
ATOM   1192  C  CA  . SER A 1 164 ? 120.846 120.273 69.137  1.00 68.41  ? 164 SER A CA  1 
ATOM   1193  C  C   . SER A 1 164 ? 120.686 121.782 69.194  1.00 68.41  ? 164 SER A C   1 
ATOM   1194  O  O   . SER A 1 164 ? 121.645 122.503 68.910  1.00 68.41  ? 164 SER A O   1 
ATOM   1195  C  CB  . SER A 1 164 ? 121.389 119.876 67.767  1.00 68.41  ? 164 SER A CB  1 
ATOM   1196  O  OG  . SER A 1 164 ? 120.850 120.712 66.764  1.00 68.41  ? 164 SER A OG  1 
ATOM   1197  N  N   . GLY A 1 165 ? 119.502 122.277 69.533  1.00 66.20  ? 165 GLY A N   1 
ATOM   1198  C  CA  . GLY A 1 165 ? 119.331 123.700 69.734  1.00 66.20  ? 165 GLY A CA  1 
ATOM   1199  C  C   . GLY A 1 165 ? 119.286 124.547 68.486  1.00 66.20  ? 165 GLY A C   1 
ATOM   1200  O  O   . GLY A 1 165 ? 119.875 125.631 68.459  1.00 66.20  ? 165 GLY A O   1 
ATOM   1201  N  N   . ILE A 1 166 ? 118.622 124.083 67.443  1.00 71.60  ? 166 ILE A N   1 
ATOM   1202  C  CA  . ILE A 1 166 ? 118.403 124.864 66.235  1.00 71.60  ? 166 ILE A CA  1 
ATOM   1203  C  C   . ILE A 1 166 ? 116.948 125.297 66.111  1.00 71.60  ? 166 ILE A C   1 
ATOM   1204  O  O   . ILE A 1 166 ? 116.657 126.477 65.919  1.00 71.60  ? 166 ILE A O   1 
ATOM   1205  C  CB  . ILE A 1 166 ? 118.874 124.099 64.983  1.00 71.60  ? 166 ILE A CB  1 
ATOM   1206  C  CG1 . ILE A 1 166 ? 120.323 123.652 65.173  1.00 71.60  ? 166 ILE A CG1 1 
ATOM   1207  C  CG2 . ILE A 1 166 ? 118.728 124.957 63.756  1.00 71.60  ? 166 ILE A CG2 1 
ATOM   1208  C  CD1 . ILE A 1 166 ? 120.925 122.965 63.970  1.00 71.60  ? 166 ILE A CD1 1 
ATOM   1209  N  N   . VAL A 1 167 ? 116.021 124.356 66.221  1.00 61.73  ? 167 VAL A N   1 
ATOM   1210  C  CA  . VAL A 1 167 ? 114.609 124.682 66.351  1.00 61.73  ? 167 VAL A CA  1 
ATOM   1211  C  C   . VAL A 1 167 ? 114.322 124.868 67.830  1.00 61.73  ? 167 VAL A C   1 
ATOM   1212  O  O   . VAL A 1 167 ? 114.465 123.931 68.621  1.00 61.73  ? 167 VAL A O   1 
ATOM   1213  C  CB  . VAL A 1 167 ? 113.729 123.573 65.766  1.00 61.73  ? 167 VAL A CB  1 
ATOM   1214  C  CG1 . VAL A 1 167 ? 112.288 123.775 66.177  1.00 61.73  ? 167 VAL A CG1 1 
ATOM   1215  C  CG2 . VAL A 1 167 ? 113.873 123.517 64.273  1.00 61.73  ? 167 VAL A CG2 1 
ATOM   1216  N  N   . ILE A 1 168 ? 113.949 126.084 68.212  1.00 59.34  ? 168 ILE A N   1 
ATOM   1217  C  CA  . ILE A 1 168 ? 113.722 126.374 69.620  1.00 59.34  ? 168 ILE A CA  1 
ATOM   1218  C  C   . ILE A 1 168 ? 112.405 125.786 70.095  1.00 59.34  ? 168 ILE A C   1 
ATOM   1219  O  O   . ILE A 1 168 ? 112.375 125.023 71.064  1.00 59.34  ? 168 ILE A O   1 
ATOM   1220  C  CB  . ILE A 1 168 ? 113.806 127.884 69.868  1.00 59.34  ? 168 ILE A CB  1 
ATOM   1221  C  CG1 . ILE A 1 168 ? 115.218 128.359 69.527  1.00 59.34  ? 168 ILE A CG1 1 
ATOM   1222  C  CG2 . ILE A 1 168 ? 113.435 128.203 71.293  1.00 59.34  ? 168 ILE A CG2 1 
ATOM   1223  C  CD1 . ILE A 1 168 ? 115.470 129.818 69.800  1.00 59.34  ? 168 ILE A CD1 1 
ATOM   1224  N  N   . GLN A 1 169 ? 111.298 126.116 69.435  1.00 48.46  ? 169 GLN A N   1 
ATOM   1225  C  CA  . GLN A 1 169 ? 110.023 125.556 69.852  1.00 48.46  ? 169 GLN A CA  1 
ATOM   1226  C  C   . GLN A 1 169 ? 109.081 125.456 68.669  1.00 48.46  ? 169 GLN A C   1 
ATOM   1227  O  O   . GLN A 1 169 ? 109.131 126.267 67.745  1.00 48.46  ? 169 GLN A O   1 
ATOM   1228  C  CB  . GLN A 1 169 ? 109.395 126.392 70.961  1.00 48.46  ? 169 GLN A CB  1 
ATOM   1229  C  CG  . GLN A 1 169 ? 109.258 127.842 70.615  1.00 48.46  ? 169 GLN A CG  1 
ATOM   1230  C  CD  . GLN A 1 169 ? 109.040 128.696 71.840  1.00 48.46  ? 169 GLN A CD  1 
ATOM   1231  O  OE1 . GLN A 1 169 ? 108.605 128.206 72.880  1.00 48.46  ? 169 GLN A OE1 1 
ATOM   1232  N  NE2 . GLN A 1 169 ? 109.356 129.981 71.731  1.00 48.46  ? 169 GLN A NE2 1 
ATOM   1233  N  N   . VAL A 1 170 ? 108.219 124.449 68.715  1.00 35.32  ? 170 VAL A N   1 
ATOM   1234  C  CA  . VAL A 1 170 ? 107.169 124.233 67.733  1.00 35.32  ? 170 VAL A CA  1 
ATOM   1235  C  C   . VAL A 1 170 ? 105.850 124.277 68.479  1.00 35.32  ? 170 VAL A C   1 
ATOM   1236  O  O   . VAL A 1 170 ? 105.576 123.408 69.312  1.00 35.32  ? 170 VAL A O   1 
ATOM   1237  C  CB  . VAL A 1 170 ? 107.342 122.907 66.992  1.00 35.32  ? 170 VAL A CB  1 
ATOM   1238  C  CG1 . VAL A 1 170 ? 106.111 122.588 66.193  1.00 35.32  ? 170 VAL A CG1 1 
ATOM   1239  C  CG2 . VAL A 1 170 ? 108.538 122.975 66.101  1.00 35.32  ? 170 VAL A CG2 1 
ATOM   1240  N  N   . PHE A 1 171 ? 105.039 125.284 68.209  1.00 39.06  ? 171 PHE A N   1 
ATOM   1241  C  CA  . PHE A 1 171 ? 103.817 125.396 68.973  1.00 39.06  ? 171 PHE A CA  1 
ATOM   1242  C  C   . PHE A 1 171 ? 102.654 125.698 68.045  1.00 39.06  ? 171 PHE A C   1 
ATOM   1243  O  O   . PHE A 1 171 ? 102.811 126.445 67.080  1.00 39.06  ? 171 PHE A O   1 
ATOM   1244  C  CB  . PHE A 1 171 ? 103.933 126.495 70.032  1.00 39.06  ? 171 PHE A CB  1 
ATOM   1245  C  CG  . PHE A 1 171 ? 104.211 127.864 69.479  1.00 39.06  ? 171 PHE A CG  1 
ATOM   1246  C  CD1 . PHE A 1 171 ? 105.505 128.288 69.262  1.00 39.06  ? 171 PHE A CD1 1 
ATOM   1247  C  CD2 . PHE A 1 171 ? 103.180 128.760 69.260  1.00 39.06  ? 171 PHE A CD2 1 
ATOM   1248  C  CE1 . PHE A 1 171 ? 105.756 129.551 68.778  1.00 39.06  ? 171 PHE A CE1 1 
ATOM   1249  C  CE2 . PHE A 1 171 ? 103.432 130.021 68.781  1.00 39.06  ? 171 PHE A CE2 1 
ATOM   1250  C  CZ  . PHE A 1 171 ? 104.719 130.415 68.542  1.00 39.06  ? 171 PHE A CZ  1 
ATOM   1251  N  N   . PRO A 1 172 ? 101.483 125.154 68.315  1.00 35.03  ? 172 PRO A N   1 
ATOM   1252  C  CA  . PRO A 1 172 ? 100.317 125.475 67.502  1.00 35.03  ? 172 PRO A CA  1 
ATOM   1253  C  C   . PRO A 1 172 ? 99.768  126.835 67.880  1.00 35.03  ? 172 PRO A C   1 
ATOM   1254  O  O   . PRO A 1 172 ? 100.139 127.422 68.891  1.00 35.03  ? 172 PRO A O   1 
ATOM   1255  C  CB  . PRO A 1 172 ? 99.332  124.369 67.849  1.00 35.03  ? 172 PRO A CB  1 
ATOM   1256  C  CG  . PRO A 1 172 ? 99.704  123.983 69.189  1.00 35.03  ? 172 PRO A CG  1 
ATOM   1257  C  CD  . PRO A 1 172 ? 101.169 124.159 69.338  1.00 35.03  ? 172 PRO A CD  1 
ATOM   1258  N  N   . LEU A 1 173 ? 98.877  127.333 67.033  1.00 42.13  ? 173 LEU A N   1 
ATOM   1259  C  CA  . LEU A 1 173 ? 98.349  128.679 67.169  1.00 42.13  ? 173 LEU A CA  1 
ATOM   1260  C  C   . LEU A 1 173 ? 96.965  128.665 67.791  1.00 42.13  ? 173 LEU A C   1 
ATOM   1261  O  O   . LEU A 1 173 ? 96.126  127.824 67.460  1.00 42.13  ? 173 LEU A O   1 
ATOM   1262  C  CB  . LEU A 1 173 ? 98.283  129.355 65.805  1.00 42.13  ? 173 LEU A CB  1 
ATOM   1263  C  CG  . LEU A 1 173 ? 99.522  130.139 65.415  1.00 42.13  ? 173 LEU A CG  1 
ATOM   1264  C  CD1 . LEU A 1 173 ? 99.232  130.975 64.208  1.00 42.13  ? 173 LEU A CD1 1 
ATOM   1265  C  CD2 . LEU A 1 173 ? 99.960  131.023 66.555  1.00 42.13  ? 173 LEU A CD2 1 
ATOM   1266  N  N   . HIS A 1 174 ? 96.737  129.612 68.692  1.00 41.05  ? 174 HIS A N   1 
ATOM   1267  C  CA  . HIS A 1 174 ? 95.414  129.845 69.239  1.00 41.05  ? 174 HIS A CA  1 
ATOM   1268  C  C   . HIS A 1 174 ? 94.528  130.491 68.187  1.00 41.05  ? 174 HIS A C   1 
ATOM   1269  O  O   . HIS A 1 174 ? 95.004  131.250 67.343  1.00 41.05  ? 174 HIS A O   1 
ATOM   1270  C  CB  . HIS A 1 174 ? 95.516  130.725 70.474  1.00 41.05  ? 174 HIS A CB  1 
ATOM   1271  C  CG  . HIS A 1 174 ? 95.623  129.949 71.744  1.00 41.05  ? 174 HIS A CG  1 
ATOM   1272  N  ND1 . HIS A 1 174 ? 94.571  129.239 72.277  1.00 41.05  ? 174 HIS A ND1 1 
ATOM   1273  C  CD2 . HIS A 1 174 ? 96.675  129.741 72.568  1.00 41.05  ? 174 HIS A CD2 1 
ATOM   1274  C  CE1 . HIS A 1 174 ? 94.965  128.645 73.388  1.00 41.05  ? 174 HIS A CE1 1 
ATOM   1275  N  NE2 . HIS A 1 174 ? 96.238  128.933 73.587  1.00 41.05  ? 174 HIS A NE2 1 
ATOM   1276  N  N   . ASP A 1 175 ? 93.240  130.195 68.229  1.00 53.39  ? 175 ASP A N   1 
ATOM   1277  C  CA  . ASP A 1 175 ? 92.284  130.851 67.350  1.00 53.39  ? 175 ASP A CA  1 
ATOM   1278  C  C   . ASP A 1 175 ? 91.536  131.851 68.212  1.00 53.39  ? 175 ASP A C   1 
ATOM   1279  O  O   . ASP A 1 175 ? 90.611  131.484 68.938  1.00 53.39  ? 175 ASP A O   1 
ATOM   1280  C  CB  . ASP A 1 175 ? 91.339  129.825 66.730  1.00 53.39  ? 175 ASP A CB  1 
ATOM   1281  C  CG  . ASP A 1 175 ? 90.428  130.416 65.676  1.00 53.39  ? 175 ASP A CG  1 
ATOM   1282  O  OD1 . ASP A 1 175 ? 90.609  131.591 65.304  1.00 53.39  ? 175 ASP A OD1 1 
ATOM   1283  O  OD2 . ASP A 1 175 ? 89.525  129.692 65.208  1.00 53.39  ? 175 ASP A OD2 1 
ATOM   1284  N  N   . SER A 1 176 ? 91.865  133.126 68.046  1.00 58.44  ? 176 SER A N   1 
ATOM   1285  C  CA  . SER A 1 176 ? 91.385  134.168 68.943  1.00 58.44  ? 176 SER A CA  1 
ATOM   1286  C  C   . SER A 1 176 ? 89.921  134.506 68.767  1.00 58.44  ? 176 SER A C   1 
ATOM   1287  O  O   . SER A 1 176 ? 89.395  135.295 69.555  1.00 58.44  ? 176 SER A O   1 
ATOM   1288  C  CB  . SER A 1 176 ? 92.218  135.430 68.756  1.00 58.44  ? 176 SER A CB  1 
ATOM   1289  O  OG  . SER A 1 176 ? 92.037  135.951 67.453  1.00 58.44  ? 176 SER A OG  1 
ATOM   1290  N  N   . GLU A 1 177 ? 89.250  133.964 67.764  1.00 63.18  ? 177 GLU A N   1 
ATOM   1291  C  CA  . GLU A 1 177 ? 87.832  134.214 67.606  1.00 63.18  ? 177 GLU A CA  1 
ATOM   1292  C  C   . GLU A 1 177 ? 86.969  133.005 67.919  1.00 63.18  ? 177 GLU A C   1 
ATOM   1293  O  O   . GLU A 1 177 ? 85.765  133.168 68.136  1.00 63.18  ? 177 GLU A O   1 
ATOM   1294  C  CB  . GLU A 1 177 ? 87.555  134.716 66.186  1.00 63.18  ? 177 GLU A CB  1 
ATOM   1295  C  CG  . GLU A 1 177 ? 88.361  135.963 65.866  1.00 63.18  ? 177 GLU A CG  1 
ATOM   1296  C  CD  . GLU A 1 177 ? 88.675  136.101 64.397  1.00 63.18  ? 177 GLU A CD  1 
ATOM   1297  O  OE1 . GLU A 1 177 ? 88.802  135.061 63.722  1.00 63.18  ? 177 GLU A OE1 1 
ATOM   1298  O  OE2 . GLU A 1 177 ? 88.796  137.245 63.914  1.00 63.18  ? 177 GLU A OE2 1 
ATOM   1299  N  N   . ALA A 1 178 ? 87.554  131.811 67.982  1.00 55.31  ? 178 ALA A N   1 
ATOM   1300  C  CA  . ALA A 1 178 ? 86.838  130.635 68.454  1.00 55.31  ? 178 ALA A CA  1 
ATOM   1301  C  C   . ALA A 1 178 ? 87.171  130.310 69.892  1.00 55.31  ? 178 ALA A C   1 
ATOM   1302  O  O   . ALA A 1 178 ? 86.466  129.520 70.525  1.00 55.31  ? 178 ALA A O   1 
ATOM   1303  C  CB  . ALA A 1 178 ? 87.155  129.424 67.576  1.00 55.31  ? 178 ALA A CB  1 
ATOM   1304  N  N   . LEU A 1 179 ? 88.213  130.934 70.430  1.00 47.79  ? 179 LEU A N   1 
ATOM   1305  C  CA  . LEU A 1 179 ? 88.524  130.756 71.837  1.00 47.79  ? 179 LEU A CA  1 
ATOM   1306  C  C   . LEU A 1 179 ? 87.593  131.582 72.702  1.00 47.79  ? 179 LEU A C   1 
ATOM   1307  O  O   . LEU A 1 179 ? 87.221  131.157 73.801  1.00 47.79  ? 179 LEU A O   1 
ATOM   1308  C  CB  . LEU A 1 179 ? 89.971  131.140 72.098  1.00 47.79  ? 179 LEU A CB  1 
ATOM   1309  C  CG  . LEU A 1 179 ? 90.496  130.945 73.501  1.00 47.79  ? 179 LEU A CG  1 
ATOM   1310  C  CD1 . LEU A 1 179 ? 90.235  129.535 73.919  1.00 47.79  ? 179 LEU A CD1 1 
ATOM   1311  C  CD2 . LEU A 1 179 ? 91.968  131.233 73.502  1.00 47.79  ? 179 LEU A CD2 1 
ATOM   1312  N  N   . LYS A 1 180 ? 87.186  132.752 72.213  1.00 52.59  ? 180 LYS A N   1 
ATOM   1313  C  CA  . LYS A 1 180 ? 86.305  133.602 72.999  1.00 52.59  ? 180 LYS A CA  1 
ATOM   1314  C  C   . LYS A 1 180 ? 84.915  132.998 73.054  1.00 52.59  ? 180 LYS A C   1 
ATOM   1315  O  O   . LYS A 1 180 ? 84.243  133.057 74.088  1.00 52.59  ? 180 LYS A O   1 
ATOM   1316  C  CB  . LYS A 1 180 ? 86.275  135.014 72.429  1.00 52.59  ? 180 LYS A CB  1 
ATOM   1317  C  CG  . LYS A 1 180 ? 87.383  135.885 72.976  1.00 52.59  ? 180 LYS A CG  1 
ATOM   1318  C  CD  . LYS A 1 180 ? 87.790  136.952 71.986  1.00 52.59  ? 180 LYS A CD  1 
ATOM   1319  N  N   . LYS A 1 181 ? 84.491  132.371 71.963  1.00 52.24  ? 181 LYS A N   1 
ATOM   1320  C  CA  . LYS A 1 181 ? 83.224  131.663 71.959  1.00 52.24  ? 181 LYS A CA  1 
ATOM   1321  C  C   . LYS A 1 181 ? 83.272  130.376 72.764  1.00 52.24  ? 181 LYS A C   1 
ATOM   1322  O  O   . LYS A 1 181 ? 82.216  129.808 73.056  1.00 52.24  ? 181 LYS A O   1 
ATOM   1323  C  CB  . LYS A 1 181 ? 82.786  131.348 70.531  1.00 52.24  ? 181 LYS A CB  1 
ATOM   1324  C  CG  . LYS A 1 181 ? 82.826  132.532 69.605  1.00 52.24  ? 181 LYS A CG  1 
ATOM   1325  C  CD  . LYS A 1 181 ? 82.193  132.189 68.278  1.00 52.24  ? 181 LYS A CD  1 
ATOM   1326  C  CE  . LYS A 1 181 ? 82.447  133.284 67.265  1.00 52.24  ? 181 LYS A CE  1 
ATOM   1327  N  NZ  . LYS A 1 181 ? 82.463  134.630 67.894  1.00 52.24  ? 181 LYS A NZ  1 
ATOM   1328  N  N   . LEU A 1 182 ? 84.459  129.889 73.118  1.00 47.68  ? 182 LEU A N   1 
ATOM   1329  C  CA  . LEU A 1 182 ? 84.523  128.810 74.092  1.00 47.68  ? 182 LEU A CA  1 
ATOM   1330  C  C   . LEU A 1 182 ? 84.452  129.365 75.507  1.00 47.68  ? 182 LEU A C   1 
ATOM   1331  O  O   . LEU A 1 182 ? 83.767  128.813 76.375  1.00 47.68  ? 182 LEU A O   1 
ATOM   1332  C  CB  . LEU A 1 182 ? 85.812  128.024 73.892  1.00 47.68  ? 182 LEU A CB  1 
ATOM   1333  C  CG  . LEU A 1 182 ? 86.144  127.023 74.980  1.00 47.68  ? 182 LEU A CG  1 
ATOM   1334  C  CD1 . LEU A 1 182 ? 85.094  125.942 74.966  1.00 47.68  ? 182 LEU A CD1 1 
ATOM   1335  C  CD2 . LEU A 1 182 ? 87.499  126.449 74.756  1.00 47.68  ? 182 LEU A CD2 1 
ATOM   1336  N  N   . GLU A 1 183 ? 85.132  130.485 75.746  1.00 55.97  ? 183 GLU A N   1 
ATOM   1337  C  CA  . GLU A 1 183 ? 85.151  131.095 77.068  1.00 55.97  ? 183 GLU A CA  1 
ATOM   1338  C  C   . GLU A 1 183 ? 83.803  131.650 77.486  1.00 55.97  ? 183 GLU A C   1 
ATOM   1339  O  O   . GLU A 1 183 ? 83.525  131.708 78.687  1.00 55.97  ? 183 GLU A O   1 
ATOM   1340  C  CB  . GLU A 1 183 ? 86.177  132.222 77.141  1.00 55.97  ? 183 GLU A CB  1 
ATOM   1341  C  CG  . GLU A 1 183 ? 87.557  131.794 77.569  1.00 55.97  ? 183 GLU A CG  1 
ATOM   1342  C  CD  . GLU A 1 183 ? 88.451  132.980 77.844  1.00 55.97  ? 183 GLU A CD  1 
ATOM   1343  O  OE1 . GLU A 1 183 ? 87.971  133.960 78.447  1.00 55.97  ? 183 GLU A OE1 1 
ATOM   1344  O  OE2 . GLU A 1 183 ? 89.629  132.950 77.440  1.00 55.97  ? 183 GLU A OE2 1 
ATOM   1345  N  N   . ASP A 1 184 ? 82.955  132.021 76.524  1.00 61.80  ? 184 ASP A N   1 
ATOM   1346  C  CA  . ASP A 1 184 ? 81.643  132.560 76.856  1.00 61.80  ? 184 ASP A CA  1 
ATOM   1347  C  C   . ASP A 1 184 ? 80.748  131.505 77.473  1.00 61.80  ? 184 ASP A C   1 
ATOM   1348  O  O   . ASP A 1 184 ? 79.887  131.830 78.295  1.00 61.80  ? 184 ASP A O   1 
ATOM   1349  C  CB  . ASP A 1 184 ? 80.977  133.134 75.608  1.00 61.80  ? 184 ASP A CB  1 
ATOM   1350  C  CG  . ASP A 1 184 ? 81.662  134.386 75.109  1.00 61.80  ? 184 ASP A CG  1 
ATOM   1351  O  OD1 . ASP A 1 184 ? 82.498  134.935 75.853  1.00 61.80  ? 184 ASP A OD1 1 
ATOM   1352  O  OD2 . ASP A 1 184 ? 81.366  134.823 73.976  1.00 61.80  ? 184 ASP A OD2 1 
ATOM   1353  N  N   . THR A 1 185 ? 80.952  130.245 77.121  1.00 54.95  ? 185 THR A N   1 
ATOM   1354  C  CA  . THR A 1 185 ? 80.126  129.184 77.656  1.00 54.95  ? 185 THR A CA  1 
ATOM   1355  C  C   . THR A 1 185 ? 80.886  128.314 78.630  1.00 54.95  ? 185 THR A C   1 
ATOM   1356  O  O   . THR A 1 185 ? 80.433  127.210 78.935  1.00 54.95  ? 185 THR A O   1 
ATOM   1357  C  CB  . THR A 1 185 ? 79.583  128.307 76.529  1.00 54.95  ? 185 THR A CB  1 
ATOM   1358  O  OG1 . THR A 1 185 ? 80.597  127.386 76.119  1.00 54.95  ? 185 THR A OG1 1 
ATOM   1359  C  CG2 . THR A 1 185 ? 79.186  129.154 75.339  1.00 54.95  ? 185 THR A CG2 1 
ATOM   1360  N  N   . TRP A 1 186 ? 82.036  128.767 79.112  1.00 46.15  ? 186 TRP A N   1 
ATOM   1361  C  CA  . TRP A 1 186 ? 82.828  127.941 79.998  1.00 46.15  ? 186 TRP A CA  1 
ATOM   1362  C  C   . TRP A 1 186 ? 82.877  128.447 81.429  1.00 46.15  ? 186 TRP A C   1 
ATOM   1363  O  O   . TRP A 1 186 ? 82.684  127.646 82.347  1.00 46.15  ? 186 TRP A O   1 
ATOM   1364  C  CB  . TRP A 1 186 ? 84.268  127.830 79.492  1.00 46.15  ? 186 TRP A CB  1 
ATOM   1365  C  CG  . TRP A 1 186 ? 84.987  126.618 79.971  1.00 46.15  ? 186 TRP A CG  1 
ATOM   1366  C  CD1 . TRP A 1 186 ? 84.548  125.702 80.862  1.00 46.15  ? 186 TRP A CD1 1 
ATOM   1367  C  CD2 . TRP A 1 186 ? 86.315  126.245 79.639  1.00 46.15  ? 186 TRP A CD2 1 
ATOM   1368  N  NE1 . TRP A 1 186 ? 85.499  124.755 81.071  1.00 46.15  ? 186 TRP A NE1 1 
ATOM   1369  C  CE2 . TRP A 1 186 ? 86.602  125.073 80.334  1.00 46.15  ? 186 TRP A CE2 1 
ATOM   1370  C  CE3 . TRP A 1 186 ? 87.286  126.784 78.804  1.00 46.15  ? 186 TRP A CE3 1 
ATOM   1371  C  CZ2 . TRP A 1 186 ? 87.810  124.429 80.222  1.00 46.15  ? 186 TRP A CZ2 1 
ATOM   1372  C  CZ3 . TRP A 1 186 ? 88.479  126.152 78.697  1.00 46.15  ? 186 TRP A CZ3 1 
ATOM   1373  C  CH2 . TRP A 1 186 ? 88.736  124.984 79.399  1.00 46.15  ? 186 TRP A CH2 1 
ATOM   1374  N  N   . TYR A 1 187 ? 83.107  129.737 81.650  1.00 50.91  ? 187 TYR A N   1 
ATOM   1375  C  CA  . TYR A 1 187 ? 83.266  130.240 83.010  1.00 50.91  ? 187 TYR A CA  1 
ATOM   1376  C  C   . TYR A 1 187 ? 81.921  130.289 83.707  1.00 50.91  ? 187 TYR A C   1 
ATOM   1377  O  O   . TYR A 1 187 ? 81.145  131.228 83.545  1.00 50.91  ? 187 TYR A O   1 
ATOM   1378  C  CB  . TYR A 1 187 ? 83.877  131.629 82.994  1.00 50.91  ? 187 TYR A CB  1 
ATOM   1379  C  CG  . TYR A 1 187 ? 85.266  131.690 82.450  1.00 50.91  ? 187 TYR A CG  1 
ATOM   1380  C  CD1 . TYR A 1 187 ? 86.146  130.645 82.630  1.00 50.91  ? 187 TYR A CD1 1 
ATOM   1381  C  CD2 . TYR A 1 187 ? 85.702  132.808 81.768  1.00 50.91  ? 187 TYR A CD2 1 
ATOM   1382  C  CE1 . TYR A 1 187 ? 87.421  130.709 82.133  1.00 50.91  ? 187 TYR A CE1 1 
ATOM   1383  C  CE2 . TYR A 1 187 ? 86.971  132.882 81.270  1.00 50.91  ? 187 TYR A CE2 1 
ATOM   1384  C  CZ  . TYR A 1 187 ? 87.825  131.831 81.453  1.00 50.91  ? 187 TYR A CZ  1 
ATOM   1385  O  OH  . TYR A 1 187 ? 89.097  131.906 80.953  1.00 50.91  ? 187 TYR A OH  1 
ATOM   1386  N  N   . THR A 1 188 ? 81.659  129.296 84.535  1.00 70.72  ? 188 THR A N   1 
ATOM   1387  C  CA  . THR A 1 188 ? 80.435  129.271 85.318  1.00 70.72  ? 188 THR A CA  1 
ATOM   1388  C  C   . THR A 1 188 ? 80.736  130.077 86.568  1.00 70.72  ? 188 THR A C   1 
ATOM   1389  O  O   . THR A 1 188 ? 81.810  129.929 87.158  1.00 70.72  ? 188 THR A O   1 
ATOM   1390  C  CB  . THR A 1 188 ? 80.010  127.846 85.647  1.00 70.72  ? 188 THR A CB  1 
ATOM   1391  O  OG1 . THR A 1 188 ? 80.817  127.341 86.719  1.00 70.72  ? 188 THR A OG1 1 
ATOM   1392  C  CG2 . THR A 1 188 ? 80.175  126.959 84.428  1.00 70.72  ? 188 THR A CG2 1 
ATOM   1393  N  N   . ARG A 1 189 ? 79.811  130.932 86.976  1.00 93.52  ? 189 ARG A N   1 
ATOM   1394  C  CA  . ARG A 1 189 ? 80.136  131.785 88.107  1.00 93.52  ? 189 ARG A CA  1 
ATOM   1395  C  C   . ARG A 1 189 ? 78.917  132.170 88.925  1.00 93.52  ? 189 ARG A C   1 
ATOM   1396  O  O   . ARG A 1 189 ? 79.040  132.493 90.110  1.00 93.52  ? 189 ARG A O   1 
ATOM   1397  C  CB  . ARG A 1 189 ? 80.849  133.049 87.622  1.00 93.52  ? 189 ARG A CB  1 
ATOM   1398  N  N   . PHE A 1 190 ? 77.738  132.149 88.317  1.00 107.51 ? 190 PHE A N   1 
ATOM   1399  C  CA  . PHE A 1 190 ? 76.562  132.552 89.071  1.00 107.51 ? 190 PHE A CA  1 
ATOM   1400  C  C   . PHE A 1 190 ? 75.475  131.486 89.119  1.00 107.51 ? 190 PHE A C   1 
ATOM   1401  O  O   . PHE A 1 190 ? 74.439  131.674 89.765  1.00 107.51 ? 190 PHE A O   1 
ATOM   1402  C  CB  . PHE A 1 190 ? 76.058  133.870 88.483  1.00 107.51 ? 190 PHE A CB  1 
ATOM   1403  C  CG  . PHE A 1 190 ? 77.149  134.893 88.333  1.00 107.51 ? 190 PHE A CG  1 
ATOM   1404  C  CD1 . PHE A 1 190 ? 77.661  135.537 89.448  1.00 107.51 ? 190 PHE A CD1 1 
ATOM   1405  C  CD2 . PHE A 1 190 ? 77.701  135.169 87.092  1.00 107.51 ? 190 PHE A CD2 1 
ATOM   1406  C  CE1 . PHE A 1 190 ? 78.678  136.458 89.328  1.00 107.51 ? 190 PHE A CE1 1 
ATOM   1407  C  CE2 . PHE A 1 190 ? 78.720  136.092 86.966  1.00 107.51 ? 190 PHE A CE2 1 
ATOM   1408  C  CZ  . PHE A 1 190 ? 79.207  136.737 88.086  1.00 107.51 ? 190 PHE A CZ  1 
ATOM   1409  N  N   . ALA A 1 191 ? 75.710  130.358 88.465  1.00 103.20 ? 191 ALA A N   1 
ATOM   1410  C  CA  . ALA A 1 191 ? 74.695  129.332 88.298  1.00 103.20 ? 191 ALA A CA  1 
ATOM   1411  C  C   . ALA A 1 191 ? 75.385  128.008 88.029  1.00 103.20 ? 191 ALA A C   1 
ATOM   1412  O  O   . ALA A 1 191 ? 76.391  127.957 87.315  1.00 103.20 ? 191 ALA A O   1 
ATOM   1413  C  CB  . ALA A 1 191 ? 73.728  129.657 87.150  1.00 103.20 ? 191 ALA A CB  1 
ATOM   1414  N  N   . LEU A 1 192 ? 74.872  126.946 88.653  1.00 95.94  ? 192 LEU A N   1 
ATOM   1415  C  CA  . LEU A 1 192 ? 75.446  125.615 88.477  1.00 95.94  ? 192 LEU A CA  1 
ATOM   1416  C  C   . LEU A 1 192 ? 75.150  125.214 87.043  1.00 95.94  ? 192 LEU A C   1 
ATOM   1417  O  O   . LEU A 1 192 ? 74.049  125.417 86.530  1.00 95.94  ? 192 LEU A O   1 
ATOM   1418  C  CB  . LEU A 1 192 ? 74.869  124.622 89.479  1.00 95.94  ? 192 LEU A CB  1 
ATOM   1419  N  N   . LYS A 1 193 ? 76.134  124.607 86.400  1.00 73.41  ? 193 LYS A N   1 
ATOM   1420  C  CA  . LYS A 1 193 ? 76.023  124.300 84.991  1.00 73.41  ? 193 LYS A CA  1 
ATOM   1421  C  C   . LYS A 1 193 ? 77.031  123.228 84.635  1.00 73.41  ? 193 LYS A C   1 
ATOM   1422  O  O   . LYS A 1 193 ? 78.185  123.256 85.063  1.00 73.41  ? 193 LYS A O   1 
ATOM   1423  C  CB  . LYS A 1 193 ? 76.262  125.540 84.123  1.00 73.41  ? 193 LYS A CB  1 
ATOM   1424  N  N   . TYR A 1 194 ? 76.564  122.276 83.856  1.00 62.71  ? 194 TYR A N   1 
ATOM   1425  C  CA  . TYR A 1 194 ? 77.402  121.203 83.381  1.00 62.71  ? 194 TYR A CA  1 
ATOM   1426  C  C   . TYR A 1 194 ? 78.382  121.778 82.377  1.00 62.71  ? 194 TYR A C   1 
ATOM   1427  O  O   . TYR A 1 194 ? 78.010  122.536 81.482  1.00 62.71  ? 194 TYR A O   1 
ATOM   1428  C  CB  . TYR A 1 194 ? 76.559  120.091 82.779  1.00 62.71  ? 194 TYR A CB  1 
ATOM   1429  C  CG  . TYR A 1 194 ? 75.750  119.429 83.848  1.00 62.71  ? 194 TYR A CG  1 
ATOM   1430  C  CD1 . TYR A 1 194 ? 76.314  118.462 84.654  1.00 62.71  ? 194 TYR A CD1 1 
ATOM   1431  C  CD2 . TYR A 1 194 ? 74.429  119.773 84.059  1.00 62.71  ? 194 TYR A CD2 1 
ATOM   1432  C  CE1 . TYR A 1 194 ? 75.591  117.852 85.645  1.00 62.71  ? 194 TYR A CE1 1 
ATOM   1433  C  CE2 . TYR A 1 194 ? 73.691  119.166 85.051  1.00 62.71  ? 194 TYR A CE2 1 
ATOM   1434  C  CZ  . TYR A 1 194 ? 74.280  118.202 85.842  1.00 62.71  ? 194 TYR A CZ  1 
ATOM   1435  O  OH  . TYR A 1 194 ? 73.565  117.581 86.841  1.00 62.71  ? 194 TYR A OH  1 
ATOM   1436  N  N   . GLN A 1 195 ? 79.643  121.444 82.560  1.00 46.71  ? 195 GLN A N   1 
ATOM   1437  C  CA  . GLN A 1 195 ? 80.704  122.018 81.764  1.00 46.71  ? 195 GLN A CA  1 
ATOM   1438  C  C   . GLN A 1 195 ? 80.670  121.418 80.370  1.00 46.71  ? 195 GLN A C   1 
ATOM   1439  O  O   . GLN A 1 195 ? 80.462  120.205 80.237  1.00 46.71  ? 195 GLN A O   1 
ATOM   1440  C  CB  . GLN A 1 195 ? 82.038  121.754 82.426  1.00 46.71  ? 195 GLN A CB  1 
ATOM   1441  C  CG  . GLN A 1 195 ? 83.040  122.821 82.242  1.00 46.71  ? 195 GLN A CG  1 
ATOM   1442  C  CD  . GLN A 1 195 ? 84.240  122.606 83.103  1.00 46.71  ? 195 GLN A CD  1 
ATOM   1443  O  OE1 . GLN A 1 195 ? 85.196  123.370 83.045  1.00 46.71  ? 195 GLN A OE1 1 
ATOM   1444  N  NE2 . GLN A 1 195 ? 84.208  121.559 83.912  1.00 46.71  ? 195 GLN A NE2 1 
ATOM   1445  N  N   . PRO A 1 196 ? 80.833  122.212 79.319  1.00 41.11  ? 196 PRO A N   1 
ATOM   1446  C  CA  . PRO A 1 196 ? 80.780  121.701 77.938  1.00 41.11  ? 196 PRO A CA  1 
ATOM   1447  C  C   . PRO A 1 196 ? 82.038  120.979 77.470  1.00 41.11  ? 196 PRO A C   1 
ATOM   1448  O  O   . PRO A 1 196 ? 82.893  121.522 76.784  1.00 41.11  ? 196 PRO A O   1 
ATOM   1449  C  CB  . PRO A 1 196 ? 80.550  122.974 77.125  1.00 41.11  ? 196 PRO A CB  1 
ATOM   1450  C  CG  . PRO A 1 196 ? 81.177  124.037 77.921  1.00 41.11  ? 196 PRO A CG  1 
ATOM   1451  C  CD  . PRO A 1 196 ? 81.002  123.672 79.353  1.00 41.11  ? 196 PRO A CD  1 
ATOM   1452  N  N   . ILE A 1 197 ? 82.108  119.689 77.809  1.00 36.89  ? 197 ILE A N   1 
ATOM   1453  C  CA  . ILE A 1 197 ? 83.305  118.899 77.575  1.00 36.89  ? 197 ILE A CA  1 
ATOM   1454  C  C   . ILE A 1 197 ? 83.525  118.633 76.099  1.00 36.89  ? 197 ILE A C   1 
ATOM   1455  O  O   . ILE A 1 197 ? 84.675  118.535 75.659  1.00 36.89  ? 197 ILE A O   1 
ATOM   1456  C  CB  . ILE A 1 197 ? 83.202  117.554 78.300  1.00 36.89  ? 197 ILE A CB  1 
ATOM   1457  C  CG1 . ILE A 1 197 ? 82.676  117.757 79.696  1.00 36.89  ? 197 ILE A CG1 1 
ATOM   1458  C  CG2 . ILE A 1 197 ? 84.549  116.906 78.440  1.00 36.89  ? 197 ILE A CG2 1 
ATOM   1459  C  CD1 . ILE A 1 197 ? 82.274  116.469 80.332  1.00 36.89  ? 197 ILE A CD1 1 
ATOM   1460  N  N   . ASP A 1 198 ? 82.462  118.604 75.301  1.00 37.51  ? 198 ASP A N   1 
ATOM   1461  C  CA  . ASP A 1 198 ? 82.633  118.335 73.881  1.00 37.51  ? 198 ASP A CA  1 
ATOM   1462  C  C   . ASP A 1 198 ? 83.221  119.522 73.142  1.00 37.51  ? 198 ASP A C   1 
ATOM   1463  O  O   . ASP A 1 198 ? 83.983  119.330 72.192  1.00 37.51  ? 198 ASP A O   1 
ATOM   1464  C  CB  . ASP A 1 198 ? 81.321  117.885 73.271  1.00 37.51  ? 198 ASP A CB  1 
ATOM   1465  C  CG  . ASP A 1 198 ? 81.184  116.389 73.300  1.00 37.51  ? 198 ASP A CG  1 
ATOM   1466  O  OD1 . ASP A 1 198 ? 82.216  115.713 73.140  1.00 37.51  ? 198 ASP A OD1 1 
ATOM   1467  O  OD2 . ASP A 1 198 ? 80.068  115.879 73.509  1.00 37.51  ? 198 ASP A OD2 1 
ATOM   1468  N  N   . SER A 1 199 ? 82.880  120.739 73.538  1.00 39.49  ? 199 SER A N   1 
ATOM   1469  C  CA  . SER A 1 199 ? 83.496  121.889 72.898  1.00 39.49  ? 199 SER A CA  1 
ATOM   1470  C  C   . SER A 1 199 ? 84.929  122.066 73.376  1.00 39.49  ? 199 SER A C   1 
ATOM   1471  O  O   . SER A 1 199 ? 85.786  122.512 72.608  1.00 39.49  ? 199 SER A O   1 
ATOM   1472  C  CB  . SER A 1 199 ? 82.701  123.147 73.204  1.00 39.49  ? 199 SER A CB  1 
ATOM   1473  O  OG  . SER A 1 199 ? 82.649  123.349 74.601  1.00 39.49  ? 199 SER A OG  1 
ATOM   1474  N  N   . ILE A 1 200 ? 85.177  121.763 74.651  1.00 36.99  ? 200 ILE A N   1 
ATOM   1475  C  CA  . ILE A 1 200 ? 86.531  121.668 75.189  1.00 36.99  ? 200 ILE A CA  1 
ATOM   1476  C  C   . ILE A 1 200 ? 87.355  120.649 74.423  1.00 36.99  ? 200 ILE A C   1 
ATOM   1477  O  O   . ILE A 1 200 ? 88.521  120.896 74.093  1.00 36.99  ? 200 ILE A O   1 
ATOM   1478  C  CB  . ILE A 1 200 ? 86.464  121.317 76.683  1.00 36.99  ? 200 ILE A CB  1 
ATOM   1479  C  CG1 . ILE A 1 200 ? 85.929  122.494 77.474  1.00 36.99  ? 200 ILE A CG1 1 
ATOM   1480  C  CG2 . ILE A 1 200 ? 87.801  120.935 77.222  1.00 36.99  ? 200 ILE A CG2 1 
ATOM   1481  C  CD1 . ILE A 1 200 ? 85.441  122.110 78.828  1.00 36.99  ? 200 ILE A CD1 1 
ATOM   1482  N  N   . ARG A 1 201 ? 86.746  119.517 74.077  1.00 33.25  ? 201 ARG A N   1 
ATOM   1483  C  CA  . ARG A 1 201 ? 87.448  118.494 73.313  1.00 33.25  ? 201 ARG A CA  1 
ATOM   1484  C  C   . ARG A 1 201 ? 87.825  118.980 71.929  1.00 33.25  ? 201 ARG A C   1 
ATOM   1485  O  O   . ARG A 1 201 ? 88.979  118.834 71.513  1.00 33.25  ? 201 ARG A O   1 
ATOM   1486  C  CB  . ARG A 1 201 ? 86.581  117.249 73.193  1.00 33.25  ? 201 ARG A CB  1 
ATOM   1487  C  CG  . ARG A 1 201 ? 87.209  116.171 72.358  1.00 33.25  ? 201 ARG A CG  1 
ATOM   1488  C  CD  . ARG A 1 201 ? 86.421  115.912 71.107  1.00 33.25  ? 201 ARG A CD  1 
ATOM   1489  N  NE  . ARG A 1 201 ? 87.166  115.067 70.191  1.00 33.25  ? 201 ARG A NE  1 
ATOM   1490  C  CZ  . ARG A 1 201 ? 86.776  114.794 68.956  1.00 33.25  ? 201 ARG A CZ  1 
ATOM   1491  N  NH1 . ARG A 1 201 ? 85.642  115.300 68.499  1.00 33.25  ? 201 ARG A NH1 1 
ATOM   1492  N  NH2 . ARG A 1 201 ? 87.516  114.012 68.184  1.00 33.25  ? 201 ARG A NH2 1 
ATOM   1493  N  N   . GLY A 1 202 ? 86.874  119.583 71.216  1.00 37.03  ? 202 GLY A N   1 
ATOM   1494  C  CA  . GLY A 1 202 ? 87.131  120.019 69.857  1.00 37.03  ? 202 GLY A CA  1 
ATOM   1495  C  C   . GLY A 1 202 ? 88.131  121.146 69.762  1.00 37.03  ? 202 GLY A C   1 
ATOM   1496  O  O   . GLY A 1 202 ? 88.742  121.348 68.713  1.00 37.03  ? 202 GLY A O   1 
ATOM   1497  N  N   . TYR A 1 203 ? 88.334  121.875 70.848  1.00 35.96  ? 203 TYR A N   1 
ATOM   1498  C  CA  . TYR A 1 203 ? 89.366  122.891 70.867  1.00 35.96  ? 203 TYR A CA  1 
ATOM   1499  C  C   . TYR A 1 203 ? 90.689  122.428 71.453  1.00 35.96  ? 203 TYR A C   1 
ATOM   1500  O  O   . TYR A 1 203 ? 91.739  122.857 70.974  1.00 35.96  ? 203 TYR A O   1 
ATOM   1501  C  CB  . TYR A 1 203 ? 88.891  124.114 71.635  1.00 35.96  ? 203 TYR A CB  1 
ATOM   1502  C  CG  . TYR A 1 203 ? 89.806  125.264 71.404  1.00 35.96  ? 203 TYR A CG  1 
ATOM   1503  C  CD1 . TYR A 1 203 ? 89.805  125.930 70.206  1.00 35.96  ? 203 TYR A CD1 1 
ATOM   1504  C  CD2 . TYR A 1 203 ? 90.706  125.652 72.375  1.00 35.96  ? 203 TYR A CD2 1 
ATOM   1505  C  CE1 . TYR A 1 203 ? 90.655  126.967 69.989  1.00 35.96  ? 203 TYR A CE1 1 
ATOM   1506  C  CE2 . TYR A 1 203 ? 91.565  126.679 72.165  1.00 35.96  ? 203 TYR A CE2 1 
ATOM   1507  C  CZ  . TYR A 1 203 ? 91.537  127.335 70.973  1.00 35.96  ? 203 TYR A CZ  1 
ATOM   1508  O  OH  . TYR A 1 203 ? 92.400  128.378 70.768  1.00 35.96  ? 203 TYR A OH  1 
ATOM   1509  N  N   . PHE A 1 204 ? 90.695  121.577 72.475  1.00 30.25  ? 204 PHE A N   1 
ATOM   1510  C  CA  . PHE A 1 204 ? 91.928  121.323 73.203  1.00 30.25  ? 204 PHE A CA  1 
ATOM   1511  C  C   . PHE A 1 204 ? 92.422  119.902 73.113  1.00 30.25  ? 204 PHE A C   1 
ATOM   1512  O  O   . PHE A 1 204 ? 93.324  119.540 73.865  1.00 30.25  ? 204 PHE A O   1 
ATOM   1513  C  CB  . PHE A 1 204 ? 91.749  121.639 74.682  1.00 30.25  ? 204 PHE A CB  1 
ATOM   1514  C  CG  . PHE A 1 204 ? 91.820  123.070 75.010  1.00 30.25  ? 204 PHE A CG  1 
ATOM   1515  C  CD1 . PHE A 1 204 ? 92.978  123.768 74.811  1.00 30.25  ? 204 PHE A CD1 1 
ATOM   1516  C  CD2 . PHE A 1 204 ? 90.743  123.710 75.559  1.00 30.25  ? 204 PHE A CD2 1 
ATOM   1517  C  CE1 . PHE A 1 204 ? 93.051  125.087 75.133  1.00 30.25  ? 204 PHE A CE1 1 
ATOM   1518  C  CE2 . PHE A 1 204 ? 90.814  125.025 75.880  1.00 30.25  ? 204 PHE A CE2 1 
ATOM   1519  C  CZ  . PHE A 1 204 ? 91.969  125.713 75.667  1.00 30.25  ? 204 PHE A CZ  1 
ATOM   1520  N  N   . GLY A 1 205 ? 91.893  119.101 72.231  1.00 28.19  ? 205 GLY A N   1 
ATOM   1521  C  CA  . GLY A 1 205 ? 92.335  117.735 72.200  1.00 28.19  ? 205 GLY A CA  1 
ATOM   1522  C  C   . GLY A 1 205 ? 91.603  116.905 73.220  1.00 28.19  ? 205 GLY A C   1 
ATOM   1523  O  O   . GLY A 1 205 ? 90.665  117.351 73.878  1.00 28.19  ? 205 GLY A O   1 
ATOM   1524  N  N   . GLU A 1 206 ? 92.020  115.653 73.324  1.00 30.49  ? 206 GLU A N   1 
ATOM   1525  C  CA  . GLU A 1 206 ? 91.288  114.743 74.177  1.00 30.49  ? 206 GLU A CA  1 
ATOM   1526  C  C   . GLU A 1 206 ? 91.899  114.574 75.555  1.00 30.49  ? 206 GLU A C   1 
ATOM   1527  O  O   . GLU A 1 206 ? 91.169  114.238 76.487  1.00 30.49  ? 206 GLU A O   1 
ATOM   1528  C  CB  . GLU A 1 206 ? 91.193  113.382 73.504  1.00 30.49  ? 206 GLU A CB  1 
ATOM   1529  C  CG  . GLU A 1 206 ? 90.130  113.336 72.441  1.00 30.49  ? 206 GLU A CG  1 
ATOM   1530  C  CD  . GLU A 1 206 ? 90.692  113.622 71.057  1.00 30.49  ? 206 GLU A CD  1 
ATOM   1531  O  OE1 . GLU A 1 206 ? 91.931  113.678 70.922  1.00 30.49  ? 206 GLU A OE1 1 
ATOM   1532  O  OE2 . GLU A 1 206 ? 89.904  113.795 70.102  1.00 30.49  ? 206 GLU A OE2 1 
ATOM   1533  N  N   . THR A 1 207 ? 93.204  114.784 75.723  1.00 24.42  ? 207 THR A N   1 
ATOM   1534  C  CA  . THR A 1 207 ? 93.788  114.602 77.048  1.00 24.42  ? 207 THR A CA  1 
ATOM   1535  C  C   . THR A 1 207 ? 93.387  115.724 77.992  1.00 24.42  ? 207 THR A C   1 
ATOM   1536  O  O   . THR A 1 207 ? 93.006  115.471 79.137  1.00 24.42  ? 207 THR A O   1 
ATOM   1537  C  CB  . THR A 1 207 ? 95.299  114.494 76.958  1.00 24.42  ? 207 THR A CB  1 
ATOM   1538  O  OG1 . THR A 1 207 ? 95.628  113.394 76.114  1.00 24.42  ? 207 THR A OG1 1 
ATOM   1539  C  CG2 . THR A 1 207 ? 95.859  114.180 78.304  1.00 24.42  ? 207 THR A CG2 1 
ATOM   1540  N  N   . ILE A 1 208 ? 93.428  116.962 77.512  1.00 22.40  ? 208 ILE A N   1 
ATOM   1541  C  CA  . ILE A 1 208 ? 93.027  118.107 78.316  1.00 22.40  ? 208 ILE A CA  1 
ATOM   1542  C  C   . ILE A 1 208 ? 91.544  118.060 78.609  1.00 22.40  ? 208 ILE A C   1 
ATOM   1543  O  O   . ILE A 1 208 ? 91.095  118.466 79.680  1.00 22.40  ? 208 ILE A O   1 
ATOM   1544  C  CB  . ILE A 1 208 ? 93.400  119.407 77.600  1.00 22.40  ? 208 ILE A CB  1 
ATOM   1545  C  CG1 . ILE A 1 208 ? 94.784  119.285 76.978  1.00 22.40  ? 208 ILE A CG1 1 
ATOM   1546  C  CG2 . ILE A 1 208 ? 93.349  120.547 78.559  1.00 22.40  ? 208 ILE A CG2 1 
ATOM   1547  C  CD1 . ILE A 1 208 ? 95.888  119.208 77.957  1.00 22.40  ? 208 ILE A CD1 1 
ATOM   1548  N  N   . ALA A 1 209 ? 90.759  117.583 77.662  1.00 22.22  ? 209 ALA A N   1 
ATOM   1549  C  CA  . ALA A 1 209 ? 89.333  117.463 77.893  1.00 22.22  ? 209 ALA A CA  1 
ATOM   1550  C  C   . ALA A 1 209 ? 89.003  116.377 78.892  1.00 22.22  ? 209 ALA A C   1 
ATOM   1551  O  O   . ALA A 1 209 ? 88.023  116.501 79.626  1.00 22.22  ? 209 ALA A O   1 
ATOM   1552  C  CB  . ALA A 1 209 ? 88.610  117.182 76.589  1.00 22.22  ? 209 ALA A CB  1 
ATOM   1553  N  N   . LEU A 1 210 ? 89.802  115.319 78.949  1.00 20.65  ? 210 LEU A N   1 
ATOM   1554  C  CA  . LEU A 1 210 ? 89.551  114.285 79.940  1.00 20.65  ? 210 LEU A CA  1 
ATOM   1555  C  C   . LEU A 1 210 ? 89.848  114.750 81.346  1.00 20.65  ? 210 LEU A C   1 
ATOM   1556  O  O   . LEU A 1 210 ? 89.161  114.342 82.284  1.00 20.65  ? 210 LEU A O   1 
ATOM   1557  C  CB  . LEU A 1 210 ? 90.369  113.049 79.645  1.00 20.65  ? 210 LEU A CB  1 
ATOM   1558  C  CG  . LEU A 1 210 ? 89.551  111.848 80.041  1.00 20.65  ? 210 LEU A CG  1 
ATOM   1559  C  CD1 . LEU A 1 210 ? 88.301  111.769 79.222  1.00 20.65  ? 210 LEU A CD1 1 
ATOM   1560  C  CD2 . LEU A 1 210 ? 90.392  110.649 79.834  1.00 20.65  ? 210 LEU A CD2 1 
ATOM   1561  N  N   . TYR A 1 211 ? 90.854  115.595 81.518  1.00 21.66  ? 211 TYR A N   1 
ATOM   1562  C  CA  . TYR A 1 211 ? 91.084  116.147 82.840  1.00 21.66  ? 211 TYR A CA  1 
ATOM   1563  C  C   . TYR A 1 211 ? 89.937  117.048 83.262  1.00 21.66  ? 211 TYR A C   1 
ATOM   1564  O  O   . TYR A 1 211 ? 89.464  116.942 84.394  1.00 21.66  ? 211 TYR A O   1 
ATOM   1565  C  CB  . TYR A 1 211 ? 92.393  116.916 82.889  1.00 21.66  ? 211 TYR A CB  1 
ATOM   1566  C  CG  . TYR A 1 211 ? 92.455  117.825 84.069  1.00 21.66  ? 211 TYR A CG  1 
ATOM   1567  C  CD1 . TYR A 1 211 ? 92.494  117.312 85.343  1.00 21.66  ? 211 TYR A CD1 1 
ATOM   1568  C  CD2 . TYR A 1 211 ? 92.459  119.186 83.919  1.00 21.66  ? 211 TYR A CD2 1 
ATOM   1569  C  CE1 . TYR A 1 211 ? 92.532  118.122 86.426  1.00 21.66  ? 211 TYR A CE1 1 
ATOM   1570  C  CE2 . TYR A 1 211 ? 92.504  120.003 85.002  1.00 21.66  ? 211 TYR A CE2 1 
ATOM   1571  C  CZ  . TYR A 1 211 ? 92.530  119.460 86.256  1.00 21.66  ? 211 TYR A CZ  1 
ATOM   1572  O  OH  . TYR A 1 211 ? 92.587  120.253 87.367  1.00 21.66  ? 211 TYR A OH  1 
ATOM   1573  N  N   . PHE A 1 212 ? 89.437  117.893 82.364  1.00 25.29  ? 212 PHE A N   1 
ATOM   1574  C  CA  . PHE A 1 212 ? 88.362  118.786 82.767  1.00 25.29  ? 212 PHE A CA  1 
ATOM   1575  C  C   . PHE A 1 212 ? 87.077  118.019 82.945  1.00 25.29  ? 212 PHE A C   1 
ATOM   1576  O  O   . PHE A 1 212 ? 86.208  118.436 83.710  1.00 25.29  ? 212 PHE A O   1 
ATOM   1577  C  CB  . PHE A 1 212 ? 88.156  119.895 81.758  1.00 25.29  ? 212 PHE A CB  1 
ATOM   1578  C  CG  . PHE A 1 212 ? 89.053  121.042 81.966  1.00 25.29  ? 212 PHE A CG  1 
ATOM   1579  C  CD1 . PHE A 1 212 ? 88.839  121.904 82.997  1.00 25.29  ? 212 PHE A CD1 1 
ATOM   1580  C  CD2 . PHE A 1 212 ? 90.095  121.279 81.107  1.00 25.29  ? 212 PHE A CD2 1 
ATOM   1581  C  CE1 . PHE A 1 212 ? 89.675  122.968 83.193  1.00 25.29  ? 212 PHE A CE1 1 
ATOM   1582  C  CE2 . PHE A 1 212 ? 90.925  122.344 81.292  1.00 25.29  ? 212 PHE A CE2 1 
ATOM   1583  C  CZ  . PHE A 1 212 ? 90.716  123.188 82.335  1.00 25.29  ? 212 PHE A CZ  1 
ATOM   1584  N  N   . GLY A 1 213 ? 86.919  116.930 82.212  1.00 30.48  ? 213 GLY A N   1 
ATOM   1585  C  CA  . GLY A 1 213 ? 85.810  116.049 82.487  1.00 30.48  ? 213 GLY A CA  1 
ATOM   1586  C  C   . GLY A 1 213 ? 85.976  115.343 83.816  1.00 30.48  ? 213 GLY A C   1 
ATOM   1587  O  O   . GLY A 1 213 ? 85.005  115.135 84.543  1.00 30.48  ? 213 GLY A O   1 
ATOM   1588  N  N   . PHE A 1 214 ? 87.206  114.971 84.151  1.00 47.99  ? 214 PHE A N   1 
ATOM   1589  C  CA  . PHE A 1 214 ? 87.448  114.350 85.443  1.00 47.99  ? 214 PHE A CA  1 
ATOM   1590  C  C   . PHE A 1 214 ? 87.296  115.324 86.596  1.00 47.99  ? 214 PHE A C   1 
ATOM   1591  O  O   . PHE A 1 214 ? 86.862  114.928 87.675  1.00 47.99  ? 214 PHE A O   1 
ATOM   1592  C  CB  . PHE A 1 214 ? 88.833  113.746 85.469  1.00 47.99  ? 214 PHE A CB  1 
ATOM   1593  C  CG  . PHE A 1 214 ? 89.170  113.087 86.737  1.00 47.99  ? 214 PHE A CG  1 
ATOM   1594  C  CD1 . PHE A 1 214 ? 88.553  111.918 87.095  1.00 47.99  ? 214 PHE A CD1 1 
ATOM   1595  C  CD2 . PHE A 1 214 ? 90.118  113.614 87.559  1.00 47.99  ? 214 PHE A CD2 1 
ATOM   1596  C  CE1 . PHE A 1 214 ? 88.870  111.295 88.263  1.00 47.99  ? 214 PHE A CE1 1 
ATOM   1597  C  CE2 . PHE A 1 214 ? 90.437  112.997 88.717  1.00 47.99  ? 214 PHE A CE2 1 
ATOM   1598  C  CZ  . PHE A 1 214 ? 89.811  111.834 89.073  1.00 47.99  ? 214 PHE A CZ  1 
ATOM   1599  N  N   . LEU A 1 215 ? 87.642  116.589 86.400  1.00 28.51  ? 215 LEU A N   1 
ATOM   1600  C  CA  . LEU A 1 215 ? 87.483  117.556 87.477  1.00 28.51  ? 215 LEU A CA  1 
ATOM   1601  C  C   . LEU A 1 215 ? 86.023  117.891 87.706  1.00 28.51  ? 215 LEU A C   1 
ATOM   1602  O  O   . LEU A 1 215 ? 85.577  118.004 88.849  1.00 28.51  ? 215 LEU A O   1 
ATOM   1603  C  CB  . LEU A 1 215 ? 88.254  118.818 87.135  1.00 28.51  ? 215 LEU A CB  1 
ATOM   1604  C  CG  . LEU A 1 215 ? 88.114  119.979 88.086  1.00 28.51  ? 215 LEU A CG  1 
ATOM   1605  C  CD1 . LEU A 1 215 ? 88.596  119.515 89.419  1.00 28.51  ? 215 LEU A CD1 1 
ATOM   1606  C  CD2 . LEU A 1 215 ? 88.913  121.150 87.615  1.00 28.51  ? 215 LEU A CD2 1 
ATOM   1607  N  N   . GLU A 1 216 ? 85.266  118.016 86.625  1.00 35.39  ? 216 GLU A N   1 
ATOM   1608  C  CA  . GLU A 1 216 ? 83.828  118.223 86.712  1.00 35.39  ? 216 GLU A CA  1 
ATOM   1609  C  C   . GLU A 1 216 ? 83.125  117.017 87.303  1.00 35.39  ? 216 GLU A C   1 
ATOM   1610  O  O   . GLU A 1 216 ? 82.097  117.152 87.972  1.00 35.39  ? 216 GLU A O   1 
ATOM   1611  C  CB  . GLU A 1 216 ? 83.298  118.523 85.315  1.00 35.39  ? 216 GLU A CB  1 
ATOM   1612  C  CG  . GLU A 1 216 ? 81.842  118.831 85.181  1.00 35.39  ? 216 GLU A CG  1 
ATOM   1613  C  CD  . GLU A 1 216 ? 81.375  118.518 83.784  1.00 35.39  ? 216 GLU A CD  1 
ATOM   1614  O  OE1 . GLU A 1 216 ? 82.207  118.612 82.869  1.00 35.39  ? 216 GLU A OE1 1 
ATOM   1615  O  OE2 . GLU A 1 216 ? 80.198  118.153 83.597  1.00 35.39  ? 216 GLU A OE2 1 
ATOM   1616  N  N   . TYR A 1 217 ? 83.651  115.828 87.057  1.00 25.50  ? 217 TYR A N   1 
ATOM   1617  C  CA  . TYR A 1 217 ? 83.059  114.646 87.655  1.00 25.50  ? 217 TYR A CA  1 
ATOM   1618  C  C   . TYR A 1 217 ? 83.395  114.528 89.132  1.00 25.50  ? 217 TYR A C   1 
ATOM   1619  O  O   . TYR A 1 217 ? 82.555  114.123 89.939  1.00 25.50  ? 217 TYR A O   1 
ATOM   1620  C  CB  . TYR A 1 217 ? 83.543  113.418 86.920  1.00 25.50  ? 217 TYR A CB  1 
ATOM   1621  C  CG  . TYR A 1 217 ? 82.984  112.172 87.482  1.00 25.50  ? 217 TYR A CG  1 
ATOM   1622  C  CD1 . TYR A 1 217 ? 81.683  111.814 87.221  1.00 25.50  ? 217 TYR A CD1 1 
ATOM   1623  C  CD2 . TYR A 1 217 ? 83.746  111.364 88.292  1.00 25.50  ? 217 TYR A CD2 1 
ATOM   1624  C  CE1 . TYR A 1 217 ? 81.164  110.681 87.735  1.00 25.50  ? 217 TYR A CE1 1 
ATOM   1625  C  CE2 . TYR A 1 217 ? 83.241  110.248 88.816  1.00 25.50  ? 217 TYR A CE2 1 
ATOM   1626  C  CZ  . TYR A 1 217 ? 81.954  109.904 88.534  1.00 25.50  ? 217 TYR A CZ  1 
ATOM   1627  O  OH  . TYR A 1 217 ? 81.457  108.760 89.068  1.00 25.50  ? 217 TYR A OH  1 
ATOM   1628  N  N   . PHE A 1 218 ? 84.640  114.808 89.487  1.00 27.32  ? 218 PHE A N   1 
ATOM   1629  C  CA  . PHE A 1 218 ? 85.089  114.666 90.865  1.00 27.32  ? 218 PHE A CA  1 
ATOM   1630  C  C   . PHE A 1 218 ? 84.502  115.732 91.773  1.00 27.32  ? 218 PHE A C   1 
ATOM   1631  O  O   . PHE A 1 218 ? 84.415  115.541 92.987  1.00 27.32  ? 218 PHE A O   1 
ATOM   1632  C  CB  . PHE A 1 218 ? 86.597  114.721 90.900  1.00 27.32  ? 218 PHE A CB  1 
ATOM   1633  C  CG  . PHE A 1 218 ? 87.176  114.245 92.150  1.00 27.32  ? 218 PHE A CG  1 
ATOM   1634  C  CD1 . PHE A 1 218 ? 87.059  112.924 92.495  1.00 27.32  ? 218 PHE A CD1 1 
ATOM   1635  C  CD2 . PHE A 1 218 ? 87.873  115.099 92.965  1.00 27.32  ? 218 PHE A CD2 1 
ATOM   1636  C  CE1 . PHE A 1 218 ? 87.612  112.468 93.642  1.00 27.32  ? 218 PHE A CE1 1 
ATOM   1637  C  CE2 . PHE A 1 218 ? 88.426  114.651 94.112  1.00 27.32  ? 218 PHE A CE2 1 
ATOM   1638  C  CZ  . PHE A 1 218 ? 88.297  113.334 94.453  1.00 27.32  ? 218 PHE A CZ  1 
ATOM   1639  N  N   . THR A 1 219 ? 84.115  116.865 91.210  1.00 33.20  ? 219 THR A N   1 
ATOM   1640  C  CA  . THR A 1 219 ? 83.407  117.872 91.985  1.00 33.20  ? 219 THR A CA  1 
ATOM   1641  C  C   . THR A 1 219 ? 82.009  117.403 92.337  1.00 33.20  ? 219 THR A C   1 
ATOM   1642  O  O   . THR A 1 219 ? 81.560  117.577 93.472  1.00 33.20  ? 219 THR A O   1 
ATOM   1643  C  CB  . THR A 1 219 ? 83.370  119.180 91.226  1.00 33.20  ? 219 THR A CB  1 
ATOM   1644  O  OG1 . THR A 1 219 ? 84.705  119.519 90.850  1.00 33.20  ? 219 THR A OG1 1 
ATOM   1645  C  CG2 . THR A 1 219 ? 82.819  120.265 92.095  1.00 33.20  ? 219 THR A CG2 1 
ATOM   1646  N  N   . PHE A 1 220 ? 81.328  116.753 91.410  1.00 34.45  ? 220 PHE A N   1 
ATOM   1647  C  CA  . PHE A 1 220 ? 79.987  116.258 91.683  1.00 34.45  ? 220 PHE A CA  1 
ATOM   1648  C  C   . PHE A 1 220 ? 80.004  114.913 92.375  1.00 34.45  ? 220 PHE A C   1 
ATOM   1649  O  O   . PHE A 1 220 ? 78.997  114.207 92.350  1.00 34.45  ? 220 PHE A O   1 
ATOM   1650  C  CB  . PHE A 1 220 ? 79.190  116.098 90.390  1.00 34.45  ? 220 PHE A CB  1 
ATOM   1651  C  CG  . PHE A 1 220 ? 78.917  117.371 89.673  1.00 34.45  ? 220 PHE A CG  1 
ATOM   1652  C  CD1 . PHE A 1 220 ? 78.880  118.579 90.345  1.00 34.45  ? 220 PHE A CD1 1 
ATOM   1653  C  CD2 . PHE A 1 220 ? 78.690  117.356 88.311  1.00 34.45  ? 220 PHE A CD2 1 
ATOM   1654  C  CE1 . PHE A 1 220 ? 78.626  119.757 89.665  1.00 34.45  ? 220 PHE A CE1 1 
ATOM   1655  C  CE2 . PHE A 1 220 ? 78.434  118.521 87.627  1.00 34.45  ? 220 PHE A CE2 1 
ATOM   1656  C  CZ  . PHE A 1 220 ? 78.403  119.726 88.303  1.00 34.45  ? 220 PHE A CZ  1 
ATOM   1657  N  N   . ALA A 1 221 ? 81.132  114.524 92.944  1.00 29.71  ? 221 ALA A N   1 
ATOM   1658  C  CA  . ALA A 1 221 ? 81.233  113.320 93.732  1.00 29.71  ? 221 ALA A CA  1 
ATOM   1659  C  C   . ALA A 1 221 ? 81.645  113.569 95.164  1.00 29.71  ? 221 ALA A C   1 
ATOM   1660  O  O   . ALA A 1 221 ? 81.614  112.633 95.963  1.00 29.71  ? 221 ALA A O   1 
ATOM   1661  C  CB  . ALA A 1 221 ? 82.230  112.357 93.096  1.00 29.71  ? 221 ALA A CB  1 
ATOM   1662  N  N   . LEU A 1 222 ? 82.090  114.771 95.499  1.00 34.79  ? 222 LEU A N   1 
ATOM   1663  C  CA  . LEU A 1 222 ? 82.309  115.143 96.885  1.00 34.79  ? 222 LEU A CA  1 
ATOM   1664  C  C   . LEU A 1 222 ? 81.133  115.902 97.464  1.00 34.79  ? 222 LEU A C   1 
ATOM   1665  O  O   . LEU A 1 222 ? 81.162  116.269 98.641  1.00 34.79  ? 222 LEU A O   1 
ATOM   1666  C  CB  . LEU A 1 222 ? 83.590  115.951 97.039  1.00 34.79  ? 222 LEU A CB  1 
ATOM   1667  C  CG  . LEU A 1 222 ? 84.841  115.178 96.672  1.00 34.79  ? 222 LEU A CG  1 
ATOM   1668  C  CD1 . LEU A 1 222 ? 86.059  116.019 96.928  1.00 34.79  ? 222 LEU A CD1 1 
ATOM   1669  C  CD2 . LEU A 1 222 ? 84.903  113.895 97.469  1.00 34.79  ? 222 LEU A CD2 1 
ATOM   1670  N  N   . ILE A 1 223 ? 80.102  116.141 96.667  1.00 36.11  ? 223 ILE A N   1 
ATOM   1671  C  CA  . ILE A 1 223 ? 78.903  116.812 97.151  1.00 36.11  ? 223 ILE A CA  1 
ATOM   1672  C  C   . ILE A 1 223 ? 78.132  115.882 98.092  1.00 36.11  ? 223 ILE A C   1 
ATOM   1673  O  O   . ILE A 1 223 ? 77.701  116.370 99.143  1.00 36.11  ? 223 ILE A O   1 
ATOM   1674  C  CB  . ILE A 1 223 ? 78.043  117.329 95.981  1.00 36.11  ? 223 ILE A CB  1 
ATOM   1675  C  CG1 . ILE A 1 223 ? 78.711  118.514 95.305  1.00 36.11  ? 223 ILE A CG1 1 
ATOM   1676  C  CG2 . ILE A 1 223 ? 76.662  117.728 96.423  1.00 36.11  ? 223 ILE A CG2 1 
ATOM   1677  C  CD1 . ILE A 1 223 ? 77.968  118.981 94.078  1.00 36.11  ? 223 ILE A CD1 1 
ATOM   1678  N  N   . PRO A 1 224 ? 77.984  114.560 97.852  1.00 37.56  ? 224 PRO A N   1 
ATOM   1679  C  CA  . PRO A 1 224 ? 77.441  113.714 98.931  1.00 37.56  ? 224 PRO A CA  1 
ATOM   1680  C  C   . PRO A 1 224 ? 78.300  113.641 100.175 1.00 37.56  ? 224 PRO A C   1 
ATOM   1681  O  O   . PRO A 1 224 ? 77.756  113.484 101.269 1.00 37.56  ? 224 PRO A O   1 
ATOM   1682  C  CB  . PRO A 1 224 ? 77.303  112.355 98.256  1.00 37.56  ? 224 PRO A CB  1 
ATOM   1683  C  CG  . PRO A 1 224 ? 76.980  112.694 96.907  1.00 37.56  ? 224 PRO A CG  1 
ATOM   1684  C  CD  . PRO A 1 224 ? 77.898  113.813 96.583  1.00 37.56  ? 224 PRO A CD  1 
ATOM   1685  N  N   . MET A 1 225 ? 79.621  113.672 100.042 1.00 44.99  ? 225 MET A N   1 
ATOM   1686  C  CA  . MET A 1 225 ? 80.467  113.707 101.227 1.00 44.99  ? 225 MET A CA  1 
ATOM   1687  C  C   . MET A 1 225 ? 80.287  115.010 101.994 1.00 44.99  ? 225 MET A C   1 
ATOM   1688  O  O   . MET A 1 225 ? 80.258  115.022 103.227 1.00 44.99  ? 225 MET A O   1 
ATOM   1689  C  CB  . MET A 1 225 ? 81.930  113.504 100.856 1.00 44.99  ? 225 MET A CB  1 
ATOM   1690  C  CG  . MET A 1 225 ? 82.270  112.081 100.507 1.00 44.99  ? 225 MET A CG  1 
ATOM   1691  S  SD  . MET A 1 225 ? 82.207  111.058 101.977 1.00 44.99  ? 225 MET A SD  1 
ATOM   1692  C  CE  . MET A 1 225 ? 83.156  112.062 103.116 1.00 44.99  ? 225 MET A CE  1 
ATOM   1693  N  N   . ALA A 1 226 ? 80.177  116.125 101.276 1.00 40.96  ? 226 ALA A N   1 
ATOM   1694  C  CA  . ALA A 1 226 ? 80.017  117.413 101.943 1.00 40.96  ? 226 ALA A CA  1 
ATOM   1695  C  C   . ALA A 1 226 ? 78.619  117.597 102.523 1.00 40.96  ? 226 ALA A C   1 
ATOM   1696  O  O   . ALA A 1 226 ? 78.468  118.130 103.626 1.00 40.96  ? 226 ALA A O   1 
ATOM   1697  C  CB  . ALA A 1 226 ? 80.335  118.543 100.972 1.00 40.96  ? 226 ALA A CB  1 
ATOM   1698  N  N   . VAL A 1 227 ? 77.585  117.157 101.807 1.00 40.54  ? 227 VAL A N   1 
ATOM   1699  C  CA  . VAL A 1 227 ? 76.226  117.335 102.310 1.00 40.54  ? 227 VAL A CA  1 
ATOM   1700  C  C   . VAL A 1 227 ? 75.937  116.443 103.503 1.00 40.54  ? 227 VAL A C   1 
ATOM   1701  O  O   . VAL A 1 227 ? 75.328  116.905 104.470 1.00 40.54  ? 227 VAL A O   1 
ATOM   1702  C  CB  . VAL A 1 227 ? 75.224  117.117 101.166 1.00 40.54  ? 227 VAL A CB  1 
ATOM   1703  C  CG1 . VAL A 1 227 ? 73.807  116.925 101.664 1.00 40.54  ? 227 VAL A CG1 1 
ATOM   1704  C  CG2 . VAL A 1 227 ? 75.260  118.318 100.253 1.00 40.54  ? 227 VAL A CG2 1 
ATOM   1705  N  N   . ILE A 1 228 ? 76.391  115.202 103.495 1.00 42.01  ? 228 ILE A N   1 
ATOM   1706  C  CA  . ILE A 1 228 ? 76.251  114.372 104.680 1.00 42.01  ? 228 ILE A CA  1 
ATOM   1707  C  C   . ILE A 1 228 ? 77.192  114.842 105.779 1.00 42.01  ? 228 ILE A C   1 
ATOM   1708  O  O   . ILE A 1 228 ? 76.804  114.934 106.944 1.00 42.01  ? 228 ILE A O   1 
ATOM   1709  C  CB  . ILE A 1 228 ? 76.471  112.895 104.324 1.00 42.01  ? 228 ILE A CB  1 
ATOM   1710  C  CG1 . ILE A 1 228 ? 75.367  112.432 103.386 1.00 42.01  ? 228 ILE A CG1 1 
ATOM   1711  C  CG2 . ILE A 1 228 ? 76.450  112.030 105.558 1.00 42.01  ? 228 ILE A CG2 1 
ATOM   1712  C  CD1 . ILE A 1 228 ? 73.995  112.570 103.959 1.00 42.01  ? 228 ILE A CD1 1 
ATOM   1713  N  N   . GLY A 1 229 ? 78.418  115.207 105.431 1.00 47.86  ? 229 GLY A N   1 
ATOM   1714  C  CA  . GLY A 1 229 ? 79.395  115.571 106.430 1.00 47.86  ? 229 GLY A CA  1 
ATOM   1715  C  C   . GLY A 1 229 ? 79.286  116.968 106.995 1.00 47.86  ? 229 GLY A C   1 
ATOM   1716  O  O   . GLY A 1 229 ? 80.091  117.328 107.860 1.00 47.86  ? 229 GLY A O   1 
ATOM   1717  N  N   . LEU A 1 230 ? 78.359  117.777 106.534 1.00 53.89  ? 230 LEU A N   1 
ATOM   1718  C  CA  . LEU A 1 230 ? 78.255  119.091 107.153 1.00 53.89  ? 230 LEU A CA  1 
ATOM   1719  C  C   . LEU A 1 230 ? 77.426  119.057 108.443 1.00 53.89  ? 230 LEU A C   1 
ATOM   1720  O  O   . LEU A 1 230 ? 77.862  119.656 109.430 1.00 53.89  ? 230 LEU A O   1 
ATOM   1721  C  CB  . LEU A 1 230 ? 77.719  120.121 106.152 1.00 53.89  ? 230 LEU A CB  1 
ATOM   1722  C  CG  . LEU A 1 230 ? 77.653  121.573 106.595 1.00 53.89  ? 230 LEU A CG  1 
ATOM   1723  C  CD1 . LEU A 1 230 ? 79.003  121.988 107.104 1.00 53.89  ? 230 LEU A CD1 1 
ATOM   1724  C  CD2 . LEU A 1 230 ? 77.219  122.460 105.442 1.00 53.89  ? 230 LEU A CD2 1 
ATOM   1725  N  N   . PRO A 1 231 ? 76.260  118.389 108.527 1.00 64.12  ? 231 PRO A N   1 
ATOM   1726  C  CA  . PRO A 1 231 ? 75.646  118.212 109.849 1.00 64.12  ? 231 PRO A CA  1 
ATOM   1727  C  C   . PRO A 1 231 ? 76.216  117.071 110.663 1.00 64.12  ? 231 PRO A C   1 
ATOM   1728  O  O   . PRO A 1 231 ? 75.964  117.025 111.872 1.00 64.12  ? 231 PRO A O   1 
ATOM   1729  C  CB  . PRO A 1 231 ? 74.173  117.962 109.520 1.00 64.12  ? 231 PRO A CB  1 
ATOM   1730  C  CG  . PRO A 1 231 ? 74.214  117.285 108.274 1.00 64.12  ? 231 PRO A CG  1 
ATOM   1731  C  CD  . PRO A 1 231 ? 75.275  117.988 107.501 1.00 64.12  ? 231 PRO A CD  1 
ATOM   1732  N  N   . TYR A 1 232 ? 76.961  116.149 110.053 1.00 65.63  ? 232 TYR A N   1 
ATOM   1733  C  CA  . TYR A 1 232 ? 77.580  115.075 110.823 1.00 65.63  ? 232 TYR A CA  1 
ATOM   1734  C  C   . TYR A 1 232 ? 78.658  115.601 111.756 1.00 65.63  ? 232 TYR A C   1 
ATOM   1735  O  O   . TYR A 1 232 ? 79.005  114.947 112.743 1.00 65.63  ? 232 TYR A O   1 
ATOM   1736  C  CB  . TYR A 1 232 ? 78.141  114.017 109.896 1.00 65.63  ? 232 TYR A CB  1 
ATOM   1737  C  CG  . TYR A 1 232 ? 78.436  112.733 110.607 1.00 65.63  ? 232 TYR A CG  1 
ATOM   1738  C  CD1 . TYR A 1 232 ? 79.732  112.362 110.897 1.00 65.63  ? 232 TYR A CD1 1 
ATOM   1739  C  CD2 . TYR A 1 232 ? 77.413  111.894 110.997 1.00 65.63  ? 232 TYR A CD2 1 
ATOM   1740  C  CE1 . TYR A 1 232 ? 80.005  111.184 111.543 1.00 65.63  ? 232 TYR A CE1 1 
ATOM   1741  C  CE2 . TYR A 1 232 ? 77.674  110.714 111.647 1.00 65.63  ? 232 TYR A CE2 1 
ATOM   1742  C  CZ  . TYR A 1 232 ? 78.972  110.367 111.920 1.00 65.63  ? 232 TYR A CZ  1 
ATOM   1743  O  OH  . TYR A 1 232 ? 79.243  109.189 112.567 1.00 65.63  ? 232 TYR A OH  1 
ATOM   1744  N  N   . TYR A 1 233 ? 79.234  116.745 111.438 1.00 71.41  ? 233 TYR A N   1 
ATOM   1745  C  CA  . TYR A 1 233 ? 80.228  117.346 112.307 1.00 71.41  ? 233 TYR A CA  1 
ATOM   1746  C  C   . TYR A 1 233 ? 79.600  118.395 113.215 1.00 71.41  ? 233 TYR A C   1 
ATOM   1747  O  O   . TYR A 1 233 ? 79.988  118.519 114.379 1.00 71.41  ? 233 TYR A O   1 
ATOM   1748  C  CB  . TYR A 1 233 ? 81.344  117.964 111.475 1.00 71.41  ? 233 TYR A CB  1 
ATOM   1749  C  CG  . TYR A 1 233 ? 82.301  118.804 112.263 1.00 71.41  ? 233 TYR A CG  1 
ATOM   1750  C  CD1 . TYR A 1 233 ? 83.128  118.229 113.211 1.00 71.41  ? 233 TYR A CD1 1 
ATOM   1751  C  CD2 . TYR A 1 233 ? 82.386  120.168 112.053 1.00 71.41  ? 233 TYR A CD2 1 
ATOM   1752  C  CE1 . TYR A 1 233 ? 84.011  118.990 113.933 1.00 71.41  ? 233 TYR A CE1 1 
ATOM   1753  C  CE2 . TYR A 1 233 ? 83.264  120.939 112.771 1.00 71.41  ? 233 TYR A CE2 1 
ATOM   1754  C  CZ  . TYR A 1 233 ? 84.077  120.345 113.711 1.00 71.41  ? 233 TYR A CZ  1 
ATOM   1755  O  OH  . TYR A 1 233 ? 84.962  121.110 114.435 1.00 71.41  ? 233 TYR A OH  1 
ATOM   1756  N  N   . LEU A 1 234 ? 78.639  119.161 112.696 1.00 74.52  ? 234 LEU A N   1 
ATOM   1757  C  CA  . LEU A 1 234 ? 78.020  120.222 113.483 1.00 74.52  ? 234 LEU A CA  1 
ATOM   1758  C  C   . LEU A 1 234 ? 77.064  119.676 114.532 1.00 74.52  ? 234 LEU A C   1 
ATOM   1759  O  O   . LEU A 1 234 ? 77.138  120.072 115.698 1.00 74.52  ? 234 LEU A O   1 
ATOM   1760  C  CB  . LEU A 1 234 ? 77.298  121.214 112.581 1.00 74.52  ? 234 LEU A CB  1 
ATOM   1761  C  CG  . LEU A 1 234 ? 78.228  122.078 111.739 1.00 74.52  ? 234 LEU A CG  1 
ATOM   1762  C  CD1 . LEU A 1 234 ? 77.423  123.018 110.878 1.00 74.52  ? 234 LEU A CD1 1 
ATOM   1763  C  CD2 . LEU A 1 234 ? 79.179  122.851 112.621 1.00 74.52  ? 234 LEU A CD2 1 
ATOM   1764  N  N   . PHE A 1 235 ? 76.164  118.772 114.161 1.00 86.49  ? 235 PHE A N   1 
ATOM   1765  C  CA  . PHE A 1 235 ? 75.190  118.288 115.128 1.00 86.49  ? 235 PHE A CA  1 
ATOM   1766  C  C   . PHE A 1 235 ? 75.706  117.166 116.004 1.00 86.49  ? 235 PHE A C   1 
ATOM   1767  O  O   . PHE A 1 235 ? 74.962  116.718 116.878 1.00 86.49  ? 235 PHE A O   1 
ATOM   1768  C  CB  . PHE A 1 235 ? 73.916  117.802 114.437 1.00 86.49  ? 235 PHE A CB  1 
ATOM   1769  C  CG  . PHE A 1 235 ? 73.097  118.890 113.838 1.00 86.49  ? 235 PHE A CG  1 
ATOM   1770  C  CD1 . PHE A 1 235 ? 73.250  120.202 114.247 1.00 86.49  ? 235 PHE A CD1 1 
ATOM   1771  C  CD2 . PHE A 1 235 ? 72.130  118.591 112.897 1.00 86.49  ? 235 PHE A CD2 1 
ATOM   1772  C  CE1 . PHE A 1 235 ? 72.486  121.205 113.692 1.00 86.49  ? 235 PHE A CE1 1 
ATOM   1773  C  CE2 . PHE A 1 235 ? 71.357  119.585 112.340 1.00 86.49  ? 235 PHE A CE2 1 
ATOM   1774  C  CZ  . PHE A 1 235 ? 71.535  120.895 112.738 1.00 86.49  ? 235 PHE A CZ  1 
ATOM   1775  N  N   . VAL A 1 236 ? 76.971  116.769 115.837 1.00 86.55  ? 236 VAL A N   1 
ATOM   1776  C  CA  . VAL A 1 236 ? 77.650  115.618 116.443 1.00 86.55  ? 236 VAL A CA  1 
ATOM   1777  C  C   . VAL A 1 236 ? 76.734  114.397 116.595 1.00 86.55  ? 236 VAL A C   1 
ATOM   1778  O  O   . VAL A 1 236 ? 76.181  114.106 117.661 1.00 86.55  ? 236 VAL A O   1 
ATOM   1779  C  CB  . VAL A 1 236 ? 78.396  116.049 117.740 1.00 86.55  ? 236 VAL A CB  1 
ATOM   1780  C  CG1 . VAL A 1 236 ? 77.526  116.673 118.873 1.00 86.55  ? 236 VAL A CG1 1 
ATOM   1781  C  CG2 . VAL A 1 236 ? 79.267  114.920 118.269 1.00 86.55  ? 236 VAL A CG2 1 
ATOM   1782  N  N   . TRP A 1 237 ? 76.555  113.680 115.494 1.00 90.98  ? 237 TRP A N   1 
ATOM   1783  C  CA  . TRP A 1 237 ? 75.791  112.444 115.461 1.00 90.98  ? 237 TRP A CA  1 
ATOM   1784  C  C   . TRP A 1 237 ? 76.650  111.233 115.741 1.00 90.98  ? 237 TRP A C   1 
ATOM   1785  O  O   . TRP A 1 237 ? 76.220  110.107 115.488 1.00 90.98  ? 237 TRP A O   1 
ATOM   1786  C  CB  . TRP A 1 237 ? 75.109  112.256 114.113 1.00 90.98  ? 237 TRP A CB  1 
ATOM   1787  C  CG  . TRP A 1 237 ? 74.010  113.180 113.853 1.00 90.98  ? 237 TRP A CG  1 
ATOM   1788  C  CD1 . TRP A 1 237 ? 73.444  114.045 114.725 1.00 90.98  ? 237 TRP A CD1 1 
ATOM   1789  C  CD2 . TRP A 1 237 ? 73.313  113.326 112.624 1.00 90.98  ? 237 TRP A CD2 1 
ATOM   1790  N  NE1 . TRP A 1 237 ? 72.436  114.738 114.112 1.00 90.98  ? 237 TRP A NE1 1 
ATOM   1791  C  CE2 . TRP A 1 237 ? 72.337  114.312 112.815 1.00 90.98  ? 237 TRP A CE2 1 
ATOM   1792  C  CE3 . TRP A 1 237 ? 73.426  112.722 111.373 1.00 90.98  ? 237 TRP A CE3 1 
ATOM   1793  C  CZ2 . TRP A 1 237 ? 71.475  114.708 111.805 1.00 90.98  ? 237 TRP A CZ2 1 
ATOM   1794  C  CZ3 . TRP A 1 237 ? 72.574  113.116 110.372 1.00 90.98  ? 237 TRP A CZ3 1 
ATOM   1795  C  CH2 . TRP A 1 237 ? 71.610  114.098 110.590 1.00 90.98  ? 237 TRP A CH2 1 
ATOM   1796  N  N   . GLU A 1 238 ? 77.836  111.432 116.292 1.00 89.29  ? 238 GLU A N   1 
ATOM   1797  C  CA  . GLU A 1 238 ? 78.701  110.337 116.685 1.00 89.29  ? 238 GLU A CA  1 
ATOM   1798  C  C   . GLU A 1 238 ? 78.167  109.588 117.891 1.00 89.29  ? 238 GLU A C   1 
ATOM   1799  O  O   . GLU A 1 238 ? 78.650  108.496 118.195 1.00 89.29  ? 238 GLU A O   1 
ATOM   1800  C  CB  . GLU A 1 238 ? 80.074  110.911 116.997 1.00 89.29  ? 238 GLU A CB  1 
ATOM   1801  C  CG  . GLU A 1 238 ? 80.360  112.123 116.135 1.00 89.29  ? 238 GLU A CG  1 
ATOM   1802  C  CD  . GLU A 1 238 ? 81.648  112.805 116.485 1.00 89.29  ? 238 GLU A CD  1 
ATOM   1803  O  OE1 . GLU A 1 238 ? 82.331  112.347 117.422 1.00 89.29  ? 238 GLU A OE1 1 
ATOM   1804  O  OE2 . GLU A 1 238 ? 81.977  113.809 115.825 1.00 89.29  ? 238 GLU A OE2 1 
ATOM   1805  N  N   . ASP A 1 239 ? 77.187  110.159 118.590 1.00 101.73 ? 239 ASP A N   1 
ATOM   1806  C  CA  . ASP A 1 239 ? 76.594  109.481 119.728 1.00 101.73 ? 239 ASP A CA  1 
ATOM   1807  C  C   . ASP A 1 239 ? 75.681  108.349 119.284 1.00 101.73 ? 239 ASP A C   1 
ATOM   1808  O  O   . ASP A 1 239 ? 75.630  107.300 119.935 1.00 101.73 ? 239 ASP A O   1 
ATOM   1809  C  CB  . ASP A 1 239 ? 75.804  110.487 120.556 1.00 101.73 ? 239 ASP A CB  1 
ATOM   1810  C  CG  . ASP A 1 239 ? 76.667  111.607 121.073 1.00 101.73 ? 239 ASP A CG  1 
ATOM   1811  O  OD1 . ASP A 1 239 ? 77.871  111.372 121.297 1.00 101.73 ? 239 ASP A OD1 1 
ATOM   1812  O  OD2 . ASP A 1 239 ? 76.148  112.731 121.228 1.00 101.73 ? 239 ASP A OD2 1 
ATOM   1813  N  N   . TYR A 1 240 ? 74.959  108.541 118.181 1.00 101.67 ? 240 TYR A N   1 
ATOM   1814  C  CA  . TYR A 1 240 ? 73.874  107.629 117.853 1.00 101.67 ? 240 TYR A CA  1 
ATOM   1815  C  C   . TYR A 1 240 ? 74.357  106.415 117.070 1.00 101.67 ? 240 TYR A C   1 
ATOM   1816  O  O   . TYR A 1 240 ? 74.002  105.280 117.400 1.00 101.67 ? 240 TYR A O   1 
ATOM   1817  C  CB  . TYR A 1 240 ? 72.790  108.353 117.049 1.00 101.67 ? 240 TYR A CB  1 
ATOM   1818  C  CG  . TYR A 1 240 ? 72.240  109.607 117.690 1.00 101.67 ? 240 TYR A CG  1 
ATOM   1819  C  CD1 . TYR A 1 240 ? 72.087  109.716 119.067 1.00 101.67 ? 240 TYR A CD1 1 
ATOM   1820  C  CD2 . TYR A 1 240 ? 71.853  110.683 116.903 1.00 101.67 ? 240 TYR A CD2 1 
ATOM   1821  C  CE1 . TYR A 1 240 ? 71.587  110.877 119.639 1.00 101.67 ? 240 TYR A CE1 1 
ATOM   1822  C  CE2 . TYR A 1 240 ? 71.349  111.840 117.463 1.00 101.67 ? 240 TYR A CE2 1 
ATOM   1823  C  CZ  . TYR A 1 240 ? 71.218  111.933 118.828 1.00 101.67 ? 240 TYR A CZ  1 
ATOM   1824  O  OH  . TYR A 1 240 ? 70.716  113.093 119.369 1.00 101.67 ? 240 TYR A OH  1 
ATOM   1825  N  N   . ASP A 1 241 ? 75.149  106.636 116.020 1.00 89.03  ? 241 ASP A N   1 
ATOM   1826  C  CA  . ASP A 1 241 ? 75.647  105.539 115.201 1.00 89.03  ? 241 ASP A CA  1 
ATOM   1827  C  C   . ASP A 1 241 ? 76.970  104.981 115.690 1.00 89.03  ? 241 ASP A C   1 
ATOM   1828  O  O   . ASP A 1 241 ? 77.300  103.840 115.347 1.00 89.03  ? 241 ASP A O   1 
ATOM   1829  C  CB  . ASP A 1 241 ? 75.822  105.980 113.747 1.00 89.03  ? 241 ASP A CB  1 
ATOM   1830  C  CG  . ASP A 1 241 ? 77.077  106.793 113.538 1.00 89.03  ? 241 ASP A CG  1 
ATOM   1831  O  OD1 . ASP A 1 241 ? 77.301  107.746 114.309 1.00 89.03  ? 241 ASP A OD1 1 
ATOM   1832  O  OD2 . ASP A 1 241 ? 77.854  106.464 112.618 1.00 89.03  ? 241 ASP A OD2 1 
ATOM   1833  N  N   . LYS A 1 242 ? 77.707  105.762 116.475 1.00 84.71  ? 242 LYS A N   1 
ATOM   1834  C  CA  . LYS A 1 242 ? 79.048  105.448 116.962 1.00 84.71  ? 242 LYS A CA  1 
ATOM   1835  C  C   . LYS A 1 242 ? 80.002  105.102 115.817 1.00 84.71  ? 242 LYS A C   1 
ATOM   1836  O  O   . LYS A 1 242 ? 80.617  104.038 115.783 1.00 84.71  ? 242 LYS A O   1 
ATOM   1837  C  CB  . LYS A 1 242 ? 79.013  104.332 118.006 1.00 84.71  ? 242 LYS A CB  1 
ATOM   1838  N  N   . TYR A 1 243 ? 80.065  106.009 114.840 1.00 70.26  ? 243 TYR A N   1 
ATOM   1839  C  CA  . TYR A 1 243 ? 81.054  106.077 113.762 1.00 70.26  ? 243 TYR A CA  1 
ATOM   1840  C  C   . TYR A 1 243 ? 81.013  104.918 112.780 1.00 70.26  ? 243 TYR A C   1 
ATOM   1841  O  O   . TYR A 1 243 ? 81.928  104.811 111.973 1.00 70.26  ? 243 TYR A O   1 
ATOM   1842  C  CB  . TYR A 1 243 ? 82.491  106.177 114.281 1.00 70.26  ? 243 TYR A CB  1 
ATOM   1843  C  CG  . TYR A 1 243 ? 82.923  107.550 114.676 1.00 70.26  ? 243 TYR A CG  1 
ATOM   1844  C  CD1 . TYR A 1 243 ? 82.581  108.650 113.917 1.00 70.26  ? 243 TYR A CD1 1 
ATOM   1845  C  CD2 . TYR A 1 243 ? 83.739  107.738 115.777 1.00 70.26  ? 243 TYR A CD2 1 
ATOM   1846  C  CE1 . TYR A 1 243 ? 83.009  109.912 114.274 1.00 70.26  ? 243 TYR A CE1 1 
ATOM   1847  C  CE2 . TYR A 1 243 ? 84.171  108.986 116.136 1.00 70.26  ? 243 TYR A CE2 1 
ATOM   1848  C  CZ  . TYR A 1 243 ? 83.808  110.067 115.387 1.00 70.26  ? 243 TYR A CZ  1 
ATOM   1849  O  OH  . TYR A 1 243 ? 84.252  111.306 115.767 1.00 70.26  ? 243 TYR A OH  1 
ATOM   1850  N  N   . VAL A 1 244 ? 80.012  104.054 112.812 1.00 69.88  ? 244 VAL A N   1 
ATOM   1851  C  CA  . VAL A 1 244 ? 80.002  102.917 111.899 1.00 69.88  ? 244 VAL A CA  1 
ATOM   1852  C  C   . VAL A 1 244 ? 79.343  103.243 110.566 1.00 69.88  ? 244 VAL A C   1 
ATOM   1853  O  O   . VAL A 1 244 ? 79.865  102.862 109.518 1.00 69.88  ? 244 VAL A O   1 
ATOM   1854  C  CB  . VAL A 1 244 ? 79.326  101.718 112.587 1.00 69.88  ? 244 VAL A CB  1 
ATOM   1855  C  CG1 . VAL A 1 244 ? 79.218  100.534 111.649 1.00 69.88  ? 244 VAL A CG1 1 
ATOM   1856  C  CG2 . VAL A 1 244 ? 80.107  101.326 113.820 1.00 69.88  ? 244 VAL A CG2 1 
ATOM   1857  N  N   . ILE A 1 245 ? 78.231  103.982 110.559 1.00 64.00  ? 245 ILE A N   1 
ATOM   1858  C  CA  . ILE A 1 245 ? 77.541  104.259 109.300 1.00 64.00  ? 245 ILE A CA  1 
ATOM   1859  C  C   . ILE A 1 245 ? 78.342  105.216 108.436 1.00 64.00  ? 245 ILE A C   1 
ATOM   1860  O  O   . ILE A 1 245 ? 78.539  104.966 107.241 1.00 64.00  ? 245 ILE A O   1 
ATOM   1861  C  CB  . ILE A 1 245 ? 76.130  104.802 109.571 1.00 64.00  ? 245 ILE A CB  1 
ATOM   1862  C  CG1 . ILE A 1 245 ? 75.224  103.686 110.080 1.00 64.00  ? 245 ILE A CG1 1 
ATOM   1863  C  CG2 . ILE A 1 245 ? 75.539  105.434 108.325 1.00 64.00  ? 245 ILE A CG2 1 
ATOM   1864  C  CD1 . ILE A 1 245 ? 73.818  104.154 110.424 1.00 64.00  ? 245 ILE A CD1 1 
ATOM   1865  N  N   . PHE A 1 246 ? 78.881  106.273 109.028 1.00 55.27  ? 246 PHE A N   1 
ATOM   1866  C  CA  . PHE A 1 246 ? 79.507  107.308 108.220 1.00 55.27  ? 246 PHE A CA  1 
ATOM   1867  C  C   . PHE A 1 246 ? 80.839  106.870 107.647 1.00 55.27  ? 246 PHE A C   1 
ATOM   1868  O  O   . PHE A 1 246 ? 81.181  107.263 106.527 1.00 55.27  ? 246 PHE A O   1 
ATOM   1869  C  CB  . PHE A 1 246 ? 79.740  108.578 109.022 1.00 55.27  ? 246 PHE A CB  1 
ATOM   1870  C  CG  . PHE A 1 246 ? 80.302  109.679 108.203 1.00 55.27  ? 246 PHE A CG  1 
ATOM   1871  C  CD1 . PHE A 1 246 ? 79.631  110.117 107.078 1.00 55.27  ? 246 PHE A CD1 1 
ATOM   1872  C  CD2 . PHE A 1 246 ? 81.531  110.215 108.494 1.00 55.27  ? 246 PHE A CD2 1 
ATOM   1873  C  CE1 . PHE A 1 246 ? 80.145  111.119 106.297 1.00 55.27  ? 246 PHE A CE1 1 
ATOM   1874  C  CE2 . PHE A 1 246 ? 82.054  111.213 107.712 1.00 55.27  ? 246 PHE A CE2 1 
ATOM   1875  C  CZ  . PHE A 1 246 ? 81.358  111.668 106.612 1.00 55.27  ? 246 PHE A CZ  1 
ATOM   1876  N  N   . ALA A 1 247 ? 81.613  106.111 108.406 1.00 49.35  ? 247 ALA A N   1 
ATOM   1877  C  CA  . ALA A 1 247 ? 82.869  105.613 107.883 1.00 49.35  ? 247 ALA A CA  1 
ATOM   1878  C  C   . ALA A 1 247 ? 82.608  104.614 106.770 1.00 49.35  ? 247 ALA A C   1 
ATOM   1879  O  O   . ALA A 1 247 ? 83.294  104.632 105.747 1.00 49.35  ? 247 ALA A O   1 
ATOM   1880  C  CB  . ALA A 1 247 ? 83.681  104.950 108.984 1.00 49.35  ? 247 ALA A CB  1 
ATOM   1881  N  N   . SER A 1 248 ? 81.626  103.733 106.970 1.00 44.33  ? 248 SER A N   1 
ATOM   1882  C  CA  . SER A 1 248 ? 81.268  102.781 105.926 1.00 44.33  ? 248 SER A CA  1 
ATOM   1883  C  C   . SER A 1 248 ? 80.697  103.458 104.696 1.00 44.33  ? 248 SER A C   1 
ATOM   1884  O  O   . SER A 1 248 ? 80.957  103.029 103.569 1.00 44.33  ? 248 SER A O   1 
ATOM   1885  C  CB  . SER A 1 248 ? 80.259  101.770 106.452 1.00 44.33  ? 248 SER A CB  1 
ATOM   1886  O  OG  . SER A 1 248 ? 79.311  101.469 105.446 1.00 44.33  ? 248 SER A OG  1 
ATOM   1887  N  N   . PHE A 1 249 ? 79.900  104.503 104.889 1.00 42.41  ? 249 PHE A N   1 
ATOM   1888  C  CA  . PHE A 1 249 ? 79.359  105.219 103.742 1.00 42.41  ? 249 PHE A CA  1 
ATOM   1889  C  C   . PHE A 1 249 ? 80.433  105.941 102.955 1.00 42.41  ? 249 PHE A C   1 
ATOM   1890  O  O   . PHE A 1 249 ? 80.399  105.937 101.728 1.00 42.41  ? 249 PHE A O   1 
ATOM   1891  C  CB  . PHE A 1 249 ? 78.307  106.223 104.174 1.00 42.41  ? 249 PHE A CB  1 
ATOM   1892  C  CG  . PHE A 1 249 ? 77.891  107.147 103.084 1.00 42.41  ? 249 PHE A CG  1 
ATOM   1893  C  CD1 . PHE A 1 249 ? 77.169  106.674 102.014 1.00 42.41  ? 249 PHE A CD1 1 
ATOM   1894  C  CD2 . PHE A 1 249 ? 78.241  108.482 103.114 1.00 42.41  ? 249 PHE A CD2 1 
ATOM   1895  C  CE1 . PHE A 1 249 ? 76.783  107.517 101.002 1.00 42.41  ? 249 PHE A CE1 1 
ATOM   1896  C  CE2 . PHE A 1 249 ? 77.864  109.327 102.102 1.00 42.41  ? 249 PHE A CE2 1 
ATOM   1897  C  CZ  . PHE A 1 249 ? 77.133  108.845 101.046 1.00 42.41  ? 249 PHE A CZ  1 
ATOM   1898  N  N   . ASN A 1 250 ? 81.383  106.569 103.640 1.00 36.14  ? 250 ASN A N   1 
ATOM   1899  C  CA  . ASN A 1 250 ? 82.442  107.290 102.945 1.00 36.14  ? 250 ASN A CA  1 
ATOM   1900  C  C   . ASN A 1 250 ? 83.365  106.381 102.139 1.00 36.14  ? 250 ASN A C   1 
ATOM   1901  O  O   . ASN A 1 250 ? 83.687  106.694 100.989 1.00 36.14  ? 250 ASN A O   1 
ATOM   1902  C  CB  . ASN A 1 250 ? 83.246  108.102 103.942 1.00 36.14  ? 250 ASN A CB  1 
ATOM   1903  C  CG  . ASN A 1 250 ? 84.641  108.345 103.471 1.00 36.14  ? 250 ASN A CG  1 
ATOM   1904  O  OD1 . ASN A 1 250 ? 85.581  107.730 103.956 1.00 36.14  ? 250 ASN A OD1 1 
ATOM   1905  N  ND2 . ASN A 1 250 ? 84.790  109.221 102.491 1.00 36.14  ? 250 ASN A ND2 1 
ATOM   1906  N  N   . LEU A 1 251 ? 83.780  105.247 102.698 1.00 29.65  ? 251 LEU A N   1 
ATOM   1907  C  CA  . LEU A 1 251 ? 84.749  104.406 101.999 1.00 29.65  ? 251 LEU A CA  1 
ATOM   1908  C  C   . LEU A 1 251 ? 84.120  103.669 100.829 1.00 29.65  ? 251 LEU A C   1 
ATOM   1909  O  O   . LEU A 1 251 ? 84.761  103.505 99.789  1.00 29.65  ? 251 LEU A O   1 
ATOM   1910  C  CB  . LEU A 1 251 ? 85.429  103.458 102.967 1.00 29.65  ? 251 LEU A CB  1 
ATOM   1911  C  CG  . LEU A 1 251 ? 86.109  104.310 104.030 1.00 29.65  ? 251 LEU A CG  1 
ATOM   1912  C  CD1 . LEU A 1 251 ? 86.492  103.476 105.223 1.00 29.65  ? 251 LEU A CD1 1 
ATOM   1913  C  CD2 . LEU A 1 251 ? 87.330  104.978 103.443 1.00 29.65  ? 251 LEU A CD2 1 
ATOM   1914  N  N   . ILE A 1 252 ? 82.899  103.173 100.994 1.00 29.03  ? 252 ILE A N   1 
ATOM   1915  C  CA  . ILE A 1 252 ? 82.178  102.569 99.879  1.00 29.03  ? 252 ILE A CA  1 
ATOM   1916  C  C   . ILE A 1 252 ? 81.890  103.600 98.793  1.00 29.03  ? 252 ILE A C   1 
ATOM   1917  O  O   . ILE A 1 252 ? 81.955  103.288 97.598  1.00 29.03  ? 252 ILE A O   1 
ATOM   1918  C  CB  . ILE A 1 252 ? 80.911  101.875 100.397 1.00 29.03  ? 252 ILE A CB  1 
ATOM   1919  C  CG1 . ILE A 1 252 ? 81.322  100.708 101.283 1.00 29.03  ? 252 ILE A CG1 1 
ATOM   1920  C  CG2 . ILE A 1 252 ? 80.013  101.403 99.273  1.00 29.03  ? 252 ILE A CG2 1 
ATOM   1921  C  CD1 . ILE A 1 252 ? 80.163  99.931  101.824 1.00 29.03  ? 252 ILE A CD1 1 
ATOM   1922  N  N   . TRP A 1 253 ? 81.655  104.851 99.175  1.00 30.04  ? 253 TRP A N   1 
ATOM   1923  C  CA  . TRP A 1 253 ? 81.381  105.884 98.184  1.00 30.04  ? 253 TRP A CA  1 
ATOM   1924  C  C   . TRP A 1 253 ? 82.598  106.241 97.345  1.00 30.04  ? 253 TRP A C   1 
ATOM   1925  O  O   . TRP A 1 253 ? 82.439  106.576 96.168  1.00 30.04  ? 253 TRP A O   1 
ATOM   1926  C  CB  . TRP A 1 253 ? 80.878  107.148 98.842  1.00 30.04  ? 253 TRP A CB  1 
ATOM   1927  C  CG  . TRP A 1 253 ? 80.507  108.174 97.890  1.00 30.04  ? 253 TRP A CG  1 
ATOM   1928  C  CD1 . TRP A 1 253 ? 81.104  109.369 97.730  1.00 30.04  ? 253 TRP A CD1 1 
ATOM   1929  C  CD2 . TRP A 1 253 ? 79.405  108.145 96.987  1.00 30.04  ? 253 TRP A CD2 1 
ATOM   1930  N  NE1 . TRP A 1 253 ? 80.471  110.086 96.756  1.00 30.04  ? 253 TRP A NE1 1 
ATOM   1931  C  CE2 . TRP A 1 253 ? 79.415  109.355 96.287  1.00 30.04  ? 253 TRP A CE2 1 
ATOM   1932  C  CE3 . TRP A 1 253 ? 78.414  107.212 96.697  1.00 30.04  ? 253 TRP A CE3 1 
ATOM   1933  C  CZ2 . TRP A 1 253 ? 78.480  109.659 95.311  1.00 30.04  ? 253 TRP A CZ2 1 
ATOM   1934  C  CZ3 . TRP A 1 253 ? 77.488  107.514 95.729  1.00 30.04  ? 253 TRP A CZ3 1 
ATOM   1935  C  CH2 . TRP A 1 253 ? 77.525  108.726 95.047  1.00 30.04  ? 253 TRP A CH2 1 
ATOM   1936  N  N   . SER A 1 254 ? 83.804  106.187 97.905  1.00 23.18  ? 254 SER A N   1 
ATOM   1937  C  CA  . SER A 1 254 ? 84.982  106.481 97.093  1.00 23.18  ? 254 SER A CA  1 
ATOM   1938  C  C   . SER A 1 254 ? 85.206  105.415 96.029  1.00 23.18  ? 254 SER A C   1 
ATOM   1939  O  O   . SER A 1 254 ? 85.668  105.727 94.930  1.00 23.18  ? 254 SER A O   1 
ATOM   1940  C  CB  . SER A 1 254 ? 86.224  106.613 97.957  1.00 23.18  ? 254 SER A CB  1 
ATOM   1941  O  OG  . SER A 1 254 ? 86.565  105.367 98.506  1.00 23.18  ? 254 SER A OG  1 
ATOM   1942  N  N   . THR A 1 255 ? 84.939  104.153 96.344  1.00 22.65  ? 255 THR A N   1 
ATOM   1943  C  CA  . THR A 1 255 ? 85.050  103.111 95.330  1.00 22.65  ? 255 THR A CA  1 
ATOM   1944  C  C   . THR A 1 255 ? 83.995  103.245 94.246  1.00 22.65  ? 255 THR A C   1 
ATOM   1945  O  O   . THR A 1 255 ? 84.272  102.960 93.078  1.00 22.65  ? 255 THR A O   1 
ATOM   1946  C  CB  . THR A 1 255 ? 84.956  101.746 95.968  1.00 22.65  ? 255 THR A CB  1 
ATOM   1947  O  OG1 . THR A 1 255 ? 85.703  101.769 97.178  1.00 22.65  ? 255 THR A OG1 1 
ATOM   1948  C  CG2 . THR A 1 255 ? 85.580  100.733 95.064  1.00 22.65  ? 255 THR A CG2 1 
ATOM   1949  N  N   . VAL A 1 256 ? 82.779  103.642 94.606  1.00 20.57  ? 256 VAL A N   1 
ATOM   1950  C  CA  . VAL A 1 256 ? 81.722  103.773 93.608  1.00 20.57  ? 256 VAL A CA  1 
ATOM   1951  C  C   . VAL A 1 256 ? 82.026  104.897 92.626  1.00 20.57  ? 256 VAL A C   1 
ATOM   1952  O  O   . VAL A 1 256 ? 81.823  104.739 91.416  1.00 20.57  ? 256 VAL A O   1 
ATOM   1953  C  CB  . VAL A 1 256 ? 80.367  103.947 94.304  1.00 20.57  ? 256 VAL A CB  1 
ATOM   1954  C  CG1 . VAL A 1 256 ? 79.348  104.584 93.396  1.00 20.57  ? 256 VAL A CG1 1 
ATOM   1955  C  CG2 . VAL A 1 256 ? 79.874  102.600 94.728  1.00 20.57  ? 256 VAL A CG2 1 
ATOM   1956  N  N   . ILE A 1 257 ? 82.570  106.016 93.099  1.00 21.44  ? 257 ILE A N   1 
ATOM   1957  C  CA  . ILE A 1 257 ? 82.878  107.070 92.141  1.00 21.44  ? 257 ILE A CA  1 
ATOM   1958  C  C   . ILE A 1 257 ? 84.103  106.710 91.315  1.00 21.44  ? 257 ILE A C   1 
ATOM   1959  O  O   . ILE A 1 257 ? 84.206  107.125 90.160  1.00 21.44  ? 257 ILE A O   1 
ATOM   1960  C  CB  . ILE A 1 257 ? 83.036  108.428 92.824  1.00 21.44  ? 257 ILE A CB  1 
ATOM   1961  C  CG1 . ILE A 1 257 ? 84.207  108.425 93.785  1.00 21.44  ? 257 ILE A CG1 1 
ATOM   1962  C  CG2 . ILE A 1 257 ? 81.790  108.720 93.573  1.00 21.44  ? 257 ILE A CG2 1 
ATOM   1963  C  CD1 . ILE A 1 257 ? 84.597  109.770 94.271  1.00 21.44  ? 257 ILE A CD1 1 
ATOM   1964  N  N   . LEU A 1 258 ? 85.047  105.948 91.860  1.00 19.84  ? 258 LEU A N   1 
ATOM   1965  C  CA  . LEU A 1 258 ? 86.172  105.537 91.041  1.00 19.84  ? 258 LEU A CA  1 
ATOM   1966  C  C   . LEU A 1 258 ? 85.829  104.407 90.089  1.00 19.84  ? 258 LEU A C   1 
ATOM   1967  O  O   . LEU A 1 258 ? 86.625  104.119 89.198  1.00 19.84  ? 258 LEU A O   1 
ATOM   1968  C  CB  . LEU A 1 258 ? 87.350  105.137 91.899  1.00 19.84  ? 258 LEU A CB  1 
ATOM   1969  C  CG  . LEU A 1 258 ? 88.025  106.387 92.417  1.00 19.84  ? 258 LEU A CG  1 
ATOM   1970  C  CD1 . LEU A 1 258 ? 89.159  105.990 93.309  1.00 19.84  ? 258 LEU A CD1 1 
ATOM   1971  C  CD2 . LEU A 1 258 ? 88.503  107.224 91.267  1.00 19.84  ? 258 LEU A CD2 1 
ATOM   1972  N  N   . GLU A 1 259 ? 84.704  103.729 90.269  1.00 24.91  ? 259 GLU A N   1 
ATOM   1973  C  CA  . GLU A 1 259 ? 84.293  102.822 89.214  1.00 24.91  ? 259 GLU A CA  1 
ATOM   1974  C  C   . GLU A 1 259 ? 83.386  103.496 88.212  1.00 24.91  ? 259 GLU A C   1 
ATOM   1975  O  O   . GLU A 1 259 ? 83.522  103.259 87.011  1.00 24.91  ? 259 GLU A O   1 
ATOM   1976  C  CB  . GLU A 1 259 ? 83.600  101.597 89.784  1.00 24.91  ? 259 GLU A CB  1 
ATOM   1977  C  CG  . GLU A 1 259 ? 84.553  100.465 90.036  1.00 24.91  ? 259 GLU A CG  1 
ATOM   1978  C  CD  . GLU A 1 259 ? 84.905  99.715  88.757  1.00 24.91  ? 259 GLU A CD  1 
ATOM   1979  O  OE1 . GLU A 1 259 ? 84.155  99.839  87.771  1.00 24.91  ? 259 GLU A OE1 1 
ATOM   1980  O  OE2 . GLU A 1 259 ? 85.924  98.991  88.730  1.00 24.91  ? 259 GLU A OE2 1 
ATOM   1981  N  N   . LEU A 1 260 ? 82.488  104.363 88.666  1.00 23.04  ? 260 LEU A N   1 
ATOM   1982  C  CA  . LEU A 1 260 ? 81.654  105.082 87.719  1.00 23.04  ? 260 LEU A CA  1 
ATOM   1983  C  C   . LEU A 1 260 ? 82.432  106.107 86.926  1.00 23.04  ? 260 LEU A C   1 
ATOM   1984  O  O   . LEU A 1 260 ? 81.950  106.543 85.880  1.00 23.04  ? 260 LEU A O   1 
ATOM   1985  C  CB  . LEU A 1 260 ? 80.496  105.782 88.404  1.00 23.04  ? 260 LEU A CB  1 
ATOM   1986  C  CG  . LEU A 1 260 ? 79.436  104.972 89.106  1.00 23.04  ? 260 LEU A CG  1 
ATOM   1987  C  CD1 . LEU A 1 260 ? 78.304  105.895 89.446  1.00 23.04  ? 260 LEU A CD1 1 
ATOM   1988  C  CD2 . LEU A 1 260 ? 78.969  103.903 88.176  1.00 23.04  ? 260 LEU A CD2 1 
ATOM   1989  N  N   . TRP A 1 261 ? 83.596  106.535 87.403  1.00 23.91  ? 261 TRP A N   1 
ATOM   1990  C  CA  . TRP A 1 261 ? 84.437  107.332 86.528  1.00 23.91  ? 261 TRP A CA  1 
ATOM   1991  C  C   . TRP A 1 261 ? 84.976  106.510 85.368  1.00 23.91  ? 261 TRP A C   1 
ATOM   1992  O  O   . TRP A 1 261 ? 85.017  107.002 84.236  1.00 23.91  ? 261 TRP A O   1 
ATOM   1993  C  CB  . TRP A 1 261 ? 85.595  107.959 87.286  1.00 23.91  ? 261 TRP A CB  1 
ATOM   1994  C  CG  . TRP A 1 261 ? 86.620  108.405 86.348  1.00 23.91  ? 261 TRP A CG  1 
ATOM   1995  C  CD1 . TRP A 1 261 ? 87.841  107.873 86.170  1.00 23.91  ? 261 TRP A CD1 1 
ATOM   1996  C  CD2 . TRP A 1 261 ? 86.503  109.472 85.417  1.00 23.91  ? 261 TRP A CD2 1 
ATOM   1997  N  NE1 . TRP A 1 261 ? 88.505  108.539 85.182  1.00 23.91  ? 261 TRP A NE1 1 
ATOM   1998  C  CE2 . TRP A 1 261 ? 87.697  109.531 84.706  1.00 23.91  ? 261 TRP A CE2 1 
ATOM   1999  C  CE3 . TRP A 1 261 ? 85.501  110.391 85.121  1.00 23.91  ? 261 TRP A CE3 1 
ATOM   2000  C  CZ2 . TRP A 1 261 ? 87.921  110.463 83.721  1.00 23.91  ? 261 TRP A CZ2 1 
ATOM   2001  C  CZ3 . TRP A 1 261 ? 85.725  111.314 84.144  1.00 23.91  ? 261 TRP A CZ3 1 
ATOM   2002  C  CH2 . TRP A 1 261 ? 86.921  111.346 83.455  1.00 23.91  ? 261 TRP A CH2 1 
ATOM   2003  N  N   . LYS A 1 262 ? 85.364  105.254 85.613  1.00 23.28  ? 262 LYS A N   1 
ATOM   2004  C  CA  . LYS A 1 262 ? 85.840  104.417 84.512  1.00 23.28  ? 262 LYS A CA  1 
ATOM   2005  C  C   . LYS A 1 262 ? 84.748  104.138 83.502  1.00 23.28  ? 262 LYS A C   1 
ATOM   2006  O  O   . LYS A 1 262 ? 85.023  104.071 82.301  1.00 23.28  ? 262 LYS A O   1 
ATOM   2007  C  CB  . LYS A 1 262 ? 86.423  103.101 85.007  1.00 23.28  ? 262 LYS A CB  1 
ATOM   2008  C  CG  . LYS A 1 262 ? 87.813  103.227 85.546  1.00 23.28  ? 262 LYS A CG  1 
ATOM   2009  C  CD  . LYS A 1 262 ? 88.474  101.877 85.619  1.00 23.28  ? 262 LYS A CD  1 
ATOM   2010  C  CE  . LYS A 1 262 ? 87.768  100.955 86.581  1.00 23.28  ? 262 LYS A CE  1 
ATOM   2011  N  NZ  . LYS A 1 262 ? 88.436  99.629  86.620  1.00 23.28  ? 262 LYS A NZ  1 
ATOM   2012  N  N   . ARG A 1 263 ? 83.521  103.973 83.963  1.00 28.82  ? 263 ARG A N   1 
ATOM   2013  C  CA  . ARG A 1 263 ? 82.422  103.822 83.032  1.00 28.82  ? 263 ARG A CA  1 
ATOM   2014  C  C   . ARG A 1 263 ? 82.196  105.110 82.260  1.00 28.82  ? 263 ARG A C   1 
ATOM   2015  O  O   . ARG A 1 263 ? 82.053  105.085 81.035  1.00 28.82  ? 263 ARG A O   1 
ATOM   2016  C  CB  . ARG A 1 263 ? 81.171  103.406 83.789  1.00 28.82  ? 263 ARG A CB  1 
ATOM   2017  C  CG  . ARG A 1 263 ? 81.243  101.992 84.302  1.00 28.82  ? 263 ARG A CG  1 
ATOM   2018  C  CD  . ARG A 1 263 ? 80.103  101.703 85.228  1.00 28.82  ? 263 ARG A CD  1 
ATOM   2019  N  NE  . ARG A 1 263 ? 78.849  101.678 84.509  1.00 28.82  ? 263 ARG A NE  1 
ATOM   2020  C  CZ  . ARG A 1 263 ? 78.326  100.566 84.027  1.00 28.82  ? 263 ARG A CZ  1 
ATOM   2021  N  NH1 . ARG A 1 263 ? 78.967  99.425  84.201  1.00 28.82  ? 263 ARG A NH1 1 
ATOM   2022  N  NH2 . ARG A 1 263 ? 77.177  100.589 83.375  1.00 28.82  ? 263 ARG A NH2 1 
ATOM   2023  N  N   . GLY A 1 264 ? 82.201  106.246 82.953  1.00 28.23  ? 264 GLY A N   1 
ATOM   2024  C  CA  . GLY A 1 264 ? 82.017  107.516 82.277  1.00 28.23  ? 264 GLY A CA  1 
ATOM   2025  C  C   . GLY A 1 264 ? 83.155  107.903 81.356  1.00 28.23  ? 264 GLY A C   1 
ATOM   2026  O  O   . GLY A 1 264 ? 82.935  108.578 80.349  1.00 28.23  ? 264 GLY A O   1 
ATOM   2027  N  N   . CYS A 1 265 ? 84.380  107.494 81.679  1.00 30.68  ? 265 CYS A N   1 
ATOM   2028  C  CA  . CYS A 1 265 ? 85.499  107.802 80.796  1.00 30.68  ? 265 CYS A CA  1 
ATOM   2029  C  C   . CYS A 1 265 ? 85.487  106.968 79.524  1.00 30.68  ? 265 CYS A C   1 
ATOM   2030  O  O   . CYS A 1 265 ? 85.809  107.483 78.450  1.00 30.68  ? 265 CYS A O   1 
ATOM   2031  C  CB  . CYS A 1 265 ? 86.815  107.600 81.540  1.00 30.68  ? 265 CYS A CB  1 
ATOM   2032  S  SG  . CYS A 1 265 ? 88.272  107.474 80.501  1.00 30.68  ? 265 CYS A SG  1 
ATOM   2033  N  N   . ALA A 1 266 ? 85.103  105.695 79.615  1.00 32.26  ? 266 ALA A N   1 
ATOM   2034  C  CA  . ALA A 1 266 ? 84.930  104.889 78.410  1.00 32.26  ? 266 ALA A CA  1 
ATOM   2035  C  C   . ALA A 1 266 ? 83.817  105.422 77.528  1.00 32.26  ? 266 ALA A C   1 
ATOM   2036  O  O   . ALA A 1 266 ? 83.951  105.447 76.303  1.00 32.26  ? 266 ALA A O   1 
ATOM   2037  C  CB  . ALA A 1 266 ? 84.655  103.436 78.775  1.00 32.26  ? 266 ALA A CB  1 
ATOM   2038  N  N   . ASN A 1 267 ? 82.729  105.882 78.139  1.00 32.43  ? 267 ASN A N   1 
ATOM   2039  C  CA  . ASN A 1 267 ? 81.619  106.440 77.382  1.00 32.43  ? 267 ASN A CA  1 
ATOM   2040  C  C   . ASN A 1 267 ? 82.021  107.725 76.678  1.00 32.43  ? 267 ASN A C   1 
ATOM   2041  O  O   . ASN A 1 267 ? 81.657  107.944 75.520  1.00 32.43  ? 267 ASN A O   1 
ATOM   2042  C  CB  . ASN A 1 267 ? 80.433  106.666 78.304  1.00 32.43  ? 267 ASN A CB  1 
ATOM   2043  C  CG  . ASN A 1 267 ? 79.250  107.206 77.583  1.00 32.43  ? 267 ASN A CG  1 
ATOM   2044  O  OD1 . ASN A 1 267 ? 79.031  106.901 76.418  1.00 32.43  ? 267 ASN A OD1 1 
ATOM   2045  N  ND2 . ASN A 1 267 ? 78.464  108.014 78.269  1.00 32.43  ? 267 ASN A ND2 1 
ATOM   2046  N  N   . MET A 1 268 ? 82.736  108.600 77.372  1.00 35.27  ? 268 MET A N   1 
ATOM   2047  C  CA  . MET A 1 268 ? 83.171  109.850 76.761  1.00 35.27  ? 268 MET A CA  1 
ATOM   2048  C  C   . MET A 1 268 ? 84.191  109.595 75.658  1.00 35.27  ? 268 MET A C   1 
ATOM   2049  O  O   . MET A 1 268 ? 84.082  110.144 74.558  1.00 35.27  ? 268 MET A O   1 
ATOM   2050  C  CB  . MET A 1 268 ? 83.716  110.783 77.832  1.00 35.27  ? 268 MET A CB  1 
ATOM   2051  C  CG  . MET A 1 268 ? 82.628  111.603 78.478  1.00 35.27  ? 268 MET A CG  1 
ATOM   2052  S  SD  . MET A 1 268 ? 83.225  113.052 79.361  1.00 35.27  ? 268 MET A SD  1 
ATOM   2053  C  CE  . MET A 1 268 ? 84.280  112.279 80.576  1.00 35.27  ? 268 MET A CE  1 
ATOM   2054  N  N   . THR A 1 269 ? 85.186  108.761 75.926  1.00 35.93  ? 269 THR A N   1 
ATOM   2055  C  CA  . THR A 1 269 ? 86.234  108.487 74.952  1.00 35.93  ? 269 THR A CA  1 
ATOM   2056  C  C   . THR A 1 269 ? 85.794  107.575 73.818  1.00 35.93  ? 269 THR A C   1 
ATOM   2057  O  O   . THR A 1 269 ? 86.530  107.444 72.837  1.00 35.93  ? 269 THR A O   1 
ATOM   2058  C  CB  . THR A 1 269 ? 87.439  107.868 75.632  1.00 35.93  ? 269 THR A CB  1 
ATOM   2059  O  OG1 . THR A 1 269 ? 86.987  106.831 76.506  1.00 35.93  ? 269 THR A OG1 1 
ATOM   2060  C  CG2 . THR A 1 269 ? 88.177  108.909 76.420  1.00 35.93  ? 269 THR A CG2 1 
ATOM   2061  N  N   . TYR A 1 270 ? 84.629  106.950 73.910  1.00 40.61  ? 270 TYR A N   1 
ATOM   2062  C  CA  . TYR A 1 270 ? 84.048  106.377 72.706  1.00 40.61  ? 270 TYR A CA  1 
ATOM   2063  C  C   . TYR A 1 270 ? 83.368  107.431 71.866  1.00 40.61  ? 270 TYR A C   1 
ATOM   2064  O  O   . TYR A 1 270 ? 83.366  107.340 70.638  1.00 40.61  ? 270 TYR A O   1 
ATOM   2065  C  CB  . TYR A 1 270 ? 83.061  105.281 73.060  1.00 40.61  ? 270 TYR A CB  1 
ATOM   2066  C  CG  . TYR A 1 270 ? 82.400  104.675 71.865  1.00 40.61  ? 270 TYR A CG  1 
ATOM   2067  C  CD1 . TYR A 1 270 ? 83.066  103.756 71.085  1.00 40.61  ? 270 TYR A CD1 1 
ATOM   2068  C  CD2 . TYR A 1 270 ? 81.096  104.996 71.540  1.00 40.61  ? 270 TYR A CD2 1 
ATOM   2069  C  CE1 . TYR A 1 270 ? 82.463  103.188 69.997  1.00 40.61  ? 270 TYR A CE1 1 
ATOM   2070  C  CE2 . TYR A 1 270 ? 80.481  104.437 70.456  1.00 40.61  ? 270 TYR A CE2 1 
ATOM   2071  C  CZ  . TYR A 1 270 ? 81.167  103.530 69.688  1.00 40.61  ? 270 TYR A CZ  1 
ATOM   2072  O  OH  . TYR A 1 270 ? 80.553  102.964 68.600  1.00 40.61  ? 270 TYR A OH  1 
ATOM   2073  N  N   . ARG A 1 271 ? 82.779  108.427 72.505  1.00 35.07  ? 271 ARG A N   1 
ATOM   2074  C  CA  . ARG A 1 271 ? 82.095  109.484 71.782  1.00 35.07  ? 271 ARG A CA  1 
ATOM   2075  C  C   . ARG A 1 271 ? 83.059  110.342 70.983  1.00 35.07  ? 271 ARG A C   1 
ATOM   2076  O  O   . ARG A 1 271 ? 82.633  111.026 70.051  1.00 35.07  ? 271 ARG A O   1 
ATOM   2077  C  CB  . ARG A 1 271 ? 81.290  110.324 72.755  1.00 35.07  ? 271 ARG A CB  1 
ATOM   2078  C  CG  . ARG A 1 271 ? 80.030  110.894 72.203  1.00 35.07  ? 271 ARG A CG  1 
ATOM   2079  C  CD  . ARG A 1 271 ? 79.245  111.435 73.359  1.00 35.07  ? 271 ARG A CD  1 
ATOM   2080  N  NE  . ARG A 1 271 ? 79.788  112.701 73.822  1.00 35.07  ? 271 ARG A NE  1 
ATOM   2081  C  CZ  . ARG A 1 271 ? 80.168  112.921 75.075  1.00 35.07  ? 271 ARG A CZ  1 
ATOM   2082  N  NH1 . ARG A 1 271 ? 80.061  111.960 75.979  1.00 35.07  ? 271 ARG A NH1 1 
ATOM   2083  N  NH2 . ARG A 1 271 ? 80.654  114.096 75.429  1.00 35.07  ? 271 ARG A NH2 1 
ATOM   2084  N  N   . TRP A 1 272 ? 84.340  110.331 71.331  1.00 34.42  ? 272 TRP A N   1 
ATOM   2085  C  CA  . TRP A 1 272 ? 85.332  111.068 70.575  1.00 34.42  ? 272 TRP A CA  1 
ATOM   2086  C  C   . TRP A 1 272 ? 86.093  110.186 69.610  1.00 34.42  ? 272 TRP A C   1 
ATOM   2087  O  O   . TRP A 1 272 ? 86.610  110.695 68.614  1.00 34.42  ? 272 TRP A O   1 
ATOM   2088  C  CB  . TRP A 1 272 ? 86.332  111.726 71.516  1.00 34.42  ? 272 TRP A CB  1 
ATOM   2089  C  CG  . TRP A 1 272 ? 85.709  112.627 72.487  1.00 34.42  ? 272 TRP A CG  1 
ATOM   2090  C  CD1 . TRP A 1 272 ? 84.576  113.346 72.324  1.00 34.42  ? 272 TRP A CD1 1 
ATOM   2091  C  CD2 . TRP A 1 272 ? 86.142  112.850 73.819  1.00 34.42  ? 272 TRP A CD2 1 
ATOM   2092  N  NE1 . TRP A 1 272 ? 84.303  114.056 73.459  1.00 34.42  ? 272 TRP A NE1 1 
ATOM   2093  C  CE2 . TRP A 1 272 ? 85.248  113.753 74.399  1.00 34.42  ? 272 TRP A CE2 1 
ATOM   2094  C  CE3 . TRP A 1 272 ? 87.207  112.377 74.576  1.00 34.42  ? 272 TRP A CE3 1 
ATOM   2095  C  CZ2 . TRP A 1 272 ? 85.383  114.194 75.696  1.00 34.42  ? 272 TRP A CZ2 1 
ATOM   2096  C  CZ3 . TRP A 1 272 ? 87.341  112.815 75.858  1.00 34.42  ? 272 TRP A CZ3 1 
ATOM   2097  C  CH2 . TRP A 1 272 ? 86.436  113.716 76.410  1.00 34.42  ? 272 TRP A CH2 1 
ATOM   2098  N  N   . GLY A 1 273 ? 86.185  108.888 69.881  1.00 42.41  ? 273 GLY A N   1 
ATOM   2099  C  CA  . GLY A 1 273 ? 86.836  107.954 68.989  1.00 42.41  ? 273 GLY A CA  1 
ATOM   2100  C  C   . GLY A 1 273 ? 88.157  107.391 69.461  1.00 42.41  ? 273 GLY A C   1 
ATOM   2101  O  O   . GLY A 1 273 ? 88.653  106.437 68.853  1.00 42.41  ? 273 GLY A O   1 
ATOM   2102  N  N   . THR A 1 274 ? 88.729  107.922 70.528  1.00 43.00  ? 274 THR A N   1 
ATOM   2103  C  CA  . THR A 1 274 ? 90.048  107.489 70.959  1.00 43.00  ? 274 THR A CA  1 
ATOM   2104  C  C   . THR A 1 274 ? 90.052  106.189 71.745  1.00 43.00  ? 274 THR A C   1 
ATOM   2105  O  O   . THR A 1 274 ? 91.128  105.721 72.121  1.00 43.00  ? 274 THR A O   1 
ATOM   2106  C  CB  . THR A 1 274 ? 90.681  108.573 71.800  1.00 43.00  ? 274 THR A CB  1 
ATOM   2107  O  OG1 . THR A 1 274 ? 89.943  108.693 73.017  1.00 43.00  ? 274 THR A OG1 1 
ATOM   2108  C  CG2 . THR A 1 274 ? 90.617  109.878 71.053  1.00 43.00  ? 274 THR A CG2 1 
ATOM   2109  N  N   . LEU A 1 275 ? 88.899  105.584 71.989  1.00 43.10  ? 275 LEU A N   1 
ATOM   2110  C  CA  . LEU A 1 275 ? 88.876  104.219 72.491  1.00 43.10  ? 275 LEU A CA  1 
ATOM   2111  C  C   . LEU A 1 275 ? 89.247  103.204 71.416  1.00 43.10  ? 275 LEU A C   1 
ATOM   2112  O  O   . LEU A 1 275 ? 89.720  102.110 71.741  1.00 43.10  ? 275 LEU A O   1 
ATOM   2113  C  CB  . LEU A 1 275 ? 87.501  103.919 73.082  1.00 43.10  ? 275 LEU A CB  1 
ATOM   2114  C  CG  . LEU A 1 275 ? 87.367  102.637 73.888  1.00 43.10  ? 275 LEU A CG  1 
ATOM   2115  C  CD1 . LEU A 1 275 ? 88.268  102.694 75.089  1.00 43.10  ? 275 LEU A CD1 1 
ATOM   2116  C  CD2 . LEU A 1 275 ? 85.945  102.459 74.313  1.00 43.10  ? 275 LEU A CD2 1 
ATOM   2117  N  N   . LEU A 1 276 ? 89.131  103.570 70.143  1.00 54.45  ? 276 LEU A N   1 
ATOM   2118  C  CA  . LEU A 1 276 ? 89.338  102.644 69.042  1.00 54.45  ? 276 LEU A CA  1 
ATOM   2119  C  C   . LEU A 1 276 ? 90.623  102.879 68.277  1.00 54.45  ? 276 LEU A C   1 
ATOM   2120  O  O   . LEU A 1 276 ? 90.949  102.078 67.395  1.00 54.45  ? 276 LEU A O   1 
ATOM   2121  C  CB  . LEU A 1 276 ? 88.179  102.728 68.048  1.00 54.45  ? 276 LEU A CB  1 
ATOM   2122  C  CG  . LEU A 1 276 ? 86.836  102.433 68.668  1.00 54.45  ? 276 LEU A CG  1 
ATOM   2123  C  CD1 . LEU A 1 276 ? 85.736  103.123 67.900  1.00 54.45  ? 276 LEU A CD1 1 
ATOM   2124  C  CD2 . LEU A 1 276 ? 86.684  100.953 68.659  1.00 54.45  ? 276 LEU A CD2 1 
ATOM   2125  N  N   . MET A 1 277 ? 91.339  103.955 68.561  1.00 67.60  ? 277 MET A N   1 
ATOM   2126  C  CA  . MET A 1 277 ? 92.625  104.169 67.927  1.00 67.60  ? 277 MET A CA  1 
ATOM   2127  C  C   . MET A 1 277 ? 93.598  103.128 68.444  1.00 67.60  ? 277 MET A C   1 
ATOM   2128  O  O   . MET A 1 277 ? 93.654  102.864 69.649  1.00 67.60  ? 277 MET A O   1 
ATOM   2129  C  CB  . MET A 1 277 ? 93.160  105.563 68.248  1.00 67.60  ? 277 MET A CB  1 
ATOM   2130  C  CG  . MET A 1 277 ? 92.670  106.681 67.368  1.00 67.60  ? 277 MET A CG  1 
ATOM   2131  S  SD  . MET A 1 277 ? 93.577  108.188 67.736  1.00 67.60  ? 277 MET A SD  1 
ATOM   2132  C  CE  . MET A 1 277 ? 95.255  107.569 67.705  1.00 67.60  ? 277 MET A CE  1 
ATOM   2133  N  N   . LYS A 1 278 ? 94.327  102.505 67.525  1.00 82.30  ? 278 LYS A N   1 
ATOM   2134  C  CA  . LYS A 1 278 ? 95.243  101.446 67.897  1.00 82.30  ? 278 LYS A CA  1 
ATOM   2135  C  C   . LYS A 1 278 ? 96.417  102.067 68.636  1.00 82.30  ? 278 LYS A C   1 
ATOM   2136  O  O   . LYS A 1 278 ? 96.696  103.261 68.509  1.00 82.30  ? 278 LYS A O   1 
ATOM   2137  C  CB  . LYS A 1 278 ? 95.723  100.681 66.666  1.00 82.30  ? 278 LYS A CB  1 
ATOM   2138  N  N   . ARG A 1 279 ? 97.106  101.255 69.420  1.00 96.15  ? 279 ARG A N   1 
ATOM   2139  C  CA  . ARG A 1 279 ? 98.254  101.779 70.139  1.00 96.15  ? 279 ARG A CA  1 
ATOM   2140  C  C   . ARG A 1 279 ? 99.377  102.029 69.149  1.00 96.15  ? 279 ARG A C   1 
ATOM   2141  O  O   . ARG A 1 279 ? 99.916  101.088 68.559  1.00 96.15  ? 279 ARG A O   1 
ATOM   2142  C  CB  . ARG A 1 279 ? 98.691  100.798 71.223  1.00 96.15  ? 279 ARG A CB  1 
ATOM   2143  N  N   . LYS A 1 280 ? 99.694  103.304 68.936  1.00 93.61  ? 280 LYS A N   1 
ATOM   2144  C  CA  . LYS A 1 280 ? 100.804 103.647 68.067  1.00 93.61  ? 280 LYS A CA  1 
ATOM   2145  C  C   . LYS A 1 280 ? 102.103 103.269 68.753  1.00 93.61  ? 280 LYS A C   1 
ATOM   2146  O  O   . LYS A 1 280 ? 102.252 103.439 69.966  1.00 93.61  ? 280 LYS A O   1 
ATOM   2147  C  CB  . LYS A 1 280 ? 100.790 105.137 67.747  1.00 93.61  ? 280 LYS A CB  1 
ATOM   2148  N  N   . PHE A 1 281 ? 103.042 102.749 67.973  1.00 83.97  ? 281 PHE A N   1 
ATOM   2149  C  CA  . PHE A 1 281 ? 104.325 102.359 68.531  1.00 83.97  ? 281 PHE A CA  1 
ATOM   2150  C  C   . PHE A 1 281 ? 105.135 103.599 68.877  1.00 83.97  ? 281 PHE A C   1 
ATOM   2151  O  O   . PHE A 1 281 ? 105.261 104.516 68.060  1.00 83.97  ? 281 PHE A O   1 
ATOM   2152  C  CB  . PHE A 1 281 ? 105.098 101.465 67.570  1.00 83.97  ? 281 PHE A CB  1 
ATOM   2153  C  CG  . PHE A 1 281 ? 106.365 100.939 68.159  1.00 83.97  ? 281 PHE A CG  1 
ATOM   2154  C  CD1 . PHE A 1 281 ? 107.582 101.577 67.950  1.00 83.97  ? 281 PHE A CD1 1 
ATOM   2155  C  CD2 . PHE A 1 281 ? 106.328 99.815  68.963  1.00 83.97  ? 281 PHE A CD2 1 
ATOM   2156  C  CE1 . PHE A 1 281 ? 108.734 101.096 68.526  1.00 83.97  ? 281 PHE A CE1 1 
ATOM   2157  C  CE2 . PHE A 1 281 ? 107.479 99.322  69.536  1.00 83.97  ? 281 PHE A CE2 1 
ATOM   2158  C  CZ  . PHE A 1 281 ? 108.685 99.964  69.319  1.00 83.97  ? 281 PHE A CZ  1 
ATOM   2159  N  N   . GLU A 1 282 ? 105.685 103.625 70.082  1.00 74.22  ? 282 GLU A N   1 
ATOM   2160  C  CA  . GLU A 1 282 ? 106.316 104.827 70.594  1.00 74.22  ? 282 GLU A CA  1 
ATOM   2161  C  C   . GLU A 1 282 ? 107.775 104.864 70.171  1.00 74.22  ? 282 GLU A C   1 
ATOM   2162  O  O   . GLU A 1 282 ? 108.509 103.887 70.342  1.00 74.22  ? 282 GLU A O   1 
ATOM   2163  C  CB  . GLU A 1 282 ? 106.200 104.886 72.113  1.00 74.22  ? 282 GLU A CB  1 
ATOM   2164  C  CG  . GLU A 1 282 ? 104.842 105.336 72.605  1.00 74.22  ? 282 GLU A CG  1 
ATOM   2165  N  N   . GLU A 1 283 ? 108.179 105.983 69.592  1.00 59.51  ? 283 GLU A N   1 
ATOM   2166  C  CA  . GLU A 1 283 ? 109.573 106.270 69.305  1.00 59.51  ? 283 GLU A CA  1 
ATOM   2167  C  C   . GLU A 1 283 ? 110.313 106.543 70.604  1.00 59.51  ? 283 GLU A C   1 
ATOM   2168  O  O   . GLU A 1 283 ? 109.698 106.867 71.617  1.00 59.51  ? 283 GLU A O   1 
ATOM   2169  C  CB  . GLU A 1 283 ? 109.663 107.426 68.315  1.00 59.51  ? 283 GLU A CB  1 
ATOM   2170  C  CG  . GLU A 1 283 ? 109.251 106.995 66.918  1.00 59.51  ? 283 GLU A CG  1 
ATOM   2171  C  CD  . GLU A 1 283 ? 109.680 107.956 65.842  1.00 59.51  ? 283 GLU A CD  1 
ATOM   2172  O  OE1 . GLU A 1 283 ? 110.666 108.688 66.055  1.00 59.51  ? 283 GLU A OE1 1 
ATOM   2173  O  OE2 . GLU A 1 283 ? 109.039 107.963 64.772  1.00 59.51  ? 283 GLU A OE2 1 
ATOM   2174  N  N   . PRO A 1 284 ? 111.632 106.352 70.619  1.00 49.72  ? 284 PRO A N   1 
ATOM   2175  C  CA  . PRO A 1 284 ? 112.433 106.805 71.761  1.00 49.72  ? 284 PRO A CA  1 
ATOM   2176  C  C   . PRO A 1 284 ? 112.289 108.289 72.054  1.00 49.72  ? 284 PRO A C   1 
ATOM   2177  O  O   . PRO A 1 284 ? 112.191 109.125 71.158  1.00 49.72  ? 284 PRO A O   1 
ATOM   2178  C  CB  . PRO A 1 284 ? 113.866 106.466 71.337  1.00 49.72  ? 284 PRO A CB  1 
ATOM   2179  C  CG  . PRO A 1 284 ? 113.779 106.064 69.888  1.00 49.72  ? 284 PRO A CG  1 
ATOM   2180  C  CD  . PRO A 1 284 ? 112.423 105.515 69.709  1.00 49.72  ? 284 PRO A CD  1 
ATOM   2181  N  N   . ARG A 1 285 ? 112.251 108.587 73.345  1.00 47.30  ? 285 ARG A N   1 
ATOM   2182  C  CA  . ARG A 1 285 ? 111.915 109.910 73.835  1.00 47.30  ? 285 ARG A CA  1 
ATOM   2183  C  C   . ARG A 1 285 ? 113.052 110.902 73.587  1.00 47.30  ? 285 ARG A C   1 
ATOM   2184  O  O   . ARG A 1 285 ? 114.212 110.508 73.465  1.00 47.30  ? 285 ARG A O   1 
ATOM   2185  C  CB  . ARG A 1 285 ? 111.565 109.808 75.317  1.00 47.30  ? 285 ARG A CB  1 
ATOM   2186  C  CG  . ARG A 1 285 ? 112.673 109.454 76.252  1.00 47.30  ? 285 ARG A CG  1 
ATOM   2187  C  CD  . ARG A 1 285 ? 112.158 109.629 77.661  1.00 47.30  ? 285 ARG A CD  1 
ATOM   2188  N  NE  . ARG A 1 285 ? 111.707 110.977 77.964  1.00 47.30  ? 285 ARG A NE  1 
ATOM   2189  C  CZ  . ARG A 1 285 ? 112.428 111.860 78.630  1.00 47.30  ? 285 ARG A CZ  1 
ATOM   2190  N  NH1 . ARG A 1 285 ? 111.948 113.069 78.867  1.00 47.30  ? 285 ARG A NH1 1 
ATOM   2191  N  NH2 . ARG A 1 285 ? 113.633 111.526 79.054  1.00 47.30  ? 285 ARG A NH2 1 
ATOM   2192  N  N   . PRO A 1 286 ? 112.743 112.202 73.529  1.00 55.55  ? 286 PRO A N   1 
ATOM   2193  C  CA  . PRO A 1 286 ? 113.773 113.206 73.224  1.00 55.55  ? 286 PRO A CA  1 
ATOM   2194  C  C   . PRO A 1 286 ? 114.808 113.459 74.307  1.00 55.55  ? 286 PRO A C   1 
ATOM   2195  O  O   . PRO A 1 286 ? 114.602 114.315 75.171  1.00 55.55  ? 286 PRO A O   1 
ATOM   2196  C  CB  . PRO A 1 286 ? 112.951 114.476 72.973  1.00 55.55  ? 286 PRO A CB  1 
ATOM   2197  C  CG  . PRO A 1 286 ? 111.649 114.221 73.612  1.00 55.55  ? 286 PRO A CG  1 
ATOM   2198  C  CD  . PRO A 1 286 ? 111.399 112.784 73.387  1.00 55.55  ? 286 PRO A CD  1 
ATOM   2199  N  N   . GLY A 1 287 ? 115.915 112.725 74.286  1.00 50.83  ? 287 GLY A N   1 
ATOM   2200  C  CA  . GLY A 1 287 ? 116.891 112.822 75.352  1.00 50.83  ? 287 GLY A CA  1 
ATOM   2201  C  C   . GLY A 1 287 ? 117.323 111.454 75.814  1.00 50.83  ? 287 GLY A C   1 
ATOM   2202  O  O   . GLY A 1 287 ? 117.848 111.285 76.916  1.00 50.83  ? 287 GLY A O   1 
ATOM   2203  N  N   . PHE A 1 288 ? 117.116 110.469 74.952  1.00 53.30  ? 288 PHE A N   1 
ATOM   2204  C  CA  . PHE A 1 288 ? 117.586 109.105 75.161  1.00 53.30  ? 288 PHE A CA  1 
ATOM   2205  C  C   . PHE A 1 288 ? 118.804 108.828 74.297  1.00 53.30  ? 288 PHE A C   1 
ATOM   2206  O  O   . PHE A 1 288 ? 118.680 108.719 73.077  1.00 53.30  ? 288 PHE A O   1 
ATOM   2207  C  CB  . PHE A 1 288 ? 116.463 108.139 74.847  1.00 53.30  ? 288 PHE A CB  1 
ATOM   2208  C  CG  . PHE A 1 288 ? 116.896 106.733 74.723  1.00 53.30  ? 288 PHE A CG  1 
ATOM   2209  C  CD1 . PHE A 1 288 ? 117.418 106.067 75.804  1.00 53.30  ? 288 PHE A CD1 1 
ATOM   2210  C  CD2 . PHE A 1 288 ? 116.726 106.058 73.542  1.00 53.30  ? 288 PHE A CD2 1 
ATOM   2211  C  CE1 . PHE A 1 288 ? 117.791 104.765 75.697  1.00 53.30  ? 288 PHE A CE1 1 
ATOM   2212  C  CE2 . PHE A 1 288 ? 117.097 104.754 73.430  1.00 53.30  ? 288 PHE A CE2 1 
ATOM   2213  C  CZ  . PHE A 1 288 ? 117.627 104.107 74.508  1.00 53.30  ? 288 PHE A CZ  1 
ATOM   2214  N  N   . HIS A 1 289 ? 119.977 108.731 74.912  1.00 60.85  ? 289 HIS A N   1 
ATOM   2215  C  CA  . HIS A 1 289 ? 121.213 108.532 74.168  1.00 60.85  ? 289 HIS A CA  1 
ATOM   2216  C  C   . HIS A 1 289 ? 121.853 107.224 74.602  1.00 60.85  ? 289 HIS A C   1 
ATOM   2217  O  O   . HIS A 1 289 ? 121.980 106.960 75.801  1.00 60.85  ? 289 HIS A O   1 
ATOM   2218  C  CB  . HIS A 1 289 ? 122.186 109.686 74.401  1.00 60.85  ? 289 HIS A CB  1 
ATOM   2219  C  CG  . HIS A 1 289 ? 122.415 109.993 75.846  1.00 60.85  ? 289 HIS A CG  1 
ATOM   2220  N  ND1 . HIS A 1 289 ? 123.187 109.191 76.660  1.00 60.85  ? 289 HIS A ND1 1 
ATOM   2221  C  CD2 . HIS A 1 289 ? 121.955 110.992 76.633  1.00 60.85  ? 289 HIS A CD2 1 
ATOM   2222  C  CE1 . HIS A 1 289 ? 123.206 109.693 77.881  1.00 60.85  ? 289 HIS A CE1 1 
ATOM   2223  N  NE2 . HIS A 1 289 ? 122.465 110.785 77.892  1.00 60.85  ? 289 HIS A NE2 1 
ATOM   2224  N  N   . GLY A 1 290 ? 122.237 106.406 73.633  1.00 66.80  ? 290 GLY A N   1 
ATOM   2225  C  CA  . GLY A 1 290 ? 122.925 105.162 73.906  1.00 66.80  ? 290 GLY A CA  1 
ATOM   2226  C  C   . GLY A 1 290 ? 123.972 104.960 72.838  1.00 66.80  ? 290 GLY A C   1 
ATOM   2227  O  O   . GLY A 1 290 ? 124.583 105.929 72.384  1.00 66.80  ? 290 GLY A O   1 
ATOM   2228  N  N   . VAL A 1 291 ? 124.212 103.724 72.439  1.00 71.52  ? 291 VAL A N   1 
ATOM   2229  C  CA  . VAL A 1 291 ? 125.098 103.443 71.320  1.00 71.52  ? 291 VAL A CA  1 
ATOM   2230  C  C   . VAL A 1 291 ? 124.225 103.068 70.132  1.00 71.52  ? 291 VAL A C   1 
ATOM   2231  O  O   . VAL A 1 291 ? 123.160 102.462 70.303  1.00 71.52  ? 291 VAL A O   1 
ATOM   2232  C  CB  . VAL A 1 291 ? 126.091 102.322 71.674  1.00 71.52  ? 291 VAL A CB  1 
ATOM   2233  C  CG1 . VAL A 1 291 ? 127.223 102.259 70.668  1.00 71.52  ? 291 VAL A CG1 1 
ATOM   2234  C  CG2 . VAL A 1 291 ? 126.635 102.548 73.069  1.00 71.52  ? 291 VAL A CG2 1 
ATOM   2235  N  N   . LEU A 1 292 ? 124.658 103.434 68.933  1.00 76.38  ? 292 LEU A N   1 
ATOM   2236  C  CA  . LEU A 1 292 ? 123.880 103.148 67.738  1.00 76.38  ? 292 LEU A CA  1 
ATOM   2237  C  C   . LEU A 1 292 ? 123.930 101.668 67.403  1.00 76.38  ? 292 LEU A C   1 
ATOM   2238  O  O   . LEU A 1 292 ? 124.996 101.050 67.444  1.00 76.38  ? 292 LEU A O   1 
ATOM   2239  C  CB  . LEU A 1 292 ? 124.368 103.980 66.562  1.00 76.38  ? 292 LEU A CB  1 
ATOM   2240  C  CG  . LEU A 1 292 ? 123.636 105.316 66.479  1.00 76.38  ? 292 LEU A CG  1 
ATOM   2241  C  CD1 . LEU A 1 292 ? 124.086 106.111 65.269  1.00 76.38  ? 292 LEU A CD1 1 
ATOM   2242  C  CD2 . LEU A 1 292 ? 122.141 105.072 66.430  1.00 76.38  ? 292 LEU A CD2 1 
ATOM   2243  N  N   . GLY A 1 293 ? 122.775 101.089 67.112  1.00 80.15  ? 293 GLY A N   1 
ATOM   2244  C  CA  . GLY A 1 293 ? 122.736 99.681  66.810  1.00 80.15  ? 293 GLY A CA  1 
ATOM   2245  C  C   . GLY A 1 293 ? 121.439 99.303  66.136  1.00 80.15  ? 293 GLY A C   1 
ATOM   2246  O  O   . GLY A 1 293 ? 120.630 100.158 65.774  1.00 80.15  ? 293 GLY A O   1 
ATOM   2247  N  N   . ILE A 1 294 ? 121.261 98.001  65.959  1.00 81.75  ? 294 ILE A N   1 
ATOM   2248  C  CA  . ILE A 1 294 ? 120.075 97.457  65.314  1.00 81.75  ? 294 ILE A CA  1 
ATOM   2249  C  C   . ILE A 1 294 ? 119.054 97.198  66.405  1.00 81.75  ? 294 ILE A C   1 
ATOM   2250  O  O   . ILE A 1 294 ? 119.331 96.462  67.357  1.00 81.75  ? 294 ILE A O   1 
ATOM   2251  C  CB  . ILE A 1 294 ? 120.395 96.162  64.554  1.00 81.75  ? 294 ILE A CB  1 
ATOM   2252  C  CG1 . ILE A 1 294 ? 121.246 96.435  63.316  1.00 81.75  ? 294 ILE A CG1 1 
ATOM   2253  C  CG2 . ILE A 1 294 ? 119.107 95.474  64.130  1.00 81.75  ? 294 ILE A CG2 1 
ATOM   2254  C  CD1 . ILE A 1 294 ? 120.674 97.453  62.393  1.00 81.75  ? 294 ILE A CD1 1 
ATOM   2255  N  N   . ASN A 1 295 ? 117.885 97.809  66.285  1.00 81.18  ? 295 ASN A N   1 
ATOM   2256  C  CA  . ASN A 1 295 ? 116.822 97.508  67.226  1.00 81.18  ? 295 ASN A CA  1 
ATOM   2257  C  C   . ASN A 1 295 ? 116.306 96.103  66.970  1.00 81.18  ? 295 ASN A C   1 
ATOM   2258  O  O   . ASN A 1 295 ? 116.051 95.718  65.829  1.00 81.18  ? 295 ASN A O   1 
ATOM   2259  C  CB  . ASN A 1 295 ? 115.692 98.521  67.098  1.00 81.18  ? 295 ASN A CB  1 
ATOM   2260  C  CG  . ASN A 1 295 ? 114.851 98.602  68.342  1.00 81.18  ? 295 ASN A CG  1 
ATOM   2261  O  OD1 . ASN A 1 295 ? 115.212 98.052  69.377  1.00 81.18  ? 295 ASN A OD1 1 
ATOM   2262  N  ND2 . ASN A 1 295 ? 113.727 99.297  68.253  1.00 81.18  ? 295 ASN A ND2 1 
ATOM   2263  N  N   . SER A 1 296 ? 116.174 95.327  68.040  1.00 78.87  ? 296 SER A N   1 
ATOM   2264  C  CA  . SER A 1 296 ? 115.813 93.923  67.901  1.00 78.87  ? 296 SER A CA  1 
ATOM   2265  C  C   . SER A 1 296 ? 114.345 93.764  67.551  1.00 78.87  ? 296 SER A C   1 
ATOM   2266  O  O   . SER A 1 296 ? 113.982 92.871  66.779  1.00 78.87  ? 296 SER A O   1 
ATOM   2267  C  CB  . SER A 1 296 ? 116.143 93.152  69.176  1.00 78.87  ? 296 SER A CB  1 
ATOM   2268  O  OG  . SER A 1 296 ? 117.469 92.658  69.140  1.00 78.87  ? 296 SER A OG  1 
ATOM   2269  N  N   . ILE A 1 297 ? 113.495 94.621  68.108  1.00 78.15  ? 297 ILE A N   1 
ATOM   2270  C  CA  . ILE A 1 297 ? 112.057 94.537  67.904  1.00 78.15  ? 297 ILE A CA  1 
ATOM   2271  C  C   . ILE A 1 297 ? 111.700 94.941  66.483  1.00 78.15  ? 297 ILE A C   1 
ATOM   2272  O  O   . ILE A 1 297 ? 111.171 94.133  65.713  1.00 78.15  ? 297 ILE A O   1 
ATOM   2273  C  CB  . ILE A 1 297 ? 111.327 95.433  68.916  1.00 78.15  ? 297 ILE A CB  1 
ATOM   2274  C  CG1 . ILE A 1 297 ? 111.661 94.985  70.335  1.00 78.15  ? 297 ILE A CG1 1 
ATOM   2275  C  CG2 . ILE A 1 297 ? 109.828 95.394  68.673  1.00 78.15  ? 297 ILE A CG2 1 
ATOM   2276  C  CD1 . ILE A 1 297 ? 111.325 96.012  71.389  1.00 78.15  ? 297 ILE A CD1 1 
ATOM   2277  N  N   . THR A 1 298 ? 112.016 96.172  66.108  1.00 80.49  ? 298 THR A N   1 
ATOM   2278  C  CA  . THR A 1 298 ? 111.520 96.687  64.842  1.00 80.49  ? 298 THR A CA  1 
ATOM   2279  C  C   . THR A 1 298 ? 112.390 96.246  63.683  1.00 80.49  ? 298 THR A C   1 
ATOM   2280  O  O   . THR A 1 298 ? 111.900 96.125  62.557  1.00 80.49  ? 298 THR A O   1 
ATOM   2281  C  CB  . THR A 1 298 ? 111.434 98.204  64.880  1.00 80.49  ? 298 THR A CB  1 
ATOM   2282  O  OG1 . THR A 1 298 ? 112.616 98.727  65.496  1.00 80.49  ? 298 THR A OG1 1 
ATOM   2283  C  CG2 . THR A 1 298 ? 110.217 98.630  65.662  1.00 80.49  ? 298 THR A CG2 1 
ATOM   2284  N  N   . GLY A 1 299 ? 113.669 96.012  63.940  1.00 85.22  ? 299 GLY A N   1 
ATOM   2285  C  CA  . GLY A 1 299 ? 114.641 95.712  62.913  1.00 85.22  ? 299 GLY A CA  1 
ATOM   2286  C  C   . GLY A 1 299 ? 115.286 96.926  62.302  1.00 85.22  ? 299 GLY A C   1 
ATOM   2287  O  O   . GLY A 1 299 ? 116.175 96.778  61.458  1.00 85.22  ? 299 GLY A O   1 
ATOM   2288  N  N   . LYS A 1 300 ? 114.880 98.114  62.710  1.00 83.35  ? 300 LYS A N   1 
ATOM   2289  C  CA  . LYS A 1 300 ? 115.446 99.359  62.238  1.00 83.35  ? 300 LYS A CA  1 
ATOM   2290  C  C   . LYS A 1 300 ? 116.708 99.672  63.035  1.00 83.35  ? 300 LYS A C   1 
ATOM   2291  O  O   . LYS A 1 300 ? 117.206 98.849  63.809  1.00 83.35  ? 300 LYS A O   1 
ATOM   2292  C  CB  . LYS A 1 300 ? 114.398 100.464 62.267  1.00 83.35  ? 300 LYS A CB  1 
ATOM   2293  C  CG  . LYS A 1 300 ? 113.087 99.983  61.690  1.00 83.35  ? 300 LYS A CG  1 
ATOM   2294  C  CD  . LYS A 1 300 ? 112.048 101.074 61.636  1.00 83.35  ? 300 LYS A CD  1 
ATOM   2295  C  CE  . LYS A 1 300 ? 111.227 100.936 60.365  1.00 83.35  ? 300 LYS A CE  1 
ATOM   2296  N  NZ  . LYS A 1 300 ? 110.309 102.081 60.161  1.00 83.35  ? 300 LYS A NZ  1 
ATOM   2297  N  N   . GLU A 1 301 ? 117.233 100.874 62.854  1.00 91.62  ? 301 GLU A N   1 
ATOM   2298  C  CA  . GLU A 1 301 ? 118.396 101.344 63.596  1.00 91.62  ? 301 GLU A CA  1 
ATOM   2299  C  C   . GLU A 1 301 ? 117.954 102.297 64.696  1.00 91.62  ? 301 GLU A C   1 
ATOM   2300  O  O   . GLU A 1 301 ? 117.218 103.254 64.441  1.00 91.62  ? 301 GLU A O   1 
ATOM   2301  C  CB  . GLU A 1 301 ? 119.386 102.022 62.655  1.00 91.62  ? 301 GLU A CB  1 
ATOM   2302  C  CG  . GLU A 1 301 ? 120.339 101.050 62.014  1.00 91.62  ? 301 GLU A CG  1 
ATOM   2303  C  CD  . GLU A 1 301 ? 121.701 101.633 61.758  1.00 91.62  ? 301 GLU A CD  1 
ATOM   2304  O  OE1 . GLU A 1 301 ? 121.922 102.806 62.116  1.00 91.62  ? 301 GLU A OE1 1 
ATOM   2305  O  OE2 . GLU A 1 301 ? 122.555 100.917 61.199  1.00 91.62  ? 301 GLU A OE2 1 
ATOM   2306  N  N   . GLU A 1 302 ? 118.386 102.019 65.915  1.00 77.73  ? 302 GLU A N   1 
ATOM   2307  C  CA  . GLU A 1 302 ? 117.965 102.743 67.101  1.00 77.73  ? 302 GLU A CA  1 
ATOM   2308  C  C   . GLU A 1 302 ? 119.130 102.818 68.071  1.00 77.73  ? 302 GLU A C   1 
ATOM   2309  O  O   . GLU A 1 302 ? 120.081 102.036 67.976  1.00 77.73  ? 302 GLU A O   1 
ATOM   2310  C  CB  . GLU A 1 302 ? 116.767 102.048 67.763  1.00 77.73  ? 302 GLU A CB  1 
ATOM   2311  N  N   . PRO A 1 303 ? 119.090 103.750 69.015  1.00 67.54  ? 303 PRO A N   1 
ATOM   2312  C  CA  . PRO A 1 303 ? 120.018 103.694 70.142  1.00 67.54  ? 303 PRO A CA  1 
ATOM   2313  C  C   . PRO A 1 303 ? 119.723 102.521 71.055  1.00 67.54  ? 303 PRO A C   1 
ATOM   2314  O  O   . PRO A 1 303 ? 118.571 102.189 71.319  1.00 67.54  ? 303 PRO A O   1 
ATOM   2315  C  CB  . PRO A 1 303 ? 119.788 105.026 70.857  1.00 67.54  ? 303 PRO A CB  1 
ATOM   2316  C  CG  . PRO A 1 303 ? 119.243 105.911 69.820  1.00 67.54  ? 303 PRO A CG  1 
ATOM   2317  C  CD  . PRO A 1 303 ? 118.396 105.044 68.956  1.00 67.54  ? 303 PRO A CD  1 
ATOM   2318  N  N   . LEU A 1 304 ? 120.783 101.883 71.519  1.00 65.64  ? 304 LEU A N   1 
ATOM   2319  C  CA  . LEU A 1 304 ? 120.680 100.765 72.435  1.00 65.64  ? 304 LEU A CA  1 
ATOM   2320  C  C   . LEU A 1 304 ? 121.410 101.130 73.710  1.00 65.64  ? 304 LEU A C   1 
ATOM   2321  O  O   . LEU A 1 304 ? 122.432 101.818 73.682  1.00 65.64  ? 304 LEU A O   1 
ATOM   2322  C  CB  . LEU A 1 304 ? 121.271 99.492  71.856  1.00 65.64  ? 304 LEU A CB  1 
ATOM   2323  C  CG  . LEU A 1 304 ? 120.651 98.908  70.594  1.00 65.64  ? 304 LEU A CG  1 
ATOM   2324  C  CD1 . LEU A 1 304 ? 121.063 97.453  70.454  1.00 65.64  ? 304 LEU A CD1 1 
ATOM   2325  C  CD2 . LEU A 1 304 ? 119.138 99.008  70.659  1.00 65.64  ? 304 LEU A CD2 1 
ATOM   2326  N  N   . TYR A 1 305 ? 120.863 100.675 74.823  1.00 64.39  ? 305 TYR A N   1 
ATOM   2327  C  CA  . TYR A 1 305 ? 121.434 100.889 76.129  1.00 64.39  ? 305 TYR A CA  1 
ATOM   2328  C  C   . TYR A 1 305 ? 121.436 99.548  76.845  1.00 64.39  ? 305 TYR A C   1 
ATOM   2329  O  O   . TYR A 1 305 ? 120.451 98.799  76.749  1.00 64.39  ? 305 TYR A O   1 
ATOM   2330  C  CB  . TYR A 1 305 ? 120.625 101.901 76.927  1.00 64.39  ? 305 TYR A CB  1 
ATOM   2331  C  CG  . TYR A 1 305 ? 121.412 102.610 77.985  1.00 64.39  ? 305 TYR A CG  1 
ATOM   2332  C  CD1 . TYR A 1 305 ? 122.275 103.635 77.660  1.00 64.39  ? 305 TYR A CD1 1 
ATOM   2333  C  CD2 . TYR A 1 305 ? 121.318 102.230 79.303  1.00 64.39  ? 305 TYR A CD2 1 
ATOM   2334  C  CE1 . TYR A 1 305 ? 123.001 104.288 78.631  1.00 64.39  ? 305 TYR A CE1 1 
ATOM   2335  C  CE2 . TYR A 1 305 ? 122.042 102.869 80.280  1.00 64.39  ? 305 TYR A CE2 1 
ATOM   2336  C  CZ  . TYR A 1 305 ? 122.883 103.896 79.940  1.00 64.39  ? 305 TYR A CZ  1 
ATOM   2337  O  OH  . TYR A 1 305 ? 123.602 104.537 80.920  1.00 64.39  ? 305 TYR A OH  1 
ATOM   2338  N  N   . PRO A 1 306 ? 122.513 99.193  77.538  1.00 68.97  ? 306 PRO A N   1 
ATOM   2339  C  CA  . PRO A 1 306 ? 122.507 97.940  78.293  1.00 68.97  ? 306 PRO A CA  1 
ATOM   2340  C  C   . PRO A 1 306 ? 121.575 98.097  79.479  1.00 68.97  ? 306 PRO A C   1 
ATOM   2341  O  O   . PRO A 1 306 ? 121.597 99.118  80.168  1.00 68.97  ? 306 PRO A O   1 
ATOM   2342  C  CB  . PRO A 1 306 ? 123.963 97.777  78.738  1.00 68.97  ? 306 PRO A CB  1 
ATOM   2343  C  CG  . PRO A 1 306 ? 124.738 98.775  77.950  1.00 68.97  ? 306 PRO A CG  1 
ATOM   2344  C  CD  . PRO A 1 306 ? 123.795 99.894  77.660  1.00 68.97  ? 306 PRO A CD  1 
ATOM   2345  N  N   . SER A 1 307 ? 120.770 97.067  79.717  1.00 65.25  ? 307 SER A N   1 
ATOM   2346  C  CA  . SER A 1 307 ? 119.724 97.156  80.720  1.00 65.25  ? 307 SER A CA  1 
ATOM   2347  C  C   . SER A 1 307 ? 120.270 97.195  82.137  1.00 65.25  ? 307 SER A C   1 
ATOM   2348  O  O   . SER A 1 307 ? 119.615 97.764  83.015  1.00 65.25  ? 307 SER A O   1 
ATOM   2349  C  CB  . SER A 1 307 ? 118.756 95.992  80.557  1.00 65.25  ? 307 SER A CB  1 
ATOM   2350  O  OG  . SER A 1 307 ? 117.541 96.268  81.222  1.00 65.25  ? 307 SER A OG  1 
ATOM   2351  N  N   . TYR A 1 308 ? 121.447 96.620  82.384  1.00 70.15  ? 308 TYR A N   1 
ATOM   2352  C  CA  . TYR A 1 308 ? 121.980 96.635  83.740  1.00 70.15  ? 308 TYR A CA  1 
ATOM   2353  C  C   . TYR A 1 308 ? 122.435 98.023  84.170  1.00 70.15  ? 308 TYR A C   1 
ATOM   2354  O  O   . TYR A 1 308 ? 122.381 98.335  85.363  1.00 70.15  ? 308 TYR A O   1 
ATOM   2355  C  CB  . TYR A 1 308 ? 123.124 95.632  83.888  1.00 70.15  ? 308 TYR A CB  1 
ATOM   2356  C  CG  . TYR A 1 308 ? 124.315 95.850  82.983  1.00 70.15  ? 308 TYR A CG  1 
ATOM   2357  C  CD1 . TYR A 1 308 ? 124.384 95.225  81.748  1.00 70.15  ? 308 TYR A CD1 1 
ATOM   2358  C  CD2 . TYR A 1 308 ? 125.378 96.657  83.369  1.00 70.15  ? 308 TYR A CD2 1 
ATOM   2359  C  CE1 . TYR A 1 308 ? 125.468 95.402  80.920  1.00 70.15  ? 308 TYR A CE1 1 
ATOM   2360  C  CE2 . TYR A 1 308 ? 126.461 96.846  82.543  1.00 70.15  ? 308 TYR A CE2 1 
ATOM   2361  C  CZ  . TYR A 1 308 ? 126.499 96.216  81.320  1.00 70.15  ? 308 TYR A CZ  1 
ATOM   2362  O  OH  . TYR A 1 308 ? 127.579 96.394  80.493  1.00 70.15  ? 308 TYR A OH  1 
ATOM   2363  N  N   . LYS A 1 309 ? 122.896 98.861  83.241  1.00 68.80  ? 309 LYS A N   1 
ATOM   2364  C  CA  . LYS A 1 309 ? 123.241 100.225 83.631  1.00 68.80  ? 309 LYS A CA  1 
ATOM   2365  C  C   . LYS A 1 309 ? 122.008 101.031 84.005  1.00 68.80  ? 309 LYS A C   1 
ATOM   2366  O  O   . LYS A 1 309 ? 122.073 101.889 84.893  1.00 68.80  ? 309 LYS A O   1 
ATOM   2367  C  CB  . LYS A 1 309 ? 124.052 100.942 82.557  1.00 68.80  ? 309 LYS A CB  1 
ATOM   2368  C  CG  . LYS A 1 309 ? 125.445 100.384 82.358  1.00 68.80  ? 309 LYS A CG  1 
ATOM   2369  C  CD  . LYS A 1 309 ? 126.227 101.269 81.404  1.00 68.80  ? 309 LYS A CD  1 
ATOM   2370  C  CE  . LYS A 1 309 ? 127.687 100.872 81.330  1.00 68.80  ? 309 LYS A CE  1 
ATOM   2371  N  NZ  . LYS A 1 309 ? 128.458 101.832 80.496  1.00 68.80  ? 309 LYS A NZ  1 
ATOM   2372  N  N   . ARG A 1 310 ? 120.894 100.812 83.316  1.00 59.27  ? 310 ARG A N   1 
ATOM   2373  C  CA  . ARG A 1 310 ? 119.673 101.508 83.695  1.00 59.27  ? 310 ARG A CA  1 
ATOM   2374  C  C   . ARG A 1 310 ? 119.160 101.030 85.046  1.00 59.27  ? 310 ARG A C   1 
ATOM   2375  O  O   . ARG A 1 310 ? 118.740 101.846 85.874  1.00 59.27  ? 310 ARG A O   1 
ATOM   2376  C  CB  . ARG A 1 310 ? 118.608 101.341 82.617  1.00 59.27  ? 310 ARG A CB  1 
ATOM   2377  C  CG  . ARG A 1 310 ? 117.261 101.873 83.024  1.00 59.27  ? 310 ARG A CG  1 
ATOM   2378  C  CD  . ARG A 1 310 ? 116.467 102.369 81.861  1.00 59.27  ? 310 ARG A CD  1 
ATOM   2379  N  NE  . ARG A 1 310 ? 116.081 101.294 80.973  1.00 59.27  ? 310 ARG A NE  1 
ATOM   2380  C  CZ  . ARG A 1 310 ? 116.475 101.229 79.712  1.00 59.27  ? 310 ARG A CZ  1 
ATOM   2381  N  NH1 . ARG A 1 310 ? 117.259 102.175 79.224  1.00 59.27  ? 310 ARG A NH1 1 
ATOM   2382  N  NH2 . ARG A 1 310 ? 116.092 100.225 78.944  1.00 59.27  ? 310 ARG A NH2 1 
ATOM   2383  N  N   . GLN A 1 311 ? 119.224 99.723  85.309  1.00 58.61  ? 311 GLN A N   1 
ATOM   2384  C  CA  . GLN A 1 311 ? 118.770 99.226  86.602  1.00 58.61  ? 311 GLN A CA  1 
ATOM   2385  C  C   . GLN A 1 311 ? 119.675 99.660  87.743  1.00 58.61  ? 311 GLN A C   1 
ATOM   2386  O  O   . GLN A 1 311 ? 119.188 99.910  88.848  1.00 58.61  ? 311 GLN A O   1 
ATOM   2387  C  CB  . GLN A 1 311 ? 118.714 97.705  86.588  1.00 58.61  ? 311 GLN A CB  1 
ATOM   2388  C  CG  . GLN A 1 311 ? 117.688 97.091  85.679  1.00 58.61  ? 311 GLN A CG  1 
ATOM   2389  C  CD  . GLN A 1 311 ? 116.290 97.485  86.048  1.00 58.61  ? 311 GLN A CD  1 
ATOM   2390  O  OE1 . GLN A 1 311 ? 115.943 97.542  87.225  1.00 58.61  ? 311 GLN A OE1 1 
ATOM   2391  N  NE2 . GLN A 1 311 ? 115.461 97.726  85.045  1.00 58.61  ? 311 GLN A NE2 1 
ATOM   2392  N  N   . LEU A 1 312 ? 120.976 99.785  87.493  1.00 63.82  ? 312 LEU A N   1 
ATOM   2393  C  CA  . LEU A 1 312 ? 121.876 100.337 88.499  1.00 63.82  ? 312 LEU A CA  1 
ATOM   2394  C  C   . LEU A 1 312 ? 121.621 101.805 88.780  1.00 63.82  ? 312 LEU A C   1 
ATOM   2395  O  O   . LEU A 1 312 ? 121.610 102.212 89.945  1.00 63.82  ? 312 LEU A O   1 
ATOM   2396  C  CB  . LEU A 1 312 ? 123.326 100.135 88.078  1.00 63.82  ? 312 LEU A CB  1 
ATOM   2397  C  CG  . LEU A 1 312 ? 123.891 98.747  88.352  1.00 63.82  ? 312 LEU A CG  1 
ATOM   2398  C  CD1 . LEU A 1 312 ? 125.386 98.761  88.183  1.00 63.82  ? 312 LEU A CD1 1 
ATOM   2399  C  CD2 . LEU A 1 312 ? 123.537 98.302  89.757  1.00 63.82  ? 312 LEU A CD2 1 
ATOM   2400  N  N   . ARG A 1 313 ? 121.423 102.609 87.738  1.00 59.70  ? 313 ARG A N   1 
ATOM   2401  C  CA  . ARG A 1 313 ? 121.183 104.032 87.928  1.00 59.70  ? 313 ARG A CA  1 
ATOM   2402  C  C   . ARG A 1 313 ? 119.875 104.310 88.654  1.00 59.70  ? 313 ARG A C   1 
ATOM   2403  O  O   . ARG A 1 313 ? 119.762 105.332 89.337  1.00 59.70  ? 313 ARG A O   1 
ATOM   2404  C  CB  . ARG A 1 313 ? 121.221 104.727 86.571  1.00 59.70  ? 313 ARG A CB  1 
ATOM   2405  C  CG  . ARG A 1 313 ? 122.632 104.982 86.093  1.00 59.70  ? 313 ARG A CG  1 
ATOM   2406  C  CD  . ARG A 1 313 ? 122.702 105.503 84.668  1.00 59.70  ? 313 ARG A CD  1 
ATOM   2407  N  NE  . ARG A 1 313 ? 123.640 106.613 84.544  1.00 59.70  ? 313 ARG A NE  1 
ATOM   2408  C  CZ  . ARG A 1 313 ? 123.944 107.217 83.402  1.00 59.70  ? 313 ARG A CZ  1 
ATOM   2409  N  NH1 . ARG A 1 313 ? 123.388 106.816 82.270  1.00 59.70  ? 313 ARG A NH1 1 
ATOM   2410  N  NH2 . ARG A 1 313 ? 124.805 108.223 83.393  1.00 59.70  ? 313 ARG A NH2 1 
ATOM   2411  N  N   . ILE A 1 314 ? 118.889 103.421 88.554  1.00 57.84  ? 314 ILE A N   1 
ATOM   2412  C  CA  . ILE A 1 314 ? 117.705 103.565 89.391  1.00 57.84  ? 314 ILE A CA  1 
ATOM   2413  C  C   . ILE A 1 314 ? 117.989 103.106 90.813  1.00 57.84  ? 314 ILE A C   1 
ATOM   2414  O  O   . ILE A 1 314 ? 117.953 103.905 91.754  1.00 57.84  ? 314 ILE A O   1 
ATOM   2415  C  CB  . ILE A 1 314 ? 116.513 102.813 88.782  1.00 57.84  ? 314 ILE A CB  1 
ATOM   2416  C  CG1 . ILE A 1 314 ? 116.129 103.441 87.450  1.00 57.84  ? 314 ILE A CG1 1 
ATOM   2417  C  CG2 . ILE A 1 314 ? 115.330 102.887 89.704  1.00 57.84  ? 314 ILE A CG2 1 
ATOM   2418  C  CD1 . ILE A 1 314 ? 114.986 102.738 86.761  1.00 57.84  ? 314 ILE A CD1 1 
ATOM   2419  N  N   . TYR A 1 315 ? 118.256 101.813 90.996  1.00 62.79  ? 315 TYR A N   1 
ATOM   2420  C  CA  . TYR A 1 315 ? 118.237 101.203 92.319  1.00 62.79  ? 315 TYR A CA  1 
ATOM   2421  C  C   . TYR A 1 315 ? 119.507 101.446 93.126  1.00 62.79  ? 315 TYR A C   1 
ATOM   2422  O  O   . TYR A 1 315 ? 119.628 100.903 94.226  1.00 62.79  ? 315 TYR A O   1 
ATOM   2423  C  CB  . TYR A 1 315 ? 117.984 99.699  92.225  1.00 62.79  ? 315 TYR A CB  1 
ATOM   2424  C  CG  . TYR A 1 315 ? 116.579 99.324  91.842  1.00 62.79  ? 315 TYR A CG  1 
ATOM   2425  C  CD1 . TYR A 1 315 ? 115.519 100.152 92.157  1.00 62.79  ? 315 TYR A CD1 1 
ATOM   2426  C  CD2 . TYR A 1 315 ? 116.306 98.124  91.194  1.00 62.79  ? 315 TYR A CD2 1 
ATOM   2427  C  CE1 . TYR A 1 315 ? 114.219 99.814  91.816  1.00 62.79  ? 315 TYR A CE1 1 
ATOM   2428  C  CE2 . TYR A 1 315 ? 115.010 97.774  90.848  1.00 62.79  ? 315 TYR A CE2 1 
ATOM   2429  C  CZ  . TYR A 1 315 ? 113.970 98.627  91.164  1.00 62.79  ? 315 TYR A CZ  1 
ATOM   2430  O  OH  . TYR A 1 315 ? 112.672 98.309  90.834  1.00 62.79  ? 315 TYR A OH  1 
ATOM   2431  N  N   . LEU A 1 316 ? 120.464 102.225 92.620  1.00 64.44  ? 316 LEU A N   1 
ATOM   2432  C  CA  . LEU A 1 316 ? 121.588 102.596 93.474  1.00 64.44  ? 316 LEU A CA  1 
ATOM   2433  C  C   . LEU A 1 316 ? 121.820 104.083 93.639  1.00 64.44  ? 316 LEU A C   1 
ATOM   2434  O  O   . LEU A 1 316 ? 122.553 104.460 94.555  1.00 64.44  ? 316 LEU A O   1 
ATOM   2435  C  CB  . LEU A 1 316 ? 122.882 101.975 92.952  1.00 64.44  ? 316 LEU A CB  1 
ATOM   2436  C  CG  . LEU A 1 316 ? 123.224 100.563 93.415  1.00 64.44  ? 316 LEU A CG  1 
ATOM   2437  C  CD1 . LEU A 1 316 ? 124.687 100.286 93.119  1.00 64.44  ? 316 LEU A CD1 1 
ATOM   2438  C  CD2 . LEU A 1 316 ? 122.915 100.362 94.891  1.00 64.44  ? 316 LEU A CD2 1 
ATOM   2439  N  N   . VAL A 1 317 ? 121.275 104.948 92.799  1.00 60.96  ? 317 VAL A N   1 
ATOM   2440  C  CA  . VAL A 1 317 ? 121.469 106.377 92.938  1.00 60.96  ? 317 VAL A CA  1 
ATOM   2441  C  C   . VAL A 1 317 ? 120.155 107.093 93.201  1.00 60.96  ? 317 VAL A C   1 
ATOM   2442  O  O   . VAL A 1 317 ? 120.063 107.915 94.115  1.00 60.96  ? 317 VAL A O   1 
ATOM   2443  C  CB  . VAL A 1 317 ? 122.174 106.961 91.701  1.00 60.96  ? 317 VAL A CB  1 
ATOM   2444  C  CG1 . VAL A 1 317 ? 122.326 108.455 91.846  1.00 60.96  ? 317 VAL A CG1 1 
ATOM   2445  C  CG2 . VAL A 1 317 ? 123.527 106.323 91.537  1.00 60.96  ? 317 VAL A CG2 1 
ATOM   2446  N  N   . SER A 1 318 ? 119.116 106.755 92.440  1.00 55.58  ? 318 SER A N   1 
ATOM   2447  C  CA  . SER A 1 318 ? 117.852 107.465 92.561  1.00 55.58  ? 318 SER A CA  1 
ATOM   2448  C  C   . SER A 1 318 ? 117.111 107.065 93.821  1.00 55.58  ? 318 SER A C   1 
ATOM   2449  O  O   . SER A 1 318 ? 116.677 107.930 94.587  1.00 55.58  ? 318 SER A O   1 
ATOM   2450  C  CB  . SER A 1 318 ? 116.989 107.177 91.345  1.00 55.58  ? 318 SER A CB  1 
ATOM   2451  O  OG  . SER A 1 318 ? 117.802 106.710 90.293  1.00 55.58  ? 318 SER A OG  1 
ATOM   2452  N  N   . LEU A 1 319 ? 116.990 105.769 94.057  1.00 55.68  ? 319 LEU A N   1 
ATOM   2453  C  CA  . LEU A 1 319 ? 116.304 105.239 95.224  1.00 55.68  ? 319 LEU A CA  1 
ATOM   2454  C  C   . LEU A 1 319 ? 117.001 105.618 96.537  1.00 55.68  ? 319 LEU A C   1 
ATOM   2455  O  O   . LEU A 1 319 ? 116.296 105.909 97.509  1.00 55.68  ? 319 LEU A O   1 
ATOM   2456  C  CB  . LEU A 1 319 ? 116.134 103.726 95.068  1.00 55.68  ? 319 LEU A CB  1 
ATOM   2457  C  CG  . LEU A 1 319 ? 115.577 102.940 96.237  1.00 55.68  ? 319 LEU A CG  1 
ATOM   2458  C  CD1 . LEU A 1 319 ? 114.184 103.416 96.521  1.00 55.68  ? 319 LEU A CD1 1 
ATOM   2459  C  CD2 . LEU A 1 319 ? 115.561 101.478 95.885  1.00 55.68  ? 319 LEU A CD2 1 
ATOM   2460  N  N   . PRO A 1 320 ? 118.341 105.623 96.652  1.00 59.01  ? 320 PRO A N   1 
ATOM   2461  C  CA  . PRO A 1 320 ? 118.931 106.251 97.843  1.00 59.01  ? 320 PRO A CA  1 
ATOM   2462  C  C   . PRO A 1 320 ? 118.707 107.746 97.945  1.00 59.01  ? 320 PRO A C   1 
ATOM   2463  O  O   . PRO A 1 320 ? 118.609 108.261 99.064  1.00 59.01  ? 320 PRO A O   1 
ATOM   2464  C  CB  . PRO A 1 320 ? 120.418 105.923 97.706  1.00 59.01  ? 320 PRO A CB  1 
ATOM   2465  C  CG  . PRO A 1 320 ? 120.420 104.669 97.026  1.00 59.01  ? 320 PRO A CG  1 
ATOM   2466  C  CD  . PRO A 1 320 ? 119.372 104.803 95.988  1.00 59.01  ? 320 PRO A CD  1 
ATOM   2467  N  N   . PHE A 1 321 ? 118.628 108.465 96.825  1.00 56.29  ? 321 PHE A N   1 
ATOM   2468  C  CA  . PHE A 1 321 ? 118.359 109.895 96.918  1.00 56.29  ? 321 PHE A CA  1 
ATOM   2469  C  C   . PHE A 1 321 ? 116.927 110.165 97.355  1.00 56.29  ? 321 PHE A C   1 
ATOM   2470  O  O   . PHE A 1 321 ? 116.669 111.140 98.072  1.00 56.29  ? 321 PHE A O   1 
ATOM   2471  C  CB  . PHE A 1 321 ? 118.651 110.608 95.609  1.00 56.29  ? 321 PHE A CB  1 
ATOM   2472  C  CG  . PHE A 1 321 ? 118.472 112.086 95.707  1.00 56.29  ? 321 PHE A CG  1 
ATOM   2473  C  CD1 . PHE A 1 321 ? 119.435 112.853 96.329  1.00 56.29  ? 321 PHE A CD1 1 
ATOM   2474  C  CD2 . PHE A 1 321 ? 117.336 112.707 95.214  1.00 56.29  ? 321 PHE A CD2 1 
ATOM   2475  C  CE1 . PHE A 1 321 ? 119.281 114.213 96.449  1.00 56.29  ? 321 PHE A CE1 1 
ATOM   2476  C  CE2 . PHE A 1 321 ? 117.177 114.072 95.333  1.00 56.29  ? 321 PHE A CE2 1 
ATOM   2477  C  CZ  . PHE A 1 321 ? 118.151 114.825 95.950  1.00 56.29  ? 321 PHE A CZ  1 
ATOM   2478  N  N   . VAL A 1 322 ? 115.981 109.343 96.904  1.00 48.77  ? 322 VAL A N   1 
ATOM   2479  C  CA  . VAL A 1 322 ? 114.601 109.500 97.346  1.00 48.77  ? 322 VAL A CA  1 
ATOM   2480  C  C   . VAL A 1 322 ? 114.495 109.182 98.825  1.00 48.77  ? 322 VAL A C   1 
ATOM   2481  O  O   . VAL A 1 322 ? 113.813 109.888 99.577  1.00 48.77  ? 322 VAL A O   1 
ATOM   2482  C  CB  . VAL A 1 322 ? 113.666 108.614 96.507  1.00 48.77  ? 322 VAL A CB  1 
ATOM   2483  C  CG1 . VAL A 1 322 ? 112.252 108.657 97.034  1.00 48.77  ? 322 VAL A CG1 1 
ATOM   2484  C  CG2 . VAL A 1 322 ? 113.669 109.094 95.099  1.00 48.77  ? 322 VAL A CG2 1 
ATOM   2485  N  N   . CYS A 1 323 ? 115.233 108.169 99.279  1.00 48.80  ? 323 CYS A N   1 
ATOM   2486  C  CA  . CYS A 1 323 ? 115.227 107.821 100.692 1.00 48.80  ? 323 CYS A CA  1 
ATOM   2487  C  C   . CYS A 1 323 ? 115.861 108.910 101.542 1.00 48.80  ? 323 CYS A C   1 
ATOM   2488  O  O   . CYS A 1 323 ? 115.412 109.150 102.667 1.00 48.80  ? 323 CYS A O   1 
ATOM   2489  C  CB  . CYS A 1 323 ? 115.930 106.488 100.900 1.00 48.80  ? 323 CYS A CB  1 
ATOM   2490  S  SG  . CYS A 1 323 ? 114.914 105.071 100.436 1.00 48.80  ? 323 CYS A SG  1 
ATOM   2491  N  N   . LEU A 1 324 ? 116.913 109.560 101.046 1.00 47.20  ? 324 LEU A N   1 
ATOM   2492  C  CA  . LEU A 1 324 ? 117.474 110.683 101.791 1.00 47.20  ? 324 LEU A CA  1 
ATOM   2493  C  C   . LEU A 1 324 ? 116.493 111.843 101.856 1.00 47.20  ? 324 LEU A C   1 
ATOM   2494  O  O   . LEU A 1 324 ? 116.340 112.474 102.908 1.00 47.20  ? 324 LEU A O   1 
ATOM   2495  C  CB  . LEU A 1 324 ? 118.797 111.144 101.177 1.00 47.20  ? 324 LEU A CB  1 
ATOM   2496  C  CG  . LEU A 1 324 ? 119.314 112.534 101.580 1.00 47.20  ? 324 LEU A CG  1 
ATOM   2497  C  CD1 . LEU A 1 324 ? 119.884 112.518 102.972 1.00 47.20  ? 324 LEU A CD1 1 
ATOM   2498  C  CD2 . LEU A 1 324 ? 120.357 113.037 100.611 1.00 47.20  ? 324 LEU A CD2 1 
ATOM   2499  N  N   . CYS A 1 325 ? 115.769 112.091 100.765 1.00 44.61  ? 325 CYS A N   1 
ATOM   2500  C  CA  . CYS A 1 325 ? 114.802 113.180 100.764 1.00 44.61  ? 325 CYS A CA  1 
ATOM   2501  C  C   . CYS A 1 325 ? 113.593 112.884 101.636 1.00 44.61  ? 325 CYS A C   1 
ATOM   2502  O  O   . CYS A 1 325 ? 113.018 113.811 102.217 1.00 44.61  ? 325 CYS A O   1 
ATOM   2503  C  CB  . CYS A 1 325 ? 114.372 113.494 99.341  1.00 44.61  ? 325 CYS A CB  1 
ATOM   2504  S  SG  . CYS A 1 325 ? 115.536 114.545 98.478  1.00 44.61  ? 325 CYS A SG  1 
ATOM   2505  N  N   . LEU A 1 326 ? 113.171 111.622 101.724 1.00 42.39  ? 326 LEU A N   1 
ATOM   2506  C  CA  . LEU A 1 326 ? 112.102 111.302 102.661 1.00 42.39  ? 326 LEU A CA  1 
ATOM   2507  C  C   . LEU A 1 326 ? 112.558 111.466 104.100 1.00 42.39  ? 326 LEU A C   1 
ATOM   2508  O  O   . LEU A 1 326 ? 111.796 111.966 104.935 1.00 42.39  ? 326 LEU A O   1 
ATOM   2509  C  CB  . LEU A 1 326 ? 111.600 109.880 102.460 1.00 42.39  ? 326 LEU A CB  1 
ATOM   2510  C  CG  . LEU A 1 326 ? 110.948 109.495 101.151 1.00 42.39  ? 326 LEU A CG  1 
ATOM   2511  C  CD1 . LEU A 1 326 ? 110.236 108.195 101.352 1.00 42.39  ? 326 LEU A CD1 1 
ATOM   2512  C  CD2 . LEU A 1 326 ? 109.987 110.544 100.737 1.00 42.39  ? 326 LEU A CD2 1 
ATOM   2513  N  N   . TYR A 1 327 ? 113.802 111.077 104.401 1.00 52.12  ? 327 TYR A N   1 
ATOM   2514  C  CA  . TYR A 1 327 ? 114.331 111.278 105.747 1.00 52.12  ? 327 TYR A CA  1 
ATOM   2515  C  C   . TYR A 1 327 ? 114.465 112.759 106.039 1.00 52.12  ? 327 TYR A C   1 
ATOM   2516  O  O   . TYR A 1 327 ? 114.213 113.210 107.160 1.00 52.12  ? 327 TYR A O   1 
ATOM   2517  C  CB  . TYR A 1 327 ? 115.668 110.560 105.922 1.00 52.12  ? 327 TYR A CB  1 
ATOM   2518  C  CG  . TYR A 1 327 ? 116.416 110.969 107.170 1.00 52.12  ? 327 TYR A CG  1 
ATOM   2519  C  CD1 . TYR A 1 327 ? 115.950 110.581 108.417 1.00 52.12  ? 327 TYR A CD1 1 
ATOM   2520  C  CD2 . TYR A 1 327 ? 117.578 111.718 107.110 1.00 52.12  ? 327 TYR A CD2 1 
ATOM   2521  C  CE1 . TYR A 1 327 ? 116.604 110.932 109.563 1.00 52.12  ? 327 TYR A CE1 1 
ATOM   2522  C  CE2 . TYR A 1 327 ? 118.247 112.075 108.260 1.00 52.12  ? 327 TYR A CE2 1 
ATOM   2523  C  CZ  . TYR A 1 327 ? 117.750 111.676 109.480 1.00 52.12  ? 327 TYR A CZ  1 
ATOM   2524  O  OH  . TYR A 1 327 ? 118.400 112.021 110.637 1.00 52.12  ? 327 TYR A OH  1 
ATOM   2525  N  N   . PHE A 1 328 ? 114.849 113.529 105.031 1.00 49.20  ? 328 PHE A N   1 
ATOM   2526  C  CA  . PHE A 1 328 ? 114.951 114.962 105.208 1.00 49.20  ? 328 PHE A CA  1 
ATOM   2527  C  C   . PHE A 1 328 ? 113.578 115.588 105.367 1.00 49.20  ? 328 PHE A C   1 
ATOM   2528  O  O   . PHE A 1 328 ? 113.428 116.566 106.104 1.00 49.20  ? 328 PHE A O   1 
ATOM   2529  C  CB  . PHE A 1 328 ? 115.658 115.578 104.011 1.00 49.20  ? 328 PHE A CB  1 
ATOM   2530  C  CG  . PHE A 1 328 ? 115.944 117.028 104.166 1.00 49.20  ? 328 PHE A CG  1 
ATOM   2531  C  CD1 . PHE A 1 328 ? 116.880 117.465 105.082 1.00 49.20  ? 328 PHE A CD1 1 
ATOM   2532  C  CD2 . PHE A 1 328 ? 115.239 117.958 103.431 1.00 49.20  ? 328 PHE A CD2 1 
ATOM   2533  C  CE1 . PHE A 1 328 ? 117.140 118.809 105.235 1.00 49.20  ? 328 PHE A CE1 1 
ATOM   2534  C  CE2 . PHE A 1 328 ? 115.485 119.299 103.581 1.00 49.20  ? 328 PHE A CE2 1 
ATOM   2535  C  CZ  . PHE A 1 328 ? 116.439 119.727 104.487 1.00 49.20  ? 328 PHE A CZ  1 
ATOM   2536  N  N   . SER A 1 329 ? 112.568 115.024 104.704 1.00 42.26  ? 329 SER A N   1 
ATOM   2537  C  CA  . SER A 1 329 ? 111.198 115.488 104.886 1.00 42.26  ? 329 SER A CA  1 
ATOM   2538  C  C   . SER A 1 329 ? 110.693 115.230 106.292 1.00 42.26  ? 329 SER A C   1 
ATOM   2539  O  O   . SER A 1 329 ? 109.983 116.062 106.864 1.00 42.26  ? 329 SER A O   1 
ATOM   2540  C  CB  . SER A 1 329 ? 110.278 114.804 103.889 1.00 42.26  ? 329 SER A CB  1 
ATOM   2541  O  OG  . SER A 1 329 ? 108.940 115.212 104.098 1.00 42.26  ? 329 SER A OG  1 
ATOM   2542  N  N   . LEU A 1 330 ? 111.042 114.082 106.857 1.00 45.98  ? 330 LEU A N   1 
ATOM   2543  C  CA  . LEU A 1 330 ? 110.698 113.799 108.241 1.00 45.98  ? 330 LEU A CA  1 
ATOM   2544  C  C   . LEU A 1 330 ? 111.425 114.724 109.199 1.00 45.98  ? 330 LEU A C   1 
ATOM   2545  O  O   . LEU A 1 330 ? 110.878 115.081 110.247 1.00 45.98  ? 330 LEU A O   1 
ATOM   2546  C  CB  . LEU A 1 330 ? 110.997 112.341 108.563 1.00 45.98  ? 330 LEU A CB  1 
ATOM   2547  C  CG  . LEU A 1 330 ? 110.172 111.324 107.777 1.00 45.98  ? 330 LEU A CG  1 
ATOM   2548  C  CD1 . LEU A 1 330 ? 110.265 109.977 108.433 1.00 45.98  ? 330 LEU A CD1 1 
ATOM   2549  C  CD2 . LEU A 1 330 ? 108.718 111.746 107.678 1.00 45.98  ? 330 LEU A CD2 1 
ATOM   2550  N  N   . TYR A 1 331 ? 112.641 115.134 108.850 1.00 49.85  ? 331 TYR A N   1 
ATOM   2551  C  CA  . TYR A 1 331 ? 113.394 116.033 109.711 1.00 49.85  ? 331 TYR A CA  1 
ATOM   2552  C  C   . TYR A 1 331 ? 112.774 117.421 109.750 1.00 49.85  ? 331 TYR A C   1 
ATOM   2553  O  O   . TYR A 1 331 ? 112.755 118.063 110.803 1.00 49.85  ? 331 TYR A O   1 
ATOM   2554  C  CB  . TYR A 1 331 ? 114.835 116.108 109.231 1.00 49.85  ? 331 TYR A CB  1 
ATOM   2555  C  CG  . TYR A 1 331 ? 115.718 116.982 110.069 1.00 49.85  ? 331 TYR A CG  1 
ATOM   2556  C  CD1 . TYR A 1 331 ? 116.012 116.642 111.374 1.00 49.85  ? 331 TYR A CD1 1 
ATOM   2557  C  CD2 . TYR A 1 331 ? 116.266 118.144 109.555 1.00 49.85  ? 331 TYR A CD2 1 
ATOM   2558  C  CE1 . TYR A 1 331 ? 116.826 117.435 112.149 1.00 49.85  ? 331 TYR A CE1 1 
ATOM   2559  C  CE2 . TYR A 1 331 ? 117.084 118.942 110.321 1.00 49.85  ? 331 TYR A CE2 1 
ATOM   2560  C  CZ  . TYR A 1 331 ? 117.358 118.582 111.620 1.00 49.85  ? 331 TYR A CZ  1 
ATOM   2561  O  OH  . TYR A 1 331 ? 118.169 119.368 112.399 1.00 49.85  ? 331 TYR A OH  1 
ATOM   2562  N  N   . VAL A 1 332 ? 112.279 117.908 108.613 1.00 47.26  ? 332 VAL A N   1 
ATOM   2563  C  CA  . VAL A 1 332 ? 111.549 119.171 108.615 1.00 47.26  ? 332 VAL A CA  1 
ATOM   2564  C  C   . VAL A 1 332 ? 110.233 119.060 109.383 1.00 47.26  ? 332 VAL A C   1 
ATOM   2565  O  O   . VAL A 1 332 ? 109.825 120.012 110.061 1.00 47.26  ? 332 VAL A O   1 
ATOM   2566  C  CB  . VAL A 1 332 ? 111.324 119.624 107.157 1.00 47.26  ? 332 VAL A CB  1 
ATOM   2567  C  CG1 . VAL A 1 332 ? 110.547 120.925 107.076 1.00 47.26  ? 332 VAL A CG1 1 
ATOM   2568  C  CG2 . VAL A 1 332 ? 112.646 119.772 106.444 1.00 47.26  ? 332 VAL A CG2 1 
ATOM   2569  N  N   . MET A 1 333 ? 109.582 117.894 109.348 1.00 45.29  ? 333 MET A N   1 
ATOM   2570  C  CA  . MET A 1 333 ? 108.380 117.679 110.152 1.00 45.29  ? 333 MET A CA  1 
ATOM   2571  C  C   . MET A 1 333 ? 108.649 117.753 111.651 1.00 45.29  ? 333 MET A C   1 
ATOM   2572  O  O   . MET A 1 333 ? 107.896 118.399 112.389 1.00 45.29  ? 333 MET A O   1 
ATOM   2573  C  CB  . MET A 1 333 ? 107.742 116.340 109.810 1.00 45.29  ? 333 MET A CB  1 
ATOM   2574  C  CG  . MET A 1 333 ? 106.505 116.078 110.631 1.00 45.29  ? 333 MET A CG  1 
ATOM   2575  S  SD  . MET A 1 333 ? 105.880 114.411 110.513 1.00 45.29  ? 333 MET A SD  1 
ATOM   2576  C  CE  . MET A 1 333 ? 107.009 113.577 111.616 1.00 45.29  ? 333 MET A CE  1 
ATOM   2577  N  N   . MET A 1 334 ? 109.750 117.162 112.109 1.00 50.19  ? 334 MET A N   1 
ATOM   2578  C  CA  . MET A 1 334 ? 110.081 117.196 113.530 1.00 50.19  ? 334 MET A CA  1 
ATOM   2579  C  C   . MET A 1 334 ? 110.438 118.591 114.013 1.00 50.19  ? 334 MET A C   1 
ATOM   2580  O  O   . MET A 1 334 ? 110.153 118.932 115.164 1.00 50.19  ? 334 MET A O   1 
ATOM   2581  C  CB  . MET A 1 334 ? 111.239 116.249 113.824 1.00 50.19  ? 334 MET A CB  1 
ATOM   2582  C  CG  . MET A 1 334 ? 110.939 114.791 113.594 1.00 50.19  ? 334 MET A CG  1 
ATOM   2583  S  SD  . MET A 1 334 ? 109.387 114.257 114.328 1.00 50.19  ? 334 MET A SD  1 
ATOM   2584  C  CE  . MET A 1 334 ? 109.773 114.371 116.070 1.00 50.19  ? 334 MET A CE  1 
ATOM   2585  N  N   . ILE A 1 335 ? 111.056 119.396 113.152 1.00 50.15  ? 335 ILE A N   1 
ATOM   2586  C  CA  . ILE A 1 335 ? 111.320 120.797 113.458 1.00 50.15  ? 335 ILE A CA  1 
ATOM   2587  C  C   . ILE A 1 335 ? 110.025 121.569 113.678 1.00 50.15  ? 335 ILE A C   1 
ATOM   2588  O  O   . ILE A 1 335 ? 109.922 122.385 114.603 1.00 50.15  ? 335 ILE A O   1 
ATOM   2589  C  CB  . ILE A 1 335 ? 112.170 121.410 112.334 1.00 50.15  ? 335 ILE A CB  1 
ATOM   2590  C  CG1 . ILE A 1 335 ? 113.578 120.841 112.397 1.00 50.15  ? 335 ILE A CG1 1 
ATOM   2591  C  CG2 . ILE A 1 335 ? 112.256 122.912 112.461 1.00 50.15  ? 335 ILE A CG2 1 
ATOM   2592  C  CD1 . ILE A 1 335 ? 114.454 121.285 111.260 1.00 50.15  ? 335 ILE A CD1 1 
ATOM   2593  N  N   . TYR A 1 336 ? 109.006 121.287 112.870 1.00 46.72  ? 336 TYR A N   1 
ATOM   2594  C  CA  . TYR A 1 336 ? 107.714 121.951 113.009 1.00 46.72  ? 336 TYR A CA  1 
ATOM   2595  C  C   . TYR A 1 336 ? 107.030 121.629 114.329 1.00 46.72  ? 336 TYR A C   1 
ATOM   2596  O  O   . TYR A 1 336 ? 106.374 122.495 114.917 1.00 46.72  ? 336 TYR A O   1 
ATOM   2597  C  CB  . TYR A 1 336 ? 106.809 121.536 111.859 1.00 46.72  ? 336 TYR A CB  1 
ATOM   2598  C  CG  . TYR A 1 336 ? 105.329 121.676 112.119 1.00 46.72  ? 336 TYR A CG  1 
ATOM   2599  C  CD1 . TYR A 1 336 ? 104.738 122.920 112.208 1.00 46.72  ? 336 TYR A CD1 1 
ATOM   2600  C  CD2 . TYR A 1 336 ? 104.530 120.562 112.302 1.00 46.72  ? 336 TYR A CD2 1 
ATOM   2601  C  CE1 . TYR A 1 336 ? 103.397 123.051 112.439 1.00 46.72  ? 336 TYR A CE1 1 
ATOM   2602  C  CE2 . TYR A 1 336 ? 103.189 120.684 112.537 1.00 46.72  ? 336 TYR A CE2 1 
ATOM   2603  C  CZ  . TYR A 1 336 ? 102.630 121.931 112.604 1.00 46.72  ? 336 TYR A CZ  1 
ATOM   2604  O  OH  . TYR A 1 336 ? 101.287 122.064 112.835 1.00 46.72  ? 336 TYR A OH  1 
ATOM   2605  N  N   . PHE A 1 337 ? 107.171 120.405 114.820 1.00 47.84  ? 337 PHE A N   1 
ATOM   2606  C  CA  . PHE A 1 337 ? 106.509 120.069 116.074 1.00 47.84  ? 337 PHE A CA  1 
ATOM   2607  C  C   . PHE A 1 337 ? 107.177 120.703 117.285 1.00 47.84  ? 337 PHE A C   1 
ATOM   2608  O  O   . PHE A 1 337 ? 106.487 121.038 118.254 1.00 47.84  ? 337 PHE A O   1 
ATOM   2609  C  CB  . PHE A 1 337 ? 106.402 118.566 116.180 1.00 47.84  ? 337 PHE A CB  1 
ATOM   2610  C  CG  . PHE A 1 337 ? 105.221 118.061 115.464 1.00 47.84  ? 337 PHE A CG  1 
ATOM   2611  C  CD1 . PHE A 1 337 ? 103.961 118.303 115.946 1.00 47.84  ? 337 PHE A CD1 1 
ATOM   2612  C  CD2 . PHE A 1 337 ? 105.364 117.484 114.221 1.00 47.84  ? 337 PHE A CD2 1 
ATOM   2613  C  CE1 . PHE A 1 337 ? 102.867 117.886 115.244 1.00 47.84  ? 337 PHE A CE1 1 
ATOM   2614  C  CE2 . PHE A 1 337 ? 104.276 117.072 113.511 1.00 47.84  ? 337 PHE A CE2 1 
ATOM   2615  C  CZ  . PHE A 1 337 ? 103.029 117.272 114.020 1.00 47.84  ? 337 PHE A CZ  1 
ATOM   2616  N  N   . ASP A 1 338 ? 108.498 120.879 117.255 1.00 57.39  ? 338 ASP A N   1 
ATOM   2617  C  CA  . ASP A 1 338 ? 109.150 121.654 118.304 1.00 57.39  ? 338 ASP A CA  1 
ATOM   2618  C  C   . ASP A 1 338 ? 108.692 123.100 118.258 1.00 57.39  ? 338 ASP A C   1 
ATOM   2619  O  O   . ASP A 1 338 ? 108.541 123.741 119.302 1.00 57.39  ? 338 ASP A O   1 
ATOM   2620  C  CB  . ASP A 1 338 ? 110.668 121.557 118.190 1.00 57.39  ? 338 ASP A CB  1 
ATOM   2621  C  CG  . ASP A 1 338 ? 111.185 120.171 118.513 1.00 57.39  ? 338 ASP A CG  1 
ATOM   2622  O  OD1 . ASP A 1 338 ? 110.400 119.362 119.048 1.00 57.39  ? 338 ASP A OD1 1 
ATOM   2623  O  OD2 . ASP A 1 338 ? 112.372 119.887 118.240 1.00 57.39  ? 338 ASP A OD2 1 
ATOM   2624  N  N   . MET A 1 339 ? 108.466 123.625 117.054 1.00 59.80  ? 339 MET A N   1 
ATOM   2625  C  CA  . MET A 1 339 ? 107.912 124.964 116.913 1.00 59.80  ? 339 MET A CA  1 
ATOM   2626  C  C   . MET A 1 339 ? 106.491 125.036 117.446 1.00 59.80  ? 339 MET A C   1 
ATOM   2627  O  O   . MET A 1 339 ? 106.098 126.061 118.011 1.00 59.80  ? 339 MET A O   1 
ATOM   2628  C  CB  . MET A 1 339 ? 107.931 125.375 115.442 1.00 59.80  ? 339 MET A CB  1 
ATOM   2629  C  CG  . MET A 1 339 ? 107.390 126.756 115.140 1.00 59.80  ? 339 MET A CG  1 
ATOM   2630  S  SD  . MET A 1 339 ? 108.140 127.474 113.671 1.00 59.80  ? 339 MET A SD  1 
ATOM   2631  C  CE  . MET A 1 339 ? 109.859 127.566 114.157 1.00 59.80  ? 339 MET A CE  1 
ATOM   2632  N  N   . GLU A 1 340 ? 105.713 123.969 117.286 1.00 56.30  ? 340 GLU A N   1 
ATOM   2633  C  CA  . GLU A 1 340 ? 104.358 123.965 117.822 1.00 56.30  ? 340 GLU A CA  1 
ATOM   2634  C  C   . GLU A 1 340 ? 104.355 123.964 119.347 1.00 56.30  ? 340 GLU A C   1 
ATOM   2635  O  O   . GLU A 1 340 ? 103.580 124.696 119.975 1.00 56.30  ? 340 GLU A O   1 
ATOM   2636  C  CB  . GLU A 1 340 ? 103.582 122.776 117.273 1.00 56.30  ? 340 GLU A CB  1 
ATOM   2637  C  CG  . GLU A 1 340 ? 102.167 122.703 117.779 1.00 56.30  ? 340 GLU A CG  1 
ATOM   2638  C  CD  . GLU A 1 340 ? 101.221 123.494 116.908 1.00 56.30  ? 340 GLU A CD  1 
ATOM   2639  O  OE1 . GLU A 1 340 ? 101.513 123.651 115.709 1.00 56.30  ? 340 GLU A OE1 1 
ATOM   2640  O  OE2 . GLU A 1 340 ? 100.186 123.962 117.415 1.00 56.30  ? 340 GLU A OE2 1 
ATOM   2641  N  N   . VAL A 1 341 ? 105.229 123.160 119.959 1.00 65.89  ? 341 VAL A N   1 
ATOM   2642  C  CA  . VAL A 1 341 ? 105.339 123.137 121.416 1.00 65.89  ? 341 VAL A CA  1 
ATOM   2643  C  C   . VAL A 1 341 ? 105.869 124.462 121.943 1.00 65.89  ? 341 VAL A C   1 
ATOM   2644  O  O   . VAL A 1 341 ? 105.399 124.966 122.972 1.00 65.89  ? 341 VAL A O   1 
ATOM   2645  C  CB  . VAL A 1 341 ? 106.227 121.950 121.833 1.00 65.89  ? 341 VAL A CB  1 
ATOM   2646  C  CG1 . VAL A 1 341 ? 106.583 122.001 123.307 1.00 65.89  ? 341 VAL A CG1 1 
ATOM   2647  C  CG2 . VAL A 1 341 ? 105.527 120.645 121.511 1.00 65.89  ? 341 VAL A CG2 1 
ATOM   2648  N  N   . TRP A 1 342 ? 106.813 125.067 121.223 1.00 71.09  ? 342 TRP A N   1 
ATOM   2649  C  CA  . TRP A 1 342 ? 107.314 126.384 121.586 1.00 71.09  ? 342 TRP A CA  1 
ATOM   2650  C  C   . TRP A 1 342 ? 106.224 127.436 121.466 1.00 71.09  ? 342 TRP A C   1 
ATOM   2651  O  O   . TRP A 1 342 ? 106.119 128.328 122.314 1.00 71.09  ? 342 TRP A O   1 
ATOM   2652  C  CB  . TRP A 1 342 ? 108.503 126.735 120.698 1.00 71.09  ? 342 TRP A CB  1 
ATOM   2653  C  CG  . TRP A 1 342 ? 108.939 128.141 120.775 1.00 71.09  ? 342 TRP A CG  1 
ATOM   2654  C  CD1 . TRP A 1 342 ? 109.856 128.662 121.623 1.00 71.09  ? 342 TRP A CD1 1 
ATOM   2655  C  CD2 . TRP A 1 342 ? 108.497 129.220 119.944 1.00 71.09  ? 342 TRP A CD2 1 
ATOM   2656  N  NE1 . TRP A 1 342 ? 110.007 130.007 121.388 1.00 71.09  ? 342 TRP A NE1 1 
ATOM   2657  C  CE2 . TRP A 1 342 ? 109.179 130.372 120.360 1.00 71.09  ? 342 TRP A CE2 1 
ATOM   2658  C  CE3 . TRP A 1 342 ? 107.575 129.324 118.900 1.00 71.09  ? 342 TRP A CE3 1 
ATOM   2659  C  CZ2 . TRP A 1 342 ? 108.980 131.609 119.763 1.00 71.09  ? 342 TRP A CZ2 1 
ATOM   2660  C  CZ3 . TRP A 1 342 ? 107.378 130.551 118.310 1.00 71.09  ? 342 TRP A CZ3 1 
ATOM   2661  C  CH2 . TRP A 1 342 ? 108.077 131.677 118.740 1.00 71.09  ? 342 TRP A CH2 1 
ATOM   2662  N  N   . ALA A 1 343 ? 105.409 127.350 120.419 1.00 68.55  ? 343 ALA A N   1 
ATOM   2663  C  CA  . ALA A 1 343 ? 104.312 128.292 120.275 1.00 68.55  ? 343 ALA A CA  1 
ATOM   2664  C  C   . ALA A 1 343 ? 103.214 128.039 121.287 1.00 68.55  ? 343 ALA A C   1 
ATOM   2665  O  O   . ALA A 1 343 ? 102.548 128.985 121.713 1.00 68.55  ? 343 ALA A O   1 
ATOM   2666  C  CB  . ALA A 1 343 ? 103.738 128.237 118.865 1.00 68.55  ? 343 ALA A CB  1 
ATOM   2667  N  N   . LEU A 1 344 ? 102.999 126.783 121.673 1.00 69.15  ? 344 LEU A N   1 
ATOM   2668  C  CA  . LEU A 1 344 ? 102.049 126.518 122.743 1.00 69.15  ? 344 LEU A CA  1 
ATOM   2669  C  C   . LEU A 1 344 ? 102.556 127.045 124.078 1.00 69.15  ? 344 LEU A C   1 
ATOM   2670  O  O   . LEU A 1 344 ? 101.778 127.582 124.875 1.00 69.15  ? 344 LEU A O   1 
ATOM   2671  C  CB  . LEU A 1 344 ? 101.754 125.027 122.834 1.00 69.15  ? 344 LEU A CB  1 
ATOM   2672  C  CG  . LEU A 1 344 ? 100.538 124.725 123.704 1.00 69.15  ? 344 LEU A CG  1 
ATOM   2673  C  CD1 . LEU A 1 344 ? 99.297  125.322 123.089 1.00 69.15  ? 344 LEU A CD1 1 
ATOM   2674  C  CD2 . LEU A 1 344 ? 100.380 123.227 123.883 1.00 69.15  ? 344 LEU A CD2 1 
ATOM   2675  N  N   . GLY A 1 345 ? 103.860 126.908 124.331 1.00 79.96  ? 345 GLY A N   1 
ATOM   2676  C  CA  . GLY A 1 345 ? 104.442 127.510 125.519 1.00 79.96  ? 345 GLY A CA  1 
ATOM   2677  C  C   . GLY A 1 345 ? 104.420 129.025 125.486 1.00 79.96  ? 345 GLY A C   1 
ATOM   2678  O  O   . GLY A 1 345 ? 104.218 129.673 126.515 1.00 79.96  ? 345 GLY A O   1 
ATOM   2679  N  N   . LEU A 1 346 ? 104.621 129.607 124.302 1.00 79.18  ? 346 LEU A N   1 
ATOM   2680  C  CA  . LEU A 1 346 ? 104.502 131.052 124.157 1.00 79.18  ? 346 LEU A CA  1 
ATOM   2681  C  C   . LEU A 1 346 ? 103.069 131.505 124.366 1.00 79.18  ? 346 LEU A C   1 
ATOM   2682  O  O   . LEU A 1 346 ? 102.834 132.611 124.858 1.00 79.18  ? 346 LEU A O   1 
ATOM   2683  C  CB  . LEU A 1 346 ? 105.017 131.510 122.796 1.00 79.18  ? 346 LEU A CB  1 
ATOM   2684  C  CG  . LEU A 1 346 ? 105.693 132.885 122.822 1.00 79.18  ? 346 LEU A CG  1 
ATOM   2685  C  CD1 . LEU A 1 346 ? 106.804 132.922 123.853 1.00 79.18  ? 346 LEU A CD1 1 
ATOM   2686  C  CD2 . LEU A 1 346 ? 106.230 133.274 121.468 1.00 79.18  ? 346 LEU A CD2 1 
ATOM   2687  N  N   . HIS A 1 347 ? 102.105 130.676 123.982 1.00 83.02  ? 347 HIS A N   1 
ATOM   2688  C  CA  . HIS A 1 347 ? 100.715 130.986 124.267 1.00 83.02  ? 347 HIS A CA  1 
ATOM   2689  C  C   . HIS A 1 347 ? 100.414 130.885 125.756 1.00 83.02  ? 347 HIS A C   1 
ATOM   2690  O  O   . HIS A 1 347 ? 99.605  131.662 126.278 1.00 83.02  ? 347 HIS A O   1 
ATOM   2691  C  CB  . HIS A 1 347 ? 99.829  130.041 123.468 1.00 83.02  ? 347 HIS A CB  1 
ATOM   2692  C  CG  . HIS A 1 347 ? 98.478  129.824 124.063 1.00 83.02  ? 347 HIS A CG  1 
ATOM   2693  N  ND1 . HIS A 1 347 ? 98.208  128.793 124.938 1.00 83.02  ? 347 HIS A ND1 1 
ATOM   2694  C  CD2 . HIS A 1 347 ? 97.316  130.493 123.898 1.00 83.02  ? 347 HIS A CD2 1 
ATOM   2695  C  CE1 . HIS A 1 347 ? 96.939  128.847 125.296 1.00 83.02  ? 347 HIS A CE1 1 
ATOM   2696  N  NE2 . HIS A 1 347 ? 96.375  129.869 124.678 1.00 83.02  ? 347 HIS A NE2 1 
ATOM   2697  N  N   . GLU A 1 348 ? 101.043 129.936 126.451 1.00 82.46  ? 348 GLU A N   1 
ATOM   2698  C  CA  . GLU A 1 348 ? 100.933 129.839 127.905 1.00 82.46  ? 348 GLU A CA  1 
ATOM   2699  C  C   . GLU A 1 348 ? 101.601 131.010 128.617 1.00 82.46  ? 348 GLU A C   1 
ATOM   2700  O  O   . GLU A 1 348 ? 101.206 131.367 129.730 1.00 82.46  ? 348 GLU A O   1 
ATOM   2701  C  CB  . GLU A 1 348 ? 101.544 128.524 128.388 1.00 82.46  ? 348 GLU A CB  1 
ATOM   2702  N  N   . ASN A 1 349 ? 102.589 131.622 127.978 1.00 82.72  ? 349 ASN A N   1 
ATOM   2703  C  CA  . ASN A 1 349 ? 103.375 132.691 128.577 1.00 82.72  ? 349 ASN A CA  1 
ATOM   2704  C  C   . ASN A 1 349 ? 102.670 134.038 128.487 1.00 82.72  ? 349 ASN A C   1 
ATOM   2705  O  O   . ASN A 1 349 ? 102.402 134.677 129.509 1.00 82.72  ? 349 ASN A O   1 
ATOM   2706  C  CB  . ASN A 1 349 ? 104.735 132.762 127.881 1.00 82.72  ? 349 ASN A CB  1 
ATOM   2707  C  CG  . ASN A 1 349 ? 105.707 133.692 128.571 1.00 82.72  ? 349 ASN A CG  1 
ATOM   2708  O  OD1 . ASN A 1 349 ? 105.479 134.138 129.692 1.00 82.72  ? 349 ASN A OD1 1 
ATOM   2709  N  ND2 . ASN A 1 349 ? 106.801 134.001 127.890 1.00 82.72  ? 349 ASN A ND2 1 
ATOM   2710  N  N   . SER A 1 350 ? 102.331 134.466 127.277 1.00 84.06  ? 350 SER A N   1 
ATOM   2711  C  CA  . SER A 1 350 ? 102.099 135.868 126.956 1.00 84.06  ? 350 SER A CA  1 
ATOM   2712  C  C   . SER A 1 350 ? 100.752 136.435 127.382 1.00 84.06  ? 350 SER A C   1 
ATOM   2713  O  O   . SER A 1 350 ? 100.707 137.351 128.209 1.00 84.06  ? 350 SER A O   1 
ATOM   2714  C  CB  . SER A 1 350 ? 102.265 136.088 125.452 1.00 84.06  ? 350 SER A CB  1 
ATOM   2715  O  OG  . SER A 1 350 ? 103.145 137.166 125.194 1.00 84.06  ? 350 SER A OG  1 
ATOM   2716  N  N   . GLY A 1 351 ? 99.653  135.919 126.846 1.00 91.44  ? 351 GLY A N   1 
ATOM   2717  C  CA  . GLY A 1 351 ? 98.401  136.611 127.067 1.00 91.44  ? 351 GLY A CA  1 
ATOM   2718  C  C   . GLY A 1 351 ? 97.103  135.918 126.717 1.00 91.44  ? 351 GLY A C   1 
ATOM   2719  O  O   . GLY A 1 351 ? 96.981  134.690 126.764 1.00 91.44  ? 351 GLY A O   1 
ATOM   2720  N  N   . SER A 1 352 ? 96.117  136.746 126.378 1.00 98.86  ? 352 SER A N   1 
ATOM   2721  C  CA  . SER A 1 352 ? 94.727  136.387 126.138 1.00 98.86  ? 352 SER A CA  1 
ATOM   2722  C  C   . SER A 1 352 ? 94.404  136.822 124.719 1.00 98.86  ? 352 SER A C   1 
ATOM   2723  O  O   . SER A 1 352 ? 93.614  136.177 124.023 1.00 98.86  ? 352 SER A O   1 
ATOM   2724  C  CB  . SER A 1 352 ? 93.804  137.061 127.152 1.00 98.86  ? 352 SER A CB  1 
ATOM   2725  N  N   . GLU A 1 353 ? 94.987  137.937 124.300 1.00 106.64 ? 353 GLU A N   1 
ATOM   2726  C  CA  . GLU A 1 353 ? 94.688  138.526 123.007 1.00 106.64 ? 353 GLU A CA  1 
ATOM   2727  C  C   . GLU A 1 353 ? 95.310  137.721 121.879 1.00 106.64 ? 353 GLU A C   1 
ATOM   2728  O  O   . GLU A 1 353 ? 94.619  137.392 120.908 1.00 106.64 ? 353 GLU A O   1 
ATOM   2729  C  CB  . GLU A 1 353 ? 95.192  139.971 122.944 1.00 106.64 ? 353 GLU A CB  1 
ATOM   2730  C  CG  . GLU A 1 353 ? 94.289  140.973 123.638 1.00 106.64 ? 353 GLU A CG  1 
ATOM   2731  C  CD  . GLU A 1 353 ? 93.914  142.129 122.738 1.00 106.64 ? 353 GLU A CD  1 
ATOM   2732  O  OE1 . GLU A 1 353 ? 94.800  142.629 122.015 1.00 106.64 ? 353 GLU A OE1 1 
ATOM   2733  O  OE2 . GLU A 1 353 ? 92.732  142.529 122.745 1.00 106.64 ? 353 GLU A OE2 1 
ATOM   2734  N  N   . TRP A 1 354 ? 96.590  137.376 122.002 1.00 100.63 ? 354 TRP A N   1 
ATOM   2735  C  CA  . TRP A 1 354 ? 97.319  136.616 120.998 1.00 100.63 ? 354 TRP A CA  1 
ATOM   2736  C  C   . TRP A 1 354 ? 97.289  135.134 121.330 1.00 100.63 ? 354 TRP A C   1 
ATOM   2737  O  O   . TRP A 1 354 ? 98.305  134.441 121.234 1.00 100.63 ? 354 TRP A O   1 
ATOM   2738  C  CB  . TRP A 1 354 ? 98.762  137.109 120.939 1.00 100.63 ? 354 TRP A CB  1 
ATOM   2739  C  CG  . TRP A 1 354 ? 98.905  138.457 120.333 1.00 100.63 ? 354 TRP A CG  1 
ATOM   2740  C  CD1 . TRP A 1 354 ? 98.477  139.637 120.862 1.00 100.63 ? 354 TRP A CD1 1 
ATOM   2741  C  CD2 . TRP A 1 354 ? 99.543  138.781 119.097 1.00 100.63 ? 354 TRP A CD2 1 
ATOM   2742  N  NE1 . TRP A 1 354 ? 98.791  140.674 120.027 1.00 100.63 ? 354 TRP A NE1 1 
ATOM   2743  C  CE2 . TRP A 1 354 ? 99.449  140.177 118.934 1.00 100.63 ? 354 TRP A CE2 1 
ATOM   2744  C  CE3 . TRP A 1 354 ? 100.177 138.026 118.106 1.00 100.63 ? 354 TRP A CE3 1 
ATOM   2745  C  CZ2 . TRP A 1 354 ? 99.965  140.836 117.822 1.00 100.63 ? 354 TRP A CZ2 1 
ATOM   2746  C  CZ3 . TRP A 1 354 ? 100.690 138.680 117.002 1.00 100.63 ? 354 TRP A CZ3 1 
ATOM   2747  C  CH2 . TRP A 1 354 ? 100.581 140.072 116.868 1.00 100.63 ? 354 TRP A CH2 1 
ATOM   2748  N  N   . THR A 1 355 ? 96.117  134.649 121.732 1.00 97.86  ? 355 THR A N   1 
ATOM   2749  C  CA  . THR A 1 355 ? 95.953  133.268 122.162 1.00 97.86  ? 355 THR A CA  1 
ATOM   2750  C  C   . THR A 1 355 ? 95.260  132.412 121.103 1.00 97.86  ? 355 THR A C   1 
ATOM   2751  O  O   . THR A 1 355 ? 95.506  131.202 121.007 1.00 97.86  ? 355 THR A O   1 
ATOM   2752  C  CB  . THR A 1 355 ? 95.178  133.292 123.500 1.00 97.86  ? 355 THR A CB  1 
ATOM   2753  O  OG1 . THR A 1 355 ? 96.093  133.234 124.604 1.00 97.86  ? 355 THR A OG1 1 
ATOM   2754  C  CG2 . THR A 1 355 ? 94.099  132.200 123.649 1.00 97.86  ? 355 THR A CG2 1 
ATOM   2755  N  N   . SER A 1 356 ? 94.527  133.041 120.191 1.00 91.88  ? 356 SER A N   1 
ATOM   2756  C  CA  . SER A 1 356 ? 94.082  132.316 119.010 1.00 91.88  ? 356 SER A CA  1 
ATOM   2757  C  C   . SER A 1 356 ? 94.846  132.595 117.726 1.00 91.88  ? 356 SER A C   1 
ATOM   2758  O  O   . SER A 1 356 ? 94.873  131.713 116.862 1.00 91.88  ? 356 SER A O   1 
ATOM   2759  C  CB  . SER A 1 356 ? 92.600  132.600 118.754 1.00 91.88  ? 356 SER A CB  1 
ATOM   2760  O  OG  . SER A 1 356 ? 92.430  133.820 118.056 1.00 91.88  ? 356 SER A OG  1 
ATOM   2761  N  N   . VAL A 1 357 ? 95.475  133.750 117.548 1.00 85.49  ? 357 VAL A N   1 
ATOM   2762  C  CA  . VAL A 1 357 ? 96.159  133.945 116.276 1.00 85.49  ? 357 VAL A CA  1 
ATOM   2763  C  C   . VAL A 1 357 ? 97.522  133.271 116.282 1.00 85.49  ? 357 VAL A C   1 
ATOM   2764  O  O   . VAL A 1 357 ? 98.010  132.814 115.246 1.00 85.49  ? 357 VAL A O   1 
ATOM   2765  C  CB  . VAL A 1 357 ? 96.255  135.465 116.001 1.00 85.49  ? 357 VAL A CB  1 
ATOM   2766  C  CG1 . VAL A 1 357 ? 97.067  135.804 114.762 1.00 85.49  ? 357 VAL A CG1 1 
ATOM   2767  C  CG2 . VAL A 1 357 ? 94.870  136.050 115.886 1.00 85.49  ? 357 VAL A CG2 1 
ATOM   2768  N  N   . LEU A 1 358 ? 98.128  133.115 117.455 1.00 84.16  ? 358 LEU A N   1 
ATOM   2769  C  CA  . LEU A 1 358 ? 99.412  132.432 117.500 1.00 84.16  ? 358 LEU A CA  1 
ATOM   2770  C  C   . LEU A 1 358 ? 99.268  130.934 117.258 1.00 84.16  ? 358 LEU A C   1 
ATOM   2771  O  O   . LEU A 1 358 ? 100.232 130.275 116.859 1.00 84.16  ? 358 LEU A O   1 
ATOM   2772  C  CB  . LEU A 1 358 ? 100.099 132.696 118.834 1.00 84.16  ? 358 LEU A CB  1 
ATOM   2773  C  CG  . LEU A 1 358 ? 101.592 132.374 118.908 1.00 84.16  ? 358 LEU A CG  1 
ATOM   2774  C  CD1 . LEU A 1 358 ? 102.342 133.072 117.784 1.00 84.16  ? 358 LEU A CD1 1 
ATOM   2775  C  CD2 . LEU A 1 358 ? 102.151 132.765 120.266 1.00 84.16  ? 358 LEU A CD2 1 
ATOM   2776  N  N   . LEU A 1 359 ? 98.069  130.379 117.448 1.00 74.84  ? 359 LEU A N   1 
ATOM   2777  C  CA  . LEU A 1 359 ? 97.911  128.956 117.187 1.00 74.84  ? 359 LEU A CA  1 
ATOM   2778  C  C   . LEU A 1 359 ? 97.794  128.616 115.708 1.00 74.84  ? 359 LEU A C   1 
ATOM   2779  O  O   . LEU A 1 359 ? 98.022  127.465 115.329 1.00 74.84  ? 359 LEU A O   1 
ATOM   2780  C  CB  . LEU A 1 359 ? 96.682  128.453 117.930 1.00 74.84  ? 359 LEU A CB  1 
ATOM   2781  C  CG  . LEU A 1 359 ? 96.915  127.993 119.367 1.00 74.84  ? 359 LEU A CG  1 
ATOM   2782  C  CD1 . LEU A 1 359 ? 95.660  127.332 119.918 1.00 74.84  ? 359 LEU A CD1 1 
ATOM   2783  C  CD2 . LEU A 1 359 ? 98.111  127.063 119.461 1.00 74.84  ? 359 LEU A CD2 1 
ATOM   2784  N  N   . TYR A 1 360 ? 97.454  129.572 114.858 1.00 71.13  ? 360 TYR A N   1 
ATOM   2785  C  CA  . TYR A 1 360 ? 97.349  129.274 113.438 1.00 71.13  ? 360 TYR A CA  1 
ATOM   2786  C  C   . TYR A 1 360 ? 98.607  129.600 112.655 1.00 71.13  ? 360 TYR A C   1 
ATOM   2787  O  O   . TYR A 1 360 ? 98.703  129.220 111.488 1.00 71.13  ? 360 TYR A O   1 
ATOM   2788  C  CB  . TYR A 1 360 ? 96.151  129.981 112.806 1.00 71.13  ? 360 TYR A CB  1 
ATOM   2789  C  CG  . TYR A 1 360 ? 94.826  129.622 113.430 1.00 71.13  ? 360 TYR A CG  1 
ATOM   2790  C  CD1 . TYR A 1 360 ? 94.577  128.338 113.891 1.00 71.13  ? 360 TYR A CD1 1 
ATOM   2791  C  CD2 . TYR A 1 360 ? 93.796  130.552 113.494 1.00 71.13  ? 360 TYR A CD2 1 
ATOM   2792  C  CE1 . TYR A 1 360 ? 93.353  128.007 114.442 1.00 71.13  ? 360 TYR A CE1 1 
ATOM   2793  C  CE2 . TYR A 1 360 ? 92.572  130.229 114.039 1.00 71.13  ? 360 TYR A CE2 1 
ATOM   2794  C  CZ  . TYR A 1 360 ? 92.357  128.959 114.509 1.00 71.13  ? 360 TYR A CZ  1 
ATOM   2795  O  OH  . TYR A 1 360 ? 91.133  128.650 115.050 1.00 71.13  ? 360 TYR A OH  1 
ATOM   2796  N  N   . VAL A 1 361 ? 99.562  130.289 113.260 1.00 62.74  ? 361 VAL A N   1 
ATOM   2797  C  CA  . VAL A 1 361 ? 100.808 130.650 112.591 1.00 62.74  ? 361 VAL A CA  1 
ATOM   2798  C  C   . VAL A 1 361 ? 101.748 129.485 112.274 1.00 62.74  ? 361 VAL A C   1 
ATOM   2799  O  O   . VAL A 1 361 ? 102.194 129.412 111.119 1.00 62.74  ? 361 VAL A O   1 
ATOM   2800  C  CB  . VAL A 1 361 ? 101.533 131.740 113.400 1.00 62.74  ? 361 VAL A CB  1 
ATOM   2801  C  CG1 . VAL A 1 361 ? 102.945 131.970 112.901 1.00 62.74  ? 361 VAL A CG1 1 
ATOM   2802  C  CG2 . VAL A 1 361 ? 100.750 133.013 113.322 1.00 62.74  ? 361 VAL A CG2 1 
ATOM   2803  N  N   . PRO A 1 362 ? 102.085 128.554 113.183 1.00 52.08  ? 362 PRO A N   1 
ATOM   2804  C  CA  . PRO A 1 362 ? 103.072 127.536 112.792 1.00 52.08  ? 362 PRO A CA  1 
ATOM   2805  C  C   . PRO A 1 362 ? 102.592 126.538 111.753 1.00 52.08  ? 362 PRO A C   1 
ATOM   2806  O  O   . PRO A 1 362 ? 103.423 126.021 110.999 1.00 52.08  ? 362 PRO A O   1 
ATOM   2807  C  CB  . PRO A 1 362 ? 103.379 126.831 114.115 1.00 52.08  ? 362 PRO A CB  1 
ATOM   2808  C  CG  . PRO A 1 362 ? 102.153 126.972 114.861 1.00 52.08  ? 362 PRO A CG  1 
ATOM   2809  C  CD  . PRO A 1 362 ? 101.718 128.353 114.596 1.00 52.08  ? 362 PRO A CD  1 
ATOM   2810  N  N   . SER A 1 363 ? 101.294 126.264 111.658 1.00 46.24  ? 363 SER A N   1 
ATOM   2811  C  CA  . SER A 1 363 ? 100.831 125.408 110.573 1.00 46.24  ? 363 SER A CA  1 
ATOM   2812  C  C   . SER A 1 363 ? 100.893 126.120 109.230 1.00 46.24  ? 363 SER A C   1 
ATOM   2813  O  O   . SER A 1 363 ? 101.183 125.494 108.206 1.00 46.24  ? 363 SER A O   1 
ATOM   2814  C  CB  . SER A 1 363 ? 99.412  124.937 110.849 1.00 46.24  ? 363 SER A CB  1 
ATOM   2815  O  OG  . SER A 1 363 ? 98.505  125.993 110.618 1.00 46.24  ? 363 SER A OG  1 
ATOM   2816  N  N   . ILE A 1 364 ? 100.681 127.435 109.223 1.00 46.95  ? 364 ILE A N   1 
ATOM   2817  C  CA  . ILE A 1 364 ? 100.813 128.205 107.991 1.00 46.95  ? 364 ILE A CA  1 
ATOM   2818  C  C   . ILE A 1 364 ? 102.261 128.263 107.546 1.00 46.95  ? 364 ILE A C   1 
ATOM   2819  O  O   . ILE A 1 364 ? 102.556 128.123 106.352 1.00 46.95  ? 364 ILE A O   1 
ATOM   2820  C  CB  . ILE A 1 364 ? 100.189 129.595 108.170 1.00 46.95  ? 364 ILE A CB  1 
ATOM   2821  C  CG1 . ILE A 1 364 ? 98.677  129.446 108.131 1.00 46.95  ? 364 ILE A CG1 1 
ATOM   2822  C  CG2 . ILE A 1 364 ? 100.652 130.571 107.113 1.00 46.95  ? 364 ILE A CG2 1 
ATOM   2823  C  CD1 . ILE A 1 364 ? 97.940  130.671 108.540 1.00 46.95  ? 364 ILE A CD1 1 
ATOM   2824  N  N   . ILE A 1 365 ? 103.185 128.442 108.489 1.00 43.85  ? 365 ILE A N   1 
ATOM   2825  C  CA  . ILE A 1 365 ? 104.599 128.416 108.141 1.00 43.85  ? 365 ILE A CA  1 
ATOM   2826  C  C   . ILE A 1 365 ? 104.976 127.033 107.632 1.00 43.85  ? 365 ILE A C   1 
ATOM   2827  O  O   . ILE A 1 365 ? 105.721 126.893 106.656 1.00 43.85  ? 365 ILE A O   1 
ATOM   2828  C  CB  . ILE A 1 365 ? 105.448 128.830 109.352 1.00 43.85  ? 365 ILE A CB  1 
ATOM   2829  C  CG1 . ILE A 1 365 ? 105.108 130.256 109.767 1.00 43.85  ? 365 ILE A CG1 1 
ATOM   2830  C  CG2 . ILE A 1 365 ? 106.925 128.718 109.042 1.00 43.85  ? 365 ILE A CG2 1 
ATOM   2831  C  CD1 . ILE A 1 365 ? 105.904 130.751 110.960 1.00 43.85  ? 365 ILE A CD1 1 
ATOM   2832  N  N   . TYR A 1 366 ? 104.405 125.998 108.236 1.00 38.76  ? 366 TYR A N   1 
ATOM   2833  C  CA  . TYR A 1 366 ? 104.655 124.648 107.762 1.00 38.76  ? 366 TYR A CA  1 
ATOM   2834  C  C   . TYR A 1 366 ? 104.017 124.397 106.408 1.00 38.76  ? 366 TYR A C   1 
ATOM   2835  O  O   . TYR A 1 366 ? 104.578 123.669 105.583 1.00 38.76  ? 366 TYR A O   1 
ATOM   2836  C  CB  . TYR A 1 366 ? 104.123 123.640 108.769 1.00 38.76  ? 366 TYR A CB  1 
ATOM   2837  C  CG  . TYR A 1 366 ? 104.465 122.222 108.430 1.00 38.76  ? 366 TYR A CG  1 
ATOM   2838  C  CD1 . TYR A 1 366 ? 105.734 121.875 108.022 1.00 38.76  ? 366 TYR A CD1 1 
ATOM   2839  C  CD2 . TYR A 1 366 ? 103.504 121.236 108.492 1.00 38.76  ? 366 TYR A CD2 1 
ATOM   2840  C  CE1 . TYR A 1 366 ? 106.039 120.587 107.703 1.00 38.76  ? 366 TYR A CE1 1 
ATOM   2841  C  CE2 . TYR A 1 366 ? 103.799 119.948 108.181 1.00 38.76  ? 366 TYR A CE2 1 
ATOM   2842  C  CZ  . TYR A 1 366 ? 105.067 119.632 107.782 1.00 38.76  ? 366 TYR A CZ  1 
ATOM   2843  O  OH  . TYR A 1 366 ? 105.366 118.338 107.465 1.00 38.76  ? 366 TYR A OH  1 
ATOM   2844  N  N   . ALA A 1 367 ? 102.860 125.004 106.148 1.00 38.34  ? 367 ALA A N   1 
ATOM   2845  C  CA  . ALA A 1 367 ? 102.224 124.830 104.848 1.00 38.34  ? 367 ALA A CA  1 
ATOM   2846  C  C   . ALA A 1 367 ? 102.991 125.508 103.723 1.00 38.34  ? 367 ALA A C   1 
ATOM   2847  O  O   . ALA A 1 367 ? 103.068 124.973 102.614 1.00 38.34  ? 367 ALA A O   1 
ATOM   2848  C  CB  . ALA A 1 367 ? 100.796 125.350 104.895 1.00 38.34  ? 367 ALA A CB  1 
ATOM   2849  N  N   . ILE A 1 368 ? 103.555 126.683 103.981 1.00 34.65  ? 368 ILE A N   1 
ATOM   2850  C  CA  . ILE A 1 368 ? 104.353 127.355 102.964 1.00 34.65  ? 368 ILE A CA  1 
ATOM   2851  C  C   . ILE A 1 368 ? 105.649 126.604 102.701 1.00 34.65  ? 368 ILE A C   1 
ATOM   2852  O  O   . ILE A 1 368 ? 106.092 126.490 101.553 1.00 34.65  ? 368 ILE A O   1 
ATOM   2853  C  CB  . ILE A 1 368 ? 104.589 128.814 103.372 1.00 34.65  ? 368 ILE A CB  1 
ATOM   2854  C  CG1 . ILE A 1 368 ? 103.246 129.530 103.407 1.00 34.65  ? 368 ILE A CG1 1 
ATOM   2855  C  CG2 . ILE A 1 368 ? 105.475 129.517 102.381 1.00 34.65  ? 368 ILE A CG2 1 
ATOM   2856  C  CD1 . ILE A 1 368 ? 103.323 130.970 103.813 1.00 34.65  ? 368 ILE A CD1 1 
ATOM   2857  N  N   . VAL A 1 369 ? 106.251 126.036 103.743 1.00 35.30  ? 369 VAL A N   1 
ATOM   2858  C  CA  . VAL A 1 369 ? 107.478 125.270 103.556 1.00 35.30  ? 369 VAL A CA  1 
ATOM   2859  C  C   . VAL A 1 369 ? 107.225 123.966 102.813 1.00 35.30  ? 369 VAL A C   1 
ATOM   2860  O  O   . VAL A 1 369 ? 108.056 123.537 102.001 1.00 35.30  ? 369 VAL A O   1 
ATOM   2861  C  CB  . VAL A 1 369 ? 108.129 125.044 104.933 1.00 35.30  ? 369 VAL A CB  1 
ATOM   2862  C  CG1 . VAL A 1 369 ? 109.198 123.967 104.911 1.00 35.30  ? 369 VAL A CG1 1 
ATOM   2863  C  CG2 . VAL A 1 369 ? 108.732 126.331 105.413 1.00 35.30  ? 369 VAL A CG2 1 
ATOM   2864  N  N   . ILE A 1 370 ? 106.051 123.366 102.995 1.00 32.77  ? 370 ILE A N   1 
ATOM   2865  C  CA  . ILE A 1 370 ? 105.698 122.174 102.230 1.00 32.77  ? 370 ILE A CA  1 
ATOM   2866  C  C   . ILE A 1 370 ? 105.562 122.477 100.742 1.00 32.77  ? 370 ILE A C   1 
ATOM   2867  O  O   . ILE A 1 370 ? 106.140 121.782 99.899  1.00 32.77  ? 370 ILE A O   1 
ATOM   2868  C  CB  . ILE A 1 370 ? 104.409 121.570 102.799 1.00 32.77  ? 370 ILE A CB  1 
ATOM   2869  C  CG1 . ILE A 1 370 ? 104.752 120.717 103.999 1.00 32.77  ? 370 ILE A CG1 1 
ATOM   2870  C  CG2 . ILE A 1 370 ? 103.677 120.732 101.776 1.00 32.77  ? 370 ILE A CG2 1 
ATOM   2871  C  CD1 . ILE A 1 370 ? 103.544 120.194 104.665 1.00 32.77  ? 370 ILE A CD1 1 
ATOM   2872  N  N   . GLU A 1 371 ? 104.843 123.540 100.395 1.00 36.21  ? 371 GLU A N   1 
ATOM   2873  C  CA  . GLU A 1 371 ? 104.668 123.860 98.984  1.00 36.21  ? 371 GLU A CA  1 
ATOM   2874  C  C   . GLU A 1 371 ? 105.910 124.441 98.331  1.00 36.21  ? 371 GLU A C   1 
ATOM   2875  O  O   . GLU A 1 371 ? 105.963 124.520 97.103  1.00 36.21  ? 371 GLU A O   1 
ATOM   2876  C  CB  . GLU A 1 371 ? 103.480 124.782 98.790  1.00 36.21  ? 371 GLU A CB  1 
ATOM   2877  C  CG  . GLU A 1 371 ? 102.736 124.510 97.495  1.00 36.21  ? 371 GLU A CG  1 
ATOM   2878  C  CD  . GLU A 1 371 ? 102.350 123.044 97.312  1.00 36.21  ? 371 GLU A CD  1 
ATOM   2879  O  OE1 . GLU A 1 371 ? 101.835 122.427 98.264  1.00 36.21  ? 371 GLU A OE1 1 
ATOM   2880  O  OE2 . GLU A 1 371 ? 102.543 122.505 96.203  1.00 36.21  ? 371 GLU A OE2 1 
ATOM   2881  N  N   . ILE A 1 372 ? 106.902 124.863 99.102  1.00 32.96  ? 372 ILE A N   1 
ATOM   2882  C  CA  . ILE A 1 372 ? 108.157 125.231 98.468  1.00 32.96  ? 372 ILE A CA  1 
ATOM   2883  C  C   . ILE A 1 372 ? 109.019 124.005 98.257  1.00 32.96  ? 372 ILE A C   1 
ATOM   2884  O  O   . ILE A 1 372 ? 109.577 123.809 97.173  1.00 32.96  ? 372 ILE A O   1 
ATOM   2885  C  CB  . ILE A 1 372 ? 108.874 126.307 99.298  1.00 32.96  ? 372 ILE A CB  1 
ATOM   2886  C  CG1 . ILE A 1 372 ? 108.289 127.672 98.971  1.00 32.96  ? 372 ILE A CG1 1 
ATOM   2887  C  CG2 . ILE A 1 372 ? 110.362 126.330 99.022  1.00 32.96  ? 372 ILE A CG2 1 
ATOM   2888  C  CD1 . ILE A 1 372 ? 108.921 128.799 99.743  1.00 32.96  ? 372 ILE A CD1 1 
ATOM   2889  N  N   . MET A 1 373 ? 109.116 123.151 99.268  1.00 35.75  ? 373 MET A N   1 
ATOM   2890  C  CA  . MET A 1 373 ? 109.933 121.953 99.145  1.00 35.75  ? 373 MET A CA  1 
ATOM   2891  C  C   . MET A 1 373 ? 109.388 120.980 98.107  1.00 35.75  ? 373 MET A C   1 
ATOM   2892  O  O   . MET A 1 373 ? 110.175 120.261 97.483  1.00 35.75  ? 373 MET A O   1 
ATOM   2893  C  CB  . MET A 1 373 ? 110.101 121.278 100.501 1.00 35.75  ? 373 MET A CB  1 
ATOM   2894  C  CG  . MET A 1 373 ? 111.346 120.419 100.561 1.00 35.75  ? 373 MET A CG  1 
ATOM   2895  S  SD  . MET A 1 373 ? 111.757 119.853 102.211 1.00 35.75  ? 373 MET A SD  1 
ATOM   2896  C  CE  . MET A 1 373 ? 110.329 118.859 102.576 1.00 35.75  ? 373 MET A CE  1 
ATOM   2897  N  N   . ASN A 1 374 ? 108.070 120.955 97.882  1.00 32.35  ? 374 ASN A N   1 
ATOM   2898  C  CA  . ASN A 1 374 ? 107.524 120.057 96.867  1.00 32.35  ? 374 ASN A CA  1 
ATOM   2899  C  C   . ASN A 1 374 ? 107.939 120.464 95.465  1.00 32.35  ? 374 ASN A C   1 
ATOM   2900  O  O   . ASN A 1 374 ? 108.222 119.601 94.631  1.00 32.35  ? 374 ASN A O   1 
ATOM   2901  C  CB  . ASN A 1 374 ? 106.011 119.999 96.959  1.00 32.35  ? 374 ASN A CB  1 
ATOM   2902  C  CG  . ASN A 1 374 ? 105.554 119.189 98.111  1.00 32.35  ? 374 ASN A CG  1 
ATOM   2903  O  OD1 . ASN A 1 374 ? 106.366 118.696 98.886  1.00 32.35  ? 374 ASN A OD1 1 
ATOM   2904  N  ND2 . ASN A 1 374 ? 104.248 119.024 98.237  1.00 32.35  ? 374 ASN A ND2 1 
ATOM   2905  N  N   . ARG A 1 375 ? 107.982 121.759 95.179  1.00 34.41  ? 375 ARG A N   1 
ATOM   2906  C  CA  . ARG A 1 375 ? 108.420 122.168 93.854  1.00 34.41  ? 375 ARG A CA  1 
ATOM   2907  C  C   . ARG A 1 375 ? 109.914 121.960 93.697  1.00 34.41  ? 375 ARG A C   1 
ATOM   2908  O  O   . ARG A 1 375 ? 110.387 121.662 92.595  1.00 34.41  ? 375 ARG A O   1 
ATOM   2909  C  CB  . ARG A 1 375 ? 108.022 123.602 93.569  1.00 34.41  ? 375 ARG A CB  1 
ATOM   2910  C  CG  . ARG A 1 375 ? 106.548 123.756 93.553  1.00 34.41  ? 375 ARG A CG  1 
ATOM   2911  C  CD  . ARG A 1 375 ? 106.152 125.098 93.037  1.00 34.41  ? 375 ARG A CD  1 
ATOM   2912  N  NE  . ARG A 1 375 ? 104.762 125.358 93.356  1.00 34.41  ? 375 ARG A NE  1 
ATOM   2913  C  CZ  . ARG A 1 375 ? 103.765 125.120 92.515  1.00 34.41  ? 375 ARG A CZ  1 
ATOM   2914  N  NH1 . ARG A 1 375 ? 104.013 124.625 91.310  1.00 34.41  ? 375 ARG A NH1 1 
ATOM   2915  N  NH2 . ARG A 1 375 ? 102.520 125.377 92.878  1.00 34.41  ? 375 ARG A NH2 1 
ATOM   2916  N  N   . LEU A 1 376 ? 110.675 122.150 94.773  1.00 36.27  ? 376 LEU A N   1 
ATOM   2917  C  CA  . LEU A 1 376 ? 112.105 121.873 94.718  1.00 36.27  ? 376 LEU A CA  1 
ATOM   2918  C  C   . LEU A 1 376 ? 112.369 120.391 94.522  1.00 36.27  ? 376 LEU A C   1 
ATOM   2919  O  O   . LEU A 1 376 ? 113.258 120.016 93.753  1.00 36.27  ? 376 LEU A O   1 
ATOM   2920  C  CB  . LEU A 1 376 ? 112.810 122.369 95.974  1.00 36.27  ? 376 LEU A CB  1 
ATOM   2921  C  CG  . LEU A 1 376 ? 112.833 123.877 96.190  1.00 36.27  ? 376 LEU A CG  1 
ATOM   2922  C  CD1 . LEU A 1 376 ? 113.820 124.231 97.289  1.00 36.27  ? 376 LEU A CD1 1 
ATOM   2923  C  CD2 . LEU A 1 376 ? 113.165 124.611 94.900  1.00 36.27  ? 376 LEU A CD2 1 
ATOM   2924  N  N   . TYR A 1 377 ? 111.613 119.536 95.205  1.00 29.00  ? 377 TYR A N   1 
ATOM   2925  C  CA  . TYR A 1 377 ? 111.752 118.106 94.981  1.00 29.00  ? 377 TYR A CA  1 
ATOM   2926  C  C   . TYR A 1 377 ? 111.290 117.700 93.593  1.00 29.00  ? 377 TYR A C   1 
ATOM   2927  O  O   . TYR A 1 377 ? 111.812 116.734 93.031  1.00 29.00  ? 377 TYR A O   1 
ATOM   2928  C  CB  . TYR A 1 377 ? 110.925 117.339 96.007  1.00 29.00  ? 377 TYR A CB  1 
ATOM   2929  C  CG  . TYR A 1 377 ? 111.061 115.848 95.918  1.00 29.00  ? 377 TYR A CG  1 
ATOM   2930  C  CD1 . TYR A 1 377 ? 112.109 115.213 96.532  1.00 29.00  ? 377 TYR A CD1 1 
ATOM   2931  C  CD2 . TYR A 1 377 ? 110.168 115.082 95.206  1.00 29.00  ? 377 TYR A CD2 1 
ATOM   2932  C  CE1 . TYR A 1 377 ? 112.254 113.867 96.454  1.00 29.00  ? 377 TYR A CE1 1 
ATOM   2933  C  CE2 . TYR A 1 377 ? 110.328 113.746 95.094  1.00 29.00  ? 377 TYR A CE2 1 
ATOM   2934  C  CZ  . TYR A 1 377 ? 111.356 113.140 95.742  1.00 29.00  ? 377 TYR A CZ  1 
ATOM   2935  O  OH  . TYR A 1 377 ? 111.506 111.785 95.664  1.00 29.00  ? 377 TYR A OH  1 
ATOM   2936  N  N   . ARG A 1 378 ? 110.325 118.417 93.028  1.00 31.20  ? 378 ARG A N   1 
ATOM   2937  C  CA  . ARG A 1 378 ? 109.853 118.095 91.689  1.00 31.20  ? 378 ARG A CA  1 
ATOM   2938  C  C   . ARG A 1 378 ? 110.901 118.357 90.621  1.00 31.20  ? 378 ARG A C   1 
ATOM   2939  O  O   . ARG A 1 378 ? 111.070 117.541 89.710  1.00 31.20  ? 378 ARG A O   1 
ATOM   2940  C  CB  . ARG A 1 378 ? 108.600 118.911 91.396  1.00 31.20  ? 378 ARG A CB  1 
ATOM   2941  C  CG  . ARG A 1 378 ? 108.136 118.838 89.987  1.00 31.20  ? 378 ARG A CG  1 
ATOM   2942  C  CD  . ARG A 1 378 ? 107.612 117.501 89.629  1.00 31.20  ? 378 ARG A CD  1 
ATOM   2943  N  NE  . ARG A 1 378 ? 107.369 117.460 88.196  1.00 31.20  ? 378 ARG A NE  1 
ATOM   2944  C  CZ  . ARG A 1 378 ? 106.262 117.892 87.610  1.00 31.20  ? 378 ARG A CZ  1 
ATOM   2945  N  NH1 . ARG A 1 378 ? 105.274 118.391 88.340  1.00 31.20  ? 378 ARG A NH1 1 
ATOM   2946  N  NH2 . ARG A 1 378 ? 106.140 117.815 86.293  1.00 31.20  ? 378 ARG A NH2 1 
ATOM   2947  N  N   . TYR A 1 379 ? 111.635 119.464 90.730  1.00 39.66  ? 379 TYR A N   1 
ATOM   2948  C  CA  . TYR A 1 379 ? 112.730 119.717 89.797  1.00 39.66  ? 379 TYR A CA  1 
ATOM   2949  C  C   . TYR A 1 379 ? 113.858 118.715 89.958  1.00 39.66  ? 379 TYR A C   1 
ATOM   2950  O  O   . TYR A 1 379 ? 114.461 118.298 88.966  1.00 39.66  ? 379 TYR A O   1 
ATOM   2951  C  CB  . TYR A 1 379 ? 113.220 121.152 89.929  1.00 39.66  ? 379 TYR A CB  1 
ATOM   2952  C  CG  . TYR A 1 379 ? 112.216 122.155 89.396  1.00 39.66  ? 379 TYR A CG  1 
ATOM   2953  C  CD1 . TYR A 1 379 ? 111.173 121.752 88.566  1.00 39.66  ? 379 TYR A CD1 1 
ATOM   2954  C  CD2 . TYR A 1 379 ? 112.302 123.497 89.725  1.00 39.66  ? 379 TYR A CD2 1 
ATOM   2955  C  CE1 . TYR A 1 379 ? 110.251 122.650 88.081  1.00 39.66  ? 379 TYR A CE1 1 
ATOM   2956  C  CE2 . TYR A 1 379 ? 111.379 124.409 89.240  1.00 39.66  ? 379 TYR A CE2 1 
ATOM   2957  C  CZ  . TYR A 1 379 ? 110.355 123.976 88.417  1.00 39.66  ? 379 TYR A CZ  1 
ATOM   2958  O  OH  . TYR A 1 379 ? 109.430 124.869 87.922  1.00 39.66  ? 379 TYR A OH  1 
ATOM   2959  N  N   . ALA A 1 380 ? 114.202 118.370 91.194  1.00 39.40  ? 380 ALA A N   1 
ATOM   2960  C  CA  . ALA A 1 380 ? 115.272 117.404 91.398  1.00 39.40  ? 380 ALA A CA  1 
ATOM   2961  C  C   . ALA A 1 380 ? 114.880 116.014 90.915  1.00 39.40  ? 380 ALA A C   1 
ATOM   2962  O  O   . ALA A 1 380 ? 115.702 115.309 90.324  1.00 39.40  ? 380 ALA A O   1 
ATOM   2963  C  CB  . ALA A 1 380 ? 115.673 117.358 92.869  1.00 39.40  ? 380 ALA A CB  1 
ATOM   2964  N  N   . ALA A 1 381 ? 113.623 115.619 91.103  1.00 36.11  ? 381 ALA A N   1 
ATOM   2965  C  CA  . ALA A 1 381 ? 113.220 114.291 90.661  1.00 36.11  ? 381 ALA A CA  1 
ATOM   2966  C  C   . ALA A 1 381 ? 113.030 114.200 89.159  1.00 36.11  ? 381 ALA A C   1 
ATOM   2967  O  O   . ALA A 1 381 ? 113.296 113.145 88.579  1.00 36.11  ? 381 ALA A O   1 
ATOM   2968  C  CB  . ALA A 1 381 ? 111.939 113.860 91.363  1.00 36.11  ? 381 ALA A CB  1 
ATOM   2969  N  N   . GLU A 1 382 ? 112.570 115.276 88.522  1.00 38.06  ? 382 GLU A N   1 
ATOM   2970  C  CA  . GLU A 1 382 ? 112.489 115.294 87.066  1.00 38.06  ? 382 GLU A CA  1 
ATOM   2971  C  C   . GLU A 1 382 ? 113.869 115.210 86.449  1.00 38.06  ? 382 GLU A C   1 
ATOM   2972  O  O   . GLU A 1 382 ? 114.084 114.468 85.485  1.00 38.06  ? 382 GLU A O   1 
ATOM   2973  C  CB  . GLU A 1 382 ? 111.764 116.549 86.595  1.00 38.06  ? 382 GLU A CB  1 
ATOM   2974  C  CG  . GLU A 1 382 ? 111.949 116.866 85.134  1.00 38.06  ? 382 GLU A CG  1 
ATOM   2975  C  CD  . GLU A 1 382 ? 111.198 118.108 84.716  1.00 38.06  ? 382 GLU A CD  1 
ATOM   2976  O  OE1 . GLU A 1 382 ? 110.515 118.706 85.570  1.00 38.06  ? 382 GLU A OE1 1 
ATOM   2977  O  OE2 . GLU A 1 382 ? 111.303 118.505 83.537  1.00 38.06  ? 382 GLU A OE2 1 
ATOM   2978  N  N   . PHE A 1 383 ? 114.826 115.923 87.029  1.00 41.97  ? 383 PHE A N   1 
ATOM   2979  C  CA  . PHE A 1 383 ? 116.201 115.839 86.563  1.00 41.97  ? 383 PHE A CA  1 
ATOM   2980  C  C   . PHE A 1 383 ? 116.784 114.461 86.833  1.00 41.97  ? 383 PHE A C   1 
ATOM   2981  O  O   . PHE A 1 383 ? 117.528 113.926 86.006  1.00 41.97  ? 383 PHE A O   1 
ATOM   2982  C  CB  . PHE A 1 383 ? 117.058 116.926 87.199  1.00 41.97  ? 383 PHE A CB  1 
ATOM   2983  C  CG  . PHE A 1 383 ? 118.514 116.648 87.113  1.00 41.97  ? 383 PHE A CG  1 
ATOM   2984  C  CD1 . PHE A 1 383 ? 119.156 116.717 85.893  1.00 41.97  ? 383 PHE A CD1 1 
ATOM   2985  C  CD2 . PHE A 1 383 ? 119.240 116.313 88.236  1.00 41.97  ? 383 PHE A CD2 1 
ATOM   2986  C  CE1 . PHE A 1 383 ? 120.489 116.450 85.790  1.00 41.97  ? 383 PHE A CE1 1 
ATOM   2987  C  CE2 . PHE A 1 383 ? 120.577 116.047 88.141  1.00 41.97  ? 383 PHE A CE2 1 
ATOM   2988  C  CZ  . PHE A 1 383 ? 121.204 116.116 86.914  1.00 41.97  ? 383 PHE A CZ  1 
ATOM   2989  N  N   . LEU A 1 384 ? 116.472 113.875 87.984  1.00 41.33  ? 384 LEU A N   1 
ATOM   2990  C  CA  . LEU A 1 384 ? 117.087 112.602 88.314  1.00 41.33  ? 384 LEU A CA  1 
ATOM   2991  C  C   . LEU A 1 384 ? 116.497 111.460 87.513  1.00 41.33  ? 384 LEU A C   1 
ATOM   2992  O  O   . LEU A 1 384 ? 117.133 110.413 87.400  1.00 41.33  ? 384 LEU A O   1 
ATOM   2993  C  CB  . LEU A 1 384 ? 116.907 112.298 89.791  1.00 41.33  ? 384 LEU A CB  1 
ATOM   2994  C  CG  . LEU A 1 384 ? 117.985 111.460 90.449  1.00 41.33  ? 384 LEU A CG  1 
ATOM   2995  C  CD1 . LEU A 1 384 ? 119.274 112.218 90.422  1.00 41.33  ? 384 LEU A CD1 1 
ATOM   2996  C  CD2 . LEU A 1 384 ? 117.582 111.150 91.860  1.00 41.33  ? 384 LEU A CD2 1 
ATOM   2997  N  N   . THR A 1 385 ? 115.304 111.631 86.959  1.00 41.01  ? 385 THR A N   1 
ATOM   2998  C  CA  . THR A 1 385 ? 114.708 110.614 86.111  1.00 41.01  ? 385 THR A CA  1 
ATOM   2999  C  C   . THR A 1 385 ? 114.946 110.883 84.634  1.00 41.01  ? 385 THR A C   1 
ATOM   3000  O  O   . THR A 1 385 ? 114.995 109.939 83.845  1.00 41.01  ? 385 THR A O   1 
ATOM   3001  C  CB  . THR A 1 385 ? 113.219 110.491 86.407  1.00 41.01  ? 385 THR A CB  1 
ATOM   3002  O  OG1 . THR A 1 385 ? 113.048 110.469 87.825  1.00 41.01  ? 385 THR A OG1 1 
ATOM   3003  C  CG2 . THR A 1 385 ? 112.688 109.183 85.895  1.00 41.01  ? 385 THR A CG2 1 
ATOM   3004  N  N   . SER A 1 386 ? 115.206 112.132 84.254  1.00 43.70  ? 386 SER A N   1 
ATOM   3005  C  CA  . SER A 1 386 ? 115.703 112.390 82.908  1.00 43.70  ? 386 SER A CA  1 
ATOM   3006  C  C   . SER A 1 386 ? 117.161 112.009 82.749  1.00 43.70  ? 386 SER A C   1 
ATOM   3007  O  O   . SER A 1 386 ? 117.682 112.075 81.635  1.00 43.70  ? 386 SER A O   1 
ATOM   3008  C  CB  . SER A 1 386 ? 115.544 113.859 82.544  1.00 43.70  ? 386 SER A CB  1 
ATOM   3009  O  OG  . SER A 1 386 ? 116.466 114.215 81.534  1.00 43.70  ? 386 SER A OG  1 
ATOM   3010  N  N   . TRP A 1 387 ? 117.824 111.638 83.833  1.00 52.62  ? 387 TRP A N   1 
ATOM   3011  C  CA  . TRP A 1 387 ? 119.212 111.230 83.835  1.00 52.62  ? 387 TRP A CA  1 
ATOM   3012  C  C   . TRP A 1 387 ? 119.351 109.730 83.678  1.00 52.62  ? 387 TRP A C   1 
ATOM   3013  O  O   . TRP A 1 387 ? 120.395 109.254 83.233  1.00 52.62  ? 387 TRP A O   1 
ATOM   3014  C  CB  . TRP A 1 387 ? 119.868 111.671 85.145  1.00 52.62  ? 387 TRP A CB  1 
ATOM   3015  C  CG  . TRP A 1 387 ? 121.281 111.271 85.298  1.00 52.62  ? 387 TRP A CG  1 
ATOM   3016  C  CD1 . TRP A 1 387 ? 122.354 111.837 84.701  1.00 52.62  ? 387 TRP A CD1 1 
ATOM   3017  C  CD2 . TRP A 1 387 ? 121.781 110.182 86.077  1.00 52.62  ? 387 TRP A CD2 1 
ATOM   3018  N  NE1 . TRP A 1 387 ? 123.502 111.184 85.071  1.00 52.62  ? 387 TRP A NE1 1 
ATOM   3019  C  CE2 . TRP A 1 387 ? 123.172 110.162 85.917  1.00 52.62  ? 387 TRP A CE2 1 
ATOM   3020  C  CE3 . TRP A 1 387 ? 121.186 109.227 86.898  1.00 52.62  ? 387 TRP A CE3 1 
ATOM   3021  C  CZ2 . TRP A 1 387 ? 123.976 109.230 86.544  1.00 52.62  ? 387 TRP A CZ2 1 
ATOM   3022  C  CZ3 . TRP A 1 387 ? 121.986 108.302 87.521  1.00 52.62  ? 387 TRP A CZ3 1 
ATOM   3023  C  CH2 . TRP A 1 387 ? 123.364 108.312 87.344  1.00 52.62  ? 387 TRP A CH2 1 
ATOM   3024  N  N   . GLU A 1 388 ? 118.300 108.986 83.963  1.00 50.68  ? 388 GLU A N   1 
ATOM   3025  C  CA  . GLU A 1 388 ? 118.352 107.540 83.924  1.00 50.68  ? 388 GLU A CA  1 
ATOM   3026  C  C   . GLU A 1 388 ? 118.227 106.961 82.532  1.00 50.68  ? 388 GLU A C   1 
ATOM   3027  O  O   . GLU A 1 388 ? 118.304 105.737 82.401  1.00 50.68  ? 388 GLU A O   1 
ATOM   3028  C  CB  . GLU A 1 388 ? 117.181 107.002 84.723  1.00 50.68  ? 388 GLU A CB  1 
ATOM   3029  C  CG  . GLU A 1 388 ? 117.147 107.425 86.146  1.00 50.68  ? 388 GLU A CG  1 
ATOM   3030  C  CD  . GLU A 1 388 ? 115.759 107.267 86.727  1.00 50.68  ? 388 GLU A CD  1 
ATOM   3031  O  OE1 . GLU A 1 388 ? 114.904 106.661 86.052  1.00 50.68  ? 388 GLU A OE1 1 
ATOM   3032  O  OE2 . GLU A 1 388 ? 115.498 107.803 87.823  1.00 50.68  ? 388 GLU A OE2 1 
ATOM   3033  N  N   . ASN A 1 389 ? 118.053 107.803 81.510  1.00 52.01  ? 389 ASN A N   1 
ATOM   3034  C  CA  . ASN A 1 389 ? 117.967 107.400 80.104  1.00 52.01  ? 389 ASN A CA  1 
ATOM   3035  C  C   . ASN A 1 389 ? 116.833 106.402 79.878  1.00 52.01  ? 389 ASN A C   1 
ATOM   3036  O  O   . ASN A 1 389 ? 117.046 105.284 79.413  1.00 52.01  ? 389 ASN A O   1 
ATOM   3037  C  CB  . ASN A 1 389 ? 119.292 106.842 79.579  1.00 52.01  ? 389 ASN A CB  1 
ATOM   3038  C  CG  . ASN A 1 389 ? 120.074 107.857 78.787  1.00 52.01  ? 389 ASN A CG  1 
ATOM   3039  O  OD1 . ASN A 1 389 ? 119.882 109.060 78.935  1.00 52.01  ? 389 ASN A OD1 1 
ATOM   3040  N  ND2 . ASN A 1 389 ? 120.956 107.375 77.922  1.00 52.01  ? 389 ASN A ND2 1 
ATOM   3041  N  N   . HIS A 1 390 ? 115.624 106.804 80.246  1.00 42.49  ? 390 HIS A N   1 
ATOM   3042  C  CA  . HIS A 1 390 ? 114.492 105.936 79.981  1.00 42.49  ? 390 HIS A CA  1 
ATOM   3043  C  C   . HIS A 1 390 ? 114.186 105.958 78.498  1.00 42.49  ? 390 HIS A C   1 
ATOM   3044  O  O   . HIS A 1 390 ? 114.253 107.003 77.855  1.00 42.49  ? 390 HIS A O   1 
ATOM   3045  C  CB  . HIS A 1 390 ? 113.283 106.379 80.779  1.00 42.49  ? 390 HIS A CB  1 
ATOM   3046  C  CG  . HIS A 1 390 ? 113.294 105.886 82.181  1.00 42.49  ? 390 HIS A CG  1 
ATOM   3047  N  ND1 . HIS A 1 390 ? 113.251 104.548 82.494  1.00 42.49  ? 390 HIS A ND1 1 
ATOM   3048  C  CD2 . HIS A 1 390 ? 113.357 106.547 83.356  1.00 42.49  ? 390 HIS A CD2 1 
ATOM   3049  C  CE1 . HIS A 1 390 ? 113.286 104.405 83.804  1.00 42.49  ? 390 HIS A CE1 1 
ATOM   3050  N  NE2 . HIS A 1 390 ? 113.348 105.604 84.352  1.00 42.49  ? 390 HIS A NE2 1 
ATOM   3051  N  N   . ARG A 1 391 ? 113.821 104.801 77.958  1.00 48.93  ? 391 ARG A N   1 
ATOM   3052  C  CA  . ARG A 1 391 ? 113.676 104.699 76.509  1.00 48.93  ? 391 ARG A CA  1 
ATOM   3053  C  C   . ARG A 1 391 ? 112.357 105.274 76.007  1.00 48.93  ? 391 ARG A C   1 
ATOM   3054  O  O   . ARG A 1 391 ? 112.344 106.259 75.267  1.00 48.93  ? 391 ARG A O   1 
ATOM   3055  C  CB  . ARG A 1 391 ? 113.857 103.248 76.064  1.00 48.93  ? 391 ARG A CB  1 
ATOM   3056  C  CG  . ARG A 1 391 ? 114.109 103.116 74.576  1.00 48.93  ? 391 ARG A CG  1 
ATOM   3057  C  CD  . ARG A 1 391 ? 114.232 101.675 74.147  1.00 48.93  ? 391 ARG A CD  1 
ATOM   3058  N  NE  . ARG A 1 391 ? 114.443 101.572 72.711  1.00 48.93  ? 391 ARG A NE  1 
ATOM   3059  C  CZ  . ARG A 1 391 ? 113.463 101.527 71.818  1.00 48.93  ? 391 ARG A CZ  1 
ATOM   3060  N  NH1 . ARG A 1 391 ? 112.202 101.567 72.215  1.00 48.93  ? 391 ARG A NH1 1 
ATOM   3061  N  NH2 . ARG A 1 391 ? 113.743 101.436 70.528  1.00 48.93  ? 391 ARG A NH2 1 
ATOM   3062  N  N   . LEU A 1 392 ? 111.237 104.701 76.422  1.00 44.81  ? 392 LEU A N   1 
ATOM   3063  C  CA  . LEU A 1 392 ? 109.983 105.219 75.912  1.00 44.81  ? 392 LEU A CA  1 
ATOM   3064  C  C   . LEU A 1 392 ? 109.546 106.428 76.721  1.00 44.81  ? 392 LEU A C   1 
ATOM   3065  O  O   . LEU A 1 392 ? 110.207 106.842 77.670  1.00 44.81  ? 392 LEU A O   1 
ATOM   3066  C  CB  . LEU A 1 392 ? 108.915 104.140 75.946  1.00 44.81  ? 392 LEU A CB  1 
ATOM   3067  C  CG  . LEU A 1 392 ? 109.386 102.798 75.412  1.00 44.81  ? 392 LEU A CG  1 
ATOM   3068  C  CD1 . LEU A 1 392 ? 108.434 101.707 75.855  1.00 44.81  ? 392 LEU A CD1 1 
ATOM   3069  C  CD2 . LEU A 1 392 ? 109.499 102.844 73.916  1.00 44.81  ? 392 LEU A CD2 1 
ATOM   3070  N  N   . GLU A 1 393 ? 108.426 107.023 76.334  1.00 39.23  ? 393 GLU A N   1 
ATOM   3071  C  CA  . GLU A 1 393 ? 107.857 108.085 77.144  1.00 39.23  ? 393 GLU A CA  1 
ATOM   3072  C  C   . GLU A 1 393 ? 106.885 107.578 78.192  1.00 39.23  ? 393 GLU A C   1 
ATOM   3073  O  O   . GLU A 1 393 ? 106.750 108.203 79.250  1.00 39.23  ? 393 GLU A O   1 
ATOM   3074  C  CB  . GLU A 1 393 ? 107.186 109.109 76.234  1.00 39.23  ? 393 GLU A CB  1 
ATOM   3075  C  CG  . GLU A 1 393 ? 106.727 110.374 76.915  1.00 39.23  ? 393 GLU A CG  1 
ATOM   3076  C  CD  . GLU A 1 393 ? 107.864 111.271 77.312  1.00 39.23  ? 393 GLU A CD  1 
ATOM   3077  O  OE1 . GLU A 1 393 ? 108.957 111.153 76.732  1.00 39.23  ? 393 GLU A OE1 1 
ATOM   3078  O  OE2 . GLU A 1 393 ? 107.656 112.119 78.198  1.00 39.23  ? 393 GLU A OE2 1 
ATOM   3079  N  N   . SER A 1 394 ? 106.239 106.439 77.948  1.00 42.99  ? 394 SER A N   1 
ATOM   3080  C  CA  . SER A 1 394 ? 105.329 105.885 78.943  1.00 42.99  ? 394 SER A CA  1 
ATOM   3081  C  C   . SER A 1 394 ? 106.098 105.424 80.168  1.00 42.99  ? 394 SER A C   1 
ATOM   3082  O  O   . SER A 1 394 ? 105.635 105.580 81.302  1.00 42.99  ? 394 SER A O   1 
ATOM   3083  C  CB  . SER A 1 394 ? 104.532 104.726 78.360  1.00 42.99  ? 394 SER A CB  1 
ATOM   3084  O  OG  . SER A 1 394 ? 105.242 103.513 78.517  1.00 42.99  ? 394 SER A OG  1 
ATOM   3085  N  N   . ALA A 1 395 ? 107.275 104.851 79.951  1.00 37.21  ? 395 ALA A N   1 
ATOM   3086  C  CA  . ALA A 1 395 ? 108.103 104.387 81.053  1.00 37.21  ? 395 ALA A CA  1 
ATOM   3087  C  C   . ALA A 1 395 ? 108.672 105.548 81.853  1.00 37.21  ? 395 ALA A C   1 
ATOM   3088  O  O   . ALA A 1 395 ? 108.794 105.465 83.078  1.00 37.21  ? 395 ALA A O   1 
ATOM   3089  C  CB  . ALA A 1 395 ? 109.224 103.498 80.527  1.00 37.21  ? 395 ALA A CB  1 
ATOM   3090  N  N   . TYR A 1 396 ? 109.056 106.625 81.176  1.00 34.37  ? 396 TYR A N   1 
ATOM   3091  C  CA  . TYR A 1 396 ? 109.561 107.798 81.877  1.00 34.37  ? 396 TYR A CA  1 
ATOM   3092  C  C   . TYR A 1 396 ? 108.494 108.418 82.759  1.00 34.37  ? 396 TYR A C   1 
ATOM   3093  O  O   . TYR A 1 396 ? 108.781 108.865 83.871  1.00 34.37  ? 396 TYR A O   1 
ATOM   3094  C  CB  . TYR A 1 396 ? 110.100 108.819 80.893  1.00 34.37  ? 396 TYR A CB  1 
ATOM   3095  C  CG  . TYR A 1 396 ? 110.254 110.189 81.479  1.00 34.37  ? 396 TYR A CG  1 
ATOM   3096  C  CD1 . TYR A 1 396 ? 111.271 110.450 82.376  1.00 34.37  ? 396 TYR A CD1 1 
ATOM   3097  C  CD2 . TYR A 1 396 ? 109.428 111.224 81.108  1.00 34.37  ? 396 TYR A CD2 1 
ATOM   3098  C  CE1 . TYR A 1 396 ? 111.440 111.691 82.908  1.00 34.37  ? 396 TYR A CE1 1 
ATOM   3099  C  CE2 . TYR A 1 396 ? 109.591 112.474 81.637  1.00 34.37  ? 396 TYR A CE2 1 
ATOM   3100  C  CZ  . TYR A 1 396 ? 110.599 112.700 82.534  1.00 34.37  ? 396 TYR A CZ  1 
ATOM   3101  O  OH  . TYR A 1 396 ? 110.763 113.951 83.064  1.00 34.37  ? 396 TYR A OH  1 
ATOM   3102  N  N   . GLN A 1 397 ? 107.264 108.482 82.268  1.00 25.89  ? 397 GLN A N   1 
ATOM   3103  C  CA  . GLN A 1 397 ? 106.175 109.014 83.079  1.00 25.89  ? 397 GLN A CA  1 
ATOM   3104  C  C   . GLN A 1 397 ? 105.878 108.149 84.294  1.00 25.89  ? 397 GLN A C   1 
ATOM   3105  O  O   . GLN A 1 397 ? 105.529 108.679 85.346  1.00 25.89  ? 397 GLN A O   1 
ATOM   3106  C  CB  . GLN A 1 397 ? 104.915 109.213 82.246  1.00 25.89  ? 397 GLN A CB  1 
ATOM   3107  C  CG  . GLN A 1 397 ? 104.965 110.450 81.411  1.00 25.89  ? 397 GLN A CG  1 
ATOM   3108  C  CD  . GLN A 1 397 ? 105.016 111.680 82.272  1.00 25.89  ? 397 GLN A CD  1 
ATOM   3109  O  OE1 . GLN A 1 397 ? 104.378 111.731 83.314  1.00 25.89  ? 397 GLN A OE1 1 
ATOM   3110  N  NE2 . GLN A 1 397 ? 105.780 112.675 81.852  1.00 25.89  ? 397 GLN A NE2 1 
ATOM   3111  N  N   . ASN A 1 398 ? 105.996 106.825 84.182  1.00 26.88  ? 398 ASN A N   1 
ATOM   3112  C  CA  . ASN A 1 398 ? 105.715 105.998 85.353  1.00 26.88  ? 398 ASN A CA  1 
ATOM   3113  C  C   . ASN A 1 398 ? 106.739 106.199 86.457  1.00 26.88  ? 398 ASN A C   1 
ATOM   3114  O  O   . ASN A 1 398 ? 106.372 106.283 87.632  1.00 26.88  ? 398 ASN A O   1 
ATOM   3115  C  CB  . ASN A 1 398 ? 105.679 104.528 84.972  1.00 26.88  ? 398 ASN A CB  1 
ATOM   3116  C  CG  . ASN A 1 398 ? 104.462 104.171 84.195  1.00 26.88  ? 398 ASN A CG  1 
ATOM   3117  O  OD1 . ASN A 1 398 ? 103.677 105.038 83.823  1.00 26.88  ? 398 ASN A OD1 1 
ATOM   3118  N  ND2 . ASN A 1 398 ? 104.295 102.886 83.920  1.00 26.88  ? 398 ASN A ND2 1 
ATOM   3119  N  N   . HIS A 1 399 ? 108.015 106.300 86.113  1.00 26.60  ? 399 HIS A N   1 
ATOM   3120  C  CA  . HIS A 1 399 ? 109.020 106.524 87.143  1.00 26.60  ? 399 HIS A CA  1 
ATOM   3121  C  C   . HIS A 1 399 ? 108.928 107.904 87.766  1.00 26.60  ? 399 HIS A C   1 
ATOM   3122  O  O   . HIS A 1 399 ? 109.153 108.045 88.968  1.00 26.60  ? 399 HIS A O   1 
ATOM   3123  C  CB  . HIS A 1 399 ? 110.395 106.212 86.615  1.00 26.60  ? 399 HIS A CB  1 
ATOM   3124  C  CG  . HIS A 1 399 ? 110.626 104.750 86.519  1.00 26.60  ? 399 HIS A CG  1 
ATOM   3125  N  ND1 . HIS A 1 399 ? 110.947 103.990 87.617  1.00 26.60  ? 399 HIS A ND1 1 
ATOM   3126  C  CD2 . HIS A 1 399 ? 110.487 103.888 85.489  1.00 26.60  ? 399 HIS A CD2 1 
ATOM   3127  C  CE1 . HIS A 1 399 ? 111.049 102.725 87.256  1.00 26.60  ? 399 HIS A CE1 1 
ATOM   3128  N  NE2 . HIS A 1 399 ? 110.776 102.636 85.968  1.00 26.60  ? 399 HIS A NE2 1 
ATOM   3129  N  N   . LEU A 1 400 ? 108.658 108.933 86.970  1.00 22.58  ? 400 LEU A N   1 
ATOM   3130  C  CA  . LEU A 1 400 ? 108.504 110.265 87.537  1.00 22.58  ? 400 LEU A CA  1 
ATOM   3131  C  C   . LEU A 1 400 ? 107.289 110.333 88.444  1.00 22.58  ? 400 LEU A C   1 
ATOM   3132  O  O   . LEU A 1 400 ? 107.323 110.981 89.495  1.00 22.58  ? 400 LEU A O   1 
ATOM   3133  C  CB  . LEU A 1 400 ? 108.402 111.304 86.436  1.00 22.58  ? 400 LEU A CB  1 
ATOM   3134  C  CG  . LEU A 1 400 ? 108.376 112.706 87.016  1.00 22.58  ? 400 LEU A CG  1 
ATOM   3135  C  CD1 . LEU A 1 400 ? 109.666 112.950 87.725  1.00 22.58  ? 400 LEU A CD1 1 
ATOM   3136  C  CD2 . LEU A 1 400 ? 108.153 113.735 85.946  1.00 22.58  ? 400 LEU A CD2 1 
ATOM   3137  N  N   . ILE A 1 401 ? 106.207 109.659 88.059  1.00 17.87  ? 401 ILE A N   1 
ATOM   3138  C  CA  . ILE A 1 401 ? 105.011 109.627 88.897  1.00 17.87  ? 401 ILE A CA  1 
ATOM   3139  C  C   . ILE A 1 401 ? 105.289 108.905 90.204  1.00 17.87  ? 401 ILE A C   1 
ATOM   3140  O  O   . ILE A 1 401 ? 104.866 109.355 91.262  1.00 17.87  ? 401 ILE A O   1 
ATOM   3141  C  CB  . ILE A 1 401 ? 103.829 109.009 88.139  1.00 17.87  ? 401 ILE A CB  1 
ATOM   3142  C  CG1 . ILE A 1 401 ? 103.303 110.040 87.172  1.00 17.87  ? 401 ILE A CG1 1 
ATOM   3143  C  CG2 . ILE A 1 401 ? 102.699 108.664 89.050  1.00 17.87  ? 401 ILE A CG2 1 
ATOM   3144  C  CD1 . ILE A 1 401 ? 102.402 109.499 86.146  1.00 17.87  ? 401 ILE A CD1 1 
ATOM   3145  N  N   . LEU A 1 402 ? 106.104 107.851 90.169  1.00 16.38  ? 402 LEU A N   1 
ATOM   3146  C  CA  . LEU A 1 402 ? 106.412 107.135 91.405  1.00 16.38  ? 402 LEU A CA  1 
ATOM   3147  C  C   . LEU A 1 402 ? 107.212 107.979 92.390  1.00 16.38  ? 402 LEU A C   1 
ATOM   3148  O  O   . LEU A 1 402 ? 106.911 107.983 93.586  1.00 16.38  ? 402 LEU A O   1 
ATOM   3149  C  CB  . LEU A 1 402 ? 107.158 105.854 91.089  1.00 16.38  ? 402 LEU A CB  1 
ATOM   3150  C  CG  . LEU A 1 402 ? 107.494 105.042 92.322  1.00 16.38  ? 402 LEU A CG  1 
ATOM   3151  C  CD1 . LEU A 1 402 ? 106.235 104.661 93.035  1.00 16.38  ? 402 LEU A CD1 1 
ATOM   3152  C  CD2 . LEU A 1 402 ? 108.272 103.820 91.918  1.00 16.38  ? 402 LEU A CD2 1 
ATOM   3153  N  N   . LYS A 1 403 ? 108.257 108.661 91.929  1.00 18.52  ? 403 LYS A N   1 
ATOM   3154  C  CA  . LYS A 1 403 ? 109.048 109.487 92.839  1.00 18.52  ? 403 LYS A CA  1 
ATOM   3155  C  C   . LYS A 1 403 ? 108.253 110.654 93.416  1.00 18.52  ? 403 LYS A C   1 
ATOM   3156  O  O   . LYS A 1 403 ? 108.294 110.905 94.621  1.00 18.52  ? 403 LYS A O   1 
ATOM   3157  C  CB  . LYS A 1 403 ? 110.298 109.991 92.141  1.00 18.52  ? 403 LYS A CB  1 
ATOM   3158  C  CG  . LYS A 1 403 ? 111.285 108.901 91.871  1.00 18.52  ? 403 LYS A CG  1 
ATOM   3159  C  CD  . LYS A 1 403 ? 112.462 109.430 91.118  1.00 18.52  ? 403 LYS A CD  1 
ATOM   3160  C  CE  . LYS A 1 403 ? 113.441 108.327 90.876  1.00 18.52  ? 403 LYS A CE  1 
ATOM   3161  N  NZ  . LYS A 1 403 ? 112.811 107.262 90.076  1.00 18.52  ? 403 LYS A NZ  1 
ATOM   3162  N  N   . VAL A 1 404 ? 107.547 111.396 92.567  1.00 15.86  ? 404 VAL A N   1 
ATOM   3163  C  CA  . VAL A 1 404 ? 106.832 112.578 93.037  1.00 15.86  ? 404 VAL A CA  1 
ATOM   3164  C  C   . VAL A 1 404 ? 105.615 112.228 93.885  1.00 15.86  ? 404 VAL A C   1 
ATOM   3165  O  O   . VAL A 1 404 ? 105.328 112.915 94.872  1.00 15.86  ? 404 VAL A O   1 
ATOM   3166  C  CB  . VAL A 1 404 ? 106.461 113.438 91.823  1.00 15.86  ? 404 VAL A CB  1 
ATOM   3167  C  CG1 . VAL A 1 404 ? 105.586 114.591 92.193  1.00 15.86  ? 404 VAL A CG1 1 
ATOM   3168  C  CG2 . VAL A 1 404 ? 107.702 113.955 91.200  1.00 15.86  ? 404 VAL A CG2 1 
ATOM   3169  N  N   . LEU A 1 405 ? 104.925 111.130 93.576  1.00 16.24  ? 405 LEU A N   1 
ATOM   3170  C  CA  . LEU A 1 405 ? 103.753 110.737 94.357  1.00 16.24  ? 405 LEU A CA  1 
ATOM   3171  C  C   . LEU A 1 405 ? 104.116 110.254 95.745  1.00 16.24  ? 405 LEU A C   1 
ATOM   3172  O  O   . LEU A 1 405 ? 103.395 110.537 96.701  1.00 16.24  ? 405 LEU A O   1 
ATOM   3173  C  CB  . LEU A 1 405 ? 102.954 109.659 93.667  1.00 16.24  ? 405 LEU A CB  1 
ATOM   3174  C  CG  . LEU A 1 405 ? 101.530 109.616 94.118  1.00 16.24  ? 405 LEU A CG  1 
ATOM   3175  C  CD1 . LEU A 1 405 ? 100.917 110.883 93.662  1.00 16.24  ? 405 LEU A CD1 1 
ATOM   3176  C  CD2 . LEU A 1 405 ? 100.903 108.447 93.438  1.00 16.24  ? 405 LEU A CD2 1 
ATOM   3177  N  N   . VAL A 1 406 ? 105.195 109.483 95.865  1.00 17.43  ? 406 VAL A N   1 
ATOM   3178  C  CA  . VAL A 1 406 ? 105.607 108.968 97.166  1.00 17.43  ? 406 VAL A CA  1 
ATOM   3179  C  C   . VAL A 1 406 ? 106.000 110.111 98.078  1.00 17.43  ? 406 VAL A C   1 
ATOM   3180  O  O   . VAL A 1 406 ? 105.557 110.185 99.228  1.00 17.43  ? 406 VAL A O   1 
ATOM   3181  C  CB  . VAL A 1 406 ? 106.748 107.956 96.999  1.00 17.43  ? 406 VAL A CB  1 
ATOM   3182  C  CG1 . VAL A 1 406 ? 107.490 107.769 98.282  1.00 17.43  ? 406 VAL A CG1 1 
ATOM   3183  C  CG2 . VAL A 1 406 ? 106.187 106.651 96.571  1.00 17.43  ? 406 VAL A CG2 1 
ATOM   3184  N  N   . PHE A 1 407 ? 106.793 111.042 97.571  1.00 24.12  ? 407 PHE A N   1 
ATOM   3185  C  CA  . PHE A 1 407 ? 107.192 112.153 98.414  1.00 24.12  ? 407 PHE A CA  1 
ATOM   3186  C  C   . PHE A 1 407 ? 106.051 113.105 98.715  1.00 24.12  ? 407 PHE A C   1 
ATOM   3187  O  O   . PHE A 1 407 ? 105.986 113.622 99.828  1.00 24.12  ? 407 PHE A O   1 
ATOM   3188  C  CB  . PHE A 1 407 ? 108.307 112.930 97.754  1.00 24.12  ? 407 PHE A CB  1 
ATOM   3189  C  CG  . PHE A 1 407 ? 108.777 114.090 98.547  1.00 24.12  ? 407 PHE A CG  1 
ATOM   3190  C  CD1 . PHE A 1 407 ? 109.579 113.918 99.637  1.00 24.12  ? 407 PHE A CD1 1 
ATOM   3191  C  CD2 . PHE A 1 407 ? 108.405 115.371 98.193  1.00 24.12  ? 407 PHE A CD2 1 
ATOM   3192  C  CE1 . PHE A 1 407 ? 110.005 114.999 100.368 1.00 24.12  ? 407 PHE A CE1 1 
ATOM   3193  C  CE2 . PHE A 1 407 ? 108.816 116.451 98.922  1.00 24.12  ? 407 PHE A CE2 1 
ATOM   3194  C  CZ  . PHE A 1 407 ? 109.620 116.267 100.010 1.00 24.12  ? 407 PHE A CZ  1 
ATOM   3195  N  N   . ASN A 1 408 ? 105.128 113.330 97.783  1.00 20.00  ? 408 ASN A N   1 
ATOM   3196  C  CA  . ASN A 1 408 ? 104.068 114.285 98.081  1.00 20.00  ? 408 ASN A CA  1 
ATOM   3197  C  C   . ASN A 1 408 ? 103.058 113.682 99.029  1.00 20.00  ? 408 ASN A C   1 
ATOM   3198  O  O   . ASN A 1 408 ? 102.467 114.397 99.840  1.00 20.00  ? 408 ASN A O   1 
ATOM   3199  C  CB  . ASN A 1 408 ? 103.416 114.791 96.815  1.00 20.00  ? 408 ASN A CB  1 
ATOM   3200  C  CG  . ASN A 1 408 ? 104.216 115.883 96.182  1.00 20.00  ? 408 ASN A CG  1 
ATOM   3201  O  OD1 . ASN A 1 408 ? 103.992 117.058 96.440  1.00 20.00  ? 408 ASN A OD1 1 
ATOM   3202  N  ND2 . ASN A 1 408 ? 105.185 115.506 95.376  1.00 20.00  ? 408 ASN A ND2 1 
ATOM   3203  N  N   . PHE A 1 409 ? 102.806 112.384 98.899  1.00 19.84  ? 409 PHE A N   1 
ATOM   3204  C  CA  . PHE A 1 409 ? 102.011 111.683 99.895  1.00 19.84  ? 409 PHE A CA  1 
ATOM   3205  C  C   . PHE A 1 409 ? 102.671 111.750 101.252 1.00 19.84  ? 409 PHE A C   1 
ATOM   3206  O  O   . PHE A 1 409 ? 102.019 112.052 102.253 1.00 19.84  ? 409 PHE A O   1 
ATOM   3207  C  CB  . PHE A 1 409 ? 101.829 110.233 99.478  1.00 19.84  ? 409 PHE A CB  1 
ATOM   3208  C  CG  . PHE A 1 409 ? 100.979 109.432 100.389 1.00 19.84  ? 409 PHE A CG  1 
ATOM   3209  C  CD1 . PHE A 1 409 ? 99.621  109.396 100.244 1.00 19.84  ? 409 PHE A CD1 1 
ATOM   3210  C  CD2 . PHE A 1 409 ? 101.571 108.606 101.326 1.00 19.84  ? 409 PHE A CD2 1 
ATOM   3211  C  CE1 . PHE A 1 409 ? 98.858  108.619 101.081 1.00 19.84  ? 409 PHE A CE1 1 
ATOM   3212  C  CE2 . PHE A 1 409 ? 100.822 107.831 102.151 1.00 19.84  ? 409 PHE A CE2 1 
ATOM   3213  C  CZ  . PHE A 1 409 ? 99.462  107.833 102.031 1.00 19.84  ? 409 PHE A CZ  1 
ATOM   3214  N  N   . LEU A 1 410 ? 103.959 111.429 101.311 1.00 23.29  ? 410 LEU A N   1 
ATOM   3215  C  CA  . LEU A 1 410 ? 104.647 111.426 102.592 1.00 23.29  ? 410 LEU A CA  1 
ATOM   3216  C  C   . LEU A 1 410 ? 104.778 112.825 103.177 1.00 23.29  ? 410 LEU A C   1 
ATOM   3217  O  O   . LEU A 1 410 ? 104.432 113.041 104.332 1.00 23.29  ? 410 LEU A O   1 
ATOM   3218  C  CB  . LEU A 1 410 ? 106.008 110.778 102.455 1.00 23.29  ? 410 LEU A CB  1 
ATOM   3219  C  CG  . LEU A 1 410 ? 106.513 110.477 103.847 1.00 23.29  ? 410 LEU A CG  1 
ATOM   3220  C  CD1 . LEU A 1 410 ? 106.043 109.095 104.205 1.00 23.29  ? 410 LEU A CD1 1 
ATOM   3221  C  CD2 . LEU A 1 410 ? 108.007 110.557 103.896 1.00 23.29  ? 410 LEU A CD2 1 
ATOM   3222  N  N   . ASN A 1 411 ? 105.197 113.806 102.379 1.00 24.51  ? 411 ASN A N   1 
ATOM   3223  C  CA  . ASN A 1 411 ? 105.427 115.141 102.929 1.00 24.51  ? 411 ASN A CA  1 
ATOM   3224  C  C   . ASN A 1 411 ? 104.154 115.869 103.312 1.00 24.51  ? 411 ASN A C   1 
ATOM   3225  O  O   . ASN A 1 411 ? 104.188 116.734 104.186 1.00 24.51  ? 411 ASN A O   1 
ATOM   3226  C  CB  . ASN A 1 411 ? 106.198 116.002 101.952 1.00 24.51  ? 411 ASN A CB  1 
ATOM   3227  C  CG  . ASN A 1 411 ? 106.851 117.156 102.619 1.00 24.51  ? 411 ASN A CG  1 
ATOM   3228  O  OD1 . ASN A 1 411 ? 107.104 117.120 103.817 1.00 24.51  ? 411 ASN A OD1 1 
ATOM   3229  N  ND2 . ASN A 1 411 ? 107.107 118.209 101.863 1.00 24.51  ? 411 ASN A ND2 1 
ATOM   3230  N  N   . CYS A 1 412 ? 103.035 115.557 102.685 1.00 21.27  ? 412 CYS A N   1 
ATOM   3231  C  CA  . CYS A 1 412 ? 101.811 116.234 103.082 1.00 21.27  ? 412 CYS A CA  1 
ATOM   3232  C  C   . CYS A 1 412 ? 101.124 115.523 104.234 1.00 21.27  ? 412 CYS A C   1 
ATOM   3233  O  O   . CYS A 1 412 ? 100.544 116.185 105.096 1.00 21.27  ? 412 CYS A O   1 
ATOM   3234  C  CB  . CYS A 1 412 ? 100.880 116.430 101.903 1.00 21.27  ? 412 CYS A CB  1 
ATOM   3235  S  SG  . CYS A 1 412 ? 101.517 117.644 100.746 1.00 21.27  ? 412 CYS A SG  1 
ATOM   3236  N  N   . PHE A 1 413 ? 101.114 114.194 104.261 1.00 25.03  ? 413 PHE A N   1 
ATOM   3237  C  CA  . PHE A 1 413 ? 100.324 113.521 105.277 1.00 25.03  ? 413 PHE A CA  1 
ATOM   3238  C  C   . PHE A 1 413 ? 101.142 112.941 106.425 1.00 25.03  ? 413 PHE A C   1 
ATOM   3239  O  O   . PHE A 1 413 ? 100.588 112.186 107.225 1.00 25.03  ? 413 PHE A O   1 
ATOM   3240  C  CB  . PHE A 1 413 ? 99.495  112.403 104.670 1.00 25.03  ? 413 PHE A CB  1 
ATOM   3241  C  CG  . PHE A 1 413 ? 98.683  112.820 103.519 1.00 25.03  ? 413 PHE A CG  1 
ATOM   3242  C  CD1 . PHE A 1 413 ? 97.650  113.700 103.685 1.00 25.03  ? 413 PHE A CD1 1 
ATOM   3243  C  CD2 . PHE A 1 413 ? 98.885  112.252 102.285 1.00 25.03  ? 413 PHE A CD2 1 
ATOM   3244  C  CE1 . PHE A 1 413 ? 96.873  114.062 102.619 1.00 25.03  ? 413 PHE A CE1 1 
ATOM   3245  C  CE2 . PHE A 1 413 ? 98.112  112.604 101.221 1.00 25.03  ? 413 PHE A CE2 1 
ATOM   3246  C  CZ  . PHE A 1 413 ? 97.106  113.512 101.386 1.00 25.03  ? 413 PHE A CZ  1 
ATOM   3247  N  N   . ALA A 1 414 ? 102.446 113.206 106.502 1.00 28.89  ? 414 ALA A N   1 
ATOM   3248  C  CA  . ALA A 1 414 ? 103.201 112.654 107.621 1.00 28.89  ? 414 ALA A CA  1 
ATOM   3249  C  C   . ALA A 1 414 ? 102.827 113.370 108.897 1.00 28.89  ? 414 ALA A C   1 
ATOM   3250  O  O   . ALA A 1 414 ? 102.643 112.740 109.942 1.00 28.89  ? 414 ALA A O   1 
ATOM   3251  C  CB  . ALA A 1 414 ? 104.707 112.756 107.430 1.00 28.89  ? 414 ALA A CB  1 
ATOM   3252  N  N   . SER A 1 415 ? 102.654 114.686 108.803 1.00 31.34  ? 415 SER A N   1 
ATOM   3253  C  CA  . SER A 1 415 ? 102.304 115.469 109.971 1.00 31.34  ? 415 SER A CA  1 
ATOM   3254  C  C   . SER A 1 415 ? 100.917 115.136 110.470 1.00 31.34  ? 415 SER A C   1 
ATOM   3255  O  O   . SER A 1 415 ? 100.688 115.142 111.681 1.00 31.34  ? 415 SER A O   1 
ATOM   3256  C  CB  . SER A 1 415 ? 102.387 116.943 109.630 1.00 31.34  ? 415 SER A CB  1 
ATOM   3257  O  OG  . SER A 1 415 ? 101.148 117.363 109.110 1.00 31.34  ? 415 SER A OG  1 
ATOM   3258  N  N   . LEU A 1 416 ? 99.983  114.853 109.577 1.00 33.13  ? 416 LEU A N   1 
ATOM   3259  C  CA  . LEU A 1 416 ? 98.673  114.458 110.061 1.00 33.13  ? 416 LEU A CA  1 
ATOM   3260  C  C   . LEU A 1 416 ? 98.719  113.053 110.636 1.00 33.13  ? 416 LEU A C   1 
ATOM   3261  O  O   . LEU A 1 416 ? 97.993  112.749 111.585 1.00 33.13  ? 416 LEU A O   1 
ATOM   3262  C  CB  . LEU A 1 416 ? 97.640  114.582 108.961 1.00 33.13  ? 416 LEU A CB  1 
ATOM   3263  C  CG  . LEU A 1 416 ? 97.720  115.981 108.380 1.00 33.13  ? 416 LEU A CG  1 
ATOM   3264  C  CD1 . LEU A 1 416 ? 96.789  116.074 107.226 1.00 33.13  ? 416 LEU A CD1 1 
ATOM   3265  C  CD2 . LEU A 1 416 ? 97.350  117.000 109.425 1.00 33.13  ? 416 LEU A CD2 1 
ATOM   3266  N  N   . PHE A 1 417 ? 99.560  112.186 110.077 1.00 35.06  ? 417 PHE A N   1 
ATOM   3267  C  CA  . PHE A 1 417 ? 99.739  110.863 110.657 1.00 35.06  ? 417 PHE A CA  1 
ATOM   3268  C  C   . PHE A 1 417 ? 100.463 110.933 111.989 1.00 35.06  ? 417 PHE A C   1 
ATOM   3269  O  O   . PHE A 1 417 ? 100.141 110.182 112.913 1.00 35.06  ? 417 PHE A O   1 
ATOM   3270  C  CB  . PHE A 1 417 ? 100.532 109.972 109.710 1.00 35.06  ? 417 PHE A CB  1 
ATOM   3271  C  CG  . PHE A 1 417 ? 99.732  109.393 108.599 1.00 35.06  ? 417 PHE A CG  1 
ATOM   3272  C  CD1 . PHE A 1 417 ? 98.373  109.236 108.716 1.00 35.06  ? 417 PHE A CD1 1 
ATOM   3273  C  CD2 . PHE A 1 417 ? 100.354 109.004 107.428 1.00 35.06  ? 417 PHE A CD2 1 
ATOM   3274  C  CE1 . PHE A 1 417 ? 97.653  108.701 107.683 1.00 35.06  ? 417 PHE A CE1 1 
ATOM   3275  C  CE2 . PHE A 1 417 ? 99.639  108.475 106.400 1.00 35.06  ? 417 PHE A CE2 1 
ATOM   3276  C  CZ  . PHE A 1 417 ? 98.289  108.321 106.525 1.00 35.06  ? 417 PHE A CZ  1 
ATOM   3277  N  N   . TYR A 1 418 ? 101.425 111.844 112.117 1.00 39.12  ? 418 TYR A N   1 
ATOM   3278  C  CA  . TYR A 1 418 ? 102.130 111.999 113.381 1.00 39.12  ? 418 TYR A CA  1 
ATOM   3279  C  C   . TYR A 1 418 ? 101.253 112.568 114.478 1.00 39.12  ? 418 TYR A C   1 
ATOM   3280  O  O   . TYR A 1 418 ? 101.454 112.243 115.648 1.00 39.12  ? 418 TYR A O   1 
ATOM   3281  C  CB  . TYR A 1 418 ? 103.342 112.896 113.183 1.00 39.12  ? 418 TYR A CB  1 
ATOM   3282  C  CG  . TYR A 1 418 ? 104.272 112.998 114.364 1.00 39.12  ? 418 TYR A CG  1 
ATOM   3283  C  CD1 . TYR A 1 418 ? 105.231 112.037 114.597 1.00 39.12  ? 418 TYR A CD1 1 
ATOM   3284  C  CD2 . TYR A 1 418 ? 104.202 114.075 115.231 1.00 39.12  ? 418 TYR A CD2 1 
ATOM   3285  C  CE1 . TYR A 1 418 ? 106.088 112.139 115.663 1.00 39.12  ? 418 TYR A CE1 1 
ATOM   3286  C  CE2 . TYR A 1 418 ? 105.050 114.184 116.297 1.00 39.12  ? 418 TYR A CE2 1 
ATOM   3287  C  CZ  . TYR A 1 418 ? 105.990 113.214 116.509 1.00 39.12  ? 418 TYR A CZ  1 
ATOM   3288  O  OH  . TYR A 1 418 ? 106.841 113.324 117.577 1.00 39.12  ? 418 TYR A OH  1 
ATOM   3289  N  N   . ILE A 1 419 ? 100.300 113.426 114.141 1.00 37.64  ? 419 ILE A N   1 
ATOM   3290  C  CA  . ILE A 1 419 ? 99.390  113.922 115.161 1.00 37.64  ? 419 ILE A CA  1 
ATOM   3291  C  C   . ILE A 1 419 ? 98.399  112.849 115.577 1.00 37.64  ? 419 ILE A C   1 
ATOM   3292  O  O   . ILE A 1 419 ? 98.164  112.634 116.770 1.00 37.64  ? 419 ILE A O   1 
ATOM   3293  C  CB  . ILE A 1 419 ? 98.692  115.192 114.666 1.00 37.64  ? 419 ILE A CB  1 
ATOM   3294  C  CG1 . ILE A 1 419 ? 99.696  116.322 114.645 1.00 37.64  ? 419 ILE A CG1 1 
ATOM   3295  C  CG2 . ILE A 1 419 ? 97.563  115.577 115.560 1.00 37.64  ? 419 ILE A CG2 1 
ATOM   3296  C  CD1 . ILE A 1 419 ? 99.205  117.569 113.985 1.00 37.64  ? 419 ILE A CD1 1 
ATOM   3297  N  N   . ALA A 1 420 ? 97.854  112.119 114.617 1.00 40.95  ? 420 ALA A N   1 
ATOM   3298  C  CA  . ALA A 1 420 ? 96.759  111.206 114.911 1.00 40.95  ? 420 ALA A CA  1 
ATOM   3299  C  C   . ALA A 1 420 ? 97.192  109.942 115.636 1.00 40.95  ? 420 ALA A C   1 
ATOM   3300  O  O   . ALA A 1 420 ? 96.441  109.437 116.474 1.00 40.95  ? 420 ALA A O   1 
ATOM   3301  C  CB  . ALA A 1 420 ? 96.045  110.823 113.623 1.00 40.95  ? 420 ALA A CB  1 
ATOM   3302  N  N   . PHE A 1 421 ? 98.371  109.413 115.347 1.00 40.53  ? 421 PHE A N   1 
ATOM   3303  C  CA  . PHE A 1 421 ? 98.743  108.100 115.845 1.00 40.53  ? 421 PHE A CA  1 
ATOM   3304  C  C   . PHE A 1 421 ? 99.897  108.094 116.826 1.00 40.53  ? 421 PHE A C   1 
ATOM   3305  O  O   . PHE A 1 421 ? 100.261 107.022 117.315 1.00 40.53  ? 421 PHE A O   1 
ATOM   3306  C  CB  . PHE A 1 421 ? 99.089  107.180 114.680 1.00 40.53  ? 421 PHE A CB  1 
ATOM   3307  C  CG  . PHE A 1 421 ? 97.998  107.050 113.689 1.00 40.53  ? 421 PHE A CG  1 
ATOM   3308  C  CD1 . PHE A 1 421 ? 96.723  106.750 114.101 1.00 40.53  ? 421 PHE A CD1 1 
ATOM   3309  C  CD2 . PHE A 1 421 ? 98.241  107.243 112.350 1.00 40.53  ? 421 PHE A CD2 1 
ATOM   3310  C  CE1 . PHE A 1 421 ? 95.715  106.628 113.197 1.00 40.53  ? 421 PHE A CE1 1 
ATOM   3311  C  CE2 . PHE A 1 421 ? 97.238  107.127 111.444 1.00 40.53  ? 421 PHE A CE2 1 
ATOM   3312  C  CZ  . PHE A 1 421 ? 95.972  106.817 111.866 1.00 40.53  ? 421 PHE A CZ  1 
ATOM   3313  N  N   . VAL A 1 422 ? 100.493 109.237 117.125 1.00 43.22  ? 422 VAL A N   1 
ATOM   3314  C  CA  . VAL A 1 422 ? 101.554 109.321 118.115 1.00 43.22  ? 422 VAL A CA  1 
ATOM   3315  C  C   . VAL A 1 422 ? 101.153 110.228 119.267 1.00 43.22  ? 422 VAL A C   1 
ATOM   3316  O  O   . VAL A 1 422 ? 101.150 109.813 120.426 1.00 43.22  ? 422 VAL A O   1 
ATOM   3317  C  CB  . VAL A 1 422 ? 102.872 109.805 117.477 1.00 43.22  ? 422 VAL A CB  1 
ATOM   3318  C  CG1 . VAL A 1 422 ? 103.896 110.136 118.545 1.00 43.22  ? 422 VAL A CG1 1 
ATOM   3319  C  CG2 . VAL A 1 422 ? 103.395 108.769 116.508 1.00 43.22  ? 422 VAL A CG2 1 
ATOM   3320  N  N   . LEU A 1 423 ? 100.785 111.465 118.964 1.00 47.78  ? 423 LEU A N   1 
ATOM   3321  C  CA  . LEU A 1 423 ? 100.298 112.337 120.018 1.00 47.78  ? 423 LEU A CA  1 
ATOM   3322  C  C   . LEU A 1 423 ? 98.895  111.939 120.435 1.00 47.78  ? 423 LEU A C   1 
ATOM   3323  O  O   . LEU A 1 423 ? 98.566  112.010 121.622 1.00 47.78  ? 423 LEU A O   1 
ATOM   3324  C  CB  . LEU A 1 423 ? 100.366 113.796 119.588 1.00 47.78  ? 423 LEU A CB  1 
ATOM   3325  C  CG  . LEU A 1 423 ? 101.757 114.306 119.202 1.00 47.78  ? 423 LEU A CG  1 
ATOM   3326  C  CD1 . LEU A 1 423 ? 101.743 115.814 119.187 1.00 47.78  ? 423 LEU A CD1 1 
ATOM   3327  C  CD2 . LEU A 1 423 ? 102.854 113.812 120.131 1.00 47.78  ? 423 LEU A CD2 1 
ATOM   3328  N  N   . LYS A 1 424 ? 98.086  111.494 119.473 1.00 52.74  ? 424 LYS A N   1 
ATOM   3329  C  CA  . LYS A 1 424 ? 96.687  111.102 119.646 1.00 52.74  ? 424 LYS A CA  1 
ATOM   3330  C  C   . LYS A 1 424 ? 95.865  112.224 120.278 1.00 52.74  ? 424 LYS A C   1 
ATOM   3331  O  O   . LYS A 1 424 ? 95.294  112.086 121.354 1.00 52.74  ? 424 LYS A O   1 
ATOM   3332  C  CB  . LYS A 1 424 ? 96.573  109.817 120.472 1.00 52.74  ? 424 LYS A CB  1 
ATOM   3333  C  CG  . LYS A 1 424 ? 97.546  108.737 120.064 1.00 52.74  ? 424 LYS A CG  1 
ATOM   3334  N  N   . ASP A 1 425 ? 95.812  113.348 119.569 1.00 59.86  ? 425 ASP A N   1 
ATOM   3335  C  CA  . ASP A 1 425 ? 95.147  114.540 120.094 1.00 59.86  ? 425 ASP A CA  1 
ATOM   3336  C  C   . ASP A 1 425 ? 94.243  115.099 118.995 1.00 59.86  ? 425 ASP A C   1 
ATOM   3337  O  O   . ASP A 1 425 ? 94.700  115.817 118.104 1.00 59.86  ? 425 ASP A O   1 
ATOM   3338  C  CB  . ASP A 1 425 ? 96.191  115.543 120.549 1.00 59.86  ? 425 ASP A CB  1 
ATOM   3339  C  CG  . ASP A 1 425 ? 95.585  116.737 121.221 1.00 59.86  ? 425 ASP A CG  1 
ATOM   3340  O  OD1 . ASP A 1 425 ? 94.469  116.594 121.756 1.00 59.86  ? 425 ASP A OD1 1 
ATOM   3341  O  OD2 . ASP A 1 425 ? 96.224  117.810 121.233 1.00 59.86  ? 425 ASP A OD2 1 
ATOM   3342  N  N   . MET A 1 426 ? 92.941  114.825 119.112 1.00 60.38  ? 426 MET A N   1 
ATOM   3343  C  CA  . MET A 1 426 ? 92.023  115.084 118.007 1.00 60.38  ? 426 MET A CA  1 
ATOM   3344  C  C   . MET A 1 426 ? 91.695  116.557 117.844 1.00 60.38  ? 426 MET A C   1 
ATOM   3345  O  O   . MET A 1 426 ? 91.279  116.970 116.759 1.00 60.38  ? 426 MET A O   1 
ATOM   3346  C  CB  . MET A 1 426 ? 90.722  114.317 118.207 1.00 60.38  ? 426 MET A CB  1 
ATOM   3347  C  CG  . MET A 1 426 ? 90.876  112.830 118.196 1.00 60.38  ? 426 MET A CG  1 
ATOM   3348  S  SD  . MET A 1 426 ? 91.872  112.221 116.848 1.00 60.38  ? 426 MET A SD  1 
ATOM   3349  C  CE  . MET A 1 426 ? 91.810  110.477 117.223 1.00 60.38  ? 426 MET A CE  1 
ATOM   3350  N  N   . LYS A 1 427 ? 91.813  117.354 118.903 1.00 55.97  ? 427 LYS A N   1 
ATOM   3351  C  CA  . LYS A 1 427 ? 91.569  118.783 118.753 1.00 55.97  ? 427 LYS A CA  1 
ATOM   3352  C  C   . LYS A 1 427 ? 92.671  119.421 117.920 1.00 55.97  ? 427 LYS A C   1 
ATOM   3353  O  O   . LYS A 1 427 ? 92.400  120.260 117.055 1.00 55.97  ? 427 LYS A O   1 
ATOM   3354  C  CB  . LYS A 1 427 ? 91.417  119.465 120.111 1.00 55.97  ? 427 LYS A CB  1 
ATOM   3355  C  CG  . LYS A 1 427 ? 92.369  119.002 121.174 1.00 55.97  ? 427 LYS A CG  1 
ATOM   3356  C  CD  . LYS A 1 427 ? 92.351  119.937 122.360 1.00 55.97  ? 427 LYS A CD  1 
ATOM   3357  C  CE  . LYS A 1 427 ? 93.517  119.657 123.282 1.00 55.97  ? 427 LYS A CE  1 
ATOM   3358  N  NZ  . LYS A 1 427 ? 93.848  120.847 124.105 1.00 55.97  ? 427 LYS A NZ  1 
ATOM   3359  N  N   . LEU A 1 428 ? 93.921  119.067 118.203 1.00 51.25  ? 428 LEU A N   1 
ATOM   3360  C  CA  . LEU A 1 428 ? 95.038  119.515 117.387 1.00 51.25  ? 428 LEU A CA  1 
ATOM   3361  C  C   . LEU A 1 428 ? 94.996  118.943 115.976 1.00 51.25  ? 428 LEU A C   1 
ATOM   3362  O  O   . LEU A 1 428 ? 95.441  119.604 115.031 1.00 51.25  ? 428 LEU A O   1 
ATOM   3363  C  CB  . LEU A 1 428 ? 96.339  119.117 118.073 1.00 51.25  ? 428 LEU A CB  1 
ATOM   3364  C  CG  . LEU A 1 428 ? 97.660  119.490 117.419 1.00 51.25  ? 428 LEU A CG  1 
ATOM   3365  C  CD1 . LEU A 1 428 ? 97.715  120.979 117.232 1.00 51.25  ? 428 LEU A CD1 1 
ATOM   3366  C  CD2 . LEU A 1 428 ? 98.815  119.025 118.275 1.00 51.25  ? 428 LEU A CD2 1 
ATOM   3367  N  N   . LEU A 1 429 ? 94.445  117.741 115.803 1.00 48.26  ? 429 LEU A N   1 
ATOM   3368  C  CA  . LEU A 1 429 ? 94.320  117.160 114.467 1.00 48.26  ? 429 LEU A CA  1 
ATOM   3369  C  C   . LEU A 1 429 ? 93.318  117.906 113.594 1.00 48.26  ? 429 LEU A C   1 
ATOM   3370  O  O   . LEU A 1 429 ? 93.579  118.127 112.409 1.00 48.26  ? 429 LEU A O   1 
ATOM   3371  C  CB  . LEU A 1 429 ? 93.928  115.693 114.565 1.00 48.26  ? 429 LEU A CB  1 
ATOM   3372  C  CG  . LEU A 1 429 ? 93.752  114.961 113.243 1.00 48.26  ? 429 LEU A CG  1 
ATOM   3373  C  CD1 . LEU A 1 429 ? 95.001  115.088 112.423 1.00 48.26  ? 429 LEU A CD1 1 
ATOM   3374  C  CD2 . LEU A 1 429 ? 93.470  113.526 113.510 1.00 48.26  ? 429 LEU A CD2 1 
ATOM   3375  N  N   . ARG A 1 430 ? 92.179  118.303 114.160 1.00 53.34  ? 430 ARG A N   1 
ATOM   3376  C  CA  . ARG A 1 430 ? 91.196  119.075 113.408 1.00 53.34  ? 430 ARG A CA  1 
ATOM   3377  C  C   . ARG A 1 430 ? 91.761  120.411 112.968 1.00 53.34  ? 430 ARG A C   1 
ATOM   3378  O  O   . ARG A 1 430 ? 91.532  120.849 111.837 1.00 53.34  ? 430 ARG A O   1 
ATOM   3379  C  CB  . ARG A 1 430 ? 89.935  119.291 114.234 1.00 53.34  ? 430 ARG A CB  1 
ATOM   3380  C  CG  . ARG A 1 430 ? 89.079  118.069 114.416 1.00 53.34  ? 430 ARG A CG  1 
ATOM   3381  C  CD  . ARG A 1 430 ? 87.852  118.432 115.216 1.00 53.34  ? 430 ARG A CD  1 
ATOM   3382  N  NE  . ARG A 1 430 ? 87.484  117.405 116.180 1.00 53.34  ? 430 ARG A NE  1 
ATOM   3383  C  CZ  . ARG A 1 430 ? 86.558  116.482 115.960 1.00 53.34  ? 430 ARG A CZ  1 
ATOM   3384  N  NH1 . ARG A 1 430 ? 85.905  116.461 114.811 1.00 53.34  ? 430 ARG A NH1 1 
ATOM   3385  N  NH2 . ARG A 1 430 ? 86.279  115.586 116.892 1.00 53.34  ? 430 ARG A NH2 1 
ATOM   3386  N  N   . GLN A 1 431 ? 92.443  121.099 113.870 1.00 54.25  ? 431 GLN A N   1 
ATOM   3387  C  CA  . GLN A 1 431 ? 93.009  122.395 113.536 1.00 54.25  ? 431 GLN A CA  1 
ATOM   3388  C  C   . GLN A 1 431 ? 94.081  122.265 112.467 1.00 54.25  ? 431 GLN A C   1 
ATOM   3389  O  O   . GLN A 1 431 ? 94.100  123.037 111.504 1.00 54.25  ? 431 GLN A O   1 
ATOM   3390  C  CB  . GLN A 1 431 ? 93.576  123.036 114.794 1.00 54.25  ? 431 GLN A CB  1 
ATOM   3391  C  CG  . GLN A 1 431 ? 92.515  123.661 115.663 1.00 54.25  ? 431 GLN A CG  1 
ATOM   3392  C  CD  . GLN A 1 431 ? 93.102  124.436 116.806 1.00 54.25  ? 431 GLN A CD  1 
ATOM   3393  O  OE1 . GLN A 1 431 ? 94.319  124.562 116.919 1.00 54.25  ? 431 GLN A OE1 1 
ATOM   3394  N  NE2 . GLN A 1 431 ? 92.243  124.942 117.681 1.00 54.25  ? 431 GLN A NE2 1 
ATOM   3395  N  N   . SER A 1 432 ? 94.967  121.283 112.608 1.00 45.43  ? 432 SER A N   1 
ATOM   3396  C  CA  . SER A 1 432 ? 96.064  121.144 111.659 1.00 45.43  ? 432 SER A CA  1 
ATOM   3397  C  C   . SER A 1 432 ? 95.597  120.664 110.287 1.00 45.43  ? 432 SER A C   1 
ATOM   3398  O  O   . SER A 1 432 ? 96.141  121.095 109.265 1.00 45.43  ? 432 SER A O   1 
ATOM   3399  C  CB  . SER A 1 432 ? 97.119  120.205 112.221 1.00 45.43  ? 432 SER A CB  1 
ATOM   3400  O  OG  . SER A 1 432 ? 98.181  120.065 111.302 1.00 45.43  ? 432 SER A OG  1 
ATOM   3401  N  N   . LEU A 1 433 ? 94.603  119.776 110.237 1.00 37.60  ? 433 LEU A N   1 
ATOM   3402  C  CA  . LEU A 1 433 ? 94.108  119.282 108.951 1.00 37.60  ? 433 LEU A CA  1 
ATOM   3403  C  C   . LEU A 1 433 ? 93.378  120.361 108.171 1.00 37.60  ? 433 LEU A C   1 
ATOM   3404  O  O   . LEU A 1 433 ? 93.555  120.477 106.956 1.00 37.60  ? 433 LEU A O   1 
ATOM   3405  C  CB  . LEU A 1 433 ? 93.178  118.095 109.161 1.00 37.60  ? 433 LEU A CB  1 
ATOM   3406  C  CG  . LEU A 1 433 ? 92.371  117.574 107.978 1.00 37.60  ? 433 LEU A CG  1 
ATOM   3407  C  CD1 . LEU A 1 433 ? 93.272  117.120 106.880 1.00 37.60  ? 433 LEU A CD1 1 
ATOM   3408  C  CD2 . LEU A 1 433 ? 91.468  116.457 108.407 1.00 37.60  ? 433 LEU A CD2 1 
ATOM   3409  N  N   . ALA A 1 434 ? 92.547  121.147 108.848 1.00 39.81  ? 434 ALA A N   1 
ATOM   3410  C  CA  . ALA A 1 434 ? 91.835  122.223 108.176 1.00 39.81  ? 434 ALA A CA  1 
ATOM   3411  C  C   . ALA A 1 434 ? 92.792  123.292 107.682 1.00 39.81  ? 434 ALA A C   1 
ATOM   3412  O  O   . ALA A 1 434 ? 92.605  123.832 106.589 1.00 39.81  ? 434 ALA A O   1 
ATOM   3413  C  CB  . ALA A 1 434 ? 90.792  122.823 109.109 1.00 39.81  ? 434 ALA A CB  1 
ATOM   3414  N  N   . THR A 1 435 ? 93.799  123.631 108.480 1.00 39.51  ? 435 THR A N   1 
ATOM   3415  C  CA  . THR A 1 435 ? 94.732  124.669 108.069 1.00 39.51  ? 435 THR A CA  1 
ATOM   3416  C  C   . THR A 1 435 ? 95.613  124.205 106.923 1.00 39.51  ? 435 THR A C   1 
ATOM   3417  O  O   . THR A 1 435 ? 95.876  124.975 106.002 1.00 39.51  ? 435 THR A O   1 
ATOM   3418  C  CB  . THR A 1 435 ? 95.593  125.114 109.231 1.00 39.51  ? 435 THR A CB  1 
ATOM   3419  O  OG1 . THR A 1 435 ? 96.068  123.963 109.927 1.00 39.51  ? 435 THR A OG1 1 
ATOM   3420  C  CG2 . THR A 1 435 ? 94.790  125.976 110.157 1.00 39.51  ? 435 THR A CG2 1 
ATOM   3421  N  N   . LEU A 1 436 ? 96.082  122.956 106.966 1.00 34.88  ? 436 LEU A N   1 
ATOM   3422  C  CA  . LEU A 1 436 ? 96.912  122.431 105.883 1.00 34.88  ? 436 LEU A CA  1 
ATOM   3423  C  C   . LEU A 1 436 ? 96.158  122.360 104.566 1.00 34.88  ? 436 LEU A C   1 
ATOM   3424  O  O   . LEU A 1 436 ? 96.713  122.706 103.524 1.00 34.88  ? 436 LEU A O   1 
ATOM   3425  C  CB  . LEU A 1 436 ? 97.477  121.063 106.245 1.00 34.88  ? 436 LEU A CB  1 
ATOM   3426  C  CG  . LEU A 1 436 ? 98.749  121.070 107.081 1.00 34.88  ? 436 LEU A CG  1 
ATOM   3427  C  CD1 . LEU A 1 436 ? 99.347  119.703 107.086 1.00 34.88  ? 436 LEU A CD1 1 
ATOM   3428  C  CD2 . LEU A 1 436 ? 99.742  122.022 106.482 1.00 34.88  ? 436 LEU A CD2 1 
ATOM   3429  N  N   . LEU A 1 437 ? 94.914  121.895 104.585 1.00 30.95  ? 437 LEU A N   1 
ATOM   3430  C  CA  . LEU A 1 437 ? 94.135  121.789 103.356 1.00 30.95  ? 437 LEU A CA  1 
ATOM   3431  C  C   . LEU A 1 437 ? 93.850  123.150 102.731 1.00 30.95  ? 437 LEU A C   1 
ATOM   3432  O  O   . LEU A 1 437 ? 94.033  123.337 101.524 1.00 30.95  ? 437 LEU A O   1 
ATOM   3433  C  CB  . LEU A 1 437 ? 92.829  121.064 103.649 1.00 30.95  ? 437 LEU A CB  1 
ATOM   3434  C  CG  . LEU A 1 437 ? 91.862  120.897 102.495 1.00 30.95  ? 437 LEU A CG  1 
ATOM   3435  C  CD1 . LEU A 1 437 ? 92.531  120.188 101.380 1.00 30.95  ? 437 LEU A CD1 1 
ATOM   3436  C  CD2 . LEU A 1 437 ? 90.668  120.108 102.965 1.00 30.95  ? 437 LEU A CD2 1 
ATOM   3437  N  N   . ILE A 1 438 ? 93.376  124.103 103.527 1.00 32.48  ? 438 ILE A N   1 
ATOM   3438  C  CA  . ILE A 1 438 ? 93.011  125.405 102.983 1.00 32.48  ? 438 ILE A CA  1 
ATOM   3439  C  C   . ILE A 1 438 ? 94.236  126.215 102.571 1.00 32.48  ? 438 ILE A C   1 
ATOM   3440  O  O   . ILE A 1 438 ? 94.238  126.852 101.511 1.00 32.48  ? 438 ILE A O   1 
ATOM   3441  C  CB  . ILE A 1 438 ? 92.141  126.157 104.001 1.00 32.48  ? 438 ILE A CB  1 
ATOM   3442  C  CG1 . ILE A 1 438 ? 90.835  125.404 104.199 1.00 32.48  ? 438 ILE A CG1 1 
ATOM   3443  C  CG2 . ILE A 1 438 ? 91.831  127.544 103.528 1.00 32.48  ? 438 ILE A CG2 1 
ATOM   3444  C  CD1 . ILE A 1 438 ? 89.916  126.029 105.195 1.00 32.48  ? 438 ILE A CD1 1 
ATOM   3445  N  N   . THR A 1 439 ? 95.311  126.168 103.356 1.00 35.63  ? 439 THR A N   1 
ATOM   3446  C  CA  . THR A 1 439 ? 96.486  126.958 102.998 1.00 35.63  ? 439 THR A CA  1 
ATOM   3447  C  C   . THR A 1 439 ? 97.211  126.389 101.790 1.00 35.63  ? 439 THR A C   1 
ATOM   3448  O  O   . THR A 1 439 ? 97.668  127.151 100.929 1.00 35.63  ? 439 THR A O   1 
ATOM   3449  C  CB  . THR A 1 439 ? 97.449  127.058 104.171 1.00 35.63  ? 439 THR A CB  1 
ATOM   3450  O  OG1 . THR A 1 439 ? 96.737  127.545 105.306 1.00 35.63  ? 439 THR A OG1 1 
ATOM   3451  C  CG2 . THR A 1 439 ? 98.530  128.068 103.872 1.00 35.63  ? 439 THR A CG2 1 
ATOM   3452  N  N   . SER A 1 440 ? 97.278  125.061 101.675 1.00 34.03  ? 440 SER A N   1 
ATOM   3453  C  CA  . SER A 1 440 ? 97.907  124.473 100.497 1.00 34.03  ? 440 SER A CA  1 
ATOM   3454  C  C   . SER A 1 440 ? 97.095  124.760 99.253  1.00 34.03  ? 440 SER A C   1 
ATOM   3455  O  O   . SER A 1 440 ? 97.666  125.016 98.194  1.00 34.03  ? 440 SER A O   1 
ATOM   3456  C  CB  . SER A 1 440 ? 98.104  122.974 100.662 1.00 34.03  ? 440 SER A CB  1 
ATOM   3457  O  OG  . SER A 1 440 ? 98.623  122.412 99.478  1.00 34.03  ? 440 SER A OG  1 
ATOM   3458  N  N   . GLN A 1 441 ? 95.772  124.777 99.371  1.00 37.57  ? 441 GLN A N   1 
ATOM   3459  C  CA  . GLN A 1 441 ? 94.949  125.088 98.213  1.00 37.57  ? 441 GLN A CA  1 
ATOM   3460  C  C   . GLN A 1 441 ? 95.053  126.551 97.826  1.00 37.57  ? 441 GLN A C   1 
ATOM   3461  O  O   . GLN A 1 441 ? 95.053  126.873 96.635  1.00 37.57  ? 441 GLN A O   1 
ATOM   3462  C  CB  . GLN A 1 441 ? 93.503  124.743 98.476  1.00 37.57  ? 441 GLN A CB  1 
ATOM   3463  C  CG  . GLN A 1 441 ? 93.164  123.325 98.241  1.00 37.57  ? 441 GLN A CG  1 
ATOM   3464  C  CD  . GLN A 1 441 ? 91.749  123.075 98.639  1.00 37.57  ? 441 GLN A CD  1 
ATOM   3465  O  OE1 . GLN A 1 441 ? 91.078  123.966 99.154  1.00 37.57  ? 441 GLN A OE1 1 
ATOM   3466  N  NE2 . GLN A 1 441 ? 91.267  121.876 98.395  1.00 37.57  ? 441 GLN A NE2 1 
ATOM   3467  N  N   . ILE A 1 442 ? 95.121  127.449 98.807  1.00 36.03  ? 442 ILE A N   1 
ATOM   3468  C  CA  . ILE A 1 442 ? 95.222  128.866 98.487  1.00 36.03  ? 442 ILE A CA  1 
ATOM   3469  C  C   . ILE A 1 442 ? 96.568  129.148 97.847  1.00 36.03  ? 442 ILE A C   1 
ATOM   3470  O  O   . ILE A 1 442 ? 96.659  129.872 96.848  1.00 36.03  ? 442 ILE A O   1 
ATOM   3471  C  CB  . ILE A 1 442 ? 94.992  129.708 99.753  1.00 36.03  ? 442 ILE A CB  1 
ATOM   3472  C  CG1 . ILE A 1 442 ? 93.502  129.880 100.016 1.00 36.03  ? 442 ILE A CG1 1 
ATOM   3473  C  CG2 . ILE A 1 442 ? 95.636  131.073 99.648  1.00 36.03  ? 442 ILE A CG2 1 
ATOM   3474  C  CD1 . ILE A 1 442 ? 93.204  130.644 101.288 1.00 36.03  ? 442 ILE A CD1 1 
ATOM   3475  N  N   . LEU A 1 443 ? 97.625  128.546 98.382  1.00 37.34  ? 443 LEU A N   1 
ATOM   3476  C  CA  . LEU A 1 443 ? 98.941  128.731 97.794  1.00 37.34  ? 443 LEU A CA  1 
ATOM   3477  C  C   . LEU A 1 443 ? 99.044  128.020 96.453  1.00 37.34  ? 443 LEU A C   1 
ATOM   3478  O  O   . LEU A 1 443 ? 99.811  128.440 95.579  1.00 37.34  ? 443 LEU A O   1 
ATOM   3479  C  CB  . LEU A 1 443 ? 100.020 128.235 98.738  1.00 37.34  ? 443 LEU A CB  1 
ATOM   3480  C  CG  . LEU A 1 443 ? 101.273 129.039 98.455  1.00 37.34  ? 443 LEU A CG  1 
ATOM   3481  C  CD1 . LEU A 1 443 ? 101.128 130.405 99.083  1.00 37.34  ? 443 LEU A CD1 1 
ATOM   3482  C  CD2 . LEU A 1 443 ? 102.485 128.329 98.965  1.00 37.34  ? 443 LEU A CD2 1 
ATOM   3483  N  N   . ASN A 1 444 ? 98.319  126.916 96.288  1.00 36.55  ? 444 ASN A N   1 
ATOM   3484  C  CA  . ASN A 1 444 ? 98.248  126.293 94.976  1.00 36.55  ? 444 ASN A CA  1 
ATOM   3485  C  C   . ASN A 1 444 ? 97.576  127.187 93.951  1.00 36.55  ? 444 ASN A C   1 
ATOM   3486  O  O   . ASN A 1 444 ? 98.148  127.417 92.891  1.00 36.55  ? 444 ASN A O   1 
ATOM   3487  C  CB  . ASN A 1 444 ? 97.518  124.972 95.027  1.00 36.55  ? 444 ASN A CB  1 
ATOM   3488  C  CG  . ASN A 1 444 ? 97.809  124.143 93.843  1.00 36.55  ? 444 ASN A CG  1 
ATOM   3489  O  OD1 . ASN A 1 444 ? 96.994  124.036 92.938  1.00 36.55  ? 444 ASN A OD1 1 
ATOM   3490  N  ND2 . ASN A 1 444 ? 99.002  123.574 93.805  1.00 36.55  ? 444 ASN A ND2 1 
ATOM   3491  N  N   . GLN A 1 445 ? 96.447  127.810 94.301  1.00 38.28  ? 445 GLN A N   1 
ATOM   3492  C  CA  . GLN A 1 445 ? 95.727  128.659 93.353  1.00 38.28  ? 445 GLN A CA  1 
ATOM   3493  C  C   . GLN A 1 445 ? 96.472  129.940 93.055  1.00 38.28  ? 445 GLN A C   1 
ATOM   3494  O  O   . GLN A 1 445 ? 96.242  130.558 92.014  1.00 38.28  ? 445 GLN A O   1 
ATOM   3495  C  CB  . GLN A 1 445 ? 94.342  129.003 93.874  1.00 38.28  ? 445 GLN A CB  1 
ATOM   3496  C  CG  . GLN A 1 445 ? 93.417  127.843 93.915  1.00 38.28  ? 445 GLN A CG  1 
ATOM   3497  C  CD  . GLN A 1 445 ? 92.874  127.510 92.565  1.00 38.28  ? 445 GLN A CD  1 
ATOM   3498  O  OE1 . GLN A 1 445 ? 93.531  126.866 91.757  1.00 38.28  ? 445 GLN A OE1 1 
ATOM   3499  N  NE2 . GLN A 1 445 ? 91.656  127.948 92.304  1.00 38.28  ? 445 GLN A NE2 1 
ATOM   3500  N  N   . ILE A 1 446 ? 97.359  130.358 93.937  1.00 40.86  ? 446 ILE A N   1 
ATOM   3501  C  CA  . ILE A 1 446 ? 98.134  131.541 93.634  1.00 40.86  ? 446 ILE A CA  1 
ATOM   3502  C  C   . ILE A 1 446 ? 99.273  131.178 92.700  1.00 40.86  ? 446 ILE A C   1 
ATOM   3503  O  O   . ILE A 1 446 ? 99.448  131.805 91.652  1.00 40.86  ? 446 ILE A O   1 
ATOM   3504  C  CB  . ILE A 1 446 ? 98.630  132.196 94.929  1.00 40.86  ? 446 ILE A CB  1 
ATOM   3505  C  CG1 . ILE A 1 446 ? 97.499  133.011 95.542  1.00 40.86  ? 446 ILE A CG1 1 
ATOM   3506  C  CG2 . ILE A 1 446 ? 99.823  133.087 94.665  1.00 40.86  ? 446 ILE A CG2 1 
ATOM   3507  C  CD1 . ILE A 1 446 ? 97.867  133.668 96.838  1.00 40.86  ? 446 ILE A CD1 1 
ATOM   3508  N  N   . MET A 1 447 ? 100.044 130.146 93.030  1.00 40.16  ? 447 MET A N   1 
ATOM   3509  C  CA  . MET A 1 447 ? 101.170 129.824 92.169  1.00 40.16  ? 447 MET A CA  1 
ATOM   3510  C  C   . MET A 1 447 ? 100.781 129.090 90.891  1.00 40.16  ? 447 MET A C   1 
ATOM   3511  O  O   . MET A 1 447 ? 101.592 129.049 89.962  1.00 40.16  ? 447 MET A O   1 
ATOM   3512  C  CB  . MET A 1 447 ? 102.166 128.955 92.935  1.00 40.16  ? 447 MET A CB  1 
ATOM   3513  C  CG  . MET A 1 447 ? 102.759 129.606 94.166  1.00 40.16  ? 447 MET A CG  1 
ATOM   3514  S  SD  . MET A 1 447 ? 103.050 131.368 93.977  1.00 40.16  ? 447 MET A SD  1 
ATOM   3515  C  CE  . MET A 1 447 ? 104.704 131.345 93.293  1.00 40.16  ? 447 MET A CE  1 
ATOM   3516  N  N   . GLU A 1 448 ? 99.580  128.521 90.799  1.00 39.84  ? 448 GLU A N   1 
ATOM   3517  C  CA  . GLU A 1 448 ? 99.255  127.780 89.583  1.00 39.84  ? 448 GLU A CA  1 
ATOM   3518  C  C   . GLU A 1 448 ? 98.688  128.698 88.515  1.00 39.84  ? 448 GLU A C   1 
ATOM   3519  O  O   . GLU A 1 448 ? 99.185  128.721 87.388  1.00 39.84  ? 448 GLU A O   1 
ATOM   3520  C  CB  . GLU A 1 448 ? 98.325  126.593 89.871  1.00 39.84  ? 448 GLU A CB  1 
ATOM   3521  C  CG  . GLU A 1 448 ? 97.609  125.965 88.689  1.00 39.84  ? 448 GLU A CG  1 
ATOM   3522  C  CD  . GLU A 1 448 ? 96.737  124.771 89.096  1.00 39.84  ? 448 GLU A CD  1 
ATOM   3523  O  OE1 . GLU A 1 448 ? 96.122  124.797 90.179  1.00 39.84  ? 448 GLU A OE1 1 
ATOM   3524  O  OE2 . GLU A 1 448 ? 96.681  123.790 88.333  1.00 39.84  ? 448 GLU A OE2 1 
ATOM   3525  N  N   . SER A 1 449 ? 97.686  129.490 88.853  1.00 44.21  ? 449 SER A N   1 
ATOM   3526  C  CA  . SER A 1 449 ? 97.023  130.175 87.752  1.00 44.21  ? 449 SER A CA  1 
ATOM   3527  C  C   . SER A 1 449 ? 96.907  131.685 87.899  1.00 44.21  ? 449 SER A C   1 
ATOM   3528  O  O   . SER A 1 449 ? 97.013  132.387 86.896  1.00 44.21  ? 449 SER A O   1 
ATOM   3529  C  CB  . SER A 1 449 ? 95.650  129.579 87.598  1.00 44.21  ? 449 SER A CB  1 
ATOM   3530  O  OG  . SER A 1 449 ? 94.758  130.235 88.467  1.00 44.21  ? 449 SER A OG  1 
ATOM   3531  N  N   . PHE A 1 450 ? 96.691  132.208 89.105  1.00 45.41  ? 450 PHE A N   1 
ATOM   3532  C  CA  . PHE A 1 450 ? 96.366  133.628 89.236  1.00 45.41  ? 450 PHE A CA  1 
ATOM   3533  C  C   . PHE A 1 450 ? 97.593  134.508 89.042  1.00 45.41  ? 450 PHE A C   1 
ATOM   3534  O  O   . PHE A 1 450 ? 97.560  135.471 88.272  1.00 45.41  ? 450 PHE A O   1 
ATOM   3535  C  CB  . PHE A 1 450 ? 95.717  133.926 90.581  1.00 45.41  ? 450 PHE A CB  1 
ATOM   3536  C  CG  . PHE A 1 450 ? 94.307  133.469 90.684  1.00 45.41  ? 450 PHE A CG  1 
ATOM   3537  C  CD1 . PHE A 1 450 ? 93.504  133.445 89.566  1.00 45.41  ? 450 PHE A CD1 1 
ATOM   3538  C  CD2 . PHE A 1 450 ? 93.767  133.109 91.903  1.00 45.41  ? 450 PHE A CD2 1 
ATOM   3539  C  CE1 . PHE A 1 450 ? 92.190  133.049 89.655  1.00 45.41  ? 450 PHE A CE1 1 
ATOM   3540  C  CE2 . PHE A 1 450 ? 92.454  132.707 91.998  1.00 45.41  ? 450 PHE A CE2 1 
ATOM   3541  C  CZ  . PHE A 1 450 ? 91.664  132.678 90.872  1.00 45.41  ? 450 PHE A CZ  1 
ATOM   3542  N  N   . LEU A 1 451 ? 98.675  134.206 89.747  1.00 47.19  ? 451 LEU A N   1 
ATOM   3543  C  CA  . LEU A 1 451 ? 99.918  134.937 89.526  1.00 47.19  ? 451 LEU A CA  1 
ATOM   3544  C  C   . LEU A 1 451 ? 100.512 134.783 88.125  1.00 47.19  ? 451 LEU A C   1 
ATOM   3545  O  O   . LEU A 1 451 ? 100.987 135.800 87.593  1.00 47.19  ? 451 LEU A O   1 
ATOM   3546  C  CB  . LEU A 1 451 ? 100.933 134.547 90.606  1.00 47.19  ? 451 LEU A CB  1 
ATOM   3547  C  CG  . LEU A 1 451 ? 102.388 134.948 90.404  1.00 47.19  ? 451 LEU A CG  1 
ATOM   3548  C  CD1 . LEU A 1 451 ? 102.523 136.445 90.532  1.00 47.19  ? 451 LEU A CD1 1 
ATOM   3549  C  CD2 . LEU A 1 451 ? 103.286 134.260 91.395  1.00 47.19  ? 451 LEU A CD2 1 
ATOM   3550  N  N   . PRO A 1 452 ? 100.522 133.614 87.464  1.00 46.57  ? 452 PRO A N   1 
ATOM   3551  C  CA  . PRO A 1 452 ? 100.932 133.620 86.051  1.00 46.57  ? 452 PRO A CA  1 
ATOM   3552  C  C   . PRO A 1 452 ? 99.999  134.377 85.131  1.00 46.57  ? 452 PRO A C   1 
ATOM   3553  O  O   . PRO A 1 452 ? 100.465 134.905 84.117  1.00 46.57  ? 452 PRO A O   1 
ATOM   3554  C  CB  . PRO A 1 452 ? 100.971 132.135 85.690  1.00 46.57  ? 452 PRO A CB  1 
ATOM   3555  C  CG  . PRO A 1 452 ? 101.276 131.490 86.934  1.00 46.57  ? 452 PRO A CG  1 
ATOM   3556  C  CD  . PRO A 1 452 ? 100.461 132.221 87.939  1.00 46.57  ? 452 PRO A CD  1 
ATOM   3557  N  N   . TYR A 1 453 ? 98.707  134.452 85.436  1.00 50.74  ? 453 TYR A N   1 
ATOM   3558  C  CA  . TYR A 1 453 ? 97.823  135.262 84.608  1.00 50.74  ? 453 TYR A CA  1 
ATOM   3559  C  C   . TYR A 1 453 ? 98.115  136.742 84.762  1.00 50.74  ? 453 TYR A C   1 
ATOM   3560  O  O   . TYR A 1 453 ? 98.052  137.495 83.785  1.00 50.74  ? 453 TYR A O   1 
ATOM   3561  C  CB  . TYR A 1 453 ? 96.367  135.002 84.951  1.00 50.74  ? 453 TYR A CB  1 
ATOM   3562  C  CG  . TYR A 1 453 ? 95.454  135.961 84.250  1.00 50.74  ? 453 TYR A CG  1 
ATOM   3563  C  CD1 . TYR A 1 453 ? 95.375  135.966 82.871  1.00 50.74  ? 453 TYR A CD1 1 
ATOM   3564  C  CD2 . TYR A 1 453 ? 94.704  136.880 84.952  1.00 50.74  ? 453 TYR A CD2 1 
ATOM   3565  C  CE1 . TYR A 1 453 ? 94.560  136.838 82.209  1.00 50.74  ? 453 TYR A CE1 1 
ATOM   3566  C  CE2 . TYR A 1 453 ? 93.880  137.762 84.300  1.00 50.74  ? 453 TYR A CE2 1 
ATOM   3567  C  CZ  . TYR A 1 453 ? 93.814  137.734 82.922  1.00 50.74  ? 453 TYR A CZ  1 
ATOM   3568  O  OH  . TYR A 1 453 ? 93.000  138.605 82.240  1.00 50.74  ? 453 TYR A OH  1 
ATOM   3569  N  N   . TRP A 1 454 ? 98.476  137.165 85.969  1.00 59.50  ? 454 TRP A N   1 
ATOM   3570  C  CA  . TRP A 1 454 ? 98.817  138.563 86.204  1.00 59.50  ? 454 TRP A CA  1 
ATOM   3571  C  C   . TRP A 1 454 ? 100.096 138.958 85.491  1.00 59.50  ? 454 TRP A C   1 
ATOM   3572  O  O   . TRP A 1 454 ? 100.190 140.069 84.962  1.00 59.50  ? 454 TRP A O   1 
ATOM   3573  C  CB  . TRP A 1 454 ? 98.917  138.843 87.694  1.00 59.50  ? 454 TRP A CB  1 
ATOM   3574  C  CG  . TRP A 1 454 ? 99.206  140.254 87.976  1.00 59.50  ? 454 TRP A CG  1 
ATOM   3575  C  CD1 . TRP A 1 454 ? 98.369  141.303 87.783  1.00 59.50  ? 454 TRP A CD1 1 
ATOM   3576  C  CD2 . TRP A 1 454 ? 100.387 140.784 88.570  1.00 59.50  ? 454 TRP A CD2 1 
ATOM   3577  N  NE1 . TRP A 1 454 ? 98.968  142.466 88.184  1.00 59.50  ? 454 TRP A NE1 1 
ATOM   3578  C  CE2 . TRP A 1 454 ? 100.209 142.171 88.679  1.00 59.50  ? 454 TRP A CE2 1 
ATOM   3579  C  CE3 . TRP A 1 454 ? 101.584 140.221 89.010  1.00 59.50  ? 454 TRP A CE3 1 
ATOM   3580  C  CZ2 . TRP A 1 454 ? 101.182 143.005 89.209  1.00 59.50  ? 454 TRP A CZ2 1 
ATOM   3581  C  CZ3 . TRP A 1 454 ? 102.551 141.050 89.537  1.00 59.50  ? 454 TRP A CZ3 1 
ATOM   3582  C  CH2 . TRP A 1 454 ? 102.346 142.427 89.631  1.00 59.50  ? 454 TRP A CH2 1 
ATOM   3583  N  N   . LEU A 1 455 ? 101.102 138.091 85.508  1.00 53.34  ? 455 LEU A N   1 
ATOM   3584  C  CA  . LEU A 1 455 ? 102.316 138.374 84.760  1.00 53.34  ? 455 LEU A CA  1 
ATOM   3585  C  C   . LEU A 1 455 ? 102.054 138.414 83.263  1.00 53.34  ? 455 LEU A C   1 
ATOM   3586  O  O   . LEU A 1 455 ? 102.691 139.186 82.544  1.00 53.34  ? 455 LEU A O   1 
ATOM   3587  C  CB  . LEU A 1 455 ? 103.379 137.336 85.072  1.00 53.34  ? 455 LEU A CB  1 
ATOM   3588  C  CG  . LEU A 1 455 ? 104.157 137.662 86.333  1.00 53.34  ? 455 LEU A CG  1 
ATOM   3589  C  CD1 . LEU A 1 455 ? 105.004 136.481 86.760  1.00 53.34  ? 455 LEU A CD1 1 
ATOM   3590  C  CD2 . LEU A 1 455 ? 105.006 138.875 86.078  1.00 53.34  ? 455 LEU A CD2 1 
ATOM   3591  N  N   . GLN A 1 456 ? 101.116 137.605 82.781  1.00 54.31  ? 456 GLN A N   1 
ATOM   3592  C  CA  . GLN A 1 456 ? 100.780 137.616 81.363  1.00 54.31  ? 456 GLN A CA  1 
ATOM   3593  C  C   . GLN A 1 456 ? 100.040 138.880 80.943  1.00 54.31  ? 456 GLN A C   1 
ATOM   3594  O  O   . GLN A 1 456 ? 100.222 139.352 79.816  1.00 54.31  ? 456 GLN A O   1 
ATOM   3595  C  CB  . GLN A 1 456 ? 99.963  136.381 81.010  1.00 54.31  ? 456 GLN A CB  1 
ATOM   3596  C  CG  . GLN A 1 456 ? 99.774  136.181 79.526  1.00 54.31  ? 456 GLN A CG  1 
ATOM   3597  C  CD  . GLN A 1 456 ? 101.086 136.118 78.793  1.00 54.31  ? 456 GLN A CD  1 
ATOM   3598  O  OE1 . GLN A 1 456 ? 102.014 135.428 79.206  1.00 54.31  ? 456 GLN A OE1 1 
ATOM   3599  N  NE2 . GLN A 1 456 ? 101.172 136.840 77.692  1.00 54.31  ? 456 GLN A NE2 1 
ATOM   3600  N  N   . ARG A 1 457 ? 99.210  139.448 81.821  1.00 61.54  ? 457 ARG A N   1 
ATOM   3601  C  CA  . ARG A 1 457 ? 98.543  140.700 81.471  1.00 61.54  ? 457 ARG A CA  1 
ATOM   3602  C  C   . ARG A 1 457 ? 99.538  141.838 81.336  1.00 61.54  ? 457 ARG A C   1 
ATOM   3603  O  O   . ARG A 1 457 ? 99.399  142.677 80.441  1.00 61.54  ? 457 ARG A O   1 
ATOM   3604  C  CB  . ARG A 1 457 ? 97.490  141.036 82.520  1.00 61.54  ? 457 ARG A CB  1 
ATOM   3605  C  CG  . ARG A 1 457 ? 96.072  140.647 82.150  1.00 61.54  ? 457 ARG A CG  1 
ATOM   3606  C  CD  . ARG A 1 457 ? 95.088  141.281 83.125  1.00 61.54  ? 457 ARG A CD  1 
ATOM   3607  N  NE  . ARG A 1 457 ? 94.685  142.643 82.802  1.00 61.54  ? 457 ARG A NE  1 
ATOM   3608  C  CZ  . ARG A 1 457 ? 93.619  142.949 82.071  1.00 61.54  ? 457 ARG A CZ  1 
ATOM   3609  N  NH1 . ARG A 1 457 ? 92.849  141.986 81.590  1.00 61.54  ? 457 ARG A NH1 1 
ATOM   3610  N  NH2 . ARG A 1 457 ? 93.317  144.217 81.831  1.00 61.54  ? 457 ARG A NH2 1 
ATOM   3611  N  N   . LYS A 1 458 ? 100.533 141.893 82.219  1.00 60.93  ? 458 LYS A N   1 
ATOM   3612  C  CA  . LYS A 1 458 ? 101.584 142.896 82.091  1.00 60.93  ? 458 LYS A CA  1 
ATOM   3613  C  C   . LYS A 1 458 ? 102.394 142.685 80.817  1.00 60.93  ? 458 LYS A C   1 
ATOM   3614  O  O   . LYS A 1 458 ? 102.696 143.640 80.094  1.00 60.93  ? 458 LYS A O   1 
ATOM   3615  C  CB  . LYS A 1 458 ? 102.484 142.888 83.320  1.00 60.93  ? 458 LYS A CB  1 
ATOM   3616  C  CG  . LYS A 1 458 ? 102.114 143.963 84.317  1.00 60.93  ? 458 LYS A CG  1 
ATOM   3617  C  CD  . LYS A 1 458 ? 103.016 143.921 85.523  1.00 60.93  ? 458 LYS A CD  1 
ATOM   3618  C  CE  . LYS A 1 458 ? 102.602 144.955 86.544  1.00 60.93  ? 458 LYS A CE  1 
ATOM   3619  N  NZ  . LYS A 1 458 ? 103.511 144.929 87.719  1.00 60.93  ? 458 LYS A NZ  1 
ATOM   3620  N  N   . HIS A 1 459 ? 102.777 141.437 80.544  1.00 58.37  ? 459 HIS A N   1 
ATOM   3621  C  CA  . HIS A 1 459 ? 103.535 141.123 79.339  1.00 58.37  ? 459 HIS A CA  1 
ATOM   3622  C  C   . HIS A 1 459 ? 102.740 141.341 78.064  1.00 58.37  ? 459 HIS A C   1 
ATOM   3623  O  O   . HIS A 1 459 ? 103.315 141.720 77.041  1.00 58.37  ? 459 HIS A O   1 
ATOM   3624  C  CB  . HIS A 1 459 ? 103.990 139.674 79.388  1.00 58.37  ? 459 HIS A CB  1 
ATOM   3625  C  CG  . HIS A 1 459 ? 105.083 139.349 78.428  1.00 58.37  ? 459 HIS A CG  1 
ATOM   3626  N  ND1 . HIS A 1 459 ? 106.392 139.720 78.632  1.00 58.37  ? 459 HIS A ND1 1 
ATOM   3627  C  CD2 . HIS A 1 459 ? 105.059 138.680 77.252  1.00 58.37  ? 459 HIS A CD2 1 
ATOM   3628  C  CE1 . HIS A 1 459 ? 107.130 139.291 77.624  1.00 58.37  ? 459 HIS A CE1 1 
ATOM   3629  N  NE2 . HIS A 1 459 ? 106.344 138.658 76.772  1.00 58.37  ? 459 HIS A NE2 1 
ATOM   3630  N  N   . GLY A 1 460 ? 101.434 141.096 78.093  1.00 58.97  ? 460 GLY A N   1 
ATOM   3631  C  CA  . GLY A 1 460 ? 100.634 141.323 76.903  1.00 58.97  ? 460 GLY A CA  1 
ATOM   3632  C  C   . GLY A 1 460 ? 100.443 142.791 76.586  1.00 58.97  ? 460 GLY A C   1 
ATOM   3633  O  O   . GLY A 1 460 ? 100.476 143.193 75.420  1.00 58.97  ? 460 GLY A O   1 
ATOM   3634  N  N   . VAL A 1 461 ? 100.244 143.607 77.621  1.00 65.15  ? 461 VAL A N   1 
ATOM   3635  C  CA  . VAL A 1 461 ? 100.135 145.057 77.461  1.00 65.15  ? 461 VAL A CA  1 
ATOM   3636  C  C   . VAL A 1 461 ? 101.433 145.661 76.930  1.00 65.15  ? 461 VAL A C   1 
ATOM   3637  O  O   . VAL A 1 461 ? 101.410 146.533 76.052  1.00 65.15  ? 461 VAL A O   1 
ATOM   3638  C  CB  . VAL A 1 461 ? 99.696  145.692 78.794  1.00 65.15  ? 461 VAL A CB  1 
ATOM   3639  C  CG1 . VAL A 1 461 ? 100.017 147.170 78.861  1.00 65.15  ? 461 VAL A CG1 1 
ATOM   3640  C  CG2 . VAL A 1 461 ? 98.208  145.484 78.990  1.00 65.15  ? 461 VAL A CG2 1 
ATOM   3641  N  N   . ARG A 1 462 ? 102.582 145.171 77.407  1.00 68.21  ? 462 ARG A N   1 
ATOM   3642  C  CA  . ARG A 1 462 ? 103.858 145.684 76.913  1.00 68.21  ? 462 ARG A CA  1 
ATOM   3643  C  C   . ARG A 1 462 ? 104.096 145.367 75.444  1.00 68.21  ? 462 ARG A C   1 
ATOM   3644  O  O   . ARG A 1 462 ? 104.632 146.204 74.711  1.00 68.21  ? 462 ARG A O   1 
ATOM   3645  C  CB  . ARG A 1 462 ? 105.004 145.094 77.726  1.00 68.21  ? 462 ARG A CB  1 
ATOM   3646  C  CG  . ARG A 1 462 ? 106.306 145.820 77.526  1.00 68.21  ? 462 ARG A CG  1 
ATOM   3647  C  CD  . ARG A 1 462 ? 107.261 145.613 78.676  1.00 68.21  ? 462 ARG A CD  1 
ATOM   3648  N  NE  . ARG A 1 462 ? 107.306 144.221 79.096  1.00 68.21  ? 462 ARG A NE  1 
ATOM   3649  C  CZ  . ARG A 1 462 ? 108.227 143.731 79.914  1.00 68.21  ? 462 ARG A CZ  1 
ATOM   3650  N  NH1 . ARG A 1 462 ? 109.173 144.523 80.390  1.00 68.21  ? 462 ARG A NH1 1 
ATOM   3651  N  NH2 . ARG A 1 462 ? 108.207 142.452 80.253  1.00 68.21  ? 462 ARG A NH2 1 
ATOM   3652  N  N   . VAL A 1 463 ? 103.736 144.167 74.997  1.00 71.79  ? 463 VAL A N   1 
ATOM   3653  C  CA  . VAL A 1 463 ? 103.937 143.825 73.593  1.00 71.79  ? 463 VAL A CA  1 
ATOM   3654  C  C   . VAL A 1 463 ? 102.960 144.586 72.702  1.00 71.79  ? 463 VAL A C   1 
ATOM   3655  O  O   . VAL A 1 463 ? 103.341 145.106 71.644  1.00 71.79  ? 463 VAL A O   1 
ATOM   3656  C  CB  . VAL A 1 463 ? 103.860 142.300 73.398  1.00 71.79  ? 463 VAL A CB  1 
ATOM   3657  C  CG1 . VAL A 1 463 ? 103.568 141.924 71.953  1.00 71.79  ? 463 VAL A CG1 1 
ATOM   3658  C  CG2 . VAL A 1 463 ? 105.172 141.678 73.815  1.00 71.79  ? 463 VAL A CG2 1 
ATOM   3659  N  N   . LYS A 1 464 ? 101.707 144.727 73.151  1.00 73.72  ? 464 LYS A N   1 
ATOM   3660  C  CA  . LYS A 1 464 ? 100.709 145.498 72.416  1.00 73.72  ? 464 LYS A CA  1 
ATOM   3661  C  C   . LYS A 1 464 ? 101.069 146.971 72.300  1.00 73.72  ? 464 LYS A C   1 
ATOM   3662  O  O   . LYS A 1 464 ? 100.904 147.559 71.226  1.00 73.72  ? 464 LYS A O   1 
ATOM   3663  C  CB  . LYS A 1 464 ? 99.351  145.345 73.092  1.00 73.72  ? 464 LYS A CB  1 
ATOM   3664  C  CG  . LYS A 1 464 ? 98.220  145.026 72.146  1.00 73.72  ? 464 LYS A CG  1 
ATOM   3665  C  CD  . LYS A 1 464 ? 96.980  144.619 72.919  1.00 73.72  ? 464 LYS A CD  1 
ATOM   3666  C  CE  . LYS A 1 464 ? 95.791  144.398 72.004  1.00 73.72  ? 464 LYS A CE  1 
ATOM   3667  N  NZ  . LYS A 1 464 ? 94.592  143.935 72.746  1.00 73.72  ? 464 LYS A NZ  1 
ATOM   3668  N  N   . ARG A 1 465 ? 101.567 147.577 73.374  1.00 81.02  ? 465 ARG A N   1 
ATOM   3669  C  CA  . ARG A 1 465 ? 101.973 148.974 73.315  1.00 81.02  ? 465 ARG A CA  1 
ATOM   3670  C  C   . ARG A 1 465 ? 103.233 149.148 72.479  1.00 81.02  ? 465 ARG A C   1 
ATOM   3671  O  O   . ARG A 1 465 ? 103.450 150.219 71.904  1.00 81.02  ? 465 ARG A O   1 
ATOM   3672  C  CB  . ARG A 1 465 ? 102.160 149.516 74.734  1.00 81.02  ? 465 ARG A CB  1 
ATOM   3673  C  CG  . ARG A 1 465 ? 102.050 151.023 74.867  1.00 81.02  ? 465 ARG A CG  1 
ATOM   3674  C  CD  . ARG A 1 465 ? 102.439 151.490 76.267  1.00 81.02  ? 465 ARG A CD  1 
ATOM   3675  N  NE  . ARG A 1 465 ? 103.585 150.790 76.846  1.00 81.02  ? 465 ARG A NE  1 
ATOM   3676  C  CZ  . ARG A 1 465 ? 104.853 151.130 76.651  1.00 81.02  ? 465 ARG A CZ  1 
ATOM   3677  N  NH1 . ARG A 1 465 ? 105.150 152.171 75.889  1.00 81.02  ? 465 ARG A NH1 1 
ATOM   3678  N  NH2 . ARG A 1 465 ? 105.825 150.436 77.229  1.00 81.02  ? 465 ARG A NH2 1 
ATOM   3679  N  N   . LYS A 1 466 ? 104.058 148.105 72.391  1.00 79.76  ? 466 LYS A N   1 
ATOM   3680  C  CA  . LYS A 1 466 ? 105.198 148.132 71.486  1.00 79.76  ? 466 LYS A CA  1 
ATOM   3681  C  C   . LYS A 1 466 ? 104.754 147.995 70.039  1.00 79.76  ? 466 LYS A C   1 
ATOM   3682  O  O   . LYS A 1 466 ? 105.299 148.657 69.150  1.00 79.76  ? 466 LYS A O   1 
ATOM   3683  C  CB  . LYS A 1 466 ? 106.176 147.017 71.851  1.00 79.76  ? 466 LYS A CB  1 
ATOM   3684  C  CG  . LYS A 1 466 ? 107.430 146.968 71.004  1.00 79.76  ? 466 LYS A CG  1 
ATOM   3685  C  CD  . LYS A 1 466 ? 108.308 145.792 71.394  1.00 79.76  ? 466 LYS A CD  1 
ATOM   3686  N  N   . VAL A 1 467 ? 103.776 147.128 69.778  1.00 84.98  ? 467 VAL A N   1 
ATOM   3687  C  CA  . VAL A 1 467 ? 103.391 146.886 68.396  1.00 84.98  ? 467 VAL A CA  1 
ATOM   3688  C  C   . VAL A 1 467 ? 102.608 148.047 67.793  1.00 84.98  ? 467 VAL A C   1 
ATOM   3689  O  O   . VAL A 1 467 ? 102.826 148.370 66.617  1.00 84.98  ? 467 VAL A O   1 
ATOM   3690  C  CB  . VAL A 1 467 ? 102.632 145.548 68.328  1.00 84.98  ? 467 VAL A CB  1 
ATOM   3691  C  CG1 . VAL A 1 467 ? 101.808 145.396 67.055  1.00 84.98  ? 467 VAL A CG1 1 
ATOM   3692  C  CG2 . VAL A 1 467 ? 103.623 144.412 68.413  1.00 84.98  ? 467 VAL A CG2 1 
ATOM   3693  N  N   . GLN A 1 468 ? 101.756 148.740 68.563  1.00 91.47  ? 468 GLN A N   1 
ATOM   3694  C  CA  . GLN A 1 468 ? 101.006 149.840 67.958  1.00 91.47  ? 468 GLN A CA  1 
ATOM   3695  C  C   . GLN A 1 468 ? 101.887 151.041 67.632  1.00 91.47  ? 468 GLN A C   1 
ATOM   3696  O  O   . GLN A 1 468 ? 101.542 151.841 66.755  1.00 91.47  ? 468 GLN A O   1 
ATOM   3697  C  CB  . GLN A 1 468 ? 99.858  150.268 68.877  1.00 91.47  ? 468 GLN A CB  1 
ATOM   3698  C  CG  . GLN A 1 468 ? 98.741  151.019 68.168  1.00 91.47  ? 468 GLN A CG  1 
ATOM   3699  C  CD  . GLN A 1 468 ? 97.685  151.533 69.116  1.00 91.47  ? 468 GLN A CD  1 
ATOM   3700  O  OE1 . GLN A 1 468 ? 97.653  151.160 70.285  1.00 91.47  ? 468 GLN A OE1 1 
ATOM   3701  N  NE2 . GLN A 1 468 ? 96.813  152.400 68.617  1.00 91.47  ? 468 GLN A NE2 1 
ATOM   3702  N  N   . ALA A 1 469 ? 103.043 151.155 68.285  1.00 93.34  ? 469 ALA A N   1 
ATOM   3703  C  CA  . ALA A 1 469 ? 104.044 152.157 67.954  1.00 93.34  ? 469 ALA A CA  1 
ATOM   3704  C  C   . ALA A 1 469 ? 105.145 151.561 67.088  1.00 93.34  ? 469 ALA A C   1 
ATOM   3705  O  O   . ALA A 1 469 ? 106.258 151.337 67.575  1.00 93.34  ? 469 ALA A O   1 
ATOM   3706  C  CB  . ALA A 1 469 ? 104.627 152.769 69.226  1.00 93.34  ? 469 ALA A CB  1 
ATOM   3707  N  N   . LEU A 1 470 ? 104.866 151.285 65.817  1.00 99.07  ? 470 LEU A N   1 
ATOM   3708  C  CA  . LEU A 1 470 ? 105.852 150.586 65.004  1.00 99.07  ? 470 LEU A CA  1 
ATOM   3709  C  C   . LEU A 1 470 ? 106.265 151.344 63.747  1.00 99.07  ? 470 LEU A C   1 
ATOM   3710  O  O   . LEU A 1 470 ? 107.382 151.136 63.256  1.00 99.07  ? 470 LEU A O   1 
ATOM   3711  C  CB  . LEU A 1 470 ? 105.316 149.197 64.656  1.00 99.07  ? 470 LEU A CB  1 
ATOM   3712  C  CG  . LEU A 1 470 ? 106.254 148.156 64.072  1.00 99.07  ? 470 LEU A CG  1 
ATOM   3713  C  CD1 . LEU A 1 470 ? 107.331 147.827 65.089  1.00 99.07  ? 470 LEU A CD1 1 
ATOM   3714  C  CD2 . LEU A 1 470 ? 105.425 146.942 63.795  1.00 99.07  ? 470 LEU A CD2 1 
ATOM   3715  N  N   . LYS A 1 471 ? 105.380 152.197 63.212  1.00 98.42  ? 471 LYS A N   1 
ATOM   3716  C  CA  . LYS A 1 471 ? 105.605 152.996 62.005  1.00 98.42  ? 471 LYS A CA  1 
ATOM   3717  C  C   . LYS A 1 471 ? 105.909 152.170 60.755  1.00 98.42  ? 471 LYS A C   1 
ATOM   3718  O  O   . LYS A 1 471 ? 106.710 152.588 59.914  1.00 98.42  ? 471 LYS A O   1 
ATOM   3719  C  CB  . LYS A 1 471 ? 106.705 154.044 62.235  1.00 98.42  ? 471 LYS A CB  1 
ATOM   3720  N  N   . ALA A 1 472 ? 105.297 150.999 60.621  1.00 107.21 ? 472 ALA A N   1 
ATOM   3721  C  CA  . ALA A 1 472 ? 105.553 150.149 59.470  1.00 107.21 ? 472 ALA A CA  1 
ATOM   3722  C  C   . ALA A 1 472 ? 104.231 149.647 58.898  1.00 107.21 ? 472 ALA A C   1 
ATOM   3723  O  O   . ALA A 1 472 ? 103.174 149.760 59.525  1.00 107.21 ? 472 ALA A O   1 
ATOM   3724  C  CB  . ALA A 1 472 ? 106.458 148.985 59.854  1.00 107.21 ? 472 ALA A CB  1 
ATOM   3725  N  N   . ASP A 1 473 ? 104.272 149.098 57.680  1.00 109.68 ? 473 ASP A N   1 
ATOM   3726  C  CA  . ASP A 1 473 ? 103.046 148.529 57.133  1.00 109.68 ? 473 ASP A CA  1 
ATOM   3727  C  C   . ASP A 1 473 ? 102.867 147.046 57.431  1.00 109.68 ? 473 ASP A C   1 
ATOM   3728  O  O   . ASP A 1 473 ? 102.646 146.244 56.518  1.00 109.68 ? 473 ASP A O   1 
ATOM   3729  C  CB  . ASP A 1 473 ? 103.005 148.750 55.618  1.00 109.68 ? 473 ASP A CB  1 
ATOM   3730  N  N   . ILE A 1 474 ? 102.980 146.671 58.692  1.00 109.21 ? 474 ILE A N   1 
ATOM   3731  C  CA  . ILE A 1 474 ? 102.910 145.270 59.087  1.00 109.21 ? 474 ILE A CA  1 
ATOM   3732  C  C   . ILE A 1 474 ? 101.445 144.897 59.271  1.00 109.21 ? 474 ILE A C   1 
ATOM   3733  O  O   . ILE A 1 474 ? 100.685 145.626 59.918  1.00 109.21 ? 474 ILE A O   1 
ATOM   3734  C  CB  . ILE A 1 474 ? 103.777 144.993 60.329  1.00 109.21 ? 474 ILE A CB  1 
ATOM   3735  C  CG1 . ILE A 1 474 ? 105.235 144.880 59.868  1.00 109.21 ? 474 ILE A CG1 1 
ATOM   3736  C  CG2 . ILE A 1 474 ? 103.309 143.750 61.081  1.00 109.21 ? 474 ILE A CG2 1 
ATOM   3737  C  CD1 . ILE A 1 474 ? 106.262 144.797 60.959  1.00 109.21 ? 474 ILE A CD1 1 
ATOM   3738  N  N   . ASP A 1 475 ? 101.026 143.767 58.695  1.00 94.75  ? 475 ASP A N   1 
ATOM   3739  C  CA  . ASP A 1 475 ? 99.733  143.226 59.090  1.00 94.75  ? 475 ASP A CA  1 
ATOM   3740  C  C   . ASP A 1 475 ? 99.750  142.760 60.537  1.00 94.75  ? 475 ASP A C   1 
ATOM   3741  O  O   . ASP A 1 475 ? 100.286 141.698 60.868  1.00 94.75  ? 475 ASP A O   1 
ATOM   3742  C  CB  . ASP A 1 475 ? 99.333  142.073 58.169  1.00 94.75  ? 475 ASP A CB  1 
ATOM   3743  N  N   . ALA A 1 476 ? 99.186  143.595 61.405  1.00 88.40  ? 476 ALA A N   1 
ATOM   3744  C  CA  . ALA A 1 476 ? 99.374  143.451 62.837  1.00 88.40  ? 476 ALA A CA  1 
ATOM   3745  C  C   . ALA A 1 476 ? 98.538  142.329 63.435  1.00 88.40  ? 476 ALA A C   1 
ATOM   3746  O  O   . ALA A 1 476 ? 98.880  141.829 64.506  1.00 88.40  ? 476 ALA A O   1 
ATOM   3747  C  CB  . ALA A 1 476 ? 99.052  144.769 63.541  1.00 88.40  ? 476 ALA A CB  1 
ATOM   3748  N  N   . THR A 1 477 ? 97.460  141.918 62.773  1.00 82.56  ? 477 THR A N   1 
ATOM   3749  C  CA  . THR A 1 477 ? 96.552  140.932 63.346  1.00 82.56  ? 477 THR A CA  1 
ATOM   3750  C  C   . THR A 1 477 ? 97.149  139.540 63.477  1.00 82.56  ? 477 THR A C   1 
ATOM   3751  O  O   . THR A 1 477 ? 96.664  138.754 64.293  1.00 82.56  ? 477 THR A O   1 
ATOM   3752  C  CB  . THR A 1 477 ? 95.288  140.835 62.494  1.00 82.56  ? 477 THR A CB  1 
ATOM   3753  O  OG1 . THR A 1 477 ? 94.677  139.556 62.701  1.00 82.56  ? 477 THR A OG1 1 
ATOM   3754  C  CG2 . THR A 1 477 ? 95.631  140.985 61.021  1.00 82.56  ? 477 THR A CG2 1 
ATOM   3755  N  N   . LEU A 1 478 ? 98.173  139.215 62.703  1.00 67.85  ? 478 LEU A N   1 
ATOM   3756  C  CA  . LEU A 1 478 ? 98.862  137.940 62.795  1.00 67.85  ? 478 LEU A CA  1 
ATOM   3757  C  C   . LEU A 1 478 ? 100.168 138.006 63.566  1.00 67.85  ? 478 LEU A C   1 
ATOM   3758  O  O   . LEU A 1 478 ? 100.420 137.167 64.433  1.00 67.85  ? 478 LEU A O   1 
ATOM   3759  C  CB  . LEU A 1 478 ? 99.119  137.384 61.396  1.00 67.85  ? 478 LEU A CB  1 
ATOM   3760  C  CG  . LEU A 1 478 ? 99.795  136.022 61.417  1.00 67.85  ? 478 LEU A CG  1 
ATOM   3761  C  CD1 . LEU A 1 478 ? 98.904  135.021 62.124  1.00 67.85  ? 478 LEU A CD1 1 
ATOM   3762  C  CD2 . LEU A 1 478 ? 100.085 135.576 60.012  1.00 67.85  ? 478 LEU A CD2 1 
ATOM   3763  N  N   . TYR A 1 479 ? 100.988 139.017 63.279  1.00 73.24  ? 479 TYR A N   1 
ATOM   3764  C  CA  . TYR A 1 479 ? 102.292 139.167 63.917  1.00 73.24  ? 479 TYR A CA  1 
ATOM   3765  C  C   . TYR A 1 479 ? 102.194 139.425 65.412  1.00 73.24  ? 479 TYR A C   1 
ATOM   3766  O  O   . TYR A 1 479 ? 103.023 138.921 66.175  1.00 73.24  ? 479 TYR A O   1 
ATOM   3767  C  CB  . TYR A 1 479 ? 103.043 140.298 63.228  1.00 73.24  ? 479 TYR A CB  1 
ATOM   3768  C  CG  . TYR A 1 479 ? 104.327 140.699 63.880  1.00 73.24  ? 479 TYR A CG  1 
ATOM   3769  C  CD1 . TYR A 1 479 ? 105.460 139.927 63.733  1.00 73.24  ? 479 TYR A CD1 1 
ATOM   3770  C  CD2 . TYR A 1 479 ? 104.417 141.874 64.605  1.00 73.24  ? 479 TYR A CD2 1 
ATOM   3771  C  CE1 . TYR A 1 479 ? 106.645 140.298 64.309  1.00 73.24  ? 479 TYR A CE1 1 
ATOM   3772  C  CE2 . TYR A 1 479 ? 105.595 142.255 65.187  1.00 73.24  ? 479 TYR A CE2 1 
ATOM   3773  C  CZ  . TYR A 1 479 ? 106.709 141.463 65.038  1.00 73.24  ? 479 TYR A CZ  1 
ATOM   3774  O  OH  . TYR A 1 479 ? 107.895 141.842 65.623  1.00 73.24  ? 479 TYR A OH  1 
ATOM   3775  N  N   . GLU A 1 480 ? 101.248 140.258 65.841  1.00 73.54  ? 480 GLU A N   1 
ATOM   3776  C  CA  . GLU A 1 480 ? 101.039 140.469 67.272  1.00 73.54  ? 480 GLU A CA  1 
ATOM   3777  C  C   . GLU A 1 480 ? 100.659 139.172 67.976  1.00 73.54  ? 480 GLU A C   1 
ATOM   3778  O  O   . GLU A 1 480 ? 101.162 138.878 69.067  1.00 73.54  ? 480 GLU A O   1 
ATOM   3779  C  CB  . GLU A 1 480 ? 99.968  141.525 67.496  1.00 73.54  ? 480 GLU A CB  1 
ATOM   3780  C  CG  . GLU A 1 480 ? 99.466  141.625 68.906  1.00 73.54  ? 480 GLU A CG  1 
ATOM   3781  C  CD  . GLU A 1 480 ? 98.430  142.709 69.061  1.00 73.54  ? 480 GLU A CD  1 
ATOM   3782  O  OE1 . GLU A 1 480 ? 98.434  143.664 68.254  1.00 73.54  ? 480 GLU A OE1 1 
ATOM   3783  O  OE2 . GLU A 1 480 ? 97.600  142.597 69.984  1.00 73.54  ? 480 GLU A OE2 1 
ATOM   3784  N  N   . GLN A 1 481 ? 99.809  138.370 67.337  1.00 58.23  ? 481 GLN A N   1 
ATOM   3785  C  CA  . GLN A 1 481 ? 99.353  137.113 67.920  1.00 58.23  ? 481 GLN A CA  1 
ATOM   3786  C  C   . GLN A 1 481 ? 100.485 136.098 68.025  1.00 58.23  ? 481 GLN A C   1 
ATOM   3787  O  O   . GLN A 1 481 ? 100.621 135.413 69.042  1.00 58.23  ? 481 GLN A O   1 
ATOM   3788  C  CB  . GLN A 1 481 ? 98.198  136.577 67.080  1.00 58.23  ? 481 GLN A CB  1 
ATOM   3789  C  CG  . GLN A 1 481 ? 97.756  135.178 67.363  1.00 58.23  ? 481 GLN A CG  1 
ATOM   3790  C  CD  . GLN A 1 481 ? 96.587  134.792 66.484  1.00 58.23  ? 481 GLN A CD  1 
ATOM   3791  O  OE1 . GLN A 1 481 ? 96.130  135.583 65.667  1.00 58.23  ? 481 GLN A OE1 1 
ATOM   3792  N  NE2 . GLN A 1 481 ? 96.113  133.569 66.629  1.00 58.23  ? 481 GLN A NE2 1 
ATOM   3793  N  N   . VAL A 1 482 ? 101.312 135.993 66.986  1.00 55.20  ? 482 VAL A N   1 
ATOM   3794  C  CA  . VAL A 1 482 ? 102.407 135.028 66.997  1.00 55.20  ? 482 VAL A CA  1 
ATOM   3795  C  C   . VAL A 1 482 ? 103.499 135.427 67.983  1.00 55.20  ? 482 VAL A C   1 
ATOM   3796  O  O   . VAL A 1 482 ? 104.052 134.568 68.678  1.00 55.20  ? 482 VAL A O   1 
ATOM   3797  C  CB  . VAL A 1 482 ? 102.947 134.851 65.567  1.00 55.20  ? 482 VAL A CB  1 
ATOM   3798  C  CG1 . VAL A 1 482 ? 104.223 134.039 65.538  1.00 55.20  ? 482 VAL A CG1 1 
ATOM   3799  C  CG2 . VAL A 1 482 ? 101.913 134.160 64.727  1.00 55.20  ? 482 VAL A CG2 1 
ATOM   3800  N  N   . ILE A 1 483 ? 103.778 136.720 68.119  1.00 56.94  ? 483 ILE A N   1 
ATOM   3801  C  CA  . ILE A 1 483 ? 104.775 137.165 69.087  1.00 56.94  ? 483 ILE A CA  1 
ATOM   3802  C  C   . ILE A 1 483 ? 104.303 136.923 70.510  1.00 56.94  ? 483 ILE A C   1 
ATOM   3803  O  O   . ILE A 1 483 ? 105.090 136.512 71.371  1.00 56.94  ? 483 ILE A O   1 
ATOM   3804  C  CB  . ILE A 1 483 ? 105.145 138.635 68.829  1.00 56.94  ? 483 ILE A CB  1 
ATOM   3805  C  CG1 . ILE A 1 483 ? 105.971 138.709 67.563  1.00 56.94  ? 483 ILE A CG1 1 
ATOM   3806  C  CG2 . ILE A 1 483 ? 105.955 139.239 69.953  1.00 56.94  ? 483 ILE A CG2 1 
ATOM   3807  C  CD1 . ILE A 1 483 ? 107.226 137.896 67.667  1.00 56.94  ? 483 ILE A CD1 1 
ATOM   3808  N  N   . LEU A 1 484 ? 103.008 137.086 70.764  1.00 55.99  ? 484 LEU A N   1 
ATOM   3809  C  CA  . LEU A 1 484 ? 102.492 136.819 72.100  1.00 55.99  ? 484 LEU A CA  1 
ATOM   3810  C  C   . LEU A 1 484 ? 102.555 135.338 72.442  1.00 55.99  ? 484 LEU A C   1 
ATOM   3811  O  O   . LEU A 1 484 ? 102.957 134.971 73.551  1.00 55.99  ? 484 LEU A O   1 
ATOM   3812  C  CB  . LEU A 1 484 ? 101.066 137.337 72.228  1.00 55.99  ? 484 LEU A CB  1 
ATOM   3813  C  CG  . LEU A 1 484 ? 100.975 138.815 72.587  1.00 55.99  ? 484 LEU A CG  1 
ATOM   3814  C  CD1 . LEU A 1 484 ? 99.535  139.202 72.825  1.00 55.99  ? 484 LEU A CD1 1 
ATOM   3815  C  CD2 . LEU A 1 484 ? 101.815 139.113 73.810  1.00 55.99  ? 484 LEU A CD2 1 
ATOM   3816  N  N   . GLU A 1 485 ? 102.209 134.472 71.508  1.00 52.17  ? 485 GLU A N   1 
ATOM   3817  C  CA  . GLU A 1 485 ? 102.226 133.063 71.847  1.00 52.17  ? 485 GLU A CA  1 
ATOM   3818  C  C   . GLU A 1 485 ? 103.618 132.460 71.778  1.00 52.17  ? 485 GLU A C   1 
ATOM   3819  O  O   . GLU A 1 485 ? 103.786 131.301 72.159  1.00 52.17  ? 485 GLU A O   1 
ATOM   3820  C  CB  . GLU A 1 485 ? 101.331 132.298 70.872  1.00 52.17  ? 485 GLU A CB  1 
ATOM   3821  C  CG  . GLU A 1 485 ? 99.859  132.642 70.949  1.00 52.17  ? 485 GLU A CG  1 
ATOM   3822  C  CD  . GLU A 1 485 ? 98.993  131.704 70.129  1.00 52.17  ? 485 GLU A CD  1 
ATOM   3823  O  OE1 . GLU A 1 485 ? 99.183  130.478 70.205  1.00 52.17  ? 485 GLU A OE1 1 
ATOM   3824  O  OE2 . GLU A 1 485 ? 98.149  132.204 69.363  1.00 52.17  ? 485 GLU A OE2 1 
ATOM   3825  N  N   . LYS A 1 486 ? 104.613 133.193 71.281  1.00 54.81  ? 486 LYS A N   1 
ATOM   3826  C  CA  . LYS A 1 486 ? 105.982 132.692 71.325  1.00 54.81  ? 486 LYS A CA  1 
ATOM   3827  C  C   . LYS A 1 486 ? 106.527 132.687 72.742  1.00 54.81  ? 486 LYS A C   1 
ATOM   3828  O  O   . LYS A 1 486 ? 107.216 131.749 73.156  1.00 54.81  ? 486 LYS A O   1 
ATOM   3829  C  CB  . LYS A 1 486 ? 106.874 133.527 70.411  1.00 54.81  ? 486 LYS A CB  1 
ATOM   3830  C  CG  . LYS A 1 486 ? 108.346 133.192 70.492  1.00 54.81  ? 486 LYS A CG  1 
ATOM   3831  C  CD  . LYS A 1 486 ? 109.141 134.015 69.508  1.00 54.81  ? 486 LYS A CD  1 
ATOM   3832  C  CE  . LYS A 1 486 ? 109.060 135.487 69.840  1.00 54.81  ? 486 LYS A CE  1 
ATOM   3833  N  NZ  . LYS A 1 486 ? 109.775 135.815 71.098  1.00 54.81  ? 486 LYS A NZ  1 
ATOM   3834  N  N   . GLU A 1 487 ? 106.196 133.714 73.516  1.00 58.15  ? 487 GLU A N   1 
ATOM   3835  C  CA  . GLU A 1 487 ? 106.773 133.896 74.837  1.00 58.15  ? 487 GLU A CA  1 
ATOM   3836  C  C   . GLU A 1 487 ? 105.852 133.457 75.960  1.00 58.15  ? 487 GLU A C   1 
ATOM   3837  O  O   . GLU A 1 487 ? 106.128 133.745 77.126  1.00 58.15  ? 487 GLU A O   1 
ATOM   3838  C  CB  . GLU A 1 487 ? 107.187 135.350 75.023  1.00 58.15  ? 487 GLU A CB  1 
ATOM   3839  C  CG  . GLU A 1 487 ? 108.332 135.737 74.128  1.00 58.15  ? 487 GLU A CG  1 
ATOM   3840  C  CD  . GLU A 1 487 ? 108.209 137.149 73.615  1.00 58.15  ? 487 GLU A CD  1 
ATOM   3841  O  OE1 . GLU A 1 487 ? 107.441 137.930 74.215  1.00 58.15  ? 487 GLU A OE1 1 
ATOM   3842  O  OE2 . GLU A 1 487 ? 108.875 137.474 72.609  1.00 58.15  ? 487 GLU A OE2 1 
ATOM   3843  N  N   . MET A 1 488 ? 104.783 132.749 75.644  1.00 52.99  ? 488 MET A N   1 
ATOM   3844  C  CA  . MET A 1 488 ? 103.972 132.179 76.698  1.00 52.99  ? 488 MET A CA  1 
ATOM   3845  C  C   . MET A 1 488 ? 104.677 130.959 77.273  1.00 52.99  ? 488 MET A C   1 
ATOM   3846  O  O   . MET A 1 488 ? 105.691 130.494 76.753  1.00 52.99  ? 488 MET A O   1 
ATOM   3847  C  CB  . MET A 1 488 ? 102.595 131.810 76.165  1.00 52.99  ? 488 MET A CB  1 
ATOM   3848  C  CG  . MET A 1 488 ? 101.643 132.990 76.114  1.00 52.99  ? 488 MET A CG  1 
ATOM   3849  S  SD  . MET A 1 488 ? 100.001 132.539 75.530  1.00 52.99  ? 488 MET A SD  1 
ATOM   3850  C  CE  . MET A 1 488 ? 99.103  134.072 75.748  1.00 52.99  ? 488 MET A CE  1 
ATOM   3851  N  N   . GLY A 1 489 ? 104.126 130.432 78.357  1.00 46.90  ? 489 GLY A N   1 
ATOM   3852  C  CA  . GLY A 1 489 ? 104.691 129.238 78.945  1.00 46.90  ? 489 GLY A CA  1 
ATOM   3853  C  C   . GLY A 1 489 ? 104.062 128.015 78.309  1.00 46.90  ? 489 GLY A C   1 
ATOM   3854  O  O   . GLY A 1 489 ? 102.917 128.038 77.865  1.00 46.90  ? 489 GLY A O   1 
ATOM   3855  N  N   . THR A 1 490 ? 104.834 126.944 78.248  1.00 36.21  ? 490 THR A N   1 
ATOM   3856  C  CA  . THR A 1 490 ? 104.342 125.727 77.631  1.00 36.21  ? 490 THR A CA  1 
ATOM   3857  C  C   . THR A 1 490 ? 103.680 124.836 78.661  1.00 36.21  ? 490 THR A C   1 
ATOM   3858  O  O   . THR A 1 490 ? 103.936 124.946 79.860  1.00 36.21  ? 490 THR A O   1 
ATOM   3859  C  CB  . THR A 1 490 ? 105.469 124.992 76.912  1.00 36.21  ? 490 THR A CB  1 
ATOM   3860  O  OG1 . THR A 1 490 ? 104.910 123.979 76.070  1.00 36.21  ? 490 THR A OG1 1 
ATOM   3861  C  CG2 . THR A 1 490 ? 106.447 124.382 77.885  1.00 36.21  ? 490 THR A CG2 1 
ATOM   3862  N  N   . TYR A 1 491 ? 102.766 124.005 78.195  1.00 25.29  ? 491 TYR A N   1 
ATOM   3863  C  CA  . TYR A 1 491 ? 102.047 123.112 79.083  1.00 25.29  ? 491 TYR A CA  1 
ATOM   3864  C  C   . TYR A 1 491 ? 102.847 121.834 79.266  1.00 25.29  ? 491 TYR A C   1 
ATOM   3865  O  O   . TYR A 1 491 ? 103.116 121.116 78.300  1.00 25.29  ? 491 TYR A O   1 
ATOM   3866  C  CB  . TYR A 1 491 ? 100.672 122.813 78.522  1.00 25.29  ? 491 TYR A CB  1 
ATOM   3867  C  CG  . TYR A 1 491 ? 99.774  122.196 79.526  1.00 25.29  ? 491 TYR A CG  1 
ATOM   3868  C  CD1 . TYR A 1 491 ? 99.334  122.918 80.609  1.00 25.29  ? 491 TYR A CD1 1 
ATOM   3869  C  CD2 . TYR A 1 491 ? 99.370  120.892 79.398  1.00 25.29  ? 491 TYR A CD2 1 
ATOM   3870  C  CE1 . TYR A 1 491 ? 98.506  122.355 81.540  1.00 25.29  ? 491 TYR A CE1 1 
ATOM   3871  C  CE2 . TYR A 1 491 ? 98.540  120.325 80.313  1.00 25.29  ? 491 TYR A CE2 1 
ATOM   3872  C  CZ  . TYR A 1 491 ? 98.115  121.054 81.390  1.00 25.29  ? 491 TYR A CZ  1 
ATOM   3873  O  OH  . TYR A 1 491 ? 97.282  120.486 82.321  1.00 25.29  ? 491 TYR A OH  1 
ATOM   3874  N  N   . LEU A 1 492 ? 103.225 121.555 80.503  1.00 29.74  ? 492 LEU A N   1 
ATOM   3875  C  CA  . LEU A 1 492 ? 104.063 120.412 80.862  1.00 29.74  ? 492 LEU A CA  1 
ATOM   3876  C  C   . LEU A 1 492 ? 103.222 119.199 81.233  1.00 29.74  ? 492 LEU A C   1 
ATOM   3877  O  O   . LEU A 1 492 ? 103.383 118.598 82.290  1.00 29.74  ? 492 LEU A O   1 
ATOM   3878  C  CB  . LEU A 1 492 ? 104.981 120.816 82.005  1.00 29.74  ? 492 LEU A CB  1 
ATOM   3879  C  CG  . LEU A 1 492 ? 106.204 121.635 81.588  1.00 29.74  ? 492 LEU A CG  1 
ATOM   3880  C  CD1 . LEU A 1 492 ? 106.654 122.561 82.710  1.00 29.74  ? 492 LEU A CD1 1 
ATOM   3881  C  CD2 . LEU A 1 492 ? 107.336 120.722 81.166  1.00 29.74  ? 492 LEU A CD2 1 
ATOM   3882  N  N   . GLY A 1 493 ? 102.294 118.838 80.354  1.00 27.55  ? 493 GLY A N   1 
ATOM   3883  C  CA  . GLY A 1 493 ? 101.447 117.668 80.509  1.00 27.55  ? 493 GLY A CA  1 
ATOM   3884  C  C   . GLY A 1 493 ? 100.374 117.822 81.567  1.00 27.55  ? 493 GLY A C   1 
ATOM   3885  O  O   . GLY A 1 493 ? 100.414 118.757 82.367  1.00 27.55  ? 493 GLY A O   1 
ATOM   3886  N  N   . THR A 1 494 ? 99.407  116.912 81.600  1.00 20.64  ? 494 THR A N   1 
ATOM   3887  C  CA  . THR A 1 494 ? 98.417  116.929 82.669  1.00 20.64  ? 494 THR A CA  1 
ATOM   3888  C  C   . THR A 1 494 ? 98.908  115.982 83.743  1.00 20.64  ? 494 THR A C   1 
ATOM   3889  O  O   . THR A 1 494 ? 98.415  114.873 83.921  1.00 20.64  ? 494 THR A O   1 
ATOM   3890  C  CB  . THR A 1 494 ? 97.055  116.496 82.178  1.00 20.64  ? 494 THR A CB  1 
ATOM   3891  O  OG1 . THR A 1 494 ? 97.175  115.215 81.562  1.00 20.64  ? 494 THR A OG1 1 
ATOM   3892  C  CG2 . THR A 1 494 ? 96.546  117.469 81.196  1.00 20.64  ? 494 THR A CG2 1 
ATOM   3893  N  N   . PHE A 1 495 ? 99.928  116.438 84.440  1.00 19.09  ? 495 PHE A N   1 
ATOM   3894  C  CA  . PHE A 1 495 ? 100.438 115.703 85.576  1.00 19.09  ? 495 PHE A CA  1 
ATOM   3895  C  C   . PHE A 1 495 ? 100.256 116.472 86.869  1.00 19.09  ? 495 PHE A C   1 
ATOM   3896  O  O   . PHE A 1 495 ? 99.835  115.886 87.866  1.00 19.09  ? 495 PHE A O   1 
ATOM   3897  C  CB  . PHE A 1 495 ? 101.898 115.342 85.355  1.00 19.09  ? 495 PHE A CB  1 
ATOM   3898  C  CG  . PHE A 1 495 ? 102.567 114.849 86.566  1.00 19.09  ? 495 PHE A CG  1 
ATOM   3899  C  CD1 . PHE A 1 495 ? 102.117 113.716 87.194  1.00 19.09  ? 495 PHE A CD1 1 
ATOM   3900  C  CD2 . PHE A 1 495 ? 103.658 115.501 87.070  1.00 19.09  ? 495 PHE A CD2 1 
ATOM   3901  C  CE1 . PHE A 1 495 ? 102.725 113.268 88.315  1.00 19.09  ? 495 PHE A CE1 1 
ATOM   3902  C  CE2 . PHE A 1 495 ? 104.281 115.038 88.185  1.00 19.09  ? 495 PHE A CE2 1 
ATOM   3903  C  CZ  . PHE A 1 495 ? 103.813 113.915 88.804  1.00 19.09  ? 495 PHE A CZ  1 
ATOM   3904  N  N   . ASP A 1 496 ? 100.563 117.767 86.890  1.00 23.64  ? 496 ASP A N   1 
ATOM   3905  C  CA  . ASP A 1 496 ? 100.299 118.544 88.094  1.00 23.64  ? 496 ASP A CA  1 
ATOM   3906  C  C   . ASP A 1 496 ? 98.815  118.702 88.340  1.00 23.64  ? 496 ASP A C   1 
ATOM   3907  O  O   . ASP A 1 496 ? 98.385  118.762 89.492  1.00 23.64  ? 496 ASP A O   1 
ATOM   3908  C  CB  . ASP A 1 496 ? 100.948 119.911 88.005  1.00 23.64  ? 496 ASP A CB  1 
ATOM   3909  C  CG  . ASP A 1 496 ? 102.382 119.833 87.604  1.00 23.64  ? 496 ASP A CG  1 
ATOM   3910  O  OD1 . ASP A 1 496 ? 103.230 119.627 88.497  1.00 23.64  ? 496 ASP A OD1 1 
ATOM   3911  O  OD2 . ASP A 1 496 ? 102.666 119.989 86.400  1.00 23.64  ? 496 ASP A OD2 1 
ATOM   3912  N  N   . ASP A 1 497 ? 98.022  118.756 87.289  1.00 23.45  ? 497 ASP A N   1 
ATOM   3913  C  CA  . ASP A 1 497 ? 96.604  118.960 87.480  1.00 23.45  ? 497 ASP A CA  1 
ATOM   3914  C  C   . ASP A 1 497 ? 95.914  117.719 88.001  1.00 23.45  ? 497 ASP A C   1 
ATOM   3915  O  O   . ASP A 1 497 ? 94.840  117.833 88.587  1.00 23.45  ? 497 ASP A O   1 
ATOM   3916  C  CB  . ASP A 1 497 ? 95.940  119.425 86.193  1.00 23.45  ? 497 ASP A CB  1 
ATOM   3917  C  CG  . ASP A 1 497 ? 96.428  120.775 85.742  1.00 23.45  ? 497 ASP A CG  1 
ATOM   3918  O  OD1 . ASP A 1 497 ? 96.459  121.687 86.595  1.00 23.45  ? 497 ASP A OD1 1 
ATOM   3919  O  OD2 . ASP A 1 497 ? 96.744  120.946 84.543  1.00 23.45  ? 497 ASP A OD2 1 
ATOM   3920  N  N   . TYR A 1 498 ? 96.500  116.548 87.828  1.00 17.95  ? 498 TYR A N   1 
ATOM   3921  C  CA  . TYR A 1 498 ? 95.959  115.391 88.514  1.00 17.95  ? 498 TYR A CA  1 
ATOM   3922  C  C   . TYR A 1 498 ? 96.519  115.237 89.906  1.00 17.95  ? 498 TYR A C   1 
ATOM   3923  O  O   . TYR A 1 498 ? 95.847  114.674 90.773  1.00 17.95  ? 498 TYR A O   1 
ATOM   3924  C  CB  . TYR A 1 498 ? 96.274  114.120 87.748  1.00 17.95  ? 498 TYR A CB  1 
ATOM   3925  C  CG  . TYR A 1 498 ? 95.350  113.890 86.616  1.00 17.95  ? 498 TYR A CG  1 
ATOM   3926  C  CD1 . TYR A 1 498 ? 93.993  114.009 86.775  1.00 17.95  ? 498 TYR A CD1 1 
ATOM   3927  C  CD2 . TYR A 1 498 ? 95.845  113.572 85.372  1.00 17.95  ? 498 TYR A CD2 1 
ATOM   3928  C  CE1 . TYR A 1 498 ? 93.157  113.806 85.724  1.00 17.95  ? 498 TYR A CE1 1 
ATOM   3929  C  CE2 . TYR A 1 498 ? 95.024  113.373 84.321  1.00 17.95  ? 498 TYR A CE2 1 
ATOM   3930  C  CZ  . TYR A 1 498 ? 93.685  113.489 84.500  1.00 17.95  ? 498 TYR A CZ  1 
ATOM   3931  O  OH  . TYR A 1 498 ? 92.869  113.284 83.430  1.00 17.95  ? 498 TYR A OH  1 
ATOM   3932  N  N   . LEU A 1 499 ? 97.721  115.745 90.144  1.00 17.93  ? 499 LEU A N   1 
ATOM   3933  C  CA  . LEU A 1 499 ? 98.324  115.626 91.460  1.00 17.93  ? 499 LEU A CA  1 
ATOM   3934  C  C   . LEU A 1 499 ? 97.588  116.467 92.490  1.00 17.93  ? 499 LEU A C   1 
ATOM   3935  O  O   . LEU A 1 499 ? 97.480  116.057 93.648  1.00 17.93  ? 499 LEU A O   1 
ATOM   3936  C  CB  . LEU A 1 499 ? 99.787  116.025 91.385  1.00 17.93  ? 499 LEU A CB  1 
ATOM   3937  C  CG  . LEU A 1 499 ? 100.584 115.930 92.660  1.00 17.93  ? 499 LEU A CG  1 
ATOM   3938  C  CD1 . LEU A 1 499 ? 100.490 114.524 93.099  1.00 17.93  ? 499 LEU A CD1 1 
ATOM   3939  C  CD2 . LEU A 1 499 ? 101.993 116.295 92.387  1.00 17.93  ? 499 LEU A CD2 1 
ATOM   3940  N  N   . GLU A 1 500 ? 97.063  117.624 92.086  1.00 27.79  ? 500 GLU A N   1 
ATOM   3941  C  CA  . GLU A 1 500 ? 96.254  118.429 92.993  1.00 27.79  ? 500 GLU A CA  1 
ATOM   3942  C  C   . GLU A 1 500 ? 94.992  117.698 93.415  1.00 27.79  ? 500 GLU A C   1 
ATOM   3943  O  O   . GLU A 1 500 ? 94.617  117.729 94.590  1.00 27.79  ? 500 GLU A O   1 
ATOM   3944  C  CB  . GLU A 1 500 ? 95.883  119.739 92.312  1.00 27.79  ? 500 GLU A CB  1 
ATOM   3945  C  CG  . GLU A 1 500 ? 94.847  120.578 93.032  1.00 27.79  ? 500 GLU A CG  1 
ATOM   3946  C  CD  . GLU A 1 500 ? 94.588  121.906 92.336  1.00 27.79  ? 500 GLU A CD  1 
ATOM   3947  O  OE1 . GLU A 1 500 ? 95.347  122.251 91.412  1.00 27.79  ? 500 GLU A OE1 1 
ATOM   3948  O  OE2 . GLU A 1 500 ? 93.591  122.575 92.672  1.00 27.79  ? 500 GLU A OE2 1 
ATOM   3949  N  N   . LEU A 1 501 ? 94.350  116.997 92.488  1.00 21.26  ? 501 LEU A N   1 
ATOM   3950  C  CA  . LEU A 1 501 ? 93.172  116.224 92.855  1.00 21.26  ? 501 LEU A CA  1 
ATOM   3951  C  C   . LEU A 1 501 ? 93.512  115.014 93.699  1.00 21.26  ? 501 LEU A C   1 
ATOM   3952  O  O   . LEU A 1 501 ? 92.699  114.608 94.533  1.00 21.26  ? 501 LEU A O   1 
ATOM   3953  C  CB  . LEU A 1 501 ? 92.391  115.815 91.621  1.00 21.26  ? 501 LEU A CB  1 
ATOM   3954  C  CG  . LEU A 1 501 ? 91.772  117.039 90.985  1.00 21.26  ? 501 LEU A CG  1 
ATOM   3955  C  CD1 . LEU A 1 501 ? 90.990  116.625 89.809  1.00 21.26  ? 501 LEU A CD1 1 
ATOM   3956  C  CD2 . LEU A 1 501 ? 90.848  117.666 91.975  1.00 21.26  ? 501 LEU A CD2 1 
ATOM   3957  N  N   . PHE A 1 502 ? 94.671  114.406 93.482  1.00 16.53  ? 502 PHE A N   1 
ATOM   3958  C  CA  . PHE A 1 502 ? 95.057  113.295 94.335  1.00 16.53  ? 502 PHE A CA  1 
ATOM   3959  C  C   . PHE A 1 502 ? 95.282  113.740 95.768  1.00 16.53  ? 502 PHE A C   1 
ATOM   3960  O  O   . PHE A 1 502 ? 94.810  113.083 96.699  1.00 16.53  ? 502 PHE A O   1 
ATOM   3961  C  CB  . PHE A 1 502 ? 96.315  112.644 93.796  1.00 16.53  ? 502 PHE A CB  1 
ATOM   3962  C  CG  . PHE A 1 502 ? 96.823  111.528 94.634  1.00 16.53  ? 502 PHE A CG  1 
ATOM   3963  C  CD1 . PHE A 1 502 ? 96.242  110.294 94.578  1.00 16.53  ? 502 PHE A CD1 1 
ATOM   3964  C  CD2 . PHE A 1 502 ? 97.901  111.714 95.468  1.00 16.53  ? 502 PHE A CD2 1 
ATOM   3965  C  CE1 . PHE A 1 502 ? 96.720  109.277 95.339  1.00 16.53  ? 502 PHE A CE1 1 
ATOM   3966  C  CE2 . PHE A 1 502 ? 98.370  110.701 96.230  1.00 16.53  ? 502 PHE A CE2 1 
ATOM   3967  C  CZ  . PHE A 1 502 ? 97.788  109.482 96.155  1.00 16.53  ? 502 PHE A CZ  1 
ATOM   3968  N  N   . LEU A 1 503 ? 95.957  114.865 95.972  1.00 21.07  ? 503 LEU A N   1 
ATOM   3969  C  CA  . LEU A 1 503 ? 96.140  115.319 97.341  1.00 21.07  ? 503 LEU A CA  1 
ATOM   3970  C  C   . LEU A 1 503 ? 94.861  115.864 97.953  1.00 21.07  ? 503 LEU A C   1 
ATOM   3971  O  O   . LEU A 1 503 ? 94.698  115.768 99.171  1.00 21.07  ? 503 LEU A O   1 
ATOM   3972  C  CB  . LEU A 1 503 ? 97.264  116.343 97.419  1.00 21.07  ? 503 LEU A CB  1 
ATOM   3973  C  CG  . LEU A 1 503 ? 98.600  115.737 97.013  1.00 21.07  ? 503 LEU A CG  1 
ATOM   3974  C  CD1 . LEU A 1 503 ? 99.703  116.721 97.243  1.00 21.07  ? 503 LEU A CD1 1 
ATOM   3975  C  CD2 . LEU A 1 503 ? 98.870  114.478 97.785  1.00 21.07  ? 503 LEU A CD2 1 
ATOM   3976  N  N   . GLN A 1 504 ? 93.950  116.427 97.155  1.00 28.00  ? 504 GLN A N   1 
ATOM   3977  C  CA  . GLN A 1 504 ? 92.650  116.786 97.708  1.00 28.00  ? 504 GLN A CA  1 
ATOM   3978  C  C   . GLN A 1 504 ? 91.894  115.550 98.131  1.00 28.00  ? 504 GLN A C   1 
ATOM   3979  O  O   . GLN A 1 504 ? 91.285  115.521 99.204  1.00 28.00  ? 504 GLN A O   1 
ATOM   3980  C  CB  . GLN A 1 504 ? 91.799  117.565 96.728  1.00 28.00  ? 504 GLN A CB  1 
ATOM   3981  C  CG  . GLN A 1 504 ? 91.894  119.024 96.884  1.00 28.00  ? 504 GLN A CG  1 
ATOM   3982  C  CD  . GLN A 1 504 ? 90.946  119.733 95.955  1.00 28.00  ? 504 GLN A CD  1 
ATOM   3983  O  OE1 . GLN A 1 504 ? 89.754  119.434 95.933  1.00 28.00  ? 504 GLN A OE1 1 
ATOM   3984  N  NE2 . GLN A 1 504 ? 91.456  120.691 95.198  1.00 28.00  ? 504 GLN A NE2 1 
ATOM   3985  N  N   . PHE A 1 505 ? 91.916  114.525 97.289  1.00 25.08  ? 505 PHE A N   1 
ATOM   3986  C  CA  . PHE A 1 505 ? 91.292  113.267 97.647  1.00 25.08  ? 505 PHE A CA  1 
ATOM   3987  C  C   . PHE A 1 505 ? 91.991  112.631 98.824  1.00 25.08  ? 505 PHE A C   1 
ATOM   3988  O  O   . PHE A 1 505 ? 91.371  111.883 99.580  1.00 25.08  ? 505 PHE A O   1 
ATOM   3989  C  CB  . PHE A 1 505 ? 91.286  112.319 96.469  1.00 25.08  ? 505 PHE A CB  1 
ATOM   3990  C  CG  . PHE A 1 505 ? 90.396  111.166 96.662  1.00 25.08  ? 505 PHE A CG  1 
ATOM   3991  C  CD1 . PHE A 1 505 ? 89.111  111.353 97.097  1.00 25.08  ? 505 PHE A CD1 1 
ATOM   3992  C  CD2 . PHE A 1 505 ? 90.840  109.897 96.424  1.00 25.08  ? 505 PHE A CD2 1 
ATOM   3993  C  CE1 . PHE A 1 505 ? 88.278  110.294 97.277  1.00 25.08  ? 505 PHE A CE1 1 
ATOM   3994  C  CE2 . PHE A 1 505 ? 90.016  108.831 96.603  1.00 25.08  ? 505 PHE A CE2 1 
ATOM   3995  C  CZ  . PHE A 1 505 ? 88.731  109.029 97.033  1.00 25.08  ? 505 PHE A CZ  1 
ATOM   3996  N  N   . GLY A 1 506 ? 93.281  112.900 98.979  1.00 28.29  ? 506 GLY A N   1 
ATOM   3997  C  CA  . GLY A 1 506 ? 93.976  112.416 100.151 1.00 28.29  ? 506 GLY A CA  1 
ATOM   3998  C  C   . GLY A 1 506 ? 93.539  113.117 101.424 1.00 28.29  ? 506 GLY A C   1 
ATOM   3999  O  O   . GLY A 1 506 ? 93.259  112.465 102.428 1.00 28.29  ? 506 GLY A O   1 
ATOM   4000  N  N   . TYR A 1 507 ? 93.444  114.448 101.394 1.00 26.08  ? 507 TYR A N   1 
ATOM   4001  C  CA  . TYR A 1 507 ? 93.027  115.186 102.583 1.00 26.08  ? 507 TYR A CA  1 
ATOM   4002  C  C   . TYR A 1 507 ? 91.583  114.928 102.963 1.00 26.08  ? 507 TYR A C   1 
ATOM   4003  O  O   . TYR A 1 507 ? 91.240  115.015 104.140 1.00 26.08  ? 507 TYR A O   1 
ATOM   4004  C  CB  . TYR A 1 507 ? 93.200  116.679 102.375 1.00 26.08  ? 507 TYR A CB  1 
ATOM   4005  C  CG  . TYR A 1 507 ? 94.601  117.161 102.536 1.00 26.08  ? 507 TYR A CG  1 
ATOM   4006  C  CD1 . TYR A 1 507 ? 95.285  116.963 103.706 1.00 26.08  ? 507 TYR A CD1 1 
ATOM   4007  C  CD2 . TYR A 1 507 ? 95.235  117.828 101.511 1.00 26.08  ? 507 TYR A CD2 1 
ATOM   4008  C  CE1 . TYR A 1 507 ? 96.568  117.403 103.845 1.00 26.08  ? 507 TYR A CE1 1 
ATOM   4009  C  CE2 . TYR A 1 507 ? 96.507  118.273 101.640 1.00 26.08  ? 507 TYR A CE2 1 
ATOM   4010  C  CZ  . TYR A 1 507 ? 97.171  118.061 102.807 1.00 26.08  ? 507 TYR A CZ  1 
ATOM   4011  O  OH  . TYR A 1 507 ? 98.458  118.508 102.937 1.00 26.08  ? 507 TYR A OH  1 
ATOM   4012  N  N   . VAL A 1 508 ? 90.725  114.611 102.006 1.00 29.93  ? 508 VAL A N   1 
ATOM   4013  C  CA  . VAL A 1 508 ? 89.333  114.371 102.351 1.00 29.93  ? 508 VAL A CA  1 
ATOM   4014  C  C   . VAL A 1 508 ? 89.142  112.979 102.920 1.00 29.93  ? 508 VAL A C   1 
ATOM   4015  O  O   . VAL A 1 508 ? 88.564  112.809 103.998 1.00 29.93  ? 508 VAL A O   1 
ATOM   4016  C  CB  . VAL A 1 508 ? 88.436  114.612 101.130 1.00 29.93  ? 508 VAL A CB  1 
ATOM   4017  C  CG1 . VAL A 1 508 ? 87.080  113.975 101.328 1.00 29.93  ? 508 VAL A CG1 1 
ATOM   4018  C  CG2 . VAL A 1 508 ? 88.276  116.091 100.914 1.00 29.93  ? 508 VAL A CG2 1 
ATOM   4019  N  N   . SER A 1 509 ? 89.650  111.969 102.235 1.00 30.69  ? 509 SER A N   1 
ATOM   4020  C  CA  . SER A 1 509 ? 89.220  110.610 102.509 1.00 30.69  ? 509 SER A CA  1 
ATOM   4021  C  C   . SER A 1 509 ? 90.086  109.894 103.528 1.00 30.69  ? 509 SER A C   1 
ATOM   4022  O  O   . SER A 1 509 ? 89.675  108.846 104.024 1.00 30.69  ? 509 SER A O   1 
ATOM   4023  C  CB  . SER A 1 509 ? 89.180  109.796 101.231 1.00 30.69  ? 509 SER A CB  1 
ATOM   4024  O  OG  . SER A 1 509 ? 90.228  108.867 101.257 1.00 30.69  ? 509 SER A OG  1 
ATOM   4025  N  N   . LEU A 1 510 ? 91.295  110.375 103.794 1.00 29.13  ? 510 LEU A N   1 
ATOM   4026  C  CA  . LEU A 1 510 ? 92.130  109.696 104.774 1.00 29.13  ? 510 LEU A CA  1 
ATOM   4027  C  C   . LEU A 1 510 ? 91.624  109.943 106.191 1.00 29.13  ? 510 LEU A C   1 
ATOM   4028  O  O   . LEU A 1 510 ? 91.671  109.044 107.033 1.00 29.13  ? 510 LEU A O   1 
ATOM   4029  C  CB  . LEU A 1 510 ? 93.567  110.161 104.639 1.00 29.13  ? 510 LEU A CB  1 
ATOM   4030  C  CG  . LEU A 1 510 ? 94.255  109.466 103.482 1.00 29.13  ? 510 LEU A CG  1 
ATOM   4031  C  CD1 . LEU A 1 510 ? 95.614  110.057 103.265 1.00 29.13  ? 510 LEU A CD1 1 
ATOM   4032  C  CD2 . LEU A 1 510 ? 94.386  108.013 103.804 1.00 29.13  ? 510 LEU A CD2 1 
ATOM   4033  N  N   . PHE A 1 511 ? 91.164  111.155 106.487 1.00 32.88  ? 511 PHE A N   1 
ATOM   4034  C  CA  . PHE A 1 511 ? 90.687  111.472 107.827 1.00 32.88  ? 511 PHE A CA  1 
ATOM   4035  C  C   . PHE A 1 511 ? 89.272  112.009 107.810 1.00 32.88  ? 511 PHE A C   1 
ATOM   4036  O  O   . PHE A 1 511 ? 88.975  113.001 108.477 1.00 32.88  ? 511 PHE A O   1 
ATOM   4037  C  CB  . PHE A 1 511 ? 91.595  112.469 108.513 1.00 32.88  ? 511 PHE A CB  1 
ATOM   4038  C  CG  . PHE A 1 511 ? 93.020  112.220 108.273 1.00 32.88  ? 511 PHE A CG  1 
ATOM   4039  C  CD1 . PHE A 1 511 ? 93.668  111.228 108.962 1.00 32.88  ? 511 PHE A CD1 1 
ATOM   4040  C  CD2 . PHE A 1 511 ? 93.723  112.974 107.369 1.00 32.88  ? 511 PHE A CD2 1 
ATOM   4041  C  CE1 . PHE A 1 511 ? 94.991  110.989 108.757 1.00 32.88  ? 511 PHE A CE1 1 
ATOM   4042  C  CE2 . PHE A 1 511 ? 95.049  112.738 107.158 1.00 32.88  ? 511 PHE A CE2 1 
ATOM   4043  C  CZ  . PHE A 1 511 ? 95.684  111.744 107.853 1.00 32.88  ? 511 PHE A CZ  1 
ATOM   4044  N  N   . SER A 1 512 ? 88.390  111.357 107.082 1.00 44.20  ? 512 SER A N   1 
ATOM   4045  C  CA  . SER A 1 512 ? 87.004  111.781 107.055 1.00 44.20  ? 512 SER A CA  1 
ATOM   4046  C  C   . SER A 1 512 ? 86.229  111.402 108.304 1.00 44.20  ? 512 SER A C   1 
ATOM   4047  O  O   . SER A 1 512 ? 85.138  111.936 108.518 1.00 44.20  ? 512 SER A O   1 
ATOM   4048  C  CB  . SER A 1 512 ? 86.290  111.178 105.855 1.00 44.20  ? 512 SER A CB  1 
ATOM   4049  O  OG  . SER A 1 512 ? 86.327  109.771 105.932 1.00 44.20  ? 512 SER A OG  1 
ATOM   4050  N  N   . CYS A 1 513 ? 86.760  110.515 109.141 1.00 58.18  ? 513 CYS A N   1 
ATOM   4051  C  CA  . CYS A 1 513 ? 86.050  110.151 110.361 1.00 58.18  ? 513 CYS A CA  1 
ATOM   4052  C  C   . CYS A 1 513 ? 86.121  111.245 111.411 1.00 58.18  ? 513 CYS A C   1 
ATOM   4053  O  O   . CYS A 1 513 ? 85.096  111.635 111.977 1.00 58.18  ? 513 CYS A O   1 
ATOM   4054  C  CB  . CYS A 1 513 ? 86.637  108.871 110.935 1.00 58.18  ? 513 CYS A CB  1 
ATOM   4055  S  SG  . CYS A 1 513 ? 86.082  107.399 110.116 1.00 58.18  ? 513 CYS A SG  1 
ATOM   4056  N  N   . VAL A 1 514 ? 87.314  111.763 111.678 1.00 59.76  ? 514 VAL A N   1 
ATOM   4057  C  CA  . VAL A 1 514 ? 87.471  112.694 112.785 1.00 59.76  ? 514 VAL A CA  1 
ATOM   4058  C  C   . VAL A 1 514 ? 87.154  114.109 112.341 1.00 59.76  ? 514 VAL A C   1 
ATOM   4059  O  O   . VAL A 1 514 ? 87.025  115.017 113.169 1.00 59.76  ? 514 VAL A O   1 
ATOM   4060  C  CB  . VAL A 1 514 ? 88.881  112.598 113.377 1.00 59.76  ? 514 VAL A CB  1 
ATOM   4061  C  CG1 . VAL A 1 514 ? 89.197  111.163 113.693 1.00 59.76  ? 514 VAL A CG1 1 
ATOM   4062  C  CG2 . VAL A 1 514 ? 89.877  113.170 112.411 1.00 59.76  ? 514 VAL A CG2 1 
ATOM   4063  N  N   . TYR A 1 515 ? 87.040  114.329 111.038 1.00 57.48  ? 515 TYR A N   1 
ATOM   4064  C  CA  . TYR A 1 515 ? 86.843  115.671 110.497 1.00 57.48  ? 515 TYR A CA  1 
ATOM   4065  C  C   . TYR A 1 515 ? 86.209  115.586 109.123 1.00 57.48  ? 515 TYR A C   1 
ATOM   4066  O  O   . TYR A 1 515 ? 86.879  115.754 108.099 1.00 57.48  ? 515 TYR A O   1 
ATOM   4067  C  CB  . TYR A 1 515 ? 88.165  116.424 110.420 1.00 57.48  ? 515 TYR A CB  1 
ATOM   4068  C  CG  . TYR A 1 515 ? 87.981  117.897 110.268 1.00 57.48  ? 515 TYR A CG  1 
ATOM   4069  C  CD1 . TYR A 1 515 ? 87.341  118.633 111.249 1.00 57.48  ? 515 TYR A CD1 1 
ATOM   4070  C  CD2 . TYR A 1 515 ? 88.430  118.554 109.142 1.00 57.48  ? 515 TYR A CD2 1 
ATOM   4071  C  CE1 . TYR A 1 515 ? 87.172  119.988 111.120 1.00 57.48  ? 515 TYR A CE1 1 
ATOM   4072  C  CE2 . TYR A 1 515 ? 88.263  119.908 109.002 1.00 57.48  ? 515 TYR A CE2 1 
ATOM   4073  C  CZ  . TYR A 1 515 ? 87.634  120.617 109.994 1.00 57.48  ? 515 TYR A CZ  1 
ATOM   4074  O  OH  . TYR A 1 515 ? 87.469  121.965 109.852 1.00 57.48  ? 515 TYR A OH  1 
ATOM   4075  N  N   . PRO A 1 516 ? 84.892  115.387 109.064 1.00 55.20  ? 516 PRO A N   1 
ATOM   4076  C  CA  . PRO A 1 516 ? 84.225  115.286 107.764 1.00 55.20  ? 516 PRO A CA  1 
ATOM   4077  C  C   . PRO A 1 516 ? 84.040  116.621 107.095 1.00 55.20  ? 516 PRO A C   1 
ATOM   4078  O  O   . PRO A 1 516 ? 83.787  116.654 105.887 1.00 55.20  ? 516 PRO A O   1 
ATOM   4079  C  CB  . PRO A 1 516 ? 82.883  114.657 108.109 1.00 55.20  ? 516 PRO A CB  1 
ATOM   4080  C  CG  . PRO A 1 516 ? 82.636  115.093 109.484 1.00 55.20  ? 516 PRO A CG  1 
ATOM   4081  C  CD  . PRO A 1 516 ? 83.948  115.229 110.176 1.00 55.20  ? 516 PRO A CD  1 
ATOM   4082  N  N   . LEU A 1 517 ? 84.132  117.712 107.854 1.00 54.84  ? 517 LEU A N   1 
ATOM   4083  C  CA  . LEU A 1 517 ? 83.965  119.068 107.343 1.00 54.84  ? 517 LEU A CA  1 
ATOM   4084  C  C   . LEU A 1 517 ? 84.971  119.406 106.249 1.00 54.84  ? 517 LEU A C   1 
ATOM   4085  O  O   . LEU A 1 517 ? 84.683  120.251 105.393 1.00 54.84  ? 517 LEU A O   1 
ATOM   4086  C  CB  . LEU A 1 517 ? 84.078  120.046 108.514 1.00 54.84  ? 517 LEU A CB  1 
ATOM   4087  C  CG  . LEU A 1 517 ? 84.010  121.545 108.268 1.00 54.84  ? 517 LEU A CG  1 
ATOM   4088  C  CD1 . LEU A 1 517 ? 82.675  121.868 107.674 1.00 54.84  ? 517 LEU A CD1 1 
ATOM   4089  C  CD2 . LEU A 1 517 ? 84.198  122.288 109.563 1.00 54.84  ? 517 LEU A CD2 1 
ATOM   4090  N  N   . ALA A 1 518 ? 86.127  118.737 106.246 1.00 48.37  ? 518 ALA A N   1 
ATOM   4091  C  CA  . ALA A 1 518 ? 87.141  118.921 105.214 1.00 48.37  ? 518 ALA A CA  1 
ATOM   4092  C  C   . ALA A 1 518 ? 86.626  118.601 103.818 1.00 48.37  ? 518 ALA A C   1 
ATOM   4093  O  O   . ALA A 1 518 ? 87.156  119.132 102.835 1.00 48.37  ? 518 ALA A O   1 
ATOM   4094  C  CB  . ALA A 1 518 ? 88.352  118.052 105.527 1.00 48.37  ? 518 ALA A CB  1 
ATOM   4095  N  N   . ALA A 1 519 ? 85.638  117.709 103.707 1.00 44.39  ? 519 ALA A N   1 
ATOM   4096  C  CA  . ALA A 1 519 ? 85.027  117.432 102.411 1.00 44.39  ? 519 ALA A CA  1 
ATOM   4097  C  C   . ALA A 1 519 ? 84.369  118.669 101.816 1.00 44.39  ? 519 ALA A C   1 
ATOM   4098  O  O   . ALA A 1 519 ? 84.445  118.888 100.604 1.00 44.39  ? 519 ALA A O   1 
ATOM   4099  C  CB  . ALA A 1 519 ? 84.004  116.306 102.535 1.00 44.39  ? 519 ALA A CB  1 
ATOM   4100  N  N   . ALA A 1 520 ? 83.720  119.486 102.645 1.00 46.59  ? 520 ALA A N   1 
ATOM   4101  C  CA  . ALA A 1 520 ? 83.184  120.751 102.154 1.00 46.59  ? 520 ALA A CA  1 
ATOM   4102  C  C   . ALA A 1 520 ? 84.280  121.690 101.668 1.00 46.59  ? 520 ALA A C   1 
ATOM   4103  O  O   . ALA A 1 520 ? 84.102  122.389 100.668 1.00 46.59  ? 520 ALA A O   1 
ATOM   4104  C  CB  . ALA A 1 520 ? 82.353  121.426 103.238 1.00 46.59  ? 520 ALA A CB  1 
ATOM   4105  N  N   . PHE A 1 521 ? 85.429  121.702 102.343 1.00 44.56  ? 521 PHE A N   1 
ATOM   4106  C  CA  . PHE A 1 521 ? 86.560  122.526 101.917 1.00 44.56  ? 521 PHE A CA  1 
ATOM   4107  C  C   . PHE A 1 521 ? 87.209  122.063 100.626 1.00 44.56  ? 521 PHE A C   1 
ATOM   4108  O  O   . PHE A 1 521 ? 88.022  122.803 100.065 1.00 44.56  ? 521 PHE A O   1 
ATOM   4109  C  CB  . PHE A 1 521 ? 87.609  122.599 103.013 1.00 44.56  ? 521 PHE A CB  1 
ATOM   4110  C  CG  . PHE A 1 521 ? 87.164  123.353 104.214 1.00 44.56  ? 521 PHE A CG  1 
ATOM   4111  C  CD1 . PHE A 1 521 ? 86.168  124.304 104.117 1.00 44.56  ? 521 PHE A CD1 1 
ATOM   4112  C  CD2 . PHE A 1 521 ? 87.728  123.101 105.444 1.00 44.56  ? 521 PHE A CD2 1 
ATOM   4113  C  CE1 . PHE A 1 521 ? 85.753  124.998 105.223 1.00 44.56  ? 521 PHE A CE1 1 
ATOM   4114  C  CE2 . PHE A 1 521 ? 87.316  123.789 106.554 1.00 44.56  ? 521 PHE A CE2 1 
ATOM   4115  C  CZ  . PHE A 1 521 ? 86.326  124.741 106.445 1.00 44.56  ? 521 PHE A CZ  1 
ATOM   4116  N  N   . ALA A 1 522 ? 86.891  120.876 100.145 1.00 40.29  ? 522 ALA A N   1 
ATOM   4117  C  CA  . ALA A 1 522 ? 87.313  120.531 98.803  1.00 40.29  ? 522 ALA A CA  1 
ATOM   4118  C  C   . ALA A 1 522 ? 86.348  121.077 97.764  1.00 40.29  ? 522 ALA A C   1 
ATOM   4119  O  O   . ALA A 1 522 ? 86.783  121.554 96.712  1.00 40.29  ? 522 ALA A O   1 
ATOM   4120  C  CB  . ALA A 1 522 ? 87.449  119.019 98.665  1.00 40.29  ? 522 ALA A CB  1 
ATOM   4121  N  N   . VAL A 1 523 ? 85.047  121.017 98.045  1.00 40.36  ? 523 VAL A N   1 
ATOM   4122  C  CA  . VAL A 1 523 ? 84.050  121.374 97.048  1.00 40.36  ? 523 VAL A CA  1 
ATOM   4123  C  C   . VAL A 1 523 ? 84.082  122.866 96.764  1.00 40.36  ? 523 VAL A C   1 
ATOM   4124  O  O   . VAL A 1 523 ? 84.099  123.286 95.603  1.00 40.36  ? 523 VAL A O   1 
ATOM   4125  C  CB  . VAL A 1 523 ? 82.663  120.918 97.516  1.00 40.36  ? 523 VAL A CB  1 
ATOM   4126  C  CG1 . VAL A 1 523 ? 81.613  121.331 96.531  1.00 40.36  ? 523 VAL A CG1 1 
ATOM   4127  C  CG2 . VAL A 1 523 ? 82.649  119.440 97.650  1.00 40.36  ? 523 VAL A CG2 1 
ATOM   4128  N  N   . LEU A 1 524 ? 84.173  123.686 97.811  1.00 37.77  ? 524 LEU A N   1 
ATOM   4129  C  CA  . LEU A 1 524 ? 84.372  125.120 97.643  1.00 37.77  ? 524 LEU A CA  1 
ATOM   4130  C  C   . LEU A 1 524 ? 85.692  125.474 96.993  1.00 37.77  ? 524 LEU A C   1 
ATOM   4131  O  O   . LEU A 1 524 ? 85.838  126.600 96.518  1.00 37.77  ? 524 LEU A O   1 
ATOM   4132  C  CB  . LEU A 1 524 ? 84.315  125.819 98.991  1.00 37.77  ? 524 LEU A CB  1 
ATOM   4133  C  CG  . LEU A 1 524 ? 82.918  125.916 99.562  1.00 37.77  ? 524 LEU A CG  1 
ATOM   4134  C  CD1 . LEU A 1 524 ? 82.960  126.584 100.916 1.00 37.77  ? 524 LEU A CD1 1 
ATOM   4135  C  CD2 . LEU A 1 524 ? 82.049  126.678 98.594  1.00 37.77  ? 524 LEU A CD2 1 
ATOM   4136  N  N   . ASN A 1 525 ? 86.651  124.559 96.956  1.00 37.70  ? 525 ASN A N   1 
ATOM   4137  C  CA  . ASN A 1 525 ? 87.819  124.801 96.135  1.00 37.70  ? 525 ASN A CA  1 
ATOM   4138  C  C   . ASN A 1 525 ? 87.546  124.479 94.678  1.00 37.70  ? 525 ASN A C   1 
ATOM   4139  O  O   . ASN A 1 525 ? 87.928  125.251 93.795  1.00 37.70  ? 525 ASN A O   1 
ATOM   4140  C  CB  . ASN A 1 525 ? 88.992  123.988 96.648  1.00 37.70  ? 525 ASN A CB  1 
ATOM   4141  C  CG  . ASN A 1 525 ? 90.252  124.273 95.895  1.00 37.70  ? 525 ASN A CG  1 
ATOM   4142  O  OD1 . ASN A 1 525 ? 90.576  123.595 94.926  1.00 37.70  ? 525 ASN A OD1 1 
ATOM   4143  N  ND2 . ASN A 1 525 ? 90.978  125.288 96.332  1.00 37.70  ? 525 ASN A ND2 1 
ATOM   4144  N  N   . ASN A 1 526 ? 86.887  123.348 94.412  1.00 36.07  ? 526 ASN A N   1 
ATOM   4145  C  CA  . ASN A 1 526 ? 86.752  122.865 93.041  1.00 36.07  ? 526 ASN A CA  1 
ATOM   4146  C  C   . ASN A 1 526 ? 85.819  123.744 92.226  1.00 36.07  ? 526 ASN A C   1 
ATOM   4147  O  O   . ASN A 1 526 ? 85.966  123.828 91.003  1.00 36.07  ? 526 ASN A O   1 
ATOM   4148  C  CB  . ASN A 1 526 ? 86.304  121.414 93.022  1.00 36.07  ? 526 ASN A CB  1 
ATOM   4149  C  CG  . ASN A 1 526 ? 87.421  120.479 93.366  1.00 36.07  ? 526 ASN A CG  1 
ATOM   4150  O  OD1 . ASN A 1 526 ? 88.574  120.887 93.457  1.00 36.07  ? 526 ASN A OD1 1 
ATOM   4151  N  ND2 . ASN A 1 526 ? 87.099  119.213 93.535  1.00 36.07  ? 526 ASN A ND2 1 
ATOM   4152  N  N   . PHE A 1 527 ? 84.842  124.377 92.877  1.00 40.58  ? 527 PHE A N   1 
ATOM   4153  C  CA  . PHE A 1 527 ? 84.017  125.379 92.216  1.00 40.58  ? 527 PHE A CA  1 
ATOM   4154  C  C   . PHE A 1 527 ? 84.839  126.564 91.723  1.00 40.58  ? 527 PHE A C   1 
ATOM   4155  O  O   . PHE A 1 527 ? 84.398  127.277 90.819  1.00 40.58  ? 527 PHE A O   1 
ATOM   4156  C  CB  . PHE A 1 527 ? 82.925  125.869 93.156  1.00 40.58  ? 527 PHE A CB  1 
ATOM   4157  C  CG  . PHE A 1 527 ? 81.796  124.907 93.320  1.00 40.58  ? 527 PHE A CG  1 
ATOM   4158  C  CD1 . PHE A 1 527 ? 81.560  123.928 92.378  1.00 40.58  ? 527 PHE A CD1 1 
ATOM   4159  C  CD2 . PHE A 1 527 ? 80.965  124.984 94.422  1.00 40.58  ? 527 PHE A CD2 1 
ATOM   4160  C  CE1 . PHE A 1 527 ? 80.517  123.040 92.535  1.00 40.58  ? 527 PHE A CE1 1 
ATOM   4161  C  CE2 . PHE A 1 527 ? 79.922  124.098 94.582  1.00 40.58  ? 527 PHE A CE2 1 
ATOM   4162  C  CZ  . PHE A 1 527 ? 79.700  123.127 93.636  1.00 40.58  ? 527 PHE A CZ  1 
ATOM   4163  N  N   . THR A 1 528 ? 86.004  126.810 92.314  1.00 38.81  ? 528 THR A N   1 
ATOM   4164  C  CA  . THR A 1 528 ? 86.958  127.747 91.749  1.00 38.81  ? 528 THR A CA  1 
ATOM   4165  C  C   . THR A 1 528 ? 87.901  127.073 90.765  1.00 38.81  ? 528 THR A C   1 
ATOM   4166  O  O   . THR A 1 528 ? 88.330  127.713 89.800  1.00 38.81  ? 528 THR A O   1 
ATOM   4167  C  CB  . THR A 1 528 ? 87.774  128.414 92.846  1.00 38.81  ? 528 THR A CB  1 
ATOM   4168  O  OG1 . THR A 1 528 ? 88.806  127.519 93.264  1.00 38.81  ? 528 THR A OG1 1 
ATOM   4169  C  CG2 . THR A 1 528 ? 86.897  128.718 94.015  1.00 38.81  ? 528 THR A CG2 1 
ATOM   4170  N  N   . GLU A 1 529 ? 88.253  125.805 91.005  1.00 38.00  ? 529 GLU A N   1 
ATOM   4171  C  CA  . GLU A 1 529 ? 89.294  125.145 90.222  1.00 38.00  ? 529 GLU A CA  1 
ATOM   4172  C  C   . GLU A 1 529 ? 88.841  124.925 88.787  1.00 38.00  ? 529 GLU A C   1 
ATOM   4173  O  O   . GLU A 1 529 ? 89.653  125.001 87.860  1.00 38.00  ? 529 GLU A O   1 
ATOM   4174  C  CB  . GLU A 1 529 ? 89.663  123.812 90.866  1.00 38.00  ? 529 GLU A CB  1 
ATOM   4175  C  CG  . GLU A 1 529 ? 90.928  123.157 90.338  1.00 38.00  ? 529 GLU A CG  1 
ATOM   4176  C  CD  . GLU A 1 529 ? 92.209  123.765 90.855  1.00 38.00  ? 529 GLU A CD  1 
ATOM   4177  O  OE1 . GLU A 1 529 ? 92.203  124.344 91.957  1.00 38.00  ? 529 GLU A OE1 1 
ATOM   4178  O  OE2 . GLU A 1 529 ? 93.231  123.648 90.150  1.00 38.00  ? 529 GLU A OE2 1 
ATOM   4179  N  N   . VAL A 1 530 ? 87.561  124.594 88.600  1.00 43.83  ? 530 VAL A N   1 
ATOM   4180  C  CA  . VAL A 1 530 ? 86.951  124.530 87.273  1.00 43.83  ? 530 VAL A CA  1 
ATOM   4181  C  C   . VAL A 1 530 ? 87.098  125.854 86.533  1.00 43.83  ? 530 VAL A C   1 
ATOM   4182  O  O   . VAL A 1 530 ? 87.420  125.882 85.341  1.00 43.83  ? 530 VAL A O   1 
ATOM   4183  C  CB  . VAL A 1 530 ? 85.477  124.118 87.409  1.00 43.83  ? 530 VAL A CB  1 
ATOM   4184  C  CG1 . VAL A 1 530 ? 84.707  124.372 86.135  1.00 43.83  ? 530 VAL A CG1 1 
ATOM   4185  C  CG2 . VAL A 1 530 ? 85.395  122.663 87.781  1.00 43.83  ? 530 VAL A CG2 1 
ATOM   4186  N  N   . ASN A 1 531 ? 86.946  126.968 87.243  1.00 46.78  ? 531 ASN A N   1 
ATOM   4187  C  CA  . ASN A 1 531 ? 87.232  128.259 86.636  1.00 46.78  ? 531 ASN A CA  1 
ATOM   4188  C  C   . ASN A 1 531 ? 88.723  128.473 86.470  1.00 46.78  ? 531 ASN A C   1 
ATOM   4189  O  O   . ASN A 1 531 ? 89.160  128.924 85.408  1.00 46.78  ? 531 ASN A O   1 
ATOM   4190  C  CB  . ASN A 1 531 ? 86.623  129.379 87.460  1.00 46.78  ? 531 ASN A CB  1 
ATOM   4191  C  CG  . ASN A 1 531 ? 85.147  129.220 87.605  1.00 46.78  ? 531 ASN A CG  1 
ATOM   4192  O  OD1 . ASN A 1 531 ? 84.580  128.241 87.130  1.00 46.78  ? 531 ASN A OD1 1 
ATOM   4193  N  ND2 . ASN A 1 531 ? 84.502  130.175 88.255  1.00 46.78  ? 531 ASN A ND2 1 
ATOM   4194  N  N   . SER A 1 532 ? 89.506  128.190 87.513  1.00 37.63  ? 532 SER A N   1 
ATOM   4195  C  CA  . SER A 1 532 ? 90.884  128.657 87.556  1.00 37.63  ? 532 SER A CA  1 
ATOM   4196  C  C   . SER A 1 532 ? 91.743  127.961 86.515  1.00 37.63  ? 532 SER A C   1 
ATOM   4197  O  O   . SER A 1 532 ? 92.457  128.624 85.760  1.00 37.63  ? 532 SER A O   1 
ATOM   4198  C  CB  . SER A 1 532 ? 91.467  128.421 88.933  1.00 37.63  ? 532 SER A CB  1 
ATOM   4199  O  OG  . SER A 1 532 ? 92.871  128.353 88.840  1.00 37.63  ? 532 SER A OG  1 
ATOM   4200  N  N   . ASP A 1 533 ? 91.682  126.631 86.459  1.00 37.50  ? 533 ASP A N   1 
ATOM   4201  C  CA  . ASP A 1 533 ? 92.342  125.867 85.408  1.00 37.50  ? 533 ASP A CA  1 
ATOM   4202  C  C   . ASP A 1 533 ? 91.882  126.241 84.007  1.00 37.50  ? 533 ASP A C   1 
ATOM   4203  O  O   . ASP A 1 533 ? 92.697  126.186 83.081  1.00 37.50  ? 533 ASP A O   1 
ATOM   4204  C  CB  . ASP A 1 533 ? 92.167  124.371 85.639  1.00 37.50  ? 533 ASP A CB  1 
ATOM   4205  C  CG  . ASP A 1 533 ? 93.105  123.841 86.698  1.00 37.50  ? 533 ASP A CG  1 
ATOM   4206  O  OD1 . ASP A 1 533 ? 94.099  124.522 87.007  1.00 37.50  ? 533 ASP A OD1 1 
ATOM   4207  O  OD2 . ASP A 1 533 ? 92.851  122.748 87.233  1.00 37.50  ? 533 ASP A OD2 1 
ATOM   4208  N  N   . ALA A 1 534 ? 90.607  126.598 83.829  1.00 38.96  ? 534 ALA A N   1 
ATOM   4209  C  CA  . ALA A 1 534 ? 90.139  127.058 82.524  1.00 38.96  ? 534 ALA A CA  1 
ATOM   4210  C  C   . ALA A 1 534 ? 90.860  128.326 82.105  1.00 38.96  ? 534 ALA A C   1 
ATOM   4211  O  O   . ALA A 1 534 ? 91.231  128.482 80.938  1.00 38.96  ? 534 ALA A O   1 
ATOM   4212  C  CB  . ALA A 1 534 ? 88.632  127.286 82.539  1.00 38.96  ? 534 ALA A CB  1 
ATOM   4213  N  N   . LEU A 1 535 ? 91.038  129.256 83.041  1.00 38.65  ? 535 LEU A N   1 
ATOM   4214  C  CA  . LEU A 1 535 ? 91.821  130.450 82.757  1.00 38.65  ? 535 LEU A CA  1 
ATOM   4215  C  C   . LEU A 1 535 ? 93.272  130.094 82.460  1.00 38.65  ? 535 LEU A C   1 
ATOM   4216  O  O   . LEU A 1 535 ? 93.914  130.735 81.621  1.00 38.65  ? 535 LEU A O   1 
ATOM   4217  C  CB  . LEU A 1 535 ? 91.715  131.420 83.926  1.00 38.65  ? 535 LEU A CB  1 
ATOM   4218  C  CG  . LEU A 1 535 ? 92.658  132.609 83.958  1.00 38.65  ? 535 LEU A CG  1 
ATOM   4219  C  CD1 . LEU A 1 535 ? 92.300  133.511 82.822  1.00 38.65  ? 535 LEU A CD1 1 
ATOM   4220  C  CD2 . LEU A 1 535 ? 92.526  133.345 85.261  1.00 38.65  ? 535 LEU A CD2 1 
ATOM   4221  N  N   . LYS A 1 536 ? 93.793  129.057 83.117  1.00 34.75  ? 536 LYS A N   1 
ATOM   4222  C  CA  . LYS A 1 536 ? 95.165  128.631 82.869  1.00 34.75  ? 536 LYS A CA  1 
ATOM   4223  C  C   . LYS A 1 536 ? 95.351  128.055 81.475  1.00 34.75  ? 536 LYS A C   1 
ATOM   4224  O  O   . LYS A 1 536 ? 96.436  128.166 80.895  1.00 34.75  ? 536 LYS A O   1 
ATOM   4225  C  CB  . LYS A 1 536 ? 95.573  127.578 83.887  1.00 34.75  ? 536 LYS A CB  1 
ATOM   4226  C  CG  . LYS A 1 536 ? 97.051  127.307 83.930  1.00 34.75  ? 536 LYS A CG  1 
ATOM   4227  C  CD  . LYS A 1 536 ? 97.382  126.230 84.935  1.00 34.75  ? 536 LYS A CD  1 
ATOM   4228  C  CE  . LYS A 1 536 ? 96.649  124.945 84.616  1.00 34.75  ? 536 LYS A CE  1 
ATOM   4229  N  NZ  . LYS A 1 536 ? 96.849  123.946 85.681  1.00 34.75  ? 536 LYS A NZ  1 
ATOM   4230  N  N   . MET A 1 537 ? 94.299  127.491 80.890  1.00 35.56  ? 537 MET A N   1 
ATOM   4231  C  CA  . MET A 1 537 ? 94.444  126.973 79.537  1.00 35.56  ? 537 MET A CA  1 
ATOM   4232  C  C   . MET A 1 537 ? 94.130  128.014 78.477  1.00 35.56  ? 537 MET A C   1 
ATOM   4233  O  O   . MET A 1 537 ? 94.435  127.803 77.301  1.00 35.56  ? 537 MET A O   1 
ATOM   4234  C  CB  . MET A 1 537 ? 93.579  125.737 79.348  1.00 35.56  ? 537 MET A CB  1 
ATOM   4235  C  CG  . MET A 1 537 ? 93.904  124.654 80.335  1.00 35.56  ? 537 MET A CG  1 
ATOM   4236  S  SD  . MET A 1 537 ? 95.661  124.317 80.411  1.00 35.56  ? 537 MET A SD  1 
ATOM   4237  C  CE  . MET A 1 537 ? 95.964  123.619 78.805  1.00 35.56  ? 537 MET A CE  1 
ATOM   4238  N  N   . CYS A 1 538 ? 93.531  129.133 78.858  1.00 43.87  ? 538 CYS A N   1 
ATOM   4239  C  CA  . CYS A 1 538 ? 92.978  130.052 77.879  1.00 43.87  ? 538 CYS A CA  1 
ATOM   4240  C  C   . CYS A 1 538 ? 93.862  131.274 77.709  1.00 43.87  ? 538 CYS A C   1 
ATOM   4241  O  O   . CYS A 1 538 ? 94.149  131.682 76.584  1.00 43.87  ? 538 CYS A O   1 
ATOM   4242  C  CB  . CYS A 1 538 ? 91.573  130.473 78.284  1.00 43.87  ? 538 CYS A CB  1 
ATOM   4243  S  SG  . CYS A 1 538 ? 90.314  129.287 77.828  1.00 43.87  ? 538 CYS A SG  1 
ATOM   4244  N  N   . ARG A 1 539 ? 94.294  131.872 78.802  1.00 46.82  ? 539 ARG A N   1 
ATOM   4245  C  CA  . ARG A 1 539 ? 95.023  133.119 78.722  1.00 46.82  ? 539 ARG A CA  1 
ATOM   4246  C  C   . ARG A 1 539 ? 96.406  133.055 79.332  1.00 46.82  ? 539 ARG A C   1 
ATOM   4247  O  O   . ARG A 1 539 ? 97.037  134.102 79.477  1.00 46.82  ? 539 ARG A O   1 
ATOM   4248  C  CB  . ARG A 1 539 ? 94.271  134.227 79.460  1.00 46.82  ? 539 ARG A CB  1 
ATOM   4249  C  CG  . ARG A 1 539 ? 92.894  134.567 78.982  1.00 46.82  ? 539 ARG A CG  1 
ATOM   4250  C  CD  . ARG A 1 539 ? 92.880  135.126 77.598  1.00 46.82  ? 539 ARG A CD  1 
ATOM   4251  N  NE  . ARG A 1 539 ? 91.540  135.031 77.050  1.00 46.82  ? 539 ARG A NE  1 
ATOM   4252  C  CZ  . ARG A 1 539 ? 91.211  135.443 75.839  1.00 46.82  ? 539 ARG A CZ  1 
ATOM   4253  N  NH1 . ARG A 1 539 ? 92.135  135.977 75.059  1.00 46.82  ? 539 ARG A NH1 1 
ATOM   4254  N  NH2 . ARG A 1 539 ? 89.963  135.329 75.415  1.00 46.82  ? 539 ARG A NH2 1 
ATOM   4255  N  N   . VAL A 1 540 ? 96.903  131.885 79.698  1.00 38.71  ? 540 VAL A N   1 
ATOM   4256  C  CA  . VAL A 1 540 ? 98.173  131.780 80.398  1.00 38.71  ? 540 VAL A CA  1 
ATOM   4257  C  C   . VAL A 1 540 ? 99.218  131.047 79.577  1.00 38.71  ? 540 VAL A C   1 
ATOM   4258  O  O   . VAL A 1 540 ? 100.330 131.539 79.386  1.00 38.71  ? 540 VAL A O   1 
ATOM   4259  C  CB  . VAL A 1 540 ? 97.994  131.091 81.758  1.00 38.71  ? 540 VAL A CB  1 
ATOM   4260  C  CG1 . VAL A 1 540 ? 99.317  130.992 82.462  1.00 38.71  ? 540 VAL A CG1 1 
ATOM   4261  C  CG2 . VAL A 1 540 ? 97.003  131.842 82.586  1.00 38.71  ? 540 VAL A CG2 1 
ATOM   4262  N  N   . PHE A 1 541 ? 98.862  129.898 79.040  1.00 36.00  ? 541 PHE A N   1 
ATOM   4263  C  CA  . PHE A 1 541 ? 99.823  129.015 78.409  1.00 36.00  ? 541 PHE A CA  1 
ATOM   4264  C  C   . PHE A 1 541 ? 99.699  129.084 76.899  1.00 36.00  ? 541 PHE A C   1 
ATOM   4265  O  O   . PHE A 1 541 ? 98.755  129.656 76.355  1.00 36.00  ? 541 PHE A O   1 
ATOM   4266  C  CB  . PHE A 1 541 ? 99.628  127.585 78.908  1.00 36.00  ? 541 PHE A CB  1 
ATOM   4267  C  CG  . PHE A 1 541 ? 100.215 127.350 80.260  1.00 36.00  ? 541 PHE A CG  1 
ATOM   4268  C  CD1 . PHE A 1 541 ? 101.346 128.030 80.663  1.00 36.00  ? 541 PHE A CD1 1 
ATOM   4269  C  CD2 . PHE A 1 541 ? 99.622  126.476 81.141  1.00 36.00  ? 541 PHE A CD2 1 
ATOM   4270  C  CE1 . PHE A 1 541 ? 101.884 127.828 81.921  1.00 36.00  ? 541 PHE A CE1 1 
ATOM   4271  C  CE2 . PHE A 1 541 ? 100.155 126.270 82.399  1.00 36.00  ? 541 PHE A CE2 1 
ATOM   4272  C  CZ  . PHE A 1 541 ? 101.287 126.948 82.787  1.00 36.00  ? 541 PHE A CZ  1 
ATOM   4273  N  N   . LYS A 1 542 ? 100.673 128.484 76.220  1.00 40.25  ? 542 LYS A N   1 
ATOM   4274  C  CA  . LYS A 1 542 ? 100.489 128.251 74.803  1.00 40.25  ? 542 LYS A CA  1 
ATOM   4275  C  C   . LYS A 1 542 ? 99.409  127.204 74.607  1.00 40.25  ? 542 LYS A C   1 
ATOM   4276  O  O   . LYS A 1 542 ? 99.011  126.501 75.537  1.00 40.25  ? 542 LYS A O   1 
ATOM   4277  C  CB  . LYS A 1 542 ? 101.761 127.706 74.170  1.00 40.25  ? 542 LYS A CB  1 
ATOM   4278  C  CG  . LYS A 1 542 ? 102.892 128.655 74.035  1.00 40.25  ? 542 LYS A CG  1 
ATOM   4279  C  CD  . LYS A 1 542 ? 104.076 127.896 73.495  1.00 40.25  ? 542 LYS A CD  1 
ATOM   4280  C  CE  . LYS A 1 542 ? 105.373 128.539 73.900  1.00 40.25  ? 542 LYS A CE  1 
ATOM   4281  N  NZ  . LYS A 1 542 ? 106.495 127.592 73.716  1.00 40.25  ? 542 LYS A NZ  1 
ATOM   4282  N  N   . ARG A 1 543 ? 98.948  127.080 73.387  1.00 38.02  ? 543 ARG A N   1 
ATOM   4283  C  CA  . ARG A 1 543 ? 98.021  126.010 73.089  1.00 38.02  ? 543 ARG A CA  1 
ATOM   4284  C  C   . ARG A 1 543 ? 98.794  124.706 73.107  1.00 38.02  ? 543 ARG A C   1 
ATOM   4285  O  O   . ARG A 1 543 ? 99.805  124.595 72.413  1.00 38.02  ? 543 ARG A O   1 
ATOM   4286  C  CB  . ARG A 1 543 ? 97.350  126.225 71.764  1.00 38.02  ? 543 ARG A CB  1 
ATOM   4287  C  CG  . ARG A 1 543 ? 96.306  125.207 71.485  1.00 38.02  ? 543 ARG A CG  1 
ATOM   4288  C  CD  . ARG A 1 543 ? 95.552  125.672 70.301  1.00 38.02  ? 543 ARG A CD  1 
ATOM   4289  N  NE  . ARG A 1 543 ? 94.436  124.812 69.987  1.00 38.02  ? 543 ARG A NE  1 
ATOM   4290  C  CZ  . ARG A 1 543 ? 93.463  125.192 69.180  1.00 38.02  ? 543 ARG A CZ  1 
ATOM   4291  N  NH1 . ARG A 1 543 ? 93.509  126.400 68.640  1.00 38.02  ? 543 ARG A NH1 1 
ATOM   4292  N  NH2 . ARG A 1 543 ? 92.449  124.383 68.926  1.00 38.02  ? 543 ARG A NH2 1 
ATOM   4293  N  N   . PRO A 1 544 ? 98.413  123.737 73.912  1.00 31.37  ? 544 PRO A N   1 
ATOM   4294  C  CA  . PRO A 1 544 ? 99.098  122.453 73.860  1.00 31.37  ? 544 PRO A CA  1 
ATOM   4295  C  C   . PRO A 1 544 ? 98.707  121.712 72.604  1.00 31.37  ? 544 PRO A C   1 
ATOM   4296  O  O   . PRO A 1 544 ? 97.632  121.925 72.043  1.00 31.37  ? 544 PRO A O   1 
ATOM   4297  C  CB  . PRO A 1 544 ? 98.574  121.730 75.096  1.00 31.37  ? 544 PRO A CB  1 
ATOM   4298  C  CG  . PRO A 1 544 ? 97.232  122.312 75.290  1.00 31.37  ? 544 PRO A CG  1 
ATOM   4299  C  CD  . PRO A 1 544 ? 97.330  123.741 74.897  1.00 31.37  ? 544 PRO A CD  1 
ATOM   4300  N  N   . PHE A 1 545 ? 99.610  120.865 72.135  1.00 35.34  ? 545 PHE A N   1 
ATOM   4301  C  CA  . PHE A 1 545 ? 99.282  120.001 71.016  1.00 35.34  ? 545 PHE A CA  1 
ATOM   4302  C  C   . PHE A 1 545 ? 98.296  118.942 71.474  1.00 35.34  ? 545 PHE A C   1 
ATOM   4303  O  O   . PHE A 1 545 ? 98.394  118.435 72.592  1.00 35.34  ? 545 PHE A O   1 
ATOM   4304  C  CB  . PHE A 1 545 ? 100.532 119.353 70.455  1.00 35.34  ? 545 PHE A CB  1 
ATOM   4305  C  CG  . PHE A 1 545 ? 101.149 120.124 69.349  1.00 35.34  ? 545 PHE A CG  1 
ATOM   4306  C  CD1 . PHE A 1 545 ? 100.408 120.471 68.248  1.00 35.34  ? 545 PHE A CD1 1 
ATOM   4307  C  CD2 . PHE A 1 545 ? 102.473 120.488 69.399  1.00 35.34  ? 545 PHE A CD2 1 
ATOM   4308  C  CE1 . PHE A 1 545 ? 100.972 121.180 67.224  1.00 35.34  ? 545 PHE A CE1 1 
ATOM   4309  C  CE2 . PHE A 1 545 ? 103.043 121.196 68.370  1.00 35.34  ? 545 PHE A CE2 1 
ATOM   4310  C  CZ  . PHE A 1 545 ? 102.294 121.533 67.280  1.00 35.34  ? 545 PHE A CZ  1 
ATOM   4311  N  N   . SER A 1 546 ? 97.335  118.628 70.627  1.00 37.97  ? 546 SER A N   1 
ATOM   4312  C  CA  . SER A 1 546 ? 96.328  117.639 70.968  1.00 37.97  ? 546 SER A CA  1 
ATOM   4313  C  C   . SER A 1 546 ? 96.933  116.248 71.056  1.00 37.97  ? 546 SER A C   1 
ATOM   4314  O  O   . SER A 1 546 ? 97.631  115.813 70.141  1.00 37.97  ? 546 SER A O   1 
ATOM   4315  C  CB  . SER A 1 546 ? 95.225  117.651 69.925  1.00 37.97  ? 546 SER A CB  1 
ATOM   4316  O  OG  . SER A 1 546 ? 94.481  116.451 69.985  1.00 37.97  ? 546 SER A OG  1 
ATOM   4317  N  N   . GLU A 1 547 ? 96.688  115.553 72.160  1.00 35.44  ? 547 GLU A N   1 
ATOM   4318  C  CA  . GLU A 1 547 ? 97.247  114.224 72.333  1.00 35.44  ? 547 GLU A CA  1 
ATOM   4319  C  C   . GLU A 1 547 ? 96.139  113.237 72.660  1.00 35.44  ? 547 GLU A C   1 
ATOM   4320  O  O   . GLU A 1 547 ? 95.397  113.441 73.621  1.00 35.44  ? 547 GLU A O   1 
ATOM   4321  C  CB  . GLU A 1 547 ? 98.295  114.177 73.442  1.00 35.44  ? 547 GLU A CB  1 
ATOM   4322  C  CG  . GLU A 1 547 ? 99.667  114.615 73.010  1.00 35.44  ? 547 GLU A CG  1 
ATOM   4323  C  CD  . GLU A 1 547 ? 100.582 114.859 74.183  1.00 35.44  ? 547 GLU A CD  1 
ATOM   4324  O  OE1 . GLU A 1 547 ? 100.286 114.335 75.275  1.00 35.44  ? 547 GLU A OE1 1 
ATOM   4325  O  OE2 . GLU A 1 547 ? 101.591 115.574 74.018  1.00 35.44  ? 547 GLU A OE2 1 
ATOM   4326  N  N   . PRO A 1 548 ? 95.987  112.180 71.879  1.00 29.13  ? 548 PRO A N   1 
ATOM   4327  C  CA  . PRO A 1 548 ? 94.961  111.182 72.178  1.00 29.13  ? 548 PRO A CA  1 
ATOM   4328  C  C   . PRO A 1 548 ? 95.318  110.327 73.374  1.00 29.13  ? 548 PRO A C   1 
ATOM   4329  O  O   . PRO A 1 548 ? 96.456  109.889 73.534  1.00 29.13  ? 548 PRO A O   1 
ATOM   4330  C  CB  . PRO A 1 548 ? 94.920  110.335 70.907  1.00 29.13  ? 548 PRO A CB  1 
ATOM   4331  C  CG  . PRO A 1 548 ? 95.622  111.145 69.888  1.00 29.13  ? 548 PRO A CG  1 
ATOM   4332  C  CD  . PRO A 1 548 ? 96.655  111.907 70.611  1.00 29.13  ? 548 PRO A CD  1 
ATOM   4333  N  N   . SER A 1 549 ? 94.314  110.084 74.208  1.00 28.71  ? 549 SER A N   1 
ATOM   4334  C  CA  . SER A 1 549 ? 94.429  109.259 75.400  1.00 28.71  ? 549 SER A CA  1 
ATOM   4335  C  C   . SER A 1 549 ? 93.087  108.596 75.640  1.00 28.71  ? 549 SER A C   1 
ATOM   4336  O  O   . SER A 1 549 ? 92.049  109.245 75.527  1.00 28.71  ? 549 SER A O   1 
ATOM   4337  C  CB  . SER A 1 549 ? 94.829  110.069 76.628  1.00 28.71  ? 549 SER A CB  1 
ATOM   4338  O  OG  . SER A 1 549 ? 93.696  110.299 77.439  1.00 28.71  ? 549 SER A OG  1 
ATOM   4339  N  N   . ALA A 1 550 ? 93.107  107.318 75.992  1.00 25.19  ? 550 ALA A N   1 
ATOM   4340  C  CA  . ALA A 1 550 ? 91.868  106.580 76.177  1.00 25.19  ? 550 ALA A CA  1 
ATOM   4341  C  C   . ALA A 1 550 ? 91.399  106.560 77.614  1.00 25.19  ? 550 ALA A C   1 
ATOM   4342  O  O   . ALA A 1 550 ? 90.231  106.266 77.867  1.00 25.19  ? 550 ALA A O   1 
ATOM   4343  C  CB  . ALA A 1 550 ? 92.033  105.135 75.704  1.00 25.19  ? 550 ALA A CB  1 
ATOM   4344  N  N   . ASN A 1 551 ? 92.277  106.857 78.549  1.00 22.70  ? 551 ASN A N   1 
ATOM   4345  C  CA  . ASN A 1 551 ? 91.928  106.872 79.951  1.00 22.70  ? 551 ASN A CA  1 
ATOM   4346  C  C   . ASN A 1 551 ? 92.859  107.859 80.627  1.00 22.70  ? 551 ASN A C   1 
ATOM   4347  O  O   . ASN A 1 551 ? 93.729  108.454 79.991  1.00 22.70  ? 551 ASN A O   1 
ATOM   4348  C  CB  . ASN A 1 551 ? 91.978  105.470 80.555  1.00 22.70  ? 551 ASN A CB  1 
ATOM   4349  C  CG  . ASN A 1 551 ? 93.260  104.743 80.247  1.00 22.70  ? 551 ASN A CG  1 
ATOM   4350  O  OD1 . ASN A 1 551 ? 94.173  105.290 79.639  1.00 22.70  ? 551 ASN A OD1 1 
ATOM   4351  N  ND2 . ASN A 1 551 ? 93.340  103.492 80.678  1.00 22.70  ? 551 ASN A ND2 1 
ATOM   4352  N  N   . ILE A 1 552 ? 92.681  108.028 81.930  1.00 16.18  ? 552 ILE A N   1 
ATOM   4353  C  CA  . ILE A 1 552 ? 93.607  108.874 82.652  1.00 16.18  ? 552 ILE A CA  1 
ATOM   4354  C  C   . ILE A 1 552 ? 94.931  108.171 82.879  1.00 16.18  ? 552 ILE A C   1 
ATOM   4355  O  O   . ILE A 1 552 ? 95.936  108.833 83.147  1.00 16.18  ? 552 ILE A O   1 
ATOM   4356  C  CB  . ILE A 1 552 ? 92.966  109.322 83.965  1.00 16.18  ? 552 ILE A CB  1 
ATOM   4357  C  CG1 . ILE A 1 552 ? 92.490  108.109 84.721  1.00 16.18  ? 552 ILE A CG1 1 
ATOM   4358  C  CG2 . ILE A 1 552 ? 91.778  110.153 83.681  1.00 16.18  ? 552 ILE A CG2 1 
ATOM   4359  C  CD1 . ILE A 1 552 ? 91.982  108.429 86.068  1.00 16.18  ? 552 ILE A CD1 1 
ATOM   4360  N  N   . GLY A 1 553 ? 94.974  106.854 82.758  1.00 19.94  ? 553 GLY A N   1 
ATOM   4361  C  CA  . GLY A 1 553 ? 96.249  106.176 82.747  1.00 19.94  ? 553 GLY A CA  1 
ATOM   4362  C  C   . GLY A 1 553 ? 96.584  105.508 84.057  1.00 19.94  ? 553 GLY A C   1 
ATOM   4363  O  O   . GLY A 1 553 ? 95.835  104.657 84.537  1.00 19.94  ? 553 GLY A O   1 
ATOM   4364  N  N   . VAL A 1 554 ? 97.723  105.869 84.643  1.00 14.40  ? 554 VAL A N   1 
ATOM   4365  C  CA  . VAL A 1 554 ? 98.114  105.261 85.906  1.00 14.40  ? 554 VAL A CA  1 
ATOM   4366  C  C   . VAL A 1 554 ? 97.440  105.951 87.073  1.00 14.40  ? 554 VAL A C   1 
ATOM   4367  O  O   . VAL A 1 554 ? 97.495  105.452 88.199  1.00 14.40  ? 554 VAL A O   1 
ATOM   4368  C  CB  . VAL A 1 554 ? 99.646  105.321 86.025  1.00 14.40  ? 554 VAL A CB  1 
ATOM   4369  C  CG1 . VAL A 1 554 ? 100.064 106.696 86.362  1.00 14.40  ? 554 VAL A CG1 1 
ATOM   4370  C  CG2 . VAL A 1 554 ? 100.205 104.309 87.008  1.00 14.40  ? 554 VAL A CG2 1 
ATOM   4371  N  N   . TRP A 1 555 ? 96.714  107.034 86.823  1.00 14.17  ? 555 TRP A N   1 
ATOM   4372  C  CA  . TRP A 1 555 ? 96.060  107.717 87.923  1.00 14.17  ? 555 TRP A CA  1 
ATOM   4373  C  C   . TRP A 1 555 ? 94.872  106.964 88.470  1.00 14.17  ? 555 TRP A C   1 
ATOM   4374  O  O   . TRP A 1 555 ? 94.465  107.237 89.598  1.00 14.17  ? 555 TRP A O   1 
ATOM   4375  C  CB  . TRP A 1 555 ? 95.645  109.098 87.482  1.00 14.17  ? 555 TRP A CB  1 
ATOM   4376  C  CG  . TRP A 1 555 ? 96.796  109.988 87.382  1.00 14.17  ? 555 TRP A CG  1 
ATOM   4377  C  CD1 . TRP A 1 555 ? 97.352  110.478 86.256  1.00 14.17  ? 555 TRP A CD1 1 
ATOM   4378  C  CD2 . TRP A 1 555 ? 97.513  110.548 88.461  1.00 14.17  ? 555 TRP A CD2 1 
ATOM   4379  N  NE1 . TRP A 1 555 ? 98.397  111.292 86.564  1.00 14.17  ? 555 TRP A NE1 1 
ATOM   4380  C  CE2 . TRP A 1 555 ? 98.509  111.351 87.922  1.00 14.17  ? 555 TRP A CE2 1 
ATOM   4381  C  CE3 . TRP A 1 555 ? 97.415  110.438 89.836  1.00 14.17  ? 555 TRP A CE3 1 
ATOM   4382  C  CZ2 . TRP A 1 555 ? 99.398  112.035 88.703  1.00 14.17  ? 555 TRP A CZ2 1 
ATOM   4383  C  CZ3 . TRP A 1 555 ? 98.292  111.112 90.606  1.00 14.17  ? 555 TRP A CZ3 1 
ATOM   4384  C  CH2 . TRP A 1 555 ? 99.270  111.906 90.047  1.00 14.17  ? 555 TRP A CH2 1 
ATOM   4385  N  N   . GLN A 1 556 ? 94.291  106.053 87.701  1.00 15.06  ? 556 GLN A N   1 
ATOM   4386  C  CA  . GLN A 1 556 ? 93.234  105.221 88.252  1.00 15.06  ? 556 GLN A CA  1 
ATOM   4387  C  C   . GLN A 1 556 ? 93.770  104.323 89.350  1.00 15.06  ? 556 GLN A C   1 
ATOM   4388  O  O   . GLN A 1 556 ? 93.108  104.107 90.369  1.00 15.06  ? 556 GLN A O   1 
ATOM   4389  C  CB  . GLN A 1 556 ? 92.574  104.393 87.166  1.00 15.06  ? 556 GLN A CB  1 
ATOM   4390  C  CG  . GLN A 1 556 ? 91.337  103.800 87.678  1.00 15.06  ? 556 GLN A CG  1 
ATOM   4391  C  CD  . GLN A 1 556 ? 90.257  104.797 87.681  1.00 15.06  ? 556 GLN A CD  1 
ATOM   4392  O  OE1 . GLN A 1 556 ? 90.244  105.704 86.863  1.00 15.06  ? 556 GLN A OE1 1 
ATOM   4393  N  NE2 . GLN A 1 556 ? 89.366  104.688 88.643  1.00 15.06  ? 556 GLN A NE2 1 
ATOM   4394  N  N   . LEU A 1 557 ? 94.960  103.771 89.147  1.00 13.25  ? 557 LEU A N   1 
ATOM   4395  C  CA  . LEU A 1 557 ? 95.568  102.969 90.193  1.00 13.25  ? 557 LEU A CA  1 
ATOM   4396  C  C   . LEU A 1 557 ? 95.951  103.808 91.402  1.00 13.25  ? 557 LEU A C   1 
ATOM   4397  O  O   . LEU A 1 557 ? 95.824  103.342 92.537  1.00 13.25  ? 557 LEU A O   1 
ATOM   4398  C  CB  . LEU A 1 557 ? 96.774  102.233 89.630  1.00 13.25  ? 557 LEU A CB  1 
ATOM   4399  C  CG  . LEU A 1 557 ? 97.524  101.333 90.589  1.00 13.25  ? 557 LEU A CG  1 
ATOM   4400  C  CD1 . LEU A 1 557 ? 96.626  100.215 90.967  1.00 13.25  ? 557 LEU A CD1 1 
ATOM   4401  C  CD2 . LEU A 1 557 ? 98.704  100.784 89.876  1.00 13.25  ? 557 LEU A CD2 1 
ATOM   4402  N  N   . ALA A 1 558 ? 96.389  105.046 91.193  1.00 12.20  ? 558 ALA A N   1 
ATOM   4403  C  CA  . ALA A 1 558 ? 96.759  105.886 92.326  1.00 12.20  ? 558 ALA A CA  1 
ATOM   4404  C  C   . ALA A 1 558 ? 95.555  106.314 93.149  1.00 12.20  ? 558 ALA A C   1 
ATOM   4405  O  O   . ALA A 1 558 ? 95.623  106.327 94.378  1.00 12.20  ? 558 ALA A O   1 
ATOM   4406  C  CB  . ALA A 1 558 ? 97.532  107.108 91.856  1.00 12.20  ? 558 ALA A CB  1 
ATOM   4407  N  N   . PHE A 1 559 ? 94.454  106.681 92.500  1.00 16.79  ? 559 PHE A N   1 
ATOM   4408  C  CA  . PHE A 1 559 ? 93.266  107.063 93.254  1.00 16.79  ? 559 PHE A CA  1 
ATOM   4409  C  C   . PHE A 1 559 ? 92.632  105.882 93.961  1.00 16.79  ? 559 PHE A C   1 
ATOM   4410  O  O   . PHE A 1 559 ? 92.067  106.046 95.041  1.00 16.79  ? 559 PHE A O   1 
ATOM   4411  C  CB  . PHE A 1 559 ? 92.234  107.728 92.364  1.00 16.79  ? 559 PHE A CB  1 
ATOM   4412  C  CG  . PHE A 1 559 ? 92.448  109.180 92.193  1.00 16.79  ? 559 PHE A CG  1 
ATOM   4413  C  CD1 . PHE A 1 559 ? 91.957  110.063 93.108  1.00 16.79  ? 559 PHE A CD1 1 
ATOM   4414  C  CD2 . PHE A 1 559 ? 93.078  109.665 91.080  1.00 16.79  ? 559 PHE A CD2 1 
ATOM   4415  C  CE1 . PHE A 1 559 ? 92.156  111.401 92.950  1.00 16.79  ? 559 PHE A CE1 1 
ATOM   4416  C  CE2 . PHE A 1 559 ? 93.261  110.995 90.916  1.00 16.79  ? 559 PHE A CE2 1 
ATOM   4417  C  CZ  . PHE A 1 559 ? 92.804  111.864 91.851  1.00 16.79  ? 559 PHE A CZ  1 
ATOM   4418  N  N   . GLU A 1 560 ? 92.677  104.701 93.360  1.00 16.91  ? 560 GLU A N   1 
ATOM   4419  C  CA  . GLU A 1 560 ? 92.158  103.517 94.030  1.00 16.91  ? 560 GLU A CA  1 
ATOM   4420  C  C   . GLU A 1 560 ? 93.028  103.093 95.204  1.00 16.91  ? 560 GLU A C   1 
ATOM   4421  O  O   . GLU A 1 560 ? 92.502  102.636 96.222  1.00 16.91  ? 560 GLU A O   1 
ATOM   4422  C  CB  . GLU A 1 560 ? 91.986  102.382 93.025  1.00 16.91  ? 560 GLU A CB  1 
ATOM   4423  C  CG  . GLU A 1 560 ? 91.657  101.016 93.613  1.00 16.91  ? 560 GLU A CG  1 
ATOM   4424  C  CD  . GLU A 1 560 ? 90.223  100.857 94.121  1.00 16.91  ? 560 GLU A CD  1 
ATOM   4425  O  OE1 . GLU A 1 560 ? 89.455  101.834 94.187  1.00 16.91  ? 560 GLU A OE1 1 
ATOM   4426  O  OE2 . GLU A 1 560 ? 89.857  99.717  94.467  1.00 16.91  ? 560 GLU A OE2 1 
ATOM   4427  N  N   . THR A 1 561 ? 94.338  103.304 95.117  1.00 17.23  ? 561 THR A N   1 
ATOM   4428  C  CA  . THR A 1 561 ? 95.225  102.987 96.233  1.00 17.23  ? 561 THR A CA  1 
ATOM   4429  C  C   . THR A 1 561 ? 94.968  103.919 97.404  1.00 17.23  ? 561 THR A C   1 
ATOM   4430  O  O   . THR A 1 561 ? 95.071  103.512 98.566  1.00 17.23  ? 561 THR A O   1 
ATOM   4431  C  CB  . THR A 1 561 ? 96.672  103.070 95.778  1.00 17.23  ? 561 THR A CB  1 
ATOM   4432  O  OG1 . THR A 1 561 ? 96.834  102.230 94.635  1.00 17.23  ? 561 THR A OG1 1 
ATOM   4433  C  CG2 . THR A 1 561 ? 97.619  102.604 96.854  1.00 17.23  ? 561 THR A CG2 1 
ATOM   4434  N  N   . MET A 1 562 ? 94.619  105.168 97.118  1.00 19.32  ? 562 MET A N   1 
ATOM   4435  C  CA  . MET A 1 562 ? 94.206  106.076 98.176  1.00 19.32  ? 562 MET A CA  1 
ATOM   4436  C  C   . MET A 1 562 ? 92.935  105.586 98.856  1.00 19.32  ? 562 MET A C   1 
ATOM   4437  O  O   . MET A 1 562 ? 92.839  105.602 100.085 1.00 19.32  ? 562 MET A O   1 
ATOM   4438  C  CB  . MET A 1 562 ? 94.011  107.470 97.609  1.00 19.32  ? 562 MET A CB  1 
ATOM   4439  C  CG  . MET A 1 562 ? 93.477  108.429 98.596  1.00 19.32  ? 562 MET A CG  1 
ATOM   4440  S  SD  . MET A 1 562 ? 94.648  108.529 99.928  1.00 19.32  ? 562 MET A SD  1 
ATOM   4441  C  CE  . MET A 1 562 ? 95.935  109.421 99.122  1.00 19.32  ? 562 MET A CE  1 
ATOM   4442  N  N   . SER A 1 563 ? 91.974  105.094 98.088  1.00 18.51  ? 563 SER A N   1 
ATOM   4443  C  CA  . SER A 1 563 ? 90.763  104.583 98.709  1.00 18.51  ? 563 SER A CA  1 
ATOM   4444  C  C   . SER A 1 563 ? 90.958  103.284 99.479  1.00 18.51  ? 563 SER A C   1 
ATOM   4445  O  O   . SER A 1 563 ? 90.079  102.933 100.264 1.00 18.51  ? 563 SER A O   1 
ATOM   4446  C  CB  . SER A 1 563 ? 89.679  104.368 97.672  1.00 18.51  ? 563 SER A CB  1 
ATOM   4447  O  OG  . SER A 1 563 ? 88.749  103.425 98.158  1.00 18.51  ? 563 SER A OG  1 
ATOM   4448  N  N   . VAL A 1 564 ? 92.036  102.542 99.258  1.00 18.43  ? 564 VAL A N   1 
ATOM   4449  C  CA  . VAL A 1 564 ? 92.293  101.356 100.072 1.00 18.43  ? 564 VAL A CA  1 
ATOM   4450  C  C   . VAL A 1 564 ? 93.064  101.716 101.330 1.00 18.43  ? 564 VAL A C   1 
ATOM   4451  O  O   . VAL A 1 564 ? 92.740  101.232 102.416 1.00 18.43  ? 564 VAL A O   1 
ATOM   4452  C  CB  . VAL A 1 564 ? 93.008  100.282 99.239  1.00 18.43  ? 564 VAL A CB  1 
ATOM   4453  C  CG1 . VAL A 1 564 ? 93.695  99.277  100.099 1.00 18.43  ? 564 VAL A CG1 1 
ATOM   4454  C  CG2 . VAL A 1 564 ? 91.994  99.562  98.429  1.00 18.43  ? 564 VAL A CG2 1 
ATOM   4455  N  N   . ILE A 1 565 ? 94.041  102.616 101.209 1.00 19.24  ? 565 ILE A N   1 
ATOM   4456  C  CA  . ILE A 1 565 ? 94.773  103.123 102.367 1.00 19.24  ? 565 ILE A CA  1 
ATOM   4457  C  C   . ILE A 1 565 ? 93.839  103.864 103.304 1.00 19.24  ? 565 ILE A C   1 
ATOM   4458  O  O   . ILE A 1 565 ? 93.975  103.775 104.528 1.00 19.24  ? 565 ILE A O   1 
ATOM   4459  C  CB  . ILE A 1 565 ? 95.958  103.979 101.890 1.00 19.24  ? 565 ILE A CB  1 
ATOM   4460  C  CG1 . ILE A 1 565 ? 97.011  103.055 101.306 1.00 19.24  ? 565 ILE A CG1 1 
ATOM   4461  C  CG2 . ILE A 1 565 ? 96.546  104.832 102.979 1.00 19.24  ? 565 ILE A CG2 1 
ATOM   4462  C  CD1 . ILE A 1 565 ? 98.121  103.767 100.644 1.00 19.24  ? 565 ILE A CD1 1 
ATOM   4463  N  N   . SER A 1 566 ? 92.833  104.534 102.761 1.00 22.84  ? 566 SER A N   1 
ATOM   4464  C  CA  . SER A 1 566 ? 91.922  105.269 103.614 1.00 22.84  ? 566 SER A CA  1 
ATOM   4465  C  C   . SER A 1 566 ? 91.037  104.366 104.454 1.00 22.84  ? 566 SER A C   1 
ATOM   4466  O  O   . SER A 1 566 ? 90.470  104.837 105.437 1.00 22.84  ? 566 SER A O   1 
ATOM   4467  C  CB  . SER A 1 566 ? 91.046  106.170 102.779 1.00 22.84  ? 566 SER A CB  1 
ATOM   4468  O  OG  . SER A 1 566 ? 90.298  105.398 101.873 1.00 22.84  ? 566 SER A OG  1 
ATOM   4469  N  N   . VAL A 1 567 ? 90.875  103.102 104.084 1.00 24.22  ? 567 VAL A N   1 
ATOM   4470  C  CA  . VAL A 1 567 ? 90.160  102.176 104.951 1.00 24.22  ? 567 VAL A CA  1 
ATOM   4471  C  C   . VAL A 1 567 ? 90.941  101.942 106.233 1.00 24.22  ? 567 VAL A C   1 
ATOM   4472  O  O   . VAL A 1 567 ? 90.390  102.032 107.336 1.00 24.22  ? 567 VAL A O   1 
ATOM   4473  C  CB  . VAL A 1 567 ? 89.857  100.864 104.220 1.00 24.22  ? 567 VAL A CB  1 
ATOM   4474  C  CG1 . VAL A 1 567 ? 89.472  99.800  105.190 1.00 24.22  ? 567 VAL A CG1 1 
ATOM   4475  C  CG2 . VAL A 1 567 ? 88.707  101.083 103.320 1.00 24.22  ? 567 VAL A CG2 1 
ATOM   4476  N  N   . VAL A 1 568 ? 92.236  101.651 106.105 1.00 23.05  ? 568 VAL A N   1 
ATOM   4477  C  CA  . VAL A 1 568 ? 93.077  101.406 107.273 1.00 23.05  ? 568 VAL A CA  1 
ATOM   4478  C  C   . VAL A 1 568 ? 93.213  102.650 108.142 1.00 23.05  ? 568 VAL A C   1 
ATOM   4479  O  O   . VAL A 1 568 ? 93.174  102.563 109.374 1.00 23.05  ? 568 VAL A O   1 
ATOM   4480  C  CB  . VAL A 1 568 ? 94.453  100.911 106.807 1.00 23.05  ? 568 VAL A CB  1 
ATOM   4481  C  CG1 . VAL A 1 568 ? 95.294  100.535 107.977 1.00 23.05  ? 568 VAL A CG1 1 
ATOM   4482  C  CG2 . VAL A 1 568 ? 94.289  99.750  105.885 1.00 23.05  ? 568 VAL A CG2 1 
ATOM   4483  N  N   . THR A 1 569 ? 93.348  103.824 107.531 1.00 29.10  ? 569 THR A N   1 
ATOM   4484  C  CA  . THR A 1 569 ? 93.496  105.033 108.330 1.00 29.10  ? 569 THR A CA  1 
ATOM   4485  C  C   . THR A 1 569 ? 92.200  105.416 109.027 1.00 29.10  ? 569 THR A C   1 
ATOM   4486  O  O   . THR A 1 569 ? 92.218  105.803 110.197 1.00 29.10  ? 569 THR A O   1 
ATOM   4487  C  CB  . THR A 1 569 ? 94.006  106.163 107.460 1.00 29.10  ? 569 THR A CB  1 
ATOM   4488  O  OG1 . THR A 1 569 ? 95.241  105.756 106.873 1.00 29.10  ? 569 THR A OG1 1 
ATOM   4489  C  CG2 . THR A 1 569 ? 94.275  107.377 108.285 1.00 29.10  ? 569 THR A CG2 1 
ATOM   4490  N  N   . ASN A 1 570 ? 91.064  105.269 108.351 1.00 32.05  ? 570 ASN A N   1 
ATOM   4491  C  CA  . ASN A 1 570 ? 89.790  105.578 108.991 1.00 32.05  ? 570 ASN A CA  1 
ATOM   4492  C  C   . ASN A 1 570 ? 89.454  104.590 110.093 1.00 32.05  ? 570 ASN A C   1 
ATOM   4493  O  O   . ASN A 1 570 ? 88.860  104.971 111.108 1.00 32.05  ? 570 ASN A O   1 
ATOM   4494  C  CB  . ASN A 1 570 ? 88.665  105.647 107.985 1.00 32.05  ? 570 ASN A CB  1 
ATOM   4495  C  CG  . ASN A 1 570 ? 88.517  107.006 107.421 1.00 32.05  ? 570 ASN A CG  1 
ATOM   4496  O  OD1 . ASN A 1 570 ? 89.161  107.939 107.877 1.00 32.05  ? 570 ASN A OD1 1 
ATOM   4497  N  ND2 . ASN A 1 570 ? 87.640  107.151 106.447 1.00 32.05  ? 570 ASN A ND2 1 
ATOM   4498  N  N   . CYS A 1 571 ? 89.809  103.322 109.916 1.00 34.93  ? 571 CYS A N   1 
ATOM   4499  C  CA  . CYS A 1 571 ? 89.529  102.359 110.968 1.00 34.93  ? 571 CYS A CA  1 
ATOM   4500  C  C   . CYS A 1 571 ? 90.450  102.576 112.155 1.00 34.93  ? 571 CYS A C   1 
ATOM   4501  O  O   . CYS A 1 571 ? 90.044  102.356 113.297 1.00 34.93  ? 571 CYS A O   1 
ATOM   4502  C  CB  . CYS A 1 571 ? 89.651  100.941 110.431 1.00 34.93  ? 571 CYS A CB  1 
ATOM   4503  S  SG  . CYS A 1 571 ? 88.266  100.466 109.386 1.00 34.93  ? 571 CYS A SG  1 
ATOM   4504  N  N   . ALA A 1 572 ? 91.679  103.017 111.916 1.00 33.83  ? 572 ALA A N   1 
ATOM   4505  C  CA  . ALA A 1 572 ? 92.542  103.367 113.031 1.00 33.83  ? 572 ALA A CA  1 
ATOM   4506  C  C   . ALA A 1 572 ? 92.082  104.626 113.744 1.00 33.83  ? 572 ALA A C   1 
ATOM   4507  O  O   . ALA A 1 572 ? 92.372  104.793 114.927 1.00 33.83  ? 572 ALA A O   1 
ATOM   4508  C  CB  . ALA A 1 572 ? 93.974  103.549 112.551 1.00 33.83  ? 572 ALA A CB  1 
ATOM   4509  N  N   . LEU A 1 573 ? 91.366  105.506 113.071 1.00 38.45  ? 573 LEU A N   1 
ATOM   4510  C  CA  . LEU A 1 573 ? 90.768  106.637 113.756 1.00 38.45  ? 573 LEU A CA  1 
ATOM   4511  C  C   . LEU A 1 573 ? 89.466  106.290 114.445 1.00 38.45  ? 573 LEU A C   1 
ATOM   4512  O  O   . LEU A 1 573 ? 89.067  107.003 115.369 1.00 38.45  ? 573 LEU A O   1 
ATOM   4513  C  CB  . LEU A 1 573 ? 90.559  107.815 112.815 1.00 38.45  ? 573 LEU A CB  1 
ATOM   4514  C  CG  . LEU A 1 573 ? 91.906  108.471 112.552 1.00 38.45  ? 573 LEU A CG  1 
ATOM   4515  C  CD1 . LEU A 1 573 ? 91.798  109.527 111.504 1.00 38.45  ? 573 LEU A CD1 1 
ATOM   4516  C  CD2 . LEU A 1 573 ? 92.429  109.066 113.811 1.00 38.45  ? 573 LEU A CD2 1 
ATOM   4517  N  N   . ILE A 1 574 ? 88.793  105.226 114.024 1.00 40.54  ? 574 ILE A N   1 
ATOM   4518  C  CA  . ILE A 1 574 ? 87.639  104.754 114.776 1.00 40.54  ? 574 ILE A CA  1 
ATOM   4519  C  C   . ILE A 1 574 ? 88.085  104.189 116.113 1.00 40.54  ? 574 ILE A C   1 
ATOM   4520  O  O   . ILE A 1 574 ? 87.540  104.538 117.165 1.00 40.54  ? 574 ILE A O   1 
ATOM   4521  C  CB  . ILE A 1 574 ? 86.866  103.711 113.959 1.00 40.54  ? 574 ILE A CB  1 
ATOM   4522  C  CG1 . ILE A 1 574 ? 86.093  104.393 112.850 1.00 40.54  ? 574 ILE A CG1 1 
ATOM   4523  C  CG2 . ILE A 1 574 ? 85.925  102.923 114.830 1.00 40.54  ? 574 ILE A CG2 1 
ATOM   4524  C  CD1 . ILE A 1 574 ? 85.621  103.432 111.818 1.00 40.54  ? 574 ILE A CD1 1 
ATOM   4525  N  N   . GLY A 1 575 ? 89.133  103.379 116.108 1.00 45.81  ? 575 GLY A N   1 
ATOM   4526  C  CA  . GLY A 1 575 ? 89.602  102.765 117.331 1.00 45.81  ? 575 GLY A CA  1 
ATOM   4527  C  C   . GLY A 1 575 ? 90.412  103.651 118.255 1.00 45.81  ? 575 GLY A C   1 
ATOM   4528  O  O   . GLY A 1 575 ? 91.197  103.149 119.061 1.00 45.81  ? 575 GLY A O   1 
ATOM   4529  N  N   . MET A 1 576 ? 90.266  104.964 118.134 1.00 54.24  ? 576 MET A N   1 
ATOM   4530  C  CA  . MET A 1 576 ? 90.886  105.883 119.063 1.00 54.24  ? 576 MET A CA  1 
ATOM   4531  C  C   . MET A 1 576 ? 89.951  106.950 119.582 1.00 54.24  ? 576 MET A C   1 
ATOM   4532  O  O   . MET A 1 576 ? 90.354  107.711 120.465 1.00 54.24  ? 576 MET A O   1 
ATOM   4533  C  CB  . MET A 1 576 ? 92.107  106.568 118.438 1.00 54.24  ? 576 MET A CB  1 
ATOM   4534  C  CG  . MET A 1 576 ? 93.296  105.658 118.271 1.00 54.24  ? 576 MET A CG  1 
ATOM   4535  S  SD  . MET A 1 576 ? 94.741  106.517 117.647 1.00 54.24  ? 576 MET A SD  1 
ATOM   4536  C  CE  . MET A 1 576 ? 95.868  105.140 117.507 1.00 54.24  ? 576 MET A CE  1 
ATOM   4537  N  N   . SER A 1 577 ? 88.737  107.036 119.082 1.00 58.28  ? 577 SER A N   1 
ATOM   4538  C  CA  . SER A 1 577 ? 87.836  108.080 119.528 1.00 58.28  ? 577 SER A CA  1 
ATOM   4539  C  C   . SER A 1 577 ? 87.287  107.757 120.915 1.00 58.28  ? 577 SER A C   1 
ATOM   4540  O  O   . SER A 1 577 ? 87.238  106.594 121.318 1.00 58.28  ? 577 SER A O   1 
ATOM   4541  C  CB  . SER A 1 577 ? 86.709  108.240 118.518 1.00 58.28  ? 577 SER A CB  1 
ATOM   4542  O  OG  . SER A 1 577 ? 86.204  106.978 118.134 1.00 58.28  ? 577 SER A OG  1 
ATOM   4543  N  N   . PRO A 1 578 ? 86.860  108.770 121.673 1.00 60.39  ? 578 PRO A N   1 
ATOM   4544  C  CA  . PRO A 1 578 ? 86.196  108.489 122.949 1.00 60.39  ? 578 PRO A CA  1 
ATOM   4545  C  C   . PRO A 1 578 ? 84.796  107.946 122.810 1.00 60.39  ? 578 PRO A C   1 
ATOM   4546  O  O   . PRO A 1 578 ? 84.229  107.516 123.817 1.00 60.39  ? 578 PRO A O   1 
ATOM   4547  C  CB  . PRO A 1 578 ? 86.179  109.850 123.642 1.00 60.39  ? 578 PRO A CB  1 
ATOM   4548  C  CG  . PRO A 1 578 ? 86.271  110.819 122.545 1.00 60.39  ? 578 PRO A CG  1 
ATOM   4549  C  CD  . PRO A 1 578 ? 87.153  110.201 121.525 1.00 60.39  ? 578 PRO A CD  1 
ATOM   4550  N  N   . GLN A 1 579 ? 84.209  107.945 121.620 1.00 72.06  ? 579 GLN A N   1 
ATOM   4551  C  CA  . GLN A 1 579 ? 82.869  107.389 121.502 1.00 72.06  ? 579 GLN A CA  1 
ATOM   4552  C  C   . GLN A 1 579 ? 82.922  105.875 121.477 1.00 72.06  ? 579 GLN A C   1 
ATOM   4553  O  O   . GLN A 1 579 ? 82.141  105.211 122.165 1.00 72.06  ? 579 GLN A O   1 
ATOM   4554  C  CB  . GLN A 1 579 ? 82.159  107.901 120.253 1.00 72.06  ? 579 GLN A CB  1 
ATOM   4555  C  CG  . GLN A 1 579 ? 82.437  109.330 119.896 1.00 72.06  ? 579 GLN A CG  1 
ATOM   4556  C  CD  . GLN A 1 579 ? 81.461  110.273 120.554 1.00 72.06  ? 579 GLN A CD  1 
ATOM   4557  O  OE1 . GLN A 1 579 ? 81.840  111.323 121.069 1.00 72.06  ? 579 GLN A OE1 1 
ATOM   4558  N  NE2 . GLN A 1 579 ? 80.186  109.907 120.526 1.00 72.06  ? 579 GLN A NE2 1 
ATOM   4559  N  N   . VAL A 1 580 ? 83.853  105.317 120.716 1.00 67.48  ? 580 VAL A N   1 
ATOM   4560  C  CA  . VAL A 1 580 ? 83.922  103.874 120.569 1.00 67.48  ? 580 VAL A CA  1 
ATOM   4561  C  C   . VAL A 1 580 ? 84.596  103.227 121.773 1.00 67.48  ? 580 VAL A C   1 
ATOM   4562  O  O   . VAL A 1 580 ? 84.254  102.099 122.141 1.00 67.48  ? 580 VAL A O   1 
ATOM   4563  C  CB  . VAL A 1 580 ? 84.648  103.544 119.258 1.00 67.48  ? 580 VAL A CB  1 
ATOM   4564  C  CG1 . VAL A 1 580 ? 84.626  102.060 118.964 1.00 67.48  ? 580 VAL A CG1 1 
ATOM   4565  C  CG2 . VAL A 1 580 ? 84.018  104.315 118.131 1.00 67.48  ? 580 VAL A CG2 1 
ATOM   4566  N  N   . ASN A 1 581 ? 85.505  103.936 122.441 1.00 73.27  ? 581 ASN A N   1 
ATOM   4567  C  CA  . ASN A 1 581 ? 86.148  103.366 123.616 1.00 73.27  ? 581 ASN A CA  1 
ATOM   4568  C  C   . ASN A 1 581 ? 85.197  103.258 124.799 1.00 73.27  ? 581 ASN A C   1 
ATOM   4569  O  O   . ASN A 1 581 ? 85.481  102.513 125.741 1.00 73.27  ? 581 ASN A O   1 
ATOM   4570  C  CB  . ASN A 1 581 ? 87.341  104.218 124.010 1.00 73.27  ? 581 ASN A CB  1 
ATOM   4571  C  CG  . ASN A 1 581 ? 88.548  103.926 123.174 1.00 73.27  ? 581 ASN A CG  1 
ATOM   4572  O  OD1 . ASN A 1 581 ? 89.378  103.094 123.528 1.00 73.27  ? 581 ASN A OD1 1 
ATOM   4573  N  ND2 . ASN A 1 581 ? 88.662  104.616 122.048 1.00 73.27  ? 581 ASN A ND2 1 
ATOM   4574  N  N   . ALA A 1 582 ? 84.078  103.982 124.769 1.00 74.13  ? 582 ALA A N   1 
ATOM   4575  C  CA  . ALA A 1 582 ? 83.044  103.836 125.782 1.00 74.13  ? 582 ALA A CA  1 
ATOM   4576  C  C   . ALA A 1 582 ? 82.247  102.553 125.615 1.00 74.13  ? 582 ALA A C   1 
ATOM   4577  O  O   . ALA A 1 582 ? 81.565  102.137 126.555 1.00 74.13  ? 582 ALA A O   1 
ATOM   4578  C  CB  . ALA A 1 582 ? 82.097  105.033 125.746 1.00 74.13  ? 582 ALA A CB  1 
ATOM   4579  N  N   . VAL A 1 583 ? 82.312  101.921 124.445 1.00 76.22  ? 583 VAL A N   1 
ATOM   4580  C  CA  . VAL A 1 583 ? 81.620  100.654 124.253 1.00 76.22  ? 583 VAL A CA  1 
ATOM   4581  C  C   . VAL A 1 583 ? 82.344  99.515  124.959 1.00 76.22  ? 583 VAL A C   1 
ATOM   4582  O  O   . VAL A 1 583 ? 81.711  98.684  125.618 1.00 76.22  ? 583 VAL A O   1 
ATOM   4583  C  CB  . VAL A 1 583 ? 81.449  100.390 122.748 1.00 76.22  ? 583 VAL A CB  1 
ATOM   4584  C  CG1 . VAL A 1 583 ? 80.838  99.033  122.502 1.00 76.22  ? 583 VAL A CG1 1 
ATOM   4585  C  CG2 . VAL A 1 583 ? 80.590  101.472 122.126 1.00 76.22  ? 583 VAL A CG2 1 
ATOM   4586  N  N   . PHE A 1 584 ? 83.672  99.466  124.870 1.00 78.58  ? 584 PHE A N   1 
ATOM   4587  C  CA  . PHE A 1 584 ? 84.475  98.418  125.500 1.00 78.58  ? 584 PHE A CA  1 
ATOM   4588  C  C   . PHE A 1 584 ? 85.419  99.039  126.521 1.00 78.58  ? 584 PHE A C   1 
ATOM   4589  O  O   . PHE A 1 584 ? 86.600  99.263  126.225 1.00 78.58  ? 584 PHE A O   1 
ATOM   4590  C  CB  . PHE A 1 584 ? 85.268  97.605  124.483 1.00 78.58  ? 584 PHE A CB  1 
ATOM   4591  C  CG  . PHE A 1 584 ? 84.524  97.303  123.227 1.00 78.58  ? 584 PHE A CG  1 
ATOM   4592  C  CD1 . PHE A 1 584 ? 84.708  98.072  122.096 1.00 78.58  ? 584 PHE A CD1 1 
ATOM   4593  C  CD2 . PHE A 1 584 ? 83.660  96.228  123.168 1.00 78.58  ? 584 PHE A CD2 1 
ATOM   4594  C  CE1 . PHE A 1 584 ? 84.035  97.785  120.931 1.00 78.58  ? 584 PHE A CE1 1 
ATOM   4595  C  CE2 . PHE A 1 584 ? 82.981  95.934  122.006 1.00 78.58  ? 584 PHE A CE2 1 
ATOM   4596  C  CZ  . PHE A 1 584 ? 83.169  96.717  120.886 1.00 78.58  ? 584 PHE A CZ  1 
ATOM   4597  N  N   . PRO A 1 585 ? 84.942  99.324  127.729 1.00 86.90  ? 585 PRO A N   1 
ATOM   4598  C  CA  . PRO A 1 585 ? 85.783  100.041 128.695 1.00 86.90  ? 585 PRO A CA  1 
ATOM   4599  C  C   . PRO A 1 585 ? 86.827  99.147  129.343 1.00 86.90  ? 585 PRO A C   1 
ATOM   4600  O  O   . PRO A 1 585 ? 87.940  99.594  129.630 1.00 86.90  ? 585 PRO A O   1 
ATOM   4601  C  CB  . PRO A 1 585 ? 84.772  100.557 129.731 1.00 86.90  ? 585 PRO A CB  1 
ATOM   4602  C  CG  . PRO A 1 585 ? 83.399  100.212 129.185 1.00 86.90  ? 585 PRO A CG  1 
ATOM   4603  C  CD  . PRO A 1 585 ? 83.604  99.056  128.275 1.00 86.90  ? 585 PRO A CD  1 
ATOM   4604  N  N   . GLU A 1 586 ? 86.481  97.885  129.588 1.00 96.82  ? 586 GLU A N   1 
ATOM   4605  C  CA  . GLU A 1 586 ? 87.376  96.995  130.316 1.00 96.82  ? 586 GLU A CA  1 
ATOM   4606  C  C   . GLU A 1 586 ? 88.172  96.074  129.405 1.00 96.82  ? 586 GLU A C   1 
ATOM   4607  O  O   . GLU A 1 586 ? 89.346  95.804  129.680 1.00 96.82  ? 586 GLU A O   1 
ATOM   4608  C  CB  . GLU A 1 586 ? 86.577  96.149  131.307 1.00 96.82  ? 586 GLU A CB  1 
ATOM   4609  N  N   . SER A 1 587 ? 87.567  95.590  128.326 1.00 93.35  ? 587 SER A N   1 
ATOM   4610  C  CA  . SER A 1 587 ? 88.188  94.613  127.433 1.00 93.35  ? 587 SER A CA  1 
ATOM   4611  C  C   . SER A 1 587 ? 88.649  95.315  126.158 1.00 93.35  ? 587 SER A C   1 
ATOM   4612  O  O   . SER A 1 587 ? 87.894  95.448  125.196 1.00 93.35  ? 587 SER A O   1 
ATOM   4613  C  CB  . SER A 1 587 ? 87.214  93.487  127.123 1.00 93.35  ? 587 SER A CB  1 
ATOM   4614  O  OG  . SER A 1 587 ? 86.166  93.950  126.293 1.00 93.35  ? 587 SER A OG  1 
ATOM   4615  N  N   . LYS A 1 588 ? 89.907  95.743  126.146 1.00 80.93  ? 588 LYS A N   1 
ATOM   4616  C  CA  . LYS A 1 588 ? 90.506  96.363  124.976 1.00 80.93  ? 588 LYS A CA  1 
ATOM   4617  C  C   . LYS A 1 588 ? 91.103  95.362  124.011 1.00 80.93  ? 588 LYS A C   1 
ATOM   4618  O  O   . LYS A 1 588 ? 91.825  95.762  123.097 1.00 80.93  ? 588 LYS A O   1 
ATOM   4619  C  CB  . LYS A 1 588 ? 91.574  97.367  125.387 1.00 80.93  ? 588 LYS A CB  1 
ATOM   4620  C  CG  . LYS A 1 588 ? 91.084  98.402  126.350 1.00 80.93  ? 588 LYS A CG  1 
ATOM   4621  C  CD  . LYS A 1 588 ? 89.959  99.187  125.723 1.00 80.93  ? 588 LYS A CD  1 
ATOM   4622  C  CE  . LYS A 1 588 ? 89.625  100.398 126.554 1.00 80.93  ? 588 LYS A CE  1 
ATOM   4623  N  NZ  . LYS A 1 588 ? 88.369  101.024 126.065 1.00 80.93  ? 588 LYS A NZ  1 
ATOM   4624  N  N   . ALA A 1 589 ? 90.848  94.078  124.196 1.00 75.92  ? 589 ALA A N   1 
ATOM   4625  C  CA  . ALA A 1 589 ? 91.310  93.092  123.237 1.00 75.92  ? 589 ALA A CA  1 
ATOM   4626  C  C   . ALA A 1 589 ? 90.232  92.692  122.245 1.00 75.92  ? 589 ALA A C   1 
ATOM   4627  O  O   . ALA A 1 589 ? 90.549  92.092  121.216 1.00 75.92  ? 589 ALA A O   1 
ATOM   4628  C  CB  . ALA A 1 589 ? 91.831  91.846  123.961 1.00 75.92  ? 589 ALA A CB  1 
ATOM   4629  N  N   . ASP A 1 590 ? 88.976  92.998  122.526 1.00 71.80  ? 590 ASP A N   1 
ATOM   4630  C  CA  . ASP A 1 590 ? 87.912  92.772  121.565 1.00 71.80  ? 590 ASP A CA  1 
ATOM   4631  C  C   . ASP A 1 590 ? 87.632  93.980  120.689 1.00 71.80  ? 590 ASP A C   1 
ATOM   4632  O  O   . ASP A 1 590 ? 87.071  93.817  119.600 1.00 71.80  ? 590 ASP A O   1 
ATOM   4633  C  CB  . ASP A 1 590 ? 86.641  92.327  122.278 1.00 71.80  ? 590 ASP A CB  1 
ATOM   4634  C  CG  . ASP A 1 590 ? 86.803  90.976  122.932 1.00 71.80  ? 590 ASP A CG  1 
ATOM   4635  O  OD1 . ASP A 1 590 ? 87.924  90.430  122.871 1.00 71.80  ? 590 ASP A OD1 1 
ATOM   4636  O  OD2 . ASP A 1 590 ? 85.814  90.450  123.484 1.00 71.80  ? 590 ASP A OD2 1 
ATOM   4637  N  N   . LEU A 1 591 ? 87.990  95.180  121.144 1.00 57.79  ? 591 LEU A N   1 
ATOM   4638  C  CA  . LEU A 1 591 ? 87.811  96.370  120.322 1.00 57.79  ? 591 LEU A CA  1 
ATOM   4639  C  C   . LEU A 1 591 ? 88.697  96.322  119.091 1.00 57.79  ? 591 LEU A C   1 
ATOM   4640  O  O   . LEU A 1 591 ? 88.250  96.656  117.988 1.00 57.79  ? 591 LEU A O   1 
ATOM   4641  C  CB  . LEU A 1 591 ? 88.120  97.615  121.140 1.00 57.79  ? 591 LEU A CB  1 
ATOM   4642  C  CG  . LEU A 1 591 ? 88.495  98.869  120.361 1.00 57.79  ? 591 LEU A CG  1 
ATOM   4643  C  CD1 . LEU A 1 591 ? 87.274  99.458  119.696 1.00 57.79  ? 591 LEU A CD1 1 
ATOM   4644  C  CD2 . LEU A 1 591 ? 89.150  99.876  121.269 1.00 57.79  ? 591 LEU A CD2 1 
ATOM   4645  N  N   . ILE A 1 592 ? 89.945  95.891  119.256 1.00 51.35  ? 592 ILE A N   1 
ATOM   4646  C  CA  . ILE A 1 592 ? 90.852  95.787  118.122 1.00 51.35  ? 592 ILE A CA  1 
ATOM   4647  C  C   . ILE A 1 592 ? 90.372  94.723  117.149 1.00 51.35  ? 592 ILE A C   1 
ATOM   4648  O  O   . ILE A 1 592 ? 90.452  94.906  115.933 1.00 51.35  ? 592 ILE A O   1 
ATOM   4649  C  CB  . ILE A 1 592 ? 92.277  95.513  118.614 1.00 51.35  ? 592 ILE A CB  1 
ATOM   4650  C  CG1 . ILE A 1 592 ? 92.669  96.573  119.628 1.00 51.35  ? 592 ILE A CG1 1 
ATOM   4651  C  CG2 . ILE A 1 592 ? 93.241  95.552  117.475 1.00 51.35  ? 592 ILE A CG2 1 
ATOM   4652  C  CD1 . ILE A 1 592 ? 94.016  96.347  120.240 1.00 51.35  ? 592 ILE A CD1 1 
ATOM   4653  N  N   . LEU A 1 593 ? 89.819  93.623  117.659 1.00 46.35  ? 593 LEU A N   1 
ATOM   4654  C  CA  . LEU A 1 593 ? 89.314  92.581  116.773 1.00 46.35  ? 593 LEU A CA  1 
ATOM   4655  C  C   . LEU A 1 593 ? 88.083  93.033  116.009 1.00 46.35  ? 593 LEU A C   1 
ATOM   4656  O  O   . LEU A 1 593 ? 87.930  92.695  114.832 1.00 46.35  ? 593 LEU A O   1 
ATOM   4657  C  CB  . LEU A 1 593 ? 89.012  91.318  117.558 1.00 46.35  ? 593 LEU A CB  1 
ATOM   4658  C  CG  . LEU A 1 593 ? 90.243  90.457  117.728 1.00 46.35  ? 593 LEU A CG  1 
ATOM   4659  C  CD1 . LEU A 1 593 ? 89.898  89.235  118.528 1.00 46.35  ? 593 LEU A CD1 1 
ATOM   4660  C  CD2 . LEU A 1 593 ? 90.700  90.057  116.356 1.00 46.35  ? 593 LEU A CD2 1 
ATOM   4661  N  N   . ILE A 1 594 ? 87.193  93.787  116.653 1.00 41.78  ? 594 ILE A N   1 
ATOM   4662  C  CA  . ILE A 1 594 ? 86.007  94.265  115.953 1.00 41.78  ? 594 ILE A CA  1 
ATOM   4663  C  C   . ILE A 1 594 ? 86.381  95.326  114.929 1.00 41.78  ? 594 ILE A C   1 
ATOM   4664  O  O   . ILE A 1 594 ? 85.830  95.351  113.822 1.00 41.78  ? 594 ILE A O   1 
ATOM   4665  C  CB  . ILE A 1 594 ? 84.966  94.733  116.977 1.00 41.78  ? 594 ILE A CB  1 
ATOM   4666  C  CG1 . ILE A 1 594 ? 84.316  93.501  117.594 1.00 41.78  ? 594 ILE A CG1 1 
ATOM   4667  C  CG2 . ILE A 1 594 ? 83.898  95.593  116.348 1.00 41.78  ? 594 ILE A CG2 1 
ATOM   4668  C  CD1 . ILE A 1 594 ? 83.320  93.810  118.671 1.00 41.78  ? 594 ILE A CD1 1 
ATOM   4669  N  N   . VAL A 1 595 ? 87.353  96.178  115.247 1.00 35.42  ? 595 VAL A N   1 
ATOM   4670  C  CA  . VAL A 1 595 ? 87.794  97.192  114.297 1.00 35.42  ? 595 VAL A CA  1 
ATOM   4671  C  C   . VAL A 1 595 ? 88.505  96.540  113.117 1.00 35.42  ? 595 VAL A C   1 
ATOM   4672  O  O   . VAL A 1 595 ? 88.279  96.914  111.959 1.00 35.42  ? 595 VAL A O   1 
ATOM   4673  C  CB  . VAL A 1 595 ? 88.681  98.223  115.012 1.00 35.42  ? 595 VAL A CB  1 
ATOM   4674  C  CG1 . VAL A 1 595 ? 89.516  99.021  114.034 1.00 35.42  ? 595 VAL A CG1 1 
ATOM   4675  C  CG2 . VAL A 1 595 ? 87.814  99.156  115.808 1.00 35.42  ? 595 VAL A CG2 1 
ATOM   4676  N  N   . VAL A 1 596 ? 89.297  95.500  113.380 1.00 29.78  ? 596 VAL A N   1 
ATOM   4677  C  CA  . VAL A 1 596 ? 89.971  94.781  112.305 1.00 29.78  ? 596 VAL A CA  1 
ATOM   4678  C  C   . VAL A 1 596 ? 88.963  94.016  111.461 1.00 29.78  ? 596 VAL A C   1 
ATOM   4679  O  O   . VAL A 1 596 ? 89.102  93.948  110.233 1.00 29.78  ? 596 VAL A O   1 
ATOM   4680  C  CB  . VAL A 1 596 ? 91.065  93.880  112.909 1.00 29.78  ? 596 VAL A CB  1 
ATOM   4681  C  CG1 . VAL A 1 596 ? 91.477  92.767  111.991 1.00 29.78  ? 596 VAL A CG1 1 
ATOM   4682  C  CG2 . VAL A 1 596 ? 92.274  94.713  113.214 1.00 29.78  ? 596 VAL A CG2 1 
ATOM   4683  N  N   . ALA A 1 597 ? 87.889  93.520  112.072 1.00 30.56  ? 597 ALA A N   1 
ATOM   4684  C  CA  . ALA A 1 597 ? 86.847  92.863  111.293 1.00 30.56  ? 597 ALA A CA  1 
ATOM   4685  C  C   . ALA A 1 597 ? 86.109  93.859  110.414 1.00 30.56  ? 597 ALA A C   1 
ATOM   4686  O  O   . ALA A 1 597 ? 85.766  93.539  109.274 1.00 30.56  ? 597 ALA A O   1 
ATOM   4687  C  CB  . ALA A 1 597 ? 85.869  92.135  112.204 1.00 30.56  ? 597 ALA A CB  1 
ATOM   4688  N  N   . VAL A 1 598 ? 85.853  95.067  110.922 1.00 28.16  ? 598 VAL A N   1 
ATOM   4689  C  CA  . VAL A 1 598 ? 85.232  96.103  110.100 1.00 28.16  ? 598 VAL A CA  1 
ATOM   4690  C  C   . VAL A 1 598 ? 86.191  96.529  108.998 1.00 28.16  ? 598 VAL A C   1 
ATOM   4691  O  O   . VAL A 1 598 ? 85.786  96.754  107.850 1.00 28.16  ? 598 VAL A O   1 
ATOM   4692  C  CB  . VAL A 1 598 ? 84.789  97.283  110.984 1.00 28.16  ? 598 VAL A CB  1 
ATOM   4693  C  CG1 . VAL A 1 598 ? 84.518  98.523  110.175 1.00 28.16  ? 598 VAL A CG1 1 
ATOM   4694  C  CG2 . VAL A 1 598 ? 83.546  96.909  111.727 1.00 28.16  ? 598 VAL A CG2 1 
ATOM   4695  N  N   . GLU A 1 599 ? 87.483  96.565  109.311 1.00 24.66  ? 599 GLU A N   1 
ATOM   4696  C  CA  . GLU A 1 599 ? 88.483  96.925  108.319 1.00 24.66  ? 599 GLU A CA  1 
ATOM   4697  C  C   . GLU A 1 599 ? 88.602  95.885  107.221 1.00 24.66  ? 599 GLU A C   1 
ATOM   4698  O  O   . GLU A 1 599 ? 88.671  96.232  106.039 1.00 24.66  ? 599 GLU A O   1 
ATOM   4699  C  CB  . GLU A 1 599 ? 89.827  97.066  109.017 1.00 24.66  ? 599 GLU A CB  1 
ATOM   4700  C  CG  . GLU A 1 599 ? 90.979  97.408  108.129 1.00 24.66  ? 599 GLU A CG  1 
ATOM   4701  C  CD  . GLU A 1 599 ? 91.855  96.193  107.883 1.00 24.66  ? 599 GLU A CD  1 
ATOM   4702  O  OE1 . GLU A 1 599 ? 91.902  95.307  108.754 1.00 24.66  ? 599 GLU A OE1 1 
ATOM   4703  O  OE2 . GLU A 1 599 ? 92.502  96.118  106.825 1.00 24.66  ? 599 GLU A OE2 1 
ATOM   4704  N  N   . HIS A 1 600 ? 88.634  94.612  107.581 1.00 23.10  ? 600 HIS A N   1 
ATOM   4705  C  CA  . HIS A 1 600 ? 88.684  93.591  106.549 1.00 23.10  ? 600 HIS A CA  1 
ATOM   4706  C  C   . HIS A 1 600 ? 87.367  93.453  105.801 1.00 23.10  ? 600 HIS A C   1 
ATOM   4707  O  O   . HIS A 1 600 ? 87.376  93.148  104.606 1.00 23.10  ? 600 HIS A O   1 
ATOM   4708  C  CB  . HIS A 1 600 ? 89.146  92.266  107.137 1.00 23.10  ? 600 HIS A CB  1 
ATOM   4709  C  CG  . HIS A 1 600 ? 90.622  92.209  107.358 1.00 23.10  ? 600 HIS A CG  1 
ATOM   4710  N  ND1 . HIS A 1 600 ? 91.186  91.689  108.500 1.00 23.10  ? 600 HIS A ND1 1 
ATOM   4711  C  CD2 . HIS A 1 600 ? 91.649  92.652  106.601 1.00 23.10  ? 600 HIS A CD2 1 
ATOM   4712  C  CE1 . HIS A 1 600 ? 92.500  91.791  108.424 1.00 23.10  ? 600 HIS A CE1 1 
ATOM   4713  N  NE2 . HIS A 1 600 ? 92.807  92.374  107.283 1.00 23.10  ? 600 HIS A NE2 1 
ATOM   4714  N  N   . ALA A 1 601 ? 86.232  93.665  106.468 1.00 21.21  ? 601 ALA A N   1 
ATOM   4715  C  CA  . ALA A 1 601 ? 84.968  93.619  105.745 1.00 21.21  ? 601 ALA A CA  1 
ATOM   4716  C  C   . ALA A 1 601 ? 84.826  94.768  104.764 1.00 21.21  ? 601 ALA A C   1 
ATOM   4717  O  O   . ALA A 1 601 ? 84.242  94.593  103.692 1.00 21.21  ? 601 ALA A O   1 
ATOM   4718  C  CB  . ALA A 1 601 ? 83.792  93.621  106.711 1.00 21.21  ? 601 ALA A CB  1 
ATOM   4719  N  N   . LEU A 1 602 ? 85.327  95.949  105.099 1.00 21.75  ? 602 LEU A N   1 
ATOM   4720  C  CA  . LEU A 1 602 ? 85.240  97.031  104.127 1.00 21.75  ? 602 LEU A CA  1 
ATOM   4721  C  C   . LEU A 1 602 ? 86.207  96.834  102.972 1.00 21.75  ? 602 LEU A C   1 
ATOM   4722  O  O   . LEU A 1 602 ? 85.866  97.142  101.830 1.00 21.75  ? 602 LEU A O   1 
ATOM   4723  C  CB  . LEU A 1 602 ? 85.451  98.388  104.778 1.00 21.75  ? 602 LEU A CB  1 
ATOM   4724  C  CG  . LEU A 1 602 ? 84.143  98.896  105.359 1.00 21.75  ? 602 LEU A CG  1 
ATOM   4725  C  CD1 . LEU A 1 602 ? 84.358  100.181 106.121 1.00 21.75  ? 602 LEU A CD1 1 
ATOM   4726  C  CD2 . LEU A 1 602 ? 83.155  99.093  104.243 1.00 21.75  ? 602 LEU A CD2 1 
ATOM   4727  N  N   . LEU A 1 603 ? 87.402  96.301  103.238 1.00 17.89  ? 603 LEU A N   1 
ATOM   4728  C  CA  . LEU A 1 603 ? 88.330  96.014  102.151 1.00 17.89  ? 603 LEU A CA  1 
ATOM   4729  C  C   . LEU A 1 603 ? 87.819  94.923  101.226 1.00 17.89  ? 603 LEU A C   1 
ATOM   4730  O  O   . LEU A 1 603 ? 87.980  95.024  100.006 1.00 17.89  ? 603 LEU A O   1 
ATOM   4731  C  CB  . LEU A 1 603 ? 89.686  95.602  102.703 1.00 17.89  ? 603 LEU A CB  1 
ATOM   4732  C  CG  . LEU A 1 603 ? 90.593  96.718  103.166 1.00 17.89  ? 603 LEU A CG  1 
ATOM   4733  C  CD1 . LEU A 1 603 ? 91.927  96.130  103.532 1.00 17.89  ? 603 LEU A CD1 1 
ATOM   4734  C  CD2 . LEU A 1 603 ? 90.730  97.722  102.070 1.00 17.89  ? 603 LEU A CD2 1 
ATOM   4735  N  N   . ALA A 1 604 ? 87.206  93.879  101.776 1.00 16.76  ? 604 ALA A N   1 
ATOM   4736  C  CA  . ALA A 1 604 ? 86.680  92.825  100.922 1.00 16.76  ? 604 ALA A CA  1 
ATOM   4737  C  C   . ALA A 1 604 ? 85.501  93.317  100.107 1.00 16.76  ? 604 ALA A C   1 
ATOM   4738  O  O   . ALA A 1 604 ? 85.375  92.981  98.927  1.00 16.76  ? 604 ALA A O   1 
ATOM   4739  C  CB  . ALA A 1 604 ? 86.284  91.614  101.751 1.00 16.76  ? 604 ALA A CB  1 
ATOM   4740  N  N   . LEU A 1 605 ? 84.622  94.101  100.722 1.00 16.81  ? 605 LEU A N   1 
ATOM   4741  C  CA  . LEU A 1 605 ? 83.476  94.638  100.004 1.00 16.81  ? 605 LEU A CA  1 
ATOM   4742  C  C   . LEU A 1 605 ? 83.887  95.688  98.980  1.00 16.81  ? 605 LEU A C   1 
ATOM   4743  O  O   . LEU A 1 605 ? 83.233  95.834  97.943  1.00 16.81  ? 605 LEU A O   1 
ATOM   4744  C  CB  . LEU A 1 605 ? 82.476  95.202  101.001 1.00 16.81  ? 605 LEU A CB  1 
ATOM   4745  C  CG  . LEU A 1 605 ? 81.218  95.875  100.490 1.00 16.81  ? 605 LEU A CG  1 
ATOM   4746  C  CD1 . LEU A 1 605 ? 80.492  94.914  99.595  1.00 16.81  ? 605 LEU A CD1 1 
ATOM   4747  C  CD2 . LEU A 1 605 ? 80.349  96.233  101.654 1.00 16.81  ? 605 LEU A CD2 1 
ATOM   4748  N  N   . LYS A 1 606 ? 84.954  96.432  99.249  1.00 17.72  ? 606 LYS A N   1 
ATOM   4749  C  CA  . LYS A 1 606 ? 85.441  97.394  98.269  1.00 17.72  ? 606 LYS A CA  1 
ATOM   4750  C  C   . LYS A 1 606 ? 86.038  96.730  97.035  1.00 17.72  ? 606 LYS A C   1 
ATOM   4751  O  O   . LYS A 1 606 ? 85.750  97.151  95.913  1.00 17.72  ? 606 LYS A O   1 
ATOM   4752  C  CB  . LYS A 1 606 ? 86.465  98.300  98.930  1.00 17.72  ? 606 LYS A CB  1 
ATOM   4753  C  CG  . LYS A 1 606 ? 87.304  99.123  98.031  1.00 17.72  ? 606 LYS A CG  1 
ATOM   4754  C  CD  . LYS A 1 606 ? 88.245  99.931  98.891  1.00 17.72  ? 606 LYS A CD  1 
ATOM   4755  C  CE  . LYS A 1 606 ? 87.499  100.855 99.824  1.00 17.72  ? 606 LYS A CE  1 
ATOM   4756  N  NZ  . LYS A 1 606 ? 86.986  102.039 99.139  1.00 17.72  ? 606 LYS A NZ  1 
ATOM   4757  N  N   . PHE A 1 607 ? 86.827  95.670  97.202  1.00 16.06  ? 607 PHE A N   1 
ATOM   4758  C  CA  . PHE A 1 607 ? 87.367  94.982  96.033  1.00 16.06  ? 607 PHE A CA  1 
ATOM   4759  C  C   . PHE A 1 607 ? 86.311  94.209  95.265  1.00 16.06  ? 607 PHE A C   1 
ATOM   4760  O  O   . PHE A 1 607 ? 86.418  94.084  94.044  1.00 16.06  ? 607 PHE A O   1 
ATOM   4761  C  CB  . PHE A 1 607 ? 88.507  94.056  96.421  1.00 16.06  ? 607 PHE A CB  1 
ATOM   4762  C  CG  . PHE A 1 607 ? 89.780  94.773  96.699  1.00 16.06  ? 607 PHE A CG  1 
ATOM   4763  C  CD1 . PHE A 1 607 ? 89.997  96.030  96.170  1.00 16.06  ? 607 PHE A CD1 1 
ATOM   4764  C  CD2 . PHE A 1 607 ? 90.778  94.179  97.449  1.00 16.06  ? 607 PHE A CD2 1 
ATOM   4765  C  CE1 . PHE A 1 607 ? 91.164  96.692  96.403  1.00 16.06  ? 607 PHE A CE1 1 
ATOM   4766  C  CE2 . PHE A 1 607 ? 91.956  94.836  97.689  1.00 16.06  ? 607 PHE A CE2 1 
ATOM   4767  C  CZ  . PHE A 1 607 ? 92.148  96.097  97.164  1.00 16.06  ? 607 PHE A CZ  1 
ATOM   4768  N  N   . ILE A 1 608 ? 85.288  93.704  95.944  1.00 13.75  ? 608 ILE A N   1 
ATOM   4769  C  CA  . ILE A 1 608 ? 84.197  93.038  95.246  1.00 13.75  ? 608 ILE A CA  1 
ATOM   4770  C  C   . ILE A 1 608 ? 83.407  94.041  94.425  1.00 13.75  ? 608 ILE A C   1 
ATOM   4771  O  O   . ILE A 1 608 ? 83.060  93.775  93.271  1.00 13.75  ? 608 ILE A O   1 
ATOM   4772  C  CB  . ILE A 1 608 ? 83.309  92.285  96.249  1.00 13.75  ? 608 ILE A CB  1 
ATOM   4773  C  CG1 . ILE A 1 608 ? 83.944  90.957  96.599  1.00 13.75  ? 608 ILE A CG1 1 
ATOM   4774  C  CG2 . ILE A 1 608 ? 81.938  92.033  95.715  1.00 13.75  ? 608 ILE A CG2 1 
ATOM   4775  C  CD1 . ILE A 1 608 ? 83.317  90.313  97.791  1.00 13.75  ? 608 ILE A CD1 1 
ATOM   4776  N  N   . LEU A 1 609 ? 83.227  95.250  94.956  1.00 16.25  ? 609 LEU A N   1 
ATOM   4777  C  CA  . LEU A 1 609 ? 82.557  96.306  94.206  1.00 16.25  ? 609 LEU A CA  1 
ATOM   4778  C  C   . LEU A 1 609 ? 83.360  96.754  92.997  1.00 16.25  ? 609 LEU A C   1 
ATOM   4779  O  O   . LEU A 1 609 ? 82.770  97.124  91.980  1.00 16.25  ? 609 LEU A O   1 
ATOM   4780  C  CB  . LEU A 1 609 ? 82.261  97.484  95.120  1.00 16.25  ? 609 LEU A CB  1 
ATOM   4781  C  CG  . LEU A 1 609 ? 80.824  97.461  95.605  1.00 16.25  ? 609 LEU A CG  1 
ATOM   4782  C  CD1 . LEU A 1 609 ? 80.599  98.599  96.536  1.00 16.25  ? 609 LEU A CD1 1 
ATOM   4783  C  CD2 . LEU A 1 609 ? 79.916  97.581  94.421  1.00 16.25  ? 609 LEU A CD2 1 
ATOM   4784  N  N   . ALA A 1 610 ? 84.684  96.765  93.081  1.00 16.31  ? 610 ALA A N   1 
ATOM   4785  C  CA  . ALA A 1 610 ? 85.460  97.125  91.905  1.00 16.31  ? 610 ALA A CA  1 
ATOM   4786  C  C   . ALA A 1 610 ? 85.472  95.991  90.890  1.00 16.31  ? 610 ALA A C   1 
ATOM   4787  O  O   . ALA A 1 610 ? 85.621  96.236  89.688  1.00 16.31  ? 610 ALA A O   1 
ATOM   4788  C  CB  . ALA A 1 610 ? 86.887  97.503  92.291  1.00 16.31  ? 610 ALA A CB  1 
ATOM   4789  N  N   . PHE A 1 611 ? 85.320  94.760  91.356  1.00 16.72  ? 611 PHE A N   1 
ATOM   4790  C  CA  . PHE A 1 611 ? 85.266  93.592  90.497  1.00 16.72  ? 611 PHE A CA  1 
ATOM   4791  C  C   . PHE A 1 611 ? 83.876  93.297  89.961  1.00 16.72  ? 611 PHE A C   1 
ATOM   4792  O  O   . PHE A 1 611 ? 83.759  92.660  88.914  1.00 16.72  ? 611 PHE A O   1 
ATOM   4793  C  CB  . PHE A 1 611 ? 85.765  92.394  91.301  1.00 16.72  ? 611 PHE A CB  1 
ATOM   4794  C  CG  . PHE A 1 611 ? 85.911  91.142  90.526  1.00 16.72  ? 611 PHE A CG  1 
ATOM   4795  C  CD1 . PHE A 1 611 ? 86.937  90.980  89.629  1.00 16.72  ? 611 PHE A CD1 1 
ATOM   4796  C  CD2 . PHE A 1 611 ? 85.011  90.111  90.715  1.00 16.72  ? 611 PHE A CD2 1 
ATOM   4797  C  CE1 . PHE A 1 611 ? 87.064  89.808  88.927  1.00 16.72  ? 611 PHE A CE1 1 
ATOM   4798  C  CE2 . PHE A 1 611 ? 85.124  88.945  90.024  1.00 16.72  ? 611 PHE A CE2 1 
ATOM   4799  C  CZ  . PHE A 1 611 ? 86.151  88.790  89.121  1.00 16.72  ? 611 PHE A CZ  1 
ATOM   4800  N  N   . ALA A 1 612 ? 82.821  93.743  90.633  1.00 17.17  ? 612 ALA A N   1 
ATOM   4801  C  CA  . ALA A 1 612 ? 81.480  93.385  90.185  1.00 17.17  ? 612 ALA A CA  1 
ATOM   4802  C  C   . ALA A 1 612 ? 81.000  94.299  89.070  1.00 17.17  ? 612 ALA A C   1 
ATOM   4803  O  O   . ALA A 1 612 ? 80.441  93.837  88.073  1.00 17.17  ? 612 ALA A O   1 
ATOM   4804  C  CB  . ALA A 1 612 ? 80.493  93.418  91.347  1.00 17.17  ? 612 ALA A CB  1 
ATOM   4805  N  N   . ILE A 1 613 ? 81.206  95.597  89.230  1.00 19.69  ? 613 ILE A N   1 
ATOM   4806  C  CA  . ILE A 1 613 ? 80.784  96.590  88.255  1.00 19.69  ? 613 ILE A CA  1 
ATOM   4807  C  C   . ILE A 1 613 ? 81.673  96.462  87.031  1.00 19.69  ? 613 ILE A C   1 
ATOM   4808  O  O   . ILE A 1 613 ? 82.905  96.518  87.147  1.00 19.69  ? 613 ILE A O   1 
ATOM   4809  C  CB  . ILE A 1 613 ? 80.851  97.998  88.840  1.00 19.69  ? 613 ILE A CB  1 
ATOM   4810  C  CG1 . ILE A 1 613 ? 80.150  98.021  90.184  1.00 19.69  ? 613 ILE A CG1 1 
ATOM   4811  C  CG2 . ILE A 1 613 ? 80.209  98.971  87.905  1.00 19.69  ? 613 ILE A CG2 1 
ATOM   4812  C  CD1 . ILE A 1 613 ? 80.288  99.320  90.881  1.00 19.69  ? 613 ILE A CD1 1 
ATOM   4813  N  N   . PRO A 1 614 ? 81.096  96.291  85.851  1.00 24.86  ? 614 PRO A N   1 
ATOM   4814  C  CA  . PRO A 1 614 ? 81.911  96.146  84.647  1.00 24.86  ? 614 PRO A CA  1 
ATOM   4815  C  C   . PRO A 1 614 ? 82.537  97.459  84.221  1.00 24.86  ? 614 PRO A C   1 
ATOM   4816  O  O   . PRO A 1 614 ? 82.019  98.545  84.483  1.00 24.86  ? 614 PRO A O   1 
ATOM   4817  C  CB  . PRO A 1 614 ? 80.911  95.638  83.608  1.00 24.86  ? 614 PRO A CB  1 
ATOM   4818  C  CG  . PRO A 1 614 ? 79.624  96.156  84.069  1.00 24.86  ? 614 PRO A CG  1 
ATOM   4819  C  CD  . PRO A 1 614 ? 79.665  96.143  85.562  1.00 24.86  ? 614 PRO A CD  1 
ATOM   4820  N  N   . ASP A 1 615 ? 83.683  97.328  83.558  1.00 35.22  ? 615 ASP A N   1 
ATOM   4821  C  CA  . ASP A 1 615 ? 84.515  98.465  83.196  1.00 35.22  ? 615 ASP A CA  1 
ATOM   4822  C  C   . ASP A 1 615 ? 83.912  99.271  82.061  1.00 35.22  ? 615 ASP A C   1 
ATOM   4823  O  O   . ASP A 1 615 ? 83.729  100.485 82.179  1.00 35.22  ? 615 ASP A O   1 
ATOM   4824  C  CB  . ASP A 1 615 ? 85.895  97.958  82.794  1.00 35.22  ? 615 ASP A CB  1 
ATOM   4825  C  CG  . ASP A 1 615 ? 86.532  97.112  83.869  1.00 35.22  ? 615 ASP A CG  1 
ATOM   4826  O  OD1 . ASP A 1 615 ? 85.866  96.864  84.904  1.00 35.22  ? 615 ASP A OD1 1 
ATOM   4827  O  OD2 . ASP A 1 615 ? 87.689  96.678  83.672  1.00 35.22  ? 615 ASP A OD2 1 
ATOM   4828  N  N   . LYS A 1 616 ? 83.577  98.624  80.987  1.00 37.77  ? 616 LYS A N   1 
ATOM   4829  C  CA  . LYS A 1 616 ? 82.872  99.302  79.921  1.00 37.77  ? 616 LYS A CA  1 
ATOM   4830  C  C   . LYS A 1 616 ? 81.381  99.284  80.226  1.00 37.77  ? 616 LYS A C   1 
ATOM   4831  O  O   . LYS A 1 616 ? 80.895  98.357  80.872  1.00 37.77  ? 616 LYS A O   1 
ATOM   4832  C  CB  . LYS A 1 616 ? 83.124  98.590  78.605  1.00 37.77  ? 616 LYS A CB  1 
ATOM   4833  C  CG  . LYS A 1 616 ? 84.588  98.444  78.227  1.00 37.77  ? 616 LYS A CG  1 
ATOM   4834  C  CD  . LYS A 1 616 ? 84.739  97.541  77.006  1.00 37.77  ? 616 LYS A CD  1 
ATOM   4835  C  CE  . LYS A 1 616 ? 86.159  97.058  76.837  1.00 37.77  ? 616 LYS A CE  1 
ATOM   4836  N  NZ  . LYS A 1 616 ? 87.130  98.150  77.064  1.00 37.77  ? 616 LYS A NZ  1 
ATOM   4837  N  N   . PRO A 1 617 ? 80.622  100.282 79.777  1.00 44.53  ? 617 PRO A N   1 
ATOM   4838  C  CA  . PRO A 1 617 ? 79.174  100.255 80.031  1.00 44.53  ? 617 PRO A CA  1 
ATOM   4839  C  C   . PRO A 1 617 ? 78.452  99.212  79.195  1.00 44.53  ? 617 PRO A C   1 
ATOM   4840  O  O   . PRO A 1 617 ? 79.098  98.437  78.485  1.00 44.53  ? 617 PRO A O   1 
ATOM   4841  C  CB  . PRO A 1 617 ? 78.726  101.675 79.680  1.00 44.53  ? 617 PRO A CB  1 
ATOM   4842  C  CG  . PRO A 1 617 ? 79.957  102.473 79.692  1.00 44.53  ? 617 PRO A CG  1 
ATOM   4843  C  CD  . PRO A 1 617 ? 81.053  101.578 79.252  1.00 44.53  ? 617 PRO A CD  1 
ATOM   4844  N  N   . ARG A 1 618 ? 77.123  99.159  79.252  1.00 49.15  ? 618 ARG A N   1 
ATOM   4845  C  CA  . ARG A 1 618 ? 76.463  98.100  78.499  1.00 49.15  ? 618 ARG A CA  1 
ATOM   4846  C  C   . ARG A 1 618 ? 76.443  98.351  76.992  1.00 49.15  ? 618 ARG A C   1 
ATOM   4847  O  O   . ARG A 1 618 ? 76.896  97.504  76.218  1.00 49.15  ? 618 ARG A O   1 
ATOM   4848  C  CB  . ARG A 1 618 ? 75.038  97.943  79.011  1.00 49.15  ? 618 ARG A CB  1 
ATOM   4849  C  CG  . ARG A 1 618 ? 74.308  96.711  78.538  1.00 49.15  ? 618 ARG A CG  1 
ATOM   4850  C  CD  . ARG A 1 618 ? 75.118  95.473  78.893  1.00 49.15  ? 618 ARG A CD  1 
ATOM   4851  N  NE  . ARG A 1 618 ? 74.376  94.237  78.662  1.00 49.15  ? 618 ARG A NE  1 
ATOM   4852  C  CZ  . ARG A 1 618 ? 74.869  93.022  78.876  1.00 49.15  ? 618 ARG A CZ  1 
ATOM   4853  N  NH1 . ARG A 1 618 ? 76.104  92.883  79.328  1.00 49.15  ? 618 ARG A NH1 1 
ATOM   4854  N  NH2 . ARG A 1 618 ? 74.129  91.946  78.649  1.00 49.15  ? 618 ARG A NH2 1 
ATOM   4855  N  N   . HIS A 1 619 ? 75.959  99.520  76.555  1.00 50.94  ? 619 HIS A N   1 
ATOM   4856  C  CA  . HIS A 1 619 ? 75.779  99.730  75.117  1.00 50.94  ? 619 HIS A CA  1 
ATOM   4857  C  C   . HIS A 1 619 ? 77.076  100.006 74.377  1.00 50.94  ? 619 HIS A C   1 
ATOM   4858  O  O   . HIS A 1 619 ? 77.182  99.690  73.189  1.00 50.94  ? 619 HIS A O   1 
ATOM   4859  C  CB  . HIS A 1 619 ? 74.770  100.829 74.816  1.00 50.94  ? 619 HIS A CB  1 
ATOM   4860  C  CG  . HIS A 1 619 ? 75.096  102.145 75.422  1.00 50.94  ? 619 HIS A CG  1 
ATOM   4861  N  ND1 . HIS A 1 619 ? 74.820  102.448 76.735  1.00 50.94  ? 619 HIS A ND1 1 
ATOM   4862  C  CD2 . HIS A 1 619 ? 75.624  103.263 74.876  1.00 50.94  ? 619 HIS A CD2 1 
ATOM   4863  C  CE1 . HIS A 1 619 ? 75.189  103.691 76.981  1.00 50.94  ? 619 HIS A CE1 1 
ATOM   4864  N  NE2 . HIS A 1 619 ? 75.678  104.208 75.869  1.00 50.94  ? 619 HIS A NE2 1 
ATOM   4865  N  N   . ILE A 1 620 ? 78.058  100.598 75.052  1.00 47.35  ? 620 ILE A N   1 
ATOM   4866  C  CA  . ILE A 1 620 ? 79.380  100.780 74.466  1.00 47.35  ? 620 ILE A CA  1 
ATOM   4867  C  C   . ILE A 1 620 ? 80.046  99.443  74.248  1.00 47.35  ? 620 ILE A C   1 
ATOM   4868  O  O   . ILE A 1 620 ? 80.800  99.265  73.286  1.00 47.35  ? 620 ILE A O   1 
ATOM   4869  C  CB  . ILE A 1 620 ? 80.224  101.733 75.318  1.00 47.35  ? 620 ILE A CB  1 
ATOM   4870  C  CG1 . ILE A 1 620 ? 79.416  102.996 75.564  1.00 47.35  ? 620 ILE A CG1 1 
ATOM   4871  C  CG2 . ILE A 1 620 ? 81.516  102.085 74.630  1.00 47.35  ? 620 ILE A CG2 1 
ATOM   4872  C  CD1 . ILE A 1 620 ? 79.101  103.746 74.298  1.00 47.35  ? 620 ILE A CD1 1 
ATOM   4873  N  N   . GLN A 1 621 ? 79.802  98.489  75.132  1.00 46.95  ? 621 GLN A N   1 
ATOM   4874  C  CA  . GLN A 1 621 ? 80.378  97.175  74.927  1.00 46.95  ? 621 GLN A CA  1 
ATOM   4875  C  C   . GLN A 1 621 ? 79.737  96.503  73.719  1.00 46.95  ? 621 GLN A C   1 
ATOM   4876  O  O   . GLN A 1 621 ? 80.404  95.753  73.001  1.00 46.95  ? 621 GLN A O   1 
ATOM   4877  C  CB  . GLN A 1 621 ? 80.220  96.345  76.190  1.00 46.95  ? 621 GLN A CB  1 
ATOM   4878  C  CG  . GLN A 1 621 ? 81.087  95.120  76.235  1.00 46.95  ? 621 GLN A CG  1 
ATOM   4879  C  CD  . GLN A 1 621 ? 81.186  94.558  77.642  1.00 46.95  ? 621 GLN A CD  1 
ATOM   4880  O  OE1 . GLN A 1 621 ? 80.578  95.082  78.577  1.00 46.95  ? 621 GLN A OE1 1 
ATOM   4881  N  NE2 . GLN A 1 621 ? 81.988  93.516  77.806  1.00 46.95  ? 621 GLN A NE2 1 
ATOM   4882  N  N   . MET A 1 622 ? 78.436  96.727  73.503  1.00 55.19  ? 622 MET A N   1 
ATOM   4883  C  CA  . MET A 1 622 ? 77.790  96.218  72.294  1.00 55.19  ? 622 MET A CA  1 
ATOM   4884  C  C   . MET A 1 622 ? 78.317  96.884  71.022  1.00 55.19  ? 622 MET A C   1 
ATOM   4885  O  O   . MET A 1 622 ? 78.455  96.220  69.990  1.00 55.19  ? 622 MET A O   1 
ATOM   4886  C  CB  . MET A 1 622 ? 76.279  96.400  72.390  1.00 55.19  ? 622 MET A CB  1 
ATOM   4887  C  CG  . MET A 1 622 ? 75.650  95.564  73.478  1.00 55.19  ? 622 MET A CG  1 
ATOM   4888  S  SD  . MET A 1 622 ? 73.907  95.239  73.201  1.00 55.19  ? 622 MET A SD  1 
ATOM   4889  C  CE  . MET A 1 622 ? 73.500  94.377  74.714  1.00 55.19  ? 622 MET A CE  1 
ATOM   4890  N  N   . LYS A 1 623 ? 78.596  98.191  71.058  1.00 48.34  ? 623 LYS A N   1 
ATOM   4891  C  CA  . LYS A 1 623 ? 79.106  98.840  69.850  1.00 48.34  ? 623 LYS A CA  1 
ATOM   4892  C  C   . LYS A 1 623 ? 80.541  98.449  69.563  1.00 48.34  ? 623 LYS A C   1 
ATOM   4893  O  O   . LYS A 1 623 ? 80.942  98.362  68.400  1.00 48.34  ? 623 LYS A O   1 
ATOM   4894  C  CB  . LYS A 1 623 ? 79.006  100.357 69.905  1.00 48.34  ? 623 LYS A CB  1 
ATOM   4895  C  CG  . LYS A 1 623 ? 77.643  100.911 69.642  1.00 48.34  ? 623 LYS A CG  1 
ATOM   4896  C  CD  . LYS A 1 623 ? 77.496  102.274 70.252  1.00 48.34  ? 623 LYS A CD  1 
ATOM   4897  C  CE  . LYS A 1 623 ? 76.106  102.813 70.030  1.00 48.34  ? 623 LYS A CE  1 
ATOM   4898  N  NZ  . LYS A 1 623 ? 75.989  104.202 70.539  1.00 48.34  ? 623 LYS A NZ  1 
ATOM   4899  N  N   . LEU A 1 624 ? 81.343  98.262  70.601  1.00 51.00  ? 624 LEU A N   1 
ATOM   4900  C  CA  . LEU A 1 624 ? 82.695  97.777  70.385  1.00 51.00  ? 624 LEU A CA  1 
ATOM   4901  C  C   . LEU A 1 624 ? 82.698  96.332  69.910  1.00 51.00  ? 624 LEU A C   1 
ATOM   4902  O  O   . LEU A 1 624 ? 83.557  95.948  69.111  1.00 51.00  ? 624 LEU A O   1 
ATOM   4903  C  CB  . LEU A 1 624 ? 83.499  97.947  71.667  1.00 51.00  ? 624 LEU A CB  1 
ATOM   4904  C  CG  . LEU A 1 624 ? 84.926  97.426  71.747  1.00 51.00  ? 624 LEU A CG  1 
ATOM   4905  C  CD1 . LEU A 1 624 ? 85.753  97.975  70.632  1.00 51.00  ? 624 LEU A CD1 1 
ATOM   4906  C  CD2 . LEU A 1 624 ? 85.527  97.818  73.073  1.00 51.00  ? 624 LEU A CD2 1 
ATOM   4907  N  N   . ALA A 1 625 ? 81.743  95.525  70.366  1.00 55.77  ? 625 ALA A N   1 
ATOM   4908  C  CA  . ALA A 1 625 ? 81.647  94.150  69.887  1.00 55.77  ? 625 ALA A CA  1 
ATOM   4909  C  C   . ALA A 1 625 ? 81.222  94.080  68.425  1.00 55.77  ? 625 ALA A C   1 
ATOM   4910  O  O   . ALA A 1 625 ? 81.702  93.219  67.680  1.00 55.77  ? 625 ALA A O   1 
ATOM   4911  C  CB  . ALA A 1 625 ? 80.678  93.357  70.755  1.00 55.77  ? 625 ALA A CB  1 
ATOM   4912  N  N   . ARG A 1 626 ? 80.334  94.977  67.994  1.00 54.41  ? 626 ARG A N   1 
ATOM   4913  C  CA  . ARG A 1 626 ? 79.947  95.021  66.587  1.00 54.41  ? 626 ARG A CA  1 
ATOM   4914  C  C   . ARG A 1 626 ? 81.106  95.449  65.708  1.00 54.41  ? 626 ARG A C   1 
ATOM   4915  O  O   . ARG A 1 626 ? 81.305  94.890  64.624  1.00 54.41  ? 626 ARG A O   1 
ATOM   4916  C  CB  . ARG A 1 626 ? 78.786  95.990  66.379  1.00 54.41  ? 626 ARG A CB  1 
ATOM   4917  C  CG  . ARG A 1 626 ? 78.278  96.022  64.954  1.00 54.41  ? 626 ARG A CG  1 
ATOM   4918  C  CD  . ARG A 1 626 ? 77.126  96.978  64.770  1.00 54.41  ? 626 ARG A CD  1 
ATOM   4919  N  NE  . ARG A 1 626 ? 76.062  96.785  65.742  1.00 54.41  ? 626 ARG A NE  1 
ATOM   4920  C  CZ  . ARG A 1 626 ? 75.418  97.784  66.330  1.00 54.41  ? 626 ARG A CZ  1 
ATOM   4921  N  NH1 . ARG A 1 626 ? 75.733  99.034  66.032  1.00 54.41  ? 626 ARG A NH1 1 
ATOM   4922  N  NH2 . ARG A 1 626 ? 74.456  97.538  67.206  1.00 54.41  ? 626 ARG A NH2 1 
ATOM   4923  N  N   . LEU A 1 627 ? 81.897  96.414  66.174  1.00 57.67  ? 627 LEU A N   1 
ATOM   4924  C  CA  . LEU A 1 627 ? 83.062  96.843  65.417  1.00 57.67  ? 627 LEU A CA  1 
ATOM   4925  C  C   . LEU A 1 627 ? 84.113  95.754  65.320  1.00 57.67  ? 627 LEU A C   1 
ATOM   4926  O  O   . LEU A 1 627 ? 84.851  95.698  64.332  1.00 57.67  ? 627 LEU A O   1 
ATOM   4927  C  CB  . LEU A 1 627 ? 83.673  98.092  66.031  1.00 57.67  ? 627 LEU A CB  1 
ATOM   4928  C  CG  . LEU A 1 627 ? 84.397  98.884  64.949  1.00 57.67  ? 627 LEU A CG  1 
ATOM   4929  C  CD1 . LEU A 1 627 ? 83.403  99.278  63.880  1.00 57.67  ? 627 LEU A CD1 1 
ATOM   4930  C  CD2 . LEU A 1 627 ? 85.100  100.089 65.481  1.00 57.67  ? 627 LEU A CD2 1 
ATOM   4931  N  N   . GLU A 1 628 ? 84.203  94.879  66.317  1.00 61.81  ? 628 GLU A N   1 
ATOM   4932  C  CA  . GLU A 1 628 ? 85.135  93.771  66.181  1.00 61.81  ? 628 GLU A CA  1 
ATOM   4933  C  C   . GLU A 1 628 ? 84.589  92.729  65.222  1.00 61.81  ? 628 GLU A C   1 
ATOM   4934  O  O   . GLU A 1 628 ? 85.344  92.149  64.435  1.00 61.81  ? 628 GLU A O   1 
ATOM   4935  C  CB  . GLU A 1 628 ? 85.435  93.149  67.537  1.00 61.81  ? 628 GLU A CB  1 
ATOM   4936  C  CG  . GLU A 1 628 ? 86.633  93.769  68.197  1.00 61.81  ? 628 GLU A CG  1 
ATOM   4937  C  CD  . GLU A 1 628 ? 87.919  93.101  67.773  1.00 61.81  ? 628 GLU A CD  1 
ATOM   4938  O  OE1 . GLU A 1 628 ? 87.849  92.042  67.118  1.00 61.81  ? 628 GLU A OE1 1 
ATOM   4939  O  OE2 . GLU A 1 628 ? 89.001  93.634  68.088  1.00 61.81  ? 628 GLU A OE2 1 
ATOM   4940  N  N   . PHE A 1 629 ? 83.286  92.463  65.288  1.00 67.35  ? 629 PHE A N   1 
ATOM   4941  C  CA  . PHE A 1 629 ? 82.708  91.452  64.420  1.00 67.35  ? 629 PHE A CA  1 
ATOM   4942  C  C   . PHE A 1 629 ? 82.697  91.910  62.972  1.00 67.35  ? 629 PHE A C   1 
ATOM   4943  O  O   . PHE A 1 629 ? 82.873  91.103  62.058  1.00 67.35  ? 629 PHE A O   1 
ATOM   4944  C  CB  . PHE A 1 629 ? 81.292  91.133  64.888  1.00 67.35  ? 629 PHE A CB  1 
ATOM   4945  C  CG  . PHE A 1 629 ? 80.569  90.164  64.014  1.00 67.35  ? 629 PHE A CG  1 
ATOM   4946  C  CD1 . PHE A 1 629 ? 80.921  88.832  63.991  1.00 67.35  ? 629 PHE A CD1 1 
ATOM   4947  C  CD2 . PHE A 1 629 ? 79.515  90.591  63.226  1.00 67.35  ? 629 PHE A CD2 1 
ATOM   4948  C  CE1 . PHE A 1 629 ? 80.248  87.945  63.182  1.00 67.35  ? 629 PHE A CE1 1 
ATOM   4949  C  CE2 . PHE A 1 629 ? 78.838  89.714  62.422  1.00 67.35  ? 629 PHE A CE2 1 
ATOM   4950  C  CZ  . PHE A 1 629 ? 79.206  88.388  62.397  1.00 67.35  ? 629 PHE A CZ  1 
ATOM   4951  N  N   . GLU A 1 630 ? 82.515  93.209  62.747  1.00 67.04  ? 630 GLU A N   1 
ATOM   4952  C  CA  . GLU A 1 630 ? 82.577  93.734  61.389  1.00 67.04  ? 630 GLU A CA  1 
ATOM   4953  C  C   . GLU A 1 630 ? 83.977  93.647  60.799  1.00 67.04  ? 630 GLU A C   1 
ATOM   4954  O  O   . GLU A 1 630 ? 84.135  93.338  59.614  1.00 67.04  ? 630 GLU A O   1 
ATOM   4955  C  CB  . GLU A 1 630 ? 82.085  95.176  61.364  1.00 67.04  ? 630 GLU A CB  1 
ATOM   4956  C  CG  . GLU A 1 630 ? 81.403  95.561  60.077  1.00 67.04  ? 630 GLU A CG  1 
ATOM   4957  C  CD  . GLU A 1 630 ? 80.825  96.954  60.124  1.00 67.04  ? 630 GLU A CD  1 
ATOM   4958  O  OE1 . GLU A 1 630 ? 81.450  97.840  60.742  1.00 67.04  ? 630 GLU A OE1 1 
ATOM   4959  O  OE2 . GLU A 1 630 ? 79.739  97.164  59.547  1.00 67.04  ? 630 GLU A OE2 1 
ATOM   4960  N  N   . SER A 1 631 ? 84.999  93.906  61.612  1.00 71.31  ? 631 SER A N   1 
ATOM   4961  C  CA  . SER A 1 631 ? 86.378  93.774  61.160  1.00 71.31  ? 631 SER A CA  1 
ATOM   4962  C  C   . SER A 1 631 ? 86.796  92.328  60.950  1.00 71.31  ? 631 SER A C   1 
ATOM   4963  O  O   . SER A 1 631 ? 87.599  92.044  60.055  1.00 71.31  ? 631 SER A O   1 
ATOM   4964  C  CB  . SER A 1 631 ? 87.318  94.442  62.159  1.00 71.31  ? 631 SER A CB  1 
ATOM   4965  O  OG  . SER A 1 631 ? 87.142  93.896  63.451  1.00 71.31  ? 631 SER A OG  1 
ATOM   4966  N  N   . LEU A 1 632 ? 86.286  91.413  61.770  1.00 70.85  ? 632 LEU A N   1 
ATOM   4967  C  CA  . LEU A 1 632 ? 86.591  89.999  61.594  1.00 70.85  ? 632 LEU A CA  1 
ATOM   4968  C  C   . LEU A 1 632 ? 85.952  89.442  60.325  1.00 70.85  ? 632 LEU A C   1 
ATOM   4969  O  O   . LEU A 1 632 ? 86.553  88.617  59.630  1.00 70.85  ? 632 LEU A O   1 
ATOM   4970  C  CB  . LEU A 1 632 ? 86.150  89.225  62.833  1.00 70.85  ? 632 LEU A CB  1 
ATOM   4971  C  CG  . LEU A 1 632 ? 86.249  87.710  62.778  1.00 70.85  ? 632 LEU A CG  1 
ATOM   4972  C  CD1 . LEU A 1 632 ? 87.710  87.350  62.687  1.00 70.85  ? 632 LEU A CD1 1 
ATOM   4973  C  CD2 . LEU A 1 632 ? 85.624  87.088  64.002  1.00 70.85  ? 632 LEU A CD2 1 
ATOM   4974  N  N   . GLU A 1 633 ? 84.744  89.899  59.997  1.00 74.30  ? 633 GLU A N   1 
ATOM   4975  C  CA  . GLU A 1 633 ? 84.089  89.487  58.758  1.00 74.30  ? 633 GLU A CA  1 
ATOM   4976  C  C   . GLU A 1 633 ? 84.785  90.042  57.522  1.00 74.30  ? 633 GLU A C   1 
ATOM   4977  O  O   . GLU A 1 633 ? 84.762  89.407  56.462  1.00 74.30  ? 633 GLU A O   1 
ATOM   4978  C  CB  . GLU A 1 633 ? 82.624  89.908  58.762  1.00 74.30  ? 633 GLU A CB  1 
ATOM   4979  C  CG  . GLU A 1 633 ? 81.756  89.156  59.749  1.00 74.30  ? 633 GLU A CG  1 
ATOM   4980  C  CD  . GLU A 1 633 ? 81.912  87.662  59.655  1.00 74.30  ? 633 GLU A CD  1 
ATOM   4981  O  OE1 . GLU A 1 633 ? 81.809  87.116  58.538  1.00 74.30  ? 633 GLU A OE1 1 
ATOM   4982  O  OE2 . GLU A 1 633 ? 82.135  87.030  60.705  1.00 74.30  ? 633 GLU A OE2 1 
ATOM   4983  N  N   . ALA A 1 634 ? 85.396  91.227  57.629  1.00 75.04  ? 634 ALA A N   1 
ATOM   4984  C  CA  . ALA A 1 634 ? 86.182  91.761  56.515  1.00 75.04  ? 634 ALA A CA  1 
ATOM   4985  C  C   . ALA A 1 634 ? 87.389  90.883  56.203  1.00 75.04  ? 634 ALA A C   1 
ATOM   4986  O  O   . ALA A 1 634 ? 87.744  90.707  55.031  1.00 75.04  ? 634 ALA A O   1 
ATOM   4987  C  CB  . ALA A 1 634 ? 86.626  93.190  56.826  1.00 75.04  ? 634 ALA A CB  1 
ATOM   4988  N  N   . LEU A 1 635 ? 88.049  90.351  57.233  1.00 74.35  ? 635 LEU A N   1 
ATOM   4989  C  CA  . LEU A 1 635 ? 89.139  89.410  57.000  1.00 74.35  ? 635 LEU A CA  1 
ATOM   4990  C  C   . LEU A 1 635 ? 88.595  88.132  56.376  1.00 74.35  ? 635 LEU A C   1 
ATOM   4991  O  O   . LEU A 1 635 ? 89.243  87.514  55.523  1.00 74.35  ? 635 LEU A O   1 
ATOM   4992  C  CB  . LEU A 1 635 ? 89.880  89.109  58.301  1.00 74.35  ? 635 LEU A CB  1 
ATOM   4993  C  CG  . LEU A 1 635 ? 90.783  90.207  58.856  1.00 74.35  ? 635 LEU A CG  1 
ATOM   4994  C  CD1 . LEU A 1 635 ? 91.709  89.630  59.900  1.00 74.35  ? 635 LEU A CD1 1 
ATOM   4995  C  CD2 . LEU A 1 635 ? 91.583  90.865  57.755  1.00 74.35  ? 635 LEU A CD2 1 
ATOM   4996  N  N   . LYS A 1 636 ? 87.406  87.724  56.816  1.00 79.36  ? 636 LYS A N   1 
ATOM   4997  C  CA  . LYS A 1 636 ? 86.726  86.554  56.283  1.00 79.36  ? 636 LYS A CA  1 
ATOM   4998  C  C   . LYS A 1 636 ? 86.317  86.758  54.831  1.00 79.36  ? 636 LYS A C   1 
ATOM   4999  O  O   . LYS A 1 636 ? 86.377  85.816  54.036  1.00 79.36  ? 636 LYS A O   1 
ATOM   5000  C  CB  . LYS A 1 636 ? 85.509  86.230  57.146  1.00 79.36  ? 636 LYS A CB  1 
ATOM   5001  C  CG  . LYS A 1 636 ? 84.904  84.866  56.899  1.00 79.36  ? 636 LYS A CG  1 
ATOM   5002  C  CD  . LYS A 1 636 ? 84.010  84.486  58.061  1.00 79.36  ? 636 LYS A CD  1 
ATOM   5003  C  CE  . LYS A 1 636 ? 83.352  83.135  57.863  1.00 79.36  ? 636 LYS A CE  1 
ATOM   5004  N  NZ  . LYS A 1 636 ? 82.455  82.790  59.008  1.00 79.36  ? 636 LYS A NZ  1 
ATOM   5005  N  N   . GLN A 1 637 ? 85.898  87.969  54.468  1.00 86.78  ? 637 GLN A N   1 
ATOM   5006  C  CA  . GLN A 1 637 ? 85.526  88.247  53.087  1.00 86.78  ? 637 GLN A CA  1 
ATOM   5007  C  C   . GLN A 1 637 ? 86.714  88.270  52.136  1.00 86.78  ? 637 GLN A C   1 
ATOM   5008  O  O   . GLN A 1 637 ? 86.564  87.849  50.984  1.00 86.78  ? 637 GLN A O   1 
ATOM   5009  C  CB  . GLN A 1 637 ? 84.792  89.583  52.997  1.00 86.78  ? 637 GLN A CB  1 
ATOM   5010  C  CG  . GLN A 1 637 ? 83.930  89.724  51.760  1.00 86.78  ? 637 GLN A CG  1 
ATOM   5011  C  CD  . GLN A 1 637 ? 82.820  88.693  51.716  1.00 86.78  ? 637 GLN A CD  1 
ATOM   5012  O  OE1 . GLN A 1 637 ? 81.816  88.812  52.419  1.00 86.78  ? 637 GLN A OE1 1 
ATOM   5013  N  NE2 . GLN A 1 637 ? 82.998  87.669  50.891  1.00 86.78  ? 637 GLN A NE2 1 
ATOM   5014  N  N   . GLN A 1 638 ? 87.884  88.738  52.580  1.00 84.88  ? 638 GLN A N   1 
ATOM   5015  C  CA  . GLN A 1 638 ? 89.065  88.666  51.722  1.00 84.88  ? 638 GLN A CA  1 
ATOM   5016  C  C   . GLN A 1 638 ? 89.544  87.228  51.569  1.00 84.88  ? 638 GLN A C   1 
ATOM   5017  O  O   . GLN A 1 638 ? 90.185  86.888  50.568  1.00 84.88  ? 638 GLN A O   1 
ATOM   5018  C  CB  . GLN A 1 638 ? 90.184  89.542  52.283  1.00 84.88  ? 638 GLN A CB  1 
ATOM   5019  N  N   . GLN A 1 639 ? 89.241  86.381  52.552  1.00 90.29  ? 639 GLN A N   1 
ATOM   5020  C  CA  . GLN A 1 639 ? 89.527  84.955  52.464  1.00 90.29  ? 639 GLN A CA  1 
ATOM   5021  C  C   . GLN A 1 639 ? 88.500  84.244  51.588  1.00 90.29  ? 639 GLN A C   1 
ATOM   5022  O  O   . GLN A 1 639 ? 88.844  83.309  50.858  1.00 90.29  ? 639 GLN A O   1 
ATOM   5023  C  CB  . GLN A 1 639 ? 89.563  84.336  53.862  1.00 90.29  ? 639 GLN A CB  1 
ATOM   5024  N  N   . MET A 1 640 ? 87.237  84.658  51.668  1.00 81.45  ? 640 MET A N   1 
ATOM   5025  C  CA  . MET A 1 640 ? 86.149  83.957  50.999  1.00 81.45  ? 640 MET A CA  1 
ATOM   5026  C  C   . MET A 1 640 ? 86.190  84.178  49.495  1.00 81.45  ? 640 MET A C   1 
ATOM   5027  O  O   . MET A 1 640 ? 86.728  83.352  48.756  1.00 81.45  ? 640 MET A O   1 
ATOM   5028  C  CB  . MET A 1 640 ? 84.799  84.418  51.545  1.00 81.45  ? 640 MET A CB  1 
ATOM   5029  N  N   . SER B 1 14  ? 88.428  54.914  50.895  1.00 74.79  ? 14  SER B N   1 
ATOM   5030  C  CA  . SER B 1 14  ? 89.572  54.146  51.371  1.00 74.79  ? 14  SER B CA  1 
ATOM   5031  C  C   . SER B 1 14  ? 90.480  55.030  52.209  1.00 74.79  ? 14  SER B C   1 
ATOM   5032  O  O   . SER B 1 14  ? 91.665  54.757  52.379  1.00 74.79  ? 14  SER B O   1 
ATOM   5033  C  CB  . SER B 1 14  ? 90.341  53.549  50.192  1.00 74.79  ? 14  SER B CB  1 
ATOM   5034  O  OG  . SER B 1 14  ? 90.960  54.564  49.422  1.00 74.79  ? 14  SER B OG  1 
ATOM   5035  N  N   . PHE B 1 15  ? 89.891  56.095  52.734  1.00 61.83  ? 15  PHE B N   1 
ATOM   5036  C  CA  . PHE B 1 15  ? 90.591  57.103  53.510  1.00 61.83  ? 15  PHE B CA  1 
ATOM   5037  C  C   . PHE B 1 15  ? 90.815  56.642  54.947  1.00 61.83  ? 15  PHE B C   1 
ATOM   5038  O  O   . PHE B 1 15  ? 90.462  55.529  55.345  1.00 61.83  ? 15  PHE B O   1 
ATOM   5039  C  CB  . PHE B 1 15  ? 89.818  58.422  53.478  1.00 61.83  ? 15  PHE B CB  1 
ATOM   5040  C  CG  . PHE B 1 15  ? 88.463  58.355  54.131  1.00 61.83  ? 15  PHE B CG  1 
ATOM   5041  C  CD1 . PHE B 1 15  ? 87.362  57.907  53.421  1.00 61.83  ? 15  PHE B CD1 1 
ATOM   5042  C  CD2 . PHE B 1 15  ? 88.285  58.769  55.436  1.00 61.83  ? 15  PHE B CD2 1 
ATOM   5043  C  CE1 . PHE B 1 15  ? 86.130  57.848  54.004  1.00 61.83  ? 15  PHE B CE1 1 
ATOM   5044  C  CE2 . PHE B 1 15  ? 87.051  58.707  56.025  1.00 61.83  ? 15  PHE B CE2 1 
ATOM   5045  C  CZ  . PHE B 1 15  ? 85.970  58.247  55.304  1.00 61.83  ? 15  PHE B CZ  1 
ATOM   5046  N  N   . THR B 1 16  ? 91.411  57.536  55.735  1.00 56.25  ? 16  THR B N   1 
ATOM   5047  C  CA  . THR B 1 16  ? 91.659  57.308  57.147  1.00 56.25  ? 16  THR B CA  1 
ATOM   5048  C  C   . THR B 1 16  ? 90.551  57.975  57.939  1.00 56.25  ? 16  THR B C   1 
ATOM   5049  O  O   . THR B 1 16  ? 90.367  59.193  57.814  1.00 56.25  ? 16  THR B O   1 
ATOM   5050  C  CB  . THR B 1 16  ? 93.011  57.866  57.561  1.00 56.25  ? 16  THR B CB  1 
ATOM   5051  O  OG1 . THR B 1 16  ? 93.167  59.182  57.020  1.00 56.25  ? 16  THR B OG1 1 
ATOM   5052  C  CG2 . THR B 1 16  ? 94.128  56.980  57.048  1.00 56.25  ? 16  THR B CG2 1 
ATOM   5053  N  N   . PRO B 1 17  ? 89.807  57.241  58.754  1.00 55.53  ? 17  PRO B N   1 
ATOM   5054  C  CA  . PRO B 1 17  ? 88.709  57.849  59.509  1.00 55.53  ? 17  PRO B CA  1 
ATOM   5055  C  C   . PRO B 1 17  ? 89.214  58.717  60.643  1.00 55.53  ? 17  PRO B C   1 
ATOM   5056  O  O   . PRO B 1 17  ? 90.156  58.360  61.350  1.00 55.53  ? 17  PRO B O   1 
ATOM   5057  C  CB  . PRO B 1 17  ? 87.942  56.643  60.055  1.00 55.53  ? 17  PRO B CB  1 
ATOM   5058  C  CG  . PRO B 1 17  ? 88.547  55.444  59.405  1.00 55.53  ? 17  PRO B CG  1 
ATOM   5059  C  CD  . PRO B 1 17  ? 89.935  55.810  59.039  1.00 55.53  ? 17  PRO B CD  1 
ATOM   5060  N  N   . LEU B 1 18  ? 88.601  59.884  60.789  1.00 46.97  ? 18  LEU B N   1 
ATOM   5061  C  CA  . LEU B 1 18  ? 89.017  60.822  61.816  1.00 46.97  ? 18  LEU B CA  1 
ATOM   5062  C  C   . LEU B 1 18  ? 87.931  61.115  62.835  1.00 46.97  ? 18  LEU B C   1 
ATOM   5063  O  O   . LEU B 1 18  ? 88.221  61.187  64.029  1.00 46.97  ? 18  LEU B O   1 
ATOM   5064  C  CB  . LEU B 1 18  ? 89.467  62.126  61.156  1.00 46.97  ? 18  LEU B CB  1 
ATOM   5065  C  CG  . LEU B 1 18  ? 90.645  61.987  60.198  1.00 46.97  ? 18  LEU B CG  1 
ATOM   5066  C  CD1 . LEU B 1 18  ? 91.095  63.350  59.706  1.00 46.97  ? 18  LEU B CD1 1 
ATOM   5067  C  CD2 . LEU B 1 18  ? 91.789  61.237  60.840  1.00 46.97  ? 18  LEU B CD2 1 
ATOM   5068  N  N   . VAL B 1 19  ? 86.687  61.273  62.412  1.00 39.92  ? 19  VAL B N   1 
ATOM   5069  C  CA  . VAL B 1 19  ? 85.594  61.643  63.299  1.00 39.92  ? 19  VAL B CA  1 
ATOM   5070  C  C   . VAL B 1 19  ? 84.456  60.661  63.097  1.00 39.92  ? 19  VAL B C   1 
ATOM   5071  O  O   . VAL B 1 19  ? 84.099  60.349  61.959  1.00 39.92  ? 19  VAL B O   1 
ATOM   5072  C  CB  . VAL B 1 19  ? 85.157  63.092  63.017  1.00 39.92  ? 19  VAL B CB  1 
ATOM   5073  C  CG1 . VAL B 1 19  ? 83.756  63.364  63.487  1.00 39.92  ? 19  VAL B CG1 1 
ATOM   5074  C  CG2 . VAL B 1 19  ? 86.117  64.041  63.659  1.00 39.92  ? 19  VAL B CG2 1 
ATOM   5075  N  N   . VAL B 1 20  ? 83.871  60.185  64.189  1.00 38.89  ? 20  VAL B N   1 
ATOM   5076  C  CA  . VAL B 1 20  ? 82.753  59.256  64.139  1.00 38.89  ? 20  VAL B CA  1 
ATOM   5077  C  C   . VAL B 1 20  ? 81.484  59.988  64.518  1.00 38.89  ? 20  VAL B C   1 
ATOM   5078  O  O   . VAL B 1 20  ? 81.441  60.677  65.539  1.00 38.89  ? 20  VAL B O   1 
ATOM   5079  C  CB  . VAL B 1 20  ? 82.971  58.073  65.088  1.00 38.89  ? 20  VAL B CB  1 
ATOM   5080  C  CG1 . VAL B 1 20  ? 81.853  57.091  64.948  1.00 38.89  ? 20  VAL B CG1 1 
ATOM   5081  C  CG2 . VAL B 1 20  ? 84.263  57.411  64.769  1.00 38.89  ? 20  VAL B CG2 1 
ATOM   5082  N  N   . ILE B 1 21  ? 80.459  59.850  63.690  1.00 43.92  ? 21  ILE B N   1 
ATOM   5083  C  CA  . ILE B 1 21  ? 79.136  60.379  63.970  1.00 43.92  ? 21  ILE B CA  1 
ATOM   5084  C  C   . ILE B 1 21  ? 78.225  59.207  64.254  1.00 43.92  ? 21  ILE B C   1 
ATOM   5085  O  O   . ILE B 1 21  ? 78.128  58.289  63.436  1.00 43.92  ? 21  ILE B O   1 
ATOM   5086  C  CB  . ILE B 1 21  ? 78.596  61.191  62.790  1.00 43.92  ? 21  ILE B CB  1 
ATOM   5087  C  CG1 . ILE B 1 21  ? 79.492  62.382  62.509  1.00 43.92  ? 21  ILE B CG1 1 
ATOM   5088  C  CG2 . ILE B 1 21  ? 77.184  61.617  63.045  1.00 43.92  ? 21  ILE B CG2 1 
ATOM   5089  C  CD1 . ILE B 1 21  ? 79.027  63.187  61.343  1.00 43.92  ? 21  ILE B CD1 1 
ATOM   5090  N  N   . GLU B 1 22  ? 77.579  59.204  65.406  1.00 58.17  ? 22  GLU B N   1 
ATOM   5091  C  CA  . GLU B 1 22  ? 76.661  58.127  65.738  1.00 58.17  ? 22  GLU B CA  1 
ATOM   5092  C  C   . GLU B 1 22  ? 75.254  58.686  65.621  1.00 58.17  ? 22  GLU B C   1 
ATOM   5093  O  O   . GLU B 1 22  ? 74.863  59.560  66.398  1.00 58.17  ? 22  GLU B O   1 
ATOM   5094  C  CB  . GLU B 1 22  ? 76.909  57.578  67.135  1.00 58.17  ? 22  GLU B CB  1 
ATOM   5095  C  CG  . GLU B 1 22  ? 76.010  56.393  67.455  1.00 58.17  ? 22  GLU B CG  1 
ATOM   5096  C  CD  . GLU B 1 22  ? 76.000  56.023  68.928  1.00 58.17  ? 22  GLU B CD  1 
ATOM   5097  O  OE1 . GLU B 1 22  ? 76.618  56.751  69.733  1.00 58.17  ? 22  GLU B OE1 1 
ATOM   5098  O  OE2 . GLU B 1 22  ? 75.375  54.999  69.281  1.00 58.17  ? 22  GLU B OE2 1 
ATOM   5099  N  N   . LEU B 1 23  ? 74.501  58.199  64.646  1.00 65.06  ? 23  LEU B N   1 
ATOM   5100  C  CA  . LEU B 1 23  ? 73.111  58.593  64.533  1.00 65.06  ? 23  LEU B CA  1 
ATOM   5101  C  C   . LEU B 1 23  ? 72.256  57.800  65.511  1.00 65.06  ? 23  LEU B C   1 
ATOM   5102  O  O   . LEU B 1 23  ? 72.705  56.835  66.130  1.00 65.06  ? 23  LEU B O   1 
ATOM   5103  C  CB  . LEU B 1 23  ? 72.617  58.388  63.104  1.00 65.06  ? 23  LEU B CB  1 
ATOM   5104  C  CG  . LEU B 1 23  ? 73.252  59.241  62.003  1.00 65.06  ? 23  LEU B CG  1 
ATOM   5105  C  CD1 . LEU B 1 23  ? 72.378  59.283  60.782  1.00 65.06  ? 23  LEU B CD1 1 
ATOM   5106  C  CD2 . LEU B 1 23  ? 73.497  60.643  62.474  1.00 65.06  ? 23  LEU B CD2 1 
ATOM   5107  N  N   . ALA B 1 24  ? 71.002  58.217  65.647  1.00 79.52  ? 24  ALA B N   1 
ATOM   5108  C  CA  . ALA B 1 24  ? 70.072  57.473  66.477  1.00 79.52  ? 24  ALA B CA  1 
ATOM   5109  C  C   . ALA B 1 24  ? 69.537  56.283  65.684  1.00 79.52  ? 24  ALA B C   1 
ATOM   5110  O  O   . ALA B 1 24  ? 69.864  56.084  64.512  1.00 79.52  ? 24  ALA B O   1 
ATOM   5111  C  CB  . ALA B 1 24  ? 68.935  58.369  66.956  1.00 79.52  ? 24  ALA B CB  1 
ATOM   5112  N  N   . GLN B 1 25  ? 68.677  55.490  66.315  1.00 88.56  ? 25  GLN B N   1 
ATOM   5113  C  CA  . GLN B 1 25  ? 68.094  54.338  65.629  1.00 88.56  ? 25  GLN B CA  1 
ATOM   5114  C  C   . GLN B 1 25  ? 66.966  54.740  64.683  1.00 88.56  ? 25  GLN B C   1 
ATOM   5115  O  O   . GLN B 1 25  ? 67.036  54.496  63.476  1.00 88.56  ? 25  GLN B O   1 
ATOM   5116  C  CB  . GLN B 1 25  ? 67.642  53.293  66.649  1.00 88.56  ? 25  GLN B CB  1 
ATOM   5117  C  CG  . GLN B 1 25  ? 68.826  52.673  67.353  1.00 88.56  ? 25  GLN B CG  1 
ATOM   5118  C  CD  . GLN B 1 25  ? 69.628  51.765  66.433  1.00 88.56  ? 25  GLN B CD  1 
ATOM   5119  O  OE1 . GLN B 1 25  ? 69.095  51.199  65.478  1.00 88.56  ? 25  GLN B OE1 1 
ATOM   5120  N  NE2 . GLN B 1 25  ? 70.922  51.647  66.701  1.00 88.56  ? 25  GLN B NE2 1 
ATOM   5121  N  N   . ASP B 1 26  ? 65.928  55.380  65.218  1.00 96.54  ? 26  ASP B N   1 
ATOM   5122  C  CA  . ASP B 1 26  ? 64.738  55.763  64.453  1.00 96.54  ? 26  ASP B CA  1 
ATOM   5123  C  C   . ASP B 1 26  ? 65.027  57.066  63.713  1.00 96.54  ? 26  ASP B C   1 
ATOM   5124  O  O   . ASP B 1 26  ? 64.590  58.157  64.087  1.00 96.54  ? 26  ASP B O   1 
ATOM   5125  C  CB  . ASP B 1 26  ? 63.528  55.889  65.369  1.00 96.54  ? 26  ASP B CB  1 
ATOM   5126  N  N   . VAL B 1 27  ? 65.771  56.929  62.620  1.00 93.25  ? 27  VAL B N   1 
ATOM   5127  C  CA  . VAL B 1 27  ? 66.114  58.028  61.731  1.00 93.25  ? 27  VAL B CA  1 
ATOM   5128  C  C   . VAL B 1 27  ? 65.652  57.650  60.335  1.00 93.25  ? 27  VAL B C   1 
ATOM   5129  O  O   . VAL B 1 27  ? 66.035  56.592  59.823  1.00 93.25  ? 27  VAL B O   1 
ATOM   5130  C  CB  . VAL B 1 27  ? 67.627  58.291  61.736  1.00 93.25  ? 27  VAL B CB  1 
ATOM   5131  C  CG1 . VAL B 1 27  ? 68.027  59.178  60.574  1.00 93.25  ? 27  VAL B CG1 1 
ATOM   5132  C  CG2 . VAL B 1 27  ? 68.058  58.870  63.058  1.00 93.25  ? 27  VAL B CG2 1 
ATOM   5133  N  N   . LYS B 1 28  ? 64.810  58.491  59.732  1.00 100.91 ? 28  LYS B N   1 
ATOM   5134  C  CA  . LYS B 1 28  ? 64.264  58.173  58.421  1.00 100.91 ? 28  LYS B CA  1 
ATOM   5135  C  C   . LYS B 1 28  ? 65.326  58.318  57.334  1.00 100.91 ? 28  LYS B C   1 
ATOM   5136  O  O   . LYS B 1 28  ? 66.382  58.928  57.525  1.00 100.91 ? 28  LYS B O   1 
ATOM   5137  C  CB  . LYS B 1 28  ? 63.085  59.086  58.108  1.00 100.91 ? 28  LYS B CB  1 
ATOM   5138  C  CG  . LYS B 1 28  ? 62.105  59.161  59.243  1.00 100.91 ? 28  LYS B CG  1 
ATOM   5139  C  CD  . LYS B 1 28  ? 61.030  60.195  59.011  1.00 100.91 ? 28  LYS B CD  1 
ATOM   5140  C  CE  . LYS B 1 28  ? 60.553  60.736  60.347  1.00 100.91 ? 28  LYS B CE  1 
ATOM   5141  N  NZ  . LYS B 1 28  ? 59.356  61.607  60.216  1.00 100.91 ? 28  LYS B NZ  1 
ATOM   5142  N  N   . GLU B 1 29  ? 65.017  57.753  56.165  1.00 104.13 ? 29  GLU B N   1 
ATOM   5143  C  CA  . GLU B 1 29  ? 65.993  57.721  55.084  1.00 104.13 ? 29  GLU B CA  1 
ATOM   5144  C  C   . GLU B 1 29  ? 66.191  59.081  54.440  1.00 104.13 ? 29  GLU B C   1 
ATOM   5145  O  O   . GLU B 1 29  ? 67.276  59.359  53.920  1.00 104.13 ? 29  GLU B O   1 
ATOM   5146  C  CB  . GLU B 1 29  ? 65.583  56.684  54.047  1.00 104.13 ? 29  GLU B CB  1 
ATOM   5147  C  CG  . GLU B 1 29  ? 65.819  55.280  54.540  1.00 104.13 ? 29  GLU B CG  1 
ATOM   5148  C  CD  . GLU B 1 29  ? 67.228  55.101  55.061  1.00 104.13 ? 29  GLU B CD  1 
ATOM   5149  O  OE1 . GLU B 1 29  ? 68.181  55.334  54.288  1.00 104.13 ? 29  GLU B OE1 1 
ATOM   5150  O  OE2 . GLU B 1 29  ? 67.383  54.744  56.247  1.00 104.13 ? 29  GLU B OE2 1 
ATOM   5151  N  N   . GLU B 1 30  ? 65.155  59.923  54.441  1.00 101.44 ? 30  GLU B N   1 
ATOM   5152  C  CA  . GLU B 1 30  ? 65.255  61.226  53.794  1.00 101.44 ? 30  GLU B CA  1 
ATOM   5153  C  C   . GLU B 1 30  ? 66.229  62.128  54.536  1.00 101.44 ? 30  GLU B C   1 
ATOM   5154  O  O   . GLU B 1 30  ? 67.014  62.851  53.913  1.00 101.44 ? 30  GLU B O   1 
ATOM   5155  C  CB  . GLU B 1 30  ? 63.876  61.877  53.709  1.00 101.44 ? 30  GLU B CB  1 
ATOM   5156  C  CG  . GLU B 1 30  ? 63.871  63.251  53.065  1.00 101.44 ? 30  GLU B CG  1 
ATOM   5157  N  N   . THR B 1 31  ? 66.208  62.068  55.869  1.00 97.23  ? 31  THR B N   1 
ATOM   5158  C  CA  . THR B 1 31  ? 67.157  62.817  56.682  1.00 97.23  ? 31  THR B CA  1 
ATOM   5159  C  C   . THR B 1 31  ? 68.586  62.314  56.508  1.00 97.23  ? 31  THR B C   1 
ATOM   5160  O  O   . THR B 1 31  ? 69.525  63.117  56.548  1.00 97.23  ? 31  THR B O   1 
ATOM   5161  C  CB  . THR B 1 31  ? 66.738  62.747  58.147  1.00 97.23  ? 31  THR B CB  1 
ATOM   5162  O  OG1 . THR B 1 31  ? 65.318  62.909  58.238  1.00 97.23  ? 31  THR B OG1 1 
ATOM   5163  C  CG2 . THR B 1 31  ? 67.393  63.851  58.940  1.00 97.23  ? 31  THR B CG2 1 
ATOM   5164  N  N   . LYS B 1 32  ? 68.770  61.004  56.311  1.00 92.28  ? 32  LYS B N   1 
ATOM   5165  C  CA  . LYS B 1 32  ? 70.112  60.474  56.087  1.00 92.28  ? 32  LYS B CA  1 
ATOM   5166  C  C   . LYS B 1 32  ? 70.695  60.970  54.773  1.00 92.28  ? 32  LYS B C   1 
ATOM   5167  O  O   . LYS B 1 32  ? 71.851  61.403  54.729  1.00 92.28  ? 32  LYS B O   1 
ATOM   5168  C  CB  . LYS B 1 32  ? 70.083  58.950  56.102  1.00 92.28  ? 32  LYS B CB  1 
ATOM   5169  C  CG  . LYS B 1 32  ? 70.039  58.349  57.485  1.00 92.28  ? 32  LYS B CG  1 
ATOM   5170  C  CD  . LYS B 1 32  ? 70.113  56.834  57.440  1.00 92.28  ? 32  LYS B CD  1 
ATOM   5171  C  CE  . LYS B 1 32  ? 70.050  56.245  58.838  1.00 92.28  ? 32  LYS B CE  1 
ATOM   5172  N  NZ  . LYS B 1 32  ? 70.140  54.765  58.833  1.00 92.28  ? 32  LYS B NZ  1 
ATOM   5173  N  N   . GLU B 1 33  ? 69.912  60.920  53.696  1.00 95.06  ? 33  GLU B N   1 
ATOM   5174  C  CA  . GLU B 1 33  ? 70.393  61.409  52.409  1.00 95.06  ? 33  GLU B CA  1 
ATOM   5175  C  C   . GLU B 1 33  ? 70.533  62.921  52.392  1.00 95.06  ? 33  GLU B C   1 
ATOM   5176  O  O   . GLU B 1 33  ? 71.399  63.449  51.687  1.00 95.06  ? 33  GLU B O   1 
ATOM   5177  C  CB  . GLU B 1 33  ? 69.488  60.933  51.275  1.00 95.06  ? 33  GLU B CB  1 
ATOM   5178  C  CG  . GLU B 1 33  ? 69.204  59.429  51.244  1.00 95.06  ? 33  GLU B CG  1 
ATOM   5179  C  CD  . GLU B 1 33  ? 70.442  58.522  51.175  1.00 95.06  ? 33  GLU B CD  1 
ATOM   5180  O  OE1 . GLU B 1 33  ? 71.541  58.957  50.759  1.00 95.06  ? 33  GLU B OE1 1 
ATOM   5181  O  OE2 . GLU B 1 33  ? 70.303  57.338  51.546  1.00 95.06  ? 33  GLU B OE2 1 
ATOM   5182  N  N   . TRP B 1 34  ? 69.697  63.630  53.147  1.00 89.30  ? 34  TRP B N   1 
ATOM   5183  C  CA  . TRP B 1 34  ? 69.832  65.078  53.200  1.00 89.30  ? 34  TRP B CA  1 
ATOM   5184  C  C   . TRP B 1 34  ? 71.079  65.477  53.964  1.00 89.30  ? 34  TRP B C   1 
ATOM   5185  O  O   . TRP B 1 34  ? 71.765  66.432  53.584  1.00 89.30  ? 34  TRP B O   1 
ATOM   5186  C  CB  . TRP B 1 34  ? 68.595  65.694  53.838  1.00 89.30  ? 34  TRP B CB  1 
ATOM   5187  C  CG  . TRP B 1 34  ? 68.747  67.121  54.136  1.00 89.30  ? 34  TRP B CG  1 
ATOM   5188  C  CD1 . TRP B 1 34  ? 68.628  68.150  53.265  1.00 89.30  ? 34  TRP B CD1 1 
ATOM   5189  C  CD2 . TRP B 1 34  ? 69.014  67.699  55.411  1.00 89.30  ? 34  TRP B CD2 1 
ATOM   5190  N  NE1 . TRP B 1 34  ? 68.823  69.341  53.912  1.00 89.30  ? 34  TRP B NE1 1 
ATOM   5191  C  CE2 . TRP B 1 34  ? 69.061  69.089  55.235  1.00 89.30  ? 34  TRP B CE2 1 
ATOM   5192  C  CE3 . TRP B 1 34  ? 69.228  67.173  56.684  1.00 89.30  ? 34  TRP B CE3 1 
ATOM   5193  C  CZ2 . TRP B 1 34  ? 69.312  69.963  56.282  1.00 89.30  ? 34  TRP B CZ2 1 
ATOM   5194  C  CZ3 . TRP B 1 34  ? 69.475  68.041  57.722  1.00 89.30  ? 34  TRP B CZ3 1 
ATOM   5195  C  CH2 . TRP B 1 34  ? 69.514  69.420  57.517  1.00 89.30  ? 34  TRP B CH2 1 
ATOM   5196  N  N   . LEU B 1 35  ? 71.383  64.763  55.047  1.00 84.27  ? 35  LEU B N   1 
ATOM   5197  C  CA  . LEU B 1 35  ? 72.616  65.020  55.779  1.00 84.27  ? 35  LEU B CA  1 
ATOM   5198  C  C   . LEU B 1 35  ? 73.840  64.631  54.963  1.00 84.27  ? 35  LEU B C   1 
ATOM   5199  O  O   . LEU B 1 35  ? 74.831  65.369  54.933  1.00 84.27  ? 35  LEU B O   1 
ATOM   5200  C  CB  . LEU B 1 35  ? 72.611  64.259  57.099  1.00 84.27  ? 35  LEU B CB  1 
ATOM   5201  C  CG  . LEU B 1 35  ? 73.880  64.473  57.915  1.00 84.27  ? 35  LEU B CG  1 
ATOM   5202  C  CD1 . LEU B 1 35  ? 73.961  65.912  58.363  1.00 84.27  ? 35  LEU B CD1 1 
ATOM   5203  C  CD2 . LEU B 1 35  ? 73.949  63.526  59.086  1.00 84.27  ? 35  LEU B CD2 1 
ATOM   5204  N  N   . LYS B 1 36  ? 73.765  63.504  54.255  1.00 79.54  ? 36  LYS B N   1 
ATOM   5205  C  CA  . LYS B 1 36  ? 74.876  63.062  53.420  1.00 79.54  ? 36  LYS B CA  1 
ATOM   5206  C  C   . LYS B 1 36  ? 75.113  63.998  52.243  1.00 79.54  ? 36  LYS B C   1 
ATOM   5207  O  O   . LYS B 1 36  ? 76.257  64.191  51.819  1.00 79.54  ? 36  LYS B O   1 
ATOM   5208  C  CB  . LYS B 1 36  ? 74.627  61.641  52.933  1.00 79.54  ? 36  LYS B CB  1 
ATOM   5209  C  CG  . LYS B 1 36  ? 75.860  60.991  52.374  1.00 79.54  ? 36  LYS B CG  1 
ATOM   5210  C  CD  . LYS B 1 36  ? 75.591  59.610  51.839  1.00 79.54  ? 36  LYS B CD  1 
ATOM   5211  C  CE  . LYS B 1 36  ? 76.890  58.937  51.444  1.00 79.54  ? 36  LYS B CE  1 
ATOM   5212  N  NZ  . LYS B 1 36  ? 76.743  57.467  51.307  1.00 79.54  ? 36  LYS B NZ  1 
ATOM   5213  N  N   . ASN B 1 37  ? 74.063  64.614  51.728  1.00 84.20  ? 37  ASN B N   1 
ATOM   5214  C  CA  . ASN B 1 37  ? 74.219  65.591  50.663  1.00 84.20  ? 37  ASN B CA  1 
ATOM   5215  C  C   . ASN B 1 37  ? 74.700  66.941  51.160  1.00 84.20  ? 37  ASN B C   1 
ATOM   5216  O  O   . ASN B 1 37  ? 75.222  67.722  50.361  1.00 84.20  ? 37  ASN B O   1 
ATOM   5217  C  CB  . ASN B 1 37  ? 72.913  65.762  49.895  1.00 84.20  ? 37  ASN B CB  1 
ATOM   5218  C  CG  . ASN B 1 37  ? 72.823  64.832  48.715  1.00 84.20  ? 37  ASN B CG  1 
ATOM   5219  O  OD1 . ASN B 1 37  ? 73.826  64.544  48.063  1.00 84.20  ? 37  ASN B OD1 1 
ATOM   5220  N  ND2 . ASN B 1 37  ? 71.624  64.345  48.435  1.00 84.20  ? 37  ASN B ND2 1 
ATOM   5221  N  N   . ARG B 1 38  ? 74.547  67.239  52.447  1.00 79.79  ? 38  ARG B N   1 
ATOM   5222  C  CA  . ARG B 1 38  ? 75.112  68.468  52.979  1.00 79.79  ? 38  ARG B CA  1 
ATOM   5223  C  C   . ARG B 1 38  ? 76.534  68.294  53.475  1.00 79.79  ? 38  ARG B C   1 
ATOM   5224  O  O   . ARG B 1 38  ? 77.177  69.289  53.818  1.00 79.79  ? 38  ARG B O   1 
ATOM   5225  C  CB  . ARG B 1 38  ? 74.251  69.019  54.118  1.00 79.79  ? 38  ARG B CB  1 
ATOM   5226  C  CG  . ARG B 1 38  ? 73.042  69.772  53.614  1.00 79.79  ? 38  ARG B CG  1 
ATOM   5227  C  CD  . ARG B 1 38  ? 73.428  70.848  52.620  1.00 79.79  ? 38  ARG B CD  1 
ATOM   5228  N  NE  . ARG B 1 38  ? 74.147  71.961  53.222  1.00 79.79  ? 38  ARG B NE  1 
ATOM   5229  C  CZ  . ARG B 1 38  ? 73.548  73.017  53.759  1.00 79.79  ? 38  ARG B CZ  1 
ATOM   5230  N  NH1 . ARG B 1 38  ? 72.224  73.096  53.766  1.00 79.79  ? 38  ARG B NH1 1 
ATOM   5231  N  NH2 . ARG B 1 38  ? 74.269  73.999  54.280  1.00 79.79  ? 38  ARG B NH2 1 
ATOM   5232  N  N   . ILE B 1 39  ? 77.030  67.067  53.545  1.00 73.53  ? 39  ILE B N   1 
ATOM   5233  C  CA  . ILE B 1 39  ? 78.415  66.844  53.932  1.00 73.53  ? 39  ILE B CA  1 
ATOM   5234  C  C   . ILE B 1 39  ? 79.317  66.731  52.711  1.00 73.53  ? 39  ILE B C   1 
ATOM   5235  O  O   . ILE B 1 39  ? 80.358  67.389  52.639  1.00 73.53  ? 39  ILE B O   1 
ATOM   5236  C  CB  . ILE B 1 39  ? 78.524  65.600  54.834  1.00 73.53  ? 39  ILE B CB  1 
ATOM   5237  C  CG1 . ILE B 1 39  ? 78.105  65.943  56.255  1.00 73.53  ? 39  ILE B CG1 1 
ATOM   5238  C  CG2 . ILE B 1 39  ? 79.943  65.082  54.882  1.00 73.53  ? 39  ILE B CG2 1 
ATOM   5239  C  CD1 . ILE B 1 39  ? 78.159  64.762  57.194  1.00 73.53  ? 39  ILE B CD1 1 
ATOM   5240  N  N   . ILE B 1 40  ? 78.915  65.945  51.708  1.00 73.18  ? 40  ILE B N   1 
ATOM   5241  C  CA  . ILE B 1 40  ? 79.826  65.644  50.605  1.00 73.18  ? 40  ILE B CA  1 
ATOM   5242  C  C   . ILE B 1 40  ? 79.922  66.820  49.638  1.00 73.18  ? 40  ILE B C   1 
ATOM   5243  O  O   . ILE B 1 40  ? 80.946  66.997  48.966  1.00 73.18  ? 40  ILE B O   1 
ATOM   5244  C  CB  . ILE B 1 40  ? 79.388  64.354  49.893  1.00 73.18  ? 40  ILE B CB  1 
ATOM   5245  C  CG1 . ILE B 1 40  ? 79.263  63.226  50.894  1.00 73.18  ? 40  ILE B CG1 1 
ATOM   5246  C  CG2 . ILE B 1 40  ? 80.427  63.877  48.881  1.00 73.18  ? 40  ILE B CG2 1 
ATOM   5247  C  CD1 . ILE B 1 40  ? 78.670  61.991  50.286  1.00 73.18  ? 40  ILE B CD1 1 
ATOM   5248  N  N   . ALA B 1 41  ? 78.882  67.650  49.567  1.00 76.24  ? 41  ALA B N   1 
ATOM   5249  C  CA  . ALA B 1 41  ? 78.854  68.718  48.576  1.00 76.24  ? 41  ALA B CA  1 
ATOM   5250  C  C   . ALA B 1 41  ? 79.913  69.767  48.895  1.00 76.24  ? 41  ALA B C   1 
ATOM   5251  O  O   . ALA B 1 41  ? 80.310  69.945  50.049  1.00 76.24  ? 41  ALA B O   1 
ATOM   5252  C  CB  . ALA B 1 41  ? 77.475  69.367  48.520  1.00 76.24  ? 41  ALA B CB  1 
ATOM   5253  N  N   . LYS B 1 42  ? 80.382  70.448  47.851  1.00 77.29  ? 42  LYS B N   1 
ATOM   5254  C  CA  . LYS B 1 42  ? 81.581  71.263  47.967  1.00 77.29  ? 42  LYS B CA  1 
ATOM   5255  C  C   . LYS B 1 42  ? 81.308  72.533  48.771  1.00 77.29  ? 42  LYS B C   1 
ATOM   5256  O  O   . LYS B 1 42  ? 80.168  72.857  49.119  1.00 77.29  ? 42  LYS B O   1 
ATOM   5257  C  CB  . LYS B 1 42  ? 82.122  71.596  46.581  1.00 77.29  ? 42  LYS B CB  1 
ATOM   5258  C  CG  . LYS B 1 42  ? 82.161  70.390  45.664  1.00 77.29  ? 42  LYS B CG  1 
ATOM   5259  C  CD  . LYS B 1 42  ? 82.550  70.775  44.255  1.00 77.29  ? 42  LYS B CD  1 
ATOM   5260  C  CE  . LYS B 1 42  ? 84.047  70.944  44.120  1.00 77.29  ? 42  LYS B CE  1 
ATOM   5261  N  NZ  . LYS B 1 42  ? 84.741  69.634  44.165  1.00 77.29  ? 42  LYS B NZ  1 
ATOM   5262  N  N   . LYS B 1 43  ? 82.387  73.263  49.055  1.00 74.16  ? 43  LYS B N   1 
ATOM   5263  C  CA  . LYS B 1 43  ? 82.267  74.426  49.920  1.00 74.16  ? 43  LYS B CA  1 
ATOM   5264  C  C   . LYS B 1 43  ? 81.584  75.586  49.218  1.00 74.16  ? 43  LYS B C   1 
ATOM   5265  O  O   . LYS B 1 43  ? 80.974  76.435  49.875  1.00 74.16  ? 43  LYS B O   1 
ATOM   5266  C  CB  . LYS B 1 43  ? 83.655  74.847  50.389  1.00 74.16  ? 43  LYS B CB  1 
ATOM   5267  C  CG  . LYS B 1 43  ? 83.672  75.587  51.699  1.00 74.16  ? 43  LYS B CG  1 
ATOM   5268  C  CD  . LYS B 1 43  ? 83.215  74.697  52.839  1.00 74.16  ? 43  LYS B CD  1 
ATOM   5269  C  CE  . LYS B 1 43  ? 83.413  75.398  54.169  1.00 74.16  ? 43  LYS B CE  1 
ATOM   5270  N  NZ  . LYS B 1 43  ? 84.846  75.708  54.397  1.00 74.16  ? 43  LYS B NZ  1 
ATOM   5271  N  N   . LYS B 1 44  ? 81.670  75.631  47.893  1.00 78.45  ? 44  LYS B N   1 
ATOM   5272  C  CA  . LYS B 1 44  ? 81.006  76.659  47.106  1.00 78.45  ? 44  LYS B CA  1 
ATOM   5273  C  C   . LYS B 1 44  ? 79.540  76.350  46.831  1.00 78.45  ? 44  LYS B C   1 
ATOM   5274  O  O   . LYS B 1 44  ? 78.773  77.271  46.529  1.00 78.45  ? 44  LYS B O   1 
ATOM   5275  C  CB  . LYS B 1 44  ? 81.792  76.870  45.814  1.00 78.45  ? 44  LYS B CB  1 
ATOM   5276  C  CG  . LYS B 1 44  ? 81.973  75.614  44.999  1.00 78.45  ? 44  LYS B CG  1 
ATOM   5277  C  CD  . LYS B 1 44  ? 83.069  75.806  43.973  1.00 78.45  ? 44  LYS B CD  1 
ATOM   5278  C  CE  . LYS B 1 44  ? 84.429  75.742  44.657  1.00 78.45  ? 44  LYS B CE  1 
ATOM   5279  N  NZ  . LYS B 1 44  ? 85.575  75.794  43.710  1.00 78.45  ? 44  LYS B NZ  1 
ATOM   5280  N  N   . ASP B 1 45  ? 79.133  75.089  46.938  1.00 78.31  ? 45  ASP B N   1 
ATOM   5281  C  CA  . ASP B 1 45  ? 77.744  74.705  46.739  1.00 78.31  ? 45  ASP B CA  1 
ATOM   5282  C  C   . ASP B 1 45  ? 76.953  74.656  48.035  1.00 78.31  ? 45  ASP B C   1 
ATOM   5283  O  O   . ASP B 1 45  ? 75.848  74.108  48.052  1.00 78.31  ? 45  ASP B O   1 
ATOM   5284  C  CB  . ASP B 1 45  ? 77.683  73.341  46.055  1.00 78.31  ? 45  ASP B CB  1 
ATOM   5285  C  CG  . ASP B 1 45  ? 78.635  73.235  44.882  1.00 78.31  ? 45  ASP B CG  1 
ATOM   5286  O  OD1 . ASP B 1 45  ? 78.940  74.275  44.265  1.00 78.31  ? 45  ASP B OD1 1 
ATOM   5287  O  OD2 . ASP B 1 45  ? 79.087  72.111  44.582  1.00 78.31  ? 45  ASP B OD2 1 
ATOM   5288  N  N   . GLY B 1 46  ? 77.486  75.219  49.111  1.00 79.38  ? 46  GLY B N   1 
ATOM   5289  C  CA  . GLY B 1 46  ? 76.804  75.246  50.389  1.00 79.38  ? 46  GLY B CA  1 
ATOM   5290  C  C   . GLY B 1 46  ? 76.896  73.941  51.152  1.00 79.38  ? 46  GLY B C   1 
ATOM   5291  O  O   . GLY B 1 46  ? 76.051  73.650  52.001  1.00 79.38  ? 46  GLY B O   1 
ATOM   5292  N  N   . GLY B 1 47  ? 77.930  73.155  50.876  1.00 80.03  ? 47  GLY B N   1 
ATOM   5293  C  CA  . GLY B 1 47  ? 78.115  71.900  51.575  1.00 80.03  ? 47  GLY B CA  1 
ATOM   5294  C  C   . GLY B 1 47  ? 79.305  71.980  52.505  1.00 80.03  ? 47  GLY B C   1 
ATOM   5295  O  O   . GLY B 1 47  ? 79.579  73.041  53.071  1.00 80.03  ? 47  GLY B O   1 
ATOM   5296  N  N   . ALA B 1 48  ? 80.011  70.869  52.694  1.00 73.60  ? 48  ALA B N   1 
ATOM   5297  C  CA  . ALA B 1 48  ? 81.189  70.904  53.541  1.00 73.60  ? 48  ALA B CA  1 
ATOM   5298  C  C   . ALA B 1 48  ? 82.394  70.224  52.920  1.00 73.60  ? 48  ALA B C   1 
ATOM   5299  O  O   . ALA B 1 48  ? 83.497  70.408  53.441  1.00 73.60  ? 48  ALA B O   1 
ATOM   5300  C  CB  . ALA B 1 48  ? 80.891  70.259  54.897  1.00 73.60  ? 48  ALA B CB  1 
ATOM   5301  N  N   . GLN B 1 49  ? 82.220  69.448  51.839  1.00 71.69  ? 49  GLN B N   1 
ATOM   5302  C  CA  . GLN B 1 49  ? 83.299  68.817  51.068  1.00 71.69  ? 49  GLN B CA  1 
ATOM   5303  C  C   . GLN B 1 49  ? 84.146  67.883  51.928  1.00 71.69  ? 49  GLN B C   1 
ATOM   5304  O  O   . GLN B 1 49  ? 85.372  67.958  51.942  1.00 71.69  ? 49  GLN B O   1 
ATOM   5305  C  CB  . GLN B 1 49  ? 84.166  69.862  50.363  1.00 71.69  ? 49  GLN B CB  1 
ATOM   5306  C  CG  . GLN B 1 49  ? 84.725  69.400  49.035  1.00 71.69  ? 49  GLN B CG  1 
ATOM   5307  C  CD  . GLN B 1 49  ? 85.583  70.457  48.376  1.00 71.69  ? 49  GLN B CD  1 
ATOM   5308  O  OE1 . GLN B 1 49  ? 85.232  71.636  48.369  1.00 71.69  ? 49  GLN B OE1 1 
ATOM   5309  N  NE2 . GLN B 1 49  ? 86.722  70.046  47.831  1.00 71.69  ? 49  GLN B NE2 1 
ATOM   5310  N  N   . LEU B 1 50  ? 83.480  67.021  52.680  1.00 65.85  ? 50  LEU B N   1 
ATOM   5311  C  CA  . LEU B 1 50  ? 84.158  66.035  53.501  1.00 65.85  ? 50  LEU B CA  1 
ATOM   5312  C  C   . LEU B 1 50  ? 83.923  64.636  52.957  1.00 65.85  ? 50  LEU B C   1 
ATOM   5313  O  O   . LEU B 1 50  ? 82.823  64.314  52.505  1.00 65.85  ? 50  LEU B O   1 
ATOM   5314  C  CB  . LEU B 1 50  ? 83.668  66.135  54.927  1.00 65.85  ? 50  LEU B CB  1 
ATOM   5315  C  CG  . LEU B 1 50  ? 83.941  67.537  55.452  1.00 65.85  ? 50  LEU B CG  1 
ATOM   5316  C  CD1 . LEU B 1 50  ? 83.153  67.809  56.708  1.00 65.85  ? 50  LEU B CD1 1 
ATOM   5317  C  CD2 . LEU B 1 50  ? 85.419  67.723  55.685  1.00 65.85  ? 50  LEU B CD2 1 
ATOM   5318  N  N   . LEU B 1 51  ? 84.963  63.811  52.995  1.00 58.91  ? 51  LEU B N   1 
ATOM   5319  C  CA  . LEU B 1 51  ? 84.825  62.414  52.609  1.00 58.91  ? 51  LEU B CA  1 
ATOM   5320  C  C   . LEU B 1 51  ? 83.993  61.670  53.640  1.00 58.91  ? 51  LEU B C   1 
ATOM   5321  O  O   . LEU B 1 51  ? 84.276  61.728  54.837  1.00 58.91  ? 51  LEU B O   1 
ATOM   5322  C  CB  . LEU B 1 51  ? 86.195  61.777  52.464  1.00 58.91  ? 51  LEU B CB  1 
ATOM   5323  C  CG  . LEU B 1 51  ? 87.067  62.619  51.540  1.00 58.91  ? 51  LEU B CG  1 
ATOM   5324  C  CD1 . LEU B 1 51  ? 88.464  62.062  51.482  1.00 58.91  ? 51  LEU B CD1 1 
ATOM   5325  C  CD2 . LEU B 1 51  ? 86.472  62.680  50.151  1.00 58.91  ? 51  LEU B CD2 1 
ATOM   5326  N  N   . PHE B 1 52  ? 82.972  60.970  53.176  1.00 59.48  ? 52  PHE B N   1 
ATOM   5327  C  CA  . PHE B 1 52  ? 82.008  60.309  54.035  1.00 59.48  ? 52  PHE B CA  1 
ATOM   5328  C  C   . PHE B 1 52  ? 81.986  58.823  53.724  1.00 59.48  ? 52  PHE B C   1 
ATOM   5329  O  O   . PHE B 1 52  ? 82.170  58.423  52.576  1.00 59.48  ? 52  PHE B O   1 
ATOM   5330  C  CB  . PHE B 1 52  ? 80.636  60.900  53.790  1.00 59.48  ? 52  PHE B CB  1 
ATOM   5331  C  CG  . PHE B 1 52  ? 79.608  60.524  54.800  1.00 59.48  ? 52  PHE B CG  1 
ATOM   5332  C  CD1 . PHE B 1 52  ? 79.450  61.283  55.942  1.00 59.48  ? 52  PHE B CD1 1 
ATOM   5333  C  CD2 . PHE B 1 52  ? 78.781  59.435  54.604  1.00 59.48  ? 52  PHE B CD2 1 
ATOM   5334  C  CE1 . PHE B 1 52  ? 78.491  60.965  56.867  1.00 59.48  ? 52  PHE B CE1 1 
ATOM   5335  C  CE2 . PHE B 1 52  ? 77.828  59.108  55.535  1.00 59.48  ? 52  PHE B CE2 1 
ATOM   5336  C  CZ  . PHE B 1 52  ? 77.682  59.881  56.661  1.00 59.48  ? 52  PHE B CZ  1 
ATOM   5337  N  N   . ARG B 1 53  ? 81.746  57.999  54.740  1.00 59.75  ? 53  ARG B N   1 
ATOM   5338  C  CA  . ARG B 1 53  ? 81.762  56.557  54.535  1.00 59.75  ? 53  ARG B CA  1 
ATOM   5339  C  C   . ARG B 1 53  ? 80.888  55.916  55.593  1.00 59.75  ? 53  ARG B C   1 
ATOM   5340  O  O   . ARG B 1 53  ? 80.833  56.409  56.720  1.00 59.75  ? 53  ARG B O   1 
ATOM   5341  C  CB  . ARG B 1 53  ? 83.185  56.000  54.636  1.00 59.75  ? 53  ARG B CB  1 
ATOM   5342  C  CG  . ARG B 1 53  ? 83.333  54.604  54.098  1.00 59.75  ? 53  ARG B CG  1 
ATOM   5343  C  CD  . ARG B 1 53  ? 84.753  54.291  53.654  1.00 59.75  ? 53  ARG B CD  1 
ATOM   5344  N  NE  . ARG B 1 53  ? 85.744  54.387  54.722  1.00 59.75  ? 53  ARG B NE  1 
ATOM   5345  C  CZ  . ARG B 1 53  ? 86.073  53.377  55.521  1.00 59.75  ? 53  ARG B CZ  1 
ATOM   5346  N  NH1 . ARG B 1 53  ? 85.486  52.199  55.380  1.00 59.75  ? 53  ARG B NH1 1 
ATOM   5347  N  NH2 . ARG B 1 53  ? 86.990  53.539  56.460  1.00 59.75  ? 53  ARG B NH2 1 
ATOM   5348  N  N   . PRO B 1 54  ? 80.198  54.832  55.273  1.00 60.35  ? 54  PRO B N   1 
ATOM   5349  C  CA  . PRO B 1 54  ? 79.627  53.988  56.323  1.00 60.35  ? 54  PRO B CA  1 
ATOM   5350  C  C   . PRO B 1 54  ? 80.715  53.212  57.043  1.00 60.35  ? 54  PRO B C   1 
ATOM   5351  O  O   . PRO B 1 54  ? 81.852  53.102  56.587  1.00 60.35  ? 54  PRO B O   1 
ATOM   5352  C  CB  . PRO B 1 54  ? 78.681  53.061  55.567  1.00 60.35  ? 54  PRO B CB  1 
ATOM   5353  C  CG  . PRO B 1 54  ? 78.425  53.752  54.287  1.00 60.35  ? 54  PRO B CG  1 
ATOM   5354  C  CD  . PRO B 1 54  ? 79.668  54.491  53.951  1.00 60.35  ? 54  PRO B CD  1 
ATOM   5355  N  N   . LEU B 1 55  ? 80.343  52.663  58.199  1.00 71.53  ? 55  LEU B N   1 
ATOM   5356  C  CA  . LEU B 1 55  ? 81.280  51.842  58.955  1.00 71.53  ? 55  LEU B CA  1 
ATOM   5357  C  C   . LEU B 1 55  ? 81.526  50.502  58.274  1.00 71.53  ? 55  LEU B C   1 
ATOM   5358  O  O   . LEU B 1 55  ? 82.652  49.994  58.270  1.00 71.53  ? 55  LEU B O   1 
ATOM   5359  C  CB  . LEU B 1 55  ? 80.778  51.638  60.377  1.00 71.53  ? 55  LEU B CB  1 
ATOM   5360  C  CG  . LEU B 1 55  ? 81.821  50.968  61.270  1.00 71.53  ? 55  LEU B CG  1 
ATOM   5361  C  CD1 . LEU B 1 55  ? 83.142  51.712  61.217  1.00 71.53  ? 55  LEU B CD1 1 
ATOM   5362  C  CD2 . LEU B 1 55  ? 81.332  50.859  62.687  1.00 71.53  ? 55  LEU B CD2 1 
ATOM   5363  N  N   . LEU B 1 56  ? 80.495  49.927  57.660  1.00 84.26  ? 56  LEU B N   1 
ATOM   5364  C  CA  . LEU B 1 56  ? 80.636  48.636  57.004  1.00 84.26  ? 56  LEU B CA  1 
ATOM   5365  C  C   . LEU B 1 56  ? 79.913  48.633  55.667  1.00 84.26  ? 56  LEU B C   1 
ATOM   5366  O  O   . LEU B 1 56  ? 78.769  49.071  55.554  1.00 84.26  ? 56  LEU B O   1 
ATOM   5367  C  CB  . LEU B 1 56  ? 80.095  47.497  57.874  1.00 84.26  ? 56  LEU B CB  1 
ATOM   5368  C  CG  . LEU B 1 56  ? 80.889  47.118  59.122  1.00 84.26  ? 56  LEU B CG  1 
ATOM   5369  C  CD1 . LEU B 1 56  ? 80.072  46.209  60.016  1.00 84.26  ? 56  LEU B CD1 1 
ATOM   5370  C  CD2 . LEU B 1 56  ? 82.193  46.452  58.740  1.00 84.26  ? 56  LEU B CD2 1 
ATOM   5371  N  N   . ASN B 1 57  ? 80.619  48.166  54.643  1.00 92.04  ? 57  ASN B N   1 
ATOM   5372  C  CA  . ASN B 1 57  ? 80.056  48.056  53.306  1.00 92.04  ? 57  ASN B CA  1 
ATOM   5373  C  C   . ASN B 1 57  ? 79.008  46.953  53.195  1.00 92.04  ? 57  ASN B C   1 
ATOM   5374  O  O   . ASN B 1 57  ? 78.124  47.024  52.334  1.00 92.04  ? 57  ASN B O   1 
ATOM   5375  C  CB  . ASN B 1 57  ? 81.180  47.802  52.299  1.00 92.04  ? 57  ASN B CB  1 
ATOM   5376  C  CG  . ASN B 1 57  ? 82.520  48.359  52.759  1.00 92.04  ? 57  ASN B CG  1 
ATOM   5377  O  OD1 . ASN B 1 57  ? 82.643  48.909  53.851  1.00 92.04  ? 57  ASN B OD1 1 
ATOM   5378  N  ND2 . ASN B 1 57  ? 83.537  48.200  51.924  1.00 92.04  ? 57  ASN B ND2 1 
ATOM   5379  N  N   . LYS B 1 58  ? 79.087  45.931  54.045  1.00 92.90  ? 58  LYS B N   1 
ATOM   5380  C  CA  . LYS B 1 58  ? 78.108  44.857  54.078  1.00 92.90  ? 58  LYS B CA  1 
ATOM   5381  C  C   . LYS B 1 58  ? 77.558  44.738  55.495  1.00 92.90  ? 58  LYS B C   1 
ATOM   5382  O  O   . LYS B 1 58  ? 78.209  45.137  56.462  1.00 92.90  ? 58  LYS B O   1 
ATOM   5383  C  CB  . LYS B 1 58  ? 78.756  43.531  53.644  1.00 92.90  ? 58  LYS B CB  1 
ATOM   5384  C  CG  . LYS B 1 58  ? 77.795  42.417  53.258  1.00 92.90  ? 58  LYS B CG  1 
ATOM   5385  C  CD  . LYS B 1 58  ? 78.529  41.154  52.859  1.00 92.90  ? 58  LYS B CD  1 
ATOM   5386  C  CE  . LYS B 1 58  ? 77.583  39.970  52.846  1.00 92.90  ? 58  LYS B CE  1 
ATOM   5387  N  NZ  . LYS B 1 58  ? 78.134  38.830  52.075  1.00 92.90  ? 58  LYS B NZ  1 
ATOM   5388  N  N   . TYR B 1 59  ? 76.363  44.168  55.630  1.00 95.57  ? 59  TYR B N   1 
ATOM   5389  C  CA  . TYR B 1 59  ? 75.787  43.977  56.950  1.00 95.57  ? 59  TYR B CA  1 
ATOM   5390  C  C   . TYR B 1 59  ? 75.098  42.624  57.029  1.00 95.57  ? 59  TYR B C   1 
ATOM   5391  O  O   . TYR B 1 59  ? 74.506  42.150  56.055  1.00 95.57  ? 59  TYR B O   1 
ATOM   5392  C  CB  . TYR B 1 59  ? 74.800  45.080  57.310  1.00 95.57  ? 59  TYR B CB  1 
ATOM   5393  C  CG  . TYR B 1 59  ? 75.482  46.272  57.912  1.00 95.57  ? 59  TYR B CG  1 
ATOM   5394  C  CD1 . TYR B 1 59  ? 75.615  46.398  59.283  1.00 95.57  ? 59  TYR B CD1 1 
ATOM   5395  C  CD2 . TYR B 1 59  ? 75.953  47.298  57.112  1.00 95.57  ? 59  TYR B CD2 1 
ATOM   5396  C  CE1 . TYR B 1 59  ? 76.239  47.501  59.843  1.00 95.57  ? 59  TYR B CE1 1 
ATOM   5397  C  CE2 . TYR B 1 59  ? 76.569  48.404  57.661  1.00 95.57  ? 59  TYR B CE2 1 
ATOM   5398  C  CZ  . TYR B 1 59  ? 76.709  48.504  59.024  1.00 95.57  ? 59  TYR B CZ  1 
ATOM   5399  O  OH  . TYR B 1 59  ? 77.328  49.607  59.562  1.00 95.57  ? 59  TYR B OH  1 
ATOM   5400  N  N   . GLU B 1 60  ? 75.170  42.014  58.210  1.00 108.69 ? 60  GLU B N   1 
ATOM   5401  C  CA  . GLU B 1 60  ? 74.440  40.788  58.509  1.00 108.69 ? 60  GLU B CA  1 
ATOM   5402  C  C   . GLU B 1 60  ? 73.442  41.056  59.623  1.00 108.69 ? 60  GLU B C   1 
ATOM   5403  O  O   . GLU B 1 60  ? 73.385  42.171  60.143  1.00 108.69 ? 60  GLU B O   1 
ATOM   5404  C  CB  . GLU B 1 60  ? 75.389  39.667  58.917  1.00 108.69 ? 60  GLU B CB  1 
ATOM   5405  C  CG  . GLU B 1 60  ? 76.014  39.880  60.279  1.00 108.69 ? 60  GLU B CG  1 
ATOM   5406  C  CD  . GLU B 1 60  ? 77.281  39.094  60.445  1.00 108.69 ? 60  GLU B CD  1 
ATOM   5407  O  OE1 . GLU B 1 60  ? 77.633  38.358  59.502  1.00 108.69 ? 60  GLU B OE1 1 
ATOM   5408  O  OE2 . GLU B 1 60  ? 77.927  39.217  61.504  1.00 108.69 ? 60  GLU B OE2 1 
ATOM   5409  N  N   . GLN B 1 61  ? 72.673  40.039  60.014  1.00 113.81 ? 61  GLN B N   1 
ATOM   5410  C  CA  . GLN B 1 61  ? 71.643  40.223  61.033  1.00 113.81 ? 61  GLN B CA  1 
ATOM   5411  C  C   . GLN B 1 61  ? 72.243  40.448  62.420  1.00 113.81 ? 61  GLN B C   1 
ATOM   5412  O  O   . GLN B 1 61  ? 71.557  40.915  63.336  1.00 113.81 ? 61  GLN B O   1 
ATOM   5413  C  CB  . GLN B 1 61  ? 70.707  39.014  61.047  1.00 113.81 ? 61  GLN B CB  1 
ATOM   5414  N  N   . GLU B 1 62  ? 73.521  40.119  62.602  1.00 111.00 ? 62  GLU B N   1 
ATOM   5415  C  CA  . GLU B 1 62  ? 74.133  40.317  63.907  1.00 111.00 ? 62  GLU B CA  1 
ATOM   5416  C  C   . GLU B 1 62  ? 74.524  41.767  64.166  1.00 111.00 ? 62  GLU B C   1 
ATOM   5417  O  O   . GLU B 1 62  ? 74.289  42.266  65.271  1.00 111.00 ? 62  GLU B O   1 
ATOM   5418  C  CB  . GLU B 1 62  ? 75.363  39.420  64.052  1.00 111.00 ? 62  GLU B CB  1 
ATOM   5419  N  N   . THR B 1 63  ? 75.095  42.459  63.180  1.00 107.55 ? 63  THR B N   1 
ATOM   5420  C  CA  . THR B 1 63  ? 75.610  43.805  63.384  1.00 107.55 ? 63  THR B CA  1 
ATOM   5421  C  C   . THR B 1 63  ? 74.666  44.876  62.863  1.00 107.55 ? 63  THR B C   1 
ATOM   5422  O  O   . THR B 1 63  ? 75.121  45.953  62.470  1.00 107.55 ? 63  THR B O   1 
ATOM   5423  C  CB  . THR B 1 63  ? 76.977  43.958  62.726  1.00 107.55 ? 63  THR B CB  1 
ATOM   5424  O  OG1 . THR B 1 63  ? 76.806  44.125  61.316  1.00 107.55 ? 63  THR B OG1 1 
ATOM   5425  C  CG2 . THR B 1 63  ? 77.815  42.721  62.976  1.00 107.55 ? 63  THR B CG2 1 
ATOM   5426  N  N   . LEU B 1 64  ? 73.363  44.609  62.862  1.00 101.85 ? 64  LEU B N   1 
ATOM   5427  C  CA  . LEU B 1 64  ? 72.400  45.597  62.398  1.00 101.85 ? 64  LEU B CA  1 
ATOM   5428  C  C   . LEU B 1 64  ? 72.199  46.719  63.395  1.00 101.85 ? 64  LEU B C   1 
ATOM   5429  O  O   . LEU B 1 64  ? 71.713  47.784  63.012  1.00 101.85 ? 64  LEU B O   1 
ATOM   5430  C  CB  . LEU B 1 64  ? 71.047  44.959  62.084  1.00 101.85 ? 64  LEU B CB  1 
ATOM   5431  C  CG  . LEU B 1 64  ? 70.879  44.179  60.780  1.00 101.85 ? 64  LEU B CG  1 
ATOM   5432  C  CD1 . LEU B 1 64  ? 69.410  44.029  60.453  1.00 101.85 ? 64  LEU B CD1 1 
ATOM   5433  C  CD2 . LEU B 1 64  ? 71.589  44.886  59.639  1.00 101.85 ? 64  LEU B CD2 1 
ATOM   5434  N  N   . GLU B 1 65  ? 72.547  46.508  64.662  1.00 97.47  ? 65  GLU B N   1 
ATOM   5435  C  CA  . GLU B 1 65  ? 72.365  47.573  65.634  1.00 97.47  ? 65  GLU B CA  1 
ATOM   5436  C  C   . GLU B 1 65  ? 73.529  48.552  65.652  1.00 97.47  ? 65  GLU B C   1 
ATOM   5437  O  O   . GLU B 1 65  ? 73.516  49.503  66.441  1.00 97.47  ? 65  GLU B O   1 
ATOM   5438  C  CB  . GLU B 1 65  ? 72.193  46.962  67.022  1.00 97.47  ? 65  GLU B CB  1 
ATOM   5439  C  CG  . GLU B 1 65  ? 72.898  45.630  67.168  1.00 97.47  ? 65  GLU B CG  1 
ATOM   5440  C  CD  . GLU B 1 65  ? 73.080  45.228  68.604  1.00 97.47  ? 65  GLU B CD  1 
ATOM   5441  O  OE1 . GLU B 1 65  ? 73.777  45.956  69.338  1.00 97.47  ? 65  GLU B OE1 1 
ATOM   5442  O  OE2 . GLU B 1 65  ? 72.518  44.191  69.005  1.00 97.47  ? 65  GLU B OE2 1 
ATOM   5443  N  N   . ASN B 1 66  ? 74.539  48.338  64.812  1.00 90.49  ? 66  ASN B N   1 
ATOM   5444  C  CA  . ASN B 1 66  ? 75.661  49.256  64.740  1.00 90.49  ? 66  ASN B CA  1 
ATOM   5445  C  C   . ASN B 1 66  ? 75.722  49.773  63.312  1.00 90.49  ? 66  ASN B C   1 
ATOM   5446  O  O   . ASN B 1 66  ? 76.808  49.922  62.748  1.00 90.49  ? 66  ASN B O   1 
ATOM   5447  C  CB  . ASN B 1 66  ? 76.964  48.549  65.111  1.00 90.49  ? 66  ASN B CB  1 
ATOM   5448  C  CG  . ASN B 1 66  ? 76.953  47.991  66.519  1.00 90.49  ? 66  ASN B CG  1 
ATOM   5449  O  OD1 . ASN B 1 66  ? 76.034  48.228  67.296  1.00 90.49  ? 66  ASN B OD1 1 
ATOM   5450  N  ND2 . ASN B 1 66  ? 77.939  47.160  66.819  1.00 90.49  ? 66  ASN B ND2 1 
ATOM   5451  N  N   . GLN B 1 67  ? 74.562  50.027  62.710  1.00 85.87  ? 67  GLN B N   1 
ATOM   5452  C  CA  . GLN B 1 67  ? 74.496  50.297  61.283  1.00 85.87  ? 67  GLN B CA  1 
ATOM   5453  C  C   . GLN B 1 67  ? 74.405  51.784  61.010  1.00 85.87  ? 67  GLN B C   1 
ATOM   5454  O  O   . GLN B 1 67  ? 74.276  52.197  59.853  1.00 85.87  ? 67  GLN B O   1 
ATOM   5455  C  CB  . GLN B 1 67  ? 73.329  49.554  60.632  1.00 85.87  ? 67  GLN B CB  1 
ATOM   5456  C  CG  . GLN B 1 67  ? 71.961  50.173  60.828  1.00 85.87  ? 67  GLN B CG  1 
ATOM   5457  C  CD  . GLN B 1 67  ? 70.860  49.309  60.247  1.00 85.87  ? 67  GLN B CD  1 
ATOM   5458  O  OE1 . GLN B 1 67  ? 71.021  48.720  59.179  1.00 85.87  ? 67  GLN B OE1 1 
ATOM   5459  N  NE2 . GLN B 1 67  ? 69.735  49.231  60.945  1.00 85.87  ? 67  GLN B NE2 1 
ATOM   5460  N  N   . ASN B 1 68  ? 74.536  52.591  62.052  1.00 72.07  ? 68  ASN B N   1 
ATOM   5461  C  CA  . ASN B 1 68  ? 74.356  54.026  61.996  1.00 72.07  ? 68  ASN B CA  1 
ATOM   5462  C  C   . ASN B 1 68  ? 75.644  54.777  62.236  1.00 72.07  ? 68  ASN B C   1 
ATOM   5463  O  O   . ASN B 1 68  ? 75.642  56.008  62.197  1.00 72.07  ? 68  ASN B O   1 
ATOM   5464  C  CB  . ASN B 1 68  ? 73.329  54.440  63.047  1.00 72.07  ? 68  ASN B CB  1 
ATOM   5465  C  CG  . ASN B 1 68  ? 73.566  53.743  64.368  1.00 72.07  ? 68  ASN B CG  1 
ATOM   5466  O  OD1 . ASN B 1 68  ? 74.494  52.946  64.499  1.00 72.07  ? 68  ASN B OD1 1 
ATOM   5467  N  ND2 . ASN B 1 68  ? 72.731  54.036  65.355  1.00 72.07  ? 68  ASN B ND2 1 
ATOM   5468  N  N   . LEU B 1 69  ? 76.742  54.067  62.421  1.00 61.62  ? 69  LEU B N   1 
ATOM   5469  C  CA  . LEU B 1 69  ? 78.018  54.703  62.675  1.00 61.62  ? 69  LEU B CA  1 
ATOM   5470  C  C   . LEU B 1 69  ? 78.633  55.111  61.353  1.00 61.62  ? 69  LEU B C   1 
ATOM   5471  O  O   . LEU B 1 69  ? 78.743  54.303  60.430  1.00 61.62  ? 69  LEU B O   1 
ATOM   5472  C  CB  . LEU B 1 69  ? 78.933  53.741  63.417  1.00 61.62  ? 69  LEU B CB  1 
ATOM   5473  C  CG  . LEU B 1 69  ? 78.493  53.481  64.850  1.00 61.62  ? 69  LEU B CG  1 
ATOM   5474  C  CD1 . LEU B 1 69  ? 79.196  52.281  65.410  1.00 61.62  ? 69  LEU B CD1 1 
ATOM   5475  C  CD2 . LEU B 1 69  ? 78.795  54.686  65.681  1.00 61.62  ? 69  LEU B CD2 1 
ATOM   5476  N  N   . TYR B 1 70  ? 79.055  56.359  61.267  1.00 58.25  ? 70  TYR B N   1 
ATOM   5477  C  CA  . TYR B 1 70  ? 79.628  56.894  60.052  1.00 58.25  ? 70  TYR B CA  1 
ATOM   5478  C  C   . TYR B 1 70  ? 80.960  57.535  60.366  1.00 58.25  ? 70  TYR B C   1 
ATOM   5479  O  O   . TYR B 1 70  ? 81.169  58.067  61.454  1.00 58.25  ? 70  TYR B O   1 
ATOM   5480  C  CB  . TYR B 1 70  ? 78.722  57.944  59.461  1.00 58.25  ? 70  TYR B CB  1 
ATOM   5481  C  CG  . TYR B 1 70  ? 77.413  57.419  58.953  1.00 58.25  ? 70  TYR B CG  1 
ATOM   5482  C  CD1 . TYR B 1 70  ? 77.351  56.263  58.191  1.00 58.25  ? 70  TYR B CD1 1 
ATOM   5483  C  CD2 . TYR B 1 70  ? 76.227  58.069  59.260  1.00 58.25  ? 70  TYR B CD2 1 
ATOM   5484  C  CE1 . TYR B 1 70  ? 76.141  55.781  57.723  1.00 58.25  ? 70  TYR B CE1 1 
ATOM   5485  C  CE2 . TYR B 1 70  ? 75.016  57.599  58.805  1.00 58.25  ? 70  TYR B CE2 1 
ATOM   5486  C  CZ  . TYR B 1 70  ? 74.976  56.454  58.038  1.00 58.25  ? 70  TYR B CZ  1 
ATOM   5487  O  OH  . TYR B 1 70  ? 73.765  55.985  57.580  1.00 58.25  ? 70  TYR B OH  1 
ATOM   5488  N  N   . LEU B 1 71  ? 81.865  57.461  59.411  1.00 50.03  ? 71  LEU B N   1 
ATOM   5489  C  CA  . LEU B 1 71  ? 83.200  58.000  59.567  1.00 50.03  ? 71  LEU B CA  1 
ATOM   5490  C  C   . LEU B 1 71  ? 83.331  59.209  58.668  1.00 50.03  ? 71  LEU B C   1 
ATOM   5491  O  O   . LEU B 1 71  ? 82.828  59.212  57.545  1.00 50.03  ? 71  LEU B O   1 
ATOM   5492  C  CB  . LEU B 1 71  ? 84.249  56.958  59.221  1.00 50.03  ? 71  LEU B CB  1 
ATOM   5493  C  CG  . LEU B 1 71  ? 83.946  55.634  59.909  1.00 50.03  ? 71  LEU B CG  1 
ATOM   5494  C  CD1 . LEU B 1 71  ? 84.947  54.594  59.512  1.00 50.03  ? 71  LEU B CD1 1 
ATOM   5495  C  CD2 . LEU B 1 71  ? 83.972  55.802  61.402  1.00 50.03  ? 71  LEU B CD2 1 
ATOM   5496  N  N   . VAL B 1 72  ? 83.987  60.242  59.162  1.00 48.02  ? 72  VAL B N   1 
ATOM   5497  C  CA  . VAL B 1 72  ? 84.161  61.477  58.418  1.00 48.02  ? 72  VAL B CA  1 
ATOM   5498  C  C   . VAL B 1 72  ? 85.637  61.806  58.426  1.00 48.02  ? 72  VAL B C   1 
ATOM   5499  O  O   . VAL B 1 72  ? 86.253  61.894  59.491  1.00 48.02  ? 72  VAL B O   1 
ATOM   5500  C  CB  . VAL B 1 72  ? 83.342  62.631  59.012  1.00 48.02  ? 72  VAL B CB  1 
ATOM   5501  C  CG1 . VAL B 1 72  ? 83.706  63.913  58.332  1.00 48.02  ? 72  VAL B CG1 1 
ATOM   5502  C  CG2 . VAL B 1 72  ? 81.877  62.374  58.847  1.00 48.02  ? 72  VAL B CG2 1 
ATOM   5503  N  N   . GLY B 1 73  ? 86.204  61.962  57.245  1.00 57.38  ? 73  GLY B N   1 
ATOM   5504  C  CA  . GLY B 1 73  ? 87.557  62.439  57.095  1.00 57.38  ? 73  GLY B CA  1 
ATOM   5505  C  C   . GLY B 1 73  ? 87.573  63.463  55.992  1.00 57.38  ? 73  GLY B C   1 
ATOM   5506  O  O   . GLY B 1 73  ? 86.508  63.946  55.599  1.00 57.38  ? 73  GLY B O   1 
ATOM   5507  N  N   . ALA B 1 74  ? 88.749  63.777  55.463  1.00 67.10  ? 74  ALA B N   1 
ATOM   5508  C  CA  . ALA B 1 74  ? 88.842  64.634  54.292  1.00 67.10  ? 74  ALA B CA  1 
ATOM   5509  C  C   . ALA B 1 74  ? 90.182  64.396  53.623  1.00 67.10  ? 74  ALA B C   1 
ATOM   5510  O  O   . ALA B 1 74  ? 90.990  63.577  54.066  1.00 67.10  ? 74  ALA B O   1 
ATOM   5511  C  CB  . ALA B 1 74  ? 88.689  66.112  54.652  1.00 67.10  ? 74  ALA B CB  1 
ATOM   5512  N  N   . SER B 1 75  ? 90.412  65.136  52.555  1.00 74.55  ? 75  SER B N   1 
ATOM   5513  C  CA  . SER B 1 75  ? 91.646  65.067  51.805  1.00 74.55  ? 75  SER B CA  1 
ATOM   5514  C  C   . SER B 1 75  ? 92.584  66.175  52.245  1.00 74.55  ? 75  SER B C   1 
ATOM   5515  O  O   . SER B 1 75  ? 92.220  67.056  53.024  1.00 74.55  ? 75  SER B O   1 
ATOM   5516  C  CB  . SER B 1 75  ? 91.345  65.165  50.312  1.00 74.55  ? 75  SER B CB  1 
ATOM   5517  O  OG  . SER B 1 75  ? 90.361  66.157  50.075  1.00 74.55  ? 75  SER B OG  1 
ATOM   5518  N  N   . LYS B 1 76  ? 93.804  66.128  51.716  1.00 72.94  ? 76  LYS B N   1 
ATOM   5519  C  CA  . LYS B 1 76  ? 94.876  66.966  52.228  1.00 72.94  ? 76  LYS B CA  1 
ATOM   5520  C  C   . LYS B 1 76  ? 94.642  68.424  51.872  1.00 72.94  ? 76  LYS B C   1 
ATOM   5521  O  O   . LYS B 1 76  ? 94.881  69.308  52.698  1.00 72.94  ? 76  LYS B O   1 
ATOM   5522  C  CB  . LYS B 1 76  ? 96.217  66.450  51.723  1.00 72.94  ? 76  LYS B CB  1 
ATOM   5523  C  CG  . LYS B 1 76  ? 96.567  65.127  52.387  1.00 72.94  ? 76  LYS B CG  1 
ATOM   5524  C  CD  . LYS B 1 76  ? 97.832  64.473  51.862  1.00 72.94  ? 76  LYS B CD  1 
ATOM   5525  C  CE  . LYS B 1 76  ? 99.032  65.389  51.942  1.00 72.94  ? 76  LYS B CE  1 
ATOM   5526  N  NZ  . LYS B 1 76  ? 100.264 64.703  51.458  1.00 72.94  ? 76  LYS B NZ  1 
ATOM   5527  N  N   . ILE B 1 77  ? 94.201  68.694  50.644  1.00 70.03  ? 77  ILE B N   1 
ATOM   5528  C  CA  . ILE B 1 77  ? 93.923  70.068  50.242  1.00 70.03  ? 77  ILE B CA  1 
ATOM   5529  C  C   . ILE B 1 77  ? 92.728  70.612  51.012  1.00 70.03  ? 77  ILE B C   1 
ATOM   5530  O  O   . ILE B 1 77  ? 92.672  71.805  51.334  1.00 70.03  ? 77  ILE B O   1 
ATOM   5531  C  CB  . ILE B 1 77  ? 93.675  70.141  48.726  1.00 70.03  ? 77  ILE B CB  1 
ATOM   5532  C  CG1 . ILE B 1 77  ? 94.752  69.375  47.959  1.00 70.03  ? 77  ILE B CG1 1 
ATOM   5533  C  CG2 . ILE B 1 77  ? 93.623  71.587  48.256  1.00 70.03  ? 77  ILE B CG2 1 
ATOM   5534  C  CD1 . ILE B 1 77  ? 96.096  70.068  47.901  1.00 70.03  ? 77  ILE B CD1 1 
ATOM   5535  N  N   . ARG B 1 78  ? 91.776  69.740  51.351  1.00 72.38  ? 78  ARG B N   1 
ATOM   5536  C  CA  . ARG B 1 78  ? 90.644  70.130  52.188  1.00 72.38  ? 78  ARG B CA  1 
ATOM   5537  C  C   . ARG B 1 78  ? 91.062  70.520  53.604  1.00 72.38  ? 78  ARG B C   1 
ATOM   5538  O  O   . ARG B 1 78  ? 90.529  71.486  54.162  1.00 72.38  ? 78  ARG B O   1 
ATOM   5539  C  CB  . ARG B 1 78  ? 89.616  69.001  52.214  1.00 72.38  ? 78  ARG B CB  1 
ATOM   5540  C  CG  . ARG B 1 78  ? 88.332  69.402  52.880  1.00 72.38  ? 78  ARG B CG  1 
ATOM   5541  C  CD  . ARG B 1 78  ? 87.763  70.632  52.239  1.00 72.38  ? 78  ARG B CD  1 
ATOM   5542  N  NE  . ARG B 1 78  ? 86.786  71.231  53.123  1.00 72.38  ? 78  ARG B NE  1 
ATOM   5543  C  CZ  . ARG B 1 78  ? 87.100  72.173  54.000  1.00 72.38  ? 78  ARG B CZ  1 
ATOM   5544  N  NH1 . ARG B 1 78  ? 88.355  72.591  54.090  1.00 72.38  ? 78  ARG B NH1 1 
ATOM   5545  N  NH2 . ARG B 1 78  ? 86.173  72.690  54.790  1.00 72.38  ? 78  ARG B NH2 1 
ATOM   5546  N  N   . MET B 1 79  ? 92.020  69.801  54.194  1.00 71.53  ? 79  MET B N   1 
ATOM   5547  C  CA  . MET B 1 79  ? 92.460  70.141  55.543  1.00 71.53  ? 79  MET B CA  1 
ATOM   5548  C  C   . MET B 1 79  ? 93.250  71.432  55.554  1.00 71.53  ? 79  MET B C   1 
ATOM   5549  O  O   . MET B 1 79  ? 93.199  72.185  56.530  1.00 71.53  ? 79  MET B O   1 
ATOM   5550  C  CB  . MET B 1 79  ? 93.312  69.025  56.132  1.00 71.53  ? 79  MET B CB  1 
ATOM   5551  C  CG  . MET B 1 79  ? 92.629  67.705  56.186  1.00 71.53  ? 79  MET B CG  1 
ATOM   5552  S  SD  . MET B 1 79  ? 90.981  67.884  56.855  1.00 71.53  ? 79  MET B SD  1 
ATOM   5553  C  CE  . MET B 1 79  ? 91.358  68.281  58.555  1.00 71.53  ? 79  MET B CE  1 
ATOM   5554  N  N   . LEU B 1 80  ? 93.985  71.705  54.485  1.00 70.22  ? 80  LEU B N   1 
ATOM   5555  C  CA  . LEU B 1 80  ? 94.721  72.955  54.417  1.00 70.22  ? 80  LEU B CA  1 
ATOM   5556  C  C   . LEU B 1 80  ? 93.782  74.134  54.241  1.00 70.22  ? 80  LEU B C   1 
ATOM   5557  O  O   . LEU B 1 80  ? 94.000  75.194  54.837  1.00 70.22  ? 80  LEU B O   1 
ATOM   5558  C  CB  . LEU B 1 80  ? 95.744  72.881  53.298  1.00 70.22  ? 80  LEU B CB  1 
ATOM   5559  C  CG  . LEU B 1 80  ? 96.797  71.831  53.626  1.00 70.22  ? 80  LEU B CG  1 
ATOM   5560  C  CD1 . LEU B 1 80  ? 97.842  71.777  52.549  1.00 70.22  ? 80  LEU B CD1 1 
ATOM   5561  C  CD2 . LEU B 1 80  ? 97.446  72.150  54.954  1.00 70.22  ? 80  LEU B CD2 1 
ATOM   5562  N  N   . LEU B 1 81  ? 92.728  73.969  53.441  1.00 70.08  ? 81  LEU B N   1 
ATOM   5563  C  CA  . LEU B 1 81  ? 91.741  75.035  53.326  1.00 70.08  ? 81  LEU B CA  1 
ATOM   5564  C  C   . LEU B 1 81  ? 90.964  75.215  54.620  1.00 70.08  ? 81  LEU B C   1 
ATOM   5565  O  O   . LEU B 1 81  ? 90.611  76.342  54.981  1.00 70.08  ? 81  LEU B O   1 
ATOM   5566  C  CB  . LEU B 1 81  ? 90.784  74.745  52.175  1.00 70.08  ? 81  LEU B CB  1 
ATOM   5567  C  CG  . LEU B 1 81  ? 91.408  74.847  50.788  1.00 70.08  ? 81  LEU B CG  1 
ATOM   5568  C  CD1 . LEU B 1 81  ? 90.424  74.419  49.712  1.00 70.08  ? 81  LEU B CD1 1 
ATOM   5569  C  CD2 . LEU B 1 81  ? 91.878  76.271  50.559  1.00 70.08  ? 81  LEU B CD2 1 
ATOM   5570  N  N   . GLY B 1 82  ? 90.707  74.124  55.334  1.00 64.03  ? 82  GLY B N   1 
ATOM   5571  C  CA  . GLY B 1 82  ? 90.093  74.232  56.642  1.00 64.03  ? 82  GLY B CA  1 
ATOM   5572  C  C   . GLY B 1 82  ? 91.016  74.852  57.668  1.00 64.03  ? 82  GLY B C   1 
ATOM   5573  O  O   . GLY B 1 82  ? 90.563  75.564  58.566  1.00 64.03  ? 82  GLY B O   1 
ATOM   5574  N  N   . ALA B 1 83  ? 92.323  74.638  57.514  1.00 61.58  ? 83  ALA B N   1 
ATOM   5575  C  CA  . ALA B 1 83  ? 93.296  75.275  58.387  1.00 61.58  ? 83  ALA B CA  1 
ATOM   5576  C  C   . ALA B 1 83  ? 93.376  76.764  58.141  1.00 61.58  ? 83  ALA B C   1 
ATOM   5577  O  O   . ALA B 1 83  ? 93.705  77.520  59.058  1.00 61.58  ? 83  ALA B O   1 
ATOM   5578  C  CB  . ALA B 1 83  ? 94.671  74.646  58.203  1.00 61.58  ? 83  ALA B CB  1 
ATOM   5579  N  N   . GLU B 1 84  ? 93.126  77.201  56.918  1.00 54.89  ? 84  GLU B N   1 
ATOM   5580  C  CA  . GLU B 1 84  ? 92.990  78.630  56.697  1.00 54.89  ? 84  GLU B CA  1 
ATOM   5581  C  C   . GLU B 1 84  ? 91.775  79.195  57.417  1.00 54.89  ? 84  GLU B C   1 
ATOM   5582  O  O   . GLU B 1 84  ? 91.837  80.300  57.964  1.00 54.89  ? 84  GLU B O   1 
ATOM   5583  C  CB  . GLU B 1 84  ? 92.901  78.916  55.202  1.00 54.89  ? 84  GLU B CB  1 
ATOM   5584  N  N   . ALA B 1 85  ? 90.664  78.457  57.434  1.00 50.58  ? 85  ALA B N   1 
ATOM   5585  C  CA  . ALA B 1 85  ? 89.454  78.983  58.059  1.00 50.58  ? 85  ALA B CA  1 
ATOM   5586  C  C   . ALA B 1 85  ? 89.553  79.033  59.579  1.00 50.58  ? 85  ALA B C   1 
ATOM   5587  O  O   . ALA B 1 85  ? 89.042  79.969  60.202  1.00 50.58  ? 85  ALA B O   1 
ATOM   5588  C  CB  . ALA B 1 85  ? 88.248  78.146  57.644  1.00 50.58  ? 85  ALA B CB  1 
ATOM   5589  N  N   . VAL B 1 86  ? 90.193  78.042  60.196  1.00 48.42  ? 86  VAL B N   1 
ATOM   5590  C  CA  . VAL B 1 86  ? 90.299  78.041  61.651  1.00 48.42  ? 86  VAL B CA  1 
ATOM   5591  C  C   . VAL B 1 86  ? 91.315  79.066  62.122  1.00 48.42  ? 86  VAL B C   1 
ATOM   5592  O  O   . VAL B 1 86  ? 91.026  79.891  62.994  1.00 48.42  ? 86  VAL B O   1 
ATOM   5593  C  CB  . VAL B 1 86  ? 90.645  76.633  62.153  1.00 48.42  ? 86  VAL B CB  1 
ATOM   5594  C  CG1 . VAL B 1 86  ? 91.181  76.679  63.553  1.00 48.42  ? 86  VAL B CG1 1 
ATOM   5595  C  CG2 . VAL B 1 86  ? 89.417  75.787  62.116  1.00 48.42  ? 86  VAL B CG2 1 
ATOM   5596  N  N   . GLY B 1 87  ? 92.497  79.070  61.524  1.00 52.63  ? 87  GLY B N   1 
ATOM   5597  C  CA  . GLY B 1 87  ? 93.488  80.016  61.978  1.00 52.63  ? 87  GLY B CA  1 
ATOM   5598  C  C   . GLY B 1 87  ? 94.526  79.329  62.834  1.00 52.63  ? 87  GLY B C   1 
ATOM   5599  O  O   . GLY B 1 87  ? 94.864  79.835  63.905  1.00 52.63  ? 87  GLY B O   1 
ATOM   5600  N  N   . LEU B 1 88  ? 95.012  78.170  62.400  1.00 58.75  ? 88  LEU B N   1 
ATOM   5601  C  CA  . LEU B 1 88  ? 96.099  77.507  63.100  1.00 58.75  ? 88  LEU B CA  1 
ATOM   5602  C  C   . LEU B 1 88  ? 97.352  78.355  63.057  1.00 58.75  ? 88  LEU B C   1 
ATOM   5603  O  O   . LEU B 1 88  ? 97.637  79.034  62.073  1.00 58.75  ? 88  LEU B O   1 
ATOM   5604  C  CB  . LEU B 1 88  ? 96.414  76.166  62.463  1.00 58.75  ? 88  LEU B CB  1 
ATOM   5605  C  CG  . LEU B 1 88  ? 95.357  75.086  62.528  1.00 58.75  ? 88  LEU B CG  1 
ATOM   5606  C  CD1 . LEU B 1 88  ? 95.904  73.825  61.906  1.00 58.75  ? 88  LEU B CD1 1 
ATOM   5607  C  CD2 . LEU B 1 88  ? 94.988  74.850  63.966  1.00 58.75  ? 88  LEU B CD2 1 
ATOM   5608  N  N   . VAL B 1 89  ? 98.081  78.350  64.157  1.00 56.49  ? 89  VAL B N   1 
ATOM   5609  C  CA  . VAL B 1 89  ? 99.303  79.128  64.215  1.00 56.49  ? 89  VAL B CA  1 
ATOM   5610  C  C   . VAL B 1 89  ? 100.505 78.204  64.194  1.00 56.49  ? 89  VAL B C   1 
ATOM   5611  O  O   . VAL B 1 89  ? 100.767 77.493  65.166  1.00 56.49  ? 89  VAL B O   1 
ATOM   5612  C  CB  . VAL B 1 89  ? 99.321  80.038  65.450  1.00 56.49  ? 89  VAL B CB  1 
ATOM   5613  C  CG1 . VAL B 1 89  ? 100.618 80.799  65.503  1.00 56.49  ? 89  VAL B CG1 1 
ATOM   5614  C  CG2 . VAL B 1 89  ? 98.151  80.992  65.413  1.00 56.49  ? 89  VAL B CG2 1 
ATOM   5615  N  N   . LYS B 1 90  ? 101.203 78.156  63.077  1.00 64.90  ? 90  LYS B N   1 
ATOM   5616  C  CA  . LYS B 1 90  ? 102.353 77.282  62.948  1.00 64.90  ? 90  LYS B CA  1 
ATOM   5617  C  C   . LYS B 1 90  ? 103.616 78.131  62.881  1.00 64.90  ? 90  LYS B C   1 
ATOM   5618  O  O   . LYS B 1 90  ? 103.565 79.353  62.745  1.00 64.90  ? 90  LYS B O   1 
ATOM   5619  C  CB  . LYS B 1 90  ? 102.234 76.406  61.710  1.00 64.90  ? 90  LYS B CB  1 
ATOM   5620  C  CG  . LYS B 1 90  ? 100.906 75.726  61.574  1.00 64.90  ? 90  LYS B CG  1 
ATOM   5621  C  CD  . LYS B 1 90  ? 100.799 74.554  62.502  1.00 64.90  ? 90  LYS B CD  1 
ATOM   5622  C  CE  . LYS B 1 90  ? 101.749 73.454  62.102  1.00 64.90  ? 90  LYS B CE  1 
ATOM   5623  N  NZ  . LYS B 1 90  ? 101.572 72.270  62.984  1.00 64.90  ? 90  LYS B NZ  1 
ATOM   5624  N  N   . GLU B 1 91  ? 104.761 77.475  63.004  1.00 75.27  ? 91  GLU B N   1 
ATOM   5625  C  CA  . GLU B 1 91  ? 106.047 78.161  63.020  1.00 75.27  ? 91  GLU B CA  1 
ATOM   5626  C  C   . GLU B 1 91  ? 106.485 78.385  61.578  1.00 75.27  ? 91  GLU B C   1 
ATOM   5627  O  O   . GLU B 1 91  ? 106.304 77.508  60.727  1.00 75.27  ? 91  GLU B O   1 
ATOM   5628  C  CB  . GLU B 1 91  ? 107.111 77.386  63.801  1.00 75.27  ? 91  GLU B CB  1 
ATOM   5629  C  CG  . GLU B 1 91  ? 107.511 75.997  63.295  1.00 75.27  ? 91  GLU B CG  1 
ATOM   5630  C  CD  . GLU B 1 91  ? 106.474 74.918  63.532  1.00 75.27  ? 91  GLU B CD  1 
ATOM   5631  O  OE1 . GLU B 1 91  ? 105.463 75.190  64.212  1.00 75.27  ? 91  GLU B OE1 1 
ATOM   5632  O  OE2 . GLU B 1 91  ? 106.679 73.786  63.044  1.00 75.27  ? 91  GLU B OE2 1 
ATOM   5633  N  N   . CYS B 1 92  ? 107.022 79.563  61.289  1.00 82.41  ? 92  CYS B N   1 
ATOM   5634  C  CA  . CYS B 1 92  ? 107.574 79.774  59.963  1.00 82.41  ? 92  CYS B CA  1 
ATOM   5635  C  C   . CYS B 1 92  ? 109.015 79.281  59.907  1.00 82.41  ? 92  CYS B C   1 
ATOM   5636  O  O   . CYS B 1 92  ? 109.563 78.772  60.885  1.00 82.41  ? 92  CYS B O   1 
ATOM   5637  C  CB  . CYS B 1 92  ? 107.499 81.252  59.589  1.00 82.41  ? 92  CYS B CB  1 
ATOM   5638  S  SG  . CYS B 1 92  ? 108.278 81.673  58.019  1.00 82.41  ? 92  CYS B SG  1 
ATOM   5639  N  N   . ASN B 1 93  ? 109.640 79.446  58.741  1.00 80.42  ? 93  ASN B N   1 
ATOM   5640  C  CA  . ASN B 1 93  ? 111.023 79.020  58.596  1.00 80.42  ? 93  ASN B CA  1 
ATOM   5641  C  C   . ASN B 1 93  ? 111.994 79.951  59.296  1.00 80.42  ? 93  ASN B C   1 
ATOM   5642  O  O   . ASN B 1 93  ? 113.112 79.537  59.611  1.00 80.42  ? 93  ASN B O   1 
ATOM   5643  C  CB  . ASN B 1 93  ? 111.392 78.926  57.113  1.00 80.42  ? 93  ASN B CB  1 
ATOM   5644  C  CG  . ASN B 1 93  ? 111.234 77.525  56.560  1.00 80.42  ? 93  ASN B CG  1 
ATOM   5645  O  OD1 . ASN B 1 93  ? 111.101 76.564  57.311  1.00 80.42  ? 93  ASN B OD1 1 
ATOM   5646  N  ND2 . ASN B 1 93  ? 111.244 77.403  55.240  1.00 80.42  ? 93  ASN B ND2 1 
ATOM   5647  N  N   . ASP B 1 94  ? 111.589 81.184  59.574  1.00 84.74  ? 94  ASP B N   1 
ATOM   5648  C  CA  . ASP B 1 94  ? 112.439 82.134  60.281  1.00 84.74  ? 94  ASP B CA  1 
ATOM   5649  C  C   . ASP B 1 94  ? 112.135 82.198  61.776  1.00 84.74  ? 94  ASP B C   1 
ATOM   5650  O  O   . ASP B 1 94  ? 112.327 83.247  62.404  1.00 84.74  ? 94  ASP B O   1 
ATOM   5651  C  CB  . ASP B 1 94  ? 112.331 83.504  59.612  1.00 84.74  ? 94  ASP B CB  1 
ATOM   5652  C  CG  . ASP B 1 94  ? 110.908 84.070  59.606  1.00 84.74  ? 94  ASP B CG  1 
ATOM   5653  O  OD1 . ASP B 1 94  ? 109.963 83.452  60.138  1.00 84.74  ? 94  ASP B OD1 1 
ATOM   5654  O  OD2 . ASP B 1 94  ? 110.732 85.165  59.042  1.00 84.74  ? 94  ASP B OD2 1 
ATOM   5655  N  N   . ASN B 1 95  ? 111.676 81.072  62.345  1.00 85.44  ? 95  ASN B N   1 
ATOM   5656  C  CA  . ASN B 1 95  ? 111.410 80.895  63.782  1.00 85.44  ? 95  ASN B CA  1 
ATOM   5657  C  C   . ASN B 1 95  ? 110.385 81.895  64.314  1.00 85.44  ? 95  ASN B C   1 
ATOM   5658  O  O   . ASN B 1 95  ? 110.550 82.477  65.385  1.00 85.44  ? 95  ASN B O   1 
ATOM   5659  C  CB  . ASN B 1 95  ? 112.699 80.935  64.600  1.00 85.44  ? 95  ASN B CB  1 
ATOM   5660  C  CG  . ASN B 1 95  ? 113.391 79.596  64.635  1.00 85.44  ? 95  ASN B CG  1 
ATOM   5661  O  OD1 . ASN B 1 95  ? 113.249 78.836  65.589  1.00 85.44  ? 95  ASN B OD1 1 
ATOM   5662  N  ND2 . ASN B 1 95  ? 114.130 79.287  63.578  1.00 85.44  ? 95  ASN B ND2 1 
ATOM   5663  N  N   . THR B 1 96  ? 109.326 82.107  63.543  1.00 73.30  ? 96  THR B N   1 
ATOM   5664  C  CA  . THR B 1 96  ? 108.297 83.066  63.896  1.00 73.30  ? 96  THR B CA  1 
ATOM   5665  C  C   . THR B 1 96  ? 106.942 82.397  63.727  1.00 73.30  ? 96  THR B C   1 
ATOM   5666  O  O   . THR B 1 96  ? 106.704 81.656  62.772  1.00 73.30  ? 96  THR B O   1 
ATOM   5667  C  CB  . THR B 1 96  ? 108.412 84.330  63.044  1.00 73.30  ? 96  THR B CB  1 
ATOM   5668  O  OG1 . THR B 1 96  ? 109.758 84.807  63.114  1.00 73.30  ? 96  THR B OG1 1 
ATOM   5669  C  CG2 . THR B 1 96  ? 107.508 85.421  63.578  1.00 73.30  ? 96  THR B CG2 1 
ATOM   5670  N  N   . MET B 1 97  ? 106.054 82.659  64.678  1.00 63.19  ? 97  MET B N   1 
ATOM   5671  C  CA  . MET B 1 97  ? 104.721 82.072  64.726  1.00 63.19  ? 97  MET B CA  1 
ATOM   5672  C  C   . MET B 1 97  ? 103.774 83.021  64.006  1.00 63.19  ? 97  MET B C   1 
ATOM   5673  O  O   . MET B 1 97  ? 103.455 84.094  64.518  1.00 63.19  ? 97  MET B O   1 
ATOM   5674  C  CB  . MET B 1 97  ? 104.290 81.839  66.167  1.00 63.19  ? 97  MET B CB  1 
ATOM   5675  C  CG  . MET B 1 97  ? 105.357 81.180  67.012  1.00 63.19  ? 97  MET B CG  1 
ATOM   5676  S  SD  . MET B 1 97  ? 105.747 79.495  66.522  1.00 63.19  ? 97  MET B SD  1 
ATOM   5677  C  CE  . MET B 1 97  ? 104.211 78.669  66.879  1.00 63.19  ? 97  MET B CE  1 
ATOM   5678  N  N   . ARG B 1 98  ? 103.340 82.634  62.814  1.00 62.39  ? 98  ARG B N   1 
ATOM   5679  C  CA  . ARG B 1 98  ? 102.372 83.404  62.052  1.00 62.39  ? 98  ARG B CA  1 
ATOM   5680  C  C   . ARG B 1 98  ? 101.117 82.589  61.795  1.00 62.39  ? 98  ARG B C   1 
ATOM   5681  O  O   . ARG B 1 98  ? 101.101 81.367  61.957  1.00 62.39  ? 98  ARG B O   1 
ATOM   5682  C  CB  . ARG B 1 98  ? 102.949 83.822  60.699  1.00 62.39  ? 98  ARG B CB  1 
ATOM   5683  C  CG  . ARG B 1 98  ? 104.153 84.727  60.745  1.00 62.39  ? 98  ARG B CG  1 
ATOM   5684  C  CD  . ARG B 1 98  ? 103.744 86.173  60.603  1.00 62.39  ? 98  ARG B CD  1 
ATOM   5685  N  NE  . ARG B 1 98  ? 102.595 86.336  59.721  1.00 62.39  ? 98  ARG B NE  1 
ATOM   5686  C  CZ  . ARG B 1 98  ? 102.674 86.441  58.400  1.00 62.39  ? 98  ARG B CZ  1 
ATOM   5687  N  NH1 . ARG B 1 98  ? 103.855 86.410  57.802  1.00 62.39  ? 98  ARG B NH1 1 
ATOM   5688  N  NH2 . ARG B 1 98  ? 101.573 86.584  57.678  1.00 62.39  ? 98  ARG B NH2 1 
ATOM   5689  N  N   . ALA B 1 99  ? 100.042 83.295  61.452  1.00 62.42  ? 99  ALA B N   1 
ATOM   5690  C  CA  . ALA B 1 99  ? 98.796  82.628  61.118  1.00 62.42  ? 99  ALA B CA  1 
ATOM   5691  C  C   . ALA B 1 99  ? 98.961  81.886  59.798  1.00 62.42  ? 99  ALA B C   1 
ATOM   5692  O  O   . ALA B 1 99  ? 99.695  82.316  58.908  1.00 62.42  ? 99  ALA B O   1 
ATOM   5693  C  CB  . ALA B 1 99  ? 97.656  83.633  61.026  1.00 62.42  ? 99  ALA B CB  1 
ATOM   5694  N  N   . PHE B 1 100 ? 98.268  80.768  59.671  1.00 68.50  ? 100 PHE B N   1 
ATOM   5695  C  CA  . PHE B 1 100 ? 98.411  79.901  58.510  1.00 68.50  ? 100 PHE B CA  1 
ATOM   5696  C  C   . PHE B 1 100 ? 97.470  80.338  57.398  1.00 68.50  ? 100 PHE B C   1 
ATOM   5697  O  O   . PHE B 1 100 ? 96.261  80.453  57.612  1.00 68.50  ? 100 PHE B O   1 
ATOM   5698  C  CB  . PHE B 1 100 ? 98.148  78.449  58.864  1.00 68.50  ? 100 PHE B CB  1 
ATOM   5699  C  CG  . PHE B 1 100 ? 98.375  77.522  57.733  1.00 68.50  ? 100 PHE B CG  1 
ATOM   5700  C  CD1 . PHE B 1 100 ? 99.660  77.206  57.360  1.00 68.50  ? 100 PHE B CD1 1 
ATOM   5701  C  CD2 . PHE B 1 100 ? 97.323  76.977  57.032  1.00 68.50  ? 100 PHE B CD2 1 
ATOM   5702  C  CE1 . PHE B 1 100 ? 99.899  76.348  56.318  1.00 68.50  ? 100 PHE B CE1 1 
ATOM   5703  C  CE2 . PHE B 1 100 ? 97.557  76.119  55.980  1.00 68.50  ? 100 PHE B CE2 1 
ATOM   5704  C  CZ  . PHE B 1 100 ? 98.847  75.805  55.624  1.00 68.50  ? 100 PHE B CZ  1 
ATOM   5705  N  N   . THR B 1 101 ? 98.022  80.569  56.216  1.00 77.54  ? 101 THR B N   1 
ATOM   5706  C  CA  . THR B 1 101 ? 97.245  80.851  55.020  1.00 77.54  ? 101 THR B CA  1 
ATOM   5707  C  C   . THR B 1 101 ? 97.690  79.911  53.912  1.00 77.54  ? 101 THR B C   1 
ATOM   5708  O  O   . THR B 1 101 ? 98.847  79.490  53.860  1.00 77.54  ? 101 THR B O   1 
ATOM   5709  C  CB  . THR B 1 101 ? 97.411  82.299  54.560  1.00 77.54  ? 101 THR B CB  1 
ATOM   5710  O  OG1 . THR B 1 101 ? 98.791  82.674  54.642  1.00 77.54  ? 101 THR B OG1 1 
ATOM   5711  C  CG2 . THR B 1 101 ? 96.588  83.223  55.428  1.00 77.54  ? 101 THR B CG2 1 
ATOM   5712  N  N   . TYR B 1 102 ? 96.766  79.593  53.015  1.00 75.14  ? 102 TYR B N   1 
ATOM   5713  C  CA  . TYR B 1 102 ? 97.078  78.628  51.973  1.00 75.14  ? 102 TYR B CA  1 
ATOM   5714  C  C   . TYR B 1 102 ? 97.977  79.213  50.894  1.00 75.14  ? 102 TYR B C   1 
ATOM   5715  O  O   . TYR B 1 102 ? 98.741  78.475  50.264  1.00 75.14  ? 102 TYR B O   1 
ATOM   5716  C  CB  . TYR B 1 102 ? 95.796  78.096  51.340  1.00 75.14  ? 102 TYR B CB  1 
ATOM   5717  C  CG  . TYR B 1 102 ? 96.063  76.916  50.454  1.00 75.14  ? 102 TYR B CG  1 
ATOM   5718  C  CD1 . TYR B 1 102 ? 96.383  75.687  50.995  1.00 75.14  ? 102 TYR B CD1 1 
ATOM   5719  C  CD2 . TYR B 1 102 ? 96.040  77.041  49.079  1.00 75.14  ? 102 TYR B CD2 1 
ATOM   5720  C  CE1 . TYR B 1 102 ? 96.643  74.606  50.194  1.00 75.14  ? 102 TYR B CE1 1 
ATOM   5721  C  CE2 . TYR B 1 102 ? 96.304  75.968  48.270  1.00 75.14  ? 102 TYR B CE2 1 
ATOM   5722  C  CZ  . TYR B 1 102 ? 96.611  74.753  48.835  1.00 75.14  ? 102 TYR B CZ  1 
ATOM   5723  O  OH  . TYR B 1 102 ? 96.876  73.667  48.039  1.00 75.14  ? 102 TYR B OH  1 
ATOM   5724  N  N   . ARG B 1 103 ? 97.912  80.523  50.677  1.00 82.91  ? 103 ARG B N   1 
ATOM   5725  C  CA  . ARG B 1 103 ? 98.749  81.149  49.663  1.00 82.91  ? 103 ARG B CA  1 
ATOM   5726  C  C   . ARG B 1 103 ? 100.200 81.229  50.100  1.00 82.91  ? 103 ARG B C   1 
ATOM   5727  O  O   . ARG B 1 103 ? 101.099 81.204  49.254  1.00 82.91  ? 103 ARG B O   1 
ATOM   5728  C  CB  . ARG B 1 103 ? 98.223  82.540  49.331  1.00 82.91  ? 103 ARG B CB  1 
ATOM   5729  C  CG  . ARG B 1 103 ? 96.831  82.531  48.748  1.00 82.91  ? 103 ARG B CG  1 
ATOM   5730  C  CD  . ARG B 1 103 ? 96.740  81.574  47.578  1.00 82.91  ? 103 ARG B CD  1 
ATOM   5731  N  NE  . ARG B 1 103 ? 95.436  81.635  46.936  1.00 82.91  ? 103 ARG B NE  1 
ATOM   5732  C  CZ  . ARG B 1 103 ? 95.130  82.480  45.960  1.00 82.91  ? 103 ARG B CZ  1 
ATOM   5733  N  NH1 . ARG B 1 103 ? 96.038  83.336  45.512  1.00 82.91  ? 103 ARG B NH1 1 
ATOM   5734  N  NH2 . ARG B 1 103 ? 93.916  82.470  45.431  1.00 82.91  ? 103 ARG B NH2 1 
ATOM   5735  N  N   . THR B 1 104 ? 100.456 81.319  51.399  1.00 74.31  ? 104 THR B N   1 
ATOM   5736  C  CA  . THR B 1 104 ? 101.814 81.419  51.909  1.00 74.31  ? 104 THR B CA  1 
ATOM   5737  C  C   . THR B 1 104 ? 102.262 80.117  52.550  1.00 74.31  ? 104 THR B C   1 
ATOM   5738  O  O   . THR B 1 104 ? 103.045 80.122  53.501  1.00 74.31  ? 104 THR B O   1 
ATOM   5739  C  CB  . THR B 1 104 ? 101.929 82.553  52.922  1.00 74.31  ? 104 THR B CB  1 
ATOM   5740  O  OG1 . THR B 1 104 ? 101.398 82.121  54.179  1.00 74.31  ? 104 THR B OG1 1 
ATOM   5741  C  CG2 . THR B 1 104 ? 101.151 83.762  52.449  1.00 74.31  ? 104 THR B CG2 1 
ATOM   5742  N  N   . ARG B 1 105 ? 101.775 78.995  52.031  1.00 78.00  ? 105 ARG B N   1 
ATOM   5743  C  CA  . ARG B 1 105 ? 101.961 77.733  52.723  1.00 78.00  ? 105 ARG B CA  1 
ATOM   5744  C  C   . ARG B 1 105 ? 103.367 77.186  52.566  1.00 78.00  ? 105 ARG B C   1 
ATOM   5745  O  O   . ARG B 1 105 ? 103.753 76.295  53.320  1.00 78.00  ? 105 ARG B O   1 
ATOM   5746  C  CB  . ARG B 1 105 ? 100.947 76.717  52.226  1.00 78.00  ? 105 ARG B CB  1 
ATOM   5747  C  CG  . ARG B 1 105 ? 101.162 76.281  50.810  1.00 78.00  ? 105 ARG B CG  1 
ATOM   5748  C  CD  . ARG B 1 105 ? 100.081 75.309  50.424  1.00 78.00  ? 105 ARG B CD  1 
ATOM   5749  N  NE  . ARG B 1 105 ? 100.484 74.378  49.383  1.00 78.00  ? 105 ARG B NE  1 
ATOM   5750  C  CZ  . ARG B 1 105 ? 100.191 74.535  48.101  1.00 78.00  ? 105 ARG B CZ  1 
ATOM   5751  N  NH1 . ARG B 1 105 ? 99.494  75.587  47.704  1.00 78.00  ? 105 ARG B NH1 1 
ATOM   5752  N  NH2 . ARG B 1 105 ? 100.595 73.637  47.218  1.00 78.00  ? 105 ARG B NH2 1 
ATOM   5753  N  N   . GLN B 1 106 ? 104.144 77.691  51.618  1.00 79.99  ? 106 GLN B N   1 
ATOM   5754  C  CA  . GLN B 1 106 ? 105.475 77.140  51.418  1.00 79.99  ? 106 GLN B CA  1 
ATOM   5755  C  C   . GLN B 1 106 ? 106.505 77.687  52.401  1.00 79.99  ? 106 GLN B C   1 
ATOM   5756  O  O   . GLN B 1 106 ? 107.619 77.156  52.459  1.00 79.99  ? 106 GLN B O   1 
ATOM   5757  C  CB  . GLN B 1 106 ? 105.931 77.440  49.988  1.00 79.99  ? 106 GLN B CB  1 
ATOM   5758  C  CG  . GLN B 1 106 ? 105.163 76.679  48.916  1.00 79.99  ? 106 GLN B CG  1 
ATOM   5759  C  CD  . GLN B 1 106 ? 105.696 75.290  48.670  1.00 79.99  ? 106 GLN B CD  1 
ATOM   5760  O  OE1 . GLN B 1 106 ? 106.688 74.877  49.267  1.00 79.99  ? 106 GLN B OE1 1 
ATOM   5761  N  NE2 . GLN B 1 106 ? 105.031 74.552  47.790  1.00 79.99  ? 106 GLN B NE2 1 
ATOM   5762  N  N   . ASN B 1 107 ? 106.160 78.711  53.182  1.00 76.57  ? 107 ASN B N   1 
ATOM   5763  C  CA  . ASN B 1 107 ? 107.089 79.334  54.117  1.00 76.57  ? 107 ASN B CA  1 
ATOM   5764  C  C   . ASN B 1 107 ? 107.310 78.559  55.406  1.00 76.57  ? 107 ASN B C   1 
ATOM   5765  O  O   . ASN B 1 107 ? 108.262 78.867  56.126  1.00 76.57  ? 107 ASN B O   1 
ATOM   5766  C  CB  . ASN B 1 107 ? 106.607 80.736  54.463  1.00 76.57  ? 107 ASN B CB  1 
ATOM   5767  C  CG  . ASN B 1 107 ? 106.684 81.673  53.292  1.00 76.57  ? 107 ASN B CG  1 
ATOM   5768  O  OD1 . ASN B 1 107 ? 106.719 81.240  52.142  1.00 76.57  ? 107 ASN B OD1 1 
ATOM   5769  N  ND2 . ASN B 1 107 ? 106.708 82.967  53.571  1.00 76.57  ? 107 ASN B ND2 1 
ATOM   5770  N  N   . PHE B 1 108 ? 106.469 77.588  55.730  1.00 76.69  ? 108 PHE B N   1 
ATOM   5771  C  CA  . PHE B 1 108 ? 106.426 77.013  57.067  1.00 76.69  ? 108 PHE B CA  1 
ATOM   5772  C  C   . PHE B 1 108 ? 107.317 75.780  57.175  1.00 76.69  ? 108 PHE B C   1 
ATOM   5773  O  O   . PHE B 1 108 ? 107.524 75.053  56.203  1.00 76.69  ? 108 PHE B O   1 
ATOM   5774  C  CB  . PHE B 1 108 ? 104.992 76.697  57.459  1.00 76.69  ? 108 PHE B CB  1 
ATOM   5775  C  CG  . PHE B 1 108 ? 104.128 77.910  57.489  1.00 76.69  ? 108 PHE B CG  1 
ATOM   5776  C  CD1 . PHE B 1 108 ? 104.321 78.874  58.456  1.00 76.69  ? 108 PHE B CD1 1 
ATOM   5777  C  CD2 . PHE B 1 108 ? 103.141 78.102  56.549  1.00 76.69  ? 108 PHE B CD2 1 
ATOM   5778  C  CE1 . PHE B 1 108 ? 103.537 80.004  58.489  1.00 76.69  ? 108 PHE B CE1 1 
ATOM   5779  C  CE2 . PHE B 1 108 ? 102.354 79.230  56.579  1.00 76.69  ? 108 PHE B CE2 1 
ATOM   5780  C  CZ  . PHE B 1 108 ? 102.549 80.177  57.551  1.00 76.69  ? 108 PHE B CZ  1 
ATOM   5781  N  N   . LYS B 1 109 ? 107.798 75.526  58.390  1.00 75.69  ? 109 LYS B N   1 
ATOM   5782  C  CA  . LYS B 1 109 ? 108.842 74.534  58.608  1.00 75.69  ? 109 LYS B CA  1 
ATOM   5783  C  C   . LYS B 1 109 ? 108.313 73.113  58.505  1.00 75.69  ? 109 LYS B C   1 
ATOM   5784  O  O   . LYS B 1 109 ? 107.232 72.796  59.003  1.00 75.69  ? 109 LYS B O   1 
ATOM   5785  C  CB  . LYS B 1 109 ? 109.465 74.721  59.991  1.00 75.69  ? 109 LYS B CB  1 
ATOM   5786  C  CG  . LYS B 1 109 ? 110.719 73.887  60.212  1.00 75.69  ? 109 LYS B CG  1 
ATOM   5787  C  CD  . LYS B 1 109 ? 111.344 74.074  61.585  1.00 75.69  ? 109 LYS B CD  1 
ATOM   5788  C  CE  . LYS B 1 109 ? 111.713 75.509  61.867  1.00 75.69  ? 109 LYS B CE  1 
ATOM   5789  N  NZ  . LYS B 1 109 ? 112.264 75.644  63.245  1.00 75.69  ? 109 LYS B NZ  1 
ATOM   5790  N  N   . GLY B 1 110 ? 109.087 72.261  57.833  1.00 84.30  ? 110 GLY B N   1 
ATOM   5791  C  CA  . GLY B 1 110 ? 108.733 70.865  57.699  1.00 84.30  ? 110 GLY B CA  1 
ATOM   5792  C  C   . GLY B 1 110 ? 107.595 70.596  56.751  1.00 84.30  ? 110 GLY B C   1 
ATOM   5793  O  O   . GLY B 1 110 ? 106.981 69.530  56.820  1.00 84.30  ? 110 GLY B O   1 
ATOM   5794  N  N   . PHE B 1 111 ? 107.318 71.517  55.841  1.00 85.98  ? 111 PHE B N   1 
ATOM   5795  C  CA  . PHE B 1 111 ? 106.202 71.385  54.923  1.00 85.98  ? 111 PHE B CA  1 
ATOM   5796  C  C   . PHE B 1 111 ? 106.666 71.036  53.521  1.00 85.98  ? 111 PHE B C   1 
ATOM   5797  O  O   . PHE B 1 111 ? 107.499 71.732  52.936  1.00 85.98  ? 111 PHE B O   1 
ATOM   5798  C  CB  . PHE B 1 111 ? 105.393 72.675  54.880  1.00 85.98  ? 111 PHE B CB  1 
ATOM   5799  C  CG  . PHE B 1 111 ? 104.225 72.611  53.961  1.00 85.98  ? 111 PHE B CG  1 
ATOM   5800  C  CD1 . PHE B 1 111 ? 103.093 71.912  54.315  1.00 85.98  ? 111 PHE B CD1 1 
ATOM   5801  C  CD2 . PHE B 1 111 ? 104.249 73.265  52.748  1.00 85.98  ? 111 PHE B CD2 1 
ATOM   5802  C  CE1 . PHE B 1 111 ? 102.010 71.853  53.471  1.00 85.98  ? 111 PHE B CE1 1 
ATOM   5803  C  CE2 . PHE B 1 111 ? 103.167 73.218  51.903  1.00 85.98  ? 111 PHE B CE2 1 
ATOM   5804  C  CZ  . PHE B 1 111 ? 102.049 72.509  52.264  1.00 85.98  ? 111 PHE B CZ  1 
ATOM   5805  N  N   . ASP B 1 112 ? 106.104 69.957  52.986  1.00 97.07  ? 112 ASP B N   1 
ATOM   5806  C  CA  . ASP B 1 112 ? 106.189 69.624  51.574  1.00 97.07  ? 112 ASP B CA  1 
ATOM   5807  C  C   . ASP B 1 112 ? 104.782 69.649  51.005  1.00 97.07  ? 112 ASP B C   1 
ATOM   5808  O  O   . ASP B 1 112 ? 103.802 69.878  51.718  1.00 97.07  ? 112 ASP B O   1 
ATOM   5809  C  CB  . ASP B 1 112 ? 106.803 68.239  51.315  1.00 97.07  ? 112 ASP B CB  1 
ATOM   5810  C  CG  . ASP B 1 112 ? 108.217 68.114  51.818  1.00 97.07  ? 112 ASP B CG  1 
ATOM   5811  O  OD1 . ASP B 1 112 ? 108.778 69.119  52.294  1.00 97.07  ? 112 ASP B OD1 1 
ATOM   5812  O  OD2 . ASP B 1 112 ? 108.777 67.002  51.716  1.00 97.07  ? 112 ASP B OD2 1 
ATOM   5813  N  N   . ASP B 1 113 ? 104.684 69.394  49.711  1.00 102.15 ? 113 ASP B N   1 
ATOM   5814  C  CA  . ASP B 1 113 ? 103.386 69.123  49.121  1.00 102.15 ? 113 ASP B CA  1 
ATOM   5815  C  C   . ASP B 1 113 ? 103.014 67.650  49.181  1.00 102.15 ? 113 ASP B C   1 
ATOM   5816  O  O   . ASP B 1 113 ? 101.871 67.306  48.866  1.00 102.15 ? 113 ASP B O   1 
ATOM   5817  C  CB  . ASP B 1 113 ? 103.345 69.644  47.685  1.00 102.15 ? 113 ASP B CB  1 
ATOM   5818  C  CG  . ASP B 1 113 ? 103.229 71.159  47.626  1.00 102.15 ? 113 ASP B CG  1 
ATOM   5819  O  OD1 . ASP B 1 113 ? 102.260 71.711  48.190  1.00 102.15 ? 113 ASP B OD1 1 
ATOM   5820  O  OD2 . ASP B 1 113 ? 104.113 71.805  47.031  1.00 102.15 ? 113 ASP B OD2 1 
ATOM   5821  N  N   . ASN B 1 114 ? 103.943 66.777  49.558  1.00 98.34  ? 114 ASN B N   1 
ATOM   5822  C  CA  . ASN B 1 114 ? 103.662 65.365  49.779  1.00 98.34  ? 114 ASN B CA  1 
ATOM   5823  C  C   . ASN B 1 114 ? 103.954 64.975  51.222  1.00 98.34  ? 114 ASN B C   1 
ATOM   5824  O  O   . ASN B 1 114 ? 104.557 63.938  51.500  1.00 98.34  ? 114 ASN B O   1 
ATOM   5825  C  CB  . ASN B 1 114 ? 104.456 64.495  48.809  1.00 98.34  ? 114 ASN B CB  1 
ATOM   5826  C  CG  . ASN B 1 114 ? 104.067 64.736  47.371  1.00 98.34  ? 114 ASN B CG  1 
ATOM   5827  O  OD1 . ASN B 1 114 ? 103.237 64.016  46.816  1.00 98.34  ? 114 ASN B OD1 1 
ATOM   5828  N  ND2 . ASN B 1 114 ? 104.660 65.752  46.756  1.00 98.34  ? 114 ASN B ND2 1 
ATOM   5829  N  N   . ASN B 1 115 ? 103.524 65.812  52.157  1.00 94.43  ? 115 ASN B N   1 
ATOM   5830  C  CA  . ASN B 1 115 ? 103.808 65.627  53.574  1.00 94.43  ? 115 ASN B CA  1 
ATOM   5831  C  C   . ASN B 1 115 ? 102.483 65.590  54.321  1.00 94.43  ? 115 ASN B C   1 
ATOM   5832  O  O   . ASN B 1 115 ? 101.855 66.634  54.519  1.00 94.43  ? 115 ASN B O   1 
ATOM   5833  C  CB  . ASN B 1 115 ? 104.709 66.752  54.089  1.00 94.43  ? 115 ASN B CB  1 
ATOM   5834  C  CG  . ASN B 1 115 ? 105.224 66.497  55.483  1.00 94.43  ? 115 ASN B CG  1 
ATOM   5835  O  OD1 . ASN B 1 115 ? 105.101 65.396  56.014  1.00 94.43  ? 115 ASN B OD1 1 
ATOM   5836  N  ND2 . ASN B 1 115 ? 105.827 67.516  56.081  1.00 94.43  ? 115 ASN B ND2 1 
ATOM   5837  N  N   . ASP B 1 116 ? 102.066 64.400  54.749  1.00 94.46  ? 116 ASP B N   1 
ATOM   5838  C  CA  . ASP B 1 116 ? 100.873 64.236  55.574  1.00 94.46  ? 116 ASP B CA  1 
ATOM   5839  C  C   . ASP B 1 116 ? 101.140 64.380  57.066  1.00 94.46  ? 116 ASP B C   1 
ATOM   5840  O  O   . ASP B 1 116 ? 100.229 64.170  57.870  1.00 94.46  ? 116 ASP B O   1 
ATOM   5841  C  CB  . ASP B 1 116 ? 100.203 62.885  55.291  1.00 94.46  ? 116 ASP B CB  1 
ATOM   5842  C  CG  . ASP B 1 116 ? 101.161 61.713  55.386  1.00 94.46  ? 116 ASP B CG  1 
ATOM   5843  O  OD1 . ASP B 1 116 ? 102.351 61.919  55.702  1.00 94.46  ? 116 ASP B OD1 1 
ATOM   5844  O  OD2 . ASP B 1 116 ? 100.710 60.571  55.147  1.00 94.46  ? 116 ASP B OD2 1 
ATOM   5845  N  N   . ASP B 1 117 ? 102.355 64.741  57.452  1.00 88.76  ? 117 ASP B N   1 
ATOM   5846  C  CA  . ASP B 1 117 ? 102.710 64.869  58.854  1.00 88.76  ? 117 ASP B CA  1 
ATOM   5847  C  C   . ASP B 1 117 ? 102.793 66.321  59.293  1.00 88.76  ? 117 ASP B C   1 
ATOM   5848  O  O   . ASP B 1 117 ? 103.278 66.605  60.393  1.00 88.76  ? 117 ASP B O   1 
ATOM   5849  C  CB  . ASP B 1 117 ? 104.023 64.140  59.113  1.00 88.76  ? 117 ASP B CB  1 
ATOM   5850  C  CG  . ASP B 1 117 ? 104.068 62.788  58.430  1.00 88.76  ? 117 ASP B CG  1 
ATOM   5851  O  OD1 . ASP B 1 117 ? 103.064 62.056  58.513  1.00 88.76  ? 117 ASP B OD1 1 
ATOM   5852  O  OD2 . ASP B 1 117 ? 105.095 62.463  57.801  1.00 88.76  ? 117 ASP B OD2 1 
ATOM   5853  N  N   . PHE B 1 118 ? 102.336 67.243  58.449  1.00 77.20  ? 118 PHE B N   1 
ATOM   5854  C  CA  . PHE B 1 118 ? 102.335 68.664  58.752  1.00 77.20  ? 118 PHE B CA  1 
ATOM   5855  C  C   . PHE B 1 118 ? 101.252 68.990  59.760  1.00 77.20  ? 118 PHE B C   1 
ATOM   5856  O  O   . PHE B 1 118 ? 101.536 69.474  60.856  1.00 77.20  ? 118 PHE B O   1 
ATOM   5857  C  CB  . PHE B 1 118 ? 102.102 69.515  57.520  1.00 77.20  ? 118 PHE B CB  1 
ATOM   5858  C  CG  . PHE B 1 118 ? 102.165 70.972  57.809  1.00 77.20  ? 118 PHE B CG  1 
ATOM   5859  C  CD1 . PHE B 1 118 ? 103.228 71.504  58.506  1.00 77.20  ? 118 PHE B CD1 1 
ATOM   5860  C  CD2 . PHE B 1 118 ? 101.120 71.801  57.452  1.00 77.20  ? 118 PHE B CD2 1 
ATOM   5861  C  CE1 . PHE B 1 118 ? 103.271 72.850  58.797  1.00 77.20  ? 118 PHE B CE1 1 
ATOM   5862  C  CE2 . PHE B 1 118 ? 101.156 73.145  57.741  1.00 77.20  ? 118 PHE B CE2 1 
ATOM   5863  C  CZ  . PHE B 1 118 ? 102.232 73.670  58.416  1.00 77.20  ? 118 PHE B CZ  1 
ATOM   5864  N  N   . LEU B 1 119 ? 100.007 68.726  59.395  1.00 72.05  ? 119 LEU B N   1 
ATOM   5865  C  CA  . LEU B 1 119 ? 98.919  68.910  60.334  1.00 72.05  ? 119 LEU B CA  1 
ATOM   5866  C  C   . LEU B 1 119 ? 98.792  67.663  61.179  1.00 72.05  ? 119 LEU B C   1 
ATOM   5867  O  O   . LEU B 1 119 ? 98.576  66.567  60.658  1.00 72.05  ? 119 LEU B O   1 
ATOM   5868  C  CB  . LEU B 1 119 ? 97.625  69.153  59.580  1.00 72.05  ? 119 LEU B CB  1 
ATOM   5869  C  CG  . LEU B 1 119 ? 97.548  70.475  58.842  1.00 72.05  ? 119 LEU B CG  1 
ATOM   5870  C  CD1 . LEU B 1 119 ? 96.129  70.704  58.397  1.00 72.05  ? 119 LEU B CD1 1 
ATOM   5871  C  CD2 . LEU B 1 119 ? 98.041  71.614  59.698  1.00 72.05  ? 119 LEU B CD2 1 
ATOM   5872  N  N   . THR B 1 120 ? 98.941  67.829  62.486  1.00 67.69  ? 120 THR B N   1 
ATOM   5873  C  CA  . THR B 1 120 ? 98.849  66.691  63.373  1.00 67.69  ? 120 THR B CA  1 
ATOM   5874  C  C   . THR B 1 120 ? 97.404  66.225  63.480  1.00 67.69  ? 120 THR B C   1 
ATOM   5875  O  O   . THR B 1 120 ? 96.468  66.912  63.070  1.00 67.69  ? 120 THR B O   1 
ATOM   5876  C  CB  . THR B 1 120 ? 99.394  67.069  64.736  1.00 67.69  ? 120 THR B CB  1 
ATOM   5877  O  OG1 . THR B 1 120 ? 98.621  68.156  65.250  1.00 67.69  ? 120 THR B OG1 1 
ATOM   5878  C  CG2 . THR B 1 120 ? 100.819 67.534  64.587  1.00 67.69  ? 120 THR B CG2 1 
ATOM   5879  N  N   . MET B 1 121 ? 97.225  65.050  64.081  1.00 59.97  ? 121 MET B N   1 
ATOM   5880  C  CA  . MET B 1 121 ? 95.899  64.454  64.173  1.00 59.97  ? 121 MET B CA  1 
ATOM   5881  C  C   . MET B 1 121 ? 94.968  65.239  65.082  1.00 59.97  ? 121 MET B C   1 
ATOM   5882  O  O   . MET B 1 121 ? 93.750  65.203  64.888  1.00 59.97  ? 121 MET B O   1 
ATOM   5883  C  CB  . MET B 1 121 ? 96.007  63.011  64.637  1.00 59.97  ? 121 MET B CB  1 
ATOM   5884  C  CG  . MET B 1 121 ? 94.927  62.152  64.048  1.00 59.97  ? 121 MET B CG  1 
ATOM   5885  S  SD  . MET B 1 121 ? 94.807  60.550  64.838  1.00 59.97  ? 121 MET B SD  1 
ATOM   5886  C  CE  . MET B 1 121 ? 93.672  59.730  63.723  1.00 59.97  ? 121 MET B CE  1 
ATOM   5887  N  N   . ALA B 1 122 ? 95.512  65.936  66.077  1.00 54.93  ? 122 ALA B N   1 
ATOM   5888  C  CA  . ALA B 1 122 ? 94.678  66.779  66.924  1.00 54.93  ? 122 ALA B CA  1 
ATOM   5889  C  C   . ALA B 1 122 ? 94.112  67.967  66.162  1.00 54.93  ? 122 ALA B C   1 
ATOM   5890  O  O   . ALA B 1 122 ? 92.919  68.265  66.276  1.00 54.93  ? 122 ALA B O   1 
ATOM   5891  C  CB  . ALA B 1 122 ? 95.478  67.260  68.125  1.00 54.93  ? 122 ALA B CB  1 
ATOM   5892  N  N   . GLU B 1 123 ? 94.948  68.660  65.388  1.00 61.05  ? 123 GLU B N   1 
ATOM   5893  C  CA  . GLU B 1 123 ? 94.455  69.766  64.575  1.00 61.05  ? 123 GLU B CA  1 
ATOM   5894  C  C   . GLU B 1 123 ? 93.528  69.292  63.469  1.00 61.05  ? 123 GLU B C   1 
ATOM   5895  O  O   . GLU B 1 123 ? 92.597  70.015  63.105  1.00 61.05  ? 123 GLU B O   1 
ATOM   5896  C  CB  . GLU B 1 123 ? 95.610  70.578  64.002  1.00 61.05  ? 123 GLU B CB  1 
ATOM   5897  C  CG  . GLU B 1 123 ? 96.274  71.479  65.017  1.00 61.05  ? 123 GLU B CG  1 
ATOM   5898  C  CD  . GLU B 1 123 ? 97.725  71.768  64.693  1.00 61.05  ? 123 GLU B CD  1 
ATOM   5899  O  OE1 . GLU B 1 123 ? 98.370  70.933  64.029  1.00 61.05  ? 123 GLU B OE1 1 
ATOM   5900  O  OE2 . GLU B 1 123 ? 98.222  72.838  65.094  1.00 61.05  ? 123 GLU B OE2 1 
ATOM   5901  N  N   . CYS B 1 124 ? 93.773  68.107  62.908  1.00 62.56  ? 124 CYS B N   1 
ATOM   5902  C  CA  . CYS B 1 124 ? 92.868  67.601  61.885  1.00 62.56  ? 124 CYS B CA  1 
ATOM   5903  C  C   . CYS B 1 124 ? 91.505  67.275  62.464  1.00 62.56  ? 124 CYS B C   1 
ATOM   5904  O  O   . CYS B 1 124 ? 90.483  67.557  61.832  1.00 62.56  ? 124 CYS B O   1 
ATOM   5905  C  CB  . CYS B 1 124 ? 93.452  66.375  61.199  1.00 62.56  ? 124 CYS B CB  1 
ATOM   5906  S  SG  . CYS B 1 124 ? 94.945  66.705  60.263  1.00 62.56  ? 124 CYS B SG  1 
ATOM   5907  N  N   . GLN B 1 125 ? 91.459  66.680  63.652  1.00 52.85  ? 125 GLN B N   1 
ATOM   5908  C  CA  . GLN B 1 125 ? 90.164  66.413  64.260  1.00 52.85  ? 125 GLN B CA  1 
ATOM   5909  C  C   . GLN B 1 125 ? 89.491  67.691  64.725  1.00 52.85  ? 125 GLN B C   1 
ATOM   5910  O  O   . GLN B 1 125 ? 88.263  67.774  64.725  1.00 52.85  ? 125 GLN B O   1 
ATOM   5911  C  CB  . GLN B 1 125 ? 90.296  65.443  65.421  1.00 52.85  ? 125 GLN B CB  1 
ATOM   5912  C  CG  . GLN B 1 125 ? 90.395  64.013  64.987  1.00 52.85  ? 125 GLN B CG  1 
ATOM   5913  C  CD  . GLN B 1 125 ? 91.272  63.198  65.900  1.00 52.85  ? 125 GLN B CD  1 
ATOM   5914  O  OE1 . GLN B 1 125 ? 91.879  63.730  66.825  1.00 52.85  ? 125 GLN B OE1 1 
ATOM   5915  N  NE2 . GLN B 1 125 ? 91.341  61.898  65.653  1.00 52.85  ? 125 GLN B NE2 1 
ATOM   5916  N  N   . PHE B 1 126 ? 90.271  68.688  65.121  1.00 46.40  ? 126 PHE B N   1 
ATOM   5917  C  CA  . PHE B 1 126 ? 89.699  69.982  65.463  1.00 46.40  ? 126 PHE B CA  1 
ATOM   5918  C  C   . PHE B 1 126 ? 89.090  70.686  64.262  1.00 46.40  ? 126 PHE B C   1 
ATOM   5919  O  O   . PHE B 1 126 ? 88.028  71.301  64.384  1.00 46.40  ? 126 PHE B O   1 
ATOM   5920  C  CB  . PHE B 1 126 ? 90.782  70.844  66.095  1.00 46.40  ? 126 PHE B CB  1 
ATOM   5921  C  CG  . PHE B 1 126 ? 90.352  72.227  66.432  1.00 46.40  ? 126 PHE B CG  1 
ATOM   5922  C  CD1 . PHE B 1 126 ? 89.173  72.463  67.103  1.00 46.40  ? 126 PHE B CD1 1 
ATOM   5923  C  CD2 . PHE B 1 126 ? 91.179  73.290  66.143  1.00 46.40  ? 126 PHE B CD2 1 
ATOM   5924  C  CE1 . PHE B 1 126 ? 88.803  73.735  67.422  1.00 46.40  ? 126 PHE B CE1 1 
ATOM   5925  C  CE2 . PHE B 1 126 ? 90.822  74.559  66.470  1.00 46.40  ? 126 PHE B CE2 1 
ATOM   5926  C  CZ  . PHE B 1 126 ? 89.632  74.785  67.110  1.00 46.40  ? 126 PHE B CZ  1 
ATOM   5927  N  N   . ILE B 1 127 ? 89.728  70.602  63.097  1.00 49.24  ? 127 ILE B N   1 
ATOM   5928  C  CA  . ILE B 1 127 ? 89.185  71.269  61.917  1.00 49.24  ? 127 ILE B CA  1 
ATOM   5929  C  C   . ILE B 1 127 ? 87.904  70.609  61.427  1.00 49.24  ? 127 ILE B C   1 
ATOM   5930  O  O   . ILE B 1 127 ? 86.932  71.299  61.098  1.00 49.24  ? 127 ILE B O   1 
ATOM   5931  C  CB  . ILE B 1 127 ? 90.255  71.335  60.813  1.00 49.24  ? 127 ILE B CB  1 
ATOM   5932  C  CG1 . ILE B 1 127 ? 91.292  72.385  61.153  1.00 49.24  ? 127 ILE B CG1 1 
ATOM   5933  C  CG2 . ILE B 1 127 ? 89.676  71.690  59.485  1.00 49.24  ? 127 ILE B CG2 1 
ATOM   5934  C  CD1 . ILE B 1 127 ? 92.584  72.163  60.462  1.00 49.24  ? 127 ILE B CD1 1 
ATOM   5935  N  N   . ILE B 1 128 ? 87.835  69.281  61.473  1.00 45.98  ? 128 ILE B N   1 
ATOM   5936  C  CA  . ILE B 1 128 ? 86.625  68.604  61.024  1.00 45.98  ? 128 ILE B CA  1 
ATOM   5937  C  C   . ILE B 1 128 ? 85.448  68.846  61.956  1.00 45.98  ? 128 ILE B C   1 
ATOM   5938  O  O   . ILE B 1 128 ? 84.319  69.043  61.488  1.00 45.98  ? 128 ILE B O   1 
ATOM   5939  C  CB  . ILE B 1 128 ? 86.952  67.122  60.820  1.00 45.98  ? 128 ILE B CB  1 
ATOM   5940  C  CG1 . ILE B 1 128 ? 87.838  67.008  59.582  1.00 45.98  ? 128 ILE B CG1 1 
ATOM   5941  C  CG2 . ILE B 1 128 ? 85.709  66.291  60.684  1.00 45.98  ? 128 ILE B CG2 1 
ATOM   5942  C  CD1 . ILE B 1 128 ? 88.126  65.602  59.133  1.00 45.98  ? 128 ILE B CD1 1 
ATOM   5943  N  N   . LYS B 1 129 ? 85.684  68.919  63.262  1.00 43.45  ? 129 LYS B N   1 
ATOM   5944  C  CA  . LYS B 1 129 ? 84.600  69.294  64.165  1.00 43.45  ? 129 LYS B CA  1 
ATOM   5945  C  C   . LYS B 1 129 ? 84.194  70.740  63.942  1.00 43.45  ? 129 LYS B C   1 
ATOM   5946  O  O   . LYS B 1 129 ? 83.008  71.075  64.016  1.00 43.45  ? 129 LYS B O   1 
ATOM   5947  C  CB  . LYS B 1 129 ? 84.992  69.058  65.625  1.00 43.45  ? 129 LYS B CB  1 
ATOM   5948  C  CG  . LYS B 1 129 ? 83.881  69.374  66.615  1.00 43.45  ? 129 LYS B CG  1 
ATOM   5949  C  CD  . LYS B 1 129 ? 82.610  68.625  66.305  1.00 43.45  ? 129 LYS B CD  1 
ATOM   5950  C  CE  . LYS B 1 129 ? 81.445  69.161  67.128  1.00 43.45  ? 129 LYS B CE  1 
ATOM   5951  N  NZ  . LYS B 1 129 ? 81.666  69.141  68.591  1.00 43.45  ? 129 LYS B NZ  1 
ATOM   5952  N  N   . HIS B 1 130 ? 85.154  71.589  63.605  1.00 45.62  ? 130 HIS B N   1 
ATOM   5953  C  CA  . HIS B 1 130 ? 84.840  72.978  63.332  1.00 45.62  ? 130 HIS B CA  1 
ATOM   5954  C  C   . HIS B 1 130 ? 84.098  73.148  62.015  1.00 45.62  ? 130 HIS B C   1 
ATOM   5955  O  O   . HIS B 1 130 ? 83.294  74.073  61.881  1.00 45.62  ? 130 HIS B O   1 
ATOM   5956  C  CB  . HIS B 1 130 ? 86.112  73.800  63.343  1.00 45.62  ? 130 HIS B CB  1 
ATOM   5957  C  CG  . HIS B 1 130 ? 85.873  75.249  63.129  1.00 45.62  ? 130 HIS B CG  1 
ATOM   5958  N  ND1 . HIS B 1 130 ? 85.610  76.111  64.168  1.00 45.62  ? 130 HIS B ND1 1 
ATOM   5959  C  CD2 . HIS B 1 130 ? 85.851  75.992  62.002  1.00 45.62  ? 130 HIS B CD2 1 
ATOM   5960  C  CE1 . HIS B 1 130 ? 85.436  77.328  63.689  1.00 45.62  ? 130 HIS B CE1 1 
ATOM   5961  N  NE2 . HIS B 1 130 ? 85.577  77.283  62.377  1.00 45.62  ? 130 HIS B NE2 1 
ATOM   5962  N  N   . GLU B 1 131 ? 84.324  72.271  61.043  1.00 52.26  ? 131 GLU B N   1 
ATOM   5963  C  CA  . GLU B 1 131 ? 83.575  72.396  59.800  1.00 52.26  ? 131 GLU B CA  1 
ATOM   5964  C  C   . GLU B 1 131 ? 82.172  71.842  59.928  1.00 52.26  ? 131 GLU B C   1 
ATOM   5965  O  O   . GLU B 1 131 ? 81.261  72.323  59.252  1.00 52.26  ? 131 GLU B O   1 
ATOM   5966  C  CB  . GLU B 1 131 ? 84.291  71.688  58.655  1.00 52.26  ? 131 GLU B CB  1 
ATOM   5967  C  CG  . GLU B 1 131 ? 85.598  72.320  58.206  1.00 52.26  ? 131 GLU B CG  1 
ATOM   5968  C  CD  . GLU B 1 131 ? 85.496  73.782  57.826  1.00 52.26  ? 131 GLU B CD  1 
ATOM   5969  O  OE1 . GLU B 1 131 ? 84.439  74.225  57.328  1.00 52.26  ? 131 GLU B OE1 1 
ATOM   5970  O  OE2 . GLU B 1 131 ? 86.493  74.501  58.029  1.00 52.26  ? 131 GLU B OE2 1 
ATOM   5971  N  N   . LEU B 1 132 ? 81.969  70.865  60.799  1.00 50.58  ? 132 LEU B N   1 
ATOM   5972  C  CA  . LEU B 1 132 ? 80.613  70.414  61.064  1.00 50.58  ? 132 LEU B CA  1 
ATOM   5973  C  C   . LEU B 1 132 ? 79.851  71.426  61.904  1.00 50.58  ? 132 LEU B C   1 
ATOM   5974  O  O   . LEU B 1 132 ? 78.623  71.493  61.821  1.00 50.58  ? 132 LEU B O   1 
ATOM   5975  C  CB  . LEU B 1 132 ? 80.631  69.047  61.727  1.00 50.58  ? 132 LEU B CB  1 
ATOM   5976  C  CG  . LEU B 1 132 ? 80.986  67.959  60.731  1.00 50.58  ? 132 LEU B CG  1 
ATOM   5977  C  CD1 . LEU B 1 132 ? 81.052  66.637  61.429  1.00 50.58  ? 132 LEU B CD1 1 
ATOM   5978  C  CD2 . LEU B 1 132 ? 79.935  67.925  59.666  1.00 50.58  ? 132 LEU B CD2 1 
ATOM   5979  N  N   . GLU B 1 133 ? 80.544  72.190  62.742  1.00 50.41  ? 133 GLU B N   1 
ATOM   5980  C  CA  . GLU B 1 133 ? 79.872  73.226  63.515  1.00 50.41  ? 133 GLU B CA  1 
ATOM   5981  C  C   . GLU B 1 133 ? 79.436  74.367  62.606  1.00 50.41  ? 133 GLU B C   1 
ATOM   5982  O  O   . GLU B 1 133 ? 78.318  74.875  62.723  1.00 50.41  ? 133 GLU B O   1 
ATOM   5983  C  CB  . GLU B 1 133 ? 80.786  73.734  64.626  1.00 50.41  ? 133 GLU B CB  1 
ATOM   5984  N  N   . ASN B 1 134 ? 80.307  74.780  61.683  1.00 54.47  ? 134 ASN B N   1 
ATOM   5985  C  CA  . ASN B 1 134 ? 79.977  75.827  60.718  1.00 54.47  ? 134 ASN B CA  1 
ATOM   5986  C  C   . ASN B 1 134 ? 79.299  75.223  59.493  1.00 54.47  ? 134 ASN B C   1 
ATOM   5987  O  O   . ASN B 1 134 ? 79.786  75.331  58.367  1.00 54.47  ? 134 ASN B O   1 
ATOM   5988  C  CB  . ASN B 1 134 ? 81.233  76.570  60.282  1.00 54.47  ? 134 ASN B CB  1 
ATOM   5989  C  CG  . ASN B 1 134 ? 81.716  77.554  61.309  1.00 54.47  ? 134 ASN B CG  1 
ATOM   5990  O  OD1 . ASN B 1 134 ? 81.798  77.240  62.492  1.00 54.47  ? 134 ASN B OD1 1 
ATOM   5991  N  ND2 . ASN B 1 134 ? 82.080  78.747  60.858  1.00 54.47  ? 134 ASN B ND2 1 
ATOM   5992  N  N   . LEU B 1 135 ? 78.155  74.582  59.718  1.00 61.22  ? 135 LEU B N   1 
ATOM   5993  C  CA  . LEU B 1 135 ? 77.349  74.005  58.643  1.00 61.22  ? 135 LEU B CA  1 
ATOM   5994  C  C   . LEU B 1 135 ? 75.932  74.547  58.803  1.00 61.22  ? 135 LEU B C   1 
ATOM   5995  O  O   . LEU B 1 135 ? 75.109  73.955  59.501  1.00 61.22  ? 135 LEU B O   1 
ATOM   5996  C  CB  . LEU B 1 135 ? 77.380  72.494  58.719  1.00 61.22  ? 135 LEU B CB  1 
ATOM   5997  C  CG  . LEU B 1 135 ? 76.871  71.778  57.493  1.00 61.22  ? 135 LEU B CG  1 
ATOM   5998  C  CD1 . LEU B 1 135 ? 77.688  72.213  56.297  1.00 61.22  ? 135 LEU B CD1 1 
ATOM   5999  C  CD2 . LEU B 1 135 ? 76.957  70.294  57.715  1.00 61.22  ? 135 LEU B CD2 1 
ATOM   6000  N  N   . ARG B 1 136 ? 75.648  75.662  58.154  1.00 68.48  ? 136 ARG B N   1 
ATOM   6001  C  CA  . ARG B 1 136 ? 74.424  76.395  58.415  1.00 68.48  ? 136 ARG B CA  1 
ATOM   6002  C  C   . ARG B 1 136 ? 73.386  76.166  57.326  1.00 68.48  ? 136 ARG B C   1 
ATOM   6003  O  O   . ARG B 1 136 ? 73.701  75.837  56.182  1.00 68.48  ? 136 ARG B O   1 
ATOM   6004  C  CB  . ARG B 1 136 ? 74.735  77.874  58.588  1.00 68.48  ? 136 ARG B CB  1 
ATOM   6005  C  CG  . ARG B 1 136 ? 75.924  78.115  59.483  1.00 68.48  ? 136 ARG B CG  1 
ATOM   6006  C  CD  . ARG B 1 136 ? 76.243  79.584  59.561  1.00 68.48  ? 136 ARG B CD  1 
ATOM   6007  N  NE  . ARG B 1 136 ? 77.362  79.841  60.450  1.00 68.48  ? 136 ARG B NE  1 
ATOM   6008  C  CZ  . ARG B 1 136 ? 77.220  80.042  61.752  1.00 68.48  ? 136 ARG B CZ  1 
ATOM   6009  N  NH1 . ARG B 1 136 ? 76.010  80.011  62.290  1.00 68.48  ? 136 ARG B NH1 1 
ATOM   6010  N  NH2 . ARG B 1 136 ? 78.276  80.274  62.516  1.00 68.48  ? 136 ARG B NH2 1 
ATOM   6011  N  N   . ALA B 1 137 ? 72.124  76.357  57.704  1.00 87.24  ? 137 ALA B N   1 
ATOM   6012  C  CA  . ALA B 1 137 ? 70.972  76.243  56.821  1.00 87.24  ? 137 ALA B CA  1 
ATOM   6013  C  C   . ALA B 1 137 ? 70.594  77.617  56.291  1.00 87.24  ? 137 ALA B C   1 
ATOM   6014  O  O   . ALA B 1 137 ? 70.600  78.603  57.031  1.00 87.24  ? 137 ALA B O   1 
ATOM   6015  C  CB  . ALA B 1 137 ? 69.772  75.629  57.541  1.00 87.24  ? 137 ALA B CB  1 
ATOM   6016  N  N   . LYS B 1 138 ? 70.267  77.678  55.000  1.00 91.79  ? 138 LYS B N   1 
ATOM   6017  C  CA  . LYS B 1 138 ? 69.928  78.954  54.383  1.00 91.79  ? 138 LYS B CA  1 
ATOM   6018  C  C   . LYS B 1 138 ? 68.495  79.001  53.866  1.00 91.79  ? 138 LYS B C   1 
ATOM   6019  O  O   . LYS B 1 138 ? 67.773  79.970  54.125  1.00 91.79  ? 138 LYS B O   1 
ATOM   6020  C  CB  . LYS B 1 138 ? 70.894  79.242  53.235  1.00 91.79  ? 138 LYS B CB  1 
ATOM   6021  C  CG  . LYS B 1 138 ? 70.564  80.489  52.451  1.00 91.79  ? 138 LYS B CG  1 
ATOM   6022  C  CD  . LYS B 1 138 ? 71.542  80.693  51.314  1.00 91.79  ? 138 LYS B CD  1 
ATOM   6023  N  N   . ASP B 1 139 ? 68.064  77.959  53.155  1.00 101.23 ? 139 ASP B N   1 
ATOM   6024  C  CA  . ASP B 1 139 ? 66.739  77.986  52.542  1.00 101.23 ? 139 ASP B CA  1 
ATOM   6025  C  C   . ASP B 1 139 ? 65.739  77.170  53.342  1.00 101.23 ? 139 ASP B C   1 
ATOM   6026  O  O   . ASP B 1 139 ? 64.556  77.521  53.402  1.00 101.23 ? 139 ASP B O   1 
ATOM   6027  C  CB  . ASP B 1 139 ? 66.796  77.443  51.110  1.00 101.23 ? 139 ASP B CB  1 
ATOM   6028  C  CG  . ASP B 1 139 ? 67.791  78.178  50.240  1.00 101.23 ? 139 ASP B CG  1 
ATOM   6029  O  OD1 . ASP B 1 139 ? 68.113  79.340  50.552  1.00 101.23 ? 139 ASP B OD1 1 
ATOM   6030  O  OD2 . ASP B 1 139 ? 68.251  77.591  49.239  1.00 101.23 ? 139 ASP B OD2 1 
ATOM   6031  N  N   . GLU B 1 140 ? 66.203  76.091  53.952  1.00 102.09 ? 140 GLU B N   1 
ATOM   6032  C  CA  . GLU B 1 140 ? 65.337  75.106  54.568  1.00 102.09 ? 140 GLU B CA  1 
ATOM   6033  C  C   . GLU B 1 140 ? 64.768  75.659  55.865  1.00 102.09 ? 140 GLU B C   1 
ATOM   6034  O  O   . GLU B 1 140 ? 65.512  76.114  56.734  1.00 102.09 ? 140 GLU B O   1 
ATOM   6035  C  CB  . GLU B 1 140 ? 66.167  73.857  54.829  1.00 102.09 ? 140 GLU B CB  1 
ATOM   6036  C  CG  . GLU B 1 140 ? 66.779  73.323  53.546  1.00 102.09 ? 140 GLU B CG  1 
ATOM   6037  C  CD  . GLU B 1 140 ? 68.299  73.416  53.543  1.00 102.09 ? 140 GLU B CD  1 
ATOM   6038  O  OE1 . GLU B 1 140 ? 68.837  74.310  54.229  1.00 102.09 ? 140 GLU B OE1 1 
ATOM   6039  O  OE2 . GLU B 1 140 ? 68.957  72.622  52.840  1.00 102.09 ? 140 GLU B OE2 1 
ATOM   6040  N  N   . LYS B 1 141 ? 63.444  75.658  55.988  1.00 100.14 ? 141 LYS B N   1 
ATOM   6041  C  CA  . LYS B 1 141 ? 62.840  76.076  57.244  1.00 100.14 ? 141 LYS B CA  1 
ATOM   6042  C  C   . LYS B 1 141 ? 62.741  74.973  58.284  1.00 100.14 ? 141 LYS B C   1 
ATOM   6043  O  O   . LYS B 1 141 ? 62.655  75.274  59.476  1.00 100.14 ? 141 LYS B O   1 
ATOM   6044  C  CB  . LYS B 1 141 ? 61.439  76.641  56.991  1.00 100.14 ? 141 LYS B CB  1 
ATOM   6045  C  CG  . LYS B 1 141 ? 61.431  77.890  56.141  1.00 100.14 ? 141 LYS B CG  1 
ATOM   6046  C  CD  . LYS B 1 141 ? 60.020  78.249  55.723  1.00 100.14 ? 141 LYS B CD  1 
ATOM   6047  N  N   . MET B 1 142 ? 62.741  73.709  57.875  1.00 106.66 ? 142 MET B N   1 
ATOM   6048  C  CA  . MET B 1 142 ? 62.745  72.608  58.824  1.00 106.66 ? 142 MET B CA  1 
ATOM   6049  C  C   . MET B 1 142 ? 63.566  71.461  58.261  1.00 106.66 ? 142 MET B C   1 
ATOM   6050  O  O   . MET B 1 142 ? 63.866  71.411  57.066  1.00 106.66 ? 142 MET B O   1 
ATOM   6051  C  CB  . MET B 1 142 ? 61.328  72.161  59.194  1.00 106.66 ? 142 MET B CB  1 
ATOM   6052  C  CG  . MET B 1 142 ? 60.603  71.372  58.147  1.00 106.66 ? 142 MET B CG  1 
ATOM   6053  S  SD  . MET B 1 142 ? 59.061  70.736  58.825  1.00 106.66 ? 142 MET B SD  1 
ATOM   6054  C  CE  . MET B 1 142 ? 58.452  72.172  59.701  1.00 106.66 ? 142 MET B CE  1 
ATOM   6055  N  N   . ILE B 1 143 ? 63.935  70.540  59.144  1.00 100.26 ? 143 ILE B N   1 
ATOM   6056  C  CA  . ILE B 1 143 ? 64.603  69.311  58.738  1.00 100.26 ? 143 ILE B CA  1 
ATOM   6057  C  C   . ILE B 1 143 ? 63.576  68.426  58.045  1.00 100.26 ? 143 ILE B C   1 
ATOM   6058  O  O   . ILE B 1 143 ? 62.474  68.234  58.576  1.00 100.26 ? 143 ILE B O   1 
ATOM   6059  C  CB  . ILE B 1 143 ? 65.252  68.619  59.946  1.00 100.26 ? 143 ILE B CB  1 
ATOM   6060  C  CG1 . ILE B 1 143 ? 66.532  69.358  60.330  1.00 100.26 ? 143 ILE B CG1 1 
ATOM   6061  C  CG2 . ILE B 1 143 ? 65.537  67.156  59.666  1.00 100.26 ? 143 ILE B CG2 1 
ATOM   6062  C  CD1 . ILE B 1 143 ? 67.258  68.760  61.488  1.00 100.26 ? 143 ILE B CD1 1 
ATOM   6063  N  N   . PRO B 1 144 ? 63.880  67.903  56.848  1.00 100.33 ? 144 PRO B N   1 
ATOM   6064  C  CA  . PRO B 1 144 ? 62.885  67.135  56.089  1.00 100.33 ? 144 PRO B CA  1 
ATOM   6065  C  C   . PRO B 1 144 ? 62.517  65.814  56.738  1.00 100.33 ? 144 PRO B C   1 
ATOM   6066  O  O   . PRO B 1 144 ? 63.347  64.902  56.786  1.00 100.33 ? 144 PRO B O   1 
ATOM   6067  C  CB  . PRO B 1 144 ? 63.581  66.896  54.744  1.00 100.33 ? 144 PRO B CB  1 
ATOM   6068  C  CG  . PRO B 1 144 ? 64.679  67.899  54.682  1.00 100.33 ? 144 PRO B CG  1 
ATOM   6069  C  CD  . PRO B 1 144 ? 65.125  68.088  56.088  1.00 100.33 ? 144 PRO B CD  1 
ATOM   6070  N  N   . GLY B 1 145 ? 61.292  65.695  57.242  1.00 99.02  ? 145 GLY B N   1 
ATOM   6071  C  CA  . GLY B 1 145 ? 60.855  64.515  57.963  1.00 99.02  ? 145 GLY B CA  1 
ATOM   6072  C  C   . GLY B 1 145 ? 60.591  64.733  59.435  1.00 99.02  ? 145 GLY B C   1 
ATOM   6073  O  O   . GLY B 1 145 ? 59.909  63.914  60.060  1.00 99.02  ? 145 GLY B O   1 
ATOM   6074  N  N   . TYR B 1 146 ? 61.092  65.811  60.014  1.00 99.96  ? 146 TYR B N   1 
ATOM   6075  C  CA  . TYR B 1 146 ? 60.920  66.048  61.427  1.00 99.96  ? 146 TYR B CA  1 
ATOM   6076  C  C   . TYR B 1 146 ? 60.231  67.382  61.663  1.00 99.96  ? 146 TYR B C   1 
ATOM   6077  O  O   . TYR B 1 146 ? 60.712  68.419  61.186  1.00 99.96  ? 146 TYR B O   1 
ATOM   6078  C  CB  . TYR B 1 146 ? 62.266  66.010  62.158  1.00 99.96  ? 146 TYR B CB  1 
ATOM   6079  C  CG  . TYR B 1 146 ? 62.702  64.613  62.523  1.00 99.96  ? 146 TYR B CG  1 
ATOM   6080  C  CD1 . TYR B 1 146 ? 63.102  63.717  61.545  1.00 99.96  ? 146 TYR B CD1 1 
ATOM   6081  C  CD2 . TYR B 1 146 ? 62.714  64.195  63.844  1.00 99.96  ? 146 TYR B CD2 1 
ATOM   6082  C  CE1 . TYR B 1 146 ? 63.495  62.446  61.866  1.00 99.96  ? 146 TYR B CE1 1 
ATOM   6083  C  CE2 . TYR B 1 146 ? 63.108  62.922  64.179  1.00 99.96  ? 146 TYR B CE2 1 
ATOM   6084  C  CZ  . TYR B 1 146 ? 63.498  62.051  63.183  1.00 99.96  ? 146 TYR B CZ  1 
ATOM   6085  O  OH  . TYR B 1 146 ? 63.895  60.773  63.497  1.00 99.96  ? 146 TYR B OH  1 
ATOM   6086  N  N   . PRO B 1 147 ? 59.109  67.394  62.357  1.00 97.70  ? 147 PRO B N   1 
ATOM   6087  C  CA  . PRO B 1 147 ? 58.350  68.633  62.527  1.00 97.70  ? 147 PRO B CA  1 
ATOM   6088  C  C   . PRO B 1 147 ? 59.010  69.582  63.508  1.00 97.70  ? 147 PRO B C   1 
ATOM   6089  O  O   . PRO B 1 147 ? 59.072  70.788  63.256  1.00 97.70  ? 147 PRO B O   1 
ATOM   6090  C  CB  . PRO B 1 147 ? 56.992  68.146  63.054  1.00 97.70  ? 147 PRO B CB  1 
ATOM   6091  C  CG  . PRO B 1 147 ? 56.997  66.655  62.886  1.00 97.70  ? 147 PRO B CG  1 
ATOM   6092  C  CD  . PRO B 1 147 ? 58.423  66.248  62.967  1.00 97.70  ? 147 PRO B CD  1 
ATOM   6093  N  N   . GLN B 1 148 ? 59.514  69.060  64.622  1.00 89.02  ? 148 GLN B N   1 
ATOM   6094  C  CA  . GLN B 1 148 ? 59.941  69.935  65.704  1.00 89.02  ? 148 GLN B CA  1 
ATOM   6095  C  C   . GLN B 1 148 ? 61.292  70.591  65.461  1.00 89.02  ? 148 GLN B C   1 
ATOM   6096  O  O   . GLN B 1 148 ? 61.678  71.471  66.238  1.00 89.02  ? 148 GLN B O   1 
ATOM   6097  C  CB  . GLN B 1 148 ? 59.988  69.148  67.011  1.00 89.02  ? 148 GLN B CB  1 
ATOM   6098  C  CG  . GLN B 1 148 ? 58.625  68.754  67.527  1.00 89.02  ? 148 GLN B CG  1 
ATOM   6099  C  CD  . GLN B 1 148 ? 58.705  67.881  68.757  1.00 89.02  ? 148 GLN B CD  1 
ATOM   6100  O  OE1 . GLN B 1 148 ? 59.721  67.235  69.008  1.00 89.02  ? 148 GLN B OE1 1 
ATOM   6101  N  NE2 . GLN B 1 148 ? 57.633  67.863  69.538  1.00 89.02  ? 148 GLN B NE2 1 
ATOM   6102  N  N   . ALA B 1 149 ? 62.027  70.186  64.428  1.00 94.27  ? 149 ALA B N   1 
ATOM   6103  C  CA  . ALA B 1 149 ? 63.324  70.795  64.176  1.00 94.27  ? 149 ALA B CA  1 
ATOM   6104  C  C   . ALA B 1 149 ? 63.154  72.174  63.553  1.00 94.27  ? 149 ALA B C   1 
ATOM   6105  O  O   . ALA B 1 149 ? 63.160  72.310  62.327  1.00 94.27  ? 149 ALA B O   1 
ATOM   6106  C  CB  . ALA B 1 149 ? 64.164  69.902  63.270  1.00 94.27  ? 149 ALA B CB  1 
ATOM   6107  N  N   . LYS B 1 150 ? 63.010  73.198  64.385  1.00 91.81  ? 150 LYS B N   1 
ATOM   6108  C  CA  . LYS B 1 150 ? 62.778  74.555  63.906  1.00 91.81  ? 150 LYS B CA  1 
ATOM   6109  C  C   . LYS B 1 150 ? 64.081  75.106  63.349  1.00 91.81  ? 150 LYS B C   1 
ATOM   6110  O  O   . LYS B 1 150 ? 65.015  75.366  64.112  1.00 91.81  ? 150 LYS B O   1 
ATOM   6111  C  CB  . LYS B 1 150 ? 62.257  75.436  65.037  1.00 91.81  ? 150 LYS B CB  1 
ATOM   6112  N  N   . LEU B 1 151 ? 64.159  75.306  62.038  1.00 94.88  ? 151 LEU B N   1 
ATOM   6113  C  CA  . LEU B 1 151 ? 65.410  75.781  61.458  1.00 94.88  ? 151 LEU B CA  1 
ATOM   6114  C  C   . LEU B 1 151 ? 65.240  77.202  60.930  1.00 94.88  ? 151 LEU B C   1 
ATOM   6115  O  O   . LEU B 1 151 ? 64.421  77.450  60.041  1.00 94.88  ? 151 LEU B O   1 
ATOM   6116  C  CB  . LEU B 1 151 ? 65.818  74.846  60.328  1.00 94.88  ? 151 LEU B CB  1 
ATOM   6117  C  CG  . LEU B 1 151 ? 66.615  73.582  60.634  1.00 94.88  ? 151 LEU B CG  1 
ATOM   6118  C  CD1 . LEU B 1 151 ? 67.075  72.946  59.345  1.00 94.88  ? 151 LEU B CD1 1 
ATOM   6119  C  CD2 . LEU B 1 151 ? 67.791  73.879  61.510  1.00 94.88  ? 151 LEU B CD2 1 
ATOM   6120  N  N   . TYR B 1 152 ? 66.025  78.132  61.462  1.00 92.81  ? 152 TYR B N   1 
ATOM   6121  C  CA  . TYR B 1 152 ? 66.068  79.488  60.940  1.00 92.81  ? 152 TYR B CA  1 
ATOM   6122  C  C   . TYR B 1 152 ? 67.401  79.682  60.233  1.00 92.81  ? 152 TYR B C   1 
ATOM   6123  O  O   . TYR B 1 152 ? 68.359  78.958  60.508  1.00 92.81  ? 152 TYR B O   1 
ATOM   6124  C  CB  . TYR B 1 152 ? 65.878  80.521  62.048  1.00 92.81  ? 152 TYR B CB  1 
ATOM   6125  C  CG  . TYR B 1 152 ? 66.821  80.437  63.209  1.00 92.81  ? 152 TYR B CG  1 
ATOM   6126  C  CD1 . TYR B 1 152 ? 66.558  79.627  64.297  1.00 92.81  ? 152 TYR B CD1 1 
ATOM   6127  C  CD2 . TYR B 1 152 ? 67.961  81.227  63.231  1.00 92.81  ? 152 TYR B CD2 1 
ATOM   6128  C  CE1 . TYR B 1 152 ? 67.427  79.580  65.357  1.00 92.81  ? 152 TYR B CE1 1 
ATOM   6129  C  CE2 . TYR B 1 152 ? 68.829  81.187  64.282  1.00 92.81  ? 152 TYR B CE2 1 
ATOM   6130  C  CZ  . TYR B 1 152 ? 68.560  80.361  65.343  1.00 92.81  ? 152 TYR B CZ  1 
ATOM   6131  O  OH  . TYR B 1 152 ? 69.433  80.319  66.400  1.00 92.81  ? 152 TYR B OH  1 
ATOM   6132  N  N   . PRO B 1 153 ? 67.491  80.612  59.279  1.00 95.76  ? 153 PRO B N   1 
ATOM   6133  C  CA  . PRO B 1 153 ? 68.777  80.857  58.605  1.00 95.76  ? 153 PRO B CA  1 
ATOM   6134  C  C   . PRO B 1 153 ? 69.813  81.435  59.560  1.00 95.76  ? 153 PRO B C   1 
ATOM   6135  O  O   . PRO B 1 153 ? 69.560  82.428  60.244  1.00 95.76  ? 153 PRO B O   1 
ATOM   6136  C  CB  . PRO B 1 153 ? 68.413  81.855  57.498  1.00 95.76  ? 153 PRO B CB  1 
ATOM   6137  C  CG  . PRO B 1 153 ? 67.082  82.392  57.874  1.00 95.76  ? 153 PRO B CG  1 
ATOM   6138  C  CD  . PRO B 1 153 ? 66.387  81.276  58.570  1.00 95.76  ? 153 PRO B CD  1 
ATOM   6139  N  N   . GLY B 1 154 ? 70.981  80.795  59.608  1.00 86.57  ? 154 GLY B N   1 
ATOM   6140  C  CA  . GLY B 1 154 ? 72.053  81.111  60.545  1.00 86.57  ? 154 GLY B CA  1 
ATOM   6141  C  C   . GLY B 1 154 ? 72.199  80.162  61.723  1.00 86.57  ? 154 GLY B C   1 
ATOM   6142  O  O   . GLY B 1 154 ? 73.018  80.429  62.613  1.00 86.57  ? 154 GLY B O   1 
ATOM   6143  N  N   . LYS B 1 155 ? 71.448  79.071  61.770  1.00 84.27  ? 155 LYS B N   1 
ATOM   6144  C  CA  . LYS B 1 155 ? 71.492  78.118  62.868  1.00 84.27  ? 155 LYS B CA  1 
ATOM   6145  C  C   . LYS B 1 155 ? 72.320  76.914  62.441  1.00 84.27  ? 155 LYS B C   1 
ATOM   6146  O  O   . LYS B 1 155 ? 72.203  76.453  61.303  1.00 84.27  ? 155 LYS B O   1 
ATOM   6147  C  CB  . LYS B 1 155 ? 70.076  77.701  63.253  1.00 84.27  ? 155 LYS B CB  1 
ATOM   6148  C  CG  . LYS B 1 155 ? 69.963  76.526  64.183  1.00 84.27  ? 155 LYS B CG  1 
ATOM   6149  C  CD  . LYS B 1 155 ? 68.507  76.150  64.312  1.00 84.27  ? 155 LYS B CD  1 
ATOM   6150  C  CE  . LYS B 1 155 ? 68.052  76.136  65.743  1.00 84.27  ? 155 LYS B CE  1 
ATOM   6151  N  NZ  . LYS B 1 155 ? 66.572  76.058  65.808  1.00 84.27  ? 155 LYS B NZ  1 
ATOM   6152  N  N   . SER B 1 156 ? 73.199  76.447  63.328  1.00 71.73  ? 156 SER B N   1 
ATOM   6153  C  CA  . SER B 1 156 ? 74.017  75.281  63.011  1.00 71.73  ? 156 SER B CA  1 
ATOM   6154  C  C   . SER B 1 156 ? 73.159  74.032  62.864  1.00 71.73  ? 156 SER B C   1 
ATOM   6155  O  O   . SER B 1 156 ? 72.218  73.812  63.627  1.00 71.73  ? 156 SER B O   1 
ATOM   6156  C  CB  . SER B 1 156 ? 75.068  75.063  64.096  1.00 71.73  ? 156 SER B CB  1 
ATOM   6157  O  OG  . SER B 1 156 ? 75.500  73.716  64.105  1.00 71.73  ? 156 SER B OG  1 
ATOM   6158  N  N   . LEU B 1 157 ? 73.505  73.203  61.880  1.00 68.08  ? 157 LEU B N   1 
ATOM   6159  C  CA  . LEU B 1 157 ? 72.757  71.973  61.653  1.00 68.08  ? 157 LEU B CA  1 
ATOM   6160  C  C   . LEU B 1 157 ? 73.082  70.926  62.705  1.00 68.08  ? 157 LEU B C   1 
ATOM   6161  O  O   . LEU B 1 157 ? 72.192  70.204  63.165  1.00 68.08  ? 157 LEU B O   1 
ATOM   6162  C  CB  . LEU B 1 157 ? 73.038  71.448  60.250  1.00 68.08  ? 157 LEU B CB  1 
ATOM   6163  C  CG  . LEU B 1 157 ? 72.320  72.221  59.137  1.00 68.08  ? 157 LEU B CG  1 
ATOM   6164  C  CD1 . LEU B 1 157 ? 72.440  71.519  57.801  1.00 68.08  ? 157 LEU B CD1 1 
ATOM   6165  C  CD2 . LEU B 1 157 ? 70.856  72.432  59.467  1.00 68.08  ? 157 LEU B CD2 1 
ATOM   6166  N  N   . LEU B 1 158 ? 74.355  70.812  63.075  1.00 62.79  ? 158 LEU B N   1 
ATOM   6167  C  CA  . LEU B 1 158 ? 74.772  69.775  64.009  1.00 62.79  ? 158 LEU B CA  1 
ATOM   6168  C  C   . LEU B 1 158 ? 74.254  70.037  65.412  1.00 62.79  ? 158 LEU B C   1 
ATOM   6169  O  O   . LEU B 1 158 ? 73.957  69.093  66.152  1.00 62.79  ? 158 LEU B O   1 
ATOM   6170  C  CB  . LEU B 1 158 ? 76.288  69.673  64.035  1.00 62.79  ? 158 LEU B CB  1 
ATOM   6171  C  CG  . LEU B 1 158 ? 76.760  68.365  64.643  1.00 62.79  ? 158 LEU B CG  1 
ATOM   6172  C  CD1 . LEU B 1 158 ? 76.454  67.233  63.704  1.00 62.79  ? 158 LEU B CD1 1 
ATOM   6173  C  CD2 . LEU B 1 158 ? 78.227  68.454  64.912  1.00 62.79  ? 158 LEU B CD2 1 
ATOM   6174  N  N   . ARG B 1 159 ? 74.139  71.304  65.788  1.00 65.41  ? 159 ARG B N   1 
ATOM   6175  C  CA  . ARG B 1 159 ? 73.625  71.647  67.104  1.00 65.41  ? 159 ARG B CA  1 
ATOM   6176  C  C   . ARG B 1 159 ? 72.158  71.274  67.246  1.00 65.41  ? 159 ARG B C   1 
ATOM   6177  O  O   . ARG B 1 159 ? 71.753  70.734  68.280  1.00 65.41  ? 159 ARG B O   1 
ATOM   6178  C  CB  . ARG B 1 159 ? 73.877  73.123  67.372  1.00 65.41  ? 159 ARG B CB  1 
ATOM   6179  C  CG  . ARG B 1 159 ? 73.989  73.446  68.827  1.00 65.41  ? 159 ARG B CG  1 
ATOM   6180  C  CD  . ARG B 1 159 ? 75.358  73.020  69.308  1.00 65.41  ? 159 ARG B CD  1 
ATOM   6181  N  NE  . ARG B 1 159 ? 76.452  73.755  68.692  1.00 65.41  ? 159 ARG B NE  1 
ATOM   6182  C  CZ  . ARG B 1 159 ? 76.916  74.915  69.130  1.00 65.41  ? 159 ARG B CZ  1 
ATOM   6183  N  NH1 . ARG B 1 159 ? 76.376  75.485  70.193  1.00 65.41  ? 159 ARG B NH1 1 
ATOM   6184  N  NH2 . ARG B 1 159 ? 77.925  75.502  68.508  1.00 65.41  ? 159 ARG B NH2 1 
ATOM   6185  N  N   . ARG B 1 160 ? 71.353  71.525  66.218  1.00 71.69  ? 160 ARG B N   1 
ATOM   6186  C  CA  . ARG B 1 160 ? 69.947  71.146  66.289  1.00 71.69  ? 160 ARG B CA  1 
ATOM   6187  C  C   . ARG B 1 160 ? 69.759  69.645  66.176  1.00 71.69  ? 160 ARG B C   1 
ATOM   6188  O  O   . ARG B 1 160 ? 68.771  69.102  66.678  1.00 71.69  ? 160 ARG B O   1 
ATOM   6189  C  CB  . ARG B 1 160 ? 69.141  71.868  65.219  1.00 71.69  ? 160 ARG B CB  1 
ATOM   6190  C  CG  . ARG B 1 160 ? 67.708  72.078  65.635  1.00 71.69  ? 160 ARG B CG  1 
ATOM   6191  C  CD  . ARG B 1 160 ? 67.592  72.748  66.980  1.00 71.69  ? 160 ARG B CD  1 
ATOM   6192  N  NE  . ARG B 1 160 ? 66.251  73.274  67.182  1.00 71.69  ? 160 ARG B NE  1 
ATOM   6193  C  CZ  . ARG B 1 160 ? 65.233  72.554  67.638  1.00 71.69  ? 160 ARG B CZ  1 
ATOM   6194  N  NH1 . ARG B 1 160 ? 65.407  71.276  67.943  1.00 71.69  ? 160 ARG B NH1 1 
ATOM   6195  N  NH2 . ARG B 1 160 ? 64.039  73.107  67.789  1.00 71.69  ? 160 ARG B NH2 1 
ATOM   6196  N  N   . LEU B 1 161 ? 70.692  68.952  65.540  1.00 65.79  ? 161 LEU B N   1 
ATOM   6197  C  CA  . LEU B 1 161 ? 70.595  67.503  65.509  1.00 65.79  ? 161 LEU B CA  1 
ATOM   6198  C  C   . LEU B 1 161 ? 70.975  66.897  66.849  1.00 65.79  ? 161 LEU B C   1 
ATOM   6199  O  O   . LEU B 1 161 ? 70.488  65.818  67.200  1.00 65.79  ? 161 LEU B O   1 
ATOM   6200  C  CB  . LEU B 1 161 ? 71.472  66.939  64.402  1.00 65.79  ? 161 LEU B CB  1 
ATOM   6201  C  CG  . LEU B 1 161 ? 70.870  67.070  63.011  1.00 65.79  ? 161 LEU B CG  1 
ATOM   6202  C  CD1 . LEU B 1 161 ? 71.935  66.892  61.953  1.00 65.79  ? 161 LEU B CD1 1 
ATOM   6203  C  CD2 . LEU B 1 161 ? 69.777  66.052  62.843  1.00 65.79  ? 161 LEU B CD2 1 
ATOM   6204  N  N   . LEU B 1 162 ? 71.822  67.578  67.618  1.00 67.87  ? 162 LEU B N   1 
ATOM   6205  C  CA  . LEU B 1 162 ? 72.193  67.065  68.930  1.00 67.87  ? 162 LEU B CA  1 
ATOM   6206  C  C   . LEU B 1 162 ? 71.107  67.323  69.959  1.00 67.87  ? 162 LEU B C   1 
ATOM   6207  O  O   . LEU B 1 162 ? 70.819  66.455  70.789  1.00 67.87  ? 162 LEU B O   1 
ATOM   6208  C  CB  . LEU B 1 162 ? 73.493  67.707  69.388  1.00 67.87  ? 162 LEU B CB  1 
ATOM   6209  C  CG  . LEU B 1 162 ? 74.767  67.020  68.936  1.00 67.87  ? 162 LEU B CG  1 
ATOM   6210  C  CD1 . LEU B 1 162 ? 75.921  67.984  69.047  1.00 67.87  ? 162 LEU B CD1 1 
ATOM   6211  C  CD2 . LEU B 1 162 ? 75.006  65.813  69.798  1.00 67.87  ? 162 LEU B CD2 1 
ATOM   6212  N  N   . THR B 1 163 ? 70.491  68.502  69.923  1.00 71.42  ? 163 THR B N   1 
ATOM   6213  C  CA  . THR B 1 163 ? 69.512  68.848  70.947  1.00 71.42  ? 163 THR B CA  1 
ATOM   6214  C  C   . THR B 1 163 ? 68.193  68.122  70.711  1.00 71.42  ? 163 THR B C   1 
ATOM   6215  O  O   . THR B 1 163 ? 67.479  67.793  71.663  1.00 71.42  ? 163 THR B O   1 
ATOM   6216  C  CB  . THR B 1 163 ? 69.313  70.361  70.991  1.00 71.42  ? 163 THR B CB  1 
ATOM   6217  O  OG1 . THR B 1 163 ? 70.591  71.002  70.927  1.00 71.42  ? 163 THR B OG1 1 
ATOM   6218  C  CG2 . THR B 1 163 ? 68.653  70.772  72.285  1.00 71.42  ? 163 THR B CG2 1 
ATOM   6219  N  N   . SER B 1 164 ? 67.862  67.836  69.459  1.00 68.32  ? 164 SER B N   1 
ATOM   6220  C  CA  . SER B 1 164 ? 66.617  67.140  69.178  1.00 68.32  ? 164 SER B CA  1 
ATOM   6221  C  C   . SER B 1 164 ? 66.771  65.630  69.239  1.00 68.32  ? 164 SER B C   1 
ATOM   6222  O  O   . SER B 1 164 ? 65.808  64.914  68.957  1.00 68.32  ? 164 SER B O   1 
ATOM   6223  C  CB  . SER B 1 164 ? 66.074  67.536  67.808  1.00 68.32  ? 164 SER B CB  1 
ATOM   6224  O  OG  . SER B 1 164 ? 66.608  66.696  66.807  1.00 68.32  ? 164 SER B OG  1 
ATOM   6225  N  N   . GLY B 1 165 ? 67.953  65.131  69.576  1.00 66.96  ? 165 GLY B N   1 
ATOM   6226  C  CA  . GLY B 1 165 ? 68.118  63.707  69.780  1.00 66.96  ? 165 GLY B CA  1 
ATOM   6227  C  C   . GLY B 1 165 ? 68.156  62.857  68.534  1.00 66.96  ? 165 GLY B C   1 
ATOM   6228  O  O   . GLY B 1 165 ? 67.563  61.776  68.510  1.00 66.96  ? 165 GLY B O   1 
ATOM   6229  N  N   . ILE B 1 166 ? 68.821  63.316  67.489  1.00 72.39  ? 166 ILE B N   1 
ATOM   6230  C  CA  . ILE B 1 166 ? 69.034  62.532  66.282  1.00 72.39  ? 166 ILE B CA  1 
ATOM   6231  C  C   . ILE B 1 166 ? 70.487  62.091  66.157  1.00 72.39  ? 166 ILE B C   1 
ATOM   6232  O  O   . ILE B 1 166 ? 70.772  60.909  65.967  1.00 72.39  ? 166 ILE B O   1 
ATOM   6233  C  CB  . ILE B 1 166 ? 68.564  63.296  65.029  1.00 72.39  ? 166 ILE B CB  1 
ATOM   6234  C  CG1 . ILE B 1 166 ? 67.118  63.750  65.221  1.00 72.39  ? 166 ILE B CG1 1 
ATOM   6235  C  CG2 . ILE B 1 166 ? 68.704  62.435  63.804  1.00 72.39  ? 166 ILE B CG2 1 
ATOM   6236  C  CD1 . ILE B 1 166 ? 66.517  64.438  64.017  1.00 72.39  ? 166 ILE B CD1 1 
ATOM   6237  N  N   . VAL B 1 167 ? 71.418  63.029  66.263  1.00 62.72  ? 167 VAL B N   1 
ATOM   6238  C  CA  . VAL B 1 167 ? 72.829  62.696  66.391  1.00 62.72  ? 167 VAL B CA  1 
ATOM   6239  C  C   . VAL B 1 167 ? 73.118  62.512  67.870  1.00 62.72  ? 167 VAL B C   1 
ATOM   6240  O  O   . VAL B 1 167 ? 72.981  63.452  68.659  1.00 62.72  ? 167 VAL B O   1 
ATOM   6241  C  CB  . VAL B 1 167 ? 73.713  63.800  65.802  1.00 62.72  ? 167 VAL B CB  1 
ATOM   6242  C  CG1 . VAL B 1 167 ? 75.154  63.592  66.211  1.00 62.72  ? 167 VAL B CG1 1 
ATOM   6243  C  CG2 . VAL B 1 167 ? 73.567  63.853  64.309  1.00 62.72  ? 167 VAL B CG2 1 
ATOM   6244  N  N   . ILE B 1 168 ? 73.486  61.295  68.253  1.00 59.98  ? 168 ILE B N   1 
ATOM   6245  C  CA  . ILE B 1 168 ? 73.714  61.007  69.662  1.00 59.98  ? 168 ILE B CA  1 
ATOM   6246  C  C   . ILE B 1 168 ? 75.035  61.590  70.133  1.00 59.98  ? 168 ILE B C   1 
ATOM   6247  O  O   . ILE B 1 168 ? 75.070  62.355  71.101  1.00 59.98  ? 168 ILE B O   1 
ATOM   6248  C  CB  . ILE B 1 168 ? 73.623  59.498  69.913  1.00 59.98  ? 168 ILE B CB  1 
ATOM   6249  C  CG1 . ILE B 1 168 ? 72.209  59.029  69.576  1.00 59.98  ? 168 ILE B CG1 1 
ATOM   6250  C  CG2 . ILE B 1 168 ? 73.995  59.180  71.338  1.00 59.98  ? 168 ILE B CG2 1 
ATOM   6251  C  CD1 . ILE B 1 168 ? 71.950  57.572  69.852  1.00 59.98  ? 168 ILE B CD1 1 
ATOM   6252  N  N   . GLN B 1 169 ? 76.138  61.253  69.472  1.00 49.47  ? 169 GLN B N   1 
ATOM   6253  C  CA  . GLN B 1 169 ? 77.417  61.808  69.886  1.00 49.47  ? 169 GLN B CA  1 
ATOM   6254  C  C   . GLN B 1 169 ? 78.358  61.901  68.701  1.00 49.47  ? 169 GLN B C   1 
ATOM   6255  O  O   . GLN B 1 169 ? 78.302  61.089  67.779  1.00 49.47  ? 169 GLN B O   1 
ATOM   6256  C  CB  . GLN B 1 169 ? 78.043  60.971  70.995  1.00 49.47  ? 169 GLN B CB  1 
ATOM   6257  C  CG  . GLN B 1 169 ? 78.173  59.521  70.652  1.00 49.47  ? 169 GLN B CG  1 
ATOM   6258  C  CD  . GLN B 1 169 ? 78.389  58.668  71.879  1.00 49.47  ? 169 GLN B CD  1 
ATOM   6259  O  OE1 . GLN B 1 169 ? 78.828  59.158  72.917  1.00 49.47  ? 169 GLN B OE1 1 
ATOM   6260  N  NE2 . GLN B 1 169 ? 78.067  57.384  71.773  1.00 49.47  ? 169 GLN B NE2 1 
ATOM   6261  N  N   . VAL B 1 170 ? 79.224  62.904  68.743  1.00 35.90  ? 170 VAL B N   1 
ATOM   6262  C  CA  . VAL B 1 170 ? 80.273  63.114  67.759  1.00 35.90  ? 170 VAL B CA  1 
ATOM   6263  C  C   . VAL B 1 170 ? 81.594  63.065  68.503  1.00 35.90  ? 170 VAL B C   1 
ATOM   6264  O  O   . VAL B 1 170 ? 81.873  63.935  69.334  1.00 35.90  ? 170 VAL B O   1 
ATOM   6265  C  CB  . VAL B 1 170 ? 80.105  64.439  67.016  1.00 35.90  ? 170 VAL B CB  1 
ATOM   6266  C  CG1 . VAL B 1 170 ? 81.337  64.751  66.214  1.00 35.90  ? 170 VAL B CG1 1 
ATOM   6267  C  CG2 . VAL B 1 170 ? 78.908  64.375  66.127  1.00 35.90  ? 170 VAL B CG2 1 
ATOM   6268  N  N   . PHE B 1 171 ? 82.400  62.054  68.233  1.00 39.76  ? 171 PHE B N   1 
ATOM   6269  C  CA  . PHE B 1 171 ? 83.623  61.938  68.996  1.00 39.76  ? 171 PHE B CA  1 
ATOM   6270  C  C   . PHE B 1 171 ? 84.782  61.629  68.066  1.00 39.76  ? 171 PHE B C   1 
ATOM   6271  O  O   . PHE B 1 171 ? 84.620  60.879  67.104  1.00 39.76  ? 171 PHE B O   1 
ATOM   6272  C  CB  . PHE B 1 171 ? 83.503  60.841  70.057  1.00 39.76  ? 171 PHE B CB  1 
ATOM   6273  C  CG  . PHE B 1 171 ? 83.217  59.473  69.508  1.00 39.76  ? 171 PHE B CG  1 
ATOM   6274  C  CD1 . PHE B 1 171 ? 81.921  59.054  69.294  1.00 39.76  ? 171 PHE B CD1 1 
ATOM   6275  C  CD2 . PHE B 1 171 ? 84.244  58.571  69.289  1.00 39.76  ? 171 PHE B CD2 1 
ATOM   6276  C  CE1 . PHE B 1 171 ? 81.664  57.791  68.813  1.00 39.76  ? 171 PHE B CE1 1 
ATOM   6277  C  CE2 . PHE B 1 171 ? 83.985  57.311  68.812  1.00 39.76  ? 171 PHE B CE2 1 
ATOM   6278  C  CZ  . PHE B 1 171 ? 82.696  56.922  68.577  1.00 39.76  ? 171 PHE B CZ  1 
ATOM   6279  N  N   . PRO B 1 172 ? 85.956  62.167  68.333  1.00 35.52  ? 172 PRO B N   1 
ATOM   6280  C  CA  . PRO B 1 172 ? 87.120  61.839  67.519  1.00 35.52  ? 172 PRO B CA  1 
ATOM   6281  C  C   . PRO B 1 172 ? 87.663  60.477  67.899  1.00 35.52  ? 172 PRO B C   1 
ATOM   6282  O  O   . PRO B 1 172 ? 87.291  59.895  68.912  1.00 35.52  ? 172 PRO B O   1 
ATOM   6283  C  CB  . PRO B 1 172 ? 88.110  62.941  67.862  1.00 35.52  ? 172 PRO B CB  1 
ATOM   6284  C  CG  . PRO B 1 172 ? 87.743  63.332  69.201  1.00 35.52  ? 172 PRO B CG  1 
ATOM   6285  C  CD  . PRO B 1 172 ? 86.277  63.163  69.354  1.00 35.52  ? 172 PRO B CD  1 
ATOM   6286  N  N   . LEU B 1 173 ? 88.550  59.973  67.051  1.00 42.60  ? 173 LEU B N   1 
ATOM   6287  C  CA  . LEU B 1 173 ? 89.072  58.626  67.189  1.00 42.60  ? 173 LEU B CA  1 
ATOM   6288  C  C   . LEU B 1 173 ? 90.457  58.634  67.809  1.00 42.60  ? 173 LEU B C   1 
ATOM   6289  O  O   . LEU B 1 173 ? 91.299  59.470  67.475  1.00 42.60  ? 173 LEU B O   1 
ATOM   6290  C  CB  . LEU B 1 173 ? 89.132  57.946  65.827  1.00 42.60  ? 173 LEU B CB  1 
ATOM   6291  C  CG  . LEU B 1 173 ? 87.889  57.168  65.440  1.00 42.60  ? 173 LEU B CG  1 
ATOM   6292  C  CD1 . LEU B 1 173 ? 88.173  56.327  64.234  1.00 42.60  ? 173 LEU B CD1 1 
ATOM   6293  C  CD2 . LEU B 1 173 ? 87.449  56.288  66.583  1.00 42.60  ? 173 LEU B CD2 1 
ATOM   6294  N  N   . HIS B 1 174 ? 90.682  57.688  68.712  1.00 41.26  ? 174 HIS B N   1 
ATOM   6295  C  CA  . HIS B 1 174 ? 92.005  57.450  69.257  1.00 41.26  ? 174 HIS B CA  1 
ATOM   6296  C  C   . HIS B 1 174 ? 92.886  56.798  68.205  1.00 41.26  ? 174 HIS B C   1 
ATOM   6297  O  O   . HIS B 1 174 ? 92.406  56.039  67.363  1.00 41.26  ? 174 HIS B O   1 
ATOM   6298  C  CB  . HIS B 1 174 ? 91.901  56.573  70.494  1.00 41.26  ? 174 HIS B CB  1 
ATOM   6299  C  CG  . HIS B 1 174 ? 91.800  57.352  71.762  1.00 41.26  ? 174 HIS B CG  1 
ATOM   6300  N  ND1 . HIS B 1 174 ? 92.856  58.058  72.292  1.00 41.26  ? 174 HIS B ND1 1 
ATOM   6301  C  CD2 . HIS B 1 174 ? 90.751  57.567  72.587  1.00 41.26  ? 174 HIS B CD2 1 
ATOM   6302  C  CE1 . HIS B 1 174 ? 92.466  58.657  73.402  1.00 41.26  ? 174 HIS B CE1 1 
ATOM   6303  N  NE2 . HIS B 1 174 ? 91.193  58.375  73.604  1.00 41.26  ? 174 HIS B NE2 1 
ATOM   6304  N  N   . ASP B 1 175 ? 94.176  57.088  68.243  1.00 53.56  ? 175 ASP B N   1 
ATOM   6305  C  CA  . ASP B 1 175 ? 95.127  56.426  67.364  1.00 53.56  ? 175 ASP B CA  1 
ATOM   6306  C  C   . ASP B 1 175 ? 95.872  55.424  68.227  1.00 53.56  ? 175 ASP B C   1 
ATOM   6307  O  O   . ASP B 1 175 ? 96.799  55.788  68.951  1.00 53.56  ? 175 ASP B O   1 
ATOM   6308  C  CB  . ASP B 1 175 ? 96.076  57.446  66.740  1.00 53.56  ? 175 ASP B CB  1 
ATOM   6309  C  CG  . ASP B 1 175 ? 96.982  56.848  65.686  1.00 53.56  ? 175 ASP B CG  1 
ATOM   6310  O  OD1 . ASP B 1 175 ? 96.795  55.674  65.316  1.00 53.56  ? 175 ASP B OD1 1 
ATOM   6311  O  OD2 . ASP B 1 175 ? 97.887  57.567  65.215  1.00 53.56  ? 175 ASP B OD2 1 
ATOM   6312  N  N   . SER B 1 176 ? 95.536  54.151  68.064  1.00 58.76  ? 176 SER B N   1 
ATOM   6313  C  CA  . SER B 1 176 ? 96.013  53.108  68.962  1.00 58.76  ? 176 SER B CA  1 
ATOM   6314  C  C   . SER B 1 176 ? 97.475  52.763  68.785  1.00 58.76  ? 176 SER B C   1 
ATOM   6315  O  O   . SER B 1 176 ? 97.999  51.973  69.573  1.00 58.76  ? 176 SER B O   1 
ATOM   6316  C  CB  . SER B 1 176 ? 95.174  51.849  68.779  1.00 58.76  ? 176 SER B CB  1 
ATOM   6317  O  OG  . SER B 1 176 ? 95.351  51.325  67.477  1.00 58.76  ? 176 SER B OG  1 
ATOM   6318  N  N   . GLU B 1 177 ? 98.147  53.299  67.780  1.00 61.55  ? 177 GLU B N   1 
ATOM   6319  C  CA  . GLU B 1 177 ? 99.563  53.042  67.620  1.00 61.55  ? 177 GLU B CA  1 
ATOM   6320  C  C   . GLU B 1 177 ? 100.433 54.248  67.929  1.00 61.55  ? 177 GLU B C   1 
ATOM   6321  O  O   . GLU B 1 177 ? 101.637 54.079  68.144  1.00 61.55  ? 177 GLU B O   1 
ATOM   6322  C  CB  . GLU B 1 177 ? 99.836  52.536  66.200  1.00 61.55  ? 177 GLU B CB  1 
ATOM   6323  C  CG  . GLU B 1 177 ? 99.024  51.292  65.884  1.00 61.55  ? 177 GLU B CG  1 
ATOM   6324  C  CD  . GLU B 1 177 ? 98.707  51.153  64.416  1.00 61.55  ? 177 GLU B CD  1 
ATOM   6325  O  OE1 . GLU B 1 177 ? 98.583  52.192  63.739  1.00 61.55  ? 177 GLU B OE1 1 
ATOM   6326  O  OE2 . GLU B 1 177 ? 98.579  50.008  63.935  1.00 61.55  ? 177 GLU B OE2 1 
ATOM   6327  N  N   . ALA B 1 178 ? 99.854  55.445  67.990  1.00 54.27  ? 178 ALA B N   1 
ATOM   6328  C  CA  . ALA B 1 178 ? 100.576 56.618  68.458  1.00 54.27  ? 178 ALA B CA  1 
ATOM   6329  C  C   . ALA B 1 178 ? 100.247 56.948  69.896  1.00 54.27  ? 178 ALA B C   1 
ATOM   6330  O  O   . ALA B 1 178 ? 100.957 57.736  70.526  1.00 54.27  ? 178 ALA B O   1 
ATOM   6331  C  CB  . ALA B 1 178 ? 100.263 57.829  67.578  1.00 54.27  ? 178 ALA B CB  1 
ATOM   6332  N  N   . LEU B 1 179 ? 99.203  56.330  70.437  1.00 47.00  ? 179 LEU B N   1 
ATOM   6333  C  CA  . LEU B 1 179 ? 98.896  56.512  71.845  1.00 47.00  ? 179 LEU B CA  1 
ATOM   6334  C  C   . LEU B 1 179 ? 99.824  55.684  72.709  1.00 47.00  ? 179 LEU B C   1 
ATOM   6335  O  O   . LEU B 1 179 ? 100.200 56.109  73.807  1.00 47.00  ? 179 LEU B O   1 
ATOM   6336  C  CB  . LEU B 1 179 ? 97.447  56.136  72.108  1.00 47.00  ? 179 LEU B CB  1 
ATOM   6337  C  CG  . LEU B 1 179 ? 96.925  56.337  73.513  1.00 47.00  ? 179 LEU B CG  1 
ATOM   6338  C  CD1 . LEU B 1 179 ? 97.193  57.746  73.927  1.00 47.00  ? 179 LEU B CD1 1 
ATOM   6339  C  CD2 . LEU B 1 179 ? 95.452  56.055  73.516  1.00 47.00  ? 179 LEU B CD2 1 
ATOM   6340  N  N   . LYS B 1 180 ? 100.224 54.511  72.223  1.00 51.69  ? 180 LYS B N   1 
ATOM   6341  C  CA  . LYS B 1 180 ? 101.103 53.658  73.009  1.00 51.69  ? 180 LYS B CA  1 
ATOM   6342  C  C   . LYS B 1 180 ? 102.496 54.256  73.060  1.00 51.69  ? 180 LYS B C   1 
ATOM   6343  O  O   . LYS B 1 180 ? 103.169 54.196  74.093  1.00 51.69  ? 180 LYS B O   1 
ATOM   6344  C  CB  . LYS B 1 180 ? 101.126 52.246  72.442  1.00 51.69  ? 180 LYS B CB  1 
ATOM   6345  C  CG  . LYS B 1 180 ? 100.014 51.380  72.992  1.00 51.69  ? 180 LYS B CG  1 
ATOM   6346  C  CD  . LYS B 1 180 ? 99.601  50.313  72.005  1.00 51.69  ? 180 LYS B CD  1 
ATOM   6347  N  N   . LYS B 1 181 ? 102.921 54.879  71.967  1.00 51.46  ? 181 LYS B N   1 
ATOM   6348  C  CA  . LYS B 1 181 ? 104.191 55.581  71.959  1.00 51.46  ? 181 LYS B CA  1 
ATOM   6349  C  C   . LYS B 1 181 ? 104.151 56.870  72.761  1.00 51.46  ? 181 LYS B C   1 
ATOM   6350  O  O   . LYS B 1 181 ? 105.210 57.434  73.050  1.00 51.46  ? 181 LYS B O   1 
ATOM   6351  C  CB  . LYS B 1 181 ? 104.628 55.891  70.530  1.00 51.46  ? 181 LYS B CB  1 
ATOM   6352  C  CG  . LYS B 1 181 ? 104.581 54.705  69.606  1.00 51.46  ? 181 LYS B CG  1 
ATOM   6353  C  CD  . LYS B 1 181 ? 105.213 55.043  68.278  1.00 51.46  ? 181 LYS B CD  1 
ATOM   6354  C  CE  . LYS B 1 181 ? 104.953 53.947  67.267  1.00 51.46  ? 181 LYS B CE  1 
ATOM   6355  N  NZ  . LYS B 1 181 ? 104.931 52.602  67.899  1.00 51.46  ? 181 LYS B NZ  1 
ATOM   6356  N  N   . LEU B 1 182 ? 102.967 57.363  73.116  1.00 47.00  ? 182 LEU B N   1 
ATOM   6357  C  CA  . LEU B 1 182 ? 102.909 58.444  74.088  1.00 47.00  ? 182 LEU B CA  1 
ATOM   6358  C  C   . LEU B 1 182 ? 102.980 57.892  75.505  1.00 47.00  ? 182 LEU B C   1 
ATOM   6359  O  O   . LEU B 1 182 ? 103.669 58.443  76.370  1.00 47.00  ? 182 LEU B O   1 
ATOM   6360  C  CB  . LEU B 1 182 ? 101.624 59.236  73.888  1.00 47.00  ? 182 LEU B CB  1 
ATOM   6361  C  CG  . LEU B 1 182 ? 101.298 60.241  74.975  1.00 47.00  ? 182 LEU B CG  1 
ATOM   6362  C  CD1 . LEU B 1 182 ? 102.353 61.317  74.957  1.00 47.00  ? 182 LEU B CD1 1 
ATOM   6363  C  CD2 . LEU B 1 182 ? 99.945  60.820  74.753  1.00 47.00  ? 182 LEU B CD2 1 
ATOM   6364  N  N   . GLU B 1 183 ? 102.295 56.776  75.747  1.00 55.33  ? 183 GLU B N   1 
ATOM   6365  C  CA  . GLU B 1 183 ? 102.275 56.168  77.070  1.00 55.33  ? 183 GLU B CA  1 
ATOM   6366  C  C   . GLU B 1 183 ? 103.622 55.609  77.487  1.00 55.33  ? 183 GLU B C   1 
ATOM   6367  O  O   . GLU B 1 183 ? 103.902 55.552  78.688  1.00 55.33  ? 183 GLU B O   1 
ATOM   6368  C  CB  . GLU B 1 183 ? 101.245 55.047  77.147  1.00 55.33  ? 183 GLU B CB  1 
ATOM   6369  C  CG  . GLU B 1 183 ? 99.868  55.482  77.577  1.00 55.33  ? 183 GLU B CG  1 
ATOM   6370  C  CD  . GLU B 1 183 ? 98.968  54.300  77.856  1.00 55.33  ? 183 GLU B CD  1 
ATOM   6371  O  OE1 . GLU B 1 183 ? 99.444  53.320  78.461  1.00 55.33  ? 183 GLU B OE1 1 
ATOM   6372  O  OE2 . GLU B 1 183 ? 97.790  54.336  77.454  1.00 55.33  ? 183 GLU B OE2 1 
ATOM   6373  N  N   . ASP B 1 184 ? 104.467 55.231  76.524  1.00 59.98  ? 184 ASP B N   1 
ATOM   6374  C  CA  . ASP B 1 184 ? 105.777 54.687  76.856  1.00 59.98  ? 184 ASP B CA  1 
ATOM   6375  C  C   . ASP B 1 184 ? 106.678 55.739  77.468  1.00 59.98  ? 184 ASP B C   1 
ATOM   6376  O  O   . ASP B 1 184 ? 107.539 55.412  78.289  1.00 59.98  ? 184 ASP B O   1 
ATOM   6377  C  CB  . ASP B 1 184 ? 106.437 54.108  75.607  1.00 59.98  ? 184 ASP B CB  1 
ATOM   6378  C  CG  . ASP B 1 184 ? 105.746 52.858  75.112  1.00 59.98  ? 184 ASP B CG  1 
ATOM   6379  O  OD1 . ASP B 1 184 ? 104.909 52.314  75.859  1.00 59.98  ? 184 ASP B OD1 1 
ATOM   6380  O  OD2 . ASP B 1 184 ? 106.038 52.417  73.980  1.00 59.98  ? 184 ASP B OD2 1 
ATOM   6381  N  N   . THR B 1 185 ? 106.479 56.999  77.114  1.00 53.52  ? 185 THR B N   1 
ATOM   6382  C  CA  . THR B 1 185 ? 107.311 58.057  77.646  1.00 53.52  ? 185 THR B CA  1 
ATOM   6383  C  C   . THR B 1 185 ? 106.556 58.933  78.619  1.00 53.52  ? 185 THR B C   1 
ATOM   6384  O  O   . THR B 1 185 ? 107.015 60.036  78.921  1.00 53.52  ? 185 THR B O   1 
ATOM   6385  C  CB  . THR B 1 185 ? 107.856 58.930  76.516  1.00 53.52  ? 185 THR B CB  1 
ATOM   6386  O  OG1 . THR B 1 185 ? 106.845 59.855  76.105  1.00 53.52  ? 185 THR B OG1 1 
ATOM   6387  C  CG2 . THR B 1 185 ? 108.246 58.079  75.327  1.00 53.52  ? 185 THR B CG2 1 
ATOM   6388  N  N   . TRP B 1 186 ? 105.405 58.487  79.104  1.00 43.98  ? 186 TRP B N   1 
ATOM   6389  C  CA  . TRP B 1 186 ? 104.618 59.318  79.990  1.00 43.98  ? 186 TRP B CA  1 
ATOM   6390  C  C   . TRP B 1 186 ? 104.570 58.816  81.422  1.00 43.98  ? 186 TRP B C   1 
ATOM   6391  O  O   . TRP B 1 186 ? 104.768 59.617  82.338  1.00 43.98  ? 186 TRP B O   1 
ATOM   6392  C  CB  . TRP B 1 186 ? 103.178 59.435  79.485  1.00 43.98  ? 186 TRP B CB  1 
ATOM   6393  C  CG  . TRP B 1 186 ? 102.465 60.651  79.964  1.00 43.98  ? 186 TRP B CG  1 
ATOM   6394  C  CD1 . TRP B 1 186 ? 102.910 61.567  80.852  1.00 43.98  ? 186 TRP B CD1 1 
ATOM   6395  C  CD2 . TRP B 1 186 ? 101.138 61.030  79.633  1.00 43.98  ? 186 TRP B CD2 1 
ATOM   6396  N  NE1 . TRP B 1 186 ? 101.964 62.518  81.061  1.00 43.98  ? 186 TRP B NE1 1 
ATOM   6397  C  CE2 . TRP B 1 186 ? 100.859 62.204  80.325  1.00 43.98  ? 186 TRP B CE2 1 
ATOM   6398  C  CE3 . TRP B 1 186 ? 100.164 60.494  78.801  1.00 43.98  ? 186 TRP B CE3 1 
ATOM   6399  C  CZ2 . TRP B 1 186 ? 99.654  62.853  80.215  1.00 43.98  ? 186 TRP B CZ2 1 
ATOM   6400  C  CZ3 . TRP B 1 186 ? 98.974  61.131  78.695  1.00 43.98  ? 186 TRP B CZ3 1 
ATOM   6401  C  CH2 . TRP B 1 186 ? 98.723  62.301  79.395  1.00 43.98  ? 186 TRP B CH2 1 
ATOM   6402  N  N   . TYR B 1 187 ? 104.334 57.527  81.646  1.00 49.89  ? 187 TYR B N   1 
ATOM   6403  C  CA  . TYR B 1 187 ? 104.175 57.028  83.007  1.00 49.89  ? 187 TYR B CA  1 
ATOM   6404  C  C   . TYR B 1 187 ? 105.521 56.973  83.702  1.00 49.89  ? 187 TYR B C   1 
ATOM   6405  O  O   . TYR B 1 187 ? 106.292 56.031  83.541  1.00 49.89  ? 187 TYR B O   1 
ATOM   6406  C  CB  . TYR B 1 187 ? 103.557 55.641  82.995  1.00 49.89  ? 187 TYR B CB  1 
ATOM   6407  C  CG  . TYR B 1 187 ? 102.167 55.586  82.454  1.00 49.89  ? 187 TYR B CG  1 
ATOM   6408  C  CD1 . TYR B 1 187 ? 101.293 56.635  82.633  1.00 49.89  ? 187 TYR B CD1 1 
ATOM   6409  C  CD2 . TYR B 1 187 ? 101.725 54.469  81.774  1.00 49.89  ? 187 TYR B CD2 1 
ATOM   6410  C  CE1 . TYR B 1 187 ? 100.016 56.576  82.138  1.00 49.89  ? 187 TYR B CE1 1 
ATOM   6411  C  CE2 . TYR B 1 187 ? 100.455 54.400  81.279  1.00 49.89  ? 187 TYR B CE2 1 
ATOM   6412  C  CZ  . TYR B 1 187 ? 99.606  55.455  81.461  1.00 49.89  ? 187 TYR B CZ  1 
ATOM   6413  O  OH  . TYR B 1 187 ? 98.333  55.385  80.964  1.00 49.89  ? 187 TYR B OH  1 
ATOM   6414  N  N   . THR B 1 188 ? 105.789 57.967  84.528  1.00 70.14  ? 188 THR B N   1 
ATOM   6415  C  CA  . THR B 1 188 ? 107.015 57.989  85.308  1.00 70.14  ? 188 THR B CA  1 
ATOM   6416  C  C   . THR B 1 188 ? 106.712 57.186  86.560  1.00 70.14  ? 188 THR B C   1 
ATOM   6417  O  O   . THR B 1 188 ? 105.640 57.340  87.152  1.00 70.14  ? 188 THR B O   1 
ATOM   6418  C  CB  . THR B 1 188 ? 107.446 59.412  85.634  1.00 70.14  ? 188 THR B CB  1 
ATOM   6419  O  OG1 . THR B 1 188 ? 106.644 59.923  86.706  1.00 70.14  ? 188 THR B OG1 1 
ATOM   6420  C  CG2 . THR B 1 188 ? 107.284 60.297  84.412  1.00 70.14  ? 188 THR B CG2 1 
ATOM   6421  N  N   . ARG B 1 189 ? 107.634 56.327  86.968  1.00 95.11  ? 189 ARG B N   1 
ATOM   6422  C  CA  . ARG B 1 189 ? 107.307 55.479  88.102  1.00 95.11  ? 189 ARG B CA  1 
ATOM   6423  C  C   . ARG B 1 189 ? 108.525 55.090  88.919  1.00 95.11  ? 189 ARG B C   1 
ATOM   6424  O  O   . ARG B 1 189 ? 108.403 54.770  90.105  1.00 95.11  ? 189 ARG B O   1 
ATOM   6425  C  CB  . ARG B 1 189 ? 106.587 54.217  87.621  1.00 95.11  ? 189 ARG B CB  1 
ATOM   6426  N  N   . PHE B 1 190 ? 109.704 55.104  88.308  1.00 110.03 ? 190 PHE B N   1 
ATOM   6427  C  CA  . PHE B 1 190 ? 110.879 54.697  89.061  1.00 110.03 ? 190 PHE B CA  1 
ATOM   6428  C  C   . PHE B 1 190 ? 111.971 55.758  89.105  1.00 110.03 ? 190 PHE B C   1 
ATOM   6429  O  O   . PHE B 1 190 ? 113.007 55.567  89.749  1.00 110.03 ? 190 PHE B O   1 
ATOM   6430  C  CB  . PHE B 1 190 ? 111.376 53.376  88.476  1.00 110.03 ? 190 PHE B CB  1 
ATOM   6431  C  CG  . PHE B 1 190 ? 110.280 52.357  88.329  1.00 110.03 ? 190 PHE B CG  1 
ATOM   6432  C  CD1 . PHE B 1 190 ? 109.767 51.718  89.446  1.00 110.03 ? 190 PHE B CD1 1 
ATOM   6433  C  CD2 . PHE B 1 190 ? 109.724 52.082  87.090  1.00 110.03 ? 190 PHE B CD2 1 
ATOM   6434  C  CE1 . PHE B 1 190 ? 108.745 50.802  89.330  1.00 110.03 ? 190 PHE B CE1 1 
ATOM   6435  C  CE2 . PHE B 1 190 ? 108.700 51.162  86.968  1.00 110.03 ? 190 PHE B CE2 1 
ATOM   6436  C  CZ  . PHE B 1 190 ? 108.212 50.522  88.090  1.00 110.03 ? 190 PHE B CZ  1 
ATOM   6437  N  N   . ALA B 1 191 ? 111.740 56.886  88.450  1.00 105.88 ? 191 ALA B N   1 
ATOM   6438  C  CA  . ALA B 1 191 ? 112.759 57.907  88.279  1.00 105.88 ? 191 ALA B CA  1 
ATOM   6439  C  C   . ALA B 1 191 ? 112.075 59.233  88.008  1.00 105.88 ? 191 ALA B C   1 
ATOM   6440  O  O   . ALA B 1 191 ? 111.068 59.288  87.295  1.00 105.88 ? 191 ALA B O   1 
ATOM   6441  C  CB  . ALA B 1 191 ? 113.723 57.574  87.129  1.00 105.88 ? 191 ALA B CB  1 
ATOM   6442  N  N   . LEU B 1 192 ? 112.594 60.294  88.629  1.00 98.29  ? 192 LEU B N   1 
ATOM   6443  C  CA  . LEU B 1 192 ? 112.026 61.628  88.451  1.00 98.29  ? 192 LEU B CA  1 
ATOM   6444  C  C   . LEU B 1 192 ? 112.322 62.024  87.015  1.00 98.29  ? 192 LEU B C   1 
ATOM   6445  O  O   . LEU B 1 192 ? 113.420 61.815  86.501  1.00 98.29  ? 192 LEU B O   1 
ATOM   6446  C  CB  . LEU B 1 192 ? 112.609 62.620  89.450  1.00 98.29  ? 192 LEU B CB  1 
ATOM   6447  N  N   . LYS B 1 193 ? 111.339 62.635  86.373  1.00 74.74  ? 193 LYS B N   1 
ATOM   6448  C  CA  . LYS B 1 193 ? 111.449 62.938  84.963  1.00 74.74  ? 193 LYS B CA  1 
ATOM   6449  C  C   . LYS B 1 193 ? 110.446 64.014  84.607  1.00 74.74  ? 193 LYS B C   1 
ATOM   6450  O  O   . LYS B 1 193 ? 109.292 63.992  85.037  1.00 74.74  ? 193 LYS B O   1 
ATOM   6451  C  CB  . LYS B 1 193 ? 111.203 61.697  84.098  1.00 74.74  ? 193 LYS B CB  1 
ATOM   6452  N  N   . TYR B 1 194 ? 110.915 64.962  83.825  1.00 60.96  ? 194 TYR B N   1 
ATOM   6453  C  CA  . TYR B 1 194 ? 110.082 66.038  83.348  1.00 60.96  ? 194 TYR B CA  1 
ATOM   6454  C  C   . TYR B 1 194 ? 109.098 65.466  82.348  1.00 60.96  ? 194 TYR B C   1 
ATOM   6455  O  O   . TYR B 1 194 ? 109.464 64.703  81.454  1.00 60.96  ? 194 TYR B O   1 
ATOM   6456  C  CB  . TYR B 1 194 ? 110.929 67.144  82.743  1.00 60.96  ? 194 TYR B CB  1 
ATOM   6457  C  CG  . TYR B 1 194 ? 111.742 67.805  83.809  1.00 60.96  ? 194 TYR B CG  1 
ATOM   6458  C  CD1 . TYR B 1 194 ? 111.185 68.776  84.614  1.00 60.96  ? 194 TYR B CD1 1 
ATOM   6459  C  CD2 . TYR B 1 194 ? 113.062 67.456  84.019  1.00 60.96  ? 194 TYR B CD2 1 
ATOM   6460  C  CE1 . TYR B 1 194 ? 111.912 69.386  85.603  1.00 60.96  ? 194 TYR B CE1 1 
ATOM   6461  C  CE2 . TYR B 1 194 ? 113.805 68.061  85.008  1.00 60.96  ? 194 TYR B CE2 1 
ATOM   6462  C  CZ  . TYR B 1 194 ? 113.222 69.030  85.798  1.00 60.96  ? 194 TYR B CZ  1 
ATOM   6463  O  OH  . TYR B 1 194 ? 113.942 69.649  86.795  1.00 60.96  ? 194 TYR B OH  1 
ATOM   6464  N  N   . GLN B 1 195 ? 107.838 65.806  82.532  1.00 42.81  ? 195 GLN B N   1 
ATOM   6465  C  CA  . GLN B 1 195 ? 106.773 65.235  81.739  1.00 42.81  ? 195 GLN B CA  1 
ATOM   6466  C  C   . GLN B 1 195 ? 106.807 65.832  80.344  1.00 42.81  ? 195 GLN B C   1 
ATOM   6467  O  O   . GLN B 1 195 ? 107.021 67.044  80.208  1.00 42.81  ? 195 GLN B O   1 
ATOM   6468  C  CB  . GLN B 1 195 ? 105.442 65.507  82.403  1.00 42.81  ? 195 GLN B CB  1 
ATOM   6469  C  CG  . GLN B 1 195 ? 104.434 64.443  82.223  1.00 42.81  ? 195 GLN B CG  1 
ATOM   6470  C  CD  . GLN B 1 195 ? 103.236 64.666  83.086  1.00 42.81  ? 195 GLN B CD  1 
ATOM   6471  O  OE1 . GLN B 1 195 ? 102.277 63.907  83.031  1.00 42.81  ? 195 GLN B OE1 1 
ATOM   6472  N  NE2 . GLN B 1 195 ? 103.275 65.714  83.892  1.00 42.81  ? 195 GLN B NE2 1 
ATOM   6473  N  N   . PRO B 1 196 ? 106.639 65.037  79.294  1.00 38.58  ? 196 PRO B N   1 
ATOM   6474  C  CA  . PRO B 1 196 ? 106.692 65.544  77.912  1.00 38.58  ? 196 PRO B CA  1 
ATOM   6475  C  C   . PRO B 1 196 ? 105.436 66.271  77.446  1.00 38.58  ? 196 PRO B C   1 
ATOM   6476  O  O   . PRO B 1 196 ? 104.578 65.731  76.762  1.00 38.58  ? 196 PRO B O   1 
ATOM   6477  C  CB  . PRO B 1 196 ? 106.915 64.268  77.102  1.00 38.58  ? 196 PRO B CB  1 
ATOM   6478  C  CG  . PRO B 1 196 ? 106.284 63.210  77.902  1.00 38.58  ? 196 PRO B CG  1 
ATOM   6479  C  CD  . PRO B 1 196 ? 106.463 63.577  79.332  1.00 38.58  ? 196 PRO B CD  1 
ATOM   6480  N  N   . ILE B 1 197 ? 105.373 67.562  77.781  1.00 33.97  ? 197 ILE B N   1 
ATOM   6481  C  CA  . ILE B 1 197 ? 104.179 68.357  77.548  1.00 33.97  ? 197 ILE B CA  1 
ATOM   6482  C  C   . ILE B 1 197 ? 103.958 68.621  76.072  1.00 33.97  ? 197 ILE B C   1 
ATOM   6483  O  O   . ILE B 1 197 ? 102.808 68.723  75.633  1.00 33.97  ? 197 ILE B O   1 
ATOM   6484  C  CB  . ILE B 1 197 ? 104.290 69.703  78.270  1.00 33.97  ? 197 ILE B CB  1 
ATOM   6485  C  CG1 . ILE B 1 197 ? 104.818 69.501  79.666  1.00 33.97  ? 197 ILE B CG1 1 
ATOM   6486  C  CG2 . ILE B 1 197 ? 102.946 70.358  78.411  1.00 33.97  ? 197 ILE B CG2 1 
ATOM   6487  C  CD1 . ILE B 1 197 ? 105.226 70.788  80.298  1.00 33.97  ? 197 ILE B CD1 1 
ATOM   6488  N  N   . ASP B 1 198 ? 105.020 68.644  75.273  1.00 35.71  ? 198 ASP B N   1 
ATOM   6489  C  CA  . ASP B 1 198 ? 104.847 68.910  73.852  1.00 35.71  ? 198 ASP B CA  1 
ATOM   6490  C  C   . ASP B 1 198 ? 104.252 67.725  73.116  1.00 35.71  ? 198 ASP B C   1 
ATOM   6491  O  O   . ASP B 1 198 ? 103.490 67.918  72.167  1.00 35.71  ? 198 ASP B O   1 
ATOM   6492  C  CB  . ASP B 1 198 ? 106.160 69.352  73.239  1.00 35.71  ? 198 ASP B CB  1 
ATOM   6493  C  CG  . ASP B 1 198 ? 106.304 70.848  73.264  1.00 35.71  ? 198 ASP B CG  1 
ATOM   6494  O  OD1 . ASP B 1 198 ? 105.275 71.528  73.104  1.00 35.71  ? 198 ASP B OD1 1 
ATOM   6495  O  OD2 . ASP B 1 198 ? 107.424 71.353  73.470  1.00 35.71  ? 198 ASP B OD2 1 
ATOM   6496  N  N   . SER B 1 199 ? 104.588 66.507  73.514  1.00 37.63  ? 199 SER B N   1 
ATOM   6497  C  CA  . SER B 1 199 ? 103.966 65.358  72.878  1.00 37.63  ? 199 SER B CA  1 
ATOM   6498  C  C   . SER B 1 199 ? 102.534 65.189  73.359  1.00 37.63  ? 199 SER B C   1 
ATOM   6499  O  O   . SER B 1 199 ? 101.673 64.745  72.593  1.00 37.63  ? 199 SER B O   1 
ATOM   6500  C  CB  . SER B 1 199 ? 104.756 64.097  73.185  1.00 37.63  ? 199 SER B CB  1 
ATOM   6501  O  OG  . SER B 1 199 ? 104.809 63.898  74.582  1.00 37.63  ? 199 SER B OG  1 
ATOM   6502  N  N   . ILE B 1 200 ? 102.289 65.496  74.633  1.00 35.02  ? 200 ILE B N   1 
ATOM   6503  C  CA  . ILE B 1 200 ? 100.936 65.598  75.174  1.00 35.02  ? 200 ILE B CA  1 
ATOM   6504  C  C   . ILE B 1 200 ? 100.116 66.619  74.407  1.00 35.02  ? 200 ILE B C   1 
ATOM   6505  O  O   . ILE B 1 200 ? 98.948  66.377  74.079  1.00 35.02  ? 200 ILE B O   1 
ATOM   6506  C  CB  . ILE B 1 200 ? 101.008 65.952  76.667  1.00 35.02  ? 200 ILE B CB  1 
ATOM   6507  C  CG1 . ILE B 1 200 ? 101.539 64.774  77.459  1.00 35.02  ? 200 ILE B CG1 1 
ATOM   6508  C  CG2 . ILE B 1 200 ? 99.673  66.341  77.208  1.00 35.02  ? 200 ILE B CG2 1 
ATOM   6509  C  CD1 . ILE B 1 200 ? 102.031 65.158  78.812  1.00 35.02  ? 200 ILE B CD1 1 
ATOM   6510  N  N   . ARG B 1 201 ? 100.729 67.748  74.057  1.00 31.42  ? 201 ARG B N   1 
ATOM   6511  C  CA  . ARG B 1 201 ? 100.031 68.772  73.293  1.00 31.42  ? 201 ARG B CA  1 
ATOM   6512  C  C   . ARG B 1 201 ? 99.649  68.285  71.910  1.00 31.42  ? 201 ARG B C   1 
ATOM   6513  O  O   . ARG B 1 201 ? 98.496  68.435  71.496  1.00 31.42  ? 201 ARG B O   1 
ATOM   6514  C  CB  . ARG B 1 201 ? 100.903 70.013  73.169  1.00 31.42  ? 201 ARG B CB  1 
ATOM   6515  C  CG  . ARG B 1 201 ? 100.279 71.092  72.332  1.00 31.42  ? 201 ARG B CG  1 
ATOM   6516  C  CD  . ARG B 1 201 ? 101.066 71.345  71.079  1.00 31.42  ? 201 ARG B CD  1 
ATOM   6517  N  NE  . ARG B 1 201 ? 100.323 72.191  70.163  1.00 31.42  ? 201 ARG B NE  1 
ATOM   6518  C  CZ  . ARG B 1 201 ? 100.712 72.460  68.927  1.00 31.42  ? 201 ARG B CZ  1 
ATOM   6519  N  NH1 . ARG B 1 201 ? 101.843 71.948  68.469  1.00 31.42  ? 201 ARG B NH1 1 
ATOM   6520  N  NH2 . ARG B 1 201 ? 99.975  73.244  68.154  1.00 31.42  ? 201 ARG B NH2 1 
ATOM   6521  N  N   . GLY B 1 202 ? 100.596 67.676  71.197  1.00 35.63  ? 202 GLY B N   1 
ATOM   6522  C  CA  . GLY B 1 202 ? 100.335 67.239  69.839  1.00 35.63  ? 202 GLY B CA  1 
ATOM   6523  C  C   . GLY B 1 202 ? 99.329  66.116  69.748  1.00 35.63  ? 202 GLY B C   1 
ATOM   6524  O  O   . GLY B 1 202 ? 98.716  65.914  68.701  1.00 35.63  ? 202 GLY B O   1 
ATOM   6525  N  N   . TYR B 1 203 ? 99.125  65.391  70.836  1.00 35.12  ? 203 TYR B N   1 
ATOM   6526  C  CA  . TYR B 1 203 ? 98.088  64.380  70.859  1.00 35.12  ? 203 TYR B CA  1 
ATOM   6527  C  C   . TYR B 1 203 ? 96.769  64.850  71.447  1.00 35.12  ? 203 TYR B C   1 
ATOM   6528  O  O   . TYR B 1 203 ? 95.716  64.425  70.970  1.00 35.12  ? 203 TYR B O   1 
ATOM   6529  C  CB  . TYR B 1 203 ? 98.559  63.156  71.629  1.00 35.12  ? 203 TYR B CB  1 
ATOM   6530  C  CG  . TYR B 1 203 ? 97.638  62.010  71.402  1.00 35.12  ? 203 TYR B CG  1 
ATOM   6531  C  CD1 . TYR B 1 203 ? 97.634  61.341  70.206  1.00 35.12  ? 203 TYR B CD1 1 
ATOM   6532  C  CD2 . TYR B 1 203 ? 96.738  61.628  72.376  1.00 35.12  ? 203 TYR B CD2 1 
ATOM   6533  C  CE1 . TYR B 1 203 ? 96.779  60.308  69.992  1.00 35.12  ? 203 TYR B CE1 1 
ATOM   6534  C  CE2 . TYR B 1 203 ? 95.874  60.604  72.169  1.00 35.12  ? 203 TYR B CE2 1 
ATOM   6535  C  CZ  . TYR B 1 203 ? 95.897  59.945  70.978  1.00 35.12  ? 203 TYR B CZ  1 
ATOM   6536  O  OH  . TYR B 1 203 ? 95.028  58.906  70.777  1.00 35.12  ? 203 TYR B OH  1 
ATOM   6537  N  N   . PHE B 1 204 ? 96.768  65.703  72.466  1.00 29.35  ? 204 PHE B N   1 
ATOM   6538  C  CA  . PHE B 1 204 ? 95.538  65.964  73.196  1.00 29.35  ? 204 PHE B CA  1 
ATOM   6539  C  C   . PHE B 1 204 ? 95.050  67.387  73.104  1.00 29.35  ? 204 PHE B C   1 
ATOM   6540  O  O   . PHE B 1 204 ? 94.151  67.755  73.857  1.00 29.35  ? 204 PHE B O   1 
ATOM   6541  C  CB  . PHE B 1 204 ? 95.718  65.651  74.676  1.00 29.35  ? 204 PHE B CB  1 
ATOM   6542  C  CG  . PHE B 1 204 ? 95.641  64.220  75.007  1.00 29.35  ? 204 PHE B CG  1 
ATOM   6543  C  CD1 . PHE B 1 204 ? 94.479  63.527  74.812  1.00 29.35  ? 204 PHE B CD1 1 
ATOM   6544  C  CD2 . PHE B 1 204 ? 96.715  63.576  75.555  1.00 29.35  ? 204 PHE B CD2 1 
ATOM   6545  C  CE1 . PHE B 1 204 ? 94.401  62.209  75.136  1.00 29.35  ? 204 PHE B CE1 1 
ATOM   6546  C  CE2 . PHE B 1 204 ? 96.639  62.263  75.879  1.00 29.35  ? 204 PHE B CE2 1 
ATOM   6547  C  CZ  . PHE B 1 204 ? 95.480  61.579  75.670  1.00 29.35  ? 204 PHE B CZ  1 
ATOM   6548  N  N   . GLY B 1 205 ? 95.581  68.184  72.220  1.00 26.83  ? 205 GLY B N   1 
ATOM   6549  C  CA  . GLY B 1 205 ? 95.146  69.552  72.186  1.00 26.83  ? 205 GLY B CA  1 
ATOM   6550  C  C   . GLY B 1 205 ? 95.883  70.380  73.204  1.00 26.83  ? 205 GLY B C   1 
ATOM   6551  O  O   . GLY B 1 205 ? 96.820  69.931  73.861  1.00 26.83  ? 205 GLY B O   1 
ATOM   6552  N  N   . GLU B 1 206 ? 95.472  71.634  73.306  1.00 28.47  ? 206 GLU B N   1 
ATOM   6553  C  CA  . GLU B 1 206 ? 96.210  72.544  74.155  1.00 28.47  ? 206 GLU B CA  1 
ATOM   6554  C  C   . GLU B 1 206 ? 95.602  72.718  75.534  1.00 28.47  ? 206 GLU B C   1 
ATOM   6555  O  O   . GLU B 1 206 ? 96.335  73.052  76.464  1.00 28.47  ? 206 GLU B O   1 
ATOM   6556  C  CB  . GLU B 1 206 ? 96.310  73.902  73.479  1.00 28.47  ? 206 GLU B CB  1 
ATOM   6557  C  CG  . GLU B 1 206 ? 97.371  73.941  72.414  1.00 28.47  ? 206 GLU B CG  1 
ATOM   6558  C  CD  . GLU B 1 206 ? 96.806  73.654  71.031  1.00 28.47  ? 206 GLU B CD  1 
ATOM   6559  O  OE1 . GLU B 1 206 ? 95.567  73.604  70.900  1.00 28.47  ? 206 GLU B OE1 1 
ATOM   6560  O  OE2 . GLU B 1 206 ? 97.592  73.476  70.076  1.00 28.47  ? 206 GLU B OE2 1 
ATOM   6561  N  N   . THR B 1 207 ? 94.297  72.515  75.705  1.00 22.67  ? 207 THR B N   1 
ATOM   6562  C  CA  . THR B 1 207 ? 93.716  72.702  77.030  1.00 22.67  ? 207 THR B CA  1 
ATOM   6563  C  C   . THR B 1 207 ? 94.113  71.580  77.976  1.00 22.67  ? 207 THR B C   1 
ATOM   6564  O  O   . THR B 1 207 ? 94.497  71.834  79.120  1.00 22.67  ? 207 THR B O   1 
ATOM   6565  C  CB  . THR B 1 207 ? 92.205  72.817  76.942  1.00 22.67  ? 207 THR B CB  1 
ATOM   6566  O  OG1 . THR B 1 207 ? 91.880  73.916  76.096  1.00 22.67  ? 207 THR B OG1 1 
ATOM   6567  C  CG2 . THR B 1 207 ? 91.649  73.136  78.289  1.00 22.67  ? 207 THR B CG2 1 
ATOM   6568  N  N   . ILE B 1 208 ? 94.065  70.341  77.498  1.00 19.95  ? 208 ILE B N   1 
ATOM   6569  C  CA  . ILE B 1 208 ? 94.462  69.195  78.304  1.00 19.95  ? 208 ILE B CA  1 
ATOM   6570  C  C   . ILE B 1 208 ? 95.946  69.236  78.594  1.00 19.95  ? 208 ILE B C   1 
ATOM   6571  O  O   . ILE B 1 208 ? 96.395  68.831  79.666  1.00 19.95  ? 208 ILE B O   1 
ATOM   6572  C  CB  . ILE B 1 208 ? 94.082  67.896  77.592  1.00 19.95  ? 208 ILE B CB  1 
ATOM   6573  C  CG1 . ILE B 1 208 ? 92.698  68.023  76.972  1.00 19.95  ? 208 ILE B CG1 1 
ATOM   6574  C  CG2 . ILE B 1 208 ? 94.129  66.758  78.553  1.00 19.95  ? 208 ILE B CG2 1 
ATOM   6575  C  CD1 . ILE B 1 208 ? 91.596  68.108  77.953  1.00 19.95  ? 208 ILE B CD1 1 
ATOM   6576  N  N   . ALA B 1 209 ? 96.732  69.708  77.645  1.00 18.59  ? 209 ALA B N   1 
ATOM   6577  C  CA  . ALA B 1 209 ? 98.159  69.821  77.874  1.00 18.59  ? 209 ALA B CA  1 
ATOM   6578  C  C   . ALA B 1 209 ? 98.495  70.909  78.869  1.00 18.59  ? 209 ALA B C   1 
ATOM   6579  O  O   . ALA B 1 209 ? 99.477  70.781  79.602  1.00 18.59  ? 209 ALA B O   1 
ATOM   6580  C  CB  . ALA B 1 209 ? 98.880  70.097  76.568  1.00 18.59  ? 209 ALA B CB  1 
ATOM   6581  N  N   . LEU B 1 210 ? 97.701  71.970  78.925  1.00 16.35  ? 210 LEU B N   1 
ATOM   6582  C  CA  . LEU B 1 210 ? 97.959  73.005  79.915  1.00 16.35  ? 210 LEU B CA  1 
ATOM   6583  C  C   . LEU B 1 210 ? 97.662  72.545  81.321  1.00 16.35  ? 210 LEU B C   1 
ATOM   6584  O  O   . LEU B 1 210 ? 98.353  72.951  82.257  1.00 16.35  ? 210 LEU B O   1 
ATOM   6585  C  CB  . LEU B 1 210 ? 97.146  74.244  79.618  1.00 16.35  ? 210 LEU B CB  1 
ATOM   6586  C  CG  . LEU B 1 210 ? 97.970  75.443  80.010  1.00 16.35  ? 210 LEU B CG  1 
ATOM   6587  C  CD1 . LEU B 1 210 ? 99.219  75.514  79.189  1.00 16.35  ? 210 LEU B CD1 1 
ATOM   6588  C  CD2 . LEU B 1 210 ? 97.135  76.644  79.802  1.00 16.35  ? 210 LEU B CD2 1 
ATOM   6589  N  N   . TYR B 1 211 ? 96.653  71.705  81.497  1.00 17.36  ? 211 TYR B N   1 
ATOM   6590  C  CA  . TYR B 1 211 ? 96.423  71.156  82.821  1.00 17.36  ? 211 TYR B CA  1 
ATOM   6591  C  C   . TYR B 1 211 ? 97.566  70.251  83.243  1.00 17.36  ? 211 TYR B C   1 
ATOM   6592  O  O   . TYR B 1 211 ? 98.042  70.357  84.374  1.00 17.36  ? 211 TYR B O   1 
ATOM   6593  C  CB  . TYR B 1 211 ? 95.110  70.394  82.874  1.00 17.36  ? 211 TYR B CB  1 
ATOM   6594  C  CG  . TYR B 1 211 ? 95.046  69.488  84.056  1.00 17.36  ? 211 TYR B CG  1 
ATOM   6595  C  CD1 . TYR B 1 211 ? 95.012  70.003  85.328  1.00 17.36  ? 211 TYR B CD1 1 
ATOM   6596  C  CD2 . TYR B 1 211 ? 95.035  68.126  83.909  1.00 17.36  ? 211 TYR B CD2 1 
ATOM   6597  C  CE1 . TYR B 1 211 ? 94.971  69.195  86.413  1.00 17.36  ? 211 TYR B CE1 1 
ATOM   6598  C  CE2 . TYR B 1 211 ? 94.988  67.312  84.994  1.00 17.36  ? 211 TYR B CE2 1 
ATOM   6599  C  CZ  . TYR B 1 211 ? 94.967  67.858  86.246  1.00 17.36  ? 211 TYR B CZ  1 
ATOM   6600  O  OH  . TYR B 1 211 ? 94.908  67.067  87.359  1.00 17.36  ? 211 TYR B OH  1 
ATOM   6601  N  N   . PHE B 1 212 ? 98.060  69.402  82.345  1.00 19.23  ? 212 PHE B N   1 
ATOM   6602  C  CA  . PHE B 1 212 ? 99.132  68.505  82.749  1.00 19.23  ? 212 PHE B CA  1 
ATOM   6603  C  C   . PHE B 1 212 ? 100.421 69.266  82.923  1.00 19.23  ? 212 PHE B C   1 
ATOM   6604  O  O   . PHE B 1 212 ? 101.290 68.847  83.687  1.00 19.23  ? 212 PHE B O   1 
ATOM   6605  C  CB  . PHE B 1 212 ? 99.331  67.393  81.742  1.00 19.23  ? 212 PHE B CB  1 
ATOM   6606  C  CG  . PHE B 1 212 ? 98.429  66.251  81.954  1.00 19.23  ? 212 PHE B CG  1 
ATOM   6607  C  CD1 . PHE B 1 212 ? 98.640  65.390  82.986  1.00 19.23  ? 212 PHE B CD1 1 
ATOM   6608  C  CD2 . PHE B 1 212 ? 97.384  66.017  81.097  1.00 19.23  ? 212 PHE B CD2 1 
ATOM   6609  C  CE1 . PHE B 1 212 ? 97.800  64.329  83.186  1.00 19.23  ? 212 PHE B CE1 1 
ATOM   6610  C  CE2 . PHE B 1 212 ? 96.549  64.956  81.286  1.00 19.23  ? 212 PHE B CE2 1 
ATOM   6611  C  CZ  . PHE B 1 212 ? 96.757  64.113  82.330  1.00 19.23  ? 212 PHE B CZ  1 
ATOM   6612  N  N   . GLY B 1 213 ? 100.582 70.353  82.187  1.00 18.93  ? 213 GLY B N   1 
ATOM   6613  C  CA  . GLY B 1 213 ? 101.696 71.229  82.459  1.00 18.93  ? 213 GLY B CA  1 
ATOM   6614  C  C   . GLY B 1 213 ? 101.536 71.938  83.786  1.00 18.93  ? 213 GLY B C   1 
ATOM   6615  O  O   . GLY B 1 213 ? 102.509 72.144  84.511  1.00 18.93  ? 213 GLY B O   1 
ATOM   6616  N  N   . PHE B 1 214 ? 100.308 72.317  84.123  1.00 19.50  ? 214 PHE B N   1 
ATOM   6617  C  CA  . PHE B 1 214 ? 100.072 72.942  85.414  1.00 19.50  ? 214 PHE B CA  1 
ATOM   6618  C  C   . PHE B 1 214 ? 100.220 71.970  86.568  1.00 19.50  ? 214 PHE B C   1 
ATOM   6619  O  O   . PHE B 1 214 ? 100.659 72.366  87.646  1.00 19.50  ? 214 PHE B O   1 
ATOM   6620  C  CB  . PHE B 1 214 ? 98.689  73.553  85.441  1.00 19.50  ? 214 PHE B CB  1 
ATOM   6621  C  CG  . PHE B 1 214 ? 98.357  74.216  86.708  1.00 19.50  ? 214 PHE B CG  1 
ATOM   6622  C  CD1 . PHE B 1 214 ? 98.981  75.383  87.062  1.00 19.50  ? 214 PHE B CD1 1 
ATOM   6623  C  CD2 . PHE B 1 214 ? 97.409  73.695  87.533  1.00 19.50  ? 214 PHE B CD2 1 
ATOM   6624  C  CE1 . PHE B 1 214 ? 98.668  76.010  88.230  1.00 19.50  ? 214 PHE B CE1 1 
ATOM   6625  C  CE2 . PHE B 1 214 ? 97.094  74.316  88.690  1.00 19.50  ? 214 PHE B CE2 1 
ATOM   6626  C  CZ  . PHE B 1 214 ? 97.726  75.477  89.042  1.00 19.50  ? 214 PHE B CZ  1 
ATOM   6627  N  N   . LEU B 1 215 ? 99.869  70.706  86.376  1.00 19.68  ? 215 LEU B N   1 
ATOM   6628  C  CA  . LEU B 1 215 ? 100.025 69.740  87.455  1.00 19.68  ? 215 LEU B CA  1 
ATOM   6629  C  C   . LEU B 1 215 ? 101.483 69.399  87.682  1.00 19.68  ? 215 LEU B C   1 
ATOM   6630  O  O   . LEU B 1 215 ? 101.932 69.286  88.824  1.00 19.68  ? 215 LEU B O   1 
ATOM   6631  C  CB  . LEU B 1 215 ? 99.248  68.482  87.117  1.00 19.68  ? 215 LEU B CB  1 
ATOM   6632  C  CG  . LEU B 1 215 ? 99.384  67.322  88.070  1.00 19.68  ? 215 LEU B CG  1 
ATOM   6633  C  CD1 . LEU B 1 215 ? 98.906  67.791  89.402  1.00 19.68  ? 215 LEU B CD1 1 
ATOM   6634  C  CD2 . LEU B 1 215 ? 98.579  66.154  87.603  1.00 19.68  ? 215 LEU B CD2 1 
ATOM   6635  N  N   . GLU B 1 216 ? 102.238 69.268  86.599  1.00 27.95  ? 216 GLU B N   1 
ATOM   6636  C  CA  . GLU B 1 216 ? 103.675 69.055  86.684  1.00 27.95  ? 216 GLU B CA  1 
ATOM   6637  C  C   . GLU B 1 216 ? 104.385 70.259  87.272  1.00 27.95  ? 216 GLU B C   1 
ATOM   6638  O  O   . GLU B 1 216 ? 105.414 70.120  87.939  1.00 27.95  ? 216 GLU B O   1 
ATOM   6639  C  CB  . GLU B 1 216 ? 104.201 68.749  85.287  1.00 27.95  ? 216 GLU B CB  1 
ATOM   6640  C  CG  . GLU B 1 216 ? 105.656 68.435  85.152  1.00 27.95  ? 216 GLU B CG  1 
ATOM   6641  C  CD  . GLU B 1 216 ? 106.122 68.742  83.753  1.00 27.95  ? 216 GLU B CD  1 
ATOM   6642  O  OE1 . GLU B 1 216 ? 105.288 68.650  82.839  1.00 27.95  ? 216 GLU B OE1 1 
ATOM   6643  O  OE2 . GLU B 1 216 ? 107.301 69.101  83.563  1.00 27.95  ? 216 GLU B OE2 1 
ATOM   6644  N  N   . TYR B 1 217 ? 103.864 71.449  87.024  1.00 20.06  ? 217 TYR B N   1 
ATOM   6645  C  CA  . TYR B 1 217 ? 104.462 72.630  87.618  1.00 20.06  ? 217 TYR B CA  1 
ATOM   6646  C  C   . TYR B 1 217 ? 104.130 72.752  89.096  1.00 20.06  ? 217 TYR B C   1 
ATOM   6647  O  O   . TYR B 1 217 ? 104.973 73.156  89.900  1.00 20.06  ? 217 TYR B O   1 
ATOM   6648  C  CB  . TYR B 1 217 ? 103.983 73.859  86.882  1.00 20.06  ? 217 TYR B CB  1 
ATOM   6649  C  CG  . TYR B 1 217 ? 104.549 75.104  87.440  1.00 20.06  ? 217 TYR B CG  1 
ATOM   6650  C  CD1 . TYR B 1 217 ? 105.851 75.455  87.177  1.00 20.06  ? 217 TYR B CD1 1 
ATOM   6651  C  CD2 . TYR B 1 217 ? 103.792 75.917  88.250  1.00 20.06  ? 217 TYR B CD2 1 
ATOM   6652  C  CE1 . TYR B 1 217 ? 106.376 76.586  87.687  1.00 20.06  ? 217 TYR B CE1 1 
ATOM   6653  C  CE2 . TYR B 1 217 ? 104.303 77.032  88.771  1.00 20.06  ? 217 TYR B CE2 1 
ATOM   6654  C  CZ  . TYR B 1 217 ? 105.591 77.369  88.486  1.00 20.06  ? 217 TYR B CZ  1 
ATOM   6655  O  OH  . TYR B 1 217 ? 106.095 78.512  89.017  1.00 20.06  ? 217 TYR B OH  1 
ATOM   6656  N  N   . PHE B 1 218 ? 102.884 72.479  89.454  1.00 22.34  ? 218 PHE B N   1 
ATOM   6657  C  CA  . PHE B 1 218 ? 102.438 72.626  90.833  1.00 22.34  ? 218 PHE B CA  1 
ATOM   6658  C  C   . PHE B 1 218 ? 103.022 71.560  91.742  1.00 22.34  ? 218 PHE B C   1 
ATOM   6659  O  O   . PHE B 1 218 ? 103.111 71.752  92.955  1.00 22.34  ? 218 PHE B O   1 
ATOM   6660  C  CB  . PHE B 1 218 ? 100.930 72.578  90.870  1.00 22.34  ? 218 PHE B CB  1 
ATOM   6661  C  CG  . PHE B 1 218 ? 100.356 73.060  92.120  1.00 22.34  ? 218 PHE B CG  1 
ATOM   6662  C  CD1 . PHE B 1 218 ? 100.479 74.381  92.462  1.00 22.34  ? 218 PHE B CD1 1 
ATOM   6663  C  CD2 . PHE B 1 218 ? 99.657  72.210  92.938  1.00 22.34  ? 218 PHE B CD2 1 
ATOM   6664  C  CE1 . PHE B 1 218 ? 99.931  74.842  93.609  1.00 22.34  ? 218 PHE B CE1 1 
ATOM   6665  C  CE2 . PHE B 1 218 ? 99.107  72.664  94.085  1.00 22.34  ? 218 PHE B CE2 1 
ATOM   6666  C  CZ  . PHE B 1 218 ? 99.243  73.981  94.423  1.00 22.34  ? 218 PHE B CZ  1 
ATOM   6667  N  N   . THR B 1 219 ? 103.403 70.424  91.181  1.00 29.27  ? 219 THR B N   1 
ATOM   6668  C  CA  . THR B 1 219 ? 104.107 69.415  91.957  1.00 29.27  ? 219 THR B CA  1 
ATOM   6669  C  C   . THR B 1 219 ? 105.508 69.878  92.305  1.00 29.27  ? 219 THR B C   1 
ATOM   6670  O  O   . THR B 1 219 ? 105.958 69.704  93.439  1.00 29.27  ? 219 THR B O   1 
ATOM   6671  C  CB  . THR B 1 219 ? 104.137 68.105  91.200  1.00 29.27  ? 219 THR B CB  1 
ATOM   6672  O  OG1 . THR B 1 219 ? 102.800 67.771  90.827  1.00 29.27  ? 219 THR B OG1 1 
ATOM   6673  C  CG2 . THR B 1 219 ? 104.684 67.020  92.070  1.00 29.27  ? 219 THR B CG2 1 
ATOM   6674  N  N   . PHE B 1 220 ? 106.191 70.523  91.375  1.00 32.12  ? 220 PHE B N   1 
ATOM   6675  C  CA  . PHE B 1 220 ? 107.534 71.012  91.645  1.00 32.12  ? 220 PHE B CA  1 
ATOM   6676  C  C   . PHE B 1 220 ? 107.524 72.359  92.334  1.00 32.12  ? 220 PHE B C   1 
ATOM   6677  O  O   . PHE B 1 220 ? 108.535 73.060  92.306  1.00 32.12  ? 220 PHE B O   1 
ATOM   6678  C  CB  . PHE B 1 220 ? 108.330 71.166  90.350  1.00 32.12  ? 220 PHE B CB  1 
ATOM   6679  C  CG  . PHE B 1 220 ? 108.595 69.890  89.636  1.00 32.12  ? 220 PHE B CG  1 
ATOM   6680  C  CD1 . PHE B 1 220 ? 108.629 68.683  90.310  1.00 32.12  ? 220 PHE B CD1 1 
ATOM   6681  C  CD2 . PHE B 1 220 ? 108.820 69.902  88.273  1.00 32.12  ? 220 PHE B CD2 1 
ATOM   6682  C  CE1 . PHE B 1 220 ? 108.876 67.503  89.632  1.00 32.12  ? 220 PHE B CE1 1 
ATOM   6683  C  CE2 . PHE B 1 220 ? 109.069 68.734  87.590  1.00 32.12  ? 220 PHE B CE2 1 
ATOM   6684  C  CZ  . PHE B 1 220 ? 109.096 67.530  88.269  1.00 32.12  ? 220 PHE B CZ  1 
ATOM   6685  N  N   . ALA B 1 221 ? 106.399 72.755  92.904  1.00 27.92  ? 221 ALA B N   1 
ATOM   6686  C  CA  . ALA B 1 221 ? 106.305 73.960  93.690  1.00 27.92  ? 221 ALA B CA  1 
ATOM   6687  C  C   . ALA B 1 221 ? 105.895 73.716  95.123  1.00 27.92  ? 221 ALA B C   1 
ATOM   6688  O  O   . ALA B 1 221 ? 105.932 74.654  95.919  1.00 27.92  ? 221 ALA B O   1 
ATOM   6689  C  CB  . ALA B 1 221 ? 105.312 74.927  93.053  1.00 27.92  ? 221 ALA B CB  1 
ATOM   6690  N  N   . LEU B 1 222 ? 105.445 72.517  95.461  1.00 33.46  ? 222 LEU B N   1 
ATOM   6691  C  CA  . LEU B 1 222 ? 105.226 72.149  96.849  1.00 33.46  ? 222 LEU B CA  1 
ATOM   6692  C  C   . LEU B 1 222 ? 106.400 71.386  97.427  1.00 33.46  ? 222 LEU B C   1 
ATOM   6693  O  O   . LEU B 1 222 ? 106.372 71.022  98.605  1.00 33.46  ? 222 LEU B O   1 
ATOM   6694  C  CB  . LEU B 1 222 ? 103.942 71.347  97.006  1.00 33.46  ? 222 LEU B CB  1 
ATOM   6695  C  CG  . LEU B 1 222 ? 102.694 72.125  96.640  1.00 33.46  ? 222 LEU B CG  1 
ATOM   6696  C  CD1 . LEU B 1 222 ? 101.473 71.290  96.899  1.00 33.46  ? 222 LEU B CD1 1 
ATOM   6697  C  CD2 . LEU B 1 222 ? 102.639 73.410  97.434  1.00 33.46  ? 222 LEU B CD2 1 
ATOM   6698  N  N   . ILE B 1 223 ? 107.429 71.140  96.629  1.00 35.41  ? 223 ILE B N   1 
ATOM   6699  C  CA  . ILE B 1 223 ? 108.625 70.464  97.112  1.00 35.41  ? 223 ILE B CA  1 
ATOM   6700  C  C   . ILE B 1 223 ? 109.403 71.393  98.049  1.00 35.41  ? 223 ILE B C   1 
ATOM   6701  O  O   . ILE B 1 223 ? 109.833 70.905  99.100  1.00 35.41  ? 223 ILE B O   1 
ATOM   6702  C  CB  . ILE B 1 223 ? 109.480 69.941  95.942  1.00 35.41  ? 223 ILE B CB  1 
ATOM   6703  C  CG1 . ILE B 1 223 ? 108.806 68.758  95.269  1.00 35.41  ? 223 ILE B CG1 1 
ATOM   6704  C  CG2 . ILE B 1 223 ? 110.861 69.537  96.382  1.00 35.41  ? 223 ILE B CG2 1 
ATOM   6705  C  CD1 . ILE B 1 223 ? 109.545 68.285  94.042  1.00 35.41  ? 223 ILE B CD1 1 
ATOM   6706  N  N   . PRO B 1 224 ? 109.556 72.714  97.807  1.00 36.73  ? 224 PRO B N   1 
ATOM   6707  C  CA  . PRO B 1 224 ? 110.105 73.560  98.883  1.00 36.73  ? 224 PRO B CA  1 
ATOM   6708  C  C   . PRO B 1 224 ? 109.249 73.640  100.128 1.00 36.73  ? 224 PRO B C   1 
ATOM   6709  O  O   . PRO B 1 224 ? 109.795 73.796  101.221 1.00 36.73  ? 224 PRO B O   1 
ATOM   6710  C  CB  . PRO B 1 224 ? 110.248 74.917  98.205  1.00 36.73  ? 224 PRO B CB  1 
ATOM   6711  C  CG  . PRO B 1 224 ? 110.567 74.573  96.855  1.00 36.73  ? 224 PRO B CG  1 
ATOM   6712  C  CD  . PRO B 1 224 ? 109.644 73.458  96.536  1.00 36.73  ? 224 PRO B CD  1 
ATOM   6713  N  N   . MET B 1 225 ? 107.927 73.614  99.997  1.00 44.04  ? 225 MET B N   1 
ATOM   6714  C  CA  . MET B 1 225 ? 107.083 73.586  101.184 1.00 44.04  ? 225 MET B CA  1 
ATOM   6715  C  C   . MET B 1 225 ? 107.258 72.284  101.954 1.00 44.04  ? 225 MET B C   1 
ATOM   6716  O  O   . MET B 1 225 ? 107.289 72.274  103.187 1.00 44.04  ? 225 MET B O   1 
ATOM   6717  C  CB  . MET B 1 225 ? 105.621 73.794  100.815 1.00 44.04  ? 225 MET B CB  1 
ATOM   6718  C  CG  . MET B 1 225 ? 105.286 75.219  100.463 1.00 44.04  ? 225 MET B CG  1 
ATOM   6719  S  SD  . MET B 1 225 ? 105.357 76.244  101.932 1.00 44.04  ? 225 MET B SD  1 
ATOM   6720  C  CE  . MET B 1 225 ? 104.405 75.247  103.075 1.00 44.04  ? 225 MET B CE  1 
ATOM   6721  N  N   . ALA B 1 226 ? 107.361 71.166  101.237 1.00 40.14  ? 226 ALA B N   1 
ATOM   6722  C  CA  . ALA B 1 226 ? 107.517 69.880  101.907 1.00 40.14  ? 226 ALA B CA  1 
ATOM   6723  C  C   . ALA B 1 226 ? 108.915 69.690  102.486 1.00 40.14  ? 226 ALA B C   1 
ATOM   6724  O  O   . ALA B 1 226 ? 109.066 69.158  103.589 1.00 40.14  ? 226 ALA B O   1 
ATOM   6725  C  CB  . ALA B 1 226 ? 107.192 68.749  100.939 1.00 40.14  ? 226 ALA B CB  1 
ATOM   6726  N  N   . VAL B 1 227 ? 109.950 70.124  101.767 1.00 39.97  ? 227 VAL B N   1 
ATOM   6727  C  CA  . VAL B 1 227 ? 111.308 69.941  102.268 1.00 39.97  ? 227 VAL B CA  1 
ATOM   6728  C  C   . VAL B 1 227 ? 111.604 70.833  103.458 1.00 39.97  ? 227 VAL B C   1 
ATOM   6729  O  O   . VAL B 1 227 ? 112.213 70.371  104.425 1.00 39.97  ? 227 VAL B O   1 
ATOM   6730  C  CB  . VAL B 1 227 ? 112.310 70.151  101.122 1.00 39.97  ? 227 VAL B CB  1 
ATOM   6731  C  CG1 . VAL B 1 227 ? 113.728 70.338  101.617 1.00 39.97  ? 227 VAL B CG1 1 
ATOM   6732  C  CG2 . VAL B 1 227 ? 112.266 68.948  100.211 1.00 39.97  ? 227 VAL B CG2 1 
ATOM   6733  N  N   . ILE B 1 228 ? 111.155 72.077  103.448 1.00 41.34  ? 228 ILE B N   1 
ATOM   6734  C  CA  . ILE B 1 228 ? 111.302 72.909  104.631 1.00 41.34  ? 228 ILE B CA  1 
ATOM   6735  C  C   . ILE B 1 228 ? 110.361 72.445  105.733 1.00 41.34  ? 228 ILE B C   1 
ATOM   6736  O  O   . ILE B 1 228 ? 110.750 72.354  106.898 1.00 41.34  ? 228 ILE B O   1 
ATOM   6737  C  CB  . ILE B 1 228 ? 111.088 74.385  104.272 1.00 41.34  ? 228 ILE B CB  1 
ATOM   6738  C  CG1 . ILE B 1 228 ? 112.193 74.842  103.332 1.00 41.34  ? 228 ILE B CG1 1 
ATOM   6739  C  CG2 . ILE B 1 228 ? 111.116 75.253  105.504 1.00 41.34  ? 228 ILE B CG2 1 
ATOM   6740  C  CD1 . ILE B 1 228 ? 113.565 74.698  103.902 1.00 41.34  ? 228 ILE B CD1 1 
ATOM   6741  N  N   . GLY B 1 229 ? 109.133 72.085  105.388 1.00 46.36  ? 229 GLY B N   1 
ATOM   6742  C  CA  . GLY B 1 229 ? 108.156 71.728  106.389 1.00 46.36  ? 229 GLY B CA  1 
ATOM   6743  C  C   . GLY B 1 229 ? 108.258 70.331  106.957 1.00 46.36  ? 229 GLY B C   1 
ATOM   6744  O  O   . GLY B 1 229 ? 107.453 69.977  107.824 1.00 46.36  ? 229 GLY B O   1 
ATOM   6745  N  N   . LEU B 1 230 ? 109.181 69.517  106.496 1.00 52.69  ? 230 LEU B N   1 
ATOM   6746  C  CA  . LEU B 1 230 ? 109.280 68.204  107.117 1.00 52.69  ? 230 LEU B CA  1 
ATOM   6747  C  C   . LEU B 1 230 ? 110.111 68.237  108.406 1.00 52.69  ? 230 LEU B C   1 
ATOM   6748  O  O   . LEU B 1 230 ? 109.674 67.642  109.395 1.00 52.69  ? 230 LEU B O   1 
ATOM   6749  C  CB  . LEU B 1 230 ? 109.809 67.170  106.118 1.00 52.69  ? 230 LEU B CB  1 
ATOM   6750  C  CG  . LEU B 1 230 ? 109.869 65.718  106.564 1.00 52.69  ? 230 LEU B CG  1 
ATOM   6751  C  CD1 . LEU B 1 230 ? 108.518 65.311  107.076 1.00 52.69  ? 230 LEU B CD1 1 
ATOM   6752  C  CD2 . LEU B 1 230 ? 110.297 64.827  105.412 1.00 52.69  ? 230 LEU B CD2 1 
ATOM   6753  N  N   . PRO B 1 231 ? 111.281 68.900  108.486 1.00 62.30  ? 231 PRO B N   1 
ATOM   6754  C  CA  . PRO B 1 231 ? 111.898 69.076  109.807 1.00 62.30  ? 231 PRO B CA  1 
ATOM   6755  C  C   . PRO B 1 231 ? 111.334 70.222  110.619 1.00 62.30  ? 231 PRO B C   1 
ATOM   6756  O  O   . PRO B 1 231 ? 111.589 70.270  111.828 1.00 62.30  ? 231 PRO B O   1 
ATOM   6757  C  CB  . PRO B 1 231 ? 113.372 69.319  109.475 1.00 62.30  ? 231 PRO B CB  1 
ATOM   6758  C  CG  . PRO B 1 231 ? 113.331 69.994  108.228 1.00 62.30  ? 231 PRO B CG  1 
ATOM   6759  C  CD  . PRO B 1 231 ? 112.265 69.294  107.458 1.00 62.30  ? 231 PRO B CD  1 
ATOM   6760  N  N   . TYR B 1 232 ? 110.593 71.146  110.010 1.00 64.32  ? 232 TYR B N   1 
ATOM   6761  C  CA  . TYR B 1 232 ? 109.981 72.225  110.778 1.00 64.32  ? 232 TYR B CA  1 
ATOM   6762  C  C   . TYR B 1 232 ? 108.901 71.706  111.714 1.00 64.32  ? 232 TYR B C   1 
ATOM   6763  O  O   . TYR B 1 232 ? 108.559 72.363  112.700 1.00 64.32  ? 232 TYR B O   1 
ATOM   6764  C  CB  . TYR B 1 232 ? 109.423 73.283  109.849 1.00 64.32  ? 232 TYR B CB  1 
ATOM   6765  C  CG  . TYR B 1 232 ? 109.135 74.570  110.558 1.00 64.32  ? 232 TYR B CG  1 
ATOM   6766  C  CD1 . TYR B 1 232 ? 107.841 74.948  110.850 1.00 64.32  ? 232 TYR B CD1 1 
ATOM   6767  C  CD2 . TYR B 1 232 ? 110.163 75.405  110.945 1.00 64.32  ? 232 TYR B CD2 1 
ATOM   6768  C  CE1 . TYR B 1 232 ? 107.575 76.128  111.494 1.00 64.32  ? 232 TYR B CE1 1 
ATOM   6769  C  CE2 . TYR B 1 232 ? 109.908 76.588  111.593 1.00 64.32  ? 232 TYR B CE2 1 
ATOM   6770  C  CZ  . TYR B 1 232 ? 108.612 76.941  111.867 1.00 64.32  ? 232 TYR B CZ  1 
ATOM   6771  O  OH  . TYR B 1 232 ? 108.348 78.122  112.513 1.00 64.32  ? 232 TYR B OH  1 
ATOM   6772  N  N   . TYR B 1 233 ? 108.320 70.564  111.399 1.00 68.81  ? 233 TYR B N   1 
ATOM   6773  C  CA  . TYR B 1 233 ? 107.324 69.969  112.272 1.00 68.81  ? 233 TYR B CA  1 
ATOM   6774  C  C   . TYR B 1 233 ? 107.949 68.919  113.180 1.00 68.81  ? 233 TYR B C   1 
ATOM   6775  O  O   . TYR B 1 233 ? 107.563 68.799  114.345 1.00 68.81  ? 233 TYR B O   1 
ATOM   6776  C  CB  . TYR B 1 233 ? 106.204 69.354  111.443 1.00 68.81  ? 233 TYR B CB  1 
ATOM   6777  C  CG  . TYR B 1 233 ? 105.244 68.521  112.234 1.00 68.81  ? 233 TYR B CG  1 
ATOM   6778  C  CD1 . TYR B 1 233 ? 104.422 69.101  113.183 1.00 68.81  ? 233 TYR B CD1 1 
ATOM   6779  C  CD2 . TYR B 1 233 ? 105.152 67.156  112.028 1.00 68.81  ? 233 TYR B CD2 1 
ATOM   6780  C  CE1 . TYR B 1 233 ? 103.536 68.346  113.907 1.00 68.81  ? 233 TYR B CE1 1 
ATOM   6781  C  CE2 . TYR B 1 233 ? 104.272 66.391  112.749 1.00 68.81  ? 233 TYR B CE2 1 
ATOM   6782  C  CZ  . TYR B 1 233 ? 103.464 66.991  113.688 1.00 68.81  ? 233 TYR B CZ  1 
ATOM   6783  O  OH  . TYR B 1 233 ? 102.577 66.232  114.416 1.00 68.81  ? 233 TYR B OH  1 
ATOM   6784  N  N   . LEU B 1 234 ? 108.905 68.148  112.661 1.00 71.77  ? 234 LEU B N   1 
ATOM   6785  C  CA  . LEU B 1 234 ? 109.521 67.085  113.449 1.00 71.77  ? 234 LEU B CA  1 
ATOM   6786  C  C   . LEU B 1 234 ? 110.482 67.629  114.496 1.00 71.77  ? 234 LEU B C   1 
ATOM   6787  O  O   . LEU B 1 234 ? 110.408 67.236  115.663 1.00 71.77  ? 234 LEU B O   1 
ATOM   6788  C  CB  . LEU B 1 234 ? 110.236 66.088  112.548 1.00 71.77  ? 234 LEU B CB  1 
ATOM   6789  C  CG  . LEU B 1 234 ? 109.301 65.226  111.710 1.00 71.77  ? 234 LEU B CG  1 
ATOM   6790  C  CD1 . LEU B 1 234 ? 110.100 64.281  110.850 1.00 71.77  ? 234 LEU B CD1 1 
ATOM   6791  C  CD2 . LEU B 1 234 ? 108.348 64.460  112.595 1.00 71.77  ? 234 LEU B CD2 1 
ATOM   6792  N  N   . PHE B 1 235 ? 111.384 68.528  114.121 1.00 83.60  ? 235 PHE B N   1 
ATOM   6793  C  CA  . PHE B 1 235 ? 112.363 69.009  115.085 1.00 83.60  ? 235 PHE B CA  1 
ATOM   6794  C  C   . PHE B 1 235 ? 111.854 70.135  115.961 1.00 83.60  ? 235 PHE B C   1 
ATOM   6795  O  O   . PHE B 1 235 ? 112.602 70.582  116.832 1.00 83.60  ? 235 PHE B O   1 
ATOM   6796  C  CB  . PHE B 1 235 ? 113.638 69.488  114.392 1.00 83.60  ? 235 PHE B CB  1 
ATOM   6797  C  CG  . PHE B 1 235 ? 114.451 68.396  113.793 1.00 83.60  ? 235 PHE B CG  1 
ATOM   6798  C  CD1 . PHE B 1 235 ? 114.292 67.085  114.205 1.00 83.60  ? 235 PHE B CD1 1 
ATOM   6799  C  CD2 . PHE B 1 235 ? 115.417 68.688  112.850 1.00 83.60  ? 235 PHE B CD2 1 
ATOM   6800  C  CE1 . PHE B 1 235 ? 115.051 66.077  113.651 1.00 83.60  ? 235 PHE B CE1 1 
ATOM   6801  C  CE2 . PHE B 1 235 ? 116.185 67.689  112.294 1.00 83.60  ? 235 PHE B CE2 1 
ATOM   6802  C  CZ  . PHE B 1 235 ? 116.002 66.381  112.695 1.00 83.60  ? 235 PHE B CZ  1 
ATOM   6803  N  N   . VAL B 1 236 ? 110.590 70.539  115.794 1.00 84.12  ? 236 VAL B N   1 
ATOM   6804  C  CA  . VAL B 1 236 ? 109.917 71.693  116.399 1.00 84.12  ? 236 VAL B CA  1 
ATOM   6805  C  C   . VAL B 1 236 ? 110.840 72.911  116.547 1.00 84.12  ? 236 VAL B C   1 
ATOM   6806  O  O   . VAL B 1 236 ? 111.395 73.202  117.611 1.00 84.12  ? 236 VAL B O   1 
ATOM   6807  C  CB  . VAL B 1 236 ? 109.172 71.269  117.699 1.00 84.12  ? 236 VAL B CB  1 
ATOM   6808  C  CG1 . VAL B 1 236 ? 110.041 70.643  118.831 1.00 84.12  ? 236 VAL B CG1 1 
ATOM   6809  C  CG2 . VAL B 1 236 ? 108.307 72.403  118.227 1.00 84.12  ? 236 VAL B CG2 1 
ATOM   6810  N  N   . TRP B 1 237 ? 111.020 73.625  115.444 1.00 88.97  ? 237 TRP B N   1 
ATOM   6811  C  CA  . TRP B 1 237 ? 111.789 74.857  115.407 1.00 88.97  ? 237 TRP B CA  1 
ATOM   6812  C  C   . TRP B 1 237 ? 110.937 76.073  115.686 1.00 88.97  ? 237 TRP B C   1 
ATOM   6813  O  O   . TRP B 1 237 ? 111.372 77.196  115.430 1.00 88.97  ? 237 TRP B O   1 
ATOM   6814  C  CB  . TRP B 1 237 ? 112.470 75.039  114.058 1.00 88.97  ? 237 TRP B CB  1 
ATOM   6815  C  CG  . TRP B 1 237 ? 113.564 74.109  113.797 1.00 88.97  ? 237 TRP B CG  1 
ATOM   6816  C  CD1 . TRP B 1 237 ? 114.128 73.244  114.671 1.00 88.97  ? 237 TRP B CD1 1 
ATOM   6817  C  CD2 . TRP B 1 237 ? 114.259 73.957  112.568 1.00 88.97  ? 237 TRP B CD2 1 
ATOM   6818  N  NE1 . TRP B 1 237 ? 115.131 72.544  114.057 1.00 88.97  ? 237 TRP B NE1 1 
ATOM   6819  C  CE2 . TRP B 1 237 ? 115.230 72.968  112.759 1.00 88.97  ? 237 TRP B CE2 1 
ATOM   6820  C  CE3 . TRP B 1 237 ? 114.147 74.559  111.316 1.00 88.97  ? 237 TRP B CE3 1 
ATOM   6821  C  CZ2 . TRP B 1 237 ? 116.088 72.566  111.748 1.00 88.97  ? 237 TRP B CZ2 1 
ATOM   6822  C  CZ3 . TRP B 1 237 ? 114.995 74.160  110.314 1.00 88.97  ? 237 TRP B CZ3 1 
ATOM   6823  C  CH2 . TRP B 1 237 ? 115.954 73.173  110.533 1.00 88.97  ? 237 TRP B CH2 1 
ATOM   6824  N  N   . GLU B 1 238 ? 109.751 75.881  116.239 1.00 87.55  ? 238 GLU B N   1 
ATOM   6825  C  CA  . GLU B 1 238 ? 108.892 76.980  116.632 1.00 87.55  ? 238 GLU B CA  1 
ATOM   6826  C  C   . GLU B 1 238 ? 109.432 77.729  117.835 1.00 87.55  ? 238 GLU B C   1 
ATOM   6827  O  O   . GLU B 1 238 ? 108.954 78.824  118.138 1.00 87.55  ? 238 GLU B O   1 
ATOM   6828  C  CB  . GLU B 1 238 ? 107.516 76.413  116.947 1.00 87.55  ? 238 GLU B CB  1 
ATOM   6829  C  CG  . GLU B 1 238 ? 107.224 75.201  116.088 1.00 87.55  ? 238 GLU B CG  1 
ATOM   6830  C  CD  . GLU B 1 238 ? 105.933 74.526  116.442 1.00 87.55  ? 238 GLU B CD  1 
ATOM   6831  O  OE1 . GLU B 1 238 ? 105.254 74.988  117.380 1.00 87.55  ? 238 GLU B OE1 1 
ATOM   6832  O  OE2 . GLU B 1 238 ? 105.598 73.522  115.785 1.00 87.55  ? 238 GLU B OE2 1 
ATOM   6833  N  N   . ASP B 1 239 ? 110.410 77.155  118.533 1.00 100.43 ? 239 ASP B N   1 
ATOM   6834  C  CA  . ASP B 1 239 ? 111.008 77.833  119.670 1.00 100.43 ? 239 ASP B CA  1 
ATOM   6835  C  C   . ASP B 1 239 ? 111.925 78.960  119.222 1.00 100.43 ? 239 ASP B C   1 
ATOM   6836  O  O   . ASP B 1 239 ? 111.982 80.010  119.870 1.00 100.43 ? 239 ASP B O   1 
ATOM   6837  C  CB  . ASP B 1 239 ? 111.795 76.824  120.498 1.00 100.43 ? 239 ASP B CB  1 
ATOM   6838  C  CG  . ASP B 1 239 ? 110.928 75.710  121.019 1.00 100.43 ? 239 ASP B CG  1 
ATOM   6839  O  OD1 . ASP B 1 239 ? 109.725 75.951  121.245 1.00 100.43 ? 239 ASP B OD1 1 
ATOM   6840  O  OD2 . ASP B 1 239 ? 111.441 74.584  121.176 1.00 100.43 ? 239 ASP B OD2 1 
ATOM   6841  N  N   . TYR B 1 240 ? 112.644 78.762  118.118 1.00 99.63  ? 240 TYR B N   1 
ATOM   6842  C  CA  . TYR B 1 240 ? 113.733 79.668  117.785 1.00 99.63  ? 240 TYR B CA  1 
ATOM   6843  C  C   . TYR B 1 240 ? 113.254 80.883  117.001 1.00 99.63  ? 240 TYR B C   1 
ATOM   6844  O  O   . TYR B 1 240 ? 113.616 82.016  117.328 1.00 99.63  ? 240 TYR B O   1 
ATOM   6845  C  CB  . TYR B 1 240 ? 114.812 78.937  116.981 1.00 99.63  ? 240 TYR B CB  1 
ATOM   6846  C  CG  . TYR B 1 240 ? 115.358 77.682  117.624 1.00 99.63  ? 240 TYR B CG  1 
ATOM   6847  C  CD1 . TYR B 1 240 ? 115.512 77.575  119.001 1.00 99.63  ? 240 TYR B CD1 1 
ATOM   6848  C  CD2 . TYR B 1 240 ? 115.739 76.603  116.838 1.00 99.63  ? 240 TYR B CD2 1 
ATOM   6849  C  CE1 . TYR B 1 240 ? 116.008 76.413  119.575 1.00 99.63  ? 240 TYR B CE1 1 
ATOM   6850  C  CE2 . TYR B 1 240 ? 116.238 75.445  117.401 1.00 99.63  ? 240 TYR B CE2 1 
ATOM   6851  C  CZ  . TYR B 1 240 ? 116.371 75.354  118.765 1.00 99.63  ? 240 TYR B CZ  1 
ATOM   6852  O  OH  . TYR B 1 240 ? 116.869 74.193  119.308 1.00 99.63  ? 240 TYR B OH  1 
ATOM   6853  N  N   . ASP B 1 241 ? 112.460 80.663  115.953 1.00 87.48  ? 241 ASP B N   1 
ATOM   6854  C  CA  . ASP B 1 241 ? 111.965 81.761  115.132 1.00 87.48  ? 241 ASP B CA  1 
ATOM   6855  C  C   . ASP B 1 241 ? 110.646 82.326  115.622 1.00 87.48  ? 241 ASP B C   1 
ATOM   6856  O  O   . ASP B 1 241 ? 110.321 83.468  115.278 1.00 87.48  ? 241 ASP B O   1 
ATOM   6857  C  CB  . ASP B 1 241 ? 111.785 81.317  113.680 1.00 87.48  ? 241 ASP B CB  1 
ATOM   6858  C  CG  . ASP B 1 241 ? 110.526 80.510  113.475 1.00 87.48  ? 241 ASP B CG  1 
ATOM   6859  O  OD1 . ASP B 1 241 ? 110.299 79.559  114.248 1.00 87.48  ? 241 ASP B OD1 1 
ATOM   6860  O  OD2 . ASP B 1 241 ? 109.749 80.841  112.555 1.00 87.48  ? 241 ASP B OD2 1 
ATOM   6861  N  N   . LYS B 1 242 ? 109.907 81.550  116.410 1.00 83.01  ? 242 LYS B N   1 
ATOM   6862  C  CA  . LYS B 1 242 ? 108.568 81.872  116.899 1.00 83.01  ? 242 LYS B CA  1 
ATOM   6863  C  C   . LYS B 1 242 ? 107.614 82.220  115.755 1.00 83.01  ? 242 LYS B C   1 
ATOM   6864  O  O   . LYS B 1 242 ? 107.004 83.286  115.720 1.00 83.01  ? 242 LYS B O   1 
ATOM   6865  C  CB  . LYS B 1 242 ? 108.610 82.990  117.940 1.00 83.01  ? 242 LYS B CB  1 
ATOM   6866  N  N   . TYR B 1 243 ? 107.544 81.310  114.780 1.00 69.43  ? 243 TYR B N   1 
ATOM   6867  C  CA  . TYR B 1 243 ? 106.553 81.245  113.704 1.00 69.43  ? 243 TYR B CA  1 
ATOM   6868  C  C   . TYR B 1 243 ? 106.598 82.401  112.719 1.00 69.43  ? 243 TYR B C   1 
ATOM   6869  O  O   . TYR B 1 243 ? 105.682 82.511  111.914 1.00 69.43  ? 243 TYR B O   1 
ATOM   6870  C  CB  . TYR B 1 243 ? 105.116 81.153  114.226 1.00 69.43  ? 243 TYR B CB  1 
ATOM   6871  C  CG  . TYR B 1 243 ? 104.679 79.783  114.624 1.00 69.43  ? 243 TYR B CG  1 
ATOM   6872  C  CD1 . TYR B 1 243 ? 105.014 78.679  113.867 1.00 69.43  ? 243 TYR B CD1 1 
ATOM   6873  C  CD2 . TYR B 1 243 ? 103.864 79.601  115.727 1.00 69.43  ? 243 TYR B CD2 1 
ATOM   6874  C  CE1 . TYR B 1 243 ? 104.581 77.420  114.227 1.00 69.43  ? 243 TYR B CE1 1 
ATOM   6875  C  CE2 . TYR B 1 243 ? 103.427 78.356  116.090 1.00 69.43  ? 243 TYR B CE2 1 
ATOM   6876  C  CZ  . TYR B 1 243 ? 103.784 77.271  115.342 1.00 69.43  ? 243 TYR B CZ  1 
ATOM   6877  O  OH  . TYR B 1 243 ? 103.335 76.035  115.725 1.00 69.43  ? 243 TYR B OH  1 
ATOM   6878  N  N   . VAL B 1 244 ? 107.603 83.261  112.748 1.00 69.38  ? 244 VAL B N   1 
ATOM   6879  C  CA  . VAL B 1 244 ? 107.617 84.396  111.832 1.00 69.38  ? 244 VAL B CA  1 
ATOM   6880  C  C   . VAL B 1 244 ? 108.272 84.064  110.499 1.00 69.38  ? 244 VAL B C   1 
ATOM   6881  O  O   . VAL B 1 244 ? 107.750 84.445  109.451 1.00 69.38  ? 244 VAL B O   1 
ATOM   6882  C  CB  . VAL B 1 244 ? 108.300 85.593  112.517 1.00 69.38  ? 244 VAL B CB  1 
ATOM   6883  C  CG1 . VAL B 1 244 ? 108.412 86.775  111.576 1.00 69.38  ? 244 VAL B CG1 1 
ATOM   6884  C  CG2 . VAL B 1 244 ? 107.523 85.992  113.750 1.00 69.38  ? 244 VAL B CG2 1 
ATOM   6885  N  N   . ILE B 1 245 ? 109.381 83.320  110.492 1.00 62.88  ? 245 ILE B N   1 
ATOM   6886  C  CA  . ILE B 1 245 ? 110.067 83.037  109.232 1.00 62.88  ? 245 ILE B CA  1 
ATOM   6887  C  C   . ILE B 1 245 ? 109.260 82.082  108.371 1.00 62.88  ? 245 ILE B C   1 
ATOM   6888  O  O   . ILE B 1 245 ? 109.062 82.331  107.177 1.00 62.88  ? 245 ILE B O   1 
ATOM   6889  C  CB  . ILE B 1 245 ? 111.476 82.488  109.502 1.00 62.88  ? 245 ILE B CB  1 
ATOM   6890  C  CG1 . ILE B 1 245 ? 112.388 83.601  110.007 1.00 62.88  ? 245 ILE B CG1 1 
ATOM   6891  C  CG2 . ILE B 1 245 ? 112.061 81.851  108.256 1.00 62.88  ? 245 ILE B CG2 1 
ATOM   6892  C  CD1 . ILE B 1 245 ? 113.792 83.127  110.350 1.00 62.88  ? 245 ILE B CD1 1 
ATOM   6893  N  N   . PHE B 1 246 ? 108.717 81.029  108.966 1.00 54.61  ? 246 PHE B N   1 
ATOM   6894  C  CA  . PHE B 1 246 ? 108.085 79.995  108.162 1.00 54.61  ? 246 PHE B CA  1 
ATOM   6895  C  C   . PHE B 1 246 ? 106.754 80.438  107.591 1.00 54.61  ? 246 PHE B C   1 
ATOM   6896  O  O   . PHE B 1 246 ? 106.408 80.044  106.472 1.00 54.61  ? 246 PHE B O   1 
ATOM   6897  C  CB  . PHE B 1 246 ? 107.847 78.728  108.967 1.00 54.61  ? 246 PHE B CB  1 
ATOM   6898  C  CG  . PHE B 1 246 ? 107.279 77.627  108.151 1.00 54.61  ? 246 PHE B CG  1 
ATOM   6899  C  CD1 . PHE B 1 246 ? 107.946 77.184  107.026 1.00 54.61  ? 246 PHE B CD1 1 
ATOM   6900  C  CD2 . PHE B 1 246 ? 106.048 77.098  108.446 1.00 54.61  ? 246 PHE B CD2 1 
ATOM   6901  C  CE1 . PHE B 1 246 ? 107.426 76.183  106.248 1.00 54.61  ? 246 PHE B CE1 1 
ATOM   6902  C  CE2 . PHE B 1 246 ? 105.519 76.101  107.667 1.00 54.61  ? 246 PHE B CE2 1 
ATOM   6903  C  CZ  . PHE B 1 246 ? 106.211 75.640  106.566 1.00 54.61  ? 246 PHE B CZ  1 
ATOM   6904  N  N   . ALA B 1 247 ? 105.985 81.202  108.349 1.00 48.06  ? 247 ALA B N   1 
ATOM   6905  C  CA  . ALA B 1 247 ? 104.730 81.705  107.827 1.00 48.06  ? 247 ALA B CA  1 
ATOM   6906  C  C   . ALA B 1 247 ? 104.994 82.700  106.712 1.00 48.06  ? 247 ALA B C   1 
ATOM   6907  O  O   . ALA B 1 247 ? 104.306 82.683  105.689 1.00 48.06  ? 247 ALA B O   1 
ATOM   6908  C  CB  . ALA B 1 247 ? 103.923 82.374  108.928 1.00 48.06  ? 247 ALA B CB  1 
ATOM   6909  N  N   . SER B 1 248 ? 105.981 83.577  106.908 1.00 44.13  ? 248 SER B N   1 
ATOM   6910  C  CA  . SER B 1 248 ? 106.341 84.526  105.861 1.00 44.13  ? 248 SER B CA  1 
ATOM   6911  C  C   . SER B 1 248 ? 106.906 83.843  104.632 1.00 44.13  ? 248 SER B C   1 
ATOM   6912  O  O   . SER B 1 248 ? 106.647 84.271  103.505 1.00 44.13  ? 248 SER B O   1 
ATOM   6913  C  CB  . SER B 1 248 ? 107.356 85.532  106.384 1.00 44.13  ? 248 SER B CB  1 
ATOM   6914  O  OG  . SER B 1 248 ? 108.303 85.827  105.375 1.00 44.13  ? 248 SER B OG  1 
ATOM   6915  N  N   . PHE B 1 249 ? 107.699 82.794  104.825 1.00 42.37  ? 249 PHE B N   1 
ATOM   6916  C  CA  . PHE B 1 249 ? 108.234 82.074  103.679 1.00 42.37  ? 249 PHE B CA  1 
ATOM   6917  C  C   . PHE B 1 249 ? 107.156 81.355  102.896 1.00 42.37  ? 249 PHE B C   1 
ATOM   6918  O  O   . PHE B 1 249 ? 107.187 81.356  101.668 1.00 42.37  ? 249 PHE B O   1 
ATOM   6919  C  CB  . PHE B 1 249 ? 109.283 81.066  104.112 1.00 42.37  ? 249 PHE B CB  1 
ATOM   6920  C  CG  . PHE B 1 249 ? 109.693 80.137  103.023 1.00 42.37  ? 249 PHE B CG  1 
ATOM   6921  C  CD1 . PHE B 1 249 ? 110.415 80.605  101.951 1.00 42.37  ? 249 PHE B CD1 1 
ATOM   6922  C  CD2 . PHE B 1 249 ? 109.336 78.805  103.057 1.00 42.37  ? 249 PHE B CD2 1 
ATOM   6923  C  CE1 . PHE B 1 249 ? 110.795 79.758  100.940 1.00 42.37  ? 249 PHE B CE1 1 
ATOM   6924  C  CE2 . PHE B 1 249 ? 109.707 77.955  102.046 1.00 42.37  ? 249 PHE B CE2 1 
ATOM   6925  C  CZ  . PHE B 1 249 ? 110.439 78.432  100.987 1.00 42.37  ? 249 PHE B CZ  1 
ATOM   6926  N  N   . ASN B 1 250 ? 106.204 80.733  103.584 1.00 35.53  ? 250 ASN B N   1 
ATOM   6927  C  CA  . ASN B 1 250 ? 105.141 80.016  102.892 1.00 35.53  ? 250 ASN B CA  1 
ATOM   6928  C  C   . ASN B 1 250 ? 104.220 80.927  102.086 1.00 35.53  ? 250 ASN B C   1 
ATOM   6929  O  O   . ASN B 1 250 ? 103.895 80.613  100.937 1.00 35.53  ? 250 ASN B O   1 
ATOM   6930  C  CB  . ASN B 1 250 ? 104.335 79.209  103.892 1.00 35.53  ? 250 ASN B CB  1 
ATOM   6931  C  CG  . ASN B 1 250 ? 102.938 78.971  103.424 1.00 35.53  ? 250 ASN B CG  1 
ATOM   6932  O  OD1 . ASN B 1 250 ? 102.002 79.593  103.909 1.00 35.53  ? 250 ASN B OD1 1 
ATOM   6933  N  ND2 . ASN B 1 250 ? 102.783 78.095  102.446 1.00 35.53  ? 250 ASN B ND2 1 
ATOM   6934  N  N   . LEU B 1 251 ? 103.812 82.064  102.643 1.00 29.62  ? 251 LEU B N   1 
ATOM   6935  C  CA  . LEU B 1 251 ? 102.846 82.908  101.944 1.00 29.62  ? 251 LEU B CA  1 
ATOM   6936  C  C   . LEU B 1 251 ? 103.475 83.639  100.771 1.00 29.62  ? 251 LEU B C   1 
ATOM   6937  O  O   . LEU B 1 251 ? 102.834 83.805  99.732  1.00 29.62  ? 251 LEU B O   1 
ATOM   6938  C  CB  . LEU B 1 251 ? 102.172 83.861  102.911 1.00 29.62  ? 251 LEU B CB  1 
ATOM   6939  C  CG  . LEU B 1 251 ? 101.489 83.014  103.977 1.00 29.62  ? 251 LEU B CG  1 
ATOM   6940  C  CD1 . LEU B 1 251 ? 101.112 83.853  105.169 1.00 29.62  ? 251 LEU B CD1 1 
ATOM   6941  C  CD2 . LEU B 1 251 ? 100.264 82.351  103.394 1.00 29.62  ? 251 LEU B CD2 1 
ATOM   6942  N  N   . ILE B 1 252 ? 104.699 84.130  100.933 1.00 29.72  ? 252 ILE B N   1 
ATOM   6943  C  CA  . ILE B 1 252 ? 105.421 84.729  99.816  1.00 29.72  ? 252 ILE B CA  1 
ATOM   6944  C  C   . ILE B 1 252 ? 105.703 83.694  98.732  1.00 29.72  ? 252 ILE B C   1 
ATOM   6945  O  O   . ILE B 1 252 ? 105.637 84.003  97.536  1.00 29.72  ? 252 ILE B O   1 
ATOM   6946  C  CB  . ILE B 1 252 ? 106.692 85.418  100.329 1.00 29.72  ? 252 ILE B CB  1 
ATOM   6947  C  CG1 . ILE B 1 252 ? 106.289 86.589  101.214 1.00 29.72  ? 252 ILE B CG1 1 
ATOM   6948  C  CG2 . ILE B 1 252 ? 107.590 85.883  99.203  1.00 29.72  ? 252 ILE B CG2 1 
ATOM   6949  C  CD1 . ILE B 1 252 ? 107.452 87.362  101.751 1.00 29.72  ? 252 ILE B CD1 1 
ATOM   6950  N  N   . TRP B 1 253 ? 105.933 82.443  99.115  1.00 30.36  ? 253 TRP B N   1 
ATOM   6951  C  CA  . TRP B 1 253 ? 106.200 81.406  98.126  1.00 30.36  ? 253 TRP B CA  1 
ATOM   6952  C  C   . TRP B 1 253 ? 104.980 81.053  97.290  1.00 30.36  ? 253 TRP B C   1 
ATOM   6953  O  O   . TRP B 1 253 ? 105.135 80.715  96.113  1.00 30.36  ? 253 TRP B O   1 
ATOM   6954  C  CB  . TRP B 1 253 ? 106.698 80.142  98.786  1.00 30.36  ? 253 TRP B CB  1 
ATOM   6955  C  CG  . TRP B 1 253 ? 107.063 79.112  97.835  1.00 30.36  ? 253 TRP B CG  1 
ATOM   6956  C  CD1 . TRP B 1 253 ? 106.460 77.919  97.680  1.00 30.36  ? 253 TRP B CD1 1 
ATOM   6957  C  CD2 . TRP B 1 253 ? 108.164 79.134  96.931  1.00 30.36  ? 253 TRP B CD2 1 
ATOM   6958  N  NE1 . TRP B 1 253 ? 107.088 77.198  96.705  1.00 30.36  ? 253 TRP B NE1 1 
ATOM   6959  C  CE2 . TRP B 1 253 ? 108.146 77.922  96.233  1.00 30.36  ? 253 TRP B CE2 1 
ATOM   6960  C  CE3 . TRP B 1 253 ? 109.158 80.062  96.637  1.00 30.36  ? 253 TRP B CE3 1 
ATOM   6961  C  CZ2 . TRP B 1 253 ? 109.079 77.612  95.256  1.00 30.36  ? 253 TRP B CZ2 1 
ATOM   6962  C  CZ3 . TRP B 1 253 ? 110.081 79.754  95.668  1.00 30.36  ? 253 TRP B CZ3 1 
ATOM   6963  C  CH2 . TRP B 1 253 ? 110.037 78.540  94.989  1.00 30.36  ? 253 TRP B CH2 1 
ATOM   6964  N  N   . SER B 1 254 ? 103.775 81.114  97.852  1.00 23.39  ? 254 SER B N   1 
ATOM   6965  C  CA  . SER B 1 254 ? 102.594 80.824  97.043  1.00 23.39  ? 254 SER B CA  1 
ATOM   6966  C  C   . SER B 1 254 ? 102.373 81.889  95.977  1.00 23.39  ? 254 SER B C   1 
ATOM   6967  O  O   . SER B 1 254 ? 101.908 81.576  94.879  1.00 23.39  ? 254 SER B O   1 
ATOM   6968  C  CB  . SER B 1 254 ? 101.354 80.699  97.909  1.00 23.39  ? 254 SER B CB  1 
ATOM   6969  O  OG  . SER B 1 254 ? 101.019 81.948  98.456  1.00 23.39  ? 254 SER B OG  1 
ATOM   6970  N  N   . THR B 1 255 ? 102.647 83.150  96.288  1.00 22.31  ? 255 THR B N   1 
ATOM   6971  C  CA  . THR B 1 255 ? 102.539 84.191  95.273  1.00 22.31  ? 255 THR B CA  1 
ATOM   6972  C  C   . THR B 1 255 ? 103.591 84.050  94.187  1.00 22.31  ? 255 THR B C   1 
ATOM   6973  O  O   . THR B 1 255 ? 103.313 84.333  93.019  1.00 22.31  ? 255 THR B O   1 
ATOM   6974  C  CB  . THR B 1 255 ? 102.640 85.556  95.908  1.00 22.31  ? 255 THR B CB  1 
ATOM   6975  O  OG1 . THR B 1 255 ? 101.896 85.539  97.119  1.00 22.31  ? 255 THR B OG1 1 
ATOM   6976  C  CG2 . THR B 1 255 ? 102.020 86.571  95.003  1.00 22.31  ? 255 THR B CG2 1 
ATOM   6977  N  N   . VAL B 1 256 ? 104.806 83.647  94.546  1.00 20.25  ? 256 VAL B N   1 
ATOM   6978  C  CA  . VAL B 1 256 ? 105.861 83.509  93.547  1.00 20.25  ? 256 VAL B CA  1 
ATOM   6979  C  C   . VAL B 1 256 ? 105.550 82.385  92.567  1.00 20.25  ? 256 VAL B C   1 
ATOM   6980  O  O   . VAL B 1 256 ? 105.751 82.539  91.356  1.00 20.25  ? 256 VAL B O   1 
ATOM   6981  C  CB  . VAL B 1 256 ? 107.216 83.330  94.240  1.00 20.25  ? 256 VAL B CB  1 
ATOM   6982  C  CG1 . VAL B 1 256 ? 108.231 82.687  93.332  1.00 20.25  ? 256 VAL B CG1 1 
ATOM   6983  C  CG2 . VAL B 1 256 ? 107.716 84.676  94.660  1.00 20.25  ? 256 VAL B CG2 1 
ATOM   6984  N  N   . ILE B 1 257 ? 105.002 81.269  93.043  1.00 20.38  ? 257 ILE B N   1 
ATOM   6985  C  CA  . ILE B 1 257 ? 104.686 80.215  92.088  1.00 20.38  ? 257 ILE B CA  1 
ATOM   6986  C  C   . ILE B 1 257 ? 103.462 80.578  91.264  1.00 20.38  ? 257 ILE B C   1 
ATOM   6987  O  O   . ILE B 1 257 ? 103.355 80.162  90.110  1.00 20.38  ? 257 ILE B O   1 
ATOM   6988  C  CB  . ILE B 1 257 ? 104.524 78.859  92.774  1.00 20.38  ? 257 ILE B CB  1 
ATOM   6989  C  CG1 . ILE B 1 257 ? 103.354 78.869  93.737  1.00 20.38  ? 257 ILE B CG1 1 
ATOM   6990  C  CG2 . ILE B 1 257 ? 105.770 78.563  93.522  1.00 20.38  ? 257 ILE B CG2 1 
ATOM   6991  C  CD1 . ILE B 1 257 ? 102.959 77.528  94.227  1.00 20.38  ? 257 ILE B CD1 1 
ATOM   6992  N  N   . LEU B 1 258 ? 102.523 81.346  91.809  1.00 18.96  ? 258 LEU B N   1 
ATOM   6993  C  CA  . LEU B 1 258 ? 101.398 81.761  90.991  1.00 18.96  ? 258 LEU B CA  1 
ATOM   6994  C  C   . LEU B 1 258 ? 101.745 82.887  90.036  1.00 18.96  ? 258 LEU B C   1 
ATOM   6995  O  O   . LEU B 1 258 ? 100.949 83.177  89.145  1.00 18.96  ? 258 LEU B O   1 
ATOM   6996  C  CB  . LEU B 1 258 ? 100.223 82.168  91.850  1.00 18.96  ? 258 LEU B CB  1 
ATOM   6997  C  CG  . LEU B 1 258 ? 99.544  80.923  92.372  1.00 18.96  ? 258 LEU B CG  1 
ATOM   6998  C  CD1 . LEU B 1 258 ? 98.413  81.326  93.265  1.00 18.96  ? 258 LEU B CD1 1 
ATOM   6999  C  CD2 . LEU B 1 258 ? 99.060  80.085  91.224  1.00 18.96  ? 258 LEU B CD2 1 
ATOM   7000  N  N   . GLU B 1 259 ? 102.873 83.561  90.213  1.00 23.29  ? 259 GLU B N   1 
ATOM   7001  C  CA  . GLU B 1 259 ? 103.286 84.463  89.155  1.00 23.29  ? 259 GLU B CA  1 
ATOM   7002  C  C   . GLU B 1 259 ? 104.189 83.783  88.153  1.00 23.29  ? 259 GLU B C   1 
ATOM   7003  O  O   . GLU B 1 259 ? 104.052 84.018  86.952  1.00 23.29  ? 259 GLU B O   1 
ATOM   7004  C  CB  . GLU B 1 259 ? 103.986 85.686  89.721  1.00 23.29  ? 259 GLU B CB  1 
ATOM   7005  C  CG  . GLU B 1 259 ? 103.039 86.823  89.972  1.00 23.29  ? 259 GLU B CG  1 
ATOM   7006  C  CD  . GLU B 1 259 ? 102.688 87.572  88.692  1.00 23.29  ? 259 GLU B CD  1 
ATOM   7007  O  OE1 . GLU B 1 259 ? 103.436 87.442  87.705  1.00 23.29  ? 259 GLU B OE1 1 
ATOM   7008  O  OE2 . GLU B 1 259 ? 101.672 88.301  88.665  1.00 23.29  ? 259 GLU B OE2 1 
ATOM   7009  N  N   . LEU B 1 260 ? 105.083 82.912  88.607  1.00 20.28  ? 260 LEU B N   1 
ATOM   7010  C  CA  . LEU B 1 260 ? 105.912 82.188  87.660  1.00 20.28  ? 260 LEU B CA  1 
ATOM   7011  C  C   . LEU B 1 260 ? 105.128 81.165  86.870  1.00 20.28  ? 260 LEU B C   1 
ATOM   7012  O  O   . LEU B 1 260 ? 105.606 80.724  85.824  1.00 20.28  ? 260 LEU B O   1 
ATOM   7013  C  CB  . LEU B 1 260 ? 107.068 81.484  88.345  1.00 20.28  ? 260 LEU B CB  1 
ATOM   7014  C  CG  . LEU B 1 260 ? 108.134 82.291  89.043  1.00 20.28  ? 260 LEU B CG  1 
ATOM   7015  C  CD1 . LEU B 1 260 ? 109.261 81.363  89.383  1.00 20.28  ? 260 LEU B CD1 1 
ATOM   7016  C  CD2 . LEU B 1 260 ? 108.603 83.355  88.109  1.00 20.28  ? 260 LEU B CD2 1 
ATOM   7017  N  N   . TRP B 1 261 ? 103.963 80.743  87.351  1.00 18.37  ? 261 TRP B N   1 
ATOM   7018  C  CA  . TRP B 1 261 ? 103.117 79.948  86.479  1.00 18.37  ? 261 TRP B CA  1 
ATOM   7019  C  C   . TRP B 1 261 ? 102.580 80.770  85.318  1.00 18.37  ? 261 TRP B C   1 
ATOM   7020  O  O   . TRP B 1 261 ? 102.535 80.276  84.187  1.00 18.37  ? 261 TRP B O   1 
ATOM   7021  C  CB  . TRP B 1 261 ? 101.957 79.328  87.240  1.00 18.37  ? 261 TRP B CB  1 
ATOM   7022  C  CG  . TRP B 1 261 ? 100.929 78.885  86.305  1.00 18.37  ? 261 TRP B CG  1 
ATOM   7023  C  CD1 . TRP B 1 261 ? 99.709  79.422  86.127  1.00 18.37  ? 261 TRP B CD1 1 
ATOM   7024  C  CD2 . TRP B 1 261 ? 101.039 77.815  85.376  1.00 18.37  ? 261 TRP B CD2 1 
ATOM   7025  N  NE1 . TRP B 1 261 ? 99.041  78.757  85.142  1.00 18.37  ? 261 TRP B NE1 1 
ATOM   7026  C  CE2 . TRP B 1 261 ? 99.844  77.761  84.667  1.00 18.37  ? 261 TRP B CE2 1 
ATOM   7027  C  CE3 . TRP B 1 261 ? 102.036 76.891  85.080  1.00 18.37  ? 261 TRP B CE3 1 
ATOM   7028  C  CZ2 . TRP B 1 261 ? 99.614  76.828  83.685  1.00 18.37  ? 261 TRP B CZ2 1 
ATOM   7029  C  CZ3 . TRP B 1 261 ? 101.806 75.968  84.105  1.00 18.37  ? 261 TRP B CZ3 1 
ATOM   7030  C  CH2 . TRP B 1 261 ? 100.609 75.939  83.418  1.00 18.37  ? 261 TRP B CH2 1 
ATOM   7031  N  N   . LYS B 1 262 ? 102.197 82.028  85.561  1.00 21.50  ? 262 LYS B N   1 
ATOM   7032  C  CA  . LYS B 1 262 ? 101.724 82.865  84.459  1.00 21.50  ? 262 LYS B CA  1 
ATOM   7033  C  C   . LYS B 1 262 ? 102.815 83.137  83.446  1.00 21.50  ? 262 LYS B C   1 
ATOM   7034  O  O   . LYS B 1 262 ? 102.539 83.203  82.246  1.00 21.50  ? 262 LYS B O   1 
ATOM   7035  C  CB  . LYS B 1 262 ? 101.148 84.185  84.952  1.00 21.50  ? 262 LYS B CB  1 
ATOM   7036  C  CG  . LYS B 1 262 ? 99.758  84.067  85.493  1.00 21.50  ? 262 LYS B CG  1 
ATOM   7037  C  CD  . LYS B 1 262 ? 99.104  85.419  85.565  1.00 21.50  ? 262 LYS B CD  1 
ATOM   7038  C  CE  . LYS B 1 262 ? 99.816  86.341  86.523  1.00 21.50  ? 262 LYS B CE  1 
ATOM   7039  N  NZ  . LYS B 1 262 ? 99.154  87.670  86.561  1.00 21.50  ? 262 LYS B NZ  1 
ATOM   7040  N  N   . ARG B 1 263 ? 104.044 83.297  83.905  1.00 27.19  ? 263 ARG B N   1 
ATOM   7041  C  CA  . ARG B 1 263 ? 105.142 83.441  82.971  1.00 27.19  ? 263 ARG B CA  1 
ATOM   7042  C  C   . ARG B 1 263 ? 105.361 82.151  82.202  1.00 27.19  ? 263 ARG B C   1 
ATOM   7043  O  O   . ARG B 1 263 ? 105.502 82.173  80.977  1.00 27.19  ? 263 ARG B O   1 
ATOM   7044  C  CB  . ARG B 1 263 ? 106.396 83.853  83.726  1.00 27.19  ? 263 ARG B CB  1 
ATOM   7045  C  CG  . ARG B 1 263 ? 106.331 85.269  84.236  1.00 27.19  ? 263 ARG B CG  1 
ATOM   7046  C  CD  . ARG B 1 263 ? 107.475 85.555  85.159  1.00 27.19  ? 263 ARG B CD  1 
ATOM   7047  N  NE  . ARG B 1 263 ? 108.728 85.572  84.438  1.00 27.19  ? 263 ARG B NE  1 
ATOM   7048  C  CZ  . ARG B 1 263 ? 109.255 86.681  83.953  1.00 27.19  ? 263 ARG B CZ  1 
ATOM   7049  N  NH1 . ARG B 1 263 ? 108.619 87.825  84.126  1.00 27.19  ? 263 ARG B NH1 1 
ATOM   7050  N  NH2 . ARG B 1 263 ? 110.403 86.651  83.299  1.00 27.19  ? 263 ARG B NH2 1 
ATOM   7051  N  N   . GLY B 1 264 ? 105.352 81.016  82.897  1.00 26.16  ? 264 GLY B N   1 
ATOM   7052  C  CA  . GLY B 1 264 ? 105.529 79.744  82.224  1.00 26.16  ? 264 GLY B CA  1 
ATOM   7053  C  C   . GLY B 1 264 ? 104.387 79.361  81.306  1.00 26.16  ? 264 GLY B C   1 
ATOM   7054  O  O   . GLY B 1 264 ? 104.602 78.682  80.300  1.00 26.16  ? 264 GLY B O   1 
ATOM   7055  N  N   . CYS B 1 265 ? 103.165 79.775  81.630  1.00 28.13  ? 265 CYS B N   1 
ATOM   7056  C  CA  . CYS B 1 265 ? 102.043 79.471  80.750  1.00 28.13  ? 265 CYS B CA  1 
ATOM   7057  C  C   . CYS B 1 265 ? 102.056 80.302  79.476  1.00 28.13  ? 265 CYS B C   1 
ATOM   7058  O  O   . CYS B 1 265 ? 101.730 79.786  78.403  1.00 28.13  ? 265 CYS B O   1 
ATOM   7059  C  CB  . CYS B 1 265 ? 100.729 79.681  81.495  1.00 28.13  ? 265 CYS B CB  1 
ATOM   7060  S  SG  . CYS B 1 265 ? 99.270  79.811  80.459  1.00 28.13  ? 265 CYS B SG  1 
ATOM   7061  N  N   . ALA B 1 266 ? 102.447 81.574  79.564  1.00 30.39  ? 266 ALA B N   1 
ATOM   7062  C  CA  . ALA B 1 266 ? 102.621 82.376  78.357  1.00 30.39  ? 266 ALA B CA  1 
ATOM   7063  C  C   . ALA B 1 266 ? 103.730 81.836  77.474  1.00 30.39  ? 266 ALA B C   1 
ATOM   7064  O  O   . ALA B 1 266 ? 103.593 81.810  76.248  1.00 30.39  ? 266 ALA B O   1 
ATOM   7065  C  CB  . ALA B 1 266 ? 102.904 83.829  78.718  1.00 30.39  ? 266 ALA B CB  1 
ATOM   7066  N  N   . ASN B 1 267 ? 104.816 81.372  78.084  1.00 30.60  ? 267 ASN B N   1 
ATOM   7067  C  CA  . ASN B 1 267 ? 105.923 80.808  77.325  1.00 30.60  ? 267 ASN B CA  1 
ATOM   7068  C  C   . ASN B 1 267 ? 105.514 79.523  76.625  1.00 30.60  ? 267 ASN B C   1 
ATOM   7069  O  O   . ASN B 1 267 ? 105.874 79.300  75.467  1.00 30.60  ? 267 ASN B O   1 
ATOM   7070  C  CB  . ASN B 1 267 ? 107.109 80.578  78.246  1.00 30.60  ? 267 ASN B CB  1 
ATOM   7071  C  CG  . ASN B 1 267 ? 108.289 80.031  77.524  1.00 30.60  ? 267 ASN B CG  1 
ATOM   7072  O  OD1 . ASN B 1 267 ? 108.507 80.332  76.359  1.00 30.60  ? 267 ASN B OD1 1 
ATOM   7073  N  ND2 . ASN B 1 267 ? 109.073 79.221  78.210  1.00 30.60  ? 267 ASN B ND2 1 
ATOM   7074  N  N   . MET B 1 268 ? 104.796 78.653  77.322  1.00 33.26  ? 268 MET B N   1 
ATOM   7075  C  CA  . MET B 1 268 ? 104.354 77.404  76.715  1.00 33.26  ? 268 MET B CA  1 
ATOM   7076  C  C   . MET B 1 268 ? 103.333 77.661  75.613  1.00 33.26  ? 268 MET B C   1 
ATOM   7077  O  O   . MET B 1 268 ? 103.438 77.109  74.514  1.00 33.26  ? 268 MET B O   1 
ATOM   7078  C  CB  . MET B 1 268 ? 103.807 76.476  77.789  1.00 33.26  ? 268 MET B CB  1 
ATOM   7079  C  CG  . MET B 1 268 ? 104.892 75.652  78.435  1.00 33.26  ? 268 MET B CG  1 
ATOM   7080  S  SD  . MET B 1 268 ? 104.289 74.208  79.322  1.00 33.26  ? 268 MET B SD  1 
ATOM   7081  C  CE  . MET B 1 268 ? 103.241 74.988  80.537  1.00 33.26  ? 268 MET B CE  1 
ATOM   7082  N  N   . THR B 1 269 ? 102.342 78.500  75.881  1.00 33.94  ? 269 THR B N   1 
ATOM   7083  C  CA  . THR B 1 269 ? 101.295 78.778  74.908  1.00 33.94  ? 269 THR B CA  1 
ATOM   7084  C  C   . THR B 1 269 ? 101.737 79.684  73.772  1.00 33.94  ? 269 THR B C   1 
ATOM   7085  O  O   . THR B 1 269 ? 100.999 79.817  72.792  1.00 33.94  ? 269 THR B O   1 
ATOM   7086  C  CB  . THR B 1 269 ? 100.093 79.404  75.589  1.00 33.94  ? 269 THR B CB  1 
ATOM   7087  O  OG1 . THR B 1 269 ? 100.552 80.440  76.460  1.00 33.94  ? 269 THR B OG1 1 
ATOM   7088  C  CG2 . THR B 1 269 ? 99.352  78.367  76.381  1.00 33.94  ? 269 THR B CG2 1 
ATOM   7089  N  N   . TYR B 1 270 ? 102.905 80.304  73.860  1.00 38.47  ? 270 TYR B N   1 
ATOM   7090  C  CA  . TYR B 1 270 ? 103.487 80.873  72.654  1.00 38.47  ? 270 TYR B CA  1 
ATOM   7091  C  C   . TYR B 1 270 ? 104.160 79.813  71.815  1.00 38.47  ? 270 TYR B C   1 
ATOM   7092  O  O   . TYR B 1 270 ? 104.160 79.902  70.586  1.00 38.47  ? 270 TYR B O   1 
ATOM   7093  C  CB  . TYR B 1 270 ? 104.479 81.965  73.003  1.00 38.47  ? 270 TYR B CB  1 
ATOM   7094  C  CG  . TYR B 1 270 ? 105.141 82.564  71.807  1.00 38.47  ? 270 TYR B CG  1 
ATOM   7095  C  CD1 . TYR B 1 270 ? 104.477 83.486  71.025  1.00 38.47  ? 270 TYR B CD1 1 
ATOM   7096  C  CD2 . TYR B 1 270 ? 106.443 82.236  71.480  1.00 38.47  ? 270 TYR B CD2 1 
ATOM   7097  C  CE1 . TYR B 1 270 ? 105.081 84.048  69.935  1.00 38.47  ? 270 TYR B CE1 1 
ATOM   7098  C  CE2 . TYR B 1 270 ? 107.058 82.790  70.394  1.00 38.47  ? 270 TYR B CE2 1 
ATOM   7099  C  CZ  . TYR B 1 270 ? 106.375 83.699  69.625  1.00 38.47  ? 270 TYR B CZ  1 
ATOM   7100  O  OH  . TYR B 1 270 ? 106.990 84.260  68.534  1.00 38.47  ? 270 TYR B OH  1 
ATOM   7101  N  N   . ARG B 1 271 ? 104.745 78.815  72.455  1.00 33.13  ? 271 ARG B N   1 
ATOM   7102  C  CA  . ARG B 1 271 ? 105.423 77.754  71.733  1.00 33.13  ? 271 ARG B CA  1 
ATOM   7103  C  C   . ARG B 1 271 ? 104.453 76.899  70.937  1.00 33.13  ? 271 ARG B C   1 
ATOM   7104  O  O   . ARG B 1 271 ? 104.875 76.211  70.006  1.00 33.13  ? 271 ARG B O   1 
ATOM   7105  C  CB  . ARG B 1 271 ? 106.225 76.912  72.706  1.00 33.13  ? 271 ARG B CB  1 
ATOM   7106  C  CG  . ARG B 1 271 ? 107.483 76.336  72.154  1.00 33.13  ? 271 ARG B CG  1 
ATOM   7107  C  CD  . ARG B 1 271 ? 108.267 75.793  73.309  1.00 33.13  ? 271 ARG B CD  1 
ATOM   7108  N  NE  . ARG B 1 271 ? 107.718 74.530  73.776  1.00 33.13  ? 271 ARG B NE  1 
ATOM   7109  C  CZ  . ARG B 1 271 ? 107.340 74.316  75.030  1.00 33.13  ? 271 ARG B CZ  1 
ATOM   7110  N  NH1 . ARG B 1 271 ? 107.452 75.278  75.932  1.00 33.13  ? 271 ARG B NH1 1 
ATOM   7111  N  NH2 . ARG B 1 271 ? 106.849 73.143  75.387  1.00 33.13  ? 271 ARG B NH2 1 
ATOM   7112  N  N   . TRP B 1 272 ? 103.173 76.916  71.288  1.00 32.72  ? 272 TRP B N   1 
ATOM   7113  C  CA  . TRP B 1 272 ? 102.176 76.183  70.536  1.00 32.72  ? 272 TRP B CA  1 
ATOM   7114  C  C   . TRP B 1 272 ? 101.418 77.067  69.570  1.00 32.72  ? 272 TRP B C   1 
ATOM   7115  O  O   . TRP B 1 272 ? 100.897 76.557  68.576  1.00 32.72  ? 272 TRP B O   1 
ATOM   7116  C  CB  . TRP B 1 272 ? 101.175 75.531  71.480  1.00 32.72  ? 272 TRP B CB  1 
ATOM   7117  C  CG  . TRP B 1 272 ? 101.795 74.630  72.451  1.00 32.72  ? 272 TRP B CG  1 
ATOM   7118  C  CD1 . TRP B 1 272 ? 102.925 73.905  72.288  1.00 32.72  ? 272 TRP B CD1 1 
ATOM   7119  C  CD2 . TRP B 1 272 ? 101.364 74.411  73.784  1.00 32.72  ? 272 TRP B CD2 1 
ATOM   7120  N  NE1 . TRP B 1 272 ? 103.197 73.196  73.424  1.00 32.72  ? 272 TRP B NE1 1 
ATOM   7121  C  CE2 . TRP B 1 272 ? 102.255 73.505  74.365  1.00 32.72  ? 272 TRP B CE2 1 
ATOM   7122  C  CE3 . TRP B 1 272 ? 100.302 74.891  74.543  1.00 32.72  ? 272 TRP B CE3 1 
ATOM   7123  C  CZ2 . TRP B 1 272 ? 102.120 73.068  75.663  1.00 32.72  ? 272 TRP B CZ2 1 
ATOM   7124  C  CZ3 . TRP B 1 272 ? 100.169 74.456  75.825  1.00 32.72  ? 272 TRP B CZ3 1 
ATOM   7125  C  CH2 . TRP B 1 272 ? 101.070 73.552  76.378  1.00 32.72  ? 272 TRP B CH2 1 
ATOM   7126  N  N   . GLY B 1 273 ? 101.332 78.365  69.838  1.00 40.64  ? 273 GLY B N   1 
ATOM   7127  C  CA  . GLY B 1 273 ? 100.684 79.300  68.945  1.00 40.64  ? 273 GLY B CA  1 
ATOM   7128  C  C   . GLY B 1 273 ? 99.367  79.870  69.419  1.00 40.64  ? 273 GLY B C   1 
ATOM   7129  O  O   . GLY B 1 273 ? 98.874  80.826  68.809  1.00 40.64  ? 273 GLY B O   1 
ATOM   7130  N  N   . THR B 1 274 ? 98.794  79.344  70.487  1.00 41.27  ? 274 THR B N   1 
ATOM   7131  C  CA  . THR B 1 274 ? 97.478  79.785  70.919  1.00 41.27  ? 274 THR B CA  1 
ATOM   7132  C  C   . THR B 1 274 ? 97.481  81.086  71.703  1.00 41.27  ? 274 THR B C   1 
ATOM   7133  O  O   . THR B 1 274 ? 96.408  81.560  72.080  1.00 41.27  ? 274 THR B O   1 
ATOM   7134  C  CB  . THR B 1 274 ? 96.841  78.705  71.764  1.00 41.27  ? 274 THR B CB  1 
ATOM   7135  O  OG1 . THR B 1 274 ? 97.581  78.585  72.981  1.00 41.27  ? 274 THR B OG1 1 
ATOM   7136  C  CG2 . THR B 1 274 ? 96.898  77.398  71.019  1.00 41.27  ? 274 THR B CG2 1 
ATOM   7137  N  N   . LEU B 1 275 ? 98.638  81.686  71.944  1.00 40.88  ? 275 LEU B N   1 
ATOM   7138  C  CA  . LEU B 1 275 ? 98.668  83.053  72.443  1.00 40.88  ? 275 LEU B CA  1 
ATOM   7139  C  C   . LEU B 1 275 ? 98.300  84.067  71.366  1.00 40.88  ? 275 LEU B C   1 
ATOM   7140  O  O   . LEU B 1 275 ? 97.832  85.163  71.690  1.00 40.88  ? 275 LEU B O   1 
ATOM   7141  C  CB  . LEU B 1 275 ? 100.045 83.347  73.030  1.00 40.88  ? 275 LEU B CB  1 
ATOM   7142  C  CG  . LEU B 1 275 ? 100.186 84.630  73.834  1.00 40.88  ? 275 LEU B CG  1 
ATOM   7143  C  CD1 . LEU B 1 275 ? 99.287  84.580  75.037  1.00 40.88  ? 275 LEU B CD1 1 
ATOM   7144  C  CD2 . LEU B 1 275 ? 101.610 84.802  74.256  1.00 40.88  ? 275 LEU B CD2 1 
ATOM   7145  N  N   . LEU B 1 276 ? 98.411  83.697  70.094  1.00 52.01  ? 276 LEU B N   1 
ATOM   7146  C  CA  . LEU B 1 276 ? 98.207  84.622  68.991  1.00 52.01  ? 276 LEU B CA  1 
ATOM   7147  C  C   . LEU B 1 276 ? 96.920  84.392  68.229  1.00 52.01  ? 276 LEU B C   1 
ATOM   7148  O  O   . LEU B 1 276 ? 96.596  85.192  67.346  1.00 52.01  ? 276 LEU B O   1 
ATOM   7149  C  CB  . LEU B 1 276 ? 99.364  84.531  67.995  1.00 52.01  ? 276 LEU B CB  1 
ATOM   7150  C  CG  . LEU B 1 276 ? 100.709 84.820  68.613  1.00 52.01  ? 276 LEU B CG  1 
ATOM   7151  C  CD1 . LEU B 1 276 ? 101.804 84.124  67.844  1.00 52.01  ? 276 LEU B CD1 1 
ATOM   7152  C  CD2 . LEU B 1 276 ? 100.869 86.300  68.600  1.00 52.01  ? 276 LEU B CD2 1 
ATOM   7153  N  N   . MET B 1 277 ? 96.199  83.319  68.517  1.00 66.14  ? 277 MET B N   1 
ATOM   7154  C  CA  . MET B 1 277 ? 94.911  83.110  67.885  1.00 66.14  ? 277 MET B CA  1 
ATOM   7155  C  C   . MET B 1 277 ? 93.943  84.156  68.402  1.00 66.14  ? 277 MET B C   1 
ATOM   7156  O  O   . MET B 1 277 ? 93.891  84.423  69.606  1.00 66.14  ? 277 MET B O   1 
ATOM   7157  C  CB  . MET B 1 277 ? 94.370  81.719  68.210  1.00 66.14  ? 277 MET B CB  1 
ATOM   7158  C  CG  . MET B 1 277 ? 94.854  80.597  67.331  1.00 66.14  ? 277 MET B CG  1 
ATOM   7159  S  SD  . MET B 1 277 ? 93.940  79.095  67.704  1.00 66.14  ? 277 MET B SD  1 
ATOM   7160  C  CE  . MET B 1 277 ? 92.264  79.722  67.675  1.00 66.14  ? 277 MET B CE  1 
ATOM   7161  N  N   . LYS B 1 278 ? 93.217  84.781  67.483  1.00 79.98  ? 278 LYS B N   1 
ATOM   7162  C  CA  . LYS B 1 278 ? 92.306  85.845  67.854  1.00 79.98  ? 278 LYS B CA  1 
ATOM   7163  C  C   . LYS B 1 278 ? 91.130  85.231  68.596  1.00 79.98  ? 278 LYS B C   1 
ATOM   7164  O  O   . LYS B 1 278 ? 90.845  84.038  68.472  1.00 79.98  ? 278 LYS B O   1 
ATOM   7165  C  CB  . LYS B 1 278 ? 91.827  86.610  66.622  1.00 79.98  ? 278 LYS B CB  1 
ATOM   7166  N  N   . ARG B 1 279 ? 90.446  86.047  69.379  1.00 93.81  ? 279 ARG B N   1 
ATOM   7167  C  CA  . ARG B 1 279 ? 89.297  85.531  70.102  1.00 93.81  ? 279 ARG B CA  1 
ATOM   7168  C  C   . ARG B 1 279 ? 88.171  85.284  69.115  1.00 93.81  ? 279 ARG B C   1 
ATOM   7169  O  O   . ARG B 1 279 ? 87.636  86.226  68.523  1.00 93.81  ? 279 ARG B O   1 
ATOM   7170  C  CB  . ARG B 1 279 ? 88.867  86.516  71.185  1.00 93.81  ? 279 ARG B CB  1 
ATOM   7171  N  N   . LYS B 1 280 ? 87.848  84.010  68.905  1.00 91.93  ? 280 LYS B N   1 
ATOM   7172  C  CA  . LYS B 1 280 ? 86.735  83.671  68.039  1.00 91.93  ? 280 LYS B CA  1 
ATOM   7173  C  C   . LYS B 1 280 ? 85.439  84.056  68.726  1.00 91.93  ? 280 LYS B C   1 
ATOM   7174  O  O   . LYS B 1 280 ? 85.291  83.889  69.939  1.00 91.93  ? 280 LYS B O   1 
ATOM   7175  C  CB  . LYS B 1 280 ? 86.742  82.180  67.722  1.00 91.93  ? 280 LYS B CB  1 
ATOM   7176  N  N   . PHE B 1 281 ? 84.501  84.579  67.947  1.00 83.62  ? 281 PHE B N   1 
ATOM   7177  C  CA  . PHE B 1 281 ? 83.220  84.976  68.506  1.00 83.62  ? 281 PHE B CA  1 
ATOM   7178  C  C   . PHE B 1 281 ? 82.405  83.740  68.855  1.00 83.62  ? 281 PHE B C   1 
ATOM   7179  O  O   . PHE B 1 281 ? 82.274  82.822  68.041  1.00 83.62  ? 281 PHE B O   1 
ATOM   7180  C  CB  . PHE B 1 281 ? 82.450  85.871  67.544  1.00 83.62  ? 281 PHE B CB  1 
ATOM   7181  C  CG  . PHE B 1 281 ? 81.187  86.404  68.134  1.00 83.62  ? 281 PHE B CG  1 
ATOM   7182  C  CD1 . PHE B 1 281 ? 79.966  85.772  67.929  1.00 83.62  ? 281 PHE B CD1 1 
ATOM   7183  C  CD2 . PHE B 1 281 ? 81.230  87.530  68.936  1.00 83.62  ? 281 PHE B CD2 1 
ATOM   7184  C  CE1 . PHE B 1 281 ? 78.818  86.259  68.506  1.00 83.62  ? 281 PHE B CE1 1 
ATOM   7185  C  CE2 . PHE B 1 281 ? 80.083  88.030  69.510  1.00 83.62  ? 281 PHE B CE2 1 
ATOM   7186  C  CZ  . PHE B 1 281 ? 78.874  87.393  69.296  1.00 83.62  ? 281 PHE B CZ  1 
ATOM   7187  N  N   . GLU B 1 282 ? 81.858  83.719  70.061  1.00 72.52  ? 282 GLU B N   1 
ATOM   7188  C  CA  . GLU B 1 282 ? 81.222  82.521  70.578  1.00 72.52  ? 282 GLU B CA  1 
ATOM   7189  C  C   . GLU B 1 282 ? 79.762  82.490  70.158  1.00 72.52  ? 282 GLU B C   1 
ATOM   7190  O  O   . GLU B 1 282 ? 79.033  83.471  70.327  1.00 72.52  ? 282 GLU B O   1 
ATOM   7191  C  CB  . GLU B 1 282 ? 81.340  82.466  72.096  1.00 72.52  ? 282 GLU B CB  1 
ATOM   7192  C  CG  . GLU B 1 282 ? 82.697  82.010  72.587  1.00 72.52  ? 282 GLU B CG  1 
ATOM   7193  N  N   . GLU B 1 283 ? 79.352  81.372  69.581  1.00 59.28  ? 283 GLU B N   1 
ATOM   7194  C  CA  . GLU B 1 283 ? 77.956  81.091  69.297  1.00 59.28  ? 283 GLU B CA  1 
ATOM   7195  C  C   . GLU B 1 283 ? 77.217  80.824  70.598  1.00 59.28  ? 283 GLU B C   1 
ATOM   7196  O  O   . GLU B 1 283 ? 77.832  80.499  71.611  1.00 59.28  ? 283 GLU B O   1 
ATOM   7197  C  CB  . GLU B 1 283 ? 77.858  79.933  68.309  1.00 59.28  ? 283 GLU B CB  1 
ATOM   7198  C  CG  . GLU B 1 283 ? 78.270  80.359  66.911  1.00 59.28  ? 283 GLU B CG  1 
ATOM   7199  C  CD  . GLU B 1 283 ? 77.835  79.399  65.838  1.00 59.28  ? 283 GLU B CD  1 
ATOM   7200  O  OE1 . GLU B 1 283 ? 76.846  78.671  66.054  1.00 59.28  ? 283 GLU B OE1 1 
ATOM   7201  O  OE2 . GLU B 1 283 ? 78.474  79.386  64.767  1.00 59.28  ? 283 GLU B OE2 1 
ATOM   7202  N  N   . PRO B 1 284 ? 75.899  81.022  70.615  1.00 49.92  ? 284 PRO B N   1 
ATOM   7203  C  CA  . PRO B 1 284 ? 75.098  80.574  71.759  1.00 49.92  ? 284 PRO B CA  1 
ATOM   7204  C  C   . PRO B 1 284 ? 75.235  79.090  72.055  1.00 49.92  ? 284 PRO B C   1 
ATOM   7205  O  O   . PRO B 1 284 ? 75.328  78.252  71.161  1.00 49.92  ? 284 PRO B O   1 
ATOM   7206  C  CB  . PRO B 1 284 ? 73.666  80.919  71.337  1.00 49.92  ? 284 PRO B CB  1 
ATOM   7207  C  CG  . PRO B 1 284 ? 73.752  81.318  69.887  1.00 49.92  ? 284 PRO B CG  1 
ATOM   7208  C  CD  . PRO B 1 284 ? 75.110  81.860  69.704  1.00 49.92  ? 284 PRO B CD  1 
ATOM   7209  N  N   . ARG B 1 285 ? 75.274  78.794  73.346  1.00 47.48  ? 285 ARG B N   1 
ATOM   7210  C  CA  . ARG B 1 285 ? 75.605  77.472  73.839  1.00 47.48  ? 285 ARG B CA  1 
ATOM   7211  C  C   . ARG B 1 285 ? 74.463  76.484  73.595  1.00 47.48  ? 285 ARG B C   1 
ATOM   7212  O  O   . ARG B 1 285 ? 73.304  76.883  73.474  1.00 47.48  ? 285 ARG B O   1 
ATOM   7213  C  CB  . ARG B 1 285 ? 75.958  77.575  75.320  1.00 47.48  ? 285 ARG B CB  1 
ATOM   7214  C  CG  . ARG B 1 285 ? 74.853  77.936  76.256  1.00 47.48  ? 285 ARG B CG  1 
ATOM   7215  C  CD  . ARG B 1 285 ? 75.370  77.761  77.664  1.00 47.48  ? 285 ARG B CD  1 
ATOM   7216  N  NE  . ARG B 1 285 ? 75.815  76.412  77.970  1.00 47.48  ? 285 ARG B NE  1 
ATOM   7217  C  CZ  . ARG B 1 285 ? 75.091  75.534  78.639  1.00 47.48  ? 285 ARG B CZ  1 
ATOM   7218  N  NH1 . ARG B 1 285 ? 75.566  74.323  78.877  1.00 47.48  ? 285 ARG B NH1 1 
ATOM   7219  N  NH2 . ARG B 1 285 ? 73.888  75.874  79.064  1.00 47.48  ? 285 ARG B NH2 1 
ATOM   7220  N  N   . PRO B 1 286 ? 74.766  75.182  73.539  1.00 55.53  ? 286 PRO B N   1 
ATOM   7221  C  CA  . PRO B 1 286 ? 73.731  74.183  73.238  1.00 55.53  ? 286 PRO B CA  1 
ATOM   7222  C  C   . PRO B 1 286 ? 72.696  73.936  74.324  1.00 55.53  ? 286 PRO B C   1 
ATOM   7223  O  O   . PRO B 1 286 ? 72.900  73.082  75.189  1.00 55.53  ? 286 PRO B O   1 
ATOM   7224  C  CB  . PRO B 1 286 ? 74.546  72.909  72.989  1.00 55.53  ? 286 PRO B CB  1 
ATOM   7225  C  CG  . PRO B 1 286 ? 75.851  73.159  73.625  1.00 55.53  ? 286 PRO B CG  1 
ATOM   7226  C  CD  . PRO B 1 286 ? 76.107  74.594  73.397  1.00 55.53  ? 286 PRO B CD  1 
ATOM   7227  N  N   . GLY B 1 287 ? 71.593  74.676  74.302  1.00 50.48  ? 287 GLY B N   1 
ATOM   7228  C  CA  . GLY B 1 287 ? 70.619  74.586  75.370  1.00 50.48  ? 287 GLY B CA  1 
ATOM   7229  C  C   . GLY B 1 287 ? 70.193  75.957  75.830  1.00 50.48  ? 287 GLY B C   1 
ATOM   7230  O  O   . GLY B 1 287 ? 69.671  76.130  76.933  1.00 50.48  ? 287 GLY B O   1 
ATOM   7231  N  N   . PHE B 1 288 ? 70.403  76.939  74.966  1.00 53.43  ? 288 PHE B N   1 
ATOM   7232  C  CA  . PHE B 1 288 ? 69.940  78.305  75.173  1.00 53.43  ? 288 PHE B CA  1 
ATOM   7233  C  C   . PHE B 1 288 ? 68.722  78.586  74.310  1.00 53.43  ? 288 PHE B C   1 
ATOM   7234  O  O   . PHE B 1 288 ? 68.844  78.692  73.090  1.00 53.43  ? 288 PHE B O   1 
ATOM   7235  C  CB  . PHE B 1 288 ? 71.067  79.265  74.856  1.00 53.43  ? 288 PHE B CB  1 
ATOM   7236  C  CG  . PHE B 1 288 ? 70.641  80.674  74.729  1.00 53.43  ? 288 PHE B CG  1 
ATOM   7237  C  CD1 . PHE B 1 288 ? 70.123  81.344  75.810  1.00 53.43  ? 288 PHE B CD1 1 
ATOM   7238  C  CD2 . PHE B 1 288 ? 70.812  81.345  73.546  1.00 53.43  ? 288 PHE B CD2 1 
ATOM   7239  C  CE1 . PHE B 1 288 ? 69.757  82.647  75.700  1.00 53.43  ? 288 PHE B CE1 1 
ATOM   7240  C  CE2 . PHE B 1 288 ? 70.446  82.650  73.432  1.00 53.43  ? 288 PHE B CE2 1 
ATOM   7241  C  CZ  . PHE B 1 288 ? 69.922  83.302  74.509  1.00 53.43  ? 288 PHE B CZ  1 
ATOM   7242  N  N   . HIS B 1 289 ? 67.550  78.690  74.927  1.00 59.98  ? 289 HIS B N   1 
ATOM   7243  C  CA  . HIS B 1 289 ? 66.314  78.893  74.185  1.00 59.98  ? 289 HIS B CA  1 
ATOM   7244  C  C   . HIS B 1 289 ? 65.681  80.205  74.618  1.00 59.98  ? 289 HIS B C   1 
ATOM   7245  O  O   . HIS B 1 289 ? 65.557  80.473  75.816  1.00 59.98  ? 289 HIS B O   1 
ATOM   7246  C  CB  . HIS B 1 289 ? 65.336  77.744  74.422  1.00 59.98  ? 289 HIS B CB  1 
ATOM   7247  C  CG  . HIS B 1 289 ? 65.108  77.442  75.869  1.00 59.98  ? 289 HIS B CG  1 
ATOM   7248  N  ND1 . HIS B 1 289 ? 64.341  78.249  76.682  1.00 59.98  ? 289 HIS B ND1 1 
ATOM   7249  C  CD2 . HIS B 1 289 ? 65.565  76.442  76.656  1.00 59.98  ? 289 HIS B CD2 1 
ATOM   7250  C  CE1 . HIS B 1 289 ? 64.322  77.749  77.904  1.00 59.98  ? 289 HIS B CE1 1 
ATOM   7251  N  NE2 . HIS B 1 289 ? 65.059  76.654  77.916  1.00 59.98  ? 289 HIS B NE2 1 
ATOM   7252  N  N   . GLY B 1 290 ? 65.299  81.023  73.648  1.00 66.06  ? 290 GLY B N   1 
ATOM   7253  C  CA  . GLY B 1 290 ? 64.617  82.270  73.919  1.00 66.06  ? 290 GLY B CA  1 
ATOM   7254  C  C   . GLY B 1 290 ? 63.570  82.475  72.852  1.00 66.06  ? 290 GLY B C   1 
ATOM   7255  O  O   . GLY B 1 290 ? 62.953  81.508  72.402  1.00 66.06  ? 290 GLY B O   1 
ATOM   7256  N  N   . VAL B 1 291 ? 63.335  83.711  72.452  1.00 71.32  ? 291 VAL B N   1 
ATOM   7257  C  CA  . VAL B 1 291 ? 62.448  83.995  71.333  1.00 71.32  ? 291 VAL B CA  1 
ATOM   7258  C  C   . VAL B 1 291 ? 63.321  84.363  70.143  1.00 71.32  ? 291 VAL B C   1 
ATOM   7259  O  O   . VAL B 1 291 ? 64.388  84.964  70.310  1.00 71.32  ? 291 VAL B O   1 
ATOM   7260  C  CB  . VAL B 1 291 ? 61.461  85.121  71.686  1.00 71.32  ? 291 VAL B CB  1 
ATOM   7261  C  CG1 . VAL B 1 291 ? 60.327  85.187  70.682  1.00 71.32  ? 291 VAL B CG1 1 
ATOM   7262  C  CG2 . VAL B 1 291 ? 60.918  84.900  73.083  1.00 71.32  ? 291 VAL B CG2 1 
ATOM   7263  N  N   . LEU B 1 292 ? 62.883  83.996  68.945  1.00 76.64  ? 292 LEU B N   1 
ATOM   7264  C  CA  . LEU B 1 292 ? 63.661  84.276  67.748  1.00 76.64  ? 292 LEU B CA  1 
ATOM   7265  C  C   . LEU B 1 292 ? 63.617  85.756  67.410  1.00 76.64  ? 292 LEU B C   1 
ATOM   7266  O  O   . LEU B 1 292 ? 62.554  86.379  67.452  1.00 76.64  ? 292 LEU B O   1 
ATOM   7267  C  CB  . LEU B 1 292 ? 63.167  83.444  66.575  1.00 76.64  ? 292 LEU B CB  1 
ATOM   7268  C  CG  . LEU B 1 292 ? 63.892  82.105  66.494  1.00 76.64  ? 292 LEU B CG  1 
ATOM   7269  C  CD1 . LEU B 1 292 ? 63.437  81.309  65.286  1.00 76.64  ? 292 LEU B CD1 1 
ATOM   7270  C  CD2 . LEU B 1 292 ? 65.389  82.341  66.442  1.00 76.64  ? 292 LEU B CD2 1 
ATOM   7271  N  N   . GLY B 1 293 ? 64.774  86.328  67.116  1.00 80.80  ? 293 GLY B N   1 
ATOM   7272  C  CA  . GLY B 1 293 ? 64.819  87.736  66.811  1.00 80.80  ? 293 GLY B CA  1 
ATOM   7273  C  C   . GLY B 1 293 ? 66.117  88.107  66.134  1.00 80.80  ? 293 GLY B C   1 
ATOM   7274  O  O   . GLY B 1 293 ? 66.922  87.247  65.773  1.00 80.80  ? 293 GLY B O   1 
ATOM   7275  N  N   . ILE B 1 294 ? 66.301  89.407  65.954  1.00 82.41  ? 294 ILE B N   1 
ATOM   7276  C  CA  . ILE B 1 294 ? 67.488  89.944  65.305  1.00 82.41  ? 294 ILE B CA  1 
ATOM   7277  C  C   . ILE B 1 294 ? 68.512  90.200  66.395  1.00 82.41  ? 294 ILE B C   1 
ATOM   7278  O  O   . ILE B 1 294 ? 68.241  90.940  67.346  1.00 82.41  ? 294 ILE B O   1 
ATOM   7279  C  CB  . ILE B 1 294 ? 67.173  91.239  64.543  1.00 82.41  ? 294 ILE B CB  1 
ATOM   7280  C  CG1 . ILE B 1 294 ? 66.318  90.967  63.308  1.00 82.41  ? 294 ILE B CG1 1 
ATOM   7281  C  CG2 . ILE B 1 294 ? 68.463  91.920  64.115  1.00 82.41  ? 294 ILE B CG2 1 
ATOM   7282  C  CD1 . ILE B 1 294 ? 66.884  89.945  62.386  1.00 82.41  ? 294 ILE B CD1 1 
ATOM   7283  N  N   . ASN B 1 295 ? 69.678  89.584  66.274  1.00 81.76  ? 295 ASN B N   1 
ATOM   7284  C  CA  . ASN B 1 295 ? 70.744  89.882  67.212  1.00 81.76  ? 295 ASN B CA  1 
ATOM   7285  C  C   . ASN B 1 295 ? 71.267  91.284  66.952  1.00 81.76  ? 295 ASN B C   1 
ATOM   7286  O  O   . ASN B 1 295 ? 71.521  91.665  65.810  1.00 81.76  ? 295 ASN B O   1 
ATOM   7287  C  CB  . ASN B 1 295 ? 71.870  88.864  67.084  1.00 81.76  ? 295 ASN B CB  1 
ATOM   7288  C  CG  . ASN B 1 295 ? 72.712  88.782  68.327  1.00 81.76  ? 295 ASN B CG  1 
ATOM   7289  O  OD1 . ASN B 1 295 ? 72.356  89.335  69.362  1.00 81.76  ? 295 ASN B OD1 1 
ATOM   7290  N  ND2 . ASN B 1 295 ? 73.833  88.081  68.238  1.00 81.76  ? 295 ASN B ND2 1 
ATOM   7291  N  N   . SER B 1 296 ? 71.404  92.061  68.021  1.00 78.07  ? 296 SER B N   1 
ATOM   7292  C  CA  . SER B 1 296 ? 71.771  93.464  67.878  1.00 78.07  ? 296 SER B CA  1 
ATOM   7293  C  C   . SER B 1 296 ? 73.239  93.615  67.525  1.00 78.07  ? 296 SER B C   1 
ATOM   7294  O  O   . SER B 1 296 ? 73.605  94.505  66.751  1.00 78.07  ? 296 SER B O   1 
ATOM   7295  C  CB  . SER B 1 296 ? 71.447  94.239  69.152  1.00 78.07  ? 296 SER B CB  1 
ATOM   7296  O  OG  . SER B 1 296 ? 70.123  94.739  69.117  1.00 78.07  ? 296 SER B OG  1 
ATOM   7297  N  N   . ILE B 1 297 ? 74.086  92.755  68.083  1.00 77.37  ? 297 ILE B N   1 
ATOM   7298  C  CA  . ILE B 1 297 ? 75.524  92.832  67.876  1.00 77.37  ? 297 ILE B CA  1 
ATOM   7299  C  C   . ILE B 1 297 ? 75.876  92.424  66.455  1.00 77.37  ? 297 ILE B C   1 
ATOM   7300  O  O   . ILE B 1 297 ? 76.408  93.227  65.683  1.00 77.37  ? 297 ILE B O   1 
ATOM   7301  C  CB  . ILE B 1 297 ? 76.251  91.935  68.888  1.00 77.37  ? 297 ILE B CB  1 
ATOM   7302  C  CG1 . ILE B 1 297 ? 75.922  92.387  70.307  1.00 77.37  ? 297 ILE B CG1 1 
ATOM   7303  C  CG2 . ILE B 1 297 ? 77.751  91.967  68.642  1.00 77.37  ? 297 ILE B CG2 1 
ATOM   7304  C  CD1 . ILE B 1 297 ? 76.255  91.361  71.363  1.00 77.37  ? 297 ILE B CD1 1 
ATOM   7305  N  N   . THR B 1 298 ? 75.554  91.193  66.083  1.00 80.26  ? 298 THR B N   1 
ATOM   7306  C  CA  . THR B 1 298 ? 76.046  90.673  64.817  1.00 80.26  ? 298 THR B CA  1 
ATOM   7307  C  C   . THR B 1 298 ? 75.176  91.116  63.659  1.00 80.26  ? 298 THR B C   1 
ATOM   7308  O  O   . THR B 1 298 ? 75.664  91.232  62.532  1.00 80.26  ? 298 THR B O   1 
ATOM   7309  C  CB  . THR B 1 298 ? 76.124  89.156  64.859  1.00 80.26  ? 298 THR B CB  1 
ATOM   7310  O  OG1 . THR B 1 298 ? 74.941  88.639  65.478  1.00 80.26  ? 298 THR B OG1 1 
ATOM   7311  C  CG2 . THR B 1 298 ? 77.341  88.726  65.639  1.00 80.26  ? 298 THR B CG2 1 
ATOM   7312  N  N   . GLY B 1 299 ? 73.898  91.356  63.917  1.00 85.17  ? 299 GLY B N   1 
ATOM   7313  C  CA  . GLY B 1 299 ? 72.926  91.659  62.892  1.00 85.17  ? 299 GLY B CA  1 
ATOM   7314  C  C   . GLY B 1 299 ? 72.274  90.447  62.285  1.00 85.17  ? 299 GLY B C   1 
ATOM   7315  O  O   . GLY B 1 299 ? 71.384  90.597  61.442  1.00 85.17  ? 299 GLY B O   1 
ATOM   7316  N  N   . LYS B 1 300 ? 72.676  89.257  62.694  1.00 85.08  ? 300 LYS B N   1 
ATOM   7317  C  CA  . LYS B 1 300 ? 72.103  88.014  62.225  1.00 85.08  ? 300 LYS B CA  1 
ATOM   7318  C  C   . LYS B 1 300 ? 70.841  87.708  63.025  1.00 85.08  ? 300 LYS B C   1 
ATOM   7319  O  O   . LYS B 1 300 ? 70.348  88.536  63.799  1.00 85.08  ? 300 LYS B O   1 
ATOM   7320  C  CB  . LYS B 1 300 ? 73.146  86.905  62.255  1.00 85.08  ? 300 LYS B CB  1 
ATOM   7321  C  CG  . LYS B 1 300 ? 74.458  87.378  61.675  1.00 85.08  ? 300 LYS B CG  1 
ATOM   7322  C  CD  . LYS B 1 300 ? 75.492  86.282  61.621  1.00 85.08  ? 300 LYS B CD  1 
ATOM   7323  C  CE  . LYS B 1 300 ? 76.311  86.414  60.349  1.00 85.08  ? 300 LYS B CE  1 
ATOM   7324  N  NZ  . LYS B 1 300 ? 77.224  85.264  60.146  1.00 85.08  ? 300 LYS B NZ  1 
ATOM   7325  N  N   . GLU B 1 301 ? 70.310  86.509  62.849  1.00 93.08  ? 301 GLU B N   1 
ATOM   7326  C  CA  . GLU B 1 301 ? 69.146  86.046  63.593  1.00 93.08  ? 301 GLU B CA  1 
ATOM   7327  C  C   . GLU B 1 301 ? 69.585  85.093  64.695  1.00 93.08  ? 301 GLU B C   1 
ATOM   7328  O  O   . GLU B 1 301 ? 70.317  84.132  64.441  1.00 93.08  ? 301 GLU B O   1 
ATOM   7329  C  CB  . GLU B 1 301 ? 68.151  85.371  62.655  1.00 93.08  ? 301 GLU B CB  1 
ATOM   7330  C  CG  . GLU B 1 301 ? 67.201  86.346  62.013  1.00 93.08  ? 301 GLU B CG  1 
ATOM   7331  C  CD  . GLU B 1 301 ? 65.837  85.768  61.762  1.00 93.08  ? 301 GLU B CD  1 
ATOM   7332  O  OE1 . GLU B 1 301 ? 65.611  84.597  62.122  1.00 93.08  ? 301 GLU B OE1 1 
ATOM   7333  O  OE2 . GLU B 1 301 ? 64.985  86.487  61.202  1.00 93.08  ? 301 GLU B OE2 1 
ATOM   7334  N  N   . GLU B 1 302 ? 69.157  85.376  65.914  1.00 78.24  ? 302 GLU B N   1 
ATOM   7335  C  CA  . GLU B 1 302 ? 69.576  84.652  67.100  1.00 78.24  ? 302 GLU B CA  1 
ATOM   7336  C  C   . GLU B 1 302 ? 68.413  84.584  68.073  1.00 78.24  ? 302 GLU B C   1 
ATOM   7337  O  O   . GLU B 1 302 ? 67.465  85.370  67.978  1.00 78.24  ? 302 GLU B O   1 
ATOM   7338  C  CB  . GLU B 1 302 ? 70.779  85.343  67.759  1.00 78.24  ? 302 GLU B CB  1 
ATOM   7339  N  N   . PRO B 1 303 ? 68.450  83.654  69.018  1.00 67.45  ? 303 PRO B N   1 
ATOM   7340  C  CA  . PRO B 1 303 ? 67.524  83.717  70.147  1.00 67.45  ? 303 PRO B CA  1 
ATOM   7341  C  C   . PRO B 1 303 ? 67.826  84.891  71.057  1.00 67.45  ? 303 PRO B C   1 
ATOM   7342  O  O   . PRO B 1 303 ? 68.981  85.218  71.318  1.00 67.45  ? 303 PRO B O   1 
ATOM   7343  C  CB  . PRO B 1 303 ? 67.750  82.386  70.864  1.00 67.45  ? 303 PRO B CB  1 
ATOM   7344  C  CG  . PRO B 1 303 ? 68.288  81.496  69.829  1.00 67.45  ? 303 PRO B CG  1 
ATOM   7345  C  CD  . PRO B 1 303 ? 69.138  82.357  68.961  1.00 67.45  ? 303 PRO B CD  1 
ATOM   7346  N  N   . LEU B 1 304 ? 66.770  85.535  71.521  1.00 65.95  ? 304 LEU B N   1 
ATOM   7347  C  CA  . LEU B 1 304 ? 66.880  86.654  72.435  1.00 65.95  ? 304 LEU B CA  1 
ATOM   7348  C  C   . LEU B 1 304 ? 66.151  86.295  73.711  1.00 65.95  ? 304 LEU B C   1 
ATOM   7349  O  O   . LEU B 1 304 ? 65.126  85.612  73.687  1.00 65.95  ? 304 LEU B O   1 
ATOM   7350  C  CB  . LEU B 1 304 ? 66.294  87.928  71.854  1.00 65.95  ? 304 LEU B CB  1 
ATOM   7351  C  CG  . LEU B 1 304 ? 66.914  88.507  70.589  1.00 65.95  ? 304 LEU B CG  1 
ATOM   7352  C  CD1 . LEU B 1 304 ? 66.509  89.964  70.447  1.00 65.95  ? 304 LEU B CD1 1 
ATOM   7353  C  CD2 . LEU B 1 304 ? 68.427  88.400  70.653  1.00 65.95  ? 304 LEU B CD2 1 
ATOM   7354  N  N   . TYR B 1 305 ? 66.702  86.750  74.823  1.00 64.47  ? 305 TYR B N   1 
ATOM   7355  C  CA  . TYR B 1 305 ? 66.132  86.541  76.130  1.00 64.47  ? 305 TYR B CA  1 
ATOM   7356  C  C   . TYR B 1 305 ? 66.137  87.883  76.844  1.00 64.47  ? 305 TYR B C   1 
ATOM   7357  O  O   . TYR B 1 305 ? 67.126  88.628  76.744  1.00 64.47  ? 305 TYR B O   1 
ATOM   7358  C  CB  . TYR B 1 305 ? 66.937  85.527  76.929  1.00 64.47  ? 305 TYR B CB  1 
ATOM   7359  C  CG  . TYR B 1 305 ? 66.150  84.824  77.990  1.00 64.47  ? 305 TYR B CG  1 
ATOM   7360  C  CD1 . TYR B 1 305 ? 65.281  83.802  77.669  1.00 64.47  ? 305 TYR B CD1 1 
ATOM   7361  C  CD2 . TYR B 1 305 ? 66.247  85.206  79.307  1.00 64.47  ? 305 TYR B CD2 1 
ATOM   7362  C  CE1 . TYR B 1 305 ? 64.554  83.155  78.643  1.00 64.47  ? 305 TYR B CE1 1 
ATOM   7363  C  CE2 . TYR B 1 305 ? 65.522  84.573  80.286  1.00 64.47  ? 305 TYR B CE2 1 
ATOM   7364  C  CZ  . TYR B 1 305 ? 64.676  83.549  79.950  1.00 64.47  ? 305 TYR B CZ  1 
ATOM   7365  O  OH  . TYR B 1 305 ? 63.955  82.913  80.933  1.00 64.47  ? 305 TYR B OH  1 
ATOM   7366  N  N   . PRO B 1 306 ? 65.063  88.245  77.537  1.00 69.14  ? 306 PRO B N   1 
ATOM   7367  C  CA  . PRO B 1 306 ? 65.077  89.500  78.290  1.00 69.14  ? 306 PRO B CA  1 
ATOM   7368  C  C   . PRO B 1 306 ? 66.009  89.341  79.474  1.00 69.14  ? 306 PRO B C   1 
ATOM   7369  O  O   . PRO B 1 306 ? 65.984  88.322  80.166  1.00 69.14  ? 306 PRO B O   1 
ATOM   7370  C  CB  . PRO B 1 306 ? 63.622  89.671  78.737  1.00 69.14  ? 306 PRO B CB  1 
ATOM   7371  C  CG  . PRO B 1 306 ? 62.841  88.674  77.952  1.00 69.14  ? 306 PRO B CG  1 
ATOM   7372  C  CD  . PRO B 1 306 ? 63.778  87.550  77.664  1.00 69.14  ? 306 PRO B CD  1 
ATOM   7373  N  N   . SER B 1 307 ? 66.820  90.367  79.710  1.00 66.75  ? 307 SER B N   1 
ATOM   7374  C  CA  . SER B 1 307 ? 67.867  90.276  80.711  1.00 66.75  ? 307 SER B CA  1 
ATOM   7375  C  C   . SER B 1 307 ? 67.324  90.242  82.129  1.00 66.75  ? 307 SER B C   1 
ATOM   7376  O  O   . SER B 1 307 ? 67.977  89.672  83.007  1.00 66.75  ? 307 SER B O   1 
ATOM   7377  C  CB  . SER B 1 307 ? 68.841  91.435  80.543  1.00 66.75  ? 307 SER B CB  1 
ATOM   7378  O  OG  . SER B 1 307 ? 70.055  91.155  81.207  1.00 66.75  ? 307 SER B OG  1 
ATOM   7379  N  N   . TYR B 1 308 ? 66.150  90.824  82.376  1.00 72.05  ? 308 TYR B N   1 
ATOM   7380  C  CA  . TYR B 1 308 ? 65.619  90.814  83.733  1.00 72.05  ? 308 TYR B CA  1 
ATOM   7381  C  C   . TYR B 1 308 ? 65.159  89.429  84.167  1.00 72.05  ? 308 TYR B C   1 
ATOM   7382  O  O   . TYR B 1 308 ? 65.213  89.119  85.361  1.00 72.05  ? 308 TYR B O   1 
ATOM   7383  C  CB  . TYR B 1 308 ? 64.480  91.822  83.882  1.00 72.05  ? 308 TYR B CB  1 
ATOM   7384  C  CG  . TYR B 1 308 ? 63.287  91.609  82.979  1.00 72.05  ? 308 TYR B CG  1 
ATOM   7385  C  CD1 . TYR B 1 308 ? 63.218  92.231  81.742  1.00 72.05  ? 308 TYR B CD1 1 
ATOM   7386  C  CD2 . TYR B 1 308 ? 62.221  90.807  83.368  1.00 72.05  ? 308 TYR B CD2 1 
ATOM   7387  C  CE1 . TYR B 1 308 ? 62.132  92.058  80.917  1.00 72.05  ? 308 TYR B CE1 1 
ATOM   7388  C  CE2 . TYR B 1 308 ? 61.135  90.621  82.545  1.00 72.05  ? 308 TYR B CE2 1 
ATOM   7389  C  CZ  . TYR B 1 308 ? 61.098  91.249  81.321  1.00 72.05  ? 308 TYR B CZ  1 
ATOM   7390  O  OH  . TYR B 1 308 ? 60.016  91.074  80.495  1.00 72.05  ? 308 TYR B OH  1 
ATOM   7391  N  N   . LYS B 1 309 ? 64.692  88.591  83.241  1.00 70.09  ? 309 LYS B N   1 
ATOM   7392  C  CA  . LYS B 1 309 ? 64.341  87.230  83.634  1.00 70.09  ? 309 LYS B CA  1 
ATOM   7393  C  C   . LYS B 1 309 ? 65.571  86.418  84.008  1.00 70.09  ? 309 LYS B C   1 
ATOM   7394  O  O   . LYS B 1 309 ? 65.503  85.563  84.897  1.00 70.09  ? 309 LYS B O   1 
ATOM   7395  C  CB  . LYS B 1 309 ? 63.525  86.514  82.563  1.00 70.09  ? 309 LYS B CB  1 
ATOM   7396  C  CG  . LYS B 1 309 ? 62.135  87.079  82.365  1.00 70.09  ? 309 LYS B CG  1 
ATOM   7397  C  CD  . LYS B 1 309 ? 61.347  86.195  81.414  1.00 70.09  ? 309 LYS B CD  1 
ATOM   7398  C  CE  . LYS B 1 309 ? 59.888  86.599  81.342  1.00 70.09  ? 309 LYS B CE  1 
ATOM   7399  N  NZ  . LYS B 1 309 ? 59.112  85.640  80.512  1.00 70.09  ? 309 LYS B NZ  1 
ATOM   7400  N  N   . ARG B 1 310 ? 66.685  86.631  83.316  1.00 60.61  ? 310 ARG B N   1 
ATOM   7401  C  CA  . ARG B 1 310 ? 67.903  85.930  83.695  1.00 60.61  ? 310 ARG B CA  1 
ATOM   7402  C  C   . ARG B 1 310 ? 68.421  86.409  85.044  1.00 60.61  ? 310 ARG B C   1 
ATOM   7403  O  O   . ARG B 1 310 ? 68.838  85.592  85.873  1.00 60.61  ? 310 ARG B O   1 
ATOM   7404  C  CB  . ARG B 1 310 ? 68.967  86.089  82.614  1.00 60.61  ? 310 ARG B CB  1 
ATOM   7405  C  CG  . ARG B 1 310 ? 70.312  85.553  83.021  1.00 60.61  ? 310 ARG B CG  1 
ATOM   7406  C  CD  . ARG B 1 310 ? 71.102  85.050  81.857  1.00 60.61  ? 310 ARG B CD  1 
ATOM   7407  N  NE  . ARG B 1 310 ? 71.492  86.122  80.965  1.00 60.61  ? 310 ARG B NE  1 
ATOM   7408  C  CZ  . ARG B 1 310 ? 71.096  86.186  79.706  1.00 60.61  ? 310 ARG B CZ  1 
ATOM   7409  N  NH1 . ARG B 1 310 ? 70.307  85.242  79.221  1.00 60.61  ? 310 ARG B NH1 1 
ATOM   7410  N  NH2 . ARG B 1 310 ? 71.482  87.187  78.934  1.00 60.61  ? 310 ARG B NH2 1 
ATOM   7411  N  N   . GLN B 1 311 ? 68.364  87.716  85.304  1.00 60.39  ? 311 GLN B N   1 
ATOM   7412  C  CA  . GLN B 1 311 ? 68.822  88.214  86.596  1.00 60.39  ? 311 GLN B CA  1 
ATOM   7413  C  C   . GLN B 1 311 ? 67.917  87.787  87.738  1.00 60.39  ? 311 GLN B C   1 
ATOM   7414  O  O   . GLN B 1 311 ? 68.405  87.537  88.844  1.00 60.39  ? 311 GLN B O   1 
ATOM   7415  C  CB  . GLN B 1 311 ? 68.885  89.735  86.578  1.00 60.39  ? 311 GLN B CB  1 
ATOM   7416  C  CG  . GLN B 1 311 ? 69.913  90.342  85.665  1.00 60.39  ? 311 GLN B CG  1 
ATOM   7417  C  CD  . GLN B 1 311 ? 71.309  89.942  86.033  1.00 60.39  ? 311 GLN B CD  1 
ATOM   7418  O  OE1 . GLN B 1 311 ? 71.658  89.886  87.209  1.00 60.39  ? 311 GLN B OE1 1 
ATOM   7419  N  NE2 . GLN B 1 311 ? 72.135  89.695  85.029  1.00 60.39  ? 311 GLN B NE2 1 
ATOM   7420  N  N   . LEU B 1 312 ? 66.615  87.667  87.491  1.00 65.50  ? 312 LEU B N   1 
ATOM   7421  C  CA  . LEU B 1 312 ? 65.714  87.122  88.500  1.00 65.50  ? 312 LEU B CA  1 
ATOM   7422  C  C   . LEU B 1 312 ? 65.963  85.653  88.784  1.00 65.50  ? 312 LEU B C   1 
ATOM   7423  O  O   . LEU B 1 312 ? 65.974  85.248  89.949  1.00 65.50  ? 312 LEU B O   1 
ATOM   7424  C  CB  . LEU B 1 312 ? 64.265  87.329  88.081  1.00 65.50  ? 312 LEU B CB  1 
ATOM   7425  C  CG  . LEU B 1 312 ? 63.706  88.721  88.353  1.00 65.50  ? 312 LEU B CG  1 
ATOM   7426  C  CD1 . LEU B 1 312 ? 62.211  88.713  88.187  1.00 65.50  ? 312 LEU B CD1 1 
ATOM   7427  C  CD2 . LEU B 1 312 ? 64.065  89.167  89.756  1.00 65.50  ? 312 LEU B CD2 1 
ATOM   7428  N  N   . ARG B 1 313 ? 66.155  84.846  87.743  1.00 60.69  ? 313 ARG B N   1 
ATOM   7429  C  CA  . ARG B 1 313 ? 66.389  83.422  87.936  1.00 60.69  ? 313 ARG B CA  1 
ATOM   7430  C  C   . ARG B 1 313 ? 67.697  83.140  88.660  1.00 60.69  ? 313 ARG B C   1 
ATOM   7431  O  O   . ARG B 1 313 ? 67.806  82.119  89.344  1.00 60.69  ? 313 ARG B O   1 
ATOM   7432  C  CB  . ARG B 1 313 ? 66.345  82.724  86.580  1.00 60.69  ? 313 ARG B CB  1 
ATOM   7433  C  CG  . ARG B 1 313 ? 64.933  82.475  86.105  1.00 60.69  ? 313 ARG B CG  1 
ATOM   7434  C  CD  . ARG B 1 313 ? 64.858  81.951  84.682  1.00 60.69  ? 313 ARG B CD  1 
ATOM   7435  N  NE  . ARG B 1 313 ? 63.914  80.846  84.561  1.00 60.69  ? 313 ARG B NE  1 
ATOM   7436  C  CZ  . ARG B 1 313 ? 63.605  80.241  83.421  1.00 60.69  ? 313 ARG B CZ  1 
ATOM   7437  N  NH1 . ARG B 1 313 ? 64.161  80.636  82.287  1.00 60.69  ? 313 ARG B NH1 1 
ATOM   7438  N  NH2 . ARG B 1 313 ? 62.740  79.238  83.416  1.00 60.69  ? 313 ARG B NH2 1 
ATOM   7439  N  N   . ILE B 1 314 ? 68.687  84.024  88.556  1.00 59.31  ? 314 ILE B N   1 
ATOM   7440  C  CA  . ILE B 1 314 ? 69.872  83.876  89.391  1.00 59.31  ? 314 ILE B CA  1 
ATOM   7441  C  C   . ILE B 1 314 ? 69.592  84.339  90.813  1.00 59.31  ? 314 ILE B C   1 
ATOM   7442  O  O   . ILE B 1 314 ? 69.627  83.542  91.756  1.00 59.31  ? 314 ILE B O   1 
ATOM   7443  C  CB  . ILE B 1 314 ? 71.066  84.621  88.778  1.00 59.31  ? 314 ILE B CB  1 
ATOM   7444  C  CG1 . ILE B 1 314 ? 71.445  83.988  87.447  1.00 59.31  ? 314 ILE B CG1 1 
ATOM   7445  C  CG2 . ILE B 1 314 ? 72.250  84.544  89.699  1.00 59.31  ? 314 ILE B CG2 1 
ATOM   7446  C  CD1 . ILE B 1 314 ? 72.590  84.684  86.755  1.00 59.31  ? 314 ILE B CD1 1 
ATOM   7447  N  N   . TYR B 1 315 ? 69.332  85.634  90.994  1.00 64.37  ? 315 TYR B N   1 
ATOM   7448  C  CA  . TYR B 1 315 ? 69.356  86.247  92.315  1.00 64.37  ? 315 TYR B CA  1 
ATOM   7449  C  C   . TYR B 1 315 ? 68.086  86.011  93.125  1.00 64.37  ? 315 TYR B C   1 
ATOM   7450  O  O   . TYR B 1 315 ? 67.970  86.557  94.224  1.00 64.37  ? 315 TYR B O   1 
ATOM   7451  C  CB  . TYR B 1 315 ? 69.616  87.749  92.218  1.00 64.37  ? 315 TYR B CB  1 
ATOM   7452  C  CG  . TYR B 1 315 ? 71.022  88.116  91.831  1.00 64.37  ? 315 TYR B CG  1 
ATOM   7453  C  CD1 . TYR B 1 315 ? 72.078  87.285  92.146  1.00 64.37  ? 315 TYR B CD1 1 
ATOM   7454  C  CD2 . TYR B 1 315 ? 71.299  89.314  91.180  1.00 64.37  ? 315 TYR B CD2 1 
ATOM   7455  C  CE1 . TYR B 1 315 ? 73.379  87.616  91.802  1.00 64.37  ? 315 TYR B CE1 1 
ATOM   7456  C  CE2 . TYR B 1 315 ? 72.596  89.658  90.832  1.00 64.37  ? 315 TYR B CE2 1 
ATOM   7457  C  CZ  . TYR B 1 315 ? 73.633  88.800  91.148  1.00 64.37  ? 315 TYR B CZ  1 
ATOM   7458  O  OH  . TYR B 1 315 ? 74.931  89.111  90.814  1.00 64.37  ? 315 TYR B OH  1 
ATOM   7459  N  N   . LEU B 1 316 ? 67.125  85.236  92.622  1.00 66.06  ? 316 LEU B N   1 
ATOM   7460  C  CA  . LEU B 1 316 ? 66.000  84.871  93.480  1.00 66.06  ? 316 LEU B CA  1 
ATOM   7461  C  C   . LEU B 1 316 ? 65.761  83.387  93.648  1.00 66.06  ? 316 LEU B C   1 
ATOM   7462  O  O   . LEU B 1 316 ? 65.029  83.014  94.566  1.00 66.06  ? 316 LEU B O   1 
ATOM   7463  C  CB  . LEU B 1 316 ? 64.709  85.498  92.958  1.00 66.06  ? 316 LEU B CB  1 
ATOM   7464  C  CG  . LEU B 1 316 ? 64.374  86.912  93.418  1.00 66.06  ? 316 LEU B CG  1 
ATOM   7465  C  CD1 . LEU B 1 316 ? 62.912  87.195  93.125  1.00 66.06  ? 316 LEU B CD1 1 
ATOM   7466  C  CD2 . LEU B 1 316 ? 64.686  87.115  94.893  1.00 66.06  ? 316 LEU B CD2 1 
ATOM   7467  N  N   . VAL B 1 317 ? 66.301  82.517  92.808  1.00 62.69  ? 317 VAL B N   1 
ATOM   7468  C  CA  . VAL B 1 317 ? 66.101  81.089  92.951  1.00 62.69  ? 317 VAL B CA  1 
ATOM   7469  C  C   . VAL B 1 317 ? 67.412  80.367  93.213  1.00 62.69  ? 317 VAL B C   1 
ATOM   7470  O  O   . VAL B 1 317 ? 67.501  79.547  94.129  1.00 62.69  ? 317 VAL B O   1 
ATOM   7471  C  CB  . VAL B 1 317 ? 65.391  80.506  91.716  1.00 62.69  ? 317 VAL B CB  1 
ATOM   7472  C  CG1 . VAL B 1 317 ? 65.232  79.013  91.865  1.00 62.69  ? 317 VAL B CG1 1 
ATOM   7473  C  CG2 . VAL B 1 317 ? 64.041  81.150  91.554  1.00 62.69  ? 317 VAL B CG2 1 
ATOM   7474  N  N   . SER B 1 318 ? 68.452  80.699  92.450  1.00 57.38  ? 318 SER B N   1 
ATOM   7475  C  CA  . SER B 1 318 ? 69.712  79.983  92.570  1.00 57.38  ? 318 SER B CA  1 
ATOM   7476  C  C   . SER B 1 318 ? 70.457  80.383  93.828  1.00 57.38  ? 318 SER B C   1 
ATOM   7477  O  O   . SER B 1 318 ? 70.889  79.517  94.595  1.00 57.38  ? 318 SER B O   1 
ATOM   7478  C  CB  . SER B 1 318 ? 70.574  80.265  91.351  1.00 57.38  ? 318 SER B CB  1 
ATOM   7479  O  OG  . SER B 1 318 ? 69.762  80.734  90.300  1.00 57.38  ? 318 SER B OG  1 
ATOM   7480  N  N   . LEU B 1 319 ? 70.585  81.679  94.061  1.00 56.86  ? 319 LEU B N   1 
ATOM   7481  C  CA  . LEU B 1 319 ? 71.275  82.208  95.226  1.00 56.86  ? 319 LEU B CA  1 
ATOM   7482  C  C   . LEU B 1 319 ? 70.578  81.835  96.540  1.00 56.86  ? 319 LEU B C   1 
ATOM   7483  O  O   . LEU B 1 319 ? 71.284  81.543  97.512  1.00 56.86  ? 319 LEU B O   1 
ATOM   7484  C  CB  . LEU B 1 319 ? 71.451  83.720  95.066  1.00 56.86  ? 319 LEU B CB  1 
ATOM   7485  C  CG  . LEU B 1 319 ? 72.015  84.505  96.233  1.00 56.86  ? 319 LEU B CG  1 
ATOM   7486  C  CD1 . LEU B 1 319 ? 73.406  84.024  96.515  1.00 56.86  ? 319 LEU B CD1 1 
ATOM   7487  C  CD2 . LEU B 1 319 ? 72.037  85.967  95.877  1.00 56.86  ? 319 LEU B CD2 1 
ATOM   7488  N  N   . PRO B 1 320 ? 69.239  81.837  96.658  1.00 60.50  ? 320 PRO B N   1 
ATOM   7489  C  CA  . PRO B 1 320 ? 68.649  81.213  97.851  1.00 60.50  ? 320 PRO B CA  1 
ATOM   7490  C  C   . PRO B 1 320 ? 68.865  79.718  97.956  1.00 60.50  ? 320 PRO B C   1 
ATOM   7491  O  O   . PRO B 1 320 ? 68.963  79.205  99.076  1.00 60.50  ? 320 PRO B O   1 
ATOM   7492  C  CB  . PRO B 1 320 ? 67.163  81.548  97.716  1.00 60.50  ? 320 PRO B CB  1 
ATOM   7493  C  CG  . PRO B 1 320 ? 67.165  82.801  97.033  1.00 60.50  ? 320 PRO B CG  1 
ATOM   7494  C  CD  . PRO B 1 320 ? 68.211  82.660  95.994  1.00 60.50  ? 320 PRO B CD  1 
ATOM   7495  N  N   . PHE B 1 321 ? 68.939  78.996  96.837  1.00 57.59  ? 321 PHE B N   1 
ATOM   7496  C  CA  . PHE B 1 321 ? 69.202  77.565  96.933  1.00 57.59  ? 321 PHE B CA  1 
ATOM   7497  C  C   . PHE B 1 321 ? 70.633  77.289  97.368  1.00 57.59  ? 321 PHE B C   1 
ATOM   7498  O  O   . PHE B 1 321 ? 70.888  76.315  98.086  1.00 57.59  ? 321 PHE B O   1 
ATOM   7499  C  CB  . PHE B 1 321 ? 68.904  76.851  95.626  1.00 57.59  ? 321 PHE B CB  1 
ATOM   7500  C  CG  . PHE B 1 321 ? 69.077  75.372  95.726  1.00 57.59  ? 321 PHE B CG  1 
ATOM   7501  C  CD1 . PHE B 1 321 ? 68.111  74.611  96.352  1.00 57.59  ? 321 PHE B CD1 1 
ATOM   7502  C  CD2 . PHE B 1 321 ? 70.208  74.744  95.233  1.00 57.59  ? 321 PHE B CD2 1 
ATOM   7503  C  CE1 . PHE B 1 321 ? 68.259  73.250  96.475  1.00 57.59  ? 321 PHE B CE1 1 
ATOM   7504  C  CE2 . PHE B 1 321 ? 70.361  73.379  95.355  1.00 57.59  ? 321 PHE B CE2 1 
ATOM   7505  C  CZ  . PHE B 1 321 ? 69.385  72.632  95.975  1.00 57.59  ? 321 PHE B CZ  1 
ATOM   7506  N  N   . VAL B 1 322 ? 71.582  78.106  96.913  1.00 49.55  ? 322 VAL B N   1 
ATOM   7507  C  CA  . VAL B 1 322 ? 72.962  77.943  97.353  1.00 49.55  ? 322 VAL B CA  1 
ATOM   7508  C  C   . VAL B 1 322 ? 73.072  78.264  98.832  1.00 49.55  ? 322 VAL B C   1 
ATOM   7509  O  O   . VAL B 1 322 ? 73.752  77.556  99.584  1.00 49.55  ? 322 VAL B O   1 
ATOM   7510  C  CB  . VAL B 1 322 ? 73.900  78.823  96.511  1.00 49.55  ? 322 VAL B CB  1 
ATOM   7511  C  CG1 . VAL B 1 322 ? 75.315  78.775  97.036  1.00 49.55  ? 322 VAL B CG1 1 
ATOM   7512  C  CG2 . VAL B 1 322 ? 73.892  78.340  95.104  1.00 49.55  ? 322 VAL B CG2 1 
ATOM   7513  N  N   . CYS B 1 323 ? 72.339  79.282  99.285  1.00 49.78  ? 323 CYS B N   1 
ATOM   7514  C  CA  . CYS B 1 323 ? 72.349  79.632  100.697 1.00 49.78  ? 323 CYS B CA  1 
ATOM   7515  C  C   . CYS B 1 323 ? 71.712  78.548  101.551 1.00 49.78  ? 323 CYS B C   1 
ATOM   7516  O  O   . CYS B 1 323 ? 72.162  78.308  102.675 1.00 49.78  ? 323 CYS B O   1 
ATOM   7517  C  CB  . CYS B 1 323 ? 71.653  80.969  100.903 1.00 49.78  ? 323 CYS B CB  1 
ATOM   7518  S  SG  . CYS B 1 323 ? 72.676  82.380  100.435 1.00 49.78  ? 323 CYS B SG  1 
ATOM   7519  N  N   . LEU B 1 324 ? 70.656  77.902  101.057 1.00 47.91  ? 324 LEU B N   1 
ATOM   7520  C  CA  . LEU B 1 324 ? 70.092  76.783  101.806 1.00 47.91  ? 324 LEU B CA  1 
ATOM   7521  C  C   . LEU B 1 324 ? 71.068  75.619  101.872 1.00 47.91  ? 324 LEU B C   1 
ATOM   7522  O  O   . LEU B 1 324 ? 71.219  74.989  102.925 1.00 47.91  ? 324 LEU B O   1 
ATOM   7523  C  CB  . LEU B 1 324 ? 68.765  76.327  101.195 1.00 47.91  ? 324 LEU B CB  1 
ATOM   7524  C  CG  . LEU B 1 324 ? 68.242  74.940  101.602 1.00 47.91  ? 324 LEU B CG  1 
ATOM   7525  C  CD1 . LEU B 1 324 ? 67.675  74.962  102.995 1.00 47.91  ? 324 LEU B CD1 1 
ATOM   7526  C  CD2 . LEU B 1 324 ? 67.195  74.440  100.636 1.00 47.91  ? 324 LEU B CD2 1 
ATOM   7527  N  N   . CYS B 1 325 ? 71.788  75.365  100.780 1.00 44.70  ? 325 CYS B N   1 
ATOM   7528  C  CA  . CYS B 1 325 ? 72.750  74.271  100.780 1.00 44.70  ? 325 CYS B CA  1 
ATOM   7529  C  C   . CYS B 1 325 ? 73.962  74.564  101.649 1.00 44.70  ? 325 CYS B C   1 
ATOM   7530  O  O   . CYS B 1 325 ? 74.533  73.636  102.231 1.00 44.70  ? 325 CYS B O   1 
ATOM   7531  C  CB  . CYS B 1 325 ? 73.176  73.952  99.357  1.00 44.70  ? 325 CYS B CB  1 
ATOM   7532  S  SG  . CYS B 1 325 ? 72.006  72.905  98.498  1.00 44.70  ? 325 CYS B SG  1 
ATOM   7533  N  N   . LEU B 1 326 ? 74.390  75.824  101.734 1.00 42.92  ? 326 LEU B N   1 
ATOM   7534  C  CA  . LEU B 1 326 ? 75.462  76.141  102.668 1.00 42.92  ? 326 LEU B CA  1 
ATOM   7535  C  C   . LEU B 1 326 ? 75.008  75.982  104.108 1.00 42.92  ? 326 LEU B C   1 
ATOM   7536  O  O   . LEU B 1 326 ? 75.769  75.481  104.943 1.00 42.92  ? 326 LEU B O   1 
ATOM   7537  C  CB  . LEU B 1 326 ? 75.970  77.561  102.463 1.00 42.92  ? 326 LEU B CB  1 
ATOM   7538  C  CG  . LEU B 1 326 ? 76.622  77.940  101.152 1.00 42.92  ? 326 LEU B CG  1 
ATOM   7539  C  CD1 . LEU B 1 326 ? 77.340  79.237  101.350 1.00 42.92  ? 326 LEU B CD1 1 
ATOM   7540  C  CD2 . LEU B 1 326 ? 77.577  76.885  100.739 1.00 42.92  ? 326 LEU B CD2 1 
ATOM   7541  N  N   . TYR B 1 327 ? 73.766  76.378  104.411 1.00 52.03  ? 327 TYR B N   1 
ATOM   7542  C  CA  . TYR B 1 327 ? 73.238  76.182  105.758 1.00 52.03  ? 327 TYR B CA  1 
ATOM   7543  C  C   . TYR B 1 327 ? 73.098  74.702  106.053 1.00 52.03  ? 327 TYR B C   1 
ATOM   7544  O  O   . TYR B 1 327 ? 73.350  74.252  107.175 1.00 52.03  ? 327 TYR B O   1 
ATOM   7545  C  CB  . TYR B 1 327 ? 71.905  76.906  105.934 1.00 52.03  ? 327 TYR B CB  1 
ATOM   7546  C  CG  . TYR B 1 327 ? 71.157  76.503  107.184 1.00 52.03  ? 327 TYR B CG  1 
ATOM   7547  C  CD1 . TYR B 1 327 ? 71.627  76.893  108.429 1.00 52.03  ? 327 TYR B CD1 1 
ATOM   7548  C  CD2 . TYR B 1 327 ? 69.992  75.760  107.127 1.00 52.03  ? 327 TYR B CD2 1 
ATOM   7549  C  CE1 . TYR B 1 327 ? 70.974  76.547  109.577 1.00 52.03  ? 327 TYR B CE1 1 
ATOM   7550  C  CE2 . TYR B 1 327 ? 69.323  75.409  108.279 1.00 52.03  ? 327 TYR B CE2 1 
ATOM   7551  C  CZ  . TYR B 1 327 ? 69.824  75.807  109.498 1.00 52.03  ? 327 TYR B CZ  1 
ATOM   7552  O  OH  . TYR B 1 327 ? 69.174  75.468  110.656 1.00 52.03  ? 327 TYR B OH  1 
ATOM   7553  N  N   . PHE B 1 328 ? 72.709  73.932  105.048 1.00 49.19  ? 328 PHE B N   1 
ATOM   7554  C  CA  . PHE B 1 328 ? 72.600  72.500  105.228 1.00 49.19  ? 328 PHE B CA  1 
ATOM   7555  C  C   . PHE B 1 328 ? 73.971  71.867  105.386 1.00 49.19  ? 328 PHE B C   1 
ATOM   7556  O  O   . PHE B 1 328 ? 74.118  70.891  106.125 1.00 49.19  ? 328 PHE B O   1 
ATOM   7557  C  CB  . PHE B 1 328 ? 71.888  71.884  104.033 1.00 49.19  ? 328 PHE B CB  1 
ATOM   7558  C  CG  . PHE B 1 328 ? 71.596  70.437  104.192 1.00 49.19  ? 328 PHE B CG  1 
ATOM   7559  C  CD1 . PHE B 1 328 ? 70.659  70.006  105.110 1.00 49.19  ? 328 PHE B CD1 1 
ATOM   7560  C  CD2 . PHE B 1 328 ? 72.295  69.501  103.457 1.00 49.19  ? 328 PHE B CD2 1 
ATOM   7561  C  CE1 . PHE B 1 328 ? 70.393  68.663  105.267 1.00 49.19  ? 328 PHE B CE1 1 
ATOM   7562  C  CE2 . PHE B 1 328 ? 72.044  68.162  103.611 1.00 49.19  ? 328 PHE B CE2 1 
ATOM   7563  C  CZ  . PHE B 1 328 ? 71.089  67.740  104.520 1.00 49.19  ? 328 PHE B CZ  1 
ATOM   7564  N  N   . SER B 1 329 ? 74.983  72.425  104.720 1.00 42.52  ? 329 SER B N   1 
ATOM   7565  C  CA  . SER B 1 329 ? 76.351  71.956  104.901 1.00 42.52  ? 329 SER B CA  1 
ATOM   7566  C  C   . SER B 1 329 ? 76.859  72.214  106.305 1.00 42.52  ? 329 SER B C   1 
ATOM   7567  O  O   . SER B 1 329 ? 77.566  71.380  106.878 1.00 42.52  ? 329 SER B O   1 
ATOM   7568  C  CB  . SER B 1 329 ? 77.272  72.633  103.900 1.00 42.52  ? 329 SER B CB  1 
ATOM   7569  O  OG  . SER B 1 329 ? 78.608  72.220  104.108 1.00 42.52  ? 329 SER B OG  1 
ATOM   7570  N  N   . LEU B 1 330 ? 76.516  73.365  106.868 1.00 46.74  ? 330 LEU B N   1 
ATOM   7571  C  CA  . LEU B 1 330 ? 76.864  73.650  108.251 1.00 46.74  ? 330 LEU B CA  1 
ATOM   7572  C  C   . LEU B 1 330 ? 76.134  72.730  109.212 1.00 46.74  ? 330 LEU B C   1 
ATOM   7573  O  O   . LEU B 1 330 ? 76.682  72.373  110.260 1.00 46.74  ? 330 LEU B O   1 
ATOM   7574  C  CB  . LEU B 1 330 ? 76.572  75.110  108.570 1.00 46.74  ? 330 LEU B CB  1 
ATOM   7575  C  CG  . LEU B 1 330 ? 77.400  76.121  107.781 1.00 46.74  ? 330 LEU B CG  1 
ATOM   7576  C  CD1 . LEU B 1 330 ? 77.316  77.470  108.434 1.00 46.74  ? 330 LEU B CD1 1 
ATOM   7577  C  CD2 . LEU B 1 330 ? 78.853  75.692  107.680 1.00 46.74  ? 330 LEU B CD2 1 
ATOM   7578  N  N   . TYR B 1 331 ? 74.916  72.324  108.866 1.00 50.06  ? 331 TYR B N   1 
ATOM   7579  C  CA  . TYR B 1 331 ? 74.160  71.431  109.731 1.00 50.06  ? 331 TYR B CA  1 
ATOM   7580  C  C   . TYR B 1 331 ? 74.774  70.041  109.771 1.00 50.06  ? 331 TYR B C   1 
ATOM   7581  O  O   . TYR B 1 331 ? 74.792  69.400  110.826 1.00 50.06  ? 331 TYR B O   1 
ATOM   7582  C  CB  . TYR B 1 331 ? 72.718  71.362  109.253 1.00 50.06  ? 331 TYR B CB  1 
ATOM   7583  C  CG  . TYR B 1 331 ? 71.832  70.493  110.094 1.00 50.06  ? 331 TYR B CG  1 
ATOM   7584  C  CD1 . TYR B 1 331 ? 71.542  70.838  111.399 1.00 50.06  ? 331 TYR B CD1 1 
ATOM   7585  C  CD2 . TYR B 1 331 ? 71.278  69.333  109.584 1.00 50.06  ? 331 TYR B CD2 1 
ATOM   7586  C  CE1 . TYR B 1 331 ? 70.726  70.051  112.178 1.00 50.06  ? 331 TYR B CE1 1 
ATOM   7587  C  CE2 . TYR B 1 331 ? 70.458  68.540  110.353 1.00 50.06  ? 331 TYR B CE2 1 
ATOM   7588  C  CZ  . TYR B 1 331 ? 70.188  68.905  111.651 1.00 50.06  ? 331 TYR B CZ  1 
ATOM   7589  O  OH  . TYR B 1 331 ? 69.374  68.124  112.434 1.00 50.06  ? 331 TYR B OH  1 
ATOM   7590  N  N   . VAL B 1 332 ? 75.264  69.549  108.634 1.00 48.04  ? 332 VAL B N   1 
ATOM   7591  C  CA  . VAL B 1 332 ? 75.989  68.283  108.638 1.00 48.04  ? 332 VAL B CA  1 
ATOM   7592  C  C   . VAL B 1 332 ? 77.307  68.389  109.403 1.00 48.04  ? 332 VAL B C   1 
ATOM   7593  O  O   . VAL B 1 332 ? 77.711  67.437  110.082 1.00 48.04  ? 332 VAL B O   1 
ATOM   7594  C  CB  . VAL B 1 332 ? 76.209  67.825  107.180 1.00 48.04  ? 332 VAL B CB  1 
ATOM   7595  C  CG1 . VAL B 1 332 ? 76.980  66.521  107.100 1.00 48.04  ? 332 VAL B CG1 1 
ATOM   7596  C  CG2 . VAL B 1 332 ? 74.885  67.681  106.470 1.00 48.04  ? 332 VAL B CG2 1 
ATOM   7597  N  N   . MET B 1 333 ? 77.963  69.552  109.365 1.00 46.81  ? 333 MET B N   1 
ATOM   7598  C  CA  . MET B 1 333 ? 79.167  69.762  110.166 1.00 46.81  ? 333 MET B CA  1 
ATOM   7599  C  C   . MET B 1 333 ? 78.901  69.693  111.666 1.00 46.81  ? 333 MET B C   1 
ATOM   7600  O  O   . MET B 1 333 ? 79.652  69.045  112.403 1.00 46.81  ? 333 MET B O   1 
ATOM   7601  C  CB  . MET B 1 333 ? 79.811  71.098  109.820 1.00 46.81  ? 333 MET B CB  1 
ATOM   7602  C  CG  . MET B 1 333 ? 81.051  71.356  110.639 1.00 46.81  ? 333 MET B CG  1 
ATOM   7603  S  SD  . MET B 1 333 ? 81.683  73.019  110.515 1.00 46.81  ? 333 MET B SD  1 
ATOM   7604  C  CE  . MET B 1 333 ? 80.560  73.862  111.619 1.00 46.81  ? 333 MET B CE  1 
ATOM   7605  N  N   . MET B 1 334 ? 77.803  70.290  112.124 1.00 51.50  ? 334 MET B N   1 
ATOM   7606  C  CA  . MET B 1 334 ? 77.475  70.261  113.546 1.00 51.50  ? 334 MET B CA  1 
ATOM   7607  C  C   . MET B 1 334 ? 77.111  68.869  114.032 1.00 51.50  ? 334 MET B C   1 
ATOM   7608  O  O   . MET B 1 334 ? 77.397  68.528  115.184 1.00 51.50  ? 334 MET B O   1 
ATOM   7609  C  CB  . MET B 1 334 ? 76.321  71.214  113.840 1.00 51.50  ? 334 MET B CB  1 
ATOM   7610  C  CG  . MET B 1 334 ? 76.628  72.670  113.606 1.00 51.50  ? 334 MET B CG  1 
ATOM   7611  S  SD  . MET B 1 334 ? 78.183  73.198  114.337 1.00 51.50  ? 334 MET B SD  1 
ATOM   7612  C  CE  . MET B 1 334 ? 77.800  73.090  116.080 1.00 51.50  ? 334 MET B CE  1 
ATOM   7613  N  N   . ILE B 1 335 ? 76.489  68.065  113.174 1.00 51.28  ? 335 ILE B N   1 
ATOM   7614  C  CA  . ILE B 1 335 ? 76.219  66.665  113.484 1.00 51.28  ? 335 ILE B CA  1 
ATOM   7615  C  C   . ILE B 1 335 ? 77.511  65.888  113.704 1.00 51.28  ? 335 ILE B C   1 
ATOM   7616  O  O   . ILE B 1 335 ? 77.611  65.073  114.630 1.00 51.28  ? 335 ILE B O   1 
ATOM   7617  C  CB  . ILE B 1 335 ? 75.364  66.054  112.363 1.00 51.28  ? 335 ILE B CB  1 
ATOM   7618  C  CG1 . ILE B 1 335 ? 73.959  66.630  112.426 1.00 51.28  ? 335 ILE B CG1 1 
ATOM   7619  C  CG2 . ILE B 1 335 ? 75.271  64.553  112.493 1.00 51.28  ? 335 ILE B CG2 1 
ATOM   7620  C  CD1 . ILE B 1 335 ? 73.079  66.187  111.293 1.00 51.28  ? 335 ILE B CD1 1 
ATOM   7621  N  N   . TYR B 1 336 ? 78.530  66.164  112.893 1.00 47.82  ? 336 TYR B N   1 
ATOM   7622  C  CA  . TYR B 1 336 ? 79.819  65.494  113.031 1.00 47.82  ? 336 TYR B CA  1 
ATOM   7623  C  C   . TYR B 1 336 ? 80.506  65.815  114.349 1.00 47.82  ? 336 TYR B C   1 
ATOM   7624  O  O   . TYR B 1 336 ? 81.159  64.947  114.937 1.00 47.82  ? 336 TYR B O   1 
ATOM   7625  C  CB  . TYR B 1 336 ? 80.724  65.902  111.879 1.00 47.82  ? 336 TYR B CB  1 
ATOM   7626  C  CG  . TYR B 1 336 ? 82.203  65.756  112.137 1.00 47.82  ? 336 TYR B CG  1 
ATOM   7627  C  CD1 . TYR B 1 336 ? 82.788  64.509  112.227 1.00 47.82  ? 336 TYR B CD1 1 
ATOM   7628  C  CD2 . TYR B 1 336 ? 83.007  66.866  112.315 1.00 47.82  ? 336 TYR B CD2 1 
ATOM   7629  C  CE1 . TYR B 1 336 ? 84.130  64.373  112.456 1.00 47.82  ? 336 TYR B CE1 1 
ATOM   7630  C  CE2 . TYR B 1 336 ? 84.349  66.739  112.548 1.00 47.82  ? 336 TYR B CE2 1 
ATOM   7631  C  CZ  . TYR B 1 336 ? 84.902  65.489  112.618 1.00 47.82  ? 336 TYR B CZ  1 
ATOM   7632  O  OH  . TYR B 1 336 ? 86.245  65.351  112.846 1.00 47.82  ? 336 TYR B OH  1 
ATOM   7633  N  N   . PHE B 1 337 ? 80.372  67.041  114.838 1.00 49.51  ? 337 PHE B N   1 
ATOM   7634  C  CA  . PHE B 1 337 ? 81.038  67.376  116.090 1.00 49.51  ? 337 PHE B CA  1 
ATOM   7635  C  C   . PHE B 1 337 ? 80.369  66.748  117.303 1.00 49.51  ? 337 PHE B C   1 
ATOM   7636  O  O   . PHE B 1 337 ? 81.059  66.412  118.272 1.00 49.51  ? 337 PHE B O   1 
ATOM   7637  C  CB  . PHE B 1 337 ? 81.152  68.879  116.192 1.00 49.51  ? 337 PHE B CB  1 
ATOM   7638  C  CG  . PHE B 1 337 ? 82.334  69.377  115.474 1.00 49.51  ? 337 PHE B CG  1 
ATOM   7639  C  CD1 . PHE B 1 337 ? 83.594  69.130  115.954 1.00 49.51  ? 337 PHE B CD1 1 
ATOM   7640  C  CD2 . PHE B 1 337 ? 82.192  69.952  114.229 1.00 49.51  ? 337 PHE B CD2 1 
ATOM   7641  C  CE1 . PHE B 1 337 ? 84.688  69.540  115.248 1.00 49.51  ? 337 PHE B CE1 1 
ATOM   7642  C  CE2 . PHE B 1 337 ? 83.280  70.358  113.517 1.00 49.51  ? 337 PHE B CE2 1 
ATOM   7643  C  CZ  . PHE B 1 337 ? 84.527  70.153  114.024 1.00 49.51  ? 337 PHE B CZ  1 
ATOM   7644  N  N   . ASP B 1 338 ? 79.047  66.579  117.276 1.00 59.45  ? 338 ASP B N   1 
ATOM   7645  C  CA  . ASP B 1 338 ? 78.393  65.809  118.328 1.00 59.45  ? 338 ASP B CA  1 
ATOM   7646  C  C   . ASP B 1 338 ? 78.845  64.360  118.284 1.00 59.45  ? 338 ASP B C   1 
ATOM   7647  O  O   . ASP B 1 338 ? 78.994  63.721  119.329 1.00 59.45  ? 338 ASP B O   1 
ATOM   7648  C  CB  . ASP B 1 338 ? 76.875  65.912  118.216 1.00 59.45  ? 338 ASP B CB  1 
ATOM   7649  C  CG  . ASP B 1 338 ? 76.365  67.302  118.537 1.00 59.45  ? 338 ASP B CG  1 
ATOM   7650  O  OD1 . ASP B 1 338 ? 77.155  68.108  119.069 1.00 59.45  ? 338 ASP B OD1 1 
ATOM   7651  O  OD2 . ASP B 1 338 ? 75.180  67.590  118.266 1.00 59.45  ? 338 ASP B OD2 1 
ATOM   7652  N  N   . MET B 1 339 ? 79.066  63.832  117.081 1.00 60.61  ? 339 MET B N   1 
ATOM   7653  C  CA  . MET B 1 339 ? 79.613  62.490  116.942 1.00 60.61  ? 339 MET B CA  1 
ATOM   7654  C  C   . MET B 1 339 ? 81.034  62.413  117.473 1.00 60.61  ? 339 MET B C   1 
ATOM   7655  O  O   . MET B 1 339 ? 81.424  61.387  118.038 1.00 60.61  ? 339 MET B O   1 
ATOM   7656  C  CB  . MET B 1 339 ? 79.590  62.075  115.472 1.00 60.61  ? 339 MET B CB  1 
ATOM   7657  C  CG  . MET B 1 339 ? 80.123  60.691  115.172 1.00 60.61  ? 339 MET B CG  1 
ATOM   7658  S  SD  . MET B 1 339 ? 79.368  59.974  113.705 1.00 60.61  ? 339 MET B SD  1 
ATOM   7659  C  CE  . MET B 1 339 ? 77.650  59.891  114.195 1.00 60.61  ? 339 MET B CE  1 
ATOM   7660  N  N   . GLU B 1 340 ? 81.818  63.475  117.309 1.00 57.33  ? 340 GLU B N   1 
ATOM   7661  C  CA  . GLU B 1 340 ? 83.174  63.474  117.843 1.00 57.33  ? 340 GLU B CA  1 
ATOM   7662  C  C   . GLU B 1 340 ? 83.180  63.479  119.367 1.00 57.33  ? 340 GLU B C   1 
ATOM   7663  O  O   . GLU B 1 340 ? 83.952  62.744  119.995 1.00 57.33  ? 340 GLU B O   1 
ATOM   7664  C  CB  . GLU B 1 340 ? 83.954  64.659  117.289 1.00 57.33  ? 340 GLU B CB  1 
ATOM   7665  C  CG  . GLU B 1 340 ? 85.371  64.726  117.793 1.00 57.33  ? 340 GLU B CG  1 
ATOM   7666  C  CD  . GLU B 1 340 ? 86.311  63.929  116.921 1.00 57.33  ? 340 GLU B CD  1 
ATOM   7667  O  OE1 . GLU B 1 340 ? 86.017  63.771  115.724 1.00 57.33  ? 340 GLU B OE1 1 
ATOM   7668  O  OE2 . GLU B 1 340 ? 87.344  63.457  117.428 1.00 57.33  ? 340 GLU B OE2 1 
ATOM   7669  N  N   . VAL B 1 341 ? 82.310  64.287  119.979 1.00 66.65  ? 341 VAL B N   1 
ATOM   7670  C  CA  . VAL B 1 341 ? 82.203  64.314  121.437 1.00 66.65  ? 341 VAL B CA  1 
ATOM   7671  C  C   . VAL B 1 341 ? 81.667  62.993  121.967 1.00 66.65  ? 341 VAL B C   1 
ATOM   7672  O  O   . VAL B 1 341 ? 82.137  62.489  122.996 1.00 66.65  ? 341 VAL B O   1 
ATOM   7673  C  CB  . VAL B 1 341 ? 81.321  65.507  121.852 1.00 66.65  ? 341 VAL B CB  1 
ATOM   7674  C  CG1 . VAL B 1 341 ? 80.967  65.460  123.327 1.00 66.65  ? 341 VAL B CG1 1 
ATOM   7675  C  CG2 . VAL B 1 341 ? 82.026  66.807  121.527 1.00 66.65  ? 341 VAL B CG2 1 
ATOM   7676  N  N   . TRP B 1 342 ? 80.720  62.391  121.250 1.00 71.46  ? 342 TRP B N   1 
ATOM   7677  C  CA  . TRP B 1 342 ? 80.213  61.076  121.617 1.00 71.46  ? 342 TRP B CA  1 
ATOM   7678  C  C   . TRP B 1 342 ? 81.297  60.019  121.497 1.00 71.46  ? 342 TRP B C   1 
ATOM   7679  O  O   . TRP B 1 342 ? 81.400  59.129  122.347 1.00 71.46  ? 342 TRP B O   1 
ATOM   7680  C  CB  . TRP B 1 342 ? 79.021  60.729  120.731 1.00 71.46  ? 342 TRP B CB  1 
ATOM   7681  C  CG  . TRP B 1 342 ? 78.578  59.325  120.812 1.00 71.46  ? 342 TRP B CG  1 
ATOM   7682  C  CD1 . TRP B 1 342 ? 77.660  58.810  121.663 1.00 71.46  ? 342 TRP B CD1 1 
ATOM   7683  C  CD2 . TRP B 1 342 ? 79.014  58.243  119.982 1.00 71.46  ? 342 TRP B CD2 1 
ATOM   7684  N  NE1 . TRP B 1 342 ? 77.502  57.466  121.431 1.00 71.46  ? 342 TRP B NE1 1 
ATOM   7685  C  CE2 . TRP B 1 342 ? 78.327  57.095  120.402 1.00 71.46  ? 342 TRP B CE2 1 
ATOM   7686  C  CE3 . TRP B 1 342 ? 79.933  58.133  118.938 1.00 71.46  ? 342 TRP B CE3 1 
ATOM   7687  C  CZ2 . TRP B 1 342 ? 78.519  55.855  119.807 1.00 71.46  ? 342 TRP B CZ2 1 
ATOM   7688  C  CZ3 . TRP B 1 342 ? 80.123  56.904  118.350 1.00 71.46  ? 342 TRP B CZ3 1 
ATOM   7689  C  CH2 . TRP B 1 342 ? 79.420  55.782  118.784 1.00 71.46  ? 342 TRP B CH2 1 
ATOM   7690  N  N   . ALA B 1 343 ? 82.112  60.100  120.448 1.00 68.50  ? 343 ALA B N   1 
ATOM   7691  C  CA  . ALA B 1 343 ? 83.203  59.152  120.304 1.00 68.50  ? 343 ALA B CA  1 
ATOM   7692  C  C   . ALA B 1 343 ? 84.304  59.403  121.314 1.00 68.50  ? 343 ALA B C   1 
ATOM   7693  O  O   . ALA B 1 343 ? 84.967  58.454  121.741 1.00 68.50  ? 343 ALA B O   1 
ATOM   7694  C  CB  . ALA B 1 343 ? 83.775  59.201  118.893 1.00 68.50  ? 343 ALA B CB  1 
ATOM   7695  N  N   . LEU B 1 344 ? 84.526  60.658  121.697 1.00 68.96  ? 344 LEU B N   1 
ATOM   7696  C  CA  . LEU B 1 344 ? 85.480  60.921  122.765 1.00 68.96  ? 344 LEU B CA  1 
ATOM   7697  C  C   . LEU B 1 344 ? 84.972  60.399  124.101 1.00 68.96  ? 344 LEU B C   1 
ATOM   7698  O  O   . LEU B 1 344 ? 85.749  59.860  124.899 1.00 68.96  ? 344 LEU B O   1 
ATOM   7699  C  CB  . LEU B 1 344 ? 85.781  62.411  122.852 1.00 68.96  ? 344 LEU B CB  1 
ATOM   7700  C  CG  . LEU B 1 344 ? 87.000  62.709  123.719 1.00 68.96  ? 344 LEU B CG  1 
ATOM   7701  C  CD1 . LEU B 1 344 ? 88.237  62.104  123.103 1.00 68.96  ? 344 LEU B CD1 1 
ATOM   7702  C  CD2 . LEU B 1 344 ? 87.166  64.206  123.895 1.00 68.96  ? 344 LEU B CD2 1 
ATOM   7703  N  N   . GLY B 1 345 ? 83.669  60.543  124.357 1.00 80.57  ? 345 GLY B N   1 
ATOM   7704  C  CA  . GLY B 1 345 ? 83.086  59.946  125.547 1.00 80.57  ? 345 GLY B CA  1 
ATOM   7705  C  C   . GLY B 1 345 ? 83.101  58.431  125.517 1.00 80.57  ? 345 GLY B C   1 
ATOM   7706  O  O   . GLY B 1 345 ? 83.302  57.784  126.547 1.00 80.57  ? 345 GLY B O   1 
ATOM   7707  N  N   . LEU B 1 346 ? 82.896  57.847  124.335 1.00 79.53  ? 346 LEU B N   1 
ATOM   7708  C  CA  . LEU B 1 346 ? 83.008  56.401  124.192 1.00 79.53  ? 346 LEU B CA  1 
ATOM   7709  C  C   . LEU B 1 346 ? 84.439  55.942  124.400 1.00 79.53  ? 346 LEU B C   1 
ATOM   7710  O  O   . LEU B 1 346 ? 84.669  54.836  124.894 1.00 79.53  ? 346 LEU B O   1 
ATOM   7711  C  CB  . LEU B 1 346 ? 82.488  55.943  122.833 1.00 79.53  ? 346 LEU B CB  1 
ATOM   7712  C  CG  . LEU B 1 346 ? 81.806  54.571  122.864 1.00 79.53  ? 346 LEU B CG  1 
ATOM   7713  C  CD1 . LEU B 1 346 ? 80.696  54.541  123.897 1.00 79.53  ? 346 LEU B CD1 1 
ATOM   7714  C  CD2 . LEU B 1 346 ? 81.264  54.182  121.511 1.00 79.53  ? 346 LEU B CD2 1 
ATOM   7715  N  N   . HIS B 1 347 ? 85.406  56.765  124.013 1.00 82.65  ? 347 HIS B N   1 
ATOM   7716  C  CA  . HIS B 1 347 ? 86.795  56.449  124.296 1.00 82.65  ? 347 HIS B CA  1 
ATOM   7717  C  C   . HIS B 1 347 ? 87.099  56.552  125.785 1.00 82.65  ? 347 HIS B C   1 
ATOM   7718  O  O   . HIS B 1 347 ? 87.905  55.773  126.306 1.00 82.65  ? 347 HIS B O   1 
ATOM   7719  C  CB  . HIS B 1 347 ? 87.684  57.389  123.493 1.00 82.65  ? 347 HIS B CB  1 
ATOM   7720  C  CG  . HIS B 1 347 ? 89.037  57.601  124.086 1.00 82.65  ? 347 HIS B CG  1 
ATOM   7721  N  ND1 . HIS B 1 347 ? 89.313  58.632  124.958 1.00 82.65  ? 347 HIS B ND1 1 
ATOM   7722  C  CD2 . HIS B 1 347 ? 90.195  56.926  123.920 1.00 82.65  ? 347 HIS B CD2 1 
ATOM   7723  C  CE1 . HIS B 1 347 ? 90.583  58.573  125.314 1.00 82.65  ? 347 HIS B CE1 1 
ATOM   7724  N  NE2 . HIS B 1 347 ? 91.141  57.547  124.697 1.00 82.65  ? 347 HIS B NE2 1 
ATOM   7725  N  N   . GLU B 1 348 ? 86.476  57.506  126.478 1.00 81.76  ? 348 GLU B N   1 
ATOM   7726  C  CA  . GLU B 1 348 ? 86.589  57.606  127.932 1.00 81.76  ? 348 GLU B CA  1 
ATOM   7727  C  C   . GLU B 1 348 ? 85.917  56.440  128.647 1.00 81.76  ? 348 GLU B C   1 
ATOM   7728  O  O   . GLU B 1 348 ? 86.312  56.082  129.761 1.00 81.76  ? 348 GLU B O   1 
ATOM   7729  C  CB  . GLU B 1 348 ? 85.985  58.925  128.413 1.00 81.76  ? 348 GLU B CB  1 
ATOM   7730  N  N   . ASN B 1 349 ? 84.924  55.831  128.011 1.00 81.72  ? 349 ASN B N   1 
ATOM   7731  C  CA  . ASN B 1 349 ? 84.135  54.767  128.614 1.00 81.72  ? 349 ASN B CA  1 
ATOM   7732  C  C   . ASN B 1 349 ? 84.834  53.416  128.526 1.00 81.72  ? 349 ASN B C   1 
ATOM   7733  O  O   . ASN B 1 349 ? 85.101  52.778  129.548 1.00 81.72  ? 349 ASN B O   1 
ATOM   7734  C  CB  . ASN B 1 349 ? 82.773  54.701  127.921 1.00 81.72  ? 349 ASN B CB  1 
ATOM   7735  C  CG  . ASN B 1 349 ? 81.798  53.776  128.614 1.00 81.72  ? 349 ASN B CG  1 
ATOM   7736  O  OD1 . ASN B 1 349 ? 82.026  53.332  129.736 1.00 81.72  ? 349 ASN B OD1 1 
ATOM   7737  N  ND2 . ASN B 1 349 ? 80.702  53.471  127.936 1.00 81.72  ? 349 ASN B ND2 1 
ATOM   7738  N  N   . SER B 1 350 ? 85.168  52.984  127.316 1.00 82.88  ? 350 SER B N   1 
ATOM   7739  C  CA  . SER B 1 350 ? 85.393  51.580  126.998 1.00 82.88  ? 350 SER B CA  1 
ATOM   7740  C  C   . SER B 1 350 ? 86.738  51.008  127.423 1.00 82.88  ? 350 SER B C   1 
ATOM   7741  O  O   . SER B 1 350 ? 86.781  50.093  128.252 1.00 82.88  ? 350 SER B O   1 
ATOM   7742  C  CB  . SER B 1 350 ? 85.223  51.358  125.495 1.00 82.88  ? 350 SER B CB  1 
ATOM   7743  O  OG  . SER B 1 350 ? 84.338  50.283  125.240 1.00 82.88  ? 350 SER B OG  1 
ATOM   7744  N  N   . GLY B 1 351 ? 87.838  51.517  126.883 1.00 89.97  ? 351 GLY B N   1 
ATOM   7745  C  CA  . GLY B 1 351 ? 89.088  50.820  127.104 1.00 89.97  ? 351 GLY B CA  1 
ATOM   7746  C  C   . GLY B 1 351 ? 90.389  51.506  126.750 1.00 89.97  ? 351 GLY B C   1 
ATOM   7747  O  O   . GLY B 1 351 ? 90.517  52.734  126.794 1.00 89.97  ? 351 GLY B O   1 
ATOM   7748  N  N   . SER B 1 352 ? 91.370  50.673  126.411 1.00 98.66  ? 352 SER B N   1 
ATOM   7749  C  CA  . SER B 1 352 ? 92.761  51.025  126.168 1.00 98.66  ? 352 SER B CA  1 
ATOM   7750  C  C   . SER B 1 352 ? 93.080  50.586  124.750 1.00 98.66  ? 352 SER B C   1 
ATOM   7751  O  O   . SER B 1 352 ? 93.872  51.225  124.050 1.00 98.66  ? 352 SER B O   1 
ATOM   7752  C  CB  . SER B 1 352 ? 93.683  50.348  127.182 1.00 98.66  ? 352 SER B CB  1 
ATOM   7753  N  N   . GLU B 1 353 ? 92.491  49.472  124.333 1.00 105.82 ? 353 GLU B N   1 
ATOM   7754  C  CA  . GLU B 1 353 ? 92.785  48.879  123.041 1.00 105.82 ? 353 GLU B CA  1 
ATOM   7755  C  C   . GLU B 1 353 ? 92.164  49.685  121.913 1.00 105.82 ? 353 GLU B C   1 
ATOM   7756  O  O   . GLU B 1 353 ? 92.855  50.008  120.940 1.00 105.82 ? 353 GLU B O   1 
ATOM   7757  C  CB  . GLU B 1 353 ? 92.274  47.436  122.982 1.00 105.82 ? 353 GLU B CB  1 
ATOM   7758  C  CG  . GLU B 1 353 ? 93.173  46.432  123.677 1.00 105.82 ? 353 GLU B CG  1 
ATOM   7759  C  CD  . GLU B 1 353 ? 93.542  45.272  122.779 1.00 105.82 ? 353 GLU B CD  1 
ATOM   7760  O  OE1 . GLU B 1 353 ? 92.652  44.774  122.058 1.00 105.82 ? 353 GLU B OE1 1 
ATOM   7761  O  OE2 . GLU B 1 353 ? 94.722  44.867  122.784 1.00 105.82 ? 353 GLU B OE2 1 
ATOM   7762  N  N   . TRP B 1 354 ? 90.886  50.036  122.037 1.00 101.46 ? 354 TRP B N   1 
ATOM   7763  C  CA  . TRP B 1 354 ? 90.159  50.797  121.033 1.00 101.46 ? 354 TRP B CA  1 
ATOM   7764  C  C   . TRP B 1 354 ? 90.197  52.280  121.362 1.00 101.46 ? 354 TRP B C   1 
ATOM   7765  O  O   . TRP B 1 354 ? 89.184  52.977  121.266 1.00 101.46 ? 354 TRP B O   1 
ATOM   7766  C  CB  . TRP B 1 354 ? 88.714  50.311  120.977 1.00 101.46 ? 354 TRP B CB  1 
ATOM   7767  C  CG  . TRP B 1 354 ? 88.563  48.962  120.374 1.00 101.46 ? 354 TRP B CG  1 
ATOM   7768  C  CD1 . TRP B 1 354 ? 88.987  47.782  120.906 1.00 101.46 ? 354 TRP B CD1 1 
ATOM   7769  C  CD2 . TRP B 1 354 ? 87.922  48.639  119.140 1.00 101.46 ? 354 TRP B CD2 1 
ATOM   7770  N  NE1 . TRP B 1 354 ? 88.666  46.744  120.073 1.00 101.46 ? 354 TRP B NE1 1 
ATOM   7771  C  CE2 . TRP B 1 354 ? 88.009  47.242  118.980 1.00 101.46 ? 354 TRP B CE2 1 
ATOM   7772  C  CE3 . TRP B 1 354 ? 87.289  49.394  118.149 1.00 101.46 ? 354 TRP B CE3 1 
ATOM   7773  C  CZ2 . TRP B 1 354 ? 87.488  46.583  117.870 1.00 101.46 ? 354 TRP B CZ2 1 
ATOM   7774  C  CZ3 . TRP B 1 354 ? 86.771  48.741  117.047 1.00 101.46 ? 354 TRP B CZ3 1 
ATOM   7775  C  CH2 . TRP B 1 354 ? 86.874  47.348  116.916 1.00 101.46 ? 354 TRP B CH2 1 
ATOM   7776  N  N   . THR B 1 355 ? 91.372  52.760  121.760 1.00 98.05  ? 355 THR B N   1 
ATOM   7777  C  CA  . THR B 1 355 ? 91.543  54.141  122.187 1.00 98.05  ? 355 THR B CA  1 
ATOM   7778  C  C   . THR B 1 355 ? 92.238  54.992  121.126 1.00 98.05  ? 355 THR B C   1 
ATOM   7779  O  O   . THR B 1 355 ? 91.997  56.203  121.028 1.00 98.05  ? 355 THR B O   1 
ATOM   7780  C  CB  . THR B 1 355 ? 92.320  54.116  123.524 1.00 98.05  ? 355 THR B CB  1 
ATOM   7781  O  OG1 . THR B 1 355 ? 91.407  54.182  124.630 1.00 98.05  ? 355 THR B OG1 1 
ATOM   7782  C  CG2 . THR B 1 355 ? 93.404  55.203  123.669 1.00 98.05  ? 355 THR B CG2 1 
ATOM   7783  N  N   . SER B 1 356 ? 92.966  54.358  120.213 1.00 91.84  ? 356 SER B N   1 
ATOM   7784  C  CA  . SER B 1 356 ? 93.412  55.078  119.030 1.00 91.84  ? 356 SER B CA  1 
ATOM   7785  C  C   . SER B 1 356 ? 92.645  54.800  117.748 1.00 91.84  ? 356 SER B C   1 
ATOM   7786  O  O   . SER B 1 356 ? 92.621  55.680  116.883 1.00 91.84  ? 356 SER B O   1 
ATOM   7787  C  CB  . SER B 1 356 ? 94.893  54.786  118.772 1.00 91.84  ? 356 SER B CB  1 
ATOM   7788  O  OG  . SER B 1 356 ? 95.056  53.565  118.076 1.00 91.84  ? 356 SER B OG  1 
ATOM   7789  N  N   . VAL B 1 357 ? 92.010  53.647  117.573 1.00 84.79  ? 357 VAL B N   1 
ATOM   7790  C  CA  . VAL B 1 357 ? 91.323  53.453  116.303 1.00 84.79  ? 357 VAL B CA  1 
ATOM   7791  C  C   . VAL B 1 357 ? 89.964  54.133  116.310 1.00 84.79  ? 357 VAL B C   1 
ATOM   7792  O  O   . VAL B 1 357 ? 89.476  54.590  115.274 1.00 84.79  ? 357 VAL B O   1 
ATOM   7793  C  CB  . VAL B 1 357 ? 91.219  51.932  116.032 1.00 84.79  ? 357 VAL B CB  1 
ATOM   7794  C  CG1 . VAL B 1 357 ? 90.404  51.595  114.795 1.00 84.79  ? 357 VAL B CG1 1 
ATOM   7795  C  CG2 . VAL B 1 357 ? 92.602  51.341  115.915 1.00 84.79  ? 357 VAL B CG2 1 
ATOM   7796  N  N   . LEU B 1 358 ? 89.360  54.295  117.484 1.00 84.96  ? 358 LEU B N   1 
ATOM   7797  C  CA  . LEU B 1 358 ? 88.079  54.983  117.529 1.00 84.96  ? 358 LEU B CA  1 
ATOM   7798  C  C   . LEU B 1 358 ? 88.230  56.481  117.284 1.00 84.96  ? 358 LEU B C   1 
ATOM   7799  O  O   . LEU B 1 358 ? 87.269  57.143  116.886 1.00 84.96  ? 358 LEU B O   1 
ATOM   7800  C  CB  . LEU B 1 358 ? 87.394  54.726  118.866 1.00 84.96  ? 358 LEU B CB  1 
ATOM   7801  C  CG  . LEU B 1 358 ? 85.902  55.054  118.941 1.00 84.96  ? 358 LEU B CG  1 
ATOM   7802  C  CD1 . LEU B 1 358 ? 85.147  54.357  117.820 1.00 84.96  ? 358 LEU B CD1 1 
ATOM   7803  C  CD2 . LEU B 1 358 ? 85.344  54.669  120.301 1.00 84.96  ? 358 LEU B CD2 1 
ATOM   7804  N  N   . LEU B 1 359 ? 89.432  57.030  117.471 1.00 75.51  ? 359 LEU B N   1 
ATOM   7805  C  CA  . LEU B 1 359 ? 89.596  58.452  117.206 1.00 75.51  ? 359 LEU B CA  1 
ATOM   7806  C  C   . LEU B 1 359 ? 89.712  58.788  115.727 1.00 75.51  ? 359 LEU B C   1 
ATOM   7807  O  O   . LEU B 1 359 ? 89.489  59.939  115.346 1.00 75.51  ? 359 LEU B O   1 
ATOM   7808  C  CB  . LEU B 1 359 ? 90.829  58.951  117.946 1.00 75.51  ? 359 LEU B CB  1 
ATOM   7809  C  CG  . LEU B 1 359 ? 90.600  59.415  119.383 1.00 75.51  ? 359 LEU B CG  1 
ATOM   7810  C  CD1 . LEU B 1 359 ? 91.859  60.071  119.931 1.00 75.51  ? 359 LEU B CD1 1 
ATOM   7811  C  CD2 . LEU B 1 359 ? 89.409  60.350  119.477 1.00 75.51  ? 359 LEU B CD2 1 
ATOM   7812  N  N   . TYR B 1 360 ? 90.046  57.829  114.878 1.00 71.76  ? 360 TYR B N   1 
ATOM   7813  C  CA  . TYR B 1 360 ? 90.150  58.123  113.458 1.00 71.76  ? 360 TYR B CA  1 
ATOM   7814  C  C   . TYR B 1 360 ? 88.889  57.802  112.678 1.00 71.76  ? 360 TYR B C   1 
ATOM   7815  O  O   . TYR B 1 360 ? 88.793  58.180  111.509 1.00 71.76  ? 360 TYR B O   1 
ATOM   7816  C  CB  . TYR B 1 360 ? 91.343  57.410  112.825 1.00 71.76  ? 360 TYR B CB  1 
ATOM   7817  C  CG  . TYR B 1 360 ? 92.672  57.763  113.446 1.00 71.76  ? 360 TYR B CG  1 
ATOM   7818  C  CD1 . TYR B 1 360 ? 92.927  59.048  113.904 1.00 71.76  ? 360 TYR B CD1 1 
ATOM   7819  C  CD2 . TYR B 1 360 ? 93.697  56.829  113.510 1.00 71.76  ? 360 TYR B CD2 1 
ATOM   7820  C  CE1 . TYR B 1 360 ? 94.153  59.374  114.451 1.00 71.76  ? 360 TYR B CE1 1 
ATOM   7821  C  CE2 . TYR B 1 360 ? 94.923  57.147  114.052 1.00 71.76  ? 360 TYR B CE2 1 
ATOM   7822  C  CZ  . TYR B 1 360 ? 95.146  58.417  114.519 1.00 71.76  ? 360 TYR B CZ  1 
ATOM   7823  O  OH  . TYR B 1 360 ? 96.372  58.722  115.058 1.00 71.76  ? 360 TYR B OH  1 
ATOM   7824  N  N   . VAL B 1 361 ? 87.932  57.119  113.285 1.00 63.00  ? 361 VAL B N   1 
ATOM   7825  C  CA  . VAL B 1 361 ? 86.683  56.761  112.620 1.00 63.00  ? 361 VAL B CA  1 
ATOM   7826  C  C   . VAL B 1 361 ? 85.749  57.930  112.301 1.00 63.00  ? 361 VAL B C   1 
ATOM   7827  O  O   . VAL B 1 361 ? 85.301  58.003  111.147 1.00 63.00  ? 361 VAL B O   1 
ATOM   7828  C  CB  . VAL B 1 361 ? 85.955  55.677  113.432 1.00 63.00  ? 361 VAL B CB  1 
ATOM   7829  C  CG1 . VAL B 1 361 ? 84.541  55.453  112.936 1.00 63.00  ? 361 VAL B CG1 1 
ATOM   7830  C  CG2 . VAL B 1 361 ? 86.731  54.400  113.356 1.00 63.00  ? 361 VAL B CG2 1 
ATOM   7831  N  N   . PRO B 1 362 ? 85.417  58.865  113.209 1.00 52.60  ? 362 PRO B N   1 
ATOM   7832  C  CA  . PRO B 1 362 ? 84.434  59.886  112.818 1.00 52.60  ? 362 PRO B CA  1 
ATOM   7833  C  C   . PRO B 1 362 ? 84.917  60.880  111.775 1.00 52.60  ? 362 PRO B C   1 
ATOM   7834  O  O   . PRO B 1 362 ? 84.087  61.400  111.022 1.00 52.60  ? 362 PRO B O   1 
ATOM   7835  C  CB  . PRO B 1 362 ? 84.132  60.595  114.140 1.00 52.60  ? 362 PRO B CB  1 
ATOM   7836  C  CG  . PRO B 1 362 ? 85.359  60.450  114.884 1.00 52.60  ? 362 PRO B CG  1 
ATOM   7837  C  CD  . PRO B 1 362 ? 85.787  59.068  114.621 1.00 52.60  ? 362 PRO B CD  1 
ATOM   7838  N  N   . SER B 1 363 ? 86.216  61.147  111.678 1.00 46.86  ? 363 SER B N   1 
ATOM   7839  C  CA  . SER B 1 363 ? 86.681  61.999  110.591 1.00 46.86  ? 363 SER B CA  1 
ATOM   7840  C  C   . SER B 1 363 ? 86.613  61.285  109.249 1.00 46.86  ? 363 SER B C   1 
ATOM   7841  O  O   . SER B 1 363 ? 86.325  61.910  108.224 1.00 46.86  ? 363 SER B O   1 
ATOM   7842  C  CB  . SER B 1 363 ? 88.103  62.464  110.863 1.00 46.86  ? 363 SER B CB  1 
ATOM   7843  O  OG  . SER B 1 363 ? 89.005  61.403  110.633 1.00 46.86  ? 363 SER B OG  1 
ATOM   7844  N  N   . ILE B 1 364 ? 86.820  59.968  109.244 1.00 47.16  ? 364 ILE B N   1 
ATOM   7845  C  CA  . ILE B 1 364 ? 86.682  59.197  108.014 1.00 47.16  ? 364 ILE B CA  1 
ATOM   7846  C  C   . ILE B 1 364 ? 85.232  59.145  107.572 1.00 47.16  ? 364 ILE B C   1 
ATOM   7847  O  O   . ILE B 1 364 ? 84.936  59.284  106.379 1.00 47.16  ? 364 ILE B O   1 
ATOM   7848  C  CB  . ILE B 1 364 ? 87.299  57.804  108.195 1.00 47.16  ? 364 ILE B CB  1 
ATOM   7849  C  CG1 . ILE B 1 364 ? 88.812  57.946  108.153 1.00 47.16  ? 364 ILE B CG1 1 
ATOM   7850  C  CG2 . ILE B 1 364 ? 86.829  56.828  107.141 1.00 47.16  ? 364 ILE B CG2 1 
ATOM   7851  C  CD1 . ILE B 1 364 ? 89.544  56.718  108.564 1.00 47.16  ? 364 ILE B CD1 1 
ATOM   7852  N  N   . ILE B 1 365 ? 84.309  58.972  108.517 1.00 43.68  ? 365 ILE B N   1 
ATOM   7853  C  CA  . ILE B 1 365 ? 82.895  59.004  108.172 1.00 43.68  ? 365 ILE B CA  1 
ATOM   7854  C  C   . ILE B 1 365 ? 82.524  60.387  107.660 1.00 43.68  ? 365 ILE B C   1 
ATOM   7855  O  O   . ILE B 1 365 ? 81.778  60.529  106.685 1.00 43.68  ? 365 ILE B O   1 
ATOM   7856  C  CB  . ILE B 1 365 ? 82.046  58.597  109.385 1.00 43.68  ? 365 ILE B CB  1 
ATOM   7857  C  CG1 . ILE B 1 365 ? 82.380  57.170  109.802 1.00 43.68  ? 365 ILE B CG1 1 
ATOM   7858  C  CG2 . ILE B 1 365 ? 80.569  58.714  109.077 1.00 43.68  ? 365 ILE B CG2 1 
ATOM   7859  C  CD1 . ILE B 1 365 ? 81.584  56.681  110.997 1.00 43.68  ? 365 ILE B CD1 1 
ATOM   7860  N  N   . TYR B 1 366 ? 83.100  61.421  108.261 1.00 39.44  ? 366 TYR B N   1 
ATOM   7861  C  CA  . TYR B 1 366 ? 82.856  62.772  107.785 1.00 39.44  ? 366 TYR B CA  1 
ATOM   7862  C  C   . TYR B 1 366 ? 83.492  63.016  106.428 1.00 39.44  ? 366 TYR B C   1 
ATOM   7863  O  O   . TYR B 1 366 ? 82.933  63.745  105.604 1.00 39.44  ? 366 TYR B O   1 
ATOM   7864  C  CB  . TYR B 1 366 ? 83.395  63.778  108.788 1.00 39.44  ? 366 TYR B CB  1 
ATOM   7865  C  CG  . TYR B 1 366 ? 83.058  65.198  108.447 1.00 39.44  ? 366 TYR B CG  1 
ATOM   7866  C  CD1 . TYR B 1 366 ? 81.790  65.550  108.041 1.00 39.44  ? 366 TYR B CD1 1 
ATOM   7867  C  CD2 . TYR B 1 366 ? 84.024  66.180  108.505 1.00 39.44  ? 366 TYR B CD2 1 
ATOM   7868  C  CE1 . TYR B 1 366 ? 81.491  66.838  107.719 1.00 39.44  ? 366 TYR B CE1 1 
ATOM   7869  C  CE2 . TYR B 1 366 ? 83.734  67.468  108.192 1.00 39.44  ? 366 TYR B CE2 1 
ATOM   7870  C  CZ  . TYR B 1 366 ? 82.467  67.790  107.795 1.00 39.44  ? 366 TYR B CZ  1 
ATOM   7871  O  OH  . TYR B 1 366 ? 82.173  69.084  107.476 1.00 39.44  ? 366 TYR B OH  1 
ATOM   7872  N  N   . ALA B 1 367 ? 84.646  62.404  106.168 1.00 39.24  ? 367 ALA B N   1 
ATOM   7873  C  CA  . ALA B 1 367 ? 85.281  62.572  104.866 1.00 39.24  ? 367 ALA B CA  1 
ATOM   7874  C  C   . ALA B 1 367 ? 84.509  61.895  103.745 1.00 39.24  ? 367 ALA B C   1 
ATOM   7875  O  O   . ALA B 1 367 ? 84.432  62.428  102.634 1.00 39.24  ? 367 ALA B O   1 
ATOM   7876  C  CB  . ALA B 1 367 ? 86.706  62.045  104.913 1.00 39.24  ? 367 ALA B CB  1 
ATOM   7877  N  N   . ILE B 1 368 ? 83.939  60.724  104.006 1.00 35.36  ? 368 ILE B N   1 
ATOM   7878  C  CA  . ILE B 1 368 ? 83.137  60.053  102.991 1.00 35.36  ? 368 ILE B CA  1 
ATOM   7879  C  C   . ILE B 1 368 ? 81.843  60.809  102.729 1.00 35.36  ? 368 ILE B C   1 
ATOM   7880  O  O   . ILE B 1 368 ? 81.399  60.923  101.581 1.00 35.36  ? 368 ILE B O   1 
ATOM   7881  C  CB  . ILE B 1 368 ? 82.895  58.596  103.403 1.00 35.36  ? 368 ILE B CB  1 
ATOM   7882  C  CG1 . ILE B 1 368 ? 84.234  57.874  103.437 1.00 35.36  ? 368 ILE B CG1 1 
ATOM   7883  C  CG2 . ILE B 1 368 ? 82.003  57.894  102.415 1.00 35.36  ? 368 ILE B CG2 1 
ATOM   7884  C  CD1 . ILE B 1 368 ? 84.152  56.435  103.846 1.00 35.36  ? 368 ILE B CD1 1 
ATOM   7885  N  N   . VAL B 1 369 ? 81.246  61.383  103.771 1.00 35.87  ? 369 VAL B N   1 
ATOM   7886  C  CA  . VAL B 1 369 ? 80.022  62.154  103.585 1.00 35.87  ? 369 VAL B CA  1 
ATOM   7887  C  C   . VAL B 1 369 ? 80.281  63.455  102.839 1.00 35.87  ? 369 VAL B C   1 
ATOM   7888  O  O   . VAL B 1 369 ? 79.450  63.885  102.027 1.00 35.87  ? 369 VAL B O   1 
ATOM   7889  C  CB  . VAL B 1 369 ? 79.375  62.385  104.962 1.00 35.87  ? 369 VAL B CB  1 
ATOM   7890  C  CG1 . VAL B 1 369 ? 78.311  63.468  104.939 1.00 35.87  ? 369 VAL B CG1 1 
ATOM   7891  C  CG2 . VAL B 1 369 ? 78.767  61.103  105.446 1.00 35.87  ? 369 VAL B CG2 1 
ATOM   7892  N  N   . ILE B 1 370 ? 81.458  64.050  103.017 1.00 33.12  ? 370 ILE B N   1 
ATOM   7893  C  CA  . ILE B 1 370 ? 81.814  65.238  102.249 1.00 33.12  ? 370 ILE B CA  1 
ATOM   7894  C  C   . ILE B 1 370 ? 81.947  64.932  100.761 1.00 33.12  ? 370 ILE B C   1 
ATOM   7895  O  O   . ILE B 1 370 ? 81.371  65.628  99.917  1.00 33.12  ? 370 ILE B O   1 
ATOM   7896  C  CB  . ILE B 1 370 ? 83.107  65.838  102.814 1.00 33.12  ? 370 ILE B CB  1 
ATOM   7897  C  CG1 . ILE B 1 370 ? 82.770  66.694  104.013 1.00 33.12  ? 370 ILE B CG1 1 
ATOM   7898  C  CG2 . ILE B 1 370 ? 83.842  66.670  101.789 1.00 33.12  ? 370 ILE B CG2 1 
ATOM   7899  C  CD1 . ILE B 1 370 ? 83.982  67.214  104.676 1.00 33.12  ? 370 ILE B CD1 1 
ATOM   7900  N  N   . GLU B 1 371 ? 82.660  63.864  100.416 1.00 36.21  ? 371 GLU B N   1 
ATOM   7901  C  CA  . GLU B 1 371 ? 82.831  63.541  99.005  1.00 36.21  ? 371 GLU B CA  1 
ATOM   7902  C  C   . GLU B 1 371 ? 81.585  62.964  98.356  1.00 36.21  ? 371 GLU B C   1 
ATOM   7903  O  O   . GLU B 1 371 ? 81.530  62.883  97.127  1.00 36.21  ? 371 GLU B O   1 
ATOM   7904  C  CB  . GLU B 1 371 ? 84.014  62.613  98.810  1.00 36.21  ? 371 GLU B CB  1 
ATOM   7905  C  CG  . GLU B 1 371 ? 84.757  62.879  97.514  1.00 36.21  ? 371 GLU B CG  1 
ATOM   7906  C  CD  . GLU B 1 371 ? 85.150  64.342  97.327  1.00 36.21  ? 371 GLU B CD  1 
ATOM   7907  O  OE1 . GLU B 1 371 ? 85.670  64.959  98.277  1.00 36.21  ? 371 GLU B OE1 1 
ATOM   7908  O  OE2 . GLU B 1 371 ? 84.957  64.880  96.217  1.00 36.21  ? 371 GLU B OE2 1 
ATOM   7909  N  N   . ILE B 1 372 ? 80.592  62.549  99.129  1.00 33.71  ? 372 ILE B N   1 
ATOM   7910  C  CA  . ILE B 1 372 ? 79.335  62.185  98.498  1.00 33.71  ? 372 ILE B CA  1 
ATOM   7911  C  C   . ILE B 1 372 ? 78.478  63.414  98.285  1.00 33.71  ? 372 ILE B C   1 
ATOM   7912  O  O   . ILE B 1 372 ? 77.919  63.611  97.203  1.00 33.71  ? 372 ILE B O   1 
ATOM   7913  C  CB  . ILE B 1 372 ? 78.615  61.114  99.332  1.00 33.71  ? 372 ILE B CB  1 
ATOM   7914  C  CG1 . ILE B 1 372 ? 79.192  59.745  99.007  1.00 33.71  ? 372 ILE B CG1 1 
ATOM   7915  C  CG2 . ILE B 1 372 ? 77.125  61.098  99.058  1.00 33.71  ? 372 ILE B CG2 1 
ATOM   7916  C  CD1 . ILE B 1 372 ? 78.556  58.623  99.782  1.00 33.71  ? 372 ILE B CD1 1 
ATOM   7917  N  N   . MET B 1 373 ? 78.387  64.271  99.295  1.00 36.54  ? 373 MET B N   1 
ATOM   7918  C  CA  . MET B 1 373 ? 77.575  65.472  99.171  1.00 36.54  ? 373 MET B CA  1 
ATOM   7919  C  C   . MET B 1 373 ? 78.123  66.441  98.130  1.00 36.54  ? 373 MET B C   1 
ATOM   7920  O  O   . MET B 1 373 ? 77.338  67.162  97.506  1.00 36.54  ? 373 MET B O   1 
ATOM   7921  C  CB  . MET B 1 373 ? 77.413  66.151  100.525 1.00 36.54  ? 373 MET B CB  1 
ATOM   7922  C  CG  . MET B 1 373 ? 76.172  67.016  100.586 1.00 36.54  ? 373 MET B CG  1 
ATOM   7923  S  SD  . MET B 1 373 ? 75.767  67.588  102.236 1.00 36.54  ? 373 MET B SD  1 
ATOM   7924  C  CE  . MET B 1 373 ? 77.200  68.575  102.596 1.00 36.54  ? 373 MET B CE  1 
ATOM   7925  N  N   . ASN B 1 374 ? 79.440  66.460  97.903  1.00 33.15  ? 374 ASN B N   1 
ATOM   7926  C  CA  . ASN B 1 374 ? 79.989  67.352  96.884  1.00 33.15  ? 374 ASN B CA  1 
ATOM   7927  C  C   . ASN B 1 374 ? 79.570  66.944  95.484  1.00 33.15  ? 374 ASN B C   1 
ATOM   7928  O  O   . ASN B 1 374 ? 79.289  67.807  94.649  1.00 33.15  ? 374 ASN B O   1 
ATOM   7929  C  CB  . ASN B 1 374 ? 81.503  67.404  96.974  1.00 33.15  ? 374 ASN B CB  1 
ATOM   7930  C  CG  . ASN B 1 374 ? 81.965  68.214  98.124  1.00 33.15  ? 374 ASN B CG  1 
ATOM   7931  O  OD1 . ASN B 1 374 ? 81.157  68.713  98.898  1.00 33.15  ? 374 ASN B OD1 1 
ATOM   7932  N  ND2 . ASN B 1 374 ? 83.272  68.374  98.247  1.00 33.15  ? 374 ASN B ND2 1 
ATOM   7933  N  N   . ARG B 1 375 ? 79.520  65.649  95.201  1.00 35.31  ? 375 ARG B N   1 
ATOM   7934  C  CA  . ARG B 1 375 ? 79.078  65.239  93.878  1.00 35.31  ? 375 ARG B CA  1 
ATOM   7935  C  C   . ARG B 1 375 ? 77.585  65.454  93.722  1.00 35.31  ? 375 ARG B C   1 
ATOM   7936  O  O   . ARG B 1 375 ? 77.112  65.752  92.622  1.00 35.31  ? 375 ARG B O   1 
ATOM   7937  C  CB  . ARG B 1 375 ? 79.468  63.803  93.595  1.00 35.31  ? 375 ARG B CB  1 
ATOM   7938  C  CG  . ARG B 1 375 ? 80.942  63.643  93.576  1.00 35.31  ? 375 ARG B CG  1 
ATOM   7939  C  CD  . ARG B 1 375 ? 81.331  62.297  93.063  1.00 35.31  ? 375 ARG B CD  1 
ATOM   7940  N  NE  . ARG B 1 375 ? 82.720  62.031  93.380  1.00 35.31  ? 375 ARG B NE  1 
ATOM   7941  C  CZ  . ARG B 1 375 ? 83.717  62.263  92.537  1.00 35.31  ? 375 ARG B CZ  1 
ATOM   7942  N  NH1 . ARG B 1 375 ? 83.469  62.756  91.332  1.00 35.31  ? 375 ARG B NH1 1 
ATOM   7943  N  NH2 . ARG B 1 375 ? 84.961  62.001  92.898  1.00 35.31  ? 375 ARG B NH2 1 
ATOM   7944  N  N   . LEU B 1 376 ? 76.825  65.270  94.801  1.00 36.71  ? 376 LEU B N   1 
ATOM   7945  C  CA  . LEU B 1 376 ? 75.396  65.553  94.748  1.00 36.71  ? 376 LEU B CA  1 
ATOM   7946  C  C   . LEU B 1 376 ? 75.138  67.036  94.549  1.00 36.71  ? 376 LEU B C   1 
ATOM   7947  O  O   . LEU B 1 376 ? 74.250  67.414  93.781  1.00 36.71  ? 376 LEU B O   1 
ATOM   7948  C  CB  . LEU B 1 376 ? 74.690  65.063  96.006  1.00 36.71  ? 376 LEU B CB  1 
ATOM   7949  C  CG  . LEU B 1 376 ? 74.661  63.556  96.226  1.00 36.71  ? 376 LEU B CG  1 
ATOM   7950  C  CD1 . LEU B 1 376 ? 73.675  63.208  97.326  1.00 36.71  ? 376 LEU B CD1 1 
ATOM   7951  C  CD2 . LEU B 1 376 ? 74.324  62.820  94.937  1.00 36.71  ? 376 LEU B CD2 1 
ATOM   7952  N  N   . TYR B 1 377 ? 75.900  67.889  95.229  1.00 29.78  ? 377 TYR B N   1 
ATOM   7953  C  CA  . TYR B 1 377 ? 75.767  69.320  95.002  1.00 29.78  ? 377 TYR B CA  1 
ATOM   7954  C  C   . TYR B 1 377 ? 76.228  69.720  93.612  1.00 29.78  ? 377 TYR B C   1 
ATOM   7955  O  O   . TYR B 1 377 ? 75.709  70.687  93.049  1.00 29.78  ? 377 TYR B O   1 
ATOM   7956  C  CB  . TYR B 1 377 ? 76.599  70.085  96.024  1.00 29.78  ? 377 TYR B CB  1 
ATOM   7957  C  CG  . TYR B 1 377 ? 76.470  71.576  95.933  1.00 29.78  ? 377 TYR B CG  1 
ATOM   7958  C  CD1 . TYR B 1 377 ? 75.427  72.217  96.547  1.00 29.78  ? 377 TYR B CD1 1 
ATOM   7959  C  CD2 . TYR B 1 377 ? 77.366  72.336  95.217  1.00 29.78  ? 377 TYR B CD2 1 
ATOM   7960  C  CE1 . TYR B 1 377 ? 75.287  73.564  96.466  1.00 29.78  ? 377 TYR B CE1 1 
ATOM   7961  C  CE2 . TYR B 1 377 ? 77.211  73.673  95.104  1.00 29.78  ? 377 TYR B CE2 1 
ATOM   7962  C  CZ  . TYR B 1 377 ? 76.187  74.285  95.752  1.00 29.78  ? 377 TYR B CZ  1 
ATOM   7963  O  OH  . TYR B 1 377 ? 76.043  75.640  95.671  1.00 29.78  ? 377 TYR B OH  1 
ATOM   7964  N  N   . ARG B 1 378 ? 77.189  68.997  93.048  1.00 31.33  ? 378 ARG B N   1 
ATOM   7965  C  CA  . ARG B 1 378 ? 77.660  69.314  91.707  1.00 31.33  ? 378 ARG B CA  1 
ATOM   7966  C  C   . ARG B 1 378 ? 76.609  69.055  90.641  1.00 31.33  ? 378 ARG B C   1 
ATOM   7967  O  O   . ARG B 1 378 ? 76.442  69.870  89.728  1.00 31.33  ? 378 ARG B O   1 
ATOM   7968  C  CB  . ARG B 1 378 ? 78.909  68.492  91.413  1.00 31.33  ? 378 ARG B CB  1 
ATOM   7969  C  CG  . ARG B 1 378 ? 79.370  68.560  90.003  1.00 31.33  ? 378 ARG B CG  1 
ATOM   7970  C  CD  . ARG B 1 378 ? 79.900  69.894  89.641  1.00 31.33  ? 378 ARG B CD  1 
ATOM   7971  N  NE  . ARG B 1 378 ? 80.141  69.931  88.208  1.00 31.33  ? 378 ARG B NE  1 
ATOM   7972  C  CZ  . ARG B 1 378 ? 81.245  69.492  87.621  1.00 31.33  ? 378 ARG B CZ  1 
ATOM   7973  N  NH1 . ARG B 1 378 ? 82.232  68.990  88.350  1.00 31.33  ? 378 ARG B NH1 1 
ATOM   7974  N  NH2 . ARG B 1 378 ? 81.365  69.566  86.303  1.00 31.33  ? 378 ARG B NH2 1 
ATOM   7975  N  N   . TYR B 1 379 ? 75.870  67.952  90.754  1.00 39.93  ? 379 TYR B N   1 
ATOM   7976  C  CA  . TYR B 1 379 ? 74.773  67.702  89.823  1.00 39.93  ? 379 TYR B CA  1 
ATOM   7977  C  C   . TYR B 1 379 ? 73.649  68.709  89.984  1.00 39.93  ? 379 TYR B C   1 
ATOM   7978  O  O   . TYR B 1 379 ? 73.046  69.127  88.992  1.00 39.93  ? 379 TYR B O   1 
ATOM   7979  C  CB  . TYR B 1 379 ? 74.276  66.269  89.959  1.00 39.93  ? 379 TYR B CB  1 
ATOM   7980  C  CG  . TYR B 1 379 ? 75.274  65.261  89.426  1.00 39.93  ? 379 TYR B CG  1 
ATOM   7981  C  CD1 . TYR B 1 379 ? 76.318  65.657  88.594  1.00 39.93  ? 379 TYR B CD1 1 
ATOM   7982  C  CD2 . TYR B 1 379 ? 75.183  63.920  89.759  1.00 39.93  ? 379 TYR B CD2 1 
ATOM   7983  C  CE1 . TYR B 1 379 ? 77.234  64.754  88.109  1.00 39.93  ? 379 TYR B CE1 1 
ATOM   7984  C  CE2 . TYR B 1 379 ? 76.101  63.002  89.274  1.00 39.93  ? 379 TYR B CE2 1 
ATOM   7985  C  CZ  . TYR B 1 379 ? 77.125  63.429  88.447  1.00 39.93  ? 379 TYR B CZ  1 
ATOM   7986  O  OH  . TYR B 1 379 ? 78.045  62.531  87.954  1.00 39.93  ? 379 TYR B OH  1 
ATOM   7987  N  N   . ALA B 1 380 ? 73.309  69.058  91.220  1.00 39.61  ? 380 ALA B N   1 
ATOM   7988  C  CA  . ALA B 1 380 ? 72.244  70.030  91.423  1.00 39.61  ? 380 ALA B CA  1 
ATOM   7989  C  C   . ALA B 1 380 ? 72.641  71.417  90.937  1.00 39.61  ? 380 ALA B C   1 
ATOM   7990  O  O   . ALA B 1 380 ? 71.822  72.125  90.346  1.00 39.61  ? 380 ALA B O   1 
ATOM   7991  C  CB  . ALA B 1 380 ? 71.846  70.081  92.895  1.00 39.61  ? 380 ALA B CB  1 
ATOM   7992  N  N   . ALA B 1 381 ? 73.900  71.806  91.122  1.00 36.22  ? 381 ALA B N   1 
ATOM   7993  C  CA  . ALA B 1 381 ? 74.309  73.132  90.677  1.00 36.22  ? 381 ALA B CA  1 
ATOM   7994  C  C   . ALA B 1 381 ? 74.497  73.219  89.174  1.00 36.22  ? 381 ALA B C   1 
ATOM   7995  O  O   . ALA B 1 381 ? 74.235  74.274  88.592  1.00 36.22  ? 381 ALA B O   1 
ATOM   7996  C  CB  . ALA B 1 381 ? 75.593  73.558  91.376  1.00 36.22  ? 381 ALA B CB  1 
ATOM   7997  N  N   . GLU B 1 382 ? 74.951  72.140  88.538  1.00 38.09  ? 382 GLU B N   1 
ATOM   7998  C  CA  . GLU B 1 382 ? 75.029  72.118  87.083  1.00 38.09  ? 382 GLU B CA  1 
ATOM   7999  C  C   . GLU B 1 382 ? 73.648  72.207  86.468  1.00 38.09  ? 382 GLU B C   1 
ATOM   8000  O  O   . GLU B 1 382 ? 73.435  72.948  85.502  1.00 38.09  ? 382 GLU B O   1 
ATOM   8001  C  CB  . GLU B 1 382 ? 75.748  70.859  86.612  1.00 38.09  ? 382 GLU B CB  1 
ATOM   8002  C  CG  . GLU B 1 382 ? 75.558  70.539  85.153  1.00 38.09  ? 382 GLU B CG  1 
ATOM   8003  C  CD  . GLU B 1 382 ? 76.303  69.293  84.736  1.00 38.09  ? 382 GLU B CD  1 
ATOM   8004  O  OE1 . GLU B 1 382 ? 76.985  68.694  85.591  1.00 38.09  ? 382 GLU B OE1 1 
ATOM   8005  O  OE2 . GLU B 1 382 ? 76.194  68.895  83.558  1.00 38.09  ? 382 GLU B OE2 1 
ATOM   8006  N  N   . PHE B 1 383 ? 72.689  71.499  87.051  1.00 41.80  ? 383 PHE B N   1 
ATOM   8007  C  CA  . PHE B 1 383 ? 71.314  71.589  86.586  1.00 41.80  ? 383 PHE B CA  1 
ATOM   8008  C  C   . PHE B 1 383 ? 70.738  72.970  86.855  1.00 41.80  ? 383 PHE B C   1 
ATOM   8009  O  O   . PHE B 1 383 ? 69.995  73.507  86.028  1.00 41.80  ? 383 PHE B O   1 
ATOM   8010  C  CB  . PHE B 1 383 ? 70.453  70.508  87.227  1.00 41.80  ? 383 PHE B CB  1 
ATOM   8011  C  CG  . PHE B 1 383 ? 68.998  70.792  87.143  1.00 41.80  ? 383 PHE B CG  1 
ATOM   8012  C  CD1 . PHE B 1 383 ? 68.354  70.723  85.924  1.00 41.80  ? 383 PHE B CD1 1 
ATOM   8013  C  CD2 . PHE B 1 383 ? 68.276  71.133  88.266  1.00 41.80  ? 383 PHE B CD2 1 
ATOM   8014  C  CE1 . PHE B 1 383 ? 67.022  70.997  85.822  1.00 41.80  ? 383 PHE B CE1 1 
ATOM   8015  C  CE2 . PHE B 1 383 ? 66.939  71.405  88.173  1.00 41.80  ? 383 PHE B CE2 1 
ATOM   8016  C  CZ  . PHE B 1 383 ? 66.310  71.336  86.947  1.00 41.80  ? 383 PHE B CZ  1 
ATOM   8017  N  N   . LEU B 1 384 ? 71.055  73.558  88.004  1.00 41.22  ? 384 LEU B N   1 
ATOM   8018  C  CA  . LEU B 1 384 ? 70.446  74.834  88.333  1.00 41.22  ? 384 LEU B CA  1 
ATOM   8019  C  C   . LEU B 1 384 ? 71.040  75.972  87.529  1.00 41.22  ? 384 LEU B C   1 
ATOM   8020  O  O   . LEU B 1 384 ? 70.409  77.021  87.414  1.00 41.22  ? 384 LEU B O   1 
ATOM   8021  C  CB  . LEU B 1 384 ? 70.630  75.141  89.809  1.00 41.22  ? 384 LEU B CB  1 
ATOM   8022  C  CG  . LEU B 1 384 ? 69.557  75.985  90.467  1.00 41.22  ? 384 LEU B CG  1 
ATOM   8023  C  CD1 . LEU B 1 384 ? 68.265  75.232  90.444  1.00 41.22  ? 384 LEU B CD1 1 
ATOM   8024  C  CD2 . LEU B 1 384 ? 69.964  76.296  91.877  1.00 41.22  ? 384 LEU B CD2 1 
ATOM   8025  N  N   . THR B 1 385 ? 72.231  75.794  86.972  1.00 41.14  ? 385 THR B N   1 
ATOM   8026  C  CA  . THR B 1 385 ? 72.830  76.806  86.121  1.00 41.14  ? 385 THR B CA  1 
ATOM   8027  C  C   . THR B 1 385 ? 72.588  76.535  84.646  1.00 41.14  ? 385 THR B C   1 
ATOM   8028  O  O   . THR B 1 385 ? 72.543  77.478  83.855  1.00 41.14  ? 385 THR B O   1 
ATOM   8029  C  CB  . THR B 1 385 ? 74.320  76.923  86.415  1.00 41.14  ? 385 THR B CB  1 
ATOM   8030  O  OG1 . THR B 1 385 ? 74.494  76.947  87.832  1.00 41.14  ? 385 THR B OG1 1 
ATOM   8031  C  CG2 . THR B 1 385 ? 74.857  78.227  85.899  1.00 41.14  ? 385 THR B CG2 1 
ATOM   8032  N  N   . SER B 1 386 ? 72.322  75.286  84.268  1.00 43.95  ? 386 SER B N   1 
ATOM   8033  C  CA  . SER B 1 386 ? 71.822  75.029  82.924  1.00 43.95  ? 386 SER B CA  1 
ATOM   8034  C  C   . SER B 1 386 ? 70.365  75.415  82.766  1.00 43.95  ? 386 SER B C   1 
ATOM   8035  O  O   . SER B 1 386 ? 69.841  75.349  81.654  1.00 43.95  ? 386 SER B O   1 
ATOM   8036  C  CB  . SER B 1 386 ? 71.973  73.558  82.563  1.00 43.95  ? 386 SER B CB  1 
ATOM   8037  O  OG  . SER B 1 386 ? 71.047  73.204  81.555  1.00 43.95  ? 386 SER B OG  1 
ATOM   8038  N  N   . TRP B 1 387 ? 69.706  75.792  83.851  1.00 52.90  ? 387 TRP B N   1 
ATOM   8039  C  CA  . TRP B 1 387 ? 68.319  76.207  83.855  1.00 52.90  ? 387 TRP B CA  1 
ATOM   8040  C  C   . TRP B 1 387 ? 68.188  77.706  83.694  1.00 52.90  ? 387 TRP B C   1 
ATOM   8041  O  O   . TRP B 1 387 ? 67.144  78.187  83.250  1.00 52.90  ? 387 TRP B O   1 
ATOM   8042  C  CB  . TRP B 1 387 ? 67.663  75.771  85.167  1.00 52.90  ? 387 TRP B CB  1 
ATOM   8043  C  CG  . TRP B 1 387 ? 66.252  76.178  85.321  1.00 52.90  ? 387 TRP B CG  1 
ATOM   8044  C  CD1 . TRP B 1 387 ? 65.176  75.616  84.727  1.00 52.90  ? 387 TRP B CD1 1 
ATOM   8045  C  CD2 . TRP B 1 387 ? 65.759  77.271  86.099  1.00 52.90  ? 387 TRP B CD2 1 
ATOM   8046  N  NE1 . TRP B 1 387 ? 64.032  76.275  85.098  1.00 52.90  ? 387 TRP B NE1 1 
ATOM   8047  C  CE2 . TRP B 1 387 ? 64.368  77.298  85.941  1.00 52.90  ? 387 TRP B CE2 1 
ATOM   8048  C  CE3 . TRP B 1 387 ? 66.360  78.225  86.917  1.00 52.90  ? 387 TRP B CE3 1 
ATOM   8049  C  CZ2 . TRP B 1 387 ? 63.570  78.234  86.568  1.00 52.90  ? 387 TRP B CZ2 1 
ATOM   8050  C  CZ3 . TRP B 1 387 ? 65.565  79.155  87.539  1.00 52.90  ? 387 TRP B CZ3 1 
ATOM   8051  C  CH2 . TRP B 1 387 ? 64.187  79.151  87.364  1.00 52.90  ? 387 TRP B CH2 1 
ATOM   8052  N  N   . GLU B 1 388 ? 69.242  78.447  83.976  1.00 51.95  ? 388 GLU B N   1 
ATOM   8053  C  CA  . GLU B 1 388 ? 69.197  79.893  83.934  1.00 51.95  ? 388 GLU B CA  1 
ATOM   8054  C  C   . GLU B 1 388 ? 69.322  80.468  82.540  1.00 51.95  ? 388 GLU B C   1 
ATOM   8055  O  O   . GLU B 1 388 ? 69.251  81.692  82.407  1.00 51.95  ? 388 GLU B O   1 
ATOM   8056  C  CB  . GLU B 1 388 ? 70.372  80.427  84.730  1.00 51.95  ? 388 GLU B CB  1 
ATOM   8057  C  CG  . GLU B 1 388 ? 70.406  80.007  86.154  1.00 51.95  ? 388 GLU B CG  1 
ATOM   8058  C  CD  . GLU B 1 388 ? 71.796  80.159  86.732  1.00 51.95  ? 388 GLU B CD  1 
ATOM   8059  O  OE1 . GLU B 1 388 ? 72.652  80.760  86.054  1.00 51.95  ? 388 GLU B OE1 1 
ATOM   8060  O  OE2 . GLU B 1 388 ? 72.056  79.625  87.829  1.00 51.95  ? 388 GLU B OE2 1 
ATOM   8061  N  N   . ASN B 1 389 ? 69.490  79.623  81.520  1.00 52.37  ? 389 ASN B N   1 
ATOM   8062  C  CA  . ASN B 1 389 ? 69.576  80.022  80.113  1.00 52.37  ? 389 ASN B CA  1 
ATOM   8063  C  C   . ASN B 1 389 ? 70.714  81.015  79.883  1.00 52.37  ? 389 ASN B C   1 
ATOM   8064  O  O   . ASN B 1 389 ? 70.506  82.133  79.416  1.00 52.37  ? 389 ASN B O   1 
ATOM   8065  C  CB  . ASN B 1 389 ? 68.252  80.586  79.589  1.00 52.37  ? 389 ASN B CB  1 
ATOM   8066  C  CG  . ASN B 1 389 ? 67.464  79.573  78.800  1.00 52.37  ? 389 ASN B CG  1 
ATOM   8067  O  OD1 . ASN B 1 389 ? 67.651  78.369  78.951  1.00 52.37  ? 389 ASN B OD1 1 
ATOM   8068  N  ND2 . ASN B 1 389 ? 66.583  80.057  77.936  1.00 52.37  ? 389 ASN B ND2 1 
ATOM   8069  N  N   . HIS B 1 390 ? 71.922  80.608  80.250  1.00 42.08  ? 390 HIS B N   1 
ATOM   8070  C  CA  . HIS B 1 390 ? 73.058  81.470  79.981  1.00 42.08  ? 390 HIS B CA  1 
ATOM   8071  C  C   . HIS B 1 390 ? 73.360  81.444  78.498  1.00 42.08  ? 390 HIS B C   1 
ATOM   8072  O  O   . HIS B 1 390 ? 73.287  80.397  77.857  1.00 42.08  ? 390 HIS B O   1 
ATOM   8073  C  CB  . HIS B 1 390 ? 74.266  81.024  80.778  1.00 42.08  ? 390 HIS B CB  1 
ATOM   8074  C  CG  . HIS B 1 390 ? 74.260  81.519  82.179  1.00 42.08  ? 390 HIS B CG  1 
ATOM   8075  N  ND1 . HIS B 1 390 ? 74.310  82.857  82.488  1.00 42.08  ? 390 HIS B ND1 1 
ATOM   8076  C  CD2 . HIS B 1 390 ? 74.196  80.861  83.356  1.00 42.08  ? 390 HIS B CD2 1 
ATOM   8077  C  CE1 . HIS B 1 390 ? 74.277  83.003  83.799  1.00 42.08  ? 390 HIS B CE1 1 
ATOM   8078  N  NE2 . HIS B 1 390 ? 74.210  81.806  84.349  1.00 42.08  ? 390 HIS B NE2 1 
ATOM   8079  N  N   . ARG B 1 391 ? 73.730  82.598  77.955  1.00 48.57  ? 391 ARG B N   1 
ATOM   8080  C  CA  . ARG B 1 391 ? 73.873  82.696  76.505  1.00 48.57  ? 391 ARG B CA  1 
ATOM   8081  C  C   . ARG B 1 391 ? 75.188  82.114  76.002  1.00 48.57  ? 391 ARG B C   1 
ATOM   8082  O  O   . ARG B 1 391 ? 75.195  81.127  75.264  1.00 48.57  ? 391 ARG B O   1 
ATOM   8083  C  CB  . ARG B 1 391 ? 73.698  84.147  76.057  1.00 48.57  ? 391 ARG B CB  1 
ATOM   8084  C  CG  . ARG B 1 391 ? 73.444  84.277  74.569  1.00 48.57  ? 391 ARG B CG  1 
ATOM   8085  C  CD  . ARG B 1 391 ? 73.327  85.717  74.137  1.00 48.57  ? 391 ARG B CD  1 
ATOM   8086  N  NE  . ARG B 1 391 ? 73.114  85.818  72.702  1.00 48.57  ? 391 ARG B NE  1 
ATOM   8087  C  CZ  . ARG B 1 391 ? 74.092  85.857  71.807  1.00 48.57  ? 391 ARG B CZ  1 
ATOM   8088  N  NH1 . ARG B 1 391 ? 75.354  85.812  72.202  1.00 48.57  ? 391 ARG B NH1 1 
ATOM   8089  N  NH2 . ARG B 1 391 ? 73.811  85.946  70.517  1.00 48.57  ? 391 ARG B NH2 1 
ATOM   8090  N  N   . LEU B 1 392 ? 76.312  82.683  76.413  1.00 44.62  ? 392 LEU B N   1 
ATOM   8091  C  CA  . LEU B 1 392 ? 77.563  82.158  75.902  1.00 44.62  ? 392 LEU B CA  1 
ATOM   8092  C  C   . LEU B 1 392 ? 77.995  80.948  76.714  1.00 44.62  ? 392 LEU B C   1 
ATOM   8093  O  O   . LEU B 1 392 ? 77.334  80.540  77.665  1.00 44.62  ? 392 LEU B O   1 
ATOM   8094  C  CB  . LEU B 1 392 ? 78.636  83.232  75.932  1.00 44.62  ? 392 LEU B CB  1 
ATOM   8095  C  CG  . LEU B 1 392 ? 78.170  84.575  75.397  1.00 44.62  ? 392 LEU B CG  1 
ATOM   8096  C  CD1 . LEU B 1 392 ? 79.127  85.662  75.835  1.00 44.62  ? 392 LEU B CD1 1 
ATOM   8097  C  CD2 . LEU B 1 392 ? 78.054  84.527  73.901  1.00 44.62  ? 392 LEU B CD2 1 
ATOM   8098  N  N   . GLU B 1 393 ? 79.112  80.347  76.326  1.00 39.17  ? 393 GLU B N   1 
ATOM   8099  C  CA  . GLU B 1 393 ? 79.677  79.284  77.137  1.00 39.17  ? 393 GLU B CA  1 
ATOM   8100  C  C   . GLU B 1 393 ? 80.653  79.789  78.183  1.00 39.17  ? 393 GLU B C   1 
ATOM   8101  O  O   . GLU B 1 393 ? 80.787  79.166  79.241  1.00 39.17  ? 393 GLU B O   1 
ATOM   8102  C  CB  . GLU B 1 393 ? 80.342  78.255  76.228  1.00 39.17  ? 393 GLU B CB  1 
ATOM   8103  C  CG  . GLU B 1 393 ? 80.796  76.990  76.911  1.00 39.17  ? 393 GLU B CG  1 
ATOM   8104  C  CD  . GLU B 1 393 ? 79.656  76.099  77.312  1.00 39.17  ? 393 GLU B CD  1 
ATOM   8105  O  OE1 . GLU B 1 393 ? 78.562  76.220  76.733  1.00 39.17  ? 393 GLU B OE1 1 
ATOM   8106  O  OE2 . GLU B 1 393 ? 79.861  75.252  78.199  1.00 39.17  ? 393 GLU B OE2 1 
ATOM   8107  N  N   . SER B 1 394 ? 81.304  80.925  77.935  1.00 41.86  ? 394 SER B N   1 
ATOM   8108  C  CA  . SER B 1 394 ? 82.218  81.477  78.927  1.00 41.86  ? 394 SER B CA  1 
ATOM   8109  C  C   . SER B 1 394 ? 81.454  81.943  80.153  1.00 41.86  ? 394 SER B C   1 
ATOM   8110  O  O   . SER B 1 394 ? 81.918  81.788  81.285  1.00 41.86  ? 394 SER B O   1 
ATOM   8111  C  CB  . SER B 1 394 ? 83.020  82.630  78.340  1.00 41.86  ? 394 SER B CB  1 
ATOM   8112  O  OG  . SER B 1 394 ? 82.316  83.847  78.495  1.00 41.86  ? 394 SER B OG  1 
ATOM   8113  N  N   . ALA B 1 395 ? 80.279  82.522  79.936  1.00 36.13  ? 395 ALA B N   1 
ATOM   8114  C  CA  . ALA B 1 395 ? 79.455  82.992  81.039  1.00 36.13  ? 395 ALA B CA  1 
ATOM   8115  C  C   . ALA B 1 395 ? 78.882  81.835  81.842  1.00 36.13  ? 395 ALA B C   1 
ATOM   8116  O  O   . ALA B 1 395 ? 78.763  81.921  83.067  1.00 36.13  ? 395 ALA B O   1 
ATOM   8117  C  CB  . ALA B 1 395 ? 78.338  83.885  80.513  1.00 36.13  ? 395 ALA B CB  1 
ATOM   8118  N  N   . TYR B 1 396 ? 78.492  80.759  81.168  1.00 33.58  ? 396 TYR B N   1 
ATOM   8119  C  CA  . TYR B 1 396 ? 77.983  79.590  81.872  1.00 33.58  ? 396 TYR B CA  1 
ATOM   8120  C  C   . TYR B 1 396 ? 79.049  78.967  82.754  1.00 33.58  ? 396 TYR B C   1 
ATOM   8121  O  O   . TYR B 1 396 ? 78.762  78.523  83.867  1.00 33.58  ? 396 TYR B O   1 
ATOM   8122  C  CB  . TYR B 1 396 ? 77.437  78.569  80.892  1.00 33.58  ? 396 TYR B CB  1 
ATOM   8123  C  CG  . TYR B 1 396 ? 77.278  77.201  81.481  1.00 33.58  ? 396 TYR B CG  1 
ATOM   8124  C  CD1 . TYR B 1 396 ? 76.262  76.946  82.380  1.00 33.58  ? 396 TYR B CD1 1 
ATOM   8125  C  CD2 . TYR B 1 396 ? 78.099  76.161  81.111  1.00 33.58  ? 396 TYR B CD2 1 
ATOM   8126  C  CE1 . TYR B 1 396 ? 76.087  75.707  82.914  1.00 33.58  ? 396 TYR B CE1 1 
ATOM   8127  C  CE2 . TYR B 1 396 ? 77.931  74.913  81.643  1.00 33.58  ? 396 TYR B CE2 1 
ATOM   8128  C  CZ  . TYR B 1 396 ? 76.924  74.694  82.541  1.00 33.58  ? 396 TYR B CZ  1 
ATOM   8129  O  OH  . TYR B 1 396 ? 76.754  73.444  83.074  1.00 33.58  ? 396 TYR B OH  1 
ATOM   8130  N  N   . GLN B 1 397 ? 80.278  78.895  82.261  1.00 25.51  ? 397 GLN B N   1 
ATOM   8131  C  CA  . GLN B 1 397 ? 81.365  78.360  83.071  1.00 25.51  ? 397 GLN B CA  1 
ATOM   8132  C  C   . GLN B 1 397 ? 81.668  79.227  84.284  1.00 25.51  ? 397 GLN B C   1 
ATOM   8133  O  O   . GLN B 1 397 ? 82.016  78.697  85.336  1.00 25.51  ? 397 GLN B O   1 
ATOM   8134  C  CB  . GLN B 1 397 ? 82.623  78.153  82.236  1.00 25.51  ? 397 GLN B CB  1 
ATOM   8135  C  CG  . GLN B 1 397 ? 82.565  76.915  81.404  1.00 25.51  ? 397 GLN B CG  1 
ATOM   8136  C  CD  . GLN B 1 397 ? 82.510  75.687  82.267  1.00 25.51  ? 397 GLN B CD  1 
ATOM   8137  O  OE1 . GLN B 1 397 ? 83.150  75.635  83.309  1.00 25.51  ? 397 GLN B OE1 1 
ATOM   8138  N  NE2 . GLN B 1 397 ? 81.741  74.695  81.851  1.00 25.51  ? 397 GLN B NE2 1 
ATOM   8139  N  N   . ASN B 1 398 ? 81.557  80.551  84.170  1.00 26.50  ? 398 ASN B N   1 
ATOM   8140  C  CA  . ASN B 1 398 ? 81.843  81.379  85.338  1.00 26.50  ? 398 ASN B CA  1 
ATOM   8141  C  C   . ASN B 1 398 ? 80.820  81.184  86.444  1.00 26.50  ? 398 ASN B C   1 
ATOM   8142  O  O   . ASN B 1 398 ? 81.189  81.102  87.618  1.00 26.50  ? 398 ASN B O   1 
ATOM   8143  C  CB  . ASN B 1 398 ? 81.885  82.848  84.953  1.00 26.50  ? 398 ASN B CB  1 
ATOM   8144  C  CG  . ASN B 1 398 ? 83.103  83.197  84.173  1.00 26.50  ? 398 ASN B CG  1 
ATOM   8145  O  OD1 . ASN B 1 398 ? 83.883  82.326  83.802  1.00 26.50  ? 398 ASN B OD1 1 
ATOM   8146  N  ND2 . ASN B 1 398 ? 83.275  84.481  83.896  1.00 26.50  ? 398 ASN B ND2 1 
ATOM   8147  N  N   . HIS B 1 399 ? 79.543  81.089  86.102  1.00 26.33  ? 399 HIS B N   1 
ATOM   8148  C  CA  . HIS B 1 399 ? 78.539  80.872  87.135  1.00 26.33  ? 399 HIS B CA  1 
ATOM   8149  C  C   . HIS B 1 399 ? 78.626  79.493  87.760  1.00 26.33  ? 399 HIS B C   1 
ATOM   8150  O  O   . HIS B 1 399 ? 78.402  79.356  88.964  1.00 26.33  ? 399 HIS B O   1 
ATOM   8151  C  CB  . HIS B 1 399 ? 77.164  81.189  86.608  1.00 26.33  ? 399 HIS B CB  1 
ATOM   8152  C  CG  . HIS B 1 399 ? 76.940  82.652  86.510  1.00 26.33  ? 399 HIS B CG  1 
ATOM   8153  N  ND1 . HIS B 1 399 ? 76.625  83.416  87.607  1.00 26.33  ? 399 HIS B ND1 1 
ATOM   8154  C  CD2 . HIS B 1 399 ? 77.081  83.511  85.477  1.00 26.33  ? 399 HIS B CD2 1 
ATOM   8155  C  CE1 . HIS B 1 399 ? 76.528  84.681  87.243  1.00 26.33  ? 399 HIS B CE1 1 
ATOM   8156  N  NE2 . HIS B 1 399 ? 76.799  84.765  85.954  1.00 26.33  ? 399 HIS B NE2 1 
ATOM   8157  N  N   . LEU B 1 400 ? 78.890  78.461  86.967  1.00 22.48  ? 400 LEU B N   1 
ATOM   8158  C  CA  . LEU B 1 400 ? 79.038  77.130  87.536  1.00 22.48  ? 400 LEU B CA  1 
ATOM   8159  C  C   . LEU B 1 400 ? 80.254  77.058  88.440  1.00 22.48  ? 400 LEU B C   1 
ATOM   8160  O  O   . LEU B 1 400 ? 80.219  76.412  89.493  1.00 22.48  ? 400 LEU B O   1 
ATOM   8161  C  CB  . LEU B 1 400 ? 79.133  76.087  86.437  1.00 22.48  ? 400 LEU B CB  1 
ATOM   8162  C  CG  . LEU B 1 400 ? 79.154  74.687  87.020  1.00 22.48  ? 400 LEU B CG  1 
ATOM   8163  C  CD1 . LEU B 1 400 ? 77.864  74.450  87.731  1.00 22.48  ? 400 LEU B CD1 1 
ATOM   8164  C  CD2 . LEU B 1 400 ? 79.371  73.655  85.952  1.00 22.48  ? 400 LEU B CD2 1 
ATOM   8165  N  N   . ILE B 1 401 ? 81.339  77.726  88.053  1.00 18.33  ? 401 ILE B N   1 
ATOM   8166  C  CA  . ILE B 1 401 ? 82.537  77.754  88.888  1.00 18.33  ? 401 ILE B CA  1 
ATOM   8167  C  C   . ILE B 1 401 ? 82.264  78.480  90.194  1.00 18.33  ? 401 ILE B C   1 
ATOM   8168  O  O   . ILE B 1 401 ? 82.687  78.030  91.253  1.00 18.33  ? 401 ILE B O   1 
ATOM   8169  C  CB  . ILE B 1 401 ? 83.720  78.365  88.127  1.00 18.33  ? 401 ILE B CB  1 
ATOM   8170  C  CG1 . ILE B 1 401 ? 84.240  77.329  87.161  1.00 18.33  ? 401 ILE B CG1 1 
ATOM   8171  C  CG2 . ILE B 1 401 ? 84.853  78.707  89.035  1.00 18.33  ? 401 ILE B CG2 1 
ATOM   8172  C  CD1 . ILE B 1 401 ? 85.141  77.864  86.132  1.00 18.33  ? 401 ILE B CD1 1 
ATOM   8173  N  N   . LEU B 1 402 ? 81.454  79.537  90.159  1.00 16.43  ? 402 LEU B N   1 
ATOM   8174  C  CA  . LEU B 1 402 ? 81.151  80.258  91.393  1.00 16.43  ? 402 LEU B CA  1 
ATOM   8175  C  C   . LEU B 1 402 ? 80.349  79.420  92.382  1.00 16.43  ? 402 LEU B C   1 
ATOM   8176  O  O   . LEU B 1 402 ? 80.653  79.416  93.577  1.00 16.43  ? 402 LEU B O   1 
ATOM   8177  C  CB  . LEU B 1 402 ? 80.411  81.541  91.076  1.00 16.43  ? 402 LEU B CB  1 
ATOM   8178  C  CG  . LEU B 1 402 ? 80.080  82.358  92.308  1.00 16.43  ? 402 LEU B CG  1 
ATOM   8179  C  CD1 . LEU B 1 402 ? 81.343  82.735  93.018  1.00 16.43  ? 402 LEU B CD1 1 
ATOM   8180  C  CD2 . LEU B 1 402 ? 79.308  83.582  91.903  1.00 16.43  ? 402 LEU B CD2 1 
ATOM   8181  N  N   . LYS B 1 403 ? 79.300  78.742  91.924  1.00 18.77  ? 403 LYS B N   1 
ATOM   8182  C  CA  . LYS B 1 403 ? 78.508  77.921  92.837  1.00 18.77  ? 403 LYS B CA  1 
ATOM   8183  C  C   . LYS B 1 403 ? 79.298  76.752  93.415  1.00 18.77  ? 403 LYS B C   1 
ATOM   8184  O  O   . LYS B 1 403 ? 79.258  76.503  94.621  1.00 18.77  ? 403 LYS B O   1 
ATOM   8185  C  CB  . LYS B 1 403 ? 77.254  77.422  92.142  1.00 18.77  ? 403 LYS B CB  1 
ATOM   8186  C  CG  . LYS B 1 403 ? 76.272  78.515  91.872  1.00 18.77  ? 403 LYS B CG  1 
ATOM   8187  C  CD  . LYS B 1 403 ? 75.091  77.990  91.122  1.00 18.77  ? 403 LYS B CD  1 
ATOM   8188  C  CE  . LYS B 1 403 ? 74.116  79.097  90.879  1.00 18.77  ? 403 LYS B CE  1 
ATOM   8189  N  NZ  . LYS B 1 403 ? 74.749  80.157  90.076  1.00 18.77  ? 403 LYS B NZ  1 
ATOM   8190  N  N   . VAL B 1 404 ? 79.999  76.004  92.567  1.00 15.90  ? 404 VAL B N   1 
ATOM   8191  C  CA  . VAL B 1 404 ? 80.709  74.821  93.037  1.00 15.90  ? 404 VAL B CA  1 
ATOM   8192  C  C   . VAL B 1 404 ? 81.929  75.166  93.883  1.00 15.90  ? 404 VAL B C   1 
ATOM   8193  O  O   . VAL B 1 404 ? 82.215  74.480  94.871  1.00 15.90  ? 404 VAL B O   1 
ATOM   8194  C  CB  . VAL B 1 404 ? 81.074  73.956  91.825  1.00 15.90  ? 404 VAL B CB  1 
ATOM   8195  C  CG1 . VAL B 1 404 ? 81.944  72.800  92.195  1.00 15.90  ? 404 VAL B CG1 1 
ATOM   8196  C  CG2 . VAL B 1 404 ? 79.829  73.444  91.205  1.00 15.90  ? 404 VAL B CG2 1 
ATOM   8197  N  N   . LEU B 1 405 ? 82.623  76.261  93.571  1.00 16.26  ? 405 LEU B N   1 
ATOM   8198  C  CA  . LEU B 1 405 ? 83.799  76.650  94.349  1.00 16.26  ? 405 LEU B CA  1 
ATOM   8199  C  C   . LEU B 1 405 ? 83.441  77.137  95.736  1.00 16.26  ? 405 LEU B C   1 
ATOM   8200  O  O   . LEU B 1 405 ? 84.162  76.853  96.691  1.00 16.26  ? 405 LEU B O   1 
ATOM   8201  C  CB  . LEU B 1 405 ? 84.601  77.723  93.655  1.00 16.26  ? 405 LEU B CB  1 
ATOM   8202  C  CG  . LEU B 1 405 ? 86.026  77.760  94.103  1.00 16.26  ? 405 LEU B CG  1 
ATOM   8203  C  CD1 . LEU B 1 405 ? 86.633  76.489  93.648  1.00 16.26  ? 405 LEU B CD1 1 
ATOM   8204  C  CD2 . LEU B 1 405 ? 86.658  78.925  93.420  1.00 16.26  ? 405 LEU B CD2 1 
ATOM   8205  N  N   . VAL B 1 406 ? 82.365  77.913  95.857  1.00 17.49  ? 406 VAL B N   1 
ATOM   8206  C  CA  . VAL B 1 406 ? 81.958  78.433  97.157  1.00 17.49  ? 406 VAL B CA  1 
ATOM   8207  C  C   . VAL B 1 406 ? 81.561  77.294  98.072  1.00 17.49  ? 406 VAL B C   1 
ATOM   8208  O  O   . VAL B 1 406 ? 82.006  77.220  99.221  1.00 17.49  ? 406 VAL B O   1 
ATOM   8209  C  CB  . VAL B 1 406 ? 80.821  79.450  96.990  1.00 17.49  ? 406 VAL B CB  1 
ATOM   8210  C  CG1 . VAL B 1 406 ? 80.083  79.644  98.273  1.00 17.49  ? 406 VAL B CG1 1 
ATOM   8211  C  CG2 . VAL B 1 406 ? 81.388  80.751  96.558  1.00 17.49  ? 406 VAL B CG2 1 
ATOM   8212  N  N   . PHE B 1 407 ? 80.763  76.366  97.568  1.00 24.12  ? 407 PHE B N   1 
ATOM   8213  C  CA  . PHE B 1 407 ? 80.361  75.258  98.414  1.00 24.12  ? 407 PHE B CA  1 
ATOM   8214  C  C   . PHE B 1 407 ? 81.498  74.301  98.716  1.00 24.12  ? 407 PHE B C   1 
ATOM   8215  O  O   . PHE B 1 407 ? 81.562  73.787  99.830  1.00 24.12  ? 407 PHE B O   1 
ATOM   8216  C  CB  . PHE B 1 407 ? 79.241  74.485  97.758  1.00 24.12  ? 407 PHE B CB  1 
ATOM   8217  C  CG  . PHE B 1 407 ? 78.766  73.329  98.554  1.00 24.12  ? 407 PHE B CG  1 
ATOM   8218  C  CD1 . PHE B 1 407 ? 77.967  73.507  99.646  1.00 24.12  ? 407 PHE B CD1 1 
ATOM   8219  C  CD2 . PHE B 1 407 ? 79.132  72.045  98.202  1.00 24.12  ? 407 PHE B CD2 1 
ATOM   8220  C  CE1 . PHE B 1 407 ? 77.538  72.429  100.379 1.00 24.12  ? 407 PHE B CE1 1 
ATOM   8221  C  CE2 . PHE B 1 407 ? 78.717  70.969  98.934  1.00 24.12  ? 407 PHE B CE2 1 
ATOM   8222  C  CZ  . PHE B 1 407 ? 77.916  71.159  100.023 1.00 24.12  ? 407 PHE B CZ  1 
ATOM   8223  N  N   . ASN B 1 408 ? 82.418  74.070  97.782  1.00 19.86  ? 408 ASN B N   1 
ATOM   8224  C  CA  . ASN B 1 408 ? 83.474  73.111  98.081  1.00 19.86  ? 408 ASN B CA  1 
ATOM   8225  C  C   . ASN B 1 408 ? 84.489  73.711  99.026  1.00 19.86  ? 408 ASN B C   1 
ATOM   8226  O  O   . ASN B 1 408 ? 85.078  72.996  99.837  1.00 19.86  ? 408 ASN B O   1 
ATOM   8227  C  CB  . ASN B 1 408 ? 84.121  72.599  96.814  1.00 19.86  ? 408 ASN B CB  1 
ATOM   8228  C  CG  . ASN B 1 408 ? 83.315  71.509  96.185  1.00 19.86  ? 408 ASN B CG  1 
ATOM   8229  O  OD1 . ASN B 1 408 ? 83.534  70.334  96.445  1.00 19.86  ? 408 ASN B OD1 1 
ATOM   8230  N  ND2 . ASN B 1 408 ? 82.347  71.889  95.380  1.00 19.86  ? 408 ASN B ND2 1 
ATOM   8231  N  N   . PHE B 1 409 ? 84.747  75.007  98.892  1.00 19.76  ? 409 PHE B N   1 
ATOM   8232  C  CA  . PHE B 1 409 ? 85.546  75.707  99.886  1.00 19.76  ? 409 PHE B CA  1 
ATOM   8233  C  C   . PHE B 1 409 ? 84.888  75.646  101.244 1.00 19.76  ? 409 PHE B C   1 
ATOM   8234  O  O   . PHE B 1 409 ? 85.541  75.343  102.244 1.00 19.76  ? 409 PHE B O   1 
ATOM   8235  C  CB  . PHE B 1 409 ? 85.734  77.156  99.465  1.00 19.76  ? 409 PHE B CB  1 
ATOM   8236  C  CG  . PHE B 1 409 ? 86.589  77.955  100.373 1.00 19.76  ? 409 PHE B CG  1 
ATOM   8237  C  CD1 . PHE B 1 409 ? 87.947  77.984  100.225 1.00 19.76  ? 409 PHE B CD1 1 
ATOM   8238  C  CD2 . PHE B 1 409 ? 86.003  78.785  101.309 1.00 19.76  ? 409 PHE B CD2 1 
ATOM   8239  C  CE1 . PHE B 1 409 ? 88.715  78.759  101.060 1.00 19.76  ? 409 PHE B CE1 1 
ATOM   8240  C  CE2 . PHE B 1 409 ? 86.758  79.558  102.132 1.00 19.76  ? 409 PHE B CE2 1 
ATOM   8241  C  CZ  . PHE B 1 409 ? 88.117  79.549  102.009 1.00 19.76  ? 409 PHE B CZ  1 
ATOM   8242  N  N   . LEU B 1 410 ? 83.602  75.973  101.305 1.00 22.93  ? 410 LEU B N   1 
ATOM   8243  C  CA  . LEU B 1 410 ? 82.916  75.982  102.586 1.00 22.93  ? 410 LEU B CA  1 
ATOM   8244  C  C   . LEU B 1 410 ? 82.780  74.585  103.175 1.00 22.93  ? 410 LEU B C   1 
ATOM   8245  O  O   . LEU B 1 410 ? 83.127  74.369  104.330 1.00 22.93  ? 410 LEU B O   1 
ATOM   8246  C  CB  . LEU B 1 410 ? 81.558  76.636  102.450 1.00 22.93  ? 410 LEU B CB  1 
ATOM   8247  C  CG  . LEU B 1 410 ? 81.057  76.942  103.842 1.00 22.93  ? 410 LEU B CG  1 
ATOM   8248  C  CD1 . LEU B 1 410 ? 81.534  78.323  104.197 1.00 22.93  ? 410 LEU B CD1 1 
ATOM   8249  C  CD2 . LEU B 1 410 ? 79.563  76.870  103.895 1.00 22.93  ? 410 LEU B CD2 1 
ATOM   8250  N  N   . ASN B 1 411 ? 82.355  73.605  102.379 1.00 24.46  ? 411 ASN B N   1 
ATOM   8251  C  CA  . ASN B 1 411 ? 82.119  72.272  102.933 1.00 24.46  ? 411 ASN B CA  1 
ATOM   8252  C  C   . ASN B 1 411 ? 83.390  71.539  103.315 1.00 24.46  ? 411 ASN B C   1 
ATOM   8253  O  O   . ASN B 1 411 ? 83.354  70.675  104.191 1.00 24.46  ? 411 ASN B O   1 
ATOM   8254  C  CB  . ASN B 1 411 ? 81.342  71.412  101.959 1.00 24.46  ? 411 ASN B CB  1 
ATOM   8255  C  CG  . ASN B 1 411 ? 80.685  70.263  102.630 1.00 24.46  ? 411 ASN B CG  1 
ATOM   8256  O  OD1 . ASN B 1 411 ? 80.434  70.302  103.827 1.00 24.46  ? 411 ASN B OD1 1 
ATOM   8257  N  ND2 . ASN B 1 411 ? 80.423  69.210  101.876 1.00 24.46  ? 411 ASN B ND2 1 
ATOM   8258  N  N   . CYS B 1 412 ? 84.509  71.844  102.685 1.00 21.10  ? 412 CYS B N   1 
ATOM   8259  C  CA  . CYS B 1 412 ? 85.730  71.162  103.082 1.00 21.10  ? 412 CYS B CA  1 
ATOM   8260  C  C   . CYS B 1 412 ? 86.423  71.872  104.231 1.00 21.10  ? 412 CYS B C   1 
ATOM   8261  O  O   . CYS B 1 412 ? 87.001  71.210  105.093 1.00 21.10  ? 412 CYS B O   1 
ATOM   8262  C  CB  . CYS B 1 412 ? 86.659  70.959  101.902 1.00 21.10  ? 412 CYS B CB  1 
ATOM   8263  S  SG  . CYS B 1 412 ? 86.014  69.745  100.748 1.00 21.10  ? 412 CYS B SG  1 
ATOM   8264  N  N   . PHE B 1 413 ? 86.439  73.201  104.255 1.00 25.13  ? 413 PHE B N   1 
ATOM   8265  C  CA  . PHE B 1 413 ? 87.234  73.873  105.268 1.00 25.13  ? 413 PHE B CA  1 
ATOM   8266  C  C   . PHE B 1 413 ? 86.420  74.459  106.416 1.00 25.13  ? 413 PHE B C   1 
ATOM   8267  O  O   . PHE B 1 413 ? 86.980  75.213  107.214 1.00 25.13  ? 413 PHE B O   1 
ATOM   8268  C  CB  . PHE B 1 413 ? 88.067  74.985  104.658 1.00 25.13  ? 413 PHE B CB  1 
ATOM   8269  C  CG  . PHE B 1 413 ? 88.875  74.562  103.506 1.00 25.13  ? 413 PHE B CG  1 
ATOM   8270  C  CD1 . PHE B 1 413 ? 89.905  73.678  103.672 1.00 25.13  ? 413 PHE B CD1 1 
ATOM   8271  C  CD2 . PHE B 1 413 ? 88.674  75.128  102.271 1.00 25.13  ? 413 PHE B CD2 1 
ATOM   8272  C  CE1 . PHE B 1 413 ? 90.678  73.310  102.606 1.00 25.13  ? 413 PHE B CE1 1 
ATOM   8273  C  CE2 . PHE B 1 413 ? 89.443  74.771  101.206 1.00 25.13  ? 413 PHE B CE2 1 
ATOM   8274  C  CZ  . PHE B 1 413 ? 90.445  73.859  101.371 1.00 25.13  ? 413 PHE B CZ  1 
ATOM   8275  N  N   . ALA B 1 414 ? 85.115  74.200  106.496 1.00 29.18  ? 414 ALA B N   1 
ATOM   8276  C  CA  . ALA B 1 414 ? 84.365  74.758  107.615 1.00 29.18  ? 414 ALA B CA  1 
ATOM   8277  C  C   . ALA B 1 414 ? 84.739  74.043  108.892 1.00 29.18  ? 414 ALA B C   1 
ATOM   8278  O  O   . ALA B 1 414 ? 84.927  74.675  109.935 1.00 29.18  ? 414 ALA B O   1 
ATOM   8279  C  CB  . ALA B 1 414 ? 82.858  74.663  107.427 1.00 29.18  ? 414 ALA B CB  1 
ATOM   8280  N  N   . SER B 1 415 ? 84.904  72.726  108.801 1.00 31.97  ? 415 SER B N   1 
ATOM   8281  C  CA  . SER B 1 415 ? 85.253  71.944  109.969 1.00 31.97  ? 415 SER B CA  1 
ATOM   8282  C  C   . SER B 1 415 ? 86.642  72.271  110.466 1.00 31.97  ? 415 SER B C   1 
ATOM   8283  O  O   . SER B 1 415 ? 86.874  72.267  111.677 1.00 31.97  ? 415 SER B O   1 
ATOM   8284  C  CB  . SER B 1 415 ? 85.163  70.469  109.632 1.00 31.97  ? 415 SER B CB  1 
ATOM   8285  O  OG  . SER B 1 415 ? 86.399  70.042  109.110 1.00 31.97  ? 415 SER B OG  1 
ATOM   8286  N  N   . LEU B 1 416 ? 87.576  72.548  109.571 1.00 33.64  ? 416 LEU B N   1 
ATOM   8287  C  CA  . LEU B 1 416 ? 88.889  72.938  110.052 1.00 33.64  ? 416 LEU B CA  1 
ATOM   8288  C  C   . LEU B 1 416 ? 88.851  74.345  110.624 1.00 33.64  ? 416 LEU B C   1 
ATOM   8289  O  O   . LEU B 1 416 ? 89.580  74.647  111.570 1.00 33.64  ? 416 LEU B O   1 
ATOM   8290  C  CB  . LEU B 1 416 ? 89.919  72.807  108.949 1.00 33.64  ? 416 LEU B CB  1 
ATOM   8291  C  CG  . LEU B 1 416 ? 89.832  71.407  108.372 1.00 33.64  ? 416 LEU B CG  1 
ATOM   8292  C  CD1 . LEU B 1 416 ? 90.761  71.307  107.216 1.00 33.64  ? 416 LEU B CD1 1 
ATOM   8293  C  CD2 . LEU B 1 416 ? 90.199  70.389  109.418 1.00 33.64  ? 416 LEU B CD2 1 
ATOM   8294  N  N   . PHE B 1 417 ? 88.012  75.214  110.065 1.00 36.35  ? 417 PHE B N   1 
ATOM   8295  C  CA  . PHE B 1 417 ? 87.841  76.539  110.641 1.00 36.35  ? 417 PHE B CA  1 
ATOM   8296  C  C   . PHE B 1 417 ? 87.119  76.475  111.975 1.00 36.35  ? 417 PHE B C   1 
ATOM   8297  O  O   . PHE B 1 417 ? 87.446  77.226  112.897 1.00 36.35  ? 417 PHE B O   1 
ATOM   8298  C  CB  . PHE B 1 417 ? 87.050  77.432  109.694 1.00 36.35  ? 417 PHE B CB  1 
ATOM   8299  C  CG  . PHE B 1 417 ? 87.851  78.005  108.580 1.00 36.35  ? 417 PHE B CG  1 
ATOM   8300  C  CD1 . PHE B 1 417 ? 89.211  78.156  108.695 1.00 36.35  ? 417 PHE B CD1 1 
ATOM   8301  C  CD2 . PHE B 1 417 ? 87.229  78.395  107.410 1.00 36.35  ? 417 PHE B CD2 1 
ATOM   8302  C  CE1 . PHE B 1 417 ? 89.932  78.685  107.660 1.00 36.35  ? 417 PHE B CE1 1 
ATOM   8303  C  CE2 . PHE B 1 417 ? 87.945  78.918  106.379 1.00 36.35  ? 417 PHE B CE2 1 
ATOM   8304  C  CZ  . PHE B 1 417 ? 89.296  79.066  106.502 1.00 36.35  ? 417 PHE B CZ  1 
ATOM   8305  N  N   . TYR B 1 418 ? 86.153  75.569  112.106 1.00 40.07  ? 418 TYR B N   1 
ATOM   8306  C  CA  . TYR B 1 418 ? 85.449  75.421  113.372 1.00 40.07  ? 418 TYR B CA  1 
ATOM   8307  C  C   . TYR B 1 418 ? 86.326  74.849  114.469 1.00 40.07  ? 418 TYR B C   1 
ATOM   8308  O  O   . TYR B 1 418 ? 86.128  75.178  115.638 1.00 40.07  ? 418 TYR B O   1 
ATOM   8309  C  CB  . TYR B 1 418 ? 84.232  74.528  113.179 1.00 40.07  ? 418 TYR B CB  1 
ATOM   8310  C  CG  . TYR B 1 418 ? 83.305  74.433  114.361 1.00 40.07  ? 418 TYR B CG  1 
ATOM   8311  C  CD1 . TYR B 1 418 ? 82.350  75.399  114.593 1.00 40.07  ? 418 TYR B CD1 1 
ATOM   8312  C  CD2 . TYR B 1 418 ? 83.371  73.358  115.230 1.00 40.07  ? 418 TYR B CD2 1 
ATOM   8313  C  CE1 . TYR B 1 418 ? 81.494  75.304  115.662 1.00 40.07  ? 418 TYR B CE1 1 
ATOM   8314  C  CE2 . TYR B 1 418 ? 82.525  73.255  116.298 1.00 40.07  ? 418 TYR B CE2 1 
ATOM   8315  C  CZ  . TYR B 1 418 ? 81.590  74.230  116.510 1.00 40.07  ? 418 TYR B CZ  1 
ATOM   8316  O  OH  . TYR B 1 418 ? 80.740  74.126  117.580 1.00 40.07  ? 418 TYR B OH  1 
ATOM   8317  N  N   . ILE B 1 419 ? 87.274  73.987  114.132 1.00 38.32  ? 419 ILE B N   1 
ATOM   8318  C  CA  . ILE B 1 419 ? 88.183  73.489  115.151 1.00 38.32  ? 419 ILE B CA  1 
ATOM   8319  C  C   . ILE B 1 419 ? 89.180  74.557  115.563 1.00 38.32  ? 419 ILE B C   1 
ATOM   8320  O  O   . ILE B 1 419 ? 89.418  74.774  116.755 1.00 38.32  ? 419 ILE B O   1 
ATOM   8321  C  CB  . ILE B 1 419 ? 88.874  72.214  114.658 1.00 38.32  ? 419 ILE B CB  1 
ATOM   8322  C  CG1 . ILE B 1 419 ? 87.865  71.088  114.641 1.00 38.32  ? 419 ILE B CG1 1 
ATOM   8323  C  CG2 . ILE B 1 419 ? 90.003  71.826  115.551 1.00 38.32  ? 419 ILE B CG2 1 
ATOM   8324  C  CD1 . ILE B 1 419 ? 88.350  69.838  113.983 1.00 38.32  ? 419 ILE B CD1 1 
ATOM   8325  N  N   . ALA B 1 420 ? 89.727  75.283  114.601 1.00 42.24  ? 420 ALA B N   1 
ATOM   8326  C  CA  . ALA B 1 420 ? 90.827  76.191  114.891 1.00 42.24  ? 420 ALA B CA  1 
ATOM   8327  C  C   . ALA B 1 420 ? 90.401  77.459  115.614 1.00 42.24  ? 420 ALA B C   1 
ATOM   8328  O  O   . ALA B 1 420 ? 91.155  77.962  116.449 1.00 42.24  ? 420 ALA B O   1 
ATOM   8329  C  CB  . ALA B 1 420 ? 91.540  76.569  113.601 1.00 42.24  ? 420 ALA B CB  1 
ATOM   8330  N  N   . PHE B 1 421 ? 89.224  77.993  115.326 1.00 41.47  ? 421 PHE B N   1 
ATOM   8331  C  CA  . PHE B 1 421 ? 88.858  79.309  115.822 1.00 41.47  ? 421 PHE B CA  1 
ATOM   8332  C  C   . PHE B 1 421 ? 87.706  79.322  116.805 1.00 41.47  ? 421 PHE B C   1 
ATOM   8333  O  O   . PHE B 1 421 ? 87.348  80.396  117.292 1.00 41.47  ? 421 PHE B O   1 
ATOM   8334  C  CB  . PHE B 1 421 ? 88.515  80.228  114.656 1.00 41.47  ? 421 PHE B CB  1 
ATOM   8335  C  CG  . PHE B 1 421 ? 89.605  80.351  113.662 1.00 41.47  ? 421 PHE B CG  1 
ATOM   8336  C  CD1 . PHE B 1 421 ? 90.882  80.646  114.072 1.00 41.47  ? 421 PHE B CD1 1 
ATOM   8337  C  CD2 . PHE B 1 421 ? 89.359  80.156  112.324 1.00 41.47  ? 421 PHE B CD2 1 
ATOM   8338  C  CE1 . PHE B 1 421 ? 91.889  80.761  113.166 1.00 41.47  ? 421 PHE B CE1 1 
ATOM   8339  C  CE2 . PHE B 1 421 ? 90.360  80.265  111.416 1.00 41.47  ? 421 PHE B CE2 1 
ATOM   8340  C  CZ  . PHE B 1 421 ? 91.629  80.570  111.836 1.00 41.47  ? 421 PHE B CZ  1 
ATOM   8341  N  N   . VAL B 1 422 ? 87.106  78.183  117.107 1.00 42.84  ? 422 VAL B N   1 
ATOM   8342  C  CA  . VAL B 1 422 ? 86.046  78.105  118.100 1.00 42.84  ? 422 VAL B CA  1 
ATOM   8343  C  C   . VAL B 1 422 ? 86.445  77.199  119.252 1.00 42.84  ? 422 VAL B C   1 
ATOM   8344  O  O   . VAL B 1 422 ? 86.452  77.617  120.411 1.00 42.84  ? 422 VAL B O   1 
ATOM   8345  C  CB  . VAL B 1 422 ? 84.725  77.627  117.465 1.00 42.84  ? 422 VAL B CB  1 
ATOM   8346  C  CG1 . VAL B 1 422 ? 83.701  77.302  118.535 1.00 42.84  ? 422 VAL B CG1 1 
ATOM   8347  C  CG2 . VAL B 1 422 ? 84.205  78.663  116.494 1.00 42.84  ? 422 VAL B CG2 1 
ATOM   8348  N  N   . LEU B 1 423 ? 86.807  75.960  118.952 1.00 47.96  ? 423 LEU B N   1 
ATOM   8349  C  CA  . LEU B 1 423 ? 87.291  75.088  120.007 1.00 47.96  ? 423 LEU B CA  1 
ATOM   8350  C  C   . LEU B 1 423 ? 88.697  75.480  120.420 1.00 47.96  ? 423 LEU B C   1 
ATOM   8351  O  O   . LEU B 1 423 ? 89.027  75.410  121.607 1.00 47.96  ? 423 LEU B O   1 
ATOM   8352  C  CB  . LEU B 1 423 ? 87.216  73.628  119.580 1.00 47.96  ? 423 LEU B CB  1 
ATOM   8353  C  CG  . LEU B 1 423 ? 85.822  73.124  119.198 1.00 47.96  ? 423 LEU B CG  1 
ATOM   8354  C  CD1 . LEU B 1 423 ? 85.828  71.616  119.185 1.00 47.96  ? 423 LEU B CD1 1 
ATOM   8355  C  CD2 . LEU B 1 423 ? 84.729  73.625  120.127 1.00 47.96  ? 423 LEU B CD2 1 
ATOM   8356  N  N   . LYS B 1 424 ? 89.506  75.919  119.456 1.00 53.17  ? 424 LYS B N   1 
ATOM   8357  C  CA  . LYS B 1 424 ? 90.907  76.306  119.626 1.00 53.17  ? 424 LYS B CA  1 
ATOM   8358  C  C   . LYS B 1 424 ? 91.726  75.180  120.258 1.00 53.17  ? 424 LYS B C   1 
ATOM   8359  O  O   . LYS B 1 424 ? 92.299  75.318  121.334 1.00 53.17  ? 424 LYS B O   1 
ATOM   8360  C  CB  . LYS B 1 424 ? 91.028  77.591  120.449 1.00 53.17  ? 424 LYS B CB  1 
ATOM   8361  C  CG  . LYS B 1 424 ? 90.060  78.675  120.040 1.00 53.17  ? 424 LYS B CG  1 
ATOM   8362  N  N   . ASP B 1 425 ? 91.772  74.055  119.552 1.00 59.36  ? 425 ASP B N   1 
ATOM   8363  C  CA  . ASP B 1 425 ? 92.432  72.861  120.078 1.00 59.36  ? 425 ASP B CA  1 
ATOM   8364  C  C   . ASP B 1 425 ? 93.332  72.295  118.979 1.00 59.36  ? 425 ASP B C   1 
ATOM   8365  O  O   . ASP B 1 425 ? 92.870  71.578  118.091 1.00 59.36  ? 425 ASP B O   1 
ATOM   8366  C  CB  . ASP B 1 425 ? 91.384  71.864  120.537 1.00 59.36  ? 425 ASP B CB  1 
ATOM   8367  C  CG  . ASP B 1 425 ? 91.986  70.669  121.211 1.00 59.36  ? 425 ASP B CG  1 
ATOM   8368  O  OD1 . ASP B 1 425 ? 93.104  70.807  121.744 1.00 59.36  ? 425 ASP B OD1 1 
ATOM   8369  O  OD2 . ASP B 1 425 ? 91.342  69.599  121.226 1.00 59.36  ? 425 ASP B OD2 1 
ATOM   8370  N  N   . MET B 1 426 ? 94.635  72.564  119.093 1.00 59.63  ? 426 MET B N   1 
ATOM   8371  C  CA  . MET B 1 426 ? 95.550  72.298  117.987 1.00 59.63  ? 426 MET B CA  1 
ATOM   8372  C  C   . MET B 1 426 ? 95.871  70.823  117.827 1.00 59.63  ? 426 MET B C   1 
ATOM   8373  O  O   . MET B 1 426 ? 96.283  70.406  116.742 1.00 59.63  ? 426 MET B O   1 
ATOM   8374  C  CB  . MET B 1 426 ? 96.855  73.059  118.184 1.00 59.63  ? 426 MET B CB  1 
ATOM   8375  C  CG  . MET B 1 426 ? 96.707  74.547  118.169 1.00 59.63  ? 426 MET B CG  1 
ATOM   8376  S  SD  . MET B 1 426 ? 95.712  75.158  116.821 1.00 59.63  ? 426 MET B SD  1 
ATOM   8377  C  CE  . MET B 1 426 ? 95.783  76.902  117.193 1.00 59.63  ? 426 MET B CE  1 
ATOM   8378  N  N   . LYS B 1 427 ? 95.751  70.029  118.888 1.00 55.84  ? 427 LYS B N   1 
ATOM   8379  C  CA  . LYS B 1 427 ? 95.988  68.598  118.740 1.00 55.84  ? 427 LYS B CA  1 
ATOM   8380  C  C   . LYS B 1 427 ? 94.882  67.964  117.910 1.00 55.84  ? 427 LYS B C   1 
ATOM   8381  O  O   . LYS B 1 427 ? 95.147  67.122  117.047 1.00 55.84  ? 427 LYS B O   1 
ATOM   8382  C  CB  . LYS B 1 427 ? 96.139  67.919  120.099 1.00 55.84  ? 427 LYS B CB  1 
ATOM   8383  C  CG  . LYS B 1 427 ? 95.192  68.388  121.163 1.00 55.84  ? 427 LYS B CG  1 
ATOM   8384  C  CD  . LYS B 1 427 ? 95.207  67.456  122.351 1.00 55.84  ? 427 LYS B CD  1 
ATOM   8385  C  CE  . LYS B 1 427 ? 94.044  67.743  123.274 1.00 55.84  ? 427 LYS B CE  1 
ATOM   8386  N  NZ  . LYS B 1 427 ? 93.709  66.556  124.100 1.00 55.84  ? 427 LYS B NZ  1 
ATOM   8387  N  N   . LEU B 1 428 ? 93.634  68.325  118.195 1.00 51.34  ? 428 LEU B N   1 
ATOM   8388  C  CA  . LEU B 1 428 ? 92.513  67.880  117.382 1.00 51.34  ? 428 LEU B CA  1 
ATOM   8389  C  C   . LEU B 1 428 ? 92.555  68.449  115.969 1.00 51.34  ? 428 LEU B C   1 
ATOM   8390  O  O   . LEU B 1 428 ? 92.106  67.788  115.027 1.00 51.34  ? 428 LEU B O   1 
ATOM   8391  C  CB  . LEU B 1 428 ? 91.215  68.285  118.069 1.00 51.34  ? 428 LEU B CB  1 
ATOM   8392  C  CG  . LEU B 1 428 ? 89.891  67.917  117.418 1.00 51.34  ? 428 LEU B CG  1 
ATOM   8393  C  CD1 . LEU B 1 428 ? 89.830  66.428  117.235 1.00 51.34  ? 428 LEU B CD1 1 
ATOM   8394  C  CD2 . LEU B 1 428 ? 88.740  68.390  118.275 1.00 51.34  ? 428 LEU B CD2 1 
ATOM   8395  N  N   . LEU B 1 429 ? 93.111  69.647  115.793 1.00 48.30  ? 429 LEU B N   1 
ATOM   8396  C  CA  . LEU B 1 429 ? 93.237  70.225  114.455 1.00 48.30  ? 429 LEU B CA  1 
ATOM   8397  C  C   . LEU B 1 429 ? 94.234  69.473  113.582 1.00 48.30  ? 429 LEU B C   1 
ATOM   8398  O  O   . LEU B 1 429 ? 93.970  69.251  112.398 1.00 48.30  ? 429 LEU B O   1 
ATOM   8399  C  CB  . LEU B 1 429 ? 93.636  71.691  114.550 1.00 48.30  ? 429 LEU B CB  1 
ATOM   8400  C  CG  . LEU B 1 429 ? 93.814  72.419  113.226 1.00 48.30  ? 429 LEU B CG  1 
ATOM   8401  C  CD1 . LEU B 1 429 ? 92.562  72.296  112.409 1.00 48.30  ? 429 LEU B CD1 1 
ATOM   8402  C  CD2 . LEU B 1 429 ? 94.103  73.854  113.490 1.00 48.30  ? 429 LEU B CD2 1 
ATOM   8403  N  N   . ARG B 1 430 ? 95.372  69.072  114.147 1.00 53.88  ? 430 ARG B N   1 
ATOM   8404  C  CA  . ARG B 1 430 ? 96.350  68.293  113.395 1.00 53.88  ? 430 ARG B CA  1 
ATOM   8405  C  C   . ARG B 1 430 ? 95.779  66.959  112.959 1.00 53.88  ? 430 ARG B C   1 
ATOM   8406  O  O   . ARG B 1 430 ? 96.003  66.517  111.828 1.00 53.88  ? 430 ARG B O   1 
ATOM   8407  C  CB  . ARG B 1 430 ? 97.612  68.074  114.219 1.00 53.88  ? 430 ARG B CB  1 
ATOM   8408  C  CG  . ARG B 1 430 ? 98.474  69.292  114.397 1.00 53.88  ? 430 ARG B CG  1 
ATOM   8409  C  CD  . ARG B 1 430 ? 99.701  68.925  115.196 1.00 53.88  ? 430 ARG B CD  1 
ATOM   8410  N  NE  . ARG B 1 430 ? 100.075 69.952  116.158 1.00 53.88  ? 430 ARG B NE  1 
ATOM   8411  C  CZ  . ARG B 1 430 ? 101.005 70.870  115.934 1.00 53.88  ? 430 ARG B CZ  1 
ATOM   8412  N  NH1 . ARG B 1 430 ? 101.656 70.885  114.783 1.00 53.88  ? 430 ARG B NH1 1 
ATOM   8413  N  NH2 . ARG B 1 430 ? 101.289 71.767  116.863 1.00 53.88  ? 430 ARG B NH2 1 
ATOM   8414  N  N   . GLN B 1 431 ? 95.094  66.277  113.863 1.00 54.71  ? 431 GLN B N   1 
ATOM   8415  C  CA  . GLN B 1 431 ? 94.522  64.982  113.533 1.00 54.71  ? 431 GLN B CA  1 
ATOM   8416  C  C   . GLN B 1 431 ? 93.449  65.115  112.466 1.00 54.71  ? 431 GLN B C   1 
ATOM   8417  O  O   . GLN B 1 431 ? 93.424  64.341  111.505 1.00 54.71  ? 431 GLN B O   1 
ATOM   8418  C  CB  . GLN B 1 431 ? 93.955  64.347  114.794 1.00 54.71  ? 431 GLN B CB  1 
ATOM   8419  C  CG  . GLN B 1 431 ? 95.014  63.718  115.662 1.00 54.71  ? 431 GLN B CG  1 
ATOM   8420  C  CD  . GLN B 1 431 ? 94.426  62.949  116.808 1.00 54.71  ? 431 GLN B CD  1 
ATOM   8421  O  OE1 . GLN B 1 431 ? 93.208  62.828  116.923 1.00 54.71  ? 431 GLN B OE1 1 
ATOM   8422  N  NE2 . GLN B 1 431 ? 95.283  62.440  117.682 1.00 54.71  ? 431 GLN B NE2 1 
ATOM   8423  N  N   . SER B 1 432 ? 92.568  66.102  112.606 1.00 45.65  ? 432 SER B N   1 
ATOM   8424  C  CA  . SER B 1 432 ? 91.470  66.244  111.659 1.00 45.65  ? 432 SER B CA  1 
ATOM   8425  C  C   . SER B 1 432 ? 91.936  66.718  110.285 1.00 45.65  ? 432 SER B C   1 
ATOM   8426  O  O   . SER B 1 432 ? 91.389  66.287  109.265 1.00 45.65  ? 432 SER B O   1 
ATOM   8427  C  CB  . SER B 1 432 ? 90.420  67.189  112.221 1.00 45.65  ? 432 SER B CB  1 
ATOM   8428  O  OG  . SER B 1 432 ? 89.357  67.332  111.304 1.00 45.65  ? 432 SER B OG  1 
ATOM   8429  N  N   . LEU B 1 433 ? 92.935  67.602  110.232 1.00 37.76  ? 433 LEU B N   1 
ATOM   8430  C  CA  . LEU B 1 433 ? 93.429  68.091  108.944 1.00 37.76  ? 433 LEU B CA  1 
ATOM   8431  C  C   . LEU B 1 433 ? 94.153  67.006  108.165 1.00 37.76  ? 433 LEU B C   1 
ATOM   8432  O  O   . LEU B 1 433 ? 93.974  66.889  106.950 1.00 37.76  ? 433 LEU B O   1 
ATOM   8433  C  CB  . LEU B 1 433 ? 94.366  69.274  109.149 1.00 37.76  ? 433 LEU B CB  1 
ATOM   8434  C  CG  . LEU B 1 433 ? 95.173  69.788  107.964 1.00 37.76  ? 433 LEU B CG  1 
ATOM   8435  C  CD1 . LEU B 1 433 ? 94.272  70.245  106.867 1.00 37.76  ? 433 LEU B CD1 1 
ATOM   8436  C  CD2 . LEU B 1 433 ? 96.082  70.903  108.390 1.00 37.76  ? 433 LEU B CD2 1 
ATOM   8437  N  N   . ALA B 1 434 ? 94.982  66.218  108.842 1.00 40.38  ? 434 ALA B N   1 
ATOM   8438  C  CA  . ALA B 1 434 ? 95.687  65.137  108.171 1.00 40.38  ? 434 ALA B CA  1 
ATOM   8439  C  C   . ALA B 1 434 ? 94.725  64.072  107.681 1.00 40.38  ? 434 ALA B C   1 
ATOM   8440  O  O   . ALA B 1 434 ? 94.907  63.528  106.589 1.00 40.38  ? 434 ALA B O   1 
ATOM   8441  C  CB  . ALA B 1 434 ? 96.729  64.535  109.103 1.00 40.38  ? 434 ALA B CB  1 
ATOM   8442  N  N   . THR B 1 435 ? 93.717  63.739  108.481 1.00 40.25  ? 435 THR B N   1 
ATOM   8443  C  CA  . THR B 1 435 ? 92.779  62.704  108.074 1.00 40.25  ? 435 THR B CA  1 
ATOM   8444  C  C   . THR B 1 435 ? 91.898  63.171  106.929 1.00 40.25  ? 435 THR B C   1 
ATOM   8445  O  O   . THR B 1 435 ? 91.630  62.399  106.010 1.00 40.25  ? 435 THR B O   1 
ATOM   8446  C  CB  . THR B 1 435 ? 91.918  62.266  109.239 1.00 40.25  ? 435 THR B CB  1 
ATOM   8447  O  OG1 . THR B 1 435 ? 91.449  63.421  109.933 1.00 40.25  ? 435 THR B OG1 1 
ATOM   8448  C  CG2 . THR B 1 435 ? 92.718  61.402  110.165 1.00 40.25  ? 435 THR B CG2 1 
ATOM   8449  N  N   . LEU B 1 436 ? 91.435  64.421  106.970 1.00 35.57  ? 436 LEU B N   1 
ATOM   8450  C  CA  . LEU B 1 436 ? 90.606  64.949  105.887 1.00 35.57  ? 436 LEU B CA  1 
ATOM   8451  C  C   . LEU B 1 436 ? 91.358  65.013  104.569 1.00 35.57  ? 436 LEU B C   1 
ATOM   8452  O  O   . LEU B 1 436 ? 90.799  64.668  103.529 1.00 35.57  ? 436 LEU B O   1 
ATOM   8453  C  CB  . LEU B 1 436 ? 90.048  66.319  106.248 1.00 35.57  ? 436 LEU B CB  1 
ATOM   8454  C  CG  . LEU B 1 436 ? 88.777  66.321  107.086 1.00 35.57  ? 436 LEU B CG  1 
ATOM   8455  C  CD1 . LEU B 1 436 ? 88.185  67.690  107.088 1.00 35.57  ? 436 LEU B CD1 1 
ATOM   8456  C  CD2 . LEU B 1 436 ? 87.779  65.371  106.490 1.00 35.57  ? 436 LEU B CD2 1 
ATOM   8457  N  N   . LEU B 1 437 ? 92.604  65.472  104.584 1.00 31.24  ? 437 LEU B N   1 
ATOM   8458  C  CA  . LEU B 1 437 ? 93.381  65.572  103.354 1.00 31.24  ? 437 LEU B CA  1 
ATOM   8459  C  C   . LEU B 1 437 ? 93.659  64.208  102.731 1.00 31.24  ? 437 LEU B C   1 
ATOM   8460  O  O   . LEU B 1 437 ? 93.473  64.020  101.525 1.00 31.24  ? 437 LEU B O   1 
ATOM   8461  C  CB  . LEU B 1 437 ? 94.691  66.291  103.643 1.00 31.24  ? 437 LEU B CB  1 
ATOM   8462  C  CG  . LEU B 1 437 ? 95.657  66.451  102.487 1.00 31.24  ? 437 LEU B CG  1 
ATOM   8463  C  CD1 . LEU B 1 437 ? 94.989  67.162  101.372 1.00 31.24  ? 437 LEU B CD1 1 
ATOM   8464  C  CD2 . LEU B 1 437 ? 96.855  67.236  102.953 1.00 31.24  ? 437 LEU B CD2 1 
ATOM   8465  N  N   . ILE B 1 438 ? 94.129  63.254  103.529 1.00 32.53  ? 438 ILE B N   1 
ATOM   8466  C  CA  . ILE B 1 438 ? 94.488  61.950  102.987 1.00 32.53  ? 438 ILE B CA  1 
ATOM   8467  C  C   . ILE B 1 438 ? 93.259  61.145  102.578 1.00 32.53  ? 438 ILE B C   1 
ATOM   8468  O  O   . ILE B 1 438 ? 93.252  60.506  101.520 1.00 32.53  ? 438 ILE B O   1 
ATOM   8469  C  CB  . ILE B 1 438 ? 95.356  61.196  104.005 1.00 32.53  ? 438 ILE B CB  1 
ATOM   8470  C  CG1 . ILE B 1 438 ? 96.666  61.944  104.199 1.00 32.53  ? 438 ILE B CG1 1 
ATOM   8471  C  CG2 . ILE B 1 438 ? 95.659  59.807  103.534 1.00 32.53  ? 438 ILE B CG2 1 
ATOM   8472  C  CD1 . ILE B 1 438 ? 97.584  61.316  105.194 1.00 32.53  ? 438 ILE B CD1 1 
ATOM   8473  N  N   . THR B 1 439 ? 92.184  61.199  103.366 1.00 35.86  ? 439 THR B N   1 
ATOM   8474  C  CA  . THR B 1 439 ? 91.005  60.413  103.011 1.00 35.86  ? 439 THR B CA  1 
ATOM   8475  C  C   . THR B 1 439 ? 90.281  60.983  101.803 1.00 35.86  ? 439 THR B C   1 
ATOM   8476  O  O   . THR B 1 439 ? 89.819  60.222  100.944 1.00 35.86  ? 439 THR B O   1 
ATOM   8477  C  CB  . THR B 1 439 ? 90.045  60.320  104.185 1.00 35.86  ? 439 THR B CB  1 
ATOM   8478  O  OG1 . THR B 1 439 ? 90.756  59.832  105.321 1.00 35.86  ? 439 THR B OG1 1 
ATOM   8479  C  CG2 . THR B 1 439 ? 88.958  59.315  103.890 1.00 35.86  ? 439 THR B CG2 1 
ATOM   8480  N  N   . SER B 1 440 ? 90.220  62.311  101.685 1.00 34.27  ? 440 SER B N   1 
ATOM   8481  C  CA  . SER B 1 440 ? 89.592  62.899  100.508 1.00 34.27  ? 440 SER B CA  1 
ATOM   8482  C  C   . SER B 1 440 ? 90.400  62.606  99.262  1.00 34.27  ? 440 SER B C   1 
ATOM   8483  O  O   . SER B 1 440 ? 89.826  62.350  98.205  1.00 34.27  ? 440 SER B O   1 
ATOM   8484  C  CB  . SER B 1 440 ? 89.402  64.400  100.669 1.00 34.27  ? 440 SER B CB  1 
ATOM   8485  O  OG  . SER B 1 440 ? 88.884  64.961  99.485  1.00 34.27  ? 440 SER B OG  1 
ATOM   8486  N  N   . GLN B 1 441 ? 91.723  62.583  99.378  1.00 37.75  ? 441 GLN B N   1 
ATOM   8487  C  CA  . GLN B 1 441 ? 92.543  62.266  98.220  1.00 37.75  ? 441 GLN B CA  1 
ATOM   8488  C  C   . GLN B 1 441 ? 92.432  60.803  97.836  1.00 37.75  ? 441 GLN B C   1 
ATOM   8489  O  O   . GLN B 1 441 ? 92.427  60.478  96.645  1.00 37.75  ? 441 GLN B O   1 
ATOM   8490  C  CB  . GLN B 1 441 ? 93.991  62.605  98.479  1.00 37.75  ? 441 GLN B CB  1 
ATOM   8491  C  CG  . GLN B 1 441 ? 94.336  64.021  98.240  1.00 37.75  ? 441 GLN B CG  1 
ATOM   8492  C  CD  . GLN B 1 441 ? 95.753  64.265  98.636  1.00 37.75  ? 441 GLN B CD  1 
ATOM   8493  O  OE1 . GLN B 1 441 ? 96.420  63.371  99.151  1.00 37.75  ? 441 GLN B OE1 1 
ATOM   8494  N  NE2 . GLN B 1 441 ? 96.240  65.461  98.389  1.00 37.75  ? 441 GLN B NE2 1 
ATOM   8495  N  N   . ILE B 1 442 ? 92.361  59.907  98.818  1.00 36.29  ? 442 ILE B N   1 
ATOM   8496  C  CA  . ILE B 1 442 ? 92.253  58.490  98.502  1.00 36.29  ? 442 ILE B CA  1 
ATOM   8497  C  C   . ILE B 1 442 ? 90.904  58.213  97.865  1.00 36.29  ? 442 ILE B C   1 
ATOM   8498  O  O   . ILE B 1 442 ? 90.808  57.487  96.868  1.00 36.29  ? 442 ILE B O   1 
ATOM   8499  C  CB  . ILE B 1 442 ? 92.481  57.649  99.769  1.00 36.29  ? 442 ILE B CB  1 
ATOM   8500  C  CG1 . ILE B 1 442 ? 93.971  57.471  100.030 1.00 36.29  ? 442 ILE B CG1 1 
ATOM   8501  C  CG2 . ILE B 1 442 ? 91.831  56.287  99.668  1.00 36.29  ? 442 ILE B CG2 1 
ATOM   8502  C  CD1 . ILE B 1 442 ? 94.267  56.708  101.303 1.00 36.29  ? 442 ILE B CD1 1 
ATOM   8503  N  N   . LEU B 1 443 ? 89.851  58.821  98.400  1.00 36.96  ? 443 LEU B N   1 
ATOM   8504  C  CA  . LEU B 1 443 ? 88.533  58.641  97.815  1.00 36.96  ? 443 LEU B CA  1 
ATOM   8505  C  C   . LEU B 1 443 ? 88.431  59.349  96.473  1.00 36.96  ? 443 LEU B C   1 
ATOM   8506  O  O   . LEU B 1 443 ? 87.661  58.931  95.601  1.00 36.96  ? 443 LEU B O   1 
ATOM   8507  C  CB  . LEU B 1 443 ? 87.458  59.144  98.760  1.00 36.96  ? 443 LEU B CB  1 
ATOM   8508  C  CG  . LEU B 1 443 ? 86.201  58.345  98.481  1.00 36.96  ? 443 LEU B CG  1 
ATOM   8509  C  CD1 . LEU B 1 443 ? 86.340  56.979  99.112  1.00 36.96  ? 443 LEU B CD1 1 
ATOM   8510  C  CD2 . LEU B 1 443 ? 84.993  59.062  98.991  1.00 36.96  ? 443 LEU B CD2 1 
ATOM   8511  N  N   . ASN B 1 444 ? 89.161  60.450  96.304  1.00 36.10  ? 444 ASN B N   1 
ATOM   8512  C  CA  . ASN B 1 444 ? 89.232  61.069  94.990  1.00 36.10  ? 444 ASN B CA  1 
ATOM   8513  C  C   . ASN B 1 444 ? 89.899  60.170  93.967  1.00 36.10  ? 444 ASN B C   1 
ATOM   8514  O  O   . ASN B 1 444 ? 89.323  59.940  92.908  1.00 36.10  ? 444 ASN B O   1 
ATOM   8515  C  CB  . ASN B 1 444 ? 89.969  62.387  95.038  1.00 36.10  ? 444 ASN B CB  1 
ATOM   8516  C  CG  . ASN B 1 444 ? 89.680  63.215  93.852  1.00 36.10  ? 444 ASN B CG  1 
ATOM   8517  O  OD1 . ASN B 1 444 ? 90.493  63.316  92.946  1.00 36.10  ? 444 ASN B OD1 1 
ATOM   8518  N  ND2 . ASN B 1 444 ? 88.489  63.790  93.815  1.00 36.10  ? 444 ASN B ND2 1 
ATOM   8519  N  N   . GLN B 1 445 ? 91.025  59.543  94.315  1.00 37.54  ? 445 GLN B N   1 
ATOM   8520  C  CA  . GLN B 1 445 ? 91.740  58.688  93.368  1.00 37.54  ? 445 GLN B CA  1 
ATOM   8521  C  C   . GLN B 1 445 ? 90.988  57.411  93.074  1.00 37.54  ? 445 GLN B C   1 
ATOM   8522  O  O   . GLN B 1 445 ? 91.213  56.789  92.035  1.00 37.54  ? 445 GLN B O   1 
ATOM   8523  C  CB  . GLN B 1 445 ? 93.124  58.339  93.888  1.00 37.54  ? 445 GLN B CB  1 
ATOM   8524  C  CG  . GLN B 1 445 ? 94.055  59.495  93.925  1.00 37.54  ? 445 GLN B CG  1 
ATOM   8525  C  CD  . GLN B 1 445 ? 94.597  59.823  92.573  1.00 37.54  ? 445 GLN B CD  1 
ATOM   8526  O  OE1 . GLN B 1 445 ? 93.942  60.468  91.765  1.00 37.54  ? 445 GLN B OE1 1 
ATOM   8527  N  NE2 . GLN B 1 445 ? 95.812  59.378  92.311  1.00 37.54  ? 445 GLN B NE2 1 
ATOM   8528  N  N   . ILE B 1 446 ? 90.101  56.999  93.959  1.00 39.80  ? 446 ILE B N   1 
ATOM   8529  C  CA  . ILE B 1 446 ? 89.320  55.818  93.660  1.00 39.80  ? 446 ILE B CA  1 
ATOM   8530  C  C   . ILE B 1 446 ? 88.181  56.185  92.727  1.00 39.80  ? 446 ILE B C   1 
ATOM   8531  O  O   . ILE B 1 446 ? 88.001  55.556  91.681  1.00 39.80  ? 446 ILE B O   1 
ATOM   8532  C  CB  . ILE B 1 446 ? 88.823  55.168  94.957  1.00 39.80  ? 446 ILE B CB  1 
ATOM   8533  C  CG1 . ILE B 1 446 ? 89.951  54.349  95.569  1.00 39.80  ? 446 ILE B CG1 1 
ATOM   8534  C  CG2 . ILE B 1 446 ? 87.626  54.282  94.696  1.00 39.80  ? 446 ILE B CG2 1 
ATOM   8535  C  CD1 . ILE B 1 446 ? 89.583  53.697  96.868  1.00 39.80  ? 446 ILE B CD1 1 
ATOM   8536  N  N   . MET B 1 447 ? 87.415  57.221  93.056  1.00 39.58  ? 447 MET B N   1 
ATOM   8537  C  CA  . MET B 1 447 ? 86.289  57.546  92.196  1.00 39.58  ? 447 MET B CA  1 
ATOM   8538  C  C   . MET B 1 447 ? 86.679  58.275  90.916  1.00 39.58  ? 447 MET B C   1 
ATOM   8539  O  O   . MET B 1 447 ? 85.867  58.319  89.988  1.00 39.58  ? 447 MET B O   1 
ATOM   8540  C  CB  . MET B 1 447 ? 85.299  58.421  92.962  1.00 39.58  ? 447 MET B CB  1 
ATOM   8541  C  CG  . MET B 1 447 ? 84.704  57.776  94.195  1.00 39.58  ? 447 MET B CG  1 
ATOM   8542  S  SD  . MET B 1 447 ? 84.406  56.015  94.011  1.00 39.58  ? 447 MET B SD  1 
ATOM   8543  C  CE  . MET B 1 447 ? 82.750  56.044  93.329  1.00 39.58  ? 447 MET B CE  1 
ATOM   8544  N  N   . GLU B 1 448 ? 87.883  58.839  90.821  1.00 38.82  ? 448 GLU B N   1 
ATOM   8545  C  CA  . GLU B 1 448 ? 88.209  59.576  89.602  1.00 38.82  ? 448 GLU B CA  1 
ATOM   8546  C  C   . GLU B 1 448 ? 88.770  58.653  88.536  1.00 38.82  ? 448 GLU B C   1 
ATOM   8547  O  O   . GLU B 1 448 ? 88.271  58.630  87.409  1.00 38.82  ? 448 GLU B O   1 
ATOM   8548  C  CB  . GLU B 1 448 ? 89.145  60.759  89.886  1.00 38.82  ? 448 GLU B CB  1 
ATOM   8549  C  CG  . GLU B 1 448 ? 89.862  61.382  88.702  1.00 38.82  ? 448 GLU B CG  1 
ATOM   8550  C  CD  . GLU B 1 448 ? 90.741  62.572  89.105  1.00 38.82  ? 448 GLU B CD  1 
ATOM   8551  O  OE1 . GLU B 1 448 ? 91.357  62.545  90.187  1.00 38.82  ? 448 GLU B OE1 1 
ATOM   8552  O  OE2 . GLU B 1 448 ? 90.799  63.551  88.339  1.00 38.82  ? 448 GLU B OE2 1 
ATOM   8553  N  N   . SER B 1 449 ? 89.769  57.857  88.873  1.00 43.69  ? 449 SER B N   1 
ATOM   8554  C  CA  . SER B 1 449 ? 90.427  57.167  87.773  1.00 43.69  ? 449 SER B CA  1 
ATOM   8555  C  C   . SER B 1 449 ? 90.536  55.656  87.923  1.00 43.69  ? 449 SER B C   1 
ATOM   8556  O  O   . SER B 1 449 ? 90.425  54.953  86.921  1.00 43.69  ? 449 SER B O   1 
ATOM   8557  C  CB  . SER B 1 449 ? 91.802  57.756  87.615  1.00 43.69  ? 449 SER B CB  1 
ATOM   8558  O  OG  . SER B 1 449 ? 92.693  57.097  88.485  1.00 43.69  ? 449 SER B OG  1 
ATOM   8559  N  N   . PHE B 1 450 ? 90.751  55.135  89.130  1.00 44.80  ? 450 PHE B N   1 
ATOM   8560  C  CA  . PHE B 1 450 ? 91.070  53.714  89.264  1.00 44.80  ? 450 PHE B CA  1 
ATOM   8561  C  C   . PHE B 1 450 ? 89.839  52.839  89.073  1.00 44.80  ? 450 PHE B C   1 
ATOM   8562  O  O   . PHE B 1 450 ? 89.866  51.874  88.305  1.00 44.80  ? 450 PHE B O   1 
ATOM   8563  C  CB  . PHE B 1 450 ? 91.721  53.416  90.607  1.00 44.80  ? 450 PHE B CB  1 
ATOM   8564  C  CG  . PHE B 1 450 ? 93.132  53.866  90.707  1.00 44.80  ? 450 PHE B CG  1 
ATOM   8565  C  CD1 . PHE B 1 450 ? 93.934  53.884  89.588  1.00 44.80  ? 450 PHE B CD1 1 
ATOM   8566  C  CD2 . PHE B 1 450 ? 93.677  54.226  91.924  1.00 44.80  ? 450 PHE B CD2 1 
ATOM   8567  C  CE1 . PHE B 1 450 ? 95.250  54.274  89.673  1.00 44.80  ? 450 PHE B CE1 1 
ATOM   8568  C  CE2 . PHE B 1 450 ? 94.991  54.622  92.016  1.00 44.80  ? 450 PHE B CE2 1 
ATOM   8569  C  CZ  . PHE B 1 450 ? 95.780  54.645  90.889  1.00 44.80  ? 450 PHE B CZ  1 
ATOM   8570  N  N   . LEU B 1 451 ? 88.759  53.147  89.780  1.00 46.93  ? 451 LEU B N   1 
ATOM   8571  C  CA  . LEU B 1 451 ? 87.513  52.422  89.562  1.00 46.93  ? 451 LEU B CA  1 
ATOM   8572  C  C   . LEU B 1 451 ? 86.917  52.576  88.161  1.00 46.93  ? 451 LEU B C   1 
ATOM   8573  O  O   . LEU B 1 451 ? 86.436  51.560  87.633  1.00 46.93  ? 451 LEU B O   1 
ATOM   8574  C  CB  . LEU B 1 451 ? 86.501  52.819  90.643  1.00 46.93  ? 451 LEU B CB  1 
ATOM   8575  C  CG  . LEU B 1 451 ? 85.044  52.424  90.444  1.00 46.93  ? 451 LEU B CG  1 
ATOM   8576  C  CD1 . LEU B 1 451 ? 84.902  50.928  90.576  1.00 46.93  ? 451 LEU B CD1 1 
ATOM   8577  C  CD2 . LEU B 1 451 ? 84.151  53.119  91.436  1.00 46.93  ? 451 LEU B CD2 1 
ATOM   8578  N  N   . PRO B 1 452 ? 86.912  53.743  87.498  1.00 46.33  ? 452 PRO B N   1 
ATOM   8579  C  CA  . PRO B 1 452 ? 86.499  53.736  86.086  1.00 46.33  ? 452 PRO B CA  1 
ATOM   8580  C  C   . PRO B 1 452 ? 87.426  52.973  85.166  1.00 46.33  ? 452 PRO B C   1 
ATOM   8581  O  O   . PRO B 1 452 ? 86.956  52.445  84.154  1.00 46.33  ? 452 PRO B O   1 
ATOM   8582  C  CB  . PRO B 1 452 ? 86.466  55.221  85.722  1.00 46.33  ? 452 PRO B CB  1 
ATOM   8583  C  CG  . PRO B 1 452 ? 86.166  55.870  86.965  1.00 46.33  ? 452 PRO B CG  1 
ATOM   8584  C  CD  . PRO B 1 452 ? 86.980  55.137  87.971  1.00 46.33  ? 452 PRO B CD  1 
ATOM   8585  N  N   . TYR B 1 453 ? 88.719  52.893  85.469  1.00 50.75  ? 453 TYR B N   1 
ATOM   8586  C  CA  . TYR B 1 453 ? 89.597  52.077  84.641  1.00 50.75  ? 453 TYR B CA  1 
ATOM   8587  C  C   . TYR B 1 453 ? 89.300  50.598  84.798  1.00 50.75  ? 453 TYR B C   1 
ATOM   8588  O  O   . TYR B 1 453 ? 89.357  49.843  83.823  1.00 50.75  ? 453 TYR B O   1 
ATOM   8589  C  CB  . TYR B 1 453 ? 91.055  52.331  84.981  1.00 50.75  ? 453 TYR B CB  1 
ATOM   8590  C  CG  . TYR B 1 453 ? 91.963  51.366  84.280  1.00 50.75  ? 453 TYR B CG  1 
ATOM   8591  C  CD1 . TYR B 1 453 ? 92.040  51.358  82.902  1.00 50.75  ? 453 TYR B CD1 1 
ATOM   8592  C  CD2 . TYR B 1 453 ? 92.710  50.445  84.983  1.00 50.75  ? 453 TYR B CD2 1 
ATOM   8593  C  CE1 . TYR B 1 453 ? 92.849  50.480  82.239  1.00 50.75  ? 453 TYR B CE1 1 
ATOM   8594  C  CE2 . TYR B 1 453 ? 93.528  49.558  84.331  1.00 50.75  ? 453 TYR B CE2 1 
ATOM   8595  C  CZ  . TYR B 1 453 ? 93.592  49.583  82.953  1.00 50.75  ? 453 TYR B CZ  1 
ATOM   8596  O  OH  . TYR B 1 453 ? 94.401  48.707  82.271  1.00 50.75  ? 453 TYR B OH  1 
ATOM   8597  N  N   . TRP B 1 454 ? 88.938  50.180  86.008  1.00 59.02  ? 454 TRP B N   1 
ATOM   8598  C  CA  . TRP B 1 454 ? 88.591  48.783  86.246  1.00 59.02  ? 454 TRP B CA  1 
ATOM   8599  C  C   . TRP B 1 454 ? 87.309  48.393  85.536  1.00 59.02  ? 454 TRP B C   1 
ATOM   8600  O  O   . TRP B 1 454 ? 87.209  47.281  85.009  1.00 59.02  ? 454 TRP B O   1 
ATOM   8601  C  CB  . TRP B 1 454 ? 88.492  48.508  87.737  1.00 59.02  ? 454 TRP B CB  1 
ATOM   8602  C  CG  . TRP B 1 454 ? 88.198  47.098  88.022  1.00 59.02  ? 454 TRP B CG  1 
ATOM   8603  C  CD1 . TRP B 1 454 ? 89.029  46.045  87.830  1.00 59.02  ? 454 TRP B CD1 1 
ATOM   8604  C  CD2 . TRP B 1 454 ? 87.015  46.575  88.619  1.00 59.02  ? 454 TRP B CD2 1 
ATOM   8605  N  NE1 . TRP B 1 454 ? 88.425  44.886  88.235  1.00 59.02  ? 454 TRP B NE1 1 
ATOM   8606  C  CE2 . TRP B 1 454 ? 87.186  45.187  88.731  1.00 59.02  ? 454 TRP B CE2 1 
ATOM   8607  C  CE3 . TRP B 1 454 ? 85.821  47.145  89.060  1.00 59.02  ? 454 TRP B CE3 1 
ATOM   8608  C  CZ2 . TRP B 1 454 ? 86.211  44.359  89.265  1.00 59.02  ? 454 TRP B CZ2 1 
ATOM   8609  C  CZ3 . TRP B 1 454 ? 84.851  46.321  89.591  1.00 59.02  ? 454 TRP B CZ3 1 
ATOM   8610  C  CH2 . TRP B 1 454 ? 85.050  44.944  89.687  1.00 59.02  ? 454 TRP B CH2 1 
ATOM   8611  N  N   . LEU B 1 455 ? 86.307  49.265  85.553  1.00 53.56  ? 455 LEU B N   1 
ATOM   8612  C  CA  . LEU B 1 455 ? 85.091  48.986  84.807  1.00 53.56  ? 455 LEU B CA  1 
ATOM   8613  C  C   . LEU B 1 455 ? 85.350  48.942  83.310  1.00 53.56  ? 455 LEU B C   1 
ATOM   8614  O  O   . LEU B 1 455 ? 84.708  48.171  82.594  1.00 53.56  ? 455 LEU B O   1 
ATOM   8615  C  CB  . LEU B 1 455 ? 84.033  50.030  85.119  1.00 53.56  ? 455 LEU B CB  1 
ATOM   8616  C  CG  . LEU B 1 455 ? 83.256  49.710  86.382  1.00 53.56  ? 455 LEU B CG  1 
ATOM   8617  C  CD1 . LEU B 1 455 ? 82.415  50.896  86.808  1.00 53.56  ? 455 LEU B CD1 1 
ATOM   8618  C  CD2 . LEU B 1 455 ? 82.401  48.501  86.131  1.00 53.56  ? 455 LEU B CD2 1 
ATOM   8619  N  N   . GLN B 1 456 ? 86.290  49.745  82.825  1.00 54.68  ? 456 GLN B N   1 
ATOM   8620  C  CA  . GLN B 1 456 ? 86.624  49.730  81.406  1.00 54.68  ? 456 GLN B CA  1 
ATOM   8621  C  C   . GLN B 1 456 ? 87.358  48.462  80.988  1.00 54.68  ? 456 GLN B C   1 
ATOM   8622  O  O   . GLN B 1 456 ? 87.171  47.988  79.862  1.00 54.68  ? 456 GLN B O   1 
ATOM   8623  C  CB  . GLN B 1 456 ? 87.446  50.960  81.049  1.00 54.68  ? 456 GLN B CB  1 
ATOM   8624  C  CG  . GLN B 1 456 ? 87.633  51.157  79.565  1.00 54.68  ? 456 GLN B CG  1 
ATOM   8625  C  CD  . GLN B 1 456 ? 86.321  51.224  78.833  1.00 54.68  ? 456 GLN B CD  1 
ATOM   8626  O  OE1 . GLN B 1 456 ? 85.397  51.919  79.246  1.00 54.68  ? 456 GLN B OE1 1 
ATOM   8627  N  NE2 . GLN B 1 456 ? 86.229  50.500  77.734  1.00 54.68  ? 456 GLN B NE2 1 
ATOM   8628  N  N   . ARG B 1 457 ? 88.186  47.891  81.865  1.00 61.00  ? 457 ARG B N   1 
ATOM   8629  C  CA  . ARG B 1 457 ? 88.847  46.636  81.517  1.00 61.00  ? 457 ARG B CA  1 
ATOM   8630  C  C   . ARG B 1 457 ? 87.846  45.502  81.386  1.00 61.00  ? 457 ARG B C   1 
ATOM   8631  O  O   . ARG B 1 457 ? 87.980  44.661  80.492  1.00 61.00  ? 457 ARG B O   1 
ATOM   8632  C  CB  . ARG B 1 457 ? 89.900  46.297  82.564  1.00 61.00  ? 457 ARG B CB  1 
ATOM   8633  C  CG  . ARG B 1 457 ? 91.319  46.678  82.192  1.00 61.00  ? 457 ARG B CG  1 
ATOM   8634  C  CD  . ARG B 1 457 ? 92.302  46.042  83.166  1.00 61.00  ? 457 ARG B CD  1 
ATOM   8635  N  NE  . ARG B 1 457 ? 92.699  44.677  82.845  1.00 61.00  ? 457 ARG B NE  1 
ATOM   8636  C  CZ  . ARG B 1 457 ? 93.761  44.365  82.113  1.00 61.00  ? 457 ARG B CZ  1 
ATOM   8637  N  NH1 . ARG B 1 457 ? 94.536  45.323  81.629  1.00 61.00  ? 457 ARG B NH1 1 
ATOM   8638  N  NH2 . ARG B 1 457 ? 94.057  43.095  81.875  1.00 61.00  ? 457 ARG B NH2 1 
ATOM   8639  N  N   . LYS B 1 458 ? 86.853  45.453  82.271  1.00 60.91  ? 458 LYS B N   1 
ATOM   8640  C  CA  . LYS B 1 458 ? 85.797  44.455  82.147  1.00 60.91  ? 458 LYS B CA  1 
ATOM   8641  C  C   . LYS B 1 458 ? 84.986  44.667  80.874  1.00 60.91  ? 458 LYS B C   1 
ATOM   8642  O  O   . LYS B 1 458 ? 84.678  43.712  80.153  1.00 60.91  ? 458 LYS B O   1 
ATOM   8643  C  CB  . LYS B 1 458 ? 84.899  44.469  83.377  1.00 60.91  ? 458 LYS B CB  1 
ATOM   8644  C  CG  . LYS B 1 458 ? 85.266  43.396  84.376  1.00 60.91  ? 458 LYS B CG  1 
ATOM   8645  C  CD  . LYS B 1 458 ? 84.366  43.444  85.584  1.00 60.91  ? 458 LYS B CD  1 
ATOM   8646  C  CE  . LYS B 1 458 ? 84.777  42.410  86.606  1.00 60.91  ? 458 LYS B CE  1 
ATOM   8647  N  NZ  . LYS B 1 458 ? 83.870  42.442  87.783  1.00 60.91  ? 458 LYS B NZ  1 
ATOM   8648  N  N   . HIS B 1 459 ? 84.608  45.916  80.599  1.00 59.64  ? 459 HIS B N   1 
ATOM   8649  C  CA  . HIS B 1 459 ? 83.849  46.231  79.394  1.00 59.64  ? 459 HIS B CA  1 
ATOM   8650  C  C   . HIS B 1 459 ? 84.641  46.007  78.119  1.00 59.64  ? 459 HIS B C   1 
ATOM   8651  O  O   . HIS B 1 459 ? 84.062  45.629  77.098  1.00 59.64  ? 459 HIS B O   1 
ATOM   8652  C  CB  . HIS B 1 459 ? 83.401  47.682  79.442  1.00 59.64  ? 459 HIS B CB  1 
ATOM   8653  C  CG  . HIS B 1 459 ? 82.308  48.010  78.482  1.00 59.64  ? 459 HIS B CG  1 
ATOM   8654  N  ND1 . HIS B 1 459 ? 80.997  47.646  78.690  1.00 59.64  ? 459 HIS B ND1 1 
ATOM   8655  C  CD2 . HIS B 1 459 ? 82.333  48.677  77.305  1.00 59.64  ? 459 HIS B CD2 1 
ATOM   8656  C  CE1 . HIS B 1 459 ? 80.260  48.076  77.682  1.00 59.64  ? 459 HIS B CE1 1 
ATOM   8657  N  NE2 . HIS B 1 459 ? 81.047  48.704  76.827  1.00 59.64  ? 459 HIS B NE2 1 
ATOM   8658  N  N   . GLY B 1 460 ? 85.948  46.246  78.144  1.00 59.43  ? 460 GLY B N   1 
ATOM   8659  C  CA  . GLY B 1 460 ? 86.745  46.013  76.954  1.00 59.43  ? 460 GLY B CA  1 
ATOM   8660  C  C   . GLY B 1 460 ? 86.928  44.543  76.640  1.00 59.43  ? 460 GLY B C   1 
ATOM   8661  O  O   . GLY B 1 460 ? 86.892  44.139  75.475  1.00 59.43  ? 460 GLY B O   1 
ATOM   8662  N  N   . VAL B 1 461 ? 87.126  43.728  77.676  1.00 65.33  ? 461 VAL B N   1 
ATOM   8663  C  CA  . VAL B 1 461 ? 87.228  42.278  77.519  1.00 65.33  ? 461 VAL B CA  1 
ATOM   8664  C  C   . VAL B 1 461 ? 85.926  41.678  76.991  1.00 65.33  ? 461 VAL B C   1 
ATOM   8665  O  O   . VAL B 1 461 ? 85.943  40.804  76.115  1.00 65.33  ? 461 VAL B O   1 
ATOM   8666  C  CB  . VAL B 1 461 ? 87.666  41.644  78.853  1.00 65.33  ? 461 VAL B CB  1 
ATOM   8667  C  CG1 . VAL B 1 461 ? 87.338  40.167  78.923  1.00 65.33  ? 461 VAL B CG1 1 
ATOM   8668  C  CG2 . VAL B 1 461 ? 89.155  41.844  79.045  1.00 65.33  ? 461 VAL B CG2 1 
ATOM   8669  N  N   . ARG B 1 462 ? 84.780  42.175  77.469  1.00 69.27  ? 462 ARG B N   1 
ATOM   8670  C  CA  . ARG B 1 462 ? 83.500  41.667  76.979  1.00 69.27  ? 462 ARG B CA  1 
ATOM   8671  C  C   . ARG B 1 462 ? 83.261  41.982  75.509  1.00 69.27  ? 462 ARG B C   1 
ATOM   8672  O  O   . ARG B 1 462 ? 82.721  41.146  74.779  1.00 69.27  ? 462 ARG B O   1 
ATOM   8673  C  CB  . ARG B 1 462 ? 82.359  42.264  77.793  1.00 69.27  ? 462 ARG B CB  1 
ATOM   8674  C  CG  . ARG B 1 462 ? 81.054  41.543  77.596  1.00 69.27  ? 462 ARG B CG  1 
ATOM   8675  C  CD  . ARG B 1 462 ? 80.101  41.757  78.747  1.00 69.27  ? 462 ARG B CD  1 
ATOM   8676  N  NE  . ARG B 1 462 ? 80.064  43.151  79.165  1.00 69.27  ? 462 ARG B NE  1 
ATOM   8677  C  CZ  . ARG B 1 462 ? 79.147  43.647  79.983  1.00 69.27  ? 462 ARG B CZ  1 
ATOM   8678  N  NH1 . ARG B 1 462 ? 78.197  42.859  80.462  1.00 69.27  ? 462 ARG B NH1 1 
ATOM   8679  N  NH2 . ARG B 1 462 ? 79.173  44.927  80.319  1.00 69.27  ? 462 ARG B NH2 1 
ATOM   8680  N  N   . VAL B 1 463 ? 83.627  43.179  75.059  1.00 72.21  ? 463 VAL B N   1 
ATOM   8681  C  CA  . VAL B 1 463 ? 83.424  43.519  73.655  1.00 72.21  ? 463 VAL B CA  1 
ATOM   8682  C  C   . VAL B 1 463 ? 84.397  42.752  72.764  1.00 72.21  ? 463 VAL B C   1 
ATOM   8683  O  O   . VAL B 1 463 ? 84.011  42.231  71.708  1.00 72.21  ? 463 VAL B O   1 
ATOM   8684  C  CB  . VAL B 1 463 ? 83.508  45.044  73.456  1.00 72.21  ? 463 VAL B CB  1 
ATOM   8685  C  CG1 . VAL B 1 463 ? 83.800  45.415  72.011  1.00 72.21  ? 463 VAL B CG1 1 
ATOM   8686  C  CG2 . VAL B 1 463 ? 82.200  45.672  73.875  1.00 72.21  ? 463 VAL B CG2 1 
ATOM   8687  N  N   . LYS B 1 464 ? 85.650  42.606  73.211  1.00 73.39  ? 464 LYS B N   1 
ATOM   8688  C  CA  . LYS B 1 464 ? 86.643  41.829  72.475  1.00 73.39  ? 464 LYS B CA  1 
ATOM   8689  C  C   . LYS B 1 464 ? 86.275  40.357  72.363  1.00 73.39  ? 464 LYS B C   1 
ATOM   8690  O  O   . LYS B 1 464 ? 86.437  39.766  71.291  1.00 73.39  ? 464 LYS B O   1 
ATOM   8691  C  CB  . LYS B 1 464 ? 88.002  41.977  73.149  1.00 73.39  ? 464 LYS B CB  1 
ATOM   8692  C  CG  . LYS B 1 464 ? 89.133  42.288  72.201  1.00 73.39  ? 464 LYS B CG  1 
ATOM   8693  C  CD  . LYS B 1 464 ? 90.377  42.691  72.971  1.00 73.39  ? 464 LYS B CD  1 
ATOM   8694  C  CE  . LYS B 1 464 ? 91.566  42.904  72.053  1.00 73.39  ? 464 LYS B CE  1 
ATOM   8695  N  NZ  . LYS B 1 464 ? 92.768  43.364  72.792  1.00 73.39  ? 464 LYS B NZ  1 
ATOM   8696  N  N   . ARG B 1 465 ? 85.777  39.756  73.440  1.00 81.47  ? 465 ARG B N   1 
ATOM   8697  C  CA  . ARG B 1 465 ? 85.364  38.360  73.384  1.00 81.47  ? 465 ARG B CA  1 
ATOM   8698  C  C   . ARG B 1 465 ? 84.102  38.190  72.551  1.00 81.47  ? 465 ARG B C   1 
ATOM   8699  O  O   . ARG B 1 465 ? 83.879  37.120  71.979  1.00 81.47  ? 465 ARG B O   1 
ATOM   8700  C  CB  . ARG B 1 465 ? 85.177  37.822  74.804  1.00 81.47  ? 465 ARG B CB  1 
ATOM   8701  C  CG  . ARG B 1 465 ? 85.281  36.315  74.941  1.00 81.47  ? 465 ARG B CG  1 
ATOM   8702  C  CD  . ARG B 1 465 ? 84.891  35.853  76.342  1.00 81.47  ? 465 ARG B CD  1 
ATOM   8703  N  NE  . ARG B 1 465 ? 83.750  36.559  76.922  1.00 81.47  ? 465 ARG B NE  1 
ATOM   8704  C  CZ  . ARG B 1 465 ? 82.480  36.225  76.730  1.00 81.47  ? 465 ARG B CZ  1 
ATOM   8705  N  NH1 . ARG B 1 465 ? 82.177  35.183  75.971  1.00 81.47  ? 465 ARG B NH1 1 
ATOM   8706  N  NH2 . ARG B 1 465 ? 81.513  36.925  77.309  1.00 81.47  ? 465 ARG B NH2 1 
ATOM   8707  N  N   . LYS B 1 466 ? 83.282  39.238  72.462  1.00 81.08  ? 466 LYS B N   1 
ATOM   8708  C  CA  . LYS B 1 466 ? 82.140  39.213  71.559  1.00 81.08  ? 466 LYS B CA  1 
ATOM   8709  C  C   . LYS B 1 466 ? 82.582  39.346  70.111  1.00 81.08  ? 466 LYS B C   1 
ATOM   8710  O  O   . LYS B 1 466 ? 82.032  38.684  69.224  1.00 81.08  ? 466 LYS B O   1 
ATOM   8711  C  CB  . LYS B 1 466 ? 81.167  40.334  71.924  1.00 81.08  ? 466 LYS B CB  1 
ATOM   8712  C  CG  . LYS B 1 466 ? 79.913  40.387  71.078  1.00 81.08  ? 466 LYS B CG  1 
ATOM   8713  C  CD  . LYS B 1 466 ? 79.041  41.568  71.468  1.00 81.08  ? 466 LYS B CD  1 
ATOM   8714  N  N   . VAL B 1 467 ? 83.564  40.207  69.847  1.00 85.29  ? 467 VAL B N   1 
ATOM   8715  C  CA  . VAL B 1 467 ? 83.947  40.445  68.463  1.00 85.29  ? 467 VAL B CA  1 
ATOM   8716  C  C   . VAL B 1 467 ? 84.724  39.278  67.861  1.00 85.29  ? 467 VAL B C   1 
ATOM   8717  O  O   . VAL B 1 467 ? 84.502  38.954  66.686  1.00 85.29  ? 467 VAL B O   1 
ATOM   8718  C  CB  . VAL B 1 467 ? 84.712  41.779  68.392  1.00 85.29  ? 467 VAL B CB  1 
ATOM   8719  C  CG1 . VAL B 1 467 ? 85.534  41.924  67.117  1.00 85.29  ? 467 VAL B CG1 1 
ATOM   8720  C  CG2 . VAL B 1 467 ? 83.727  42.920  68.475  1.00 85.29  ? 467 VAL B CG2 1 
ATOM   8721  N  N   . GLN B 1 468 ? 85.574  38.583  68.631  1.00 94.47  ? 468 GLN B N   1 
ATOM   8722  C  CA  . GLN B 1 468 ? 86.318  37.479  68.027  1.00 94.47  ? 468 GLN B CA  1 
ATOM   8723  C  C   . GLN B 1 468 ? 85.431  36.281  67.706  1.00 94.47  ? 468 GLN B C   1 
ATOM   8724  O  O   . GLN B 1 468 ? 85.771  35.478  66.830  1.00 94.47  ? 468 GLN B O   1 
ATOM   8725  C  CB  . GLN B 1 468 ? 87.465  37.047  68.946  1.00 94.47  ? 468 GLN B CB  1 
ATOM   8726  C  CG  . GLN B 1 468 ? 88.577  36.290  68.236  1.00 94.47  ? 468 GLN B CG  1 
ATOM   8727  C  CD  . GLN B 1 468 ? 89.633  35.773  69.183  1.00 94.47  ? 468 GLN B CD  1 
ATOM   8728  O  OE1 . GLN B 1 468 ? 89.668  36.148  70.352  1.00 94.47  ? 468 GLN B OE1 1 
ATOM   8729  N  NE2 . GLN B 1 468 ? 90.500  34.900  68.685  1.00 94.47  ? 468 GLN B NE2 1 
ATOM   8730  N  N   . ALA B 1 469 ? 84.275  36.174  68.360  1.00 96.46  ? 469 ALA B N   1 
ATOM   8731  C  CA  . ALA B 1 469 ? 83.269  35.175  68.033  1.00 96.46  ? 469 ALA B CA  1 
ATOM   8732  C  C   . ALA B 1 469 ? 82.169  35.775  67.168  1.00 96.46  ? 469 ALA B C   1 
ATOM   8733  O  O   . ALA B 1 469 ? 81.058  36.005  67.657  1.00 96.46  ? 469 ALA B O   1 
ATOM   8734  C  CB  . ALA B 1 469 ? 82.685  34.569  69.308  1.00 96.46  ? 469 ALA B CB  1 
ATOM   8735  N  N   . LEU B 1 470 ? 82.447  36.047  65.896  1.00 100.90 ? 470 LEU B N   1 
ATOM   8736  C  CA  . LEU B 1 470 ? 81.463  36.749  65.084  1.00 100.90 ? 470 LEU B CA  1 
ATOM   8737  C  C   . LEU B 1 470 ? 81.044  35.991  63.829  1.00 100.90 ? 470 LEU B C   1 
ATOM   8738  O  O   . LEU B 1 470 ? 79.927  36.203  63.339  1.00 100.90 ? 470 LEU B O   1 
ATOM   8739  C  CB  . LEU B 1 470 ? 82.005  38.135  64.732  1.00 100.90 ? 470 LEU B CB  1 
ATOM   8740  C  CG  . LEU B 1 470 ? 81.071  39.179  64.147  1.00 100.90 ? 470 LEU B CG  1 
ATOM   8741  C  CD1 . LEU B 1 470 ? 79.997  39.515  65.165  1.00 100.90 ? 470 LEU B CD1 1 
ATOM   8742  C  CD2 . LEU B 1 470 ? 81.905  40.389  63.866  1.00 100.90 ? 470 LEU B CD2 1 
ATOM   8743  N  N   . LYS B 1 471 ? 81.924  35.132  63.295  1.00 100.74 ? 471 LYS B N   1 
ATOM   8744  C  CA  . LYS B 1 471 ? 81.694  34.331  62.089  1.00 100.74 ? 471 LYS B CA  1 
ATOM   8745  C  C   . LYS B 1 471 ? 81.392  35.156  60.838  1.00 100.74 ? 471 LYS B C   1 
ATOM   8746  O  O   . LYS B 1 471 ? 80.587  34.740  60.000  1.00 100.74 ? 471 LYS B O   1 
ATOM   8747  C  CB  . LYS B 1 471 ? 80.589  33.289  62.323  1.00 100.74 ? 471 LYS B CB  1 
ATOM   8748  N  N   . ALA B 1 472 ? 82.009  36.324  60.700  1.00 107.90 ? 472 ALA B N   1 
ATOM   8749  C  CA  . ALA B 1 472 ? 81.754  37.173  59.548  1.00 107.90 ? 472 ALA B CA  1 
ATOM   8750  C  C   . ALA B 1 472 ? 83.078  37.668  58.972  1.00 107.90 ? 472 ALA B C   1 
ATOM   8751  O  O   . ALA B 1 472 ? 84.135  37.551  59.598  1.00 107.90 ? 472 ALA B O   1 
ATOM   8752  C  CB  . ALA B 1 472 ? 80.856  38.342  59.931  1.00 107.90 ? 472 ALA B CB  1 
ATOM   8753  N  N   . ASP B 1 473 ? 83.037  38.214  57.754  1.00 109.90 ? 473 ASP B N   1 
ATOM   8754  C  CA  . ASP B 1 473 ? 84.265  38.776  57.203  1.00 109.90 ? 473 ASP B CA  1 
ATOM   8755  C  C   . ASP B 1 473 ? 84.452  40.259  57.498  1.00 109.90 ? 473 ASP B C   1 
ATOM   8756  O  O   . ASP B 1 473 ? 84.675  41.058  56.583  1.00 109.90 ? 473 ASP B O   1 
ATOM   8757  C  CB  . ASP B 1 473 ? 84.302  38.552  55.689  1.00 109.90 ? 473 ASP B CB  1 
ATOM   8758  N  N   . ILE B 1 474 ? 84.342  40.637  58.758  1.00 109.56 ? 474 ILE B N   1 
ATOM   8759  C  CA  . ILE B 1 474 ? 84.420  42.038  59.150  1.00 109.56 ? 474 ILE B CA  1 
ATOM   8760  C  C   . ILE B 1 474 ? 85.886  42.405  59.331  1.00 109.56 ? 474 ILE B C   1 
ATOM   8761  O  O   . ILE B 1 474 ? 86.644  41.674  59.978  1.00 109.56 ? 474 ILE B O   1 
ATOM   8762  C  CB  . ILE B 1 474 ? 83.556  42.322  60.393  1.00 109.56 ? 474 ILE B CB  1 
ATOM   8763  C  CG1 . ILE B 1 474 ? 82.098  42.441  59.935  1.00 109.56 ? 474 ILE B CG1 1 
ATOM   8764  C  CG2 . ILE B 1 474 ? 84.031  43.565  61.142  1.00 109.56 ? 474 ILE B CG2 1 
ATOM   8765  C  CD1 . ILE B 1 474 ? 81.073  42.531  61.027  1.00 109.56 ? 474 ILE B CD1 1 
ATOM   8766  N  N   . ASP B 1 475 ? 86.309  43.532  58.752  1.00 94.27  ? 475 ASP B N   1 
ATOM   8767  C  CA  . ASP B 1 475 ? 87.606  44.068  59.143  1.00 94.27  ? 475 ASP B CA  1 
ATOM   8768  C  C   . ASP B 1 475 ? 87.594  44.538  60.590  1.00 94.27  ? 475 ASP B C   1 
ATOM   8769  O  O   . ASP B 1 475 ? 87.063  45.602  60.919  1.00 94.27  ? 475 ASP B O   1 
ATOM   8770  C  CB  . ASP B 1 475 ? 88.010  45.217  58.219  1.00 94.27  ? 475 ASP B CB  1 
ATOM   8771  N  N   . ALA B 1 476 ? 88.156  43.701  61.458  1.00 88.43  ? 476 ALA B N   1 
ATOM   8772  C  CA  . ALA B 1 476 ? 87.970  43.849  62.891  1.00 88.43  ? 476 ALA B CA  1 
ATOM   8773  C  C   . ALA B 1 476 ? 88.812  44.969  63.484  1.00 88.43  ? 476 ALA B C   1 
ATOM   8774  O  O   . ALA B 1 476 ? 88.474  45.472  64.555  1.00 88.43  ? 476 ALA B O   1 
ATOM   8775  C  CB  . ALA B 1 476 ? 88.288  42.531  63.596  1.00 88.43  ? 476 ALA B CB  1 
ATOM   8776  N  N   . THR B 1 477 ? 89.891  45.373  62.820  1.00 82.42  ? 477 THR B N   1 
ATOM   8777  C  CA  . THR B 1 477 ? 90.805  46.356  63.389  1.00 82.42  ? 477 THR B CA  1 
ATOM   8778  C  C   . THR B 1 477 ? 90.215  47.751  63.518  1.00 82.42  ? 477 THR B C   1 
ATOM   8779  O  O   . THR B 1 477 ? 90.705  48.537  64.331  1.00 82.42  ? 477 THR B O   1 
ATOM   8780  C  CB  . THR B 1 477 ? 92.068  46.445  62.535  1.00 82.42  ? 477 THR B CB  1 
ATOM   8781  O  OG1 . THR B 1 477 ? 92.685  47.722  62.737  1.00 82.42  ? 477 THR B OG1 1 
ATOM   8782  C  CG2 . THR B 1 477 ? 91.722  46.294  61.062  1.00 82.42  ? 477 THR B CG2 1 
ATOM   8783  N  N   . LEU B 1 478 ? 89.191  48.079  62.745  1.00 68.24  ? 478 LEU B N   1 
ATOM   8784  C  CA  . LEU B 1 478 ? 88.509  49.358  62.835  1.00 68.24  ? 478 LEU B CA  1 
ATOM   8785  C  C   . LEU B 1 478 ? 87.203  49.300  63.609  1.00 68.24  ? 478 LEU B C   1 
ATOM   8786  O  O   . LEU B 1 478 ? 86.956  50.141  64.475  1.00 68.24  ? 478 LEU B O   1 
ATOM   8787  C  CB  . LEU B 1 478 ? 88.251  49.911  61.436  1.00 68.24  ? 478 LEU B CB  1 
ATOM   8788  C  CG  . LEU B 1 478 ? 87.581  51.277  61.455  1.00 68.24  ? 478 LEU B CG  1 
ATOM   8789  C  CD1 . LEU B 1 478 ? 88.478  52.275  62.158  1.00 68.24  ? 478 LEU B CD1 1 
ATOM   8790  C  CD2 . LEU B 1 478 ? 87.292  51.722  60.050  1.00 68.24  ? 478 LEU B CD2 1 
ATOM   8791  N  N   . TYR B 1 479 ? 86.378  48.292  63.326  1.00 74.21  ? 479 TYR B N   1 
ATOM   8792  C  CA  . TYR B 1 479 ? 85.075  48.149  63.967  1.00 74.21  ? 479 TYR B CA  1 
ATOM   8793  C  C   . TYR B 1 479 ? 85.174  47.893  65.461  1.00 74.21  ? 479 TYR B C   1 
ATOM   8794  O  O   . TYR B 1 479 ? 84.349  48.403  66.225  1.00 74.21  ? 479 TYR B O   1 
ATOM   8795  C  CB  . TYR B 1 479 ? 84.317  47.020  63.281  1.00 74.21  ? 479 TYR B CB  1 
ATOM   8796  C  CG  . TYR B 1 479 ? 83.033  46.626  63.936  1.00 74.21  ? 479 TYR B CG  1 
ATOM   8797  C  CD1 . TYR B 1 479 ? 81.902  47.403  63.789  1.00 74.21  ? 479 TYR B CD1 1 
ATOM   8798  C  CD2 . TYR B 1 479 ? 82.938  45.454  64.663  1.00 74.21  ? 479 TYR B CD2 1 
ATOM   8799  C  CE1 . TYR B 1 479 ? 80.717  47.039  64.369  1.00 74.21  ? 479 TYR B CE1 1 
ATOM   8800  C  CE2 . TYR B 1 479 ? 81.759  45.080  65.249  1.00 74.21  ? 479 TYR B CE2 1 
ATOM   8801  C  CZ  . TYR B 1 479 ? 80.649  45.875  65.100  1.00 74.21  ? 479 TYR B CZ  1 
ATOM   8802  O  OH  . TYR B 1 479 ? 79.462  45.504  65.688  1.00 74.21  ? 479 TYR B OH  1 
ATOM   8803  N  N   . GLU B 1 480 ? 86.116  47.057  65.891  1.00 73.10  ? 480 GLU B N   1 
ATOM   8804  C  CA  . GLU B 1 480 ? 86.328  46.849  67.322  1.00 73.10  ? 480 GLU B CA  1 
ATOM   8805  C  C   . GLU B 1 480 ? 86.714  48.145  68.022  1.00 73.10  ? 480 GLU B C   1 
ATOM   8806  O  O   . GLU B 1 480 ? 86.215  48.444  69.113  1.00 73.10  ? 480 GLU B O   1 
ATOM   8807  C  CB  . GLU B 1 480 ? 87.394  45.787  67.546  1.00 73.10  ? 480 GLU B CB  1 
ATOM   8808  C  CG  . GLU B 1 480 ? 87.897  45.689  68.955  1.00 73.10  ? 480 GLU B CG  1 
ATOM   8809  C  CD  . GLU B 1 480 ? 88.929  44.600  69.111  1.00 73.10  ? 480 GLU B CD  1 
ATOM   8810  O  OE1 . GLU B 1 480 ? 88.919  43.644  68.306  1.00 73.10  ? 480 GLU B OE1 1 
ATOM   8811  O  OE2 . GLU B 1 480 ? 89.761  44.710  70.032  1.00 73.10  ? 480 GLU B OE2 1 
ATOM   8812  N  N   . GLN B 1 481 ? 87.567  48.942  67.380  1.00 57.30  ? 481 GLN B N   1 
ATOM   8813  C  CA  . GLN B 1 481 ? 88.030  50.198  67.960  1.00 57.30  ? 481 GLN B CA  1 
ATOM   8814  C  C   . GLN B 1 481 ? 86.903  51.218  68.064  1.00 57.30  ? 481 GLN B C   1 
ATOM   8815  O  O   . GLN B 1 481 ? 86.772  51.906  69.081  1.00 57.30  ? 481 GLN B O   1 
ATOM   8816  C  CB  . GLN B 1 481 ? 89.186  50.727  67.117  1.00 57.30  ? 481 GLN B CB  1 
ATOM   8817  C  CG  . GLN B 1 481 ? 89.635  52.124  67.396  1.00 57.30  ? 481 GLN B CG  1 
ATOM   8818  C  CD  . GLN B 1 481 ? 90.804  52.502  66.514  1.00 57.30  ? 481 GLN B CD  1 
ATOM   8819  O  OE1 . GLN B 1 481 ? 91.256  51.708  65.698  1.00 57.30  ? 481 GLN B OE1 1 
ATOM   8820  N  NE2 . GLN B 1 481 ? 91.284  53.724  66.656  1.00 57.30  ? 481 GLN B NE2 1 
ATOM   8821  N  N   . VAL B 1 482 ? 86.075  51.325  67.027  1.00 55.16  ? 482 VAL B N   1 
ATOM   8822  C  CA  . VAL B 1 482 ? 84.984  52.295  67.038  1.00 55.16  ? 482 VAL B CA  1 
ATOM   8823  C  C   . VAL B 1 482 ? 83.892  51.903  68.026  1.00 55.16  ? 482 VAL B C   1 
ATOM   8824  O  O   . VAL B 1 482 ? 83.344  52.766  68.721  1.00 55.16  ? 482 VAL B O   1 
ATOM   8825  C  CB  . VAL B 1 482 ? 84.442  52.472  65.608  1.00 55.16  ? 482 VAL B CB  1 
ATOM   8826  C  CG1 . VAL B 1 482 ? 83.170  53.290  65.579  1.00 55.16  ? 482 VAL B CG1 1 
ATOM   8827  C  CG2 . VAL B 1 482 ? 85.478  53.155  64.764  1.00 55.16  ? 482 VAL B CG2 1 
ATOM   8828  N  N   . ILE B 1 483 ? 83.607  50.611  68.165  1.00 57.52  ? 483 ILE B N   1 
ATOM   8829  C  CA  . ILE B 1 483 ? 82.610  50.173  69.136  1.00 57.52  ? 483 ILE B CA  1 
ATOM   8830  C  C   . ILE B 1 483 ? 83.085  50.416  70.558  1.00 57.52  ? 483 ILE B C   1 
ATOM   8831  O  O   . ILE B 1 483 ? 82.302  50.833  71.419  1.00 57.52  ? 483 ILE B O   1 
ATOM   8832  C  CB  . ILE B 1 483 ? 82.232  48.705  68.882  1.00 57.52  ? 483 ILE B CB  1 
ATOM   8833  C  CG1 . ILE B 1 483 ? 81.404  48.631  67.618  1.00 57.52  ? 483 ILE B CG1 1 
ATOM   8834  C  CG2 . ILE B 1 483 ? 81.422  48.107  70.009  1.00 57.52  ? 483 ILE B CG2 1 
ATOM   8835  C  CD1 . ILE B 1 483 ? 80.153  49.451  67.722  1.00 57.52  ? 483 ILE B CD1 1 
ATOM   8836  N  N   . LEU B 1 484 ? 84.380  50.247  70.810  1.00 55.65  ? 484 LEU B N   1 
ATOM   8837  C  CA  . LEU B 1 484 ? 84.900  50.515  72.144  1.00 55.65  ? 484 LEU B CA  1 
ATOM   8838  C  C   . LEU B 1 484 ? 84.844  51.997  72.484  1.00 55.65  ? 484 LEU B C   1 
ATOM   8839  O  O   . LEU B 1 484 ? 84.446  52.368  73.592  1.00 55.65  ? 484 LEU B O   1 
ATOM   8840  C  CB  . LEU B 1 484 ? 86.324  49.991  72.271  1.00 55.65  ? 484 LEU B CB  1 
ATOM   8841  C  CG  . LEU B 1 484 ? 86.408  48.513  72.633  1.00 55.65  ? 484 LEU B CG  1 
ATOM   8842  C  CD1 . LEU B 1 484 ? 87.847  48.120  72.870  1.00 55.65  ? 484 LEU B CD1 1 
ATOM   8843  C  CD2 . LEU B 1 484 ? 85.569  48.221  73.858  1.00 55.65  ? 484 LEU B CD2 1 
ATOM   8844  N  N   . GLU B 1 485 ? 85.193  52.860  71.547  1.00 52.48  ? 485 GLU B N   1 
ATOM   8845  C  CA  . GLU B 1 485 ? 85.182  54.269  71.883  1.00 52.48  ? 485 GLU B CA  1 
ATOM   8846  C  C   . GLU B 1 485 ? 83.794  54.879  71.815  1.00 52.48  ? 485 GLU B C   1 
ATOM   8847  O  O   . GLU B 1 485 ? 83.632  56.039  72.194  1.00 52.48  ? 485 GLU B O   1 
ATOM   8848  C  CB  . GLU B 1 485 ? 86.080  55.028  70.905  1.00 52.48  ? 485 GLU B CB  1 
ATOM   8849  C  CG  . GLU B 1 485 ? 87.550  54.677  70.980  1.00 52.48  ? 485 GLU B CG  1 
ATOM   8850  C  CD  . GLU B 1 485 ? 88.419  55.610  70.156  1.00 52.48  ? 485 GLU B CD  1 
ATOM   8851  O  OE1 . GLU B 1 485 ? 88.235  56.836  70.230  1.00 52.48  ? 485 GLU B OE1 1 
ATOM   8852  O  OE2 . GLU B 1 485 ? 89.259  55.104  69.390  1.00 52.48  ? 485 GLU B OE2 1 
ATOM   8853  N  N   . LYS B 1 486 ? 82.794  54.149  71.322  1.00 55.12  ? 486 LYS B N   1 
ATOM   8854  C  CA  . LYS B 1 486 ? 81.428  54.657  71.367  1.00 55.12  ? 486 LYS B CA  1 
ATOM   8855  C  C   . LYS B 1 486 ? 80.885  54.667  72.785  1.00 55.12  ? 486 LYS B C   1 
ATOM   8856  O  O   . LYS B 1 486 ? 80.202  55.609  73.198  1.00 55.12  ? 486 LYS B O   1 
ATOM   8857  C  CB  . LYS B 1 486 ? 80.530  53.824  70.456  1.00 55.12  ? 486 LYS B CB  1 
ATOM   8858  C  CG  . LYS B 1 486 ? 79.059  54.166  70.539  1.00 55.12  ? 486 LYS B CG  1 
ATOM   8859  C  CD  . LYS B 1 486 ? 78.259  53.345  69.558  1.00 55.12  ? 486 LYS B CD  1 
ATOM   8860  C  CE  . LYS B 1 486 ? 78.334  51.873  69.894  1.00 55.12  ? 486 LYS B CE  1 
ATOM   8861  N  NZ  . LYS B 1 486 ? 77.620  51.551  71.153  1.00 55.12  ? 486 LYS B NZ  1 
ATOM   8862  N  N   . GLU B 1 487 ? 81.213  53.640  73.561  1.00 58.72  ? 487 GLU B N   1 
ATOM   8863  C  CA  . GLU B 1 487 ? 80.637  53.464  74.883  1.00 58.72  ? 487 GLU B CA  1 
ATOM   8864  C  C   . GLU B 1 487 ? 81.562  53.901  76.003  1.00 58.72  ? 487 GLU B C   1 
ATOM   8865  O  O   . GLU B 1 487 ? 81.287  53.617  77.170  1.00 58.72  ? 487 GLU B O   1 
ATOM   8866  C  CB  . GLU B 1 487 ? 80.216  52.012  75.073  1.00 58.72  ? 487 GLU B CB  1 
ATOM   8867  C  CG  . GLU B 1 487 ? 79.068  51.629  74.180  1.00 58.72  ? 487 GLU B CG  1 
ATOM   8868  C  CD  . GLU B 1 487 ? 79.183  50.215  73.671  1.00 58.72  ? 487 GLU B CD  1 
ATOM   8869  O  OE1 . GLU B 1 487 ? 79.949  49.432  74.270  1.00 58.72  ? 487 GLU B OE1 1 
ATOM   8870  O  OE2 . GLU B 1 487 ? 78.514  49.891  72.666  1.00 58.72  ? 487 GLU B OE2 1 
ATOM   8871  N  N   . MET B 1 488 ? 82.633  54.603  75.684  1.00 53.65  ? 488 MET B N   1 
ATOM   8872  C  CA  . MET B 1 488 ? 83.449  55.172  76.735  1.00 53.65  ? 488 MET B CA  1 
ATOM   8873  C  C   . MET B 1 488 ? 82.751  56.396  77.309  1.00 53.65  ? 488 MET B C   1 
ATOM   8874  O  O   . MET B 1 488 ? 81.738  56.865  76.790  1.00 53.65  ? 488 MET B O   1 
ATOM   8875  C  CB  . MET B 1 488 ? 84.827  55.533  76.199  1.00 53.65  ? 488 MET B CB  1 
ATOM   8876  C  CG  . MET B 1 488 ? 85.773  54.349  76.148  1.00 53.65  ? 488 MET B CG  1 
ATOM   8877  S  SD  . MET B 1 488 ? 87.416  54.791  75.561  1.00 53.65  ? 488 MET B SD  1 
ATOM   8878  C  CE  . MET B 1 488 ? 88.307  53.254  75.781  1.00 53.65  ? 488 MET B CE  1 
ATOM   8879  N  N   . GLY B 1 489 ? 83.306  56.922  78.391  1.00 47.43  ? 489 GLY B N   1 
ATOM   8880  C  CA  . GLY B 1 489 ? 82.748  58.121  78.977  1.00 47.43  ? 489 GLY B CA  1 
ATOM   8881  C  C   . GLY B 1 489 ? 83.381  59.339  78.338  1.00 47.43  ? 489 GLY B C   1 
ATOM   8882  O  O   . GLY B 1 489 ? 84.525  59.311  77.891  1.00 47.43  ? 489 GLY B O   1 
ATOM   8883  N  N   . THR B 1 490 ? 82.614  60.414  78.276  1.00 36.68  ? 490 THR B N   1 
ATOM   8884  C  CA  . THR B 1 490 ? 83.111  61.627  77.655  1.00 36.68  ? 490 THR B CA  1 
ATOM   8885  C  C   . THR B 1 490 ? 83.778  62.518  78.682  1.00 36.68  ? 490 THR B C   1 
ATOM   8886  O  O   . THR B 1 490 ? 83.524  62.411  79.882  1.00 36.68  ? 490 THR B O   1 
ATOM   8887  C  CB  . THR B 1 490 ? 81.986  62.366  76.937  1.00 36.68  ? 490 THR B CB  1 
ATOM   8888  O  OG1 . THR B 1 490 ? 82.548  63.375  76.091  1.00 36.68  ? 490 THR B OG1 1 
ATOM   8889  C  CG2 . THR B 1 490 ? 81.013  62.983  77.910  1.00 36.68  ? 490 THR B CG2 1 
ATOM   8890  N  N   . TYR B 1 491 ? 84.696  63.343  78.213  1.00 25.28  ? 491 TYR B N   1 
ATOM   8891  C  CA  . TYR B 1 491 ? 85.420  64.235  79.098  1.00 25.28  ? 491 TYR B CA  1 
ATOM   8892  C  C   . TYR B 1 491 ? 84.627  65.517  79.279  1.00 25.28  ? 491 TYR B C   1 
ATOM   8893  O  O   . TYR B 1 491 ? 84.360  66.234  78.313  1.00 25.28  ? 491 TYR B O   1 
ATOM   8894  C  CB  . TYR B 1 491 ? 86.796  64.526  78.533  1.00 25.28  ? 491 TYR B CB  1 
ATOM   8895  C  CG  . TYR B 1 491 ? 87.699  65.141  79.535  1.00 25.28  ? 491 TYR B CG  1 
ATOM   8896  C  CD1 . TYR B 1 491 ? 88.137  64.419  80.619  1.00 25.28  ? 491 TYR B CD1 1 
ATOM   8897  C  CD2 . TYR B 1 491 ? 88.109  66.443  79.404  1.00 25.28  ? 491 TYR B CD2 1 
ATOM   8898  C  CE1 . TYR B 1 491 ? 88.969  64.980  81.547  1.00 25.28  ? 491 TYR B CE1 1 
ATOM   8899  C  CE2 . TYR B 1 491 ? 88.943  67.007  80.316  1.00 25.28  ? 491 TYR B CE2 1 
ATOM   8900  C  CZ  . TYR B 1 491 ? 89.366  66.279  81.394  1.00 25.28  ? 491 TYR B CZ  1 
ATOM   8901  O  OH  . TYR B 1 491 ? 90.204  66.845  82.322  1.00 25.28  ? 491 TYR B OH  1 
ATOM   8902  N  N   . LEU B 1 492 ? 84.252  65.800  80.517  1.00 30.28  ? 492 LEU B N   1 
ATOM   8903  C  CA  . LEU B 1 492 ? 83.420  66.947  80.874  1.00 30.28  ? 492 LEU B CA  1 
ATOM   8904  C  C   . LEU B 1 492 ? 84.268  68.158  81.241  1.00 30.28  ? 492 LEU B C   1 
ATOM   8905  O  O   . LEU B 1 492 ? 84.111  68.762  82.297  1.00 30.28  ? 492 LEU B O   1 
ATOM   8906  C  CB  . LEU B 1 492 ? 82.503  66.550  82.020  1.00 30.28  ? 492 LEU B CB  1 
ATOM   8907  C  CG  . LEU B 1 492 ? 81.275  65.736  81.607  1.00 30.28  ? 492 LEU B CG  1 
ATOM   8908  C  CD1 . LEU B 1 492 ? 80.822  64.815  82.731  1.00 30.28  ? 492 LEU B CD1 1 
ATOM   8909  C  CD2 . LEU B 1 492 ? 80.146  66.653  81.185  1.00 30.28  ? 492 LEU B CD2 1 
ATOM   8910  N  N   . GLY B 1 493 ? 85.196  68.512  80.360  1.00 27.80  ? 493 GLY B N   1 
ATOM   8911  C  CA  . GLY B 1 493 ? 86.048  69.679  80.512  1.00 27.80  ? 493 GLY B CA  1 
ATOM   8912  C  C   . GLY B 1 493 ? 87.123  69.522  81.567  1.00 27.80  ? 493 GLY B C   1 
ATOM   8913  O  O   . GLY B 1 493 ? 87.080  68.588  82.370  1.00 27.80  ? 493 GLY B O   1 
ATOM   8914  N  N   . THR B 1 494 ? 88.094  70.428  81.597  1.00 21.68  ? 494 THR B N   1 
ATOM   8915  C  CA  . THR B 1 494 ? 89.085  70.408  82.664  1.00 21.68  ? 494 THR B CA  1 
ATOM   8916  C  C   . THR B 1 494 ? 88.601  71.360  83.737  1.00 21.68  ? 494 THR B C   1 
ATOM   8917  O  O   . THR B 1 494 ? 89.099  72.467  83.912  1.00 21.68  ? 494 THR B O   1 
ATOM   8918  C  CB  . THR B 1 494 ? 90.449  70.833  82.170  1.00 21.68  ? 494 THR B CB  1 
ATOM   8919  O  OG1 . THR B 1 494 ? 90.334  72.114  81.551  1.00 21.68  ? 494 THR B OG1 1 
ATOM   8920  C  CG2 . THR B 1 494 ? 90.951  69.856  81.189  1.00 21.68  ? 494 THR B CG2 1 
ATOM   8921  N  N   . PHE B 1 495 ? 87.580  70.910  84.437  1.00 19.58  ? 495 PHE B N   1 
ATOM   8922  C  CA  . PHE B 1 495 ? 87.075  71.650  85.572  1.00 19.58  ? 495 PHE B CA  1 
ATOM   8923  C  C   . PHE B 1 495 ? 87.256  70.882  86.866  1.00 19.58  ? 495 PHE B C   1 
ATOM   8924  O  O   . PHE B 1 495 ? 87.681  71.469  87.861  1.00 19.58  ? 495 PHE B O   1 
ATOM   8925  C  CB  . PHE B 1 495 ? 85.616  72.017  85.353  1.00 19.58  ? 495 PHE B CB  1 
ATOM   8926  C  CG  . PHE B 1 495 ? 84.952  72.516  86.564  1.00 19.58  ? 495 PHE B CG  1 
ATOM   8927  C  CD1 . PHE B 1 495 ? 85.409  73.648  87.189  1.00 19.58  ? 495 PHE B CD1 1 
ATOM   8928  C  CD2 . PHE B 1 495 ? 83.859  71.870  87.072  1.00 19.58  ? 495 PHE B CD2 1 
ATOM   8929  C  CE1 . PHE B 1 495 ? 84.805  74.101  88.310  1.00 19.58  ? 495 PHE B CE1 1 
ATOM   8930  C  CE2 . PHE B 1 495 ? 83.241  72.338  88.186  1.00 19.58  ? 495 PHE B CE2 1 
ATOM   8931  C  CZ  . PHE B 1 495 ? 83.715  73.461  88.802  1.00 19.58  ? 495 PHE B CZ  1 
ATOM   8932  N  N   . ASP B 1 496 ? 86.943  69.589  86.891  1.00 24.16  ? 496 ASP B N   1 
ATOM   8933  C  CA  . ASP B 1 496 ? 87.206  68.814  88.096  1.00 24.16  ? 496 ASP B CA  1 
ATOM   8934  C  C   . ASP B 1 496 ? 88.689  68.649  88.339  1.00 24.16  ? 496 ASP B C   1 
ATOM   8935  O  O   . ASP B 1 496 ? 89.121  68.589  89.492  1.00 24.16  ? 496 ASP B O   1 
ATOM   8936  C  CB  . ASP B 1 496 ? 86.550  67.449  88.011  1.00 24.16  ? 496 ASP B CB  1 
ATOM   8937  C  CG  . ASP B 1 496 ? 85.115  67.533  87.612  1.00 24.16  ? 496 ASP B CG  1 
ATOM   8938  O  OD1 . ASP B 1 496 ? 84.271  67.745  88.506  1.00 24.16  ? 496 ASP B OD1 1 
ATOM   8939  O  OD2 . ASP B 1 496 ? 84.829  67.375  86.409  1.00 24.16  ? 496 ASP B OD2 1 
ATOM   8940  N  N   . ASP B 1 497 ? 89.480  68.589  87.288  1.00 22.33  ? 497 ASP B N   1 
ATOM   8941  C  CA  . ASP B 1 497 ? 90.898  68.379  87.476  1.00 22.33  ? 497 ASP B CA  1 
ATOM   8942  C  C   . ASP B 1 497 ? 91.594  69.618  87.994  1.00 22.33  ? 497 ASP B C   1 
ATOM   8943  O  O   . ASP B 1 497 ? 92.669  69.501  88.578  1.00 22.33  ? 497 ASP B O   1 
ATOM   8944  C  CB  . ASP B 1 497 ? 91.557  67.908  86.189  1.00 22.33  ? 497 ASP B CB  1 
ATOM   8945  C  CG  . ASP B 1 497 ? 91.062  66.559  85.742  1.00 22.33  ? 497 ASP B CG  1 
ATOM   8946  O  OD1 . ASP B 1 497 ? 91.029  65.650  86.597  1.00 22.33  ? 497 ASP B OD1 1 
ATOM   8947  O  OD2 . ASP B 1 497 ? 90.743  66.388  84.544  1.00 22.33  ? 497 ASP B OD2 1 
ATOM   8948  N  N   . TYR B 1 498 ? 91.013  70.791  87.819  1.00 17.28  ? 498 TYR B N   1 
ATOM   8949  C  CA  . TYR B 1 498 ? 91.561  71.947  88.501  1.00 17.28  ? 498 TYR B CA  1 
ATOM   8950  C  C   . TYR B 1 498 ? 91.005  72.107  89.894  1.00 17.28  ? 498 TYR B C   1 
ATOM   8951  O  O   . TYR B 1 498 ? 91.681  72.669  90.759  1.00 17.28  ? 498 TYR B O   1 
ATOM   8952  C  CB  . TYR B 1 498 ? 91.250  73.218  87.733  1.00 17.28  ? 498 TYR B CB  1 
ATOM   8953  C  CG  . TYR B 1 498 ? 92.174  73.441  86.600  1.00 17.28  ? 498 TYR B CG  1 
ATOM   8954  C  CD1 . TYR B 1 498 ? 93.531  73.317  86.757  1.00 17.28  ? 498 TYR B CD1 1 
ATOM   8955  C  CD2 . TYR B 1 498 ? 91.678  73.759  85.355  1.00 17.28  ? 498 TYR B CD2 1 
ATOM   8956  C  CE1 . TYR B 1 498 ? 94.365  73.513  85.704  1.00 17.28  ? 498 TYR B CE1 1 
ATOM   8957  C  CE2 . TYR B 1 498 ? 92.498  73.952  84.303  1.00 17.28  ? 498 TYR B CE2 1 
ATOM   8958  C  CZ  . TYR B 1 498 ? 93.837  73.830  84.480  1.00 17.28  ? 498 TYR B CZ  1 
ATOM   8959  O  OH  . TYR B 1 498 ? 94.652  74.029  83.408  1.00 17.28  ? 498 TYR B OH  1 
ATOM   8960  N  N   . LEU B 1 499 ? 89.800  71.605  90.136  1.00 17.62  ? 499 LEU B N   1 
ATOM   8961  C  CA  . LEU B 1 499 ? 89.200  71.730  91.452  1.00 17.62  ? 499 LEU B CA  1 
ATOM   8962  C  C   . LEU B 1 499 ? 89.934  70.887  92.482  1.00 17.62  ? 499 LEU B C   1 
ATOM   8963  O  O   . LEU B 1 499 ? 90.046  71.299  93.640  1.00 17.62  ? 499 LEU B O   1 
ATOM   8964  C  CB  . LEU B 1 499 ? 87.735  71.337  91.380  1.00 17.62  ? 499 LEU B CB  1 
ATOM   8965  C  CG  . LEU B 1 499 ? 86.941  71.438  92.657  1.00 17.62  ? 499 LEU B CG  1 
ATOM   8966  C  CD1 . LEU B 1 499 ? 87.042  72.845  93.093  1.00 17.62  ? 499 LEU B CD1 1 
ATOM   8967  C  CD2 . LEU B 1 499 ? 85.529  71.080  92.387  1.00 17.62  ? 499 LEU B CD2 1 
ATOM   8968  N  N   . GLU B 1 500 ? 90.452  69.727  92.080  1.00 27.12  ? 500 GLU B N   1 
ATOM   8969  C  CA  . GLU B 1 500 ? 91.260  68.920  92.987  1.00 27.12  ? 500 GLU B CA  1 
ATOM   8970  C  C   . GLU B 1 500 ? 92.526  69.646  93.406  1.00 27.12  ? 500 GLU B C   1 
ATOM   8971  O  O   . GLU B 1 500 ? 92.902  69.616  94.581  1.00 27.12  ? 500 GLU B O   1 
ATOM   8972  C  CB  . GLU B 1 500 ? 91.623  67.606  92.308  1.00 27.12  ? 500 GLU B CB  1 
ATOM   8973  C  CG  . GLU B 1 500 ? 92.657  66.764  93.028  1.00 27.12  ? 500 GLU B CG  1 
ATOM   8974  C  CD  . GLU B 1 500 ? 92.908  65.434  92.335  1.00 27.12  ? 500 GLU B CD  1 
ATOM   8975  O  OE1 . GLU B 1 500 ? 92.146  65.090  91.413  1.00 27.12  ? 500 GLU B OE1 1 
ATOM   8976  O  OE2 . GLU B 1 500 ? 93.903  64.761  92.670  1.00 27.12  ? 500 GLU B OE2 1 
ATOM   8977  N  N   . LEU B 1 501 ? 93.170  70.342  92.476  1.00 19.84  ? 501 LEU B N   1 
ATOM   8978  C  CA  . LEU B 1 501 ? 94.352  71.110  92.840  1.00 19.84  ? 501 LEU B CA  1 
ATOM   8979  C  C   . LEU B 1 501 ? 94.019  72.323  93.682  1.00 19.84  ? 501 LEU B C   1 
ATOM   8980  O  O   . LEU B 1 501 ? 94.835  72.727  94.514  1.00 19.84  ? 501 LEU B O   1 
ATOM   8981  C  CB  . LEU B 1 501 ? 95.132  71.513  91.603  1.00 19.84  ? 501 LEU B CB  1 
ATOM   8982  C  CG  . LEU B 1 501 ? 95.745  70.285  90.969  1.00 19.84  ? 501 LEU B CG  1 
ATOM   8983  C  CD1 . LEU B 1 501 ? 96.527  70.693  89.790  1.00 19.84  ? 501 LEU B CD1 1 
ATOM   8984  C  CD2 . LEU B 1 501 ? 96.667  69.656  91.959  1.00 19.84  ? 501 LEU B CD2 1 
ATOM   8985  N  N   . PHE B 1 502 ? 92.862  72.936  93.466  1.00 16.38  ? 502 PHE B N   1 
ATOM   8986  C  CA  . PHE B 1 502 ? 92.483  74.051  94.317  1.00 16.38  ? 502 PHE B CA  1 
ATOM   8987  C  C   . PHE B 1 502 ? 92.259  73.610  95.751  1.00 16.38  ? 502 PHE B C   1 
ATOM   8988  O  O   . PHE B 1 502 ? 92.735  74.267  96.680  1.00 16.38  ? 502 PHE B O   1 
ATOM   8989  C  CB  . PHE B 1 502 ? 91.227  74.707  93.778  1.00 16.38  ? 502 PHE B CB  1 
ATOM   8990  C  CG  . PHE B 1 502 ? 90.725  75.827  94.615  1.00 16.38  ? 502 PHE B CG  1 
ATOM   8991  C  CD1 . PHE B 1 502 ? 91.312  77.058  94.555  1.00 16.38  ? 502 PHE B CD1 1 
ATOM   8992  C  CD2 . PHE B 1 502 ? 89.649  75.648  95.452  1.00 16.38  ? 502 PHE B CD2 1 
ATOM   8993  C  CE1 . PHE B 1 502 ? 90.841  78.079  95.315  1.00 16.38  ? 502 PHE B CE1 1 
ATOM   8994  C  CE2 . PHE B 1 502 ? 89.186  76.665  96.212  1.00 16.38  ? 502 PHE B CE2 1 
ATOM   8995  C  CZ  . PHE B 1 502 ? 89.772  77.880  96.133  1.00 16.38  ? 502 PHE B CZ  1 
ATOM   8996  N  N   . LEU B 1 503 ? 91.578  72.488  95.958  1.00 21.14  ? 503 LEU B N   1 
ATOM   8997  C  CA  . LEU B 1 503 ? 91.396  72.039  97.329  1.00 21.14  ? 503 LEU B CA  1 
ATOM   8998  C  C   . LEU B 1 503 ? 92.673  71.489  97.940  1.00 21.14  ? 503 LEU B C   1 
ATOM   8999  O  O   . LEU B 1 503 ? 92.839  71.587  99.157  1.00 21.14  ? 503 LEU B O   1 
ATOM   9000  C  CB  . LEU B 1 503 ? 90.267  71.020  97.411  1.00 21.14  ? 503 LEU B CB  1 
ATOM   9001  C  CG  . LEU B 1 503 ? 88.933  71.632  97.006  1.00 21.14  ? 503 LEU B CG  1 
ATOM   9002  C  CD1 . LEU B 1 503 ? 87.827  70.653  97.240  1.00 21.14  ? 503 LEU B CD1 1 
ATOM   9003  C  CD2 . LEU B 1 503 ? 88.671  72.893  97.776  1.00 21.14  ? 503 LEU B CD2 1 
ATOM   9004  N  N   . GLN B 1 504 ? 93.580  70.920  97.142  1.00 27.77  ? 504 GLN B N   1 
ATOM   9005  C  CA  . GLN B 1 504 ? 94.880  70.556  97.693  1.00 27.77  ? 504 GLN B CA  1 
ATOM   9006  C  C   . GLN B 1 504 ? 95.642  71.789  98.112  1.00 27.77  ? 504 GLN B C   1 
ATOM   9007  O  O   . GLN B 1 504 ? 96.253  71.818  99.184  1.00 27.77  ? 504 GLN B O   1 
ATOM   9008  C  CB  . GLN B 1 504 ? 95.725  69.771  96.713  1.00 27.77  ? 504 GLN B CB  1 
ATOM   9009  C  CG  . GLN B 1 504 ? 95.623  68.313  96.873  1.00 27.77  ? 504 GLN B CG  1 
ATOM   9010  C  CD  . GLN B 1 504 ? 96.567  67.597  95.943  1.00 27.77  ? 504 GLN B CD  1 
ATOM   9011  O  OE1 . GLN B 1 504 ? 97.761  67.890  95.919  1.00 27.77  ? 504 GLN B OE1 1 
ATOM   9012  N  NE2 . GLN B 1 504 ? 96.051  66.640  95.189  1.00 27.77  ? 504 GLN B NE2 1 
ATOM   9013  N  N   . PHE B 1 505 ? 95.624  72.813  97.267  1.00 24.98  ? 505 PHE B N   1 
ATOM   9014  C  CA  . PHE B 1 505 ? 96.254  74.069  97.622  1.00 24.98  ? 505 PHE B CA  1 
ATOM   9015  C  C   . PHE B 1 505 ? 95.560  74.710  98.799  1.00 24.98  ? 505 PHE B C   1 
ATOM   9016  O  O   . PHE B 1 505 ? 96.185  75.457  99.553  1.00 24.98  ? 505 PHE B O   1 
ATOM   9017  C  CB  . PHE B 1 505 ? 96.262  75.014  96.442  1.00 24.98  ? 505 PHE B CB  1 
ATOM   9018  C  CG  . PHE B 1 505 ? 97.158  76.163  96.631  1.00 24.98  ? 505 PHE B CG  1 
ATOM   9019  C  CD1 . PHE B 1 505 ? 98.443  75.971  97.064  1.00 24.98  ? 505 PHE B CD1 1 
ATOM   9020  C  CD2 . PHE B 1 505 ? 96.719  77.434  96.391  1.00 24.98  ? 505 PHE B CD2 1 
ATOM   9021  C  CE1 . PHE B 1 505 ? 99.281  77.027  97.240  1.00 24.98  ? 505 PHE B CE1 1 
ATOM   9022  C  CE2 . PHE B 1 505 ? 97.549  78.496  96.567  1.00 24.98  ? 505 PHE B CE2 1 
ATOM   9023  C  CZ  . PHE B 1 505 ? 98.833  78.294  96.995  1.00 24.98  ? 505 PHE B CZ  1 
ATOM   9024  N  N   . GLY B 1 506 ? 94.269  74.448  98.957  1.00 28.95  ? 506 GLY B N   1 
ATOM   9025  C  CA  . GLY B 1 506 ? 93.578  74.937  100.129 1.00 28.95  ? 506 GLY B CA  1 
ATOM   9026  C  C   . GLY B 1 506 ? 94.014  74.237  101.403 1.00 28.95  ? 506 GLY B C   1 
ATOM   9027  O  O   . GLY B 1 506 ? 94.298  74.889  102.405 1.00 28.95  ? 506 GLY B O   1 
ATOM   9028  N  N   . TYR B 1 507 ? 94.103  72.906  101.375 1.00 27.41  ? 507 TYR B N   1 
ATOM   9029  C  CA  . TYR B 1 507 ? 94.519  72.169  102.565 1.00 27.41  ? 507 TYR B CA  1 
ATOM   9030  C  C   . TYR B 1 507 ? 95.964  72.420  102.942 1.00 27.41  ? 507 TYR B C   1 
ATOM   9031  O  O   . TYR B 1 507 ? 96.309  72.334  104.119 1.00 27.41  ? 507 TYR B O   1 
ATOM   9032  C  CB  . TYR B 1 507 ? 94.338  70.675  102.360 1.00 27.41  ? 507 TYR B CB  1 
ATOM   9033  C  CG  . TYR B 1 507 ? 92.935  70.201  102.525 1.00 27.41  ? 507 TYR B CG  1 
ATOM   9034  C  CD1 . TYR B 1 507 ? 92.254  70.404  103.696 1.00 27.41  ? 507 TYR B CD1 1 
ATOM   9035  C  CD2 . TYR B 1 507 ? 92.296  69.534  101.503 1.00 27.41  ? 507 TYR B CD2 1 
ATOM   9036  C  CE1 . TYR B 1 507 ? 90.969  69.970  103.838 1.00 27.41  ? 507 TYR B CE1 1 
ATOM   9037  C  CE2 . TYR B 1 507 ? 91.023  69.095  101.634 1.00 27.41  ? 507 TYR B CE2 1 
ATOM   9038  C  CZ  . TYR B 1 507 ? 90.362  69.313  102.803 1.00 27.41  ? 507 TYR B CZ  1 
ATOM   9039  O  OH  . TYR B 1 507 ? 89.073  68.872  102.935 1.00 27.41  ? 507 TYR B OH  1 
ATOM   9040  N  N   . VAL B 1 508 ? 96.822  72.731  101.983 1.00 30.80  ? 508 VAL B N   1 
ATOM   9041  C  CA  . VAL B 1 508 ? 98.216  72.965  102.325 1.00 30.80  ? 508 VAL B CA  1 
ATOM   9042  C  C   . VAL B 1 508 ? 98.415  74.358  102.890 1.00 30.80  ? 508 VAL B C   1 
ATOM   9043  O  O   . VAL B 1 508 ? 98.995  74.527  103.967 1.00 30.80  ? 508 VAL B O   1 
ATOM   9044  C  CB  . VAL B 1 508 ? 99.109  72.718  101.103 1.00 30.80  ? 508 VAL B CB  1 
ATOM   9045  C  CG1 . VAL B 1 508 ? 100.469 73.349  101.298 1.00 30.80  ? 508 VAL B CG1 1 
ATOM   9046  C  CG2 . VAL B 1 508 ? 99.262  71.238  100.890 1.00 30.80  ? 508 VAL B CG2 1 
ATOM   9047  N  N   . SER B 1 509 ? 97.910  75.369  102.205 1.00 31.23  ? 509 SER B N   1 
ATOM   9048  C  CA  . SER B 1 509 ? 98.346  76.726  102.475 1.00 31.23  ? 509 SER B CA  1 
ATOM   9049  C  C   . SER B 1 509 ? 97.486  77.448  103.493 1.00 31.23  ? 509 SER B C   1 
ATOM   9050  O  O   . SER B 1 509 ? 97.902  78.496  103.987 1.00 31.23  ? 509 SER B O   1 
ATOM   9051  C  CB  . SER B 1 509 ? 98.389  77.538  101.195 1.00 31.23  ? 509 SER B CB  1 
ATOM   9052  O  OG  . SER B 1 509 ? 97.345  78.471  101.221 1.00 31.23  ? 509 SER B OG  1 
ATOM   9053  N  N   . LEU B 1 510 ? 96.275  76.974  103.763 1.00 29.53  ? 510 LEU B N   1 
ATOM   9054  C  CA  . LEU B 1 510 ? 95.445  77.658  104.743 1.00 29.53  ? 510 LEU B CA  1 
ATOM   9055  C  C   . LEU B 1 510 ? 95.952  77.412  106.159 1.00 29.53  ? 510 LEU B C   1 
ATOM   9056  O  O   . LEU B 1 510 ? 95.910  78.313  106.999 1.00 29.53  ? 510 LEU B O   1 
ATOM   9057  C  CB  . LEU B 1 510 ? 94.005  77.200  104.611 1.00 29.53  ? 510 LEU B CB  1 
ATOM   9058  C  CG  . LEU B 1 510 ? 93.318  77.896  103.455 1.00 29.53  ? 510 LEU B CG  1 
ATOM   9059  C  CD1 . LEU B 1 510 ? 91.957  77.311  103.241 1.00 29.53  ? 510 LEU B CD1 1 
ATOM   9060  C  CD2 . LEU B 1 510 ? 93.195  79.350  103.774 1.00 29.53  ? 510 LEU B CD2 1 
ATOM   9061  N  N   . PHE B 1 511 ? 96.407  76.199  106.457 1.00 33.07  ? 511 PHE B N   1 
ATOM   9062  C  CA  . PHE B 1 511 ? 96.885  75.882  107.797 1.00 33.07  ? 511 PHE B CA  1 
ATOM   9063  C  C   . PHE B 1 511 ? 98.297  75.338  107.779 1.00 33.07  ? 511 PHE B C   1 
ATOM   9064  O  O   . PHE B 1 511 ? 98.591  74.347  108.447 1.00 33.07  ? 511 PHE B O   1 
ATOM   9065  C  CB  . PHE B 1 511 ? 95.974  74.891  108.487 1.00 33.07  ? 511 PHE B CB  1 
ATOM   9066  C  CG  . PHE B 1 511 ? 94.549  75.146  108.249 1.00 33.07  ? 511 PHE B CG  1 
ATOM   9067  C  CD1 . PHE B 1 511 ? 93.907  76.143  108.936 1.00 33.07  ? 511 PHE B CD1 1 
ATOM   9068  C  CD2 . PHE B 1 511 ? 93.842  74.394  107.347 1.00 33.07  ? 511 PHE B CD2 1 
ATOM   9069  C  CE1 . PHE B 1 511 ? 92.584  76.387  108.734 1.00 33.07  ? 511 PHE B CE1 1 
ATOM   9070  C  CE2 . PHE B 1 511 ? 92.516  74.635  107.138 1.00 33.07  ? 511 PHE B CE2 1 
ATOM   9071  C  CZ  . PHE B 1 511 ? 91.887  75.633  107.833 1.00 33.07  ? 511 PHE B CZ  1 
ATOM   9072  N  N   . SER B 1 512 ? 99.182  75.985  107.048 1.00 44.02  ? 512 SER B N   1 
ATOM   9073  C  CA  . SER B 1 512 ? 100.565 75.554  107.020 1.00 44.02  ? 512 SER B CA  1 
ATOM   9074  C  C   . SER B 1 512 ? 101.344 75.932  108.266 1.00 44.02  ? 512 SER B C   1 
ATOM   9075  O  O   . SER B 1 512 ? 102.433 75.394  108.480 1.00 44.02  ? 512 SER B O   1 
ATOM   9076  C  CB  . SER B 1 512 ? 101.280 76.152  105.816 1.00 44.02  ? 512 SER B CB  1 
ATOM   9077  O  OG  . SER B 1 512 ? 101.249 77.559  105.891 1.00 44.02  ? 512 SER B OG  1 
ATOM   9078  N  N   . CYS B 1 513 ? 100.819 76.823  109.102 1.00 57.89  ? 513 CYS B N   1 
ATOM   9079  C  CA  . CYS B 1 513 ? 101.533 77.187  110.320 1.00 57.89  ? 513 CYS B CA  1 
ATOM   9080  C  C   . CYS B 1 513 ? 101.458 76.095  111.372 1.00 57.89  ? 513 CYS B C   1 
ATOM   9081  O  O   . CYS B 1 513 ? 102.483 75.702  111.938 1.00 57.89  ? 513 CYS B O   1 
ATOM   9082  C  CB  . CYS B 1 513 ? 100.952 78.471  110.892 1.00 57.89  ? 513 CYS B CB  1 
ATOM   9083  S  SG  . CYS B 1 513 ? 101.512 79.938  110.069 1.00 57.89  ? 513 CYS B SG  1 
ATOM   9084  N  N   . VAL B 1 514 ? 100.264 75.584  111.643 1.00 58.95  ? 514 VAL B N   1 
ATOM   9085  C  CA  . VAL B 1 514 ? 100.104 74.655  112.752 1.00 58.95  ? 514 VAL B CA  1 
ATOM   9086  C  C   . VAL B 1 514 ? 100.413 73.238  112.311 1.00 58.95  ? 514 VAL B C   1 
ATOM   9087  O  O   . VAL B 1 514 ? 100.540 72.332  113.140 1.00 58.95  ? 514 VAL B O   1 
ATOM   9088  C  CB  . VAL B 1 514 ? 98.696  74.760  113.346 1.00 58.95  ? 514 VAL B CB  1 
ATOM   9089  C  CG1 . VAL B 1 514 ? 98.386  76.196  113.660 1.00 58.95  ? 514 VAL B CG1 1 
ATOM   9090  C  CG2 . VAL B 1 514 ? 97.695  74.190  112.383 1.00 58.95  ? 514 VAL B CG2 1 
ATOM   9091  N  N   . TYR B 1 515 ? 100.525 73.015  111.008 1.00 56.97  ? 515 TYR B N   1 
ATOM   9092  C  CA  . TYR B 1 515 ? 100.714 71.671  110.469 1.00 56.97  ? 515 TYR B CA  1 
ATOM   9093  C  C   . TYR B 1 515 ? 101.346 71.750  109.094 1.00 56.97  ? 515 TYR B C   1 
ATOM   9094  O  O   . TYR B 1 515 ? 100.674 71.584  108.072 1.00 56.97  ? 515 TYR B O   1 
ATOM   9095  C  CB  . TYR B 1 515 ? 99.389  70.924  110.396 1.00 56.97  ? 515 TYR B CB  1 
ATOM   9096  C  CG  . TYR B 1 515 ? 99.565  69.450  110.247 1.00 56.97  ? 515 TYR B CG  1 
ATOM   9097  C  CD1 . TYR B 1 515 ? 100.203 68.713  111.229 1.00 56.97  ? 515 TYR B CD1 1 
ATOM   9098  C  CD2 . TYR B 1 515 ? 99.111  68.793  109.123 1.00 56.97  ? 515 TYR B CD2 1 
ATOM   9099  C  CE1 . TYR B 1 515 ? 100.366 67.357  111.102 1.00 56.97  ? 515 TYR B CE1 1 
ATOM   9100  C  CE2 . TYR B 1 515 ? 99.272  67.437  108.986 1.00 56.97  ? 515 TYR B CE2 1 
ATOM   9101  C  CZ  . TYR B 1 515 ? 99.899  66.728  109.978 1.00 56.97  ? 515 TYR B CZ  1 
ATOM   9102  O  OH  . TYR B 1 515 ? 100.058 65.378  109.839 1.00 56.97  ? 515 TYR B OH  1 
ATOM   9103  N  N   . PRO B 1 516 ? 102.663 71.943  109.032 1.00 54.91  ? 516 PRO B N   1 
ATOM   9104  C  CA  . PRO B 1 516 ? 103.329 72.038  107.731 1.00 54.91  ? 516 PRO B CA  1 
ATOM   9105  C  C   . PRO B 1 516 ? 103.506 70.701  107.064 1.00 54.91  ? 516 PRO B C   1 
ATOM   9106  O  O   . PRO B 1 516 ? 103.758 70.664  105.856 1.00 54.91  ? 516 PRO B O   1 
ATOM   9107  C  CB  . PRO B 1 516 ? 104.675 72.662  108.072 1.00 54.91  ? 516 PRO B CB  1 
ATOM   9108  C  CG  . PRO B 1 516 ? 104.922 72.227  109.448 1.00 54.91  ? 516 PRO B CG  1 
ATOM   9109  C  CD  . PRO B 1 516 ? 103.611 72.099  110.142 1.00 54.91  ? 516 PRO B CD  1 
ATOM   9110  N  N   . LEU B 1 517 ? 103.411 69.612  107.826 1.00 54.55  ? 517 LEU B N   1 
ATOM   9111  C  CA  . LEU B 1 517 ? 103.571 68.254  107.318 1.00 54.55  ? 517 LEU B CA  1 
ATOM   9112  C  C   . LEU B 1 517 ? 102.561 67.918  106.226 1.00 54.55  ? 517 LEU B C   1 
ATOM   9113  O  O   . LEU B 1 517 ? 102.844 67.071  105.372 1.00 54.55  ? 517 LEU B O   1 
ATOM   9114  C  CB  . LEU B 1 517 ? 103.455 67.279  108.490 1.00 54.55  ? 517 LEU B CB  1 
ATOM   9115  C  CG  . LEU B 1 517 ? 103.516 65.779  108.248 1.00 54.55  ? 517 LEU B CG  1 
ATOM   9116  C  CD1 . LEU B 1 517 ? 104.848 65.449  107.652 1.00 54.55  ? 517 LEU B CD1 1 
ATOM   9117  C  CD2 . LEU B 1 517 ? 103.327 65.040  109.545 1.00 54.55  ? 517 LEU B CD2 1 
ATOM   9118  N  N   . ALA B 1 518 ? 101.408 68.593  106.224 1.00 48.80  ? 518 ALA B N   1 
ATOM   9119  C  CA  . ALA B 1 518 ? 100.392 68.411  105.194 1.00 48.80  ? 518 ALA B CA  1 
ATOM   9120  C  C   . ALA B 1 518 ? 100.905 68.726  103.796 1.00 48.80  ? 518 ALA B C   1 
ATOM   9121  O  O   . ALA B 1 518 ? 100.372 68.196  102.815 1.00 48.80  ? 518 ALA B O   1 
ATOM   9122  C  CB  . ALA B 1 518 ? 99.185  69.287  105.507 1.00 48.80  ? 518 ALA B CB  1 
ATOM   9123  N  N   . ALA B 1 519 ? 101.897 69.613  103.681 1.00 44.71  ? 519 ALA B N   1 
ATOM   9124  C  CA  . ALA B 1 519 ? 102.507 69.884  102.384 1.00 44.71  ? 519 ALA B CA  1 
ATOM   9125  C  C   . ALA B 1 519 ? 103.159 68.643  101.790 1.00 44.71  ? 519 ALA B C   1 
ATOM   9126  O  O   . ALA B 1 519 ? 103.080 68.422  100.579 1.00 44.71  ? 519 ALA B O   1 
ATOM   9127  C  CB  . ALA B 1 519 ? 103.536 71.006  102.504 1.00 44.71  ? 519 ALA B CB  1 
ATOM   9128  N  N   . ALA B 1 520 ? 103.806 67.825  102.620 1.00 46.50  ? 520 ALA B N   1 
ATOM   9129  C  CA  . ALA B 1 520 ? 104.335 66.556  102.131 1.00 46.50  ? 520 ALA B CA  1 
ATOM   9130  C  C   . ALA B 1 520 ? 103.233 65.622  101.649 1.00 46.50  ? 520 ALA B C   1 
ATOM   9131  O  O   . ALA B 1 520 ? 103.407 64.919  100.650 1.00 46.50  ? 520 ALA B O   1 
ATOM   9132  C  CB  . ALA B 1 520 ? 105.165 65.879  103.215 1.00 46.50  ? 520 ALA B CB  1 
ATOM   9133  N  N   . PHE B 1 521 ? 102.085 65.616  102.326 1.00 44.89  ? 521 PHE B N   1 
ATOM   9134  C  CA  . PHE B 1 521 ? 100.950 64.796  101.903 1.00 44.89  ? 521 PHE B CA  1 
ATOM   9135  C  C   . PHE B 1 521 ? 100.301 65.260  100.612 1.00 44.89  ? 521 PHE B C   1 
ATOM   9136  O  O   . PHE B 1 521 ? 99.484  64.523  100.055 1.00 44.89  ? 521 PHE B O   1 
ATOM   9137  C  CB  . PHE B 1 521 ? 99.903  64.731  103.001 1.00 44.89  ? 521 PHE B CB  1 
ATOM   9138  C  CG  . PHE B 1 521 ? 100.346 63.978  104.203 1.00 44.89  ? 521 PHE B CG  1 
ATOM   9139  C  CD1 . PHE B 1 521 ? 101.338 63.021  104.106 1.00 44.89  ? 521 PHE B CD1 1 
ATOM   9140  C  CD2 . PHE B 1 521 ? 99.786  64.235  105.434 1.00 44.89  ? 521 PHE B CD2 1 
ATOM   9141  C  CE1 . PHE B 1 521 ? 101.752 62.328  105.213 1.00 44.89  ? 521 PHE B CE1 1 
ATOM   9142  C  CE2 . PHE B 1 521 ? 100.196 63.547  106.544 1.00 44.89  ? 521 PHE B CE2 1 
ATOM   9143  C  CZ  . PHE B 1 521 ? 101.182 62.591  106.436 1.00 44.89  ? 521 PHE B CZ  1 
ATOM   9144  N  N   . ALA B 1 522 ? 100.624 66.445  100.129 1.00 40.74  ? 522 ALA B N   1 
ATOM   9145  C  CA  . ALA B 1 522 ? 100.201 66.788  98.787  1.00 40.74  ? 522 ALA B CA  1 
ATOM   9146  C  C   . ALA B 1 522 ? 101.162 66.236  97.747  1.00 40.74  ? 522 ALA B C   1 
ATOM   9147  O  O   . ALA B 1 522 ? 100.723 65.759  96.696  1.00 40.74  ? 522 ALA B O   1 
ATOM   9148  C  CB  . ALA B 1 522 ? 100.071 68.301  98.645  1.00 40.74  ? 522 ALA B CB  1 
ATOM   9149  N  N   . VAL B 1 523 ? 102.463 66.290  98.026  1.00 40.25  ? 523 VAL B N   1 
ATOM   9150  C  CA  . VAL B 1 523 ? 103.457 65.927  97.027  1.00 40.25  ? 523 VAL B CA  1 
ATOM   9151  C  C   . VAL B 1 523 ? 103.418 64.435  96.747  1.00 40.25  ? 523 VAL B C   1 
ATOM   9152  O  O   . VAL B 1 523 ? 103.396 64.012  95.586  1.00 40.25  ? 523 VAL B O   1 
ATOM   9153  C  CB  . VAL B 1 523 ? 104.847 66.377  97.492  1.00 40.25  ? 523 VAL B CB  1 
ATOM   9154  C  CG1 . VAL B 1 523 ? 105.893 65.958  96.506  1.00 40.25  ? 523 VAL B CG1 1 
ATOM   9155  C  CG2 . VAL B 1 523 ? 104.868 67.856  97.623  1.00 40.25  ? 523 VAL B CG2 1 
ATOM   9156  N  N   . LEU B 1 524 ? 103.325 63.617  97.795  1.00 37.37  ? 524 LEU B N   1 
ATOM   9157  C  CA  . LEU B 1 524 ? 103.118 62.184  97.631  1.00 37.37  ? 524 LEU B CA  1 
ATOM   9158  C  C   . LEU B 1 524 ? 101.796 61.835  96.985  1.00 37.37  ? 524 LEU B C   1 
ATOM   9159  O  O   . LEU B 1 524 ? 101.644 60.708  96.512  1.00 37.37  ? 524 LEU B O   1 
ATOM   9160  C  CB  . LEU B 1 524 ? 103.175 61.487  98.980  1.00 37.37  ? 524 LEU B CB  1 
ATOM   9161  C  CG  . LEU B 1 524 ? 104.572 61.385  99.549  1.00 37.37  ? 524 LEU B CG  1 
ATOM   9162  C  CD1 . LEU B 1 524 ? 104.529 60.719  100.904 1.00 37.37  ? 524 LEU B CD1 1 
ATOM   9163  C  CD2 . LEU B 1 524 ? 105.436 60.617  98.581  1.00 37.37  ? 524 LEU B CD2 1 
ATOM   9164  N  N   . ASN B 1 525 ? 100.841 62.754  96.947  1.00 37.21  ? 525 ASN B N   1 
ATOM   9165  C  CA  . ASN B 1 525 ? 99.670  62.515  96.128  1.00 37.21  ? 525 ASN B CA  1 
ATOM   9166  C  C   . ASN B 1 525 ? 99.942  62.833  94.671  1.00 37.21  ? 525 ASN B C   1 
ATOM   9167  O  O   . ASN B 1 525 ? 99.555  62.061  93.789  1.00 37.21  ? 525 ASN B O   1 
ATOM   9168  C  CB  . ASN B 1 525 ? 98.502  63.335  96.642  1.00 37.21  ? 525 ASN B CB  1 
ATOM   9169  C  CG  . ASN B 1 525 ? 97.239  63.054  95.892  1.00 37.21  ? 525 ASN B CG  1 
ATOM   9170  O  OD1 . ASN B 1 525 ? 96.917  63.731  94.921  1.00 37.21  ? 525 ASN B OD1 1 
ATOM   9171  N  ND2 . ASN B 1 525 ? 96.510  62.043  96.332  1.00 37.21  ? 525 ASN B ND2 1 
ATOM   9172  N  N   . ASN B 1 526 ? 100.606 63.960  94.401  1.00 34.68  ? 526 ASN B N   1 
ATOM   9173  C  CA  . ASN B 1 526 ? 100.741 64.440  93.028  1.00 34.68  ? 526 ASN B CA  1 
ATOM   9174  C  C   . ASN B 1 526 ? 101.668 63.555  92.213  1.00 34.68  ? 526 ASN B C   1 
ATOM   9175  O  O   . ASN B 1 526 ? 101.519 63.469  90.991  1.00 34.68  ? 526 ASN B O   1 
ATOM   9176  C  CB  . ASN B 1 526 ? 101.196 65.888  93.005  1.00 34.68  ? 526 ASN B CB  1 
ATOM   9177  C  CG  . ASN B 1 526 ? 100.083 66.830  93.349  1.00 34.68  ? 526 ASN B CG  1 
ATOM   9178  O  OD1 . ASN B 1 526 ? 98.929  66.427  93.443  1.00 34.68  ? 526 ASN B OD1 1 
ATOM   9179  N  ND2 . ASN B 1 526 ? 100.412 68.095  93.515  1.00 34.68  ? 526 ASN B ND2 1 
ATOM   9180  N  N   . PHE B 1 527 ? 102.643 62.919  92.864  1.00 39.54  ? 527 PHE B N   1 
ATOM   9181  C  CA  . PHE B 1 527 ? 103.463 61.911  92.204  1.00 39.54  ? 527 PHE B CA  1 
ATOM   9182  C  C   . PHE B 1 527 ? 102.634 60.729  91.715  1.00 39.54  ? 527 PHE B C   1 
ATOM   9183  O  O   . PHE B 1 527 ? 103.070 60.013  90.812  1.00 39.54  ? 527 PHE B O   1 
ATOM   9184  C  CB  . PHE B 1 527 ? 104.554 61.418  93.144  1.00 39.54  ? 527 PHE B CB  1 
ATOM   9185  C  CG  . PHE B 1 527 ? 105.688 62.375  93.304  1.00 39.54  ? 527 PHE B CG  1 
ATOM   9186  C  CD1 . PHE B 1 527 ? 105.927 63.352  92.359  1.00 39.54  ? 527 PHE B CD1 1 
ATOM   9187  C  CD2 . PHE B 1 527 ? 106.521 62.297  94.404  1.00 39.54  ? 527 PHE B CD2 1 
ATOM   9188  C  CE1 . PHE B 1 527 ? 106.974 64.234  92.512  1.00 39.54  ? 527 PHE B CE1 1 
ATOM   9189  C  CE2 . PHE B 1 527 ? 107.567 63.178  94.560  1.00 39.54  ? 527 PHE B CE2 1 
ATOM   9190  C  CZ  . PHE B 1 527 ? 107.793 64.147  93.612  1.00 39.54  ? 527 PHE B CZ  1 
ATOM   9191  N  N   . THR B 1 528 ? 101.469 60.490  92.309  1.00 37.58  ? 528 THR B N   1 
ATOM   9192  C  CA  . THR B 1 528 ? 100.510 59.556  91.747  1.00 37.58  ? 528 THR B CA  1 
ATOM   9193  C  C   . THR B 1 528 ? 99.568  60.233  90.764  1.00 37.58  ? 528 THR B C   1 
ATOM   9194  O  O   . THR B 1 528 ? 99.135  59.592  89.801  1.00 37.58  ? 528 THR B O   1 
ATOM   9195  C  CB  . THR B 1 528 ? 99.693  58.895  92.847  1.00 37.58  ? 528 THR B CB  1 
ATOM   9196  O  OG1 . THR B 1 528 ? 98.666  59.796  93.265  1.00 37.58  ? 528 THR B OG1 1 
ATOM   9197  C  CG2 . THR B 1 528 ? 100.570 58.590  94.015  1.00 37.58  ? 528 THR B CG2 1 
ATOM   9198  N  N   . GLU B 1 529 ? 99.223  61.502  91.002  1.00 36.22  ? 529 GLU B N   1 
ATOM   9199  C  CA  . GLU B 1 529 ? 98.183  62.165  90.219  1.00 36.22  ? 529 GLU B CA  1 
ATOM   9200  C  C   . GLU B 1 529 ? 98.635  62.380  88.782  1.00 36.22  ? 529 GLU B C   1 
ATOM   9201  O  O   . GLU B 1 529 ? 97.821  62.306  87.857  1.00 36.22  ? 529 GLU B O   1 
ATOM   9202  C  CB  . GLU B 1 529 ? 97.822  63.502  90.860  1.00 36.22  ? 529 GLU B CB  1 
ATOM   9203  C  CG  . GLU B 1 529 ? 96.559  64.162  90.334  1.00 36.22  ? 529 GLU B CG  1 
ATOM   9204  C  CD  . GLU B 1 529 ? 95.276  63.561  90.853  1.00 36.22  ? 529 GLU B CD  1 
ATOM   9205  O  OE1 . GLU B 1 529 ? 95.281  62.984  91.957  1.00 36.22  ? 529 GLU B OE1 1 
ATOM   9206  O  OE2 . GLU B 1 529 ? 94.254  63.681  90.151  1.00 36.22  ? 529 GLU B OE2 1 
ATOM   9207  N  N   . VAL B 1 530 ? 99.916  62.705  88.593  1.00 41.16  ? 530 VAL B N   1 
ATOM   9208  C  CA  . VAL B 1 530 ? 100.525 62.763  87.264  1.00 41.16  ? 530 VAL B CA  1 
ATOM   9209  C  C   . VAL B 1 530 ? 100.370 61.439  86.527  1.00 41.16  ? 530 VAL B C   1 
ATOM   9210  O  O   . VAL B 1 530 ? 100.046 61.410  85.336  1.00 41.16  ? 530 VAL B O   1 
ATOM   9211  C  CB  . VAL B 1 530 ? 102.001 63.169  87.397  1.00 41.16  ? 530 VAL B CB  1 
ATOM   9212  C  CG1 . VAL B 1 530 ? 102.767 62.909  86.123  1.00 41.16  ? 530 VAL B CG1 1 
ATOM   9213  C  CG2 . VAL B 1 530 ? 102.089 64.624  87.765  1.00 41.16  ? 530 VAL B CG2 1 
ATOM   9214  N  N   . ASN B 1 531 ? 100.517 60.326  87.240  1.00 44.95  ? 531 ASN B N   1 
ATOM   9215  C  CA  . ASN B 1 531 ? 100.224 59.034  86.636  1.00 44.95  ? 531 ASN B CA  1 
ATOM   9216  C  C   . ASN B 1 531 ? 98.733  58.827  86.473  1.00 44.95  ? 531 ASN B C   1 
ATOM   9217  O  O   . ASN B 1 531 ? 98.292  58.376  85.412  1.00 44.95  ? 531 ASN B O   1 
ATOM   9218  C  CB  . ASN B 1 531 ? 100.830 57.914  87.461  1.00 44.95  ? 531 ASN B CB  1 
ATOM   9219  C  CG  . ASN B 1 531 ? 102.307 58.066  87.603  1.00 44.95  ? 531 ASN B CG  1 
ATOM   9220  O  OD1 . ASN B 1 531 ? 102.877 59.042  87.125  1.00 44.95  ? 531 ASN B OD1 1 
ATOM   9221  N  ND2 . ASN B 1 531 ? 102.949 57.109  88.254  1.00 44.95  ? 531 ASN B ND2 1 
ATOM   9222  N  N   . SER B 1 532 ? 97.953  59.116  87.516  1.00 36.04  ? 532 SER B N   1 
ATOM   9223  C  CA  . SER B 1 532 ? 96.573  58.655  87.563  1.00 36.04  ? 532 SER B CA  1 
ATOM   9224  C  C   . SER B 1 532 ? 95.715  59.353  86.522  1.00 36.04  ? 532 SER B C   1 
ATOM   9225  O  O   . SER B 1 532 ? 94.996  58.692  85.769  1.00 36.04  ? 532 SER B O   1 
ATOM   9226  C  CB  . SER B 1 532 ? 95.993  58.897  88.941  1.00 36.04  ? 532 SER B CB  1 
ATOM   9227  O  OG  . SER B 1 532 ? 94.589  58.972  88.850  1.00 36.04  ? 532 SER B OG  1 
ATOM   9228  N  N   . ASP B 1 533 ? 95.782  60.683  86.463  1.00 35.42  ? 533 ASP B N   1 
ATOM   9229  C  CA  . ASP B 1 533 ? 95.124  61.448  85.411  1.00 35.42  ? 533 ASP B CA  1 
ATOM   9230  C  C   . ASP B 1 533 ? 95.580  61.068  84.011  1.00 35.42  ? 533 ASP B C   1 
ATOM   9231  O  O   . ASP B 1 533 ? 94.764  61.126  83.086  1.00 35.42  ? 533 ASP B O   1 
ATOM   9232  C  CB  . ASP B 1 533 ? 95.306  62.944  85.639  1.00 35.42  ? 533 ASP B CB  1 
ATOM   9233  C  CG  . ASP B 1 533 ? 94.372  63.481  86.699  1.00 35.42  ? 533 ASP B CG  1 
ATOM   9234  O  OD1 . ASP B 1 533 ? 93.375  62.804  87.011  1.00 35.42  ? 533 ASP B OD1 1 
ATOM   9235  O  OD2 . ASP B 1 533 ? 94.632  64.573  87.231  1.00 35.42  ? 533 ASP B OD2 1 
ATOM   9236  N  N   . ALA B 1 534 ? 96.853  60.705  83.831  1.00 37.44  ? 534 ALA B N   1 
ATOM   9237  C  CA  . ALA B 1 534 ? 97.316  60.240  82.526  1.00 37.44  ? 534 ALA B CA  1 
ATOM   9238  C  C   . ALA B 1 534 ? 96.588  58.975  82.112  1.00 37.44  ? 534 ALA B C   1 
ATOM   9239  O  O   . ALA B 1 534 ? 96.215  58.819  80.945  1.00 37.44  ? 534 ALA B O   1 
ATOM   9240  C  CB  . ALA B 1 534 ? 98.822  60.006  82.540  1.00 37.44  ? 534 ALA B CB  1 
ATOM   9241  N  N   . LEU B 1 535 ? 96.408  58.048  83.050  1.00 37.49  ? 535 LEU B N   1 
ATOM   9242  C  CA  . LEU B 1 535 ? 95.619  56.857  82.769  1.00 37.49  ? 535 LEU B CA  1 
ATOM   9243  C  C   . LEU B 1 535 ? 94.169  57.219  82.474  1.00 37.49  ? 535 LEU B C   1 
ATOM   9244  O  O   . LEU B 1 535 ? 93.523  56.579  81.637  1.00 37.49  ? 535 LEU B O   1 
ATOM   9245  C  CB  . LEU B 1 535 ? 95.722  55.889  83.940  1.00 37.49  ? 535 LEU B CB  1 
ATOM   9246  C  CG  . LEU B 1 535 ? 94.774  54.705  83.977  1.00 37.49  ? 535 LEU B CG  1 
ATOM   9247  C  CD1 . LEU B 1 535 ? 95.125  53.798  82.842  1.00 37.49  ? 535 LEU B CD1 1 
ATOM   9248  C  CD2 . LEU B 1 535 ? 94.905  53.970  85.281  1.00 37.49  ? 535 LEU B CD2 1 
ATOM   9249  N  N   . LYS B 1 536 ? 93.654  58.260  83.130  1.00 33.68  ? 536 LYS B N   1 
ATOM   9250  C  CA  . LYS B 1 536 ? 92.283  58.691  82.884  1.00 33.68  ? 536 LYS B CA  1 
ATOM   9251  C  C   . LYS B 1 536 ? 92.097  59.265  81.489  1.00 33.68  ? 536 LYS B C   1 
ATOM   9252  O  O   . LYS B 1 536 ? 91.011  59.159  80.911  1.00 33.68  ? 536 LYS B O   1 
ATOM   9253  C  CB  . LYS B 1 536 ? 91.882  59.749  83.900  1.00 33.68  ? 536 LYS B CB  1 
ATOM   9254  C  CG  . LYS B 1 536 ? 90.405  60.026  83.945  1.00 33.68  ? 536 LYS B CG  1 
ATOM   9255  C  CD  . LYS B 1 536 ? 90.081  61.107  84.948  1.00 33.68  ? 536 LYS B CD  1 
ATOM   9256  C  CE  . LYS B 1 536 ? 90.820  62.388  84.625  1.00 33.68  ? 536 LYS B CE  1 
ATOM   9257  N  NZ  . LYS B 1 536 ? 90.626  63.391  85.688  1.00 33.68  ? 536 LYS B NZ  1 
ATOM   9258  N  N   . MET B 1 537 ? 93.151  59.824  80.901  1.00 35.02  ? 537 MET B N   1 
ATOM   9259  C  CA  . MET B 1 537 ? 93.006  60.339  79.547  1.00 35.02  ? 537 MET B CA  1 
ATOM   9260  C  C   . MET B 1 537 ? 93.314  59.294  78.488  1.00 35.02  ? 537 MET B C   1 
ATOM   9261  O  O   . MET B 1 537 ? 93.008  59.504  77.313  1.00 35.02  ? 537 MET B O   1 
ATOM   9262  C  CB  . MET B 1 537 ? 93.877  61.570  79.353  1.00 35.02  ? 537 MET B CB  1 
ATOM   9263  C  CG  . MET B 1 537 ? 93.559  62.658  80.339  1.00 35.02  ? 537 MET B CG  1 
ATOM   9264  S  SD  . MET B 1 537 ? 91.803  63.003  80.417  1.00 35.02  ? 537 MET B SD  1 
ATOM   9265  C  CE  . MET B 1 537 ? 91.501  63.698  78.810  1.00 35.02  ? 537 MET B CE  1 
ATOM   9266  N  N   . CYS B 1 538 ? 93.908  58.174  78.871  1.00 42.89  ? 538 CYS B N   1 
ATOM   9267  C  CA  . CYS B 1 538 ? 94.455  57.250  77.893  1.00 42.89  ? 538 CYS B CA  1 
ATOM   9268  C  C   . CYS B 1 538 ? 93.566  56.032  77.727  1.00 42.89  ? 538 CYS B C   1 
ATOM   9269  O  O   . CYS B 1 538 ? 93.274  55.622  76.604  1.00 42.89  ? 538 CYS B O   1 
ATOM   9270  C  CB  . CYS B 1 538 ? 95.859  56.823  78.296  1.00 42.89  ? 538 CYS B CB  1 
ATOM   9271  S  SG  . CYS B 1 538 ? 97.123  58.003  77.835  1.00 42.89  ? 538 CYS B SG  1 
ATOM   9272  N  N   . ARG B 1 539 ? 93.132  55.438  78.822  1.00 46.11  ? 539 ARG B N   1 
ATOM   9273  C  CA  . ARG B 1 539 ? 92.398  54.195  78.745  1.00 46.11  ? 539 ARG B CA  1 
ATOM   9274  C  C   . ARG B 1 539 ? 91.016  54.266  79.358  1.00 46.11  ? 539 ARG B C   1 
ATOM   9275  O  O   . ARG B 1 539 ? 90.380  53.222  79.506  1.00 46.11  ? 539 ARG B O   1 
ATOM   9276  C  CB  . ARG B 1 539 ? 93.146  53.085  79.484  1.00 46.11  ? 539 ARG B CB  1 
ATOM   9277  C  CG  . ARG B 1 539 ? 94.520  52.737  79.005  1.00 46.11  ? 539 ARG B CG  1 
ATOM   9278  C  CD  . ARG B 1 539 ? 94.529  52.175  77.622  1.00 46.11  ? 539 ARG B CD  1 
ATOM   9279  N  NE  . ARG B 1 539 ? 95.869  52.262  77.072  1.00 46.11  ? 539 ARG B NE  1 
ATOM   9280  C  CZ  . ARG B 1 539 ? 96.193  51.847  75.861  1.00 46.11  ? 539 ARG B CZ  1 
ATOM   9281  N  NH1 . ARG B 1 539 ? 95.266  51.315  75.084  1.00 46.11  ? 539 ARG B NH1 1 
ATOM   9282  N  NH2 . ARG B 1 539 ? 97.441  51.954  75.435  1.00 46.11  ? 539 ARG B NH2 1 
ATOM   9283  N  N   . VAL B 1 540 ? 90.524  55.439  79.722  1.00 38.78  ? 540 VAL B N   1 
ATOM   9284  C  CA  . VAL B 1 540 ? 89.256  55.551  80.425  1.00 38.78  ? 540 VAL B CA  1 
ATOM   9285  C  C   . VAL B 1 540 ? 88.214  56.287  79.603  1.00 38.78  ? 540 VAL B C   1 
ATOM   9286  O  O   . VAL B 1 540 ? 87.098  55.800  79.416  1.00 38.78  ? 540 VAL B O   1 
ATOM   9287  C  CB  . VAL B 1 540 ? 89.442  56.243  81.783  1.00 38.78  ? 540 VAL B CB  1 
ATOM   9288  C  CG1 . VAL B 1 540 ? 88.120  56.349  82.489  1.00 38.78  ? 540 VAL B CG1 1 
ATOM   9289  C  CG2 . VAL B 1 540 ? 90.430  55.489  82.611  1.00 38.78  ? 540 VAL B CG2 1 
ATOM   9290  N  N   . PHE B 1 541 ? 88.573  57.434  79.064  1.00 36.13  ? 541 PHE B N   1 
ATOM   9291  C  CA  . PHE B 1 541 ? 87.616  58.319  78.432  1.00 36.13  ? 541 PHE B CA  1 
ATOM   9292  C  C   . PHE B 1 541 ? 87.737  58.247  76.923  1.00 36.13  ? 541 PHE B C   1 
ATOM   9293  O  O   . PHE B 1 541 ? 88.677  57.670  76.378  1.00 36.13  ? 541 PHE B O   1 
ATOM   9294  C  CB  . PHE B 1 541 ? 87.818  59.750  78.928  1.00 36.13  ? 541 PHE B CB  1 
ATOM   9295  C  CG  . PHE B 1 541 ? 87.235  59.991  80.280  1.00 36.13  ? 541 PHE B CG  1 
ATOM   9296  C  CD1 . PHE B 1 541 ? 86.102  59.317  80.687  1.00 36.13  ? 541 PHE B CD1 1 
ATOM   9297  C  CD2 . PHE B 1 541 ? 87.834  60.864  81.159  1.00 36.13  ? 541 PHE B CD2 1 
ATOM   9298  C  CE1 . PHE B 1 541 ? 85.567  59.524  81.945  1.00 36.13  ? 541 PHE B CE1 1 
ATOM   9299  C  CE2 . PHE B 1 541 ? 87.303  61.075  82.417  1.00 36.13  ? 541 PHE B CE2 1 
ATOM   9300  C  CZ  . PHE B 1 541 ? 86.169  60.403  82.809  1.00 36.13  ? 541 PHE B CZ  1 
ATOM   9301  N  N   . LYS B 1 542 ? 86.765  58.850  76.244  1.00 40.15  ? 542 LYS B N   1 
ATOM   9302  C  CA  . LYS B 1 542 ? 86.947  59.079  74.826  1.00 40.15  ? 542 LYS B CA  1 
ATOM   9303  C  C   . LYS B 1 542 ? 88.032  60.121  74.626  1.00 40.15  ? 542 LYS B C   1 
ATOM   9304  O  O   . LYS B 1 542 ? 88.435  60.824  75.553  1.00 40.15  ? 542 LYS B O   1 
ATOM   9305  C  CB  . LYS B 1 542 ? 85.677  59.629  74.194  1.00 40.15  ? 542 LYS B CB  1 
ATOM   9306  C  CG  . LYS B 1 542 ? 84.541  58.685  74.062  1.00 40.15  ? 542 LYS B CG  1 
ATOM   9307  C  CD  . LYS B 1 542 ? 83.359  59.448  73.524  1.00 40.15  ? 542 LYS B CD  1 
ATOM   9308  C  CE  . LYS B 1 542 ? 82.060  58.813  73.932  1.00 40.15  ? 542 LYS B CE  1 
ATOM   9309  N  NZ  . LYS B 1 542 ? 80.942  59.764  73.748  1.00 40.15  ? 542 LYS B NZ  1 
ATOM   9310  N  N   . ARG B 1 543 ? 88.491  60.240  73.404  1.00 38.02  ? 543 ARG B N   1 
ATOM   9311  C  CA  . ARG B 1 543 ? 89.422  61.305  73.103  1.00 38.02  ? 543 ARG B CA  1 
ATOM   9312  C  C   . ARG B 1 543 ? 88.655  62.612  73.120  1.00 38.02  ? 543 ARG B C   1 
ATOM   9313  O  O   . ARG B 1 543 ? 87.644  62.727  72.427  1.00 38.02  ? 543 ARG B O   1 
ATOM   9314  C  CB  . ARG B 1 543 ? 90.090  61.084  71.777  1.00 38.02  ? 543 ARG B CB  1 
ATOM   9315  C  CG  . ARG B 1 543 ? 91.139  62.097  71.494  1.00 38.02  ? 543 ARG B CG  1 
ATOM   9316  C  CD  . ARG B 1 543 ? 91.889  61.626  70.310  1.00 38.02  ? 543 ARG B CD  1 
ATOM   9317  N  NE  . ARG B 1 543 ? 93.008  62.480  69.992  1.00 38.02  ? 543 ARG B NE  1 
ATOM   9318  C  CZ  . ARG B 1 543 ? 93.977  62.094  69.184  1.00 38.02  ? 543 ARG B CZ  1 
ATOM   9319  N  NH1 . ARG B 1 543 ? 93.925  60.884  68.647  1.00 38.02  ? 543 ARG B NH1 1 
ATOM   9320  N  NH2 . ARG B 1 543 ? 94.995  62.897  68.927  1.00 38.02  ? 543 ARG B NH2 1 
ATOM   9321  N  N   . PRO B 1 544 ? 89.042  63.582  73.921  1.00 31.18  ? 544 PRO B N   1 
ATOM   9322  C  CA  . PRO B 1 544 ? 88.363  64.869  73.868  1.00 31.18  ? 544 PRO B CA  1 
ATOM   9323  C  C   . PRO B 1 544 ? 88.756  65.606  72.610  1.00 31.18  ? 544 PRO B C   1 
ATOM   9324  O  O   . PRO B 1 544 ? 89.828  65.386  72.048  1.00 31.18  ? 544 PRO B O   1 
ATOM   9325  C  CB  . PRO B 1 544 ? 88.893  65.592  75.102  1.00 31.18  ? 544 PRO B CB  1 
ATOM   9326  C  CG  . PRO B 1 544 ? 90.232  65.004  75.294  1.00 31.18  ? 544 PRO B CG  1 
ATOM   9327  C  CD  . PRO B 1 544 ? 90.128  63.575  74.904  1.00 31.18  ? 544 PRO B CD  1 
ATOM   9328  N  N   . PHE B 1 545 ? 87.856  66.456  72.141  1.00 35.94  ? 545 PHE B N   1 
ATOM   9329  C  CA  . PHE B 1 545 ? 88.186  67.316  71.019  1.00 35.94  ? 545 PHE B CA  1 
ATOM   9330  C  C   . PHE B 1 545 ? 89.177  68.371  71.474  1.00 35.94  ? 545 PHE B C   1 
ATOM   9331  O  O   . PHE B 1 545 ? 89.084  68.881  72.590  1.00 35.94  ? 545 PHE B O   1 
ATOM   9332  C  CB  . PHE B 1 545 ? 86.938  67.969  70.459  1.00 35.94  ? 545 PHE B CB  1 
ATOM   9333  C  CG  . PHE B 1 545 ? 86.316  67.198  69.356  1.00 35.94  ? 545 PHE B CG  1 
ATOM   9334  C  CD1 . PHE B 1 545 ? 87.052  66.845  68.254  1.00 35.94  ? 545 PHE B CD1 1 
ATOM   9335  C  CD2 . PHE B 1 545 ? 84.990  66.840  69.409  1.00 35.94  ? 545 PHE B CD2 1 
ATOM   9336  C  CE1 . PHE B 1 545 ? 86.483  66.137  67.232  1.00 35.94  ? 545 PHE B CE1 1 
ATOM   9337  C  CE2 . PHE B 1 545 ? 84.415  66.133  68.382  1.00 35.94  ? 545 PHE B CE2 1 
ATOM   9338  C  CZ  . PHE B 1 545 ? 85.161  65.789  67.292  1.00 35.94  ? 545 PHE B CZ  1 
ATOM   9339  N  N   . SER B 1 546 ? 90.139  68.679  70.624  1.00 37.76  ? 546 SER B N   1 
ATOM   9340  C  CA  . SER B 1 546 ? 91.151  69.664  70.962  1.00 37.76  ? 546 SER B CA  1 
ATOM   9341  C  C   . SER B 1 546 ? 90.552  71.058  71.047  1.00 37.76  ? 546 SER B C   1 
ATOM   9342  O  O   . SER B 1 546 ? 89.855  71.494  70.133  1.00 37.76  ? 546 SER B O   1 
ATOM   9343  C  CB  . SER B 1 546 ? 92.252  69.645  69.916  1.00 37.76  ? 546 SER B CB  1 
ATOM   9344  O  OG  . SER B 1 546 ? 93.001  70.841  69.972  1.00 37.76  ? 546 SER B OG  1 
ATOM   9345  N  N   . GLU B 1 547 ? 90.803  71.754  72.149  1.00 33.67  ? 547 GLU B N   1 
ATOM   9346  C  CA  . GLU B 1 547 ? 90.250  73.086  72.320  1.00 33.67  ? 547 GLU B CA  1 
ATOM   9347  C  C   . GLU B 1 547 ? 91.363  74.069  72.644  1.00 33.67  ? 547 GLU B C   1 
ATOM   9348  O  O   . GLU B 1 547 ? 92.106  73.863  73.604  1.00 33.67  ? 547 GLU B O   1 
ATOM   9349  C  CB  . GLU B 1 547 ? 89.205  73.140  73.432  1.00 33.67  ? 547 GLU B CB  1 
ATOM   9350  C  CG  . GLU B 1 547 ? 87.829  72.707  73.002  1.00 33.67  ? 547 GLU B CG  1 
ATOM   9351  C  CD  . GLU B 1 547 ? 86.916  72.471  74.178  1.00 33.67  ? 547 GLU B CD  1 
ATOM   9352  O  OE1 . GLU B 1 547 ? 87.215  72.996  75.268  1.00 33.67  ? 547 GLU B OE1 1 
ATOM   9353  O  OE2 . GLU B 1 547 ? 85.902  71.760  74.016  1.00 33.67  ? 547 GLU B OE2 1 
ATOM   9354  N  N   . PRO B 1 548 ? 91.519  75.123  71.860  1.00 27.53  ? 548 PRO B N   1 
ATOM   9355  C  CA  . PRO B 1 548 ? 92.550  76.117  72.155  1.00 27.53  ? 548 PRO B CA  1 
ATOM   9356  C  C   . PRO B 1 548 ? 92.199  76.976  73.350  1.00 27.53  ? 548 PRO B C   1 
ATOM   9357  O  O   . PRO B 1 548 ? 91.063  77.420  73.511  1.00 27.53  ? 548 PRO B O   1 
ATOM   9358  C  CB  . PRO B 1 548 ? 92.592  76.961  70.882  1.00 27.53  ? 548 PRO B CB  1 
ATOM   9359  C  CG  . PRO B 1 548 ? 91.885  76.152  69.866  1.00 27.53  ? 548 PRO B CG  1 
ATOM   9360  C  CD  . PRO B 1 548 ? 90.850  75.396  70.592  1.00 27.53  ? 548 PRO B CD  1 
ATOM   9361  N  N   . SER B 1 549 ? 93.206  77.216  74.182  1.00 27.17  ? 549 SER B N   1 
ATOM   9362  C  CA  . SER B 1 549 ? 93.097  78.044  75.373  1.00 27.17  ? 549 SER B CA  1 
ATOM   9363  C  C   . SER B 1 549 ? 94.442  78.701  75.608  1.00 27.17  ? 549 SER B C   1 
ATOM   9364  O  O   . SER B 1 549 ? 95.477  78.047  75.495  1.00 27.17  ? 549 SER B O   1 
ATOM   9365  C  CB  . SER B 1 549 ? 92.695  77.238  76.602  1.00 27.17  ? 549 SER B CB  1 
ATOM   9366  O  OG  . SER B 1 549 ? 93.828  77.005  77.412  1.00 27.17  ? 549 SER B OG  1 
ATOM   9367  N  N   . ALA B 1 550 ? 94.428  79.980  75.958  1.00 23.52  ? 550 ALA B N   1 
ATOM   9368  C  CA  . ALA B 1 550 ? 95.671  80.713  76.139  1.00 23.52  ? 550 ALA B CA  1 
ATOM   9369  C  C   . ALA B 1 550 ? 96.142  80.734  77.575  1.00 23.52  ? 550 ALA B C   1 
ATOM   9370  O  O   . ALA B 1 550 ? 97.313  81.023  77.826  1.00 23.52  ? 550 ALA B O   1 
ATOM   9371  C  CB  . ALA B 1 550 ? 95.512  82.158  75.663  1.00 23.52  ? 550 ALA B CB  1 
ATOM   9372  N  N   . ASN B 1 551 ? 95.266  80.443  78.512  1.00 22.00  ? 551 ASN B N   1 
ATOM   9373  C  CA  . ASN B 1 551 ? 95.616  80.430  79.913  1.00 22.00  ? 551 ASN B CA  1 
ATOM   9374  C  C   . ASN B 1 551 ? 94.683  79.448  80.594  1.00 22.00  ? 551 ASN B C   1 
ATOM   9375  O  O   . ASN B 1 551 ? 93.809  78.855  79.961  1.00 22.00  ? 551 ASN B O   1 
ATOM   9376  C  CB  . ASN B 1 551 ? 95.574  81.833  80.515  1.00 22.00  ? 551 ASN B CB  1 
ATOM   9377  C  CG  . ASN B 1 551 ? 94.295  82.565  80.207  1.00 22.00  ? 551 ASN B CG  1 
ATOM   9378  O  OD1 . ASN B 1 551 ? 93.378  82.020  79.602  1.00 22.00  ? 551 ASN B OD1 1 
ATOM   9379  N  ND2 . ASN B 1 551 ? 94.222  83.818  80.636  1.00 22.00  ? 551 ASN B ND2 1 
ATOM   9380  N  N   . ILE B 1 552 ? 94.862  79.281  81.897  1.00 15.86  ? 552 ILE B N   1 
ATOM   9381  C  CA  . ILE B 1 552 ? 93.933  78.441  82.622  1.00 15.86  ? 552 ILE B CA  1 
ATOM   9382  C  C   . ILE B 1 552 ? 92.612  79.150  82.850  1.00 15.86  ? 552 ILE B C   1 
ATOM   9383  O  O   . ILE B 1 552 ? 91.605  78.494  83.121  1.00 15.86  ? 552 ILE B O   1 
ATOM   9384  C  CB  . ILE B 1 552 ? 94.574  77.992  83.934  1.00 15.86  ? 552 ILE B CB  1 
ATOM   9385  C  CG1 . ILE B 1 552 ? 95.057  79.205  84.687  1.00 15.86  ? 552 ILE B CG1 1 
ATOM   9386  C  CG2 . ILE B 1 552 ? 95.757  77.155  83.651  1.00 15.86  ? 552 ILE B CG2 1 
ATOM   9387  C  CD1 . ILE B 1 552 ? 95.566  78.886  86.034  1.00 15.86  ? 552 ILE B CD1 1 
ATOM   9388  N  N   . GLY B 1 553 ? 92.576  80.467  82.726  1.00 21.57  ? 553 GLY B N   1 
ATOM   9389  C  CA  . GLY B 1 553 ? 91.304  81.151  82.716  1.00 21.57  ? 553 GLY B CA  1 
ATOM   9390  C  C   . GLY B 1 553 ? 90.974  81.823  84.025  1.00 21.57  ? 553 GLY B C   1 
ATOM   9391  O  O   . GLY B 1 553 ? 91.728  82.672  84.502  1.00 21.57  ? 553 GLY B O   1 
ATOM   9392  N  N   . VAL B 1 554 ? 89.835  81.469  84.614  1.00 17.81  ? 554 VAL B N   1 
ATOM   9393  C  CA  . VAL B 1 554 ? 89.448  82.081  85.876  1.00 17.81  ? 554 VAL B CA  1 
ATOM   9394  C  C   . VAL B 1 554 ? 90.122  81.391  87.043  1.00 17.81  ? 554 VAL B C   1 
ATOM   9395  O  O   . VAL B 1 554 ? 90.070  81.892  88.169  1.00 17.81  ? 554 VAL B O   1 
ATOM   9396  C  CB  . VAL B 1 554 ? 87.916  82.028  85.998  1.00 17.81  ? 554 VAL B CB  1 
ATOM   9397  C  CG1 . VAL B 1 554 ? 87.493  80.656  86.339  1.00 17.81  ? 554 VAL B CG1 1 
ATOM   9398  C  CG2 . VAL B 1 554 ? 87.364  83.045  86.980  1.00 17.81  ? 554 VAL B CG2 1 
ATOM   9399  N  N   . TRP B 1 555 ? 90.842  80.304  86.794  1.00 9.15   ? 555 TRP B N   1 
ATOM   9400  C  CA  . TRP B 1 555 ? 91.495  79.621  87.894  1.00 9.15   ? 555 TRP B CA  1 
ATOM   9401  C  C   . TRP B 1 555 ? 92.687  80.369  88.438  1.00 9.15   ? 555 TRP B C   1 
ATOM   9402  O  O   . TRP B 1 555 ? 93.094  80.096  89.566  1.00 9.15   ? 555 TRP B O   1 
ATOM   9403  C  CB  . TRP B 1 555 ? 91.903  78.237  87.456  1.00 9.15   ? 555 TRP B CB  1 
ATOM   9404  C  CG  . TRP B 1 555 ? 90.747  77.351  87.360  1.00 9.15   ? 555 TRP B CG  1 
ATOM   9405  C  CD1 . TRP B 1 555 ? 90.187  76.862  86.236  1.00 9.15   ? 555 TRP B CD1 1 
ATOM   9406  C  CD2 . TRP B 1 555 ? 90.030  76.797  88.441  1.00 9.15   ? 555 TRP B CD2 1 
ATOM   9407  N  NE1 . TRP B 1 555 ? 89.139  76.053  86.547  1.00 9.15   ? 555 TRP B NE1 1 
ATOM   9408  C  CE2 . TRP B 1 555 ? 89.028  75.997  87.906  1.00 9.15   ? 555 TRP B CE2 1 
ATOM   9409  C  CE3 . TRP B 1 555 ? 90.131  76.910  89.816  1.00 9.15   ? 555 TRP B CE3 1 
ATOM   9410  C  CZ2 . TRP B 1 555 ? 88.138  75.320  88.690  1.00 9.15   ? 555 TRP B CZ2 1 
ATOM   9411  C  CZ3 . TRP B 1 555 ? 89.251  76.241  90.589  1.00 9.15   ? 555 TRP B CZ3 1 
ATOM   9412  C  CH2 . TRP B 1 555 ? 88.268  75.451  90.033  1.00 9.15   ? 555 TRP B CH2 1 
ATOM   9413  N  N   . GLN B 1 556 ? 93.271  81.275  87.666  1.00 16.65  ? 556 GLN B N   1 
ATOM   9414  C  CA  . GLN B 1 556 ? 94.333  82.104  88.214  1.00 16.65  ? 556 GLN B CA  1 
ATOM   9415  C  C   . GLN B 1 556 ? 93.803  83.007  89.310  1.00 16.65  ? 556 GLN B C   1 
ATOM   9416  O  O   . GLN B 1 556 ? 94.468  83.221  90.328  1.00 16.65  ? 556 GLN B O   1 
ATOM   9417  C  CB  . GLN B 1 556 ? 94.995  82.926  87.125  1.00 16.65  ? 556 GLN B CB  1 
ATOM   9418  C  CG  . GLN B 1 556 ? 96.236  83.515  87.634  1.00 16.65  ? 556 GLN B CG  1 
ATOM   9419  C  CD  . GLN B 1 556 ? 97.310  82.513  87.636  1.00 16.65  ? 556 GLN B CD  1 
ATOM   9420  O  OE1 . GLN B 1 556 ? 97.318  81.604  86.821  1.00 16.65  ? 556 GLN B OE1 1 
ATOM   9421  N  NE2 . GLN B 1 556 ? 98.204  82.619  88.597  1.00 16.65  ? 556 GLN B NE2 1 
ATOM   9422  N  N   . LEU B 1 557 ? 92.615  83.564  89.109  1.00 14.55  ? 557 LEU B N   1 
ATOM   9423  C  CA  . LEU B 1 557 ? 92.012  84.370  90.154  1.00 14.55  ? 557 LEU B CA  1 
ATOM   9424  C  C   . LEU B 1 557 ? 91.628  83.536  91.365  1.00 14.55  ? 557 LEU B C   1 
ATOM   9425  O  O   . LEU B 1 557 ? 91.759  84.004  92.499  1.00 14.55  ? 557 LEU B O   1 
ATOM   9426  C  CB  . LEU B 1 557 ? 90.809  85.111  89.592  1.00 14.55  ? 557 LEU B CB  1 
ATOM   9427  C  CG  . LEU B 1 557 ? 90.065  86.017  90.550  1.00 14.55  ? 557 LEU B CG  1 
ATOM   9428  C  CD1 . LEU B 1 557 ? 90.969  87.131  90.924  1.00 14.55  ? 557 LEU B CD1 1 
ATOM   9429  C  CD2 . LEU B 1 557 ? 88.886  86.570  89.838  1.00 14.55  ? 557 LEU B CD2 1 
ATOM   9430  N  N   . ALA B 1 558 ? 91.184  82.299  91.159  1.00 13.10  ? 558 ALA B N   1 
ATOM   9431  C  CA  . ALA B 1 558 ? 90.811  81.464  92.295  1.00 13.10  ? 558 ALA B CA  1 
ATOM   9432  C  C   . ALA B 1 558 ? 92.015  81.032  93.116  1.00 13.10  ? 558 ALA B C   1 
ATOM   9433  O  O   . ALA B 1 558 ? 91.950  81.022  94.346  1.00 13.10  ? 558 ALA B O   1 
ATOM   9434  C  CB  . ALA B 1 558 ? 90.032  80.244  91.829  1.00 13.10  ? 558 ALA B CB  1 
ATOM   9435  N  N   . PHE B 1 559 ? 93.113  80.658  92.467  1.00 16.20  ? 559 PHE B N   1 
ATOM   9436  C  CA  . PHE B 1 559 ? 94.301  80.273  93.219  1.00 16.20  ? 559 PHE B CA  1 
ATOM   9437  C  C   . PHE B 1 559 ? 94.942  81.452  93.922  1.00 16.20  ? 559 PHE B C   1 
ATOM   9438  O  O   . PHE B 1 559 ? 95.508  81.287  95.002  1.00 16.20  ? 559 PHE B O   1 
ATOM   9439  C  CB  . PHE B 1 559 ? 95.328  79.600  92.329  1.00 16.20  ? 559 PHE B CB  1 
ATOM   9440  C  CG  . PHE B 1 559 ? 95.108  78.150  92.161  1.00 16.20  ? 559 PHE B CG  1 
ATOM   9441  C  CD1 . PHE B 1 559 ? 95.595  77.266  93.077  1.00 16.20  ? 559 PHE B CD1 1 
ATOM   9442  C  CD2 . PHE B 1 559 ? 94.473  77.665  91.050  1.00 16.20  ? 559 PHE B CD2 1 
ATOM   9443  C  CE1 . PHE B 1 559 ? 95.390  75.928  92.923  1.00 16.20  ? 559 PHE B CE1 1 
ATOM   9444  C  CE2 . PHE B 1 559 ? 94.283  76.336  90.889  1.00 16.20  ? 559 PHE B CE2 1 
ATOM   9445  C  CZ  . PHE B 1 559 ? 94.739  75.466  91.826  1.00 16.20  ? 559 PHE B CZ  1 
ATOM   9446  N  N   . GLU B 1 560 ? 94.901  82.632  93.319  1.00 17.24  ? 560 GLU B N   1 
ATOM   9447  C  CA  . GLU B 1 560 ? 95.427  83.815  93.986  1.00 17.24  ? 560 GLU B CA  1 
ATOM   9448  C  C   . GLU B 1 560 ? 94.561  84.245  95.160  1.00 17.24  ? 560 GLU B C   1 
ATOM   9449  O  O   . GLU B 1 560 ? 95.091  84.702  96.176  1.00 17.24  ? 560 GLU B O   1 
ATOM   9450  C  CB  . GLU B 1 560 ? 95.602  84.947  92.978  1.00 17.24  ? 560 GLU B CB  1 
ATOM   9451  C  CG  . GLU B 1 560 ? 95.939  86.312  93.562  1.00 17.24  ? 560 GLU B CG  1 
ATOM   9452  C  CD  . GLU B 1 560 ? 97.374  86.466  94.068  1.00 17.24  ? 560 GLU B CD  1 
ATOM   9453  O  OE1 . GLU B 1 560 ? 98.138  85.486  94.135  1.00 17.24  ? 560 GLU B OE1 1 
ATOM   9454  O  OE2 . GLU B 1 560 ? 97.746  87.605  94.411  1.00 17.24  ? 560 GLU B OE2 1 
ATOM   9455  N  N   . THR B 1 561 ? 93.249  84.040  95.076  1.00 17.54  ? 561 THR B N   1 
ATOM   9456  C  CA  . THR B 1 561 ? 92.366  84.364  96.193  1.00 17.54  ? 561 THR B CA  1 
ATOM   9457  C  C   . THR B 1 561 ? 92.621  83.433  97.366  1.00 17.54  ? 561 THR B C   1 
ATOM   9458  O  O   . THR B 1 561 ? 92.522  83.843  98.526  1.00 17.54  ? 561 THR B O   1 
ATOM   9459  C  CB  . THR B 1 561 ? 90.918  84.286  95.741  1.00 17.54  ? 561 THR B CB  1 
ATOM   9460  O  OG1 . THR B 1 561 ? 90.758  85.125  94.597  1.00 17.54  ? 561 THR B OG1 1 
ATOM   9461  C  CG2 . THR B 1 561 ? 89.975  84.759  96.817  1.00 17.54  ? 561 THR B CG2 1 
ATOM   9462  N  N   . MET B 1 562 ? 92.964  82.182  97.082  1.00 19.22  ? 562 MET B N   1 
ATOM   9463  C  CA  . MET B 1 562 ? 93.375  81.275  98.141  1.00 19.22  ? 562 MET B CA  1 
ATOM   9464  C  C   . MET B 1 562 ? 94.648  81.760  98.817  1.00 19.22  ? 562 MET B C   1 
ATOM   9465  O  O   . MET B 1 562 ? 94.746  81.746  100.046 1.00 19.22  ? 562 MET B O   1 
ATOM   9466  C  CB  . MET B 1 562 ? 93.561  79.878  97.577  1.00 19.22  ? 562 MET B CB  1 
ATOM   9467  C  CG  . MET B 1 562 ? 94.093  78.919  98.564  1.00 19.22  ? 562 MET B CG  1 
ATOM   9468  S  SD  . MET B 1 562 ? 92.923  78.827  99.899  1.00 19.22  ? 562 MET B SD  1 
ATOM   9469  C  CE  . MET B 1 562 ? 91.631  77.940  99.097  1.00 19.22  ? 562 MET B CE  1 
ATOM   9470  N  N   . SER B 1 563 ? 95.611  82.246  98.047  1.00 18.46  ? 563 SER B N   1 
ATOM   9471  C  CA  . SER B 1 563 ? 96.826  82.752  98.665  1.00 18.46  ? 563 SER B CA  1 
ATOM   9472  C  C   . SER B 1 563 ? 96.637  84.054  99.432  1.00 18.46  ? 563 SER B C   1 
ATOM   9473  O  O   . SER B 1 563 ? 97.519  84.402  100.215 1.00 18.46  ? 563 SER B O   1 
ATOM   9474  C  CB  . SER B 1 563 ? 97.908  82.960  97.626  1.00 18.46  ? 563 SER B CB  1 
ATOM   9475  O  OG  . SER B 1 563 ? 98.843  83.900  98.107  1.00 18.46  ? 563 SER B OG  1 
ATOM   9476  N  N   . VAL B 1 564 ? 95.562  84.800  99.211  1.00 18.42  ? 564 VAL B N   1 
ATOM   9477  C  CA  . VAL B 1 564 ? 95.312  85.989  100.024 1.00 18.42  ? 564 VAL B CA  1 
ATOM   9478  C  C   . VAL B 1 564 ? 94.542  85.636  101.284 1.00 18.42  ? 564 VAL B C   1 
ATOM   9479  O  O   . VAL B 1 564 ? 94.870  86.120  102.368 1.00 18.42  ? 564 VAL B O   1 
ATOM   9480  C  CB  . VAL B 1 564 ? 94.601  87.065  99.189  1.00 18.42  ? 564 VAL B CB  1 
ATOM   9481  C  CG1 . VAL B 1 564 ? 93.920  88.075  100.048 1.00 18.42  ? 564 VAL B CG1 1 
ATOM   9482  C  CG2 . VAL B 1 564 ? 95.617  87.778  98.376  1.00 18.42  ? 564 VAL B CG2 1 
ATOM   9483  N  N   . ILE B 1 565 ? 93.561  84.739  101.166 1.00 18.89  ? 565 ILE B N   1 
ATOM   9484  C  CA  . ILE B 1 565 ? 92.828  84.239  102.326 1.00 18.89  ? 565 ILE B CA  1 
ATOM   9485  C  C   . ILE B 1 565 ? 93.760  83.495  103.263 1.00 18.89  ? 565 ILE B C   1 
ATOM   9486  O  O   . ILE B 1 565 ? 93.627  83.587  104.488 1.00 18.89  ? 565 ILE B O   1 
ATOM   9487  C  CB  . ILE B 1 565 ? 91.639  83.387  101.853 1.00 18.89  ? 565 ILE B CB  1 
ATOM   9488  C  CG1 . ILE B 1 565 ? 90.589  84.315  101.269 1.00 18.89  ? 565 ILE B CG1 1 
ATOM   9489  C  CG2 . ILE B 1 565 ? 91.048  82.539  102.945 1.00 18.89  ? 565 ILE B CG2 1 
ATOM   9490  C  CD1 . ILE B 1 565 ? 89.475  83.607  100.610 1.00 18.89  ? 565 ILE B CD1 1 
ATOM   9491  N  N   . SER B 1 566 ? 94.762  82.819  102.720 1.00 23.12  ? 566 SER B N   1 
ATOM   9492  C  CA  . SER B 1 566 ? 95.671  82.082  103.573 1.00 23.12  ? 566 SER B CA  1 
ATOM   9493  C  C   . SER B 1 566 ? 96.562  82.983  104.409 1.00 23.12  ? 566 SER B C   1 
ATOM   9494  O  O   . SER B 1 566 ? 97.129  82.511  105.393 1.00 23.12  ? 566 SER B O   1 
ATOM   9495  C  CB  . SER B 1 566 ? 96.542  81.175  102.738 1.00 23.12  ? 566 SER B CB  1 
ATOM   9496  O  OG  . SER B 1 566 ? 97.292  81.942  101.830 1.00 23.12  ? 566 SER B OG  1 
ATOM   9497  N  N   . VAL B 1 567 ? 96.729  84.245  104.037 1.00 24.26  ? 567 VAL B N   1 
ATOM   9498  C  CA  . VAL B 1 567 ? 97.451  85.170  104.901 1.00 24.26  ? 567 VAL B CA  1 
ATOM   9499  C  C   . VAL B 1 567 ? 96.673  85.410  106.183 1.00 24.26  ? 567 VAL B C   1 
ATOM   9500  O  O   . VAL B 1 567 ? 97.225  85.320  107.286 1.00 24.26  ? 567 VAL B O   1 
ATOM   9501  C  CB  . VAL B 1 567 ? 97.758  86.478  104.166 1.00 24.26  ? 567 VAL B CB  1 
ATOM   9502  C  CG1 . VAL B 1 567 ? 98.150  87.543  105.134 1.00 24.26  ? 567 VAL B CG1 1 
ATOM   9503  C  CG2 . VAL B 1 567 ? 98.905  86.252  103.264 1.00 24.26  ? 567 VAL B CG2 1 
ATOM   9504  N  N   . VAL B 1 568 ? 95.378  85.707  106.057 1.00 22.92  ? 568 VAL B N   1 
ATOM   9505  C  CA  . VAL B 1 568 ? 94.541  85.958  107.226 1.00 22.92  ? 568 VAL B CA  1 
ATOM   9506  C  C   . VAL B 1 568 ? 94.401  84.716  108.098 1.00 22.92  ? 568 VAL B C   1 
ATOM   9507  O  O   . VAL B 1 568 ? 94.442  84.806  109.330 1.00 22.92  ? 568 VAL B O   1 
ATOM   9508  C  CB  . VAL B 1 568 ? 93.167  86.458  106.762 1.00 22.92  ? 568 VAL B CB  1 
ATOM   9509  C  CG1 . VAL B 1 568 ? 92.330  86.840  107.932 1.00 22.92  ? 568 VAL B CG1 1 
ATOM   9510  C  CG2 . VAL B 1 568 ? 93.334  87.617  105.836 1.00 22.92  ? 568 VAL B CG2 1 
ATOM   9511  N  N   . THR B 1 569 ? 94.259  83.542  107.489 1.00 28.96  ? 569 THR B N   1 
ATOM   9512  C  CA  . THR B 1 569 ? 94.107  82.335  108.291 1.00 28.96  ? 569 THR B CA  1 
ATOM   9513  C  C   . THR B 1 569 ? 95.403  81.948  108.987 1.00 28.96  ? 569 THR B C   1 
ATOM   9514  O  O   . THR B 1 569 ? 95.385  81.563  110.158 1.00 28.96  ? 569 THR B O   1 
ATOM   9515  C  CB  . THR B 1 569 ? 93.590  81.206  107.425 1.00 28.96  ? 569 THR B CB  1 
ATOM   9516  O  OG1 . THR B 1 569 ? 92.356  81.618  106.839 1.00 28.96  ? 569 THR B OG1 1 
ATOM   9517  C  CG2 . THR B 1 569 ? 93.316  79.995  108.253 1.00 28.96  ? 569 THR B CG2 1 
ATOM   9518  N  N   . ASN B 1 570 ? 96.538  82.088  108.309 1.00 32.07  ? 570 ASN B N   1 
ATOM   9519  C  CA  . ASN B 1 570 ? 97.811  81.774  108.947 1.00 32.07  ? 570 ASN B CA  1 
ATOM   9520  C  C   . ASN B 1 570 ? 98.154  82.763  110.047 1.00 32.07  ? 570 ASN B C   1 
ATOM   9521  O  O   . ASN B 1 570 ? 98.747  82.382  111.061 1.00 32.07  ? 570 ASN B O   1 
ATOM   9522  C  CB  . ASN B 1 570 ? 98.935  81.698  107.939 1.00 32.07  ? 570 ASN B CB  1 
ATOM   9523  C  CG  . ASN B 1 570 ? 99.075  80.337  107.378 1.00 32.07  ? 570 ASN B CG  1 
ATOM   9524  O  OD1 . ASN B 1 570 ? 98.428  79.409  107.837 1.00 32.07  ? 570 ASN B OD1 1 
ATOM   9525  N  ND2 . ASN B 1 570 ? 99.950  80.186  106.403 1.00 32.07  ? 570 ASN B ND2 1 
ATOM   9526  N  N   . CYS B 1 571 ? 97.804  84.032  109.868 1.00 35.40  ? 571 CYS B N   1 
ATOM   9527  C  CA  . CYS B 1 571 ? 98.091  84.996  110.917 1.00 35.40  ? 571 CYS B CA  1 
ATOM   9528  C  C   . CYS B 1 571 ? 97.171  84.786  112.106 1.00 35.40  ? 571 CYS B C   1 
ATOM   9529  O  O   . CYS B 1 571 ? 97.580  85.007  113.247 1.00 35.40  ? 571 CYS B O   1 
ATOM   9530  C  CB  . CYS B 1 571 ? 97.975  86.414  110.377 1.00 35.40  ? 571 CYS B CB  1 
ATOM   9531  S  SG  . CYS B 1 571 ? 99.360  86.880  109.329 1.00 35.40  ? 571 CYS B SG  1 
ATOM   9532  N  N   . ALA B 1 572 ? 95.940  84.351  111.870 1.00 33.39  ? 572 ALA B N   1 
ATOM   9533  C  CA  . ALA B 1 572 ? 95.077  84.007  112.987 1.00 33.39  ? 572 ALA B CA  1 
ATOM   9534  C  C   . ALA B 1 572 ? 95.532  82.747  113.702 1.00 33.39  ? 572 ALA B C   1 
ATOM   9535  O  O   . ALA B 1 572 ? 95.243  82.584  114.886 1.00 33.39  ? 572 ALA B O   1 
ATOM   9536  C  CB  . ALA B 1 572 ? 93.644  83.830  112.511 1.00 33.39  ? 572 ALA B CB  1 
ATOM   9537  N  N   . LEU B 1 573 ? 96.243  81.863  113.030 1.00 38.20  ? 573 LEU B N   1 
ATOM   9538  C  CA  . LEU B 1 573 ? 96.837  80.730  113.716 1.00 38.20  ? 573 LEU B CA  1 
ATOM   9539  C  C   . LEU B 1 573 ? 98.142  81.073  114.402 1.00 38.20  ? 573 LEU B C   1 
ATOM   9540  O  O   . LEU B 1 573 ? 98.539  80.360  115.326 1.00 38.20  ? 573 LEU B O   1 
ATOM   9541  C  CB  . LEU B 1 573 ? 97.039  79.550  112.777 1.00 38.20  ? 573 LEU B CB  1 
ATOM   9542  C  CG  . LEU B 1 573 ? 95.688  78.899  112.518 1.00 38.20  ? 573 LEU B CG  1 
ATOM   9543  C  CD1 . LEU B 1 573 ? 95.789  77.840  111.472 1.00 38.20  ? 573 LEU B CD1 1 
ATOM   9544  C  CD2 . LEU B 1 573 ? 95.165  78.309  113.779 1.00 38.20  ? 573 LEU B CD2 1 
ATOM   9545  N  N   . ILE B 1 574 ? 98.819  82.133  113.978 1.00 40.80  ? 574 ILE B N   1 
ATOM   9546  C  CA  . ILE B 1 574 ? 99.976  82.601  114.727 1.00 40.80  ? 574 ILE B CA  1 
ATOM   9547  C  C   . ILE B 1 574 ? 99.535  83.170  116.063 1.00 40.80  ? 574 ILE B C   1 
ATOM   9548  O  O   . ILE B 1 574 ? 100.080 82.822  117.115 1.00 40.80  ? 574 ILE B O   1 
ATOM   9549  C  CB  . ILE B 1 574 ? 100.753 83.638  113.906 1.00 40.80  ? 574 ILE B CB  1 
ATOM   9550  C  CG1 . ILE B 1 574 ? 101.521 82.950  112.797 1.00 40.80  ? 574 ILE B CG1 1 
ATOM   9551  C  CG2 . ILE B 1 574 ? 101.699 84.424  114.774 1.00 40.80  ? 574 ILE B CG2 1 
ATOM   9552  C  CD1 . ILE B 1 574 ? 101.995 83.907  111.762 1.00 40.80  ? 574 ILE B CD1 1 
ATOM   9553  N  N   . GLY B 1 575 ? 98.491  83.986  116.058 1.00 45.68  ? 575 GLY B N   1 
ATOM   9554  C  CA  . GLY B 1 575 ? 98.027  84.604  117.281 1.00 45.68  ? 575 GLY B CA  1 
ATOM   9555  C  C   . GLY B 1 575 ? 97.215  83.724  118.208 1.00 45.68  ? 575 GLY B C   1 
ATOM   9556  O  O   . GLY B 1 575 ? 96.433  84.231  119.015 1.00 45.68  ? 575 GLY B O   1 
ATOM   9557  N  N   . MET B 1 576 ? 97.354  82.410  118.090 1.00 54.16  ? 576 MET B N   1 
ATOM   9558  C  CA  . MET B 1 576 ? 96.731  81.496  119.021 1.00 54.16  ? 576 MET B CA  1 
ATOM   9559  C  C   . MET B 1 576 ? 97.663  80.425  119.542 1.00 54.16  ? 576 MET B C   1 
ATOM   9560  O  O   . MET B 1 576 ? 97.257  79.669  120.427 1.00 54.16  ? 576 MET B O   1 
ATOM   9561  C  CB  . MET B 1 576 ? 95.507  80.815  118.400 1.00 54.16  ? 576 MET B CB  1 
ATOM   9562  C  CG  . MET B 1 576 ? 94.321  81.731  118.233 1.00 54.16  ? 576 MET B CG  1 
ATOM   9563  S  SD  . MET B 1 576 ? 92.871  80.876  117.613 1.00 54.16  ? 576 MET B SD  1 
ATOM   9564  C  CE  . MET B 1 576 ? 91.750  82.259  117.473 1.00 54.16  ? 576 MET B CE  1 
ATOM   9565  N  N   . SER B 1 577 ? 98.876  80.332  119.039 1.00 58.41  ? 577 SER B N   1 
ATOM   9566  C  CA  . SER B 1 577 ? 99.772  79.285  119.486 1.00 58.41  ? 577 SER B CA  1 
ATOM   9567  C  C   . SER B 1 577 ? 100.325 79.609  120.871 1.00 58.41  ? 577 SER B C   1 
ATOM   9568  O  O   . SER B 1 577 ? 100.380 80.773  121.271 1.00 58.41  ? 577 SER B O   1 
ATOM   9569  C  CB  . SER B 1 577 ? 100.897 79.118  118.475 1.00 58.41  ? 577 SER B CB  1 
ATOM   9570  O  OG  . SER B 1 577 ? 101.407 80.377  118.087 1.00 58.41  ? 577 SER B OG  1 
ATOM   9571  N  N   . PRO B 1 578 ? 100.748 78.596  121.631 1.00 61.20  ? 578 PRO B N   1 
ATOM   9572  C  CA  . PRO B 1 578 ? 101.417 78.876  122.905 1.00 61.20  ? 578 PRO B CA  1 
ATOM   9573  C  C   . PRO B 1 578 ? 102.819 79.413  122.762 1.00 61.20  ? 578 PRO B C   1 
ATOM   9574  O  O   . PRO B 1 578 ? 103.390 79.842  123.768 1.00 61.20  ? 578 PRO B O   1 
ATOM   9575  C  CB  . PRO B 1 578 ? 101.429 77.516  123.601 1.00 61.20  ? 578 PRO B CB  1 
ATOM   9576  C  CG  . PRO B 1 578 ? 101.330 76.546  122.506 1.00 61.20  ? 578 PRO B CG  1 
ATOM   9577  C  CD  . PRO B 1 578 ? 100.449 77.165  121.486 1.00 61.20  ? 578 PRO B CD  1 
ATOM   9578  N  N   . GLN B 1 579 ? 103.404 79.408  121.571 1.00 72.43  ? 579 GLN B N   1 
ATOM   9579  C  CA  . GLN B 1 579 ? 104.746 79.957  121.450 1.00 72.43  ? 579 GLN B CA  1 
ATOM   9580  C  C   . GLN B 1 579 ? 104.699 81.472  121.422 1.00 72.43  ? 579 GLN B C   1 
ATOM   9581  O  O   . GLN B 1 579 ? 105.485 82.134  122.107 1.00 72.43  ? 579 GLN B O   1 
ATOM   9582  C  CB  . GLN B 1 579 ? 105.451 79.439  120.201 1.00 72.43  ? 579 GLN B CB  1 
ATOM   9583  C  CG  . GLN B 1 579 ? 105.166 78.011  119.847 1.00 72.43  ? 579 GLN B CG  1 
ATOM   9584  C  CD  . GLN B 1 579 ? 106.139 77.066  120.505 1.00 72.43  ? 579 GLN B CD  1 
ATOM   9585  O  OE1 . GLN B 1 579 ? 105.756 76.018  121.023 1.00 72.43  ? 579 GLN B OE1 1 
ATOM   9586  N  NE2 . GLN B 1 579 ? 107.415 77.425  120.475 1.00 72.43  ? 579 GLN B NE2 1 
ATOM   9587  N  N   . VAL B 1 580 ? 103.770 82.033  120.661 1.00 68.14  ? 580 VAL B N   1 
ATOM   9588  C  CA  . VAL B 1 580 ? 103.707 83.476  120.512 1.00 68.14  ? 580 VAL B CA  1 
ATOM   9589  C  C   . VAL B 1 580 ? 103.039 84.128  121.715 1.00 68.14  ? 580 VAL B C   1 
ATOM   9590  O  O   . VAL B 1 580 ? 103.386 85.255  122.080 1.00 68.14  ? 580 VAL B O   1 
ATOM   9591  C  CB  . VAL B 1 580 ? 102.981 83.806  119.201 1.00 68.14  ? 580 VAL B CB  1 
ATOM   9592  C  CG1 . VAL B 1 580 ? 103.009 85.290  118.904 1.00 68.14  ? 580 VAL B CG1 1 
ATOM   9593  C  CG2 . VAL B 1 580 ? 103.606 83.030  118.074 1.00 68.14  ? 580 VAL B CG2 1 
ATOM   9594  N  N   . ASN B 1 581 ? 102.128 83.425  122.386 1.00 73.61  ? 581 ASN B N   1 
ATOM   9595  C  CA  . ASN B 1 581 ? 101.489 84.000  123.561 1.00 73.61  ? 581 ASN B CA  1 
ATOM   9596  C  C   . ASN B 1 581 ? 102.442 84.107  124.743 1.00 73.61  ? 581 ASN B C   1 
ATOM   9597  O  O   . ASN B 1 581 ? 102.164 84.855  125.683 1.00 73.61  ? 581 ASN B O   1 
ATOM   9598  C  CB  . ASN B 1 581 ? 100.293 83.154  123.959 1.00 73.61  ? 581 ASN B CB  1 
ATOM   9599  C  CG  . ASN B 1 581 ? 99.086  83.451  123.124 1.00 73.61  ? 581 ASN B CG  1 
ATOM   9600  O  OD1 . ASN B 1 581 ? 98.260  84.287  123.478 1.00 73.61  ? 581 ASN B OD1 1 
ATOM   9601  N  ND2 . ASN B 1 581 ? 98.967  82.759  122.000 1.00 73.61  ? 581 ASN B ND2 1 
ATOM   9602  N  N   . ALA B 1 582 ? 103.558 83.377  124.712 1.00 74.78  ? 582 ALA B N   1 
ATOM   9603  C  CA  . ALA B 1 582 ? 104.595 83.521  125.722 1.00 74.78  ? 582 ALA B CA  1 
ATOM   9604  C  C   . ALA B 1 582 ? 105.397 84.799  125.551 1.00 74.78  ? 582 ALA B C   1 
ATOM   9605  O  O   . ALA B 1 582 ? 106.083 85.214  126.490 1.00 74.78  ? 582 ALA B O   1 
ATOM   9606  C  CB  . ALA B 1 582 ? 105.536 82.319  125.687 1.00 74.78  ? 582 ALA B CB  1 
ATOM   9607  N  N   . VAL B 1 583 ? 105.333 85.429  124.381 1.00 76.21  ? 583 VAL B N   1 
ATOM   9608  C  CA  . VAL B 1 583 ? 106.031 86.692  124.184 1.00 76.21  ? 583 VAL B CA  1 
ATOM   9609  C  C   . VAL B 1 583 ? 105.314 87.837  124.889 1.00 76.21  ? 583 VAL B C   1 
ATOM   9610  O  O   . VAL B 1 583 ? 105.951 88.666  125.546 1.00 76.21  ? 583 VAL B O   1 
ATOM   9611  C  CB  . VAL B 1 583 ? 106.201 86.953  122.678 1.00 76.21  ? 583 VAL B CB  1 
ATOM   9612  C  CG1 . VAL B 1 583 ? 106.817 88.306  122.428 1.00 76.21  ? 583 VAL B CG1 1 
ATOM   9613  C  CG2 . VAL B 1 583 ? 107.054 85.865  122.058 1.00 76.21  ? 583 VAL B CG2 1 
ATOM   9614  N  N   . PHE B 1 584 ? 103.985 87.892  124.802 1.00 78.81  ? 584 PHE B N   1 
ATOM   9615  C  CA  . PHE B 1 584 ? 103.189 88.945  125.432 1.00 78.81  ? 584 PHE B CA  1 
ATOM   9616  C  C   . PHE B 1 584 ? 102.244 88.330  126.455 1.00 78.81  ? 584 PHE B C   1 
ATOM   9617  O  O   . PHE B 1 584 ? 101.061 88.111  126.162 1.00 78.81  ? 584 PHE B O   1 
ATOM   9618  C  CB  . PHE B 1 584 ? 102.398 89.759  124.414 1.00 78.81  ? 584 PHE B CB  1 
ATOM   9619  C  CG  . PHE B 1 584 ? 103.141 90.055  123.156 1.00 78.81  ? 584 PHE B CG  1 
ATOM   9620  C  CD1 . PHE B 1 584 ? 102.951 89.284  122.028 1.00 78.81  ? 584 PHE B CD1 1 
ATOM   9621  C  CD2 . PHE B 1 584 ? 104.010 91.126  123.093 1.00 78.81  ? 584 PHE B CD2 1 
ATOM   9622  C  CE1 . PHE B 1 584 ? 103.624 89.566  120.861 1.00 78.81  ? 584 PHE B CE1 1 
ATOM   9623  C  CE2 . PHE B 1 584 ? 104.688 91.414  121.930 1.00 78.81  ? 584 PHE B CE2 1 
ATOM   9624  C  CZ  . PHE B 1 584 ? 104.495 90.630  120.811 1.00 78.81  ? 584 PHE B CZ  1 
ATOM   9625  N  N   . PRO B 1 585 ? 102.721 88.045  127.663 1.00 87.05  ? 585 PRO B N   1 
ATOM   9626  C  CA  . PRO B 1 585 ? 101.879 87.334  128.632 1.00 87.05  ? 585 PRO B CA  1 
ATOM   9627  C  C   . PRO B 1 585 ? 100.840 88.235  129.281 1.00 87.05  ? 585 PRO B C   1 
ATOM   9628  O  O   . PRO B 1 585 ? 99.725  87.793  129.570 1.00 87.05  ? 585 PRO B O   1 
ATOM   9629  C  CB  . PRO B 1 585 ? 102.889 86.815  129.667 1.00 87.05  ? 585 PRO B CB  1 
ATOM   9630  C  CG  . PRO B 1 585 ? 104.263 87.153  129.118 1.00 87.05  ? 585 PRO B CG  1 
ATOM   9631  C  CD  . PRO B 1 585 ? 104.061 88.308  128.207 1.00 87.05  ? 585 PRO B CD  1 
ATOM   9632  N  N   . GLU B 1 586 ? 101.192 89.495  129.522 1.00 98.61  ? 586 GLU B N   1 
ATOM   9633  C  CA  . GLU B 1 586 ? 100.303 90.391  130.249 1.00 98.61  ? 586 GLU B CA  1 
ATOM   9634  C  C   . GLU B 1 586 ? 99.509  91.314  129.339 1.00 98.61  ? 586 GLU B C   1 
ATOM   9635  O  O   . GLU B 1 586 ? 98.337  91.590  129.615 1.00 98.61  ? 586 GLU B O   1 
ATOM   9636  C  CB  . GLU B 1 586 ? 101.107 91.236  131.237 1.00 98.61  ? 586 GLU B CB  1 
ATOM   9637  N  N   . SER B 1 587 ? 100.115 91.792  128.257 1.00 96.40  ? 587 SER B N   1 
ATOM   9638  C  CA  . SER B 1 587 ? 99.496  92.771  127.363 1.00 96.40  ? 587 SER B CA  1 
ATOM   9639  C  C   . SER B 1 587 ? 99.030  92.068  126.090 1.00 96.40  ? 587 SER B C   1 
ATOM   9640  O  O   . SER B 1 587 ? 99.783  91.930  125.128 1.00 96.40  ? 587 SER B O   1 
ATOM   9641  C  CB  . SER B 1 587 ? 100.476 93.892  127.049 1.00 96.40  ? 587 SER B CB  1 
ATOM   9642  O  OG  . SER B 1 587 ? 101.520 93.421  126.219 1.00 96.40  ? 587 SER B OG  1 
ATOM   9643  N  N   . LYS B 1 588 ? 97.770  91.646  126.082 1.00 82.85  ? 588 LYS B N   1 
ATOM   9644  C  CA  . LYS B 1 588 ? 97.166  91.027  124.914 1.00 82.85  ? 588 LYS B CA  1 
ATOM   9645  C  C   . LYS B 1 588 ? 96.573  92.028  123.947 1.00 82.85  ? 588 LYS B C   1 
ATOM   9646  O  O   . LYS B 1 588 ? 95.846  91.630  123.036 1.00 82.85  ? 588 LYS B O   1 
ATOM   9647  C  CB  . LYS B 1 588 ? 96.094  90.028  125.329 1.00 82.85  ? 588 LYS B CB  1 
ATOM   9648  C  CG  . LYS B 1 588 ? 96.581  88.993  126.293 1.00 82.85  ? 588 LYS B CG  1 
ATOM   9649  C  CD  . LYS B 1 588 ? 97.701  88.201  125.666 1.00 82.85  ? 588 LYS B CD  1 
ATOM   9650  C  CE  . LYS B 1 588 ? 98.031  86.991  126.498 1.00 82.85  ? 588 LYS B CE  1 
ATOM   9651  N  NZ  . LYS B 1 588 ? 99.283  86.358  126.009 1.00 82.85  ? 588 LYS B NZ  1 
ATOM   9652  N  N   . ALA B 1 589 ? 96.833  93.312  124.129 1.00 78.08  ? 589 ALA B N   1 
ATOM   9653  C  CA  . ALA B 1 589 ? 96.374  94.298  123.169 1.00 78.08  ? 589 ALA B CA  1 
ATOM   9654  C  C   . ALA B 1 589 ? 97.453  94.690  122.174 1.00 78.08  ? 589 ALA B C   1 
ATOM   9655  O  O   . ALA B 1 589 ? 97.136  95.289  121.144 1.00 78.08  ? 589 ALA B O   1 
ATOM   9656  C  CB  . ALA B 1 589 ? 95.861  95.547  123.892 1.00 78.08  ? 589 ALA B CB  1 
ATOM   9657  N  N   . ASP B 1 590 ? 98.707  94.379  122.454 1.00 74.78  ? 590 ASP B N   1 
ATOM   9658  C  CA  . ASP B 1 590 ? 99.771  94.598  121.490 1.00 74.78  ? 590 ASP B CA  1 
ATOM   9659  C  C   . ASP B 1 590 ? 100.044 93.387  120.617 1.00 74.78  ? 590 ASP B C   1 
ATOM   9660  O  O   . ASP B 1 590 ? 100.603 93.545  119.526 1.00 74.78  ? 590 ASP B O   1 
ATOM   9661  C  CB  . ASP B 1 590 ? 101.045 95.039  122.201 1.00 74.78  ? 590 ASP B CB  1 
ATOM   9662  C  CG  . ASP B 1 590 ? 100.891 96.392  122.852 1.00 74.78  ? 590 ASP B CG  1 
ATOM   9663  O  OD1 . ASP B 1 590 ? 99.773  96.943  122.792 1.00 74.78  ? 590 ASP B OD1 1 
ATOM   9664  O  OD2 . ASP B 1 590 ? 101.883 96.915  123.401 1.00 74.78  ? 590 ASP B OD2 1 
ATOM   9665  N  N   . LEU B 1 591 ? 99.681  92.189  121.075 1.00 60.11  ? 591 LEU B N   1 
ATOM   9666  C  CA  . LEU B 1 591 ? 99.853  90.997  120.255 1.00 60.11  ? 591 LEU B CA  1 
ATOM   9667  C  C   . LEU B 1 591 ? 98.966  91.047  119.025 1.00 60.11  ? 591 LEU B C   1 
ATOM   9668  O  O   . LEU B 1 591 ? 99.408  90.709  117.922 1.00 60.11  ? 591 LEU B O   1 
ATOM   9669  C  CB  . LEU B 1 591 ? 99.540  89.755  121.076 1.00 60.11  ? 591 LEU B CB  1 
ATOM   9670  C  CG  . LEU B 1 591 ? 99.158  88.501  120.301 1.00 60.11  ? 591 LEU B CG  1 
ATOM   9671  C  CD1 . LEU B 1 591 ? 100.375 87.906  119.634 1.00 60.11  ? 591 LEU B CD1 1 
ATOM   9672  C  CD2 . LEU B 1 591 ? 98.499  87.499  121.212 1.00 60.11  ? 591 LEU B CD2 1 
ATOM   9673  N  N   . ILE B 1 592 ? 97.720  91.484  119.192 1.00 53.07  ? 592 ILE B N   1 
ATOM   9674  C  CA  . ILE B 1 592 ? 96.811  91.590  118.060 1.00 53.07  ? 592 ILE B CA  1 
ATOM   9675  C  C   . ILE B 1 592 ? 97.294  92.650  117.083 1.00 53.07  ? 592 ILE B C   1 
ATOM   9676  O  O   . ILE B 1 592 ? 97.211  92.464  115.867 1.00 53.07  ? 592 ILE B O   1 
ATOM   9677  C  CB  . ILE B 1 592 ? 95.388  91.871  118.553 1.00 53.07  ? 592 ILE B CB  1 
ATOM   9678  C  CG1 . ILE B 1 592 ? 94.993  90.815  119.570 1.00 53.07  ? 592 ILE B CG1 1 
ATOM   9679  C  CG2 . ILE B 1 592 ? 94.422  91.834  117.416 1.00 53.07  ? 592 ILE B CG2 1 
ATOM   9680  C  CD1 . ILE B 1 592 ? 93.648  91.049  120.184 1.00 53.07  ? 592 ILE B CD1 1 
ATOM   9681  N  N   . LEU B 1 593 ? 97.853  93.748  117.590 1.00 48.35  ? 593 LEU B N   1 
ATOM   9682  C  CA  . LEU B 1 593 ? 98.361  94.786  116.701 1.00 48.35  ? 593 LEU B CA  1 
ATOM   9683  C  C   . LEU B 1 593 ? 99.589  94.326  115.935 1.00 48.35  ? 593 LEU B C   1 
ATOM   9684  O  O   . LEU B 1 593 ? 99.742  94.661  114.757 1.00 48.35  ? 593 LEU B O   1 
ATOM   9685  C  CB  . LEU B 1 593 ? 98.671  96.049  117.482 1.00 48.35  ? 593 LEU B CB  1 
ATOM   9686  C  CG  . LEU B 1 593 ? 97.444  96.916  117.653 1.00 48.35  ? 593 LEU B CG  1 
ATOM   9687  C  CD1 . LEU B 1 593 ? 97.796  98.138  118.449 1.00 48.35  ? 593 LEU B CD1 1 
ATOM   9688  C  CD2 . LEU B 1 593 ? 96.986  97.315  116.281 1.00 48.35  ? 593 LEU B CD2 1 
ATOM   9689  N  N   . ILE B 1 594 ? 100.477 93.569  116.579 1.00 44.08  ? 594 ILE B N   1 
ATOM   9690  C  CA  . ILE B 1 594 ? 101.659 93.085  115.879 1.00 44.08  ? 594 ILE B CA  1 
ATOM   9691  C  C   . ILE B 1 594 ? 101.278 92.022  114.858 1.00 44.08  ? 594 ILE B C   1 
ATOM   9692  O  O   . ILE B 1 594 ? 101.827 91.993  113.750 1.00 44.08  ? 594 ILE B O   1 
ATOM   9693  C  CB  . ILE B 1 594 ? 102.700 92.614  116.901 1.00 44.08  ? 594 ILE B CB  1 
ATOM   9694  C  CG1 . ILE B 1 594 ? 103.357 93.844  117.515 1.00 44.08  ? 594 ILE B CG1 1 
ATOM   9695  C  CG2 . ILE B 1 594 ? 103.762 91.747  116.273 1.00 44.08  ? 594 ILE B CG2 1 
ATOM   9696  C  CD1 . ILE B 1 594 ? 104.353 93.532  118.591 1.00 44.08  ? 594 ILE B CD1 1 
ATOM   9697  N  N   . VAL B 1 595 ? 100.303 91.176  115.179 1.00 37.43  ? 595 VAL B N   1 
ATOM   9698  C  CA  . VAL B 1 595 ? 99.855  90.162  114.232 1.00 37.43  ? 595 VAL B CA  1 
ATOM   9699  C  C   . VAL B 1 595 ? 99.146  90.815  113.051 1.00 37.43  ? 595 VAL B C   1 
ATOM   9700  O  O   . VAL B 1 595 ? 99.368  90.438  111.895 1.00 37.43  ? 595 VAL B O   1 
ATOM   9701  C  CB  . VAL B 1 595 ? 98.965  89.137  114.951 1.00 37.43  ? 595 VAL B CB  1 
ATOM   9702  C  CG1 . VAL B 1 595 ? 98.124  88.340  113.976 1.00 37.43  ? 595 VAL B CG1 1 
ATOM   9703  C  CG2 . VAL B 1 595 ? 99.830  88.201  115.747 1.00 37.43  ? 595 VAL B CG2 1 
ATOM   9704  N  N   . VAL B 1 596 ? 98.359  91.860  113.314 1.00 31.48  ? 596 VAL B N   1 
ATOM   9705  C  CA  . VAL B 1 596 ? 97.686  92.579  112.239 1.00 31.48  ? 596 VAL B CA  1 
ATOM   9706  C  C   . VAL B 1 596 ? 98.696  93.338  111.391 1.00 31.48  ? 596 VAL B C   1 
ATOM   9707  O  O   . VAL B 1 596 ? 98.555  93.404  110.163 1.00 31.48  ? 596 VAL B O   1 
ATOM   9708  C  CB  . VAL B 1 596 ? 96.597  93.486  112.843 1.00 31.48  ? 596 VAL B CB  1 
ATOM   9709  C  CG1 . VAL B 1 596 ? 96.189  94.600  111.923 1.00 31.48  ? 596 VAL B CG1 1 
ATOM   9710  C  CG2 . VAL B 1 596 ? 95.386  92.659  113.151 1.00 31.48  ? 596 VAL B CG2 1 
ATOM   9711  N  N   . ALA B 1 597 ? 99.774  93.829  112.000 1.00 32.24  ? 597 ALA B N   1 
ATOM   9712  C  CA  . ALA B 1 597 ? 100.817 94.481  111.217 1.00 32.24  ? 597 ALA B CA  1 
ATOM   9713  C  C   . ALA B 1 597 ? 101.550 93.479  110.339 1.00 32.24  ? 597 ALA B C   1 
ATOM   9714  O  O   . ALA B 1 597 ? 101.892 93.795  109.198 1.00 32.24  ? 597 ALA B O   1 
ATOM   9715  C  CB  . ALA B 1 597 ? 101.800 95.206  112.125 1.00 32.24  ? 597 ALA B CB  1 
ATOM   9716  N  N   . VAL B 1 598 ? 101.800 92.271  110.849 1.00 29.09  ? 598 VAL B N   1 
ATOM   9717  C  CA  . VAL B 1 598 ? 102.415 91.230  110.028 1.00 29.09  ? 598 VAL B CA  1 
ATOM   9718  C  C   . VAL B 1 598 ? 101.453 90.806  108.928 1.00 29.09  ? 598 VAL B C   1 
ATOM   9719  O  O   . VAL B 1 598 ? 101.854 90.577  107.781 1.00 29.09  ? 598 VAL B O   1 
ATOM   9720  C  CB  . VAL B 1 598 ? 102.855 90.050  110.913 1.00 29.09  ? 598 VAL B CB  1 
ATOM   9721  C  CG1 . VAL B 1 598 ? 103.118 88.807  110.107 1.00 29.09  ? 598 VAL B CG1 1 
ATOM   9722  C  CG2 . VAL B 1 598 ? 104.101 90.420  111.654 1.00 29.09  ? 598 VAL B CG2 1 
ATOM   9723  N  N   . GLU B 1 599 ? 100.161 90.777  109.244 1.00 25.69  ? 599 GLU B N   1 
ATOM   9724  C  CA  . GLU B 1 599 ? 99.157  90.420  108.254 1.00 25.69  ? 599 GLU B CA  1 
ATOM   9725  C  C   . GLU B 1 599 ? 99.041  91.458  107.154 1.00 25.69  ? 599 GLU B C   1 
ATOM   9726  O  O   . GLU B 1 599 ? 98.969  91.109  105.973 1.00 25.69  ? 599 GLU B O   1 
ATOM   9727  C  CB  . GLU B 1 599 ? 97.814  90.286  108.956 1.00 25.69  ? 599 GLU B CB  1 
ATOM   9728  C  CG  . GLU B 1 599 ? 96.659  89.948  108.070 1.00 25.69  ? 599 GLU B CG  1 
ATOM   9729  C  CD  . GLU B 1 599 ? 95.788  91.167  107.823 1.00 25.69  ? 599 GLU B CD  1 
ATOM   9730  O  OE1 . GLU B 1 599 ? 95.747  92.055  108.692 1.00 25.69  ? 599 GLU B OE1 1 
ATOM   9731  O  OE2 . GLU B 1 599 ? 95.140  91.243  106.765 1.00 25.69  ? 599 GLU B OE2 1 
ATOM   9732  N  N   . HIS B 1 600 ? 99.016  92.732  107.512 1.00 23.62  ? 600 HIS B N   1 
ATOM   9733  C  CA  . HIS B 1 600 ? 98.968  93.751  106.477 1.00 23.62  ? 600 HIS B CA  1 
ATOM   9734  C  C   . HIS B 1 600 ? 100.285 93.881  105.727 1.00 23.62  ? 600 HIS B C   1 
ATOM   9735  O  O   . HIS B 1 600 ? 100.275 94.184  104.532 1.00 23.62  ? 600 HIS B O   1 
ATOM   9736  C  CB  . HIS B 1 600 ? 98.514  95.079  107.063 1.00 23.62  ? 600 HIS B CB  1 
ATOM   9737  C  CG  . HIS B 1 600 ? 97.039  95.143  107.288 1.00 23.62  ? 600 HIS B CG  1 
ATOM   9738  N  ND1 . HIS B 1 600 ? 96.479  95.669  108.429 1.00 23.62  ? 600 HIS B ND1 1 
ATOM   9739  C  CD2 . HIS B 1 600 ? 96.008  94.703  106.533 1.00 23.62  ? 600 HIS B CD2 1 
ATOM   9740  C  CE1 . HIS B 1 600 ? 95.165  95.573  108.356 1.00 23.62  ? 600 HIS B CE1 1 
ATOM   9741  N  NE2 . HIS B 1 600 ? 94.853  94.989  107.216 1.00 23.62  ? 600 HIS B NE2 1 
ATOM   9742  N  N   . ALA B 1 601 ? 101.420 93.665  106.393 1.00 21.85  ? 601 ALA B N   1 
ATOM   9743  C  CA  . ALA B 1 601 ? 102.684 93.704  105.667 1.00 21.85  ? 601 ALA B CA  1 
ATOM   9744  C  C   . ALA B 1 601 ? 102.818 92.553  104.688 1.00 21.85  ? 601 ALA B C   1 
ATOM   9745  O  O   . ALA B 1 601 ? 103.401 92.722  103.616 1.00 21.85  ? 601 ALA B O   1 
ATOM   9746  C  CB  . ALA B 1 601 ? 103.861 93.699  106.631 1.00 21.85  ? 601 ALA B CB  1 
ATOM   9747  N  N   . LEU B 1 602 ? 102.312 91.374  105.027 1.00 22.18  ? 602 LEU B N   1 
ATOM   9748  C  CA  . LEU B 1 602 ? 102.392 90.290  104.057 1.00 22.18  ? 602 LEU B CA  1 
ATOM   9749  C  C   . LEU B 1 602 ? 101.424 90.489  102.903 1.00 22.18  ? 602 LEU B C   1 
ATOM   9750  O  O   . LEU B 1 602 ? 101.762 90.177  101.762 1.00 22.18  ? 602 LEU B O   1 
ATOM   9751  C  CB  . LEU B 1 602 ? 102.176 88.935  104.711 1.00 22.18  ? 602 LEU B CB  1 
ATOM   9752  C  CG  . LEU B 1 602 ? 103.483 88.422  105.291 1.00 22.18  ? 602 LEU B CG  1 
ATOM   9753  C  CD1 . LEU B 1 602 ? 103.263 87.140  106.056 1.00 22.18  ? 602 LEU B CD1 1 
ATOM   9754  C  CD2 . LEU B 1 602 ? 104.468 88.219  104.174 1.00 22.18  ? 602 LEU B CD2 1 
ATOM   9755  N  N   . LEU B 1 603 ? 100.233 91.028  103.171 1.00 18.19  ? 603 LEU B N   1 
ATOM   9756  C  CA  . LEU B 1 603 ? 99.303  91.317  102.084 1.00 18.19  ? 603 LEU B CA  1 
ATOM   9757  C  C   . LEU B 1 603 ? 99.818  92.404  101.156 1.00 18.19  ? 603 LEU B C   1 
ATOM   9758  O  O   . LEU B 1 603 ? 99.655  92.301  99.937  1.00 18.19  ? 603 LEU B O   1 
ATOM   9759  C  CB  . LEU B 1 603 ? 97.951  91.737  102.638 1.00 18.19  ? 603 LEU B CB  1 
ATOM   9760  C  CG  . LEU B 1 603 ? 97.039  90.626  103.105 1.00 18.19  ? 603 LEU B CG  1 
ATOM   9761  C  CD1 . LEU B 1 603 ? 95.708  91.221  103.472 1.00 18.19  ? 603 LEU B CD1 1 
ATOM   9762  C  CD2 . LEU B 1 603 ? 96.896  89.620  102.011 1.00 18.19  ? 603 LEU B CD2 1 
ATOM   9763  N  N   . ALA B 1 604 ? 100.437 93.446  101.703 1.00 16.61  ? 604 ALA B N   1 
ATOM   9764  C  CA  . ALA B 1 604 ? 100.966 94.496  100.845 1.00 16.61  ? 604 ALA B CA  1 
ATOM   9765  C  C   . ALA B 1 604 ? 102.142 93.997  100.030 1.00 16.61  ? 604 ALA B C   1 
ATOM   9766  O  O   . ALA B 1 604 ? 102.267 94.330  98.849  1.00 16.61  ? 604 ALA B O   1 
ATOM   9767  C  CB  . ALA B 1 604 ? 101.370 95.706  101.672 1.00 16.61  ? 604 ALA B CB  1 
ATOM   9768  N  N   . LEU B 1 605 ? 103.018 93.210  100.645 1.00 16.95  ? 605 LEU B N   1 
ATOM   9769  C  CA  . LEU B 1 605 ? 104.160 92.666  99.926  1.00 16.95  ? 605 LEU B CA  1 
ATOM   9770  C  C   . LEU B 1 605 ? 103.742 91.615  98.905  1.00 16.95  ? 605 LEU B C   1 
ATOM   9771  O  O   . LEU B 1 605 ? 104.394 91.464  97.868  1.00 16.95  ? 605 LEU B O   1 
ATOM   9772  C  CB  . LEU B 1 605 ? 105.159 92.099  100.923 1.00 16.95  ? 605 LEU B CB  1 
ATOM   9773  C  CG  . LEU B 1 605 ? 106.413 91.419  100.410 1.00 16.95  ? 605 LEU B CG  1 
ATOM   9774  C  CD1 . LEU B 1 605 ? 107.142 92.375  99.513  1.00 16.95  ? 605 LEU B CD1 1 
ATOM   9775  C  CD2 . LEU B 1 605 ? 107.283 91.060  101.574 1.00 16.95  ? 605 LEU B CD2 1 
ATOM   9776  N  N   . LYS B 1 606 ? 102.673 90.878  99.177  1.00 17.99  ? 606 LYS B N   1 
ATOM   9777  C  CA  . LYS B 1 606 ? 102.179 89.916  98.200  1.00 17.99  ? 606 LYS B CA  1 
ATOM   9778  C  C   . LYS B 1 606 ? 101.584 90.580  96.966  1.00 17.99  ? 606 LYS B C   1 
ATOM   9779  O  O   . LYS B 1 606 ? 101.868 90.155  95.845  1.00 17.99  ? 606 LYS B O   1 
ATOM   9780  C  CB  . LYS B 1 606 ? 101.153 89.016  98.865  1.00 17.99  ? 606 LYS B CB  1 
ATOM   9781  C  CG  . LYS B 1 606 ? 100.308 88.195  97.970  1.00 17.99  ? 606 LYS B CG  1 
ATOM   9782  C  CD  . LYS B 1 606 ? 99.365  87.393  98.832  1.00 17.99  ? 606 LYS B CD  1 
ATOM   9783  C  CE  . LYS B 1 606 ? 100.108 86.467  99.766  1.00 17.99  ? 606 LYS B CE  1 
ATOM   9784  N  NZ  . LYS B 1 606 ? 100.614 85.280  99.083  1.00 17.99  ? 606 LYS B NZ  1 
ATOM   9785  N  N   . PHE B 1 607 ? 100.799 91.644  97.132  1.00 16.06  ? 607 PHE B N   1 
ATOM   9786  C  CA  . PHE B 1 607 ? 100.261 92.332  95.962  1.00 16.06  ? 607 PHE B CA  1 
ATOM   9787  C  C   . PHE B 1 607 ? 101.319 93.098  95.191  1.00 16.06  ? 607 PHE B C   1 
ATOM   9788  O  O   . PHE B 1 607 ? 101.211 93.221  93.970  1.00 16.06  ? 607 PHE B O   1 
ATOM   9789  C  CB  . PHE B 1 607 ? 99.126  93.263  96.350  1.00 16.06  ? 607 PHE B CB  1 
ATOM   9790  C  CG  . PHE B 1 607 ? 97.850  92.553  96.632  1.00 16.06  ? 607 PHE B CG  1 
ATOM   9791  C  CD1 . PHE B 1 607 ? 97.626  91.296  96.106  1.00 16.06  ? 607 PHE B CD1 1 
ATOM   9792  C  CD2 . PHE B 1 607 ? 96.856  93.154  97.383  1.00 16.06  ? 607 PHE B CD2 1 
ATOM   9793  C  CE1 . PHE B 1 607 ? 96.457  90.641  96.343  1.00 16.06  ? 607 PHE B CE1 1 
ATOM   9794  C  CE2 . PHE B 1 607 ? 95.675  92.503  97.626  1.00 16.06  ? 607 PHE B CE2 1 
ATOM   9795  C  CZ  . PHE B 1 607 ? 95.477  91.241  97.105  1.00 16.06  ? 607 PHE B CZ  1 
ATOM   9796  N  N   . ILE B 1 608 ? 102.346 93.600  95.867  1.00 13.57  ? 608 ILE B N   1 
ATOM   9797  C  CA  . ILE B 1 608 ? 103.439 94.260  95.166  1.00 13.57  ? 608 ILE B CA  1 
ATOM   9798  C  C   . ILE B 1 608 ? 104.222 93.250  94.346  1.00 13.57  ? 608 ILE B C   1 
ATOM   9799  O  O   . ILE B 1 608 ? 104.569 93.513  93.190  1.00 13.57  ? 608 ILE B O   1 
ATOM   9800  C  CB  . ILE B 1 608 ? 104.331 95.011  96.166  1.00 13.57  ? 608 ILE B CB  1 
ATOM   9801  C  CG1 . ILE B 1 608 ? 103.703 96.342  96.514  1.00 13.57  ? 608 ILE B CG1 1 
ATOM   9802  C  CG2 . ILE B 1 608 ? 105.703 95.254  95.628  1.00 13.57  ? 608 ILE B CG2 1 
ATOM   9803  C  CD1 . ILE B 1 608 ? 104.335 96.985  97.703  1.00 13.57  ? 608 ILE B CD1 1 
ATOM   9804  N  N   . LEU B 1 609 ? 104.397 92.042  94.879  1.00 15.95  ? 609 LEU B N   1 
ATOM   9805  C  CA  . LEU B 1 609 ? 105.062 90.982  94.130  1.00 15.95  ? 609 LEU B CA  1 
ATOM   9806  C  C   . LEU B 1 609 ? 104.254 90.535  92.923  1.00 15.95  ? 609 LEU B C   1 
ATOM   9807  O  O   . LEU B 1 609 ? 104.841 90.160  91.906  1.00 15.95  ? 609 LEU B O   1 
ATOM   9808  C  CB  . LEU B 1 609 ? 105.354 89.804  95.046  1.00 15.95  ? 609 LEU B CB  1 
ATOM   9809  C  CG  . LEU B 1 609 ? 106.792 89.821  95.528  1.00 15.95  ? 609 LEU B CG  1 
ATOM   9810  C  CD1 . LEU B 1 609 ? 107.012 88.684  96.461  1.00 15.95  ? 609 LEU B CD1 1 
ATOM   9811  C  CD2 . LEU B 1 609 ? 107.697 89.695  94.343  1.00 15.95  ? 609 LEU B CD2 1 
ATOM   9812  N  N   . ALA B 1 610 ? 102.931 90.530  93.009  1.00 16.01  ? 610 ALA B N   1 
ATOM   9813  C  CA  . ALA B 1 610 ? 102.151 90.171  91.836  1.00 16.01  ? 610 ALA B CA  1 
ATOM   9814  C  C   . ALA B 1 610 ? 102.143 91.303  90.819  1.00 16.01  ? 610 ALA B C   1 
ATOM   9815  O  O   . ALA B 1 610 ? 101.990 91.056  89.618  1.00 16.01  ? 610 ALA B O   1 
ATOM   9816  C  CB  . ALA B 1 610 ? 100.723 89.800  92.225  1.00 16.01  ? 610 ALA B CB  1 
ATOM   9817  N  N   . PHE B 1 611 ? 102.301 92.535  91.282  1.00 16.25  ? 611 PHE B N   1 
ATOM   9818  C  CA  . PHE B 1 611 ? 102.359 93.700  90.420  1.00 16.25  ? 611 PHE B CA  1 
ATOM   9819  C  C   . PHE B 1 611 ? 103.749 93.988  89.881  1.00 16.25  ? 611 PHE B C   1 
ATOM   9820  O  O   . PHE B 1 611 ? 103.867 94.622  88.832  1.00 16.25  ? 611 PHE B O   1 
ATOM   9821  C  CB  . PHE B 1 611 ? 101.867 94.902  91.222  1.00 16.25  ? 611 PHE B CB  1 
ATOM   9822  C  CG  . PHE B 1 611 ? 101.725 96.153  90.445  1.00 16.25  ? 611 PHE B CG  1 
ATOM   9823  C  CD1 . PHE B 1 611 ? 100.698 96.318  89.549  1.00 16.25  ? 611 PHE B CD1 1 
ATOM   9824  C  CD2 . PHE B 1 611 ? 102.630 97.181  90.630  1.00 16.25  ? 611 PHE B CD2 1 
ATOM   9825  C  CE1 . PHE B 1 611 ? 100.575 97.489  88.845  1.00 16.25  ? 611 PHE B CE1 1 
ATOM   9826  C  CE2 . PHE B 1 611 ? 102.521 98.346  89.937  1.00 16.25  ? 611 PHE B CE2 1 
ATOM   9827  C  CZ  . PHE B 1 611 ? 101.494 98.503  89.036  1.00 16.25  ? 611 PHE B CZ  1 
ATOM   9828  N  N   . ALA B 1 612 ? 104.803 93.538  90.552  1.00 17.12  ? 612 ALA B N   1 
ATOM   9829  C  CA  . ALA B 1 612 ? 106.145 93.889  90.101  1.00 17.12  ? 612 ALA B CA  1 
ATOM   9830  C  C   . ALA B 1 612 ? 106.619 92.970  88.987  1.00 17.12  ? 612 ALA B C   1 
ATOM   9831  O  O   . ALA B 1 612 ? 107.179 93.427  87.988  1.00 17.12  ? 612 ALA B O   1 
ATOM   9832  C  CB  . ALA B 1 612 ? 107.134 93.853  91.261  1.00 17.12  ? 612 ALA B CB  1 
ATOM   9833  N  N   . ILE B 1 613 ? 106.407 91.674  89.150  1.00 18.89  ? 613 ILE B N   1 
ATOM   9834  C  CA  . ILE B 1 613 ? 106.822 90.677  88.176  1.00 18.89  ? 613 ILE B CA  1 
ATOM   9835  C  C   . ILE B 1 613 ? 105.932 90.806  86.953  1.00 18.89  ? 613 ILE B C   1 
ATOM   9836  O  O   . ILE B 1 613 ? 104.700 90.757  87.072  1.00 18.89  ? 613 ILE B O   1 
ATOM   9837  C  CB  . ILE B 1 613 ? 106.751 89.270  88.765  1.00 18.89  ? 613 ILE B CB  1 
ATOM   9838  C  CG1 . ILE B 1 613 ? 107.453 89.246  90.107  1.00 18.89  ? 613 ILE B CG1 1 
ATOM   9839  C  CG2 . ILE B 1 613 ? 107.386 88.292  87.831  1.00 18.89  ? 613 ILE B CG2 1 
ATOM   9840  C  CD1 . ILE B 1 613 ? 107.311 87.950  90.807  1.00 18.89  ? 613 ILE B CD1 1 
ATOM   9841  N  N   . PRO B 1 614 ? 106.508 90.972  85.772  1.00 24.08  ? 614 PRO B N   1 
ATOM   9842  C  CA  . PRO B 1 614 ? 105.691 91.118  84.570  1.00 24.08  ? 614 PRO B CA  1 
ATOM   9843  C  C   . PRO B 1 614 ? 105.059 89.808  84.147  1.00 24.08  ? 614 PRO B C   1 
ATOM   9844  O  O   . PRO B 1 614 ? 105.572 88.719  84.411  1.00 24.08  ? 614 PRO B O   1 
ATOM   9845  C  CB  . PRO B 1 614 ? 106.692 91.620  83.528  1.00 24.08  ? 614 PRO B CB  1 
ATOM   9846  C  CG  . PRO B 1 614 ? 107.978 91.096  83.988  1.00 24.08  ? 614 PRO B CG  1 
ATOM   9847  C  CD  . PRO B 1 614 ? 107.939 91.113  85.481  1.00 24.08  ? 614 PRO B CD  1 
ATOM   9848  N  N   . ASP B 1 615 ? 103.912 89.942  83.486  1.00 33.69  ? 615 ASP B N   1 
ATOM   9849  C  CA  . ASP B 1 615 ? 103.074 88.808  83.128  1.00 33.69  ? 615 ASP B CA  1 
ATOM   9850  C  C   . ASP B 1 615 ? 103.672 87.997  81.993  1.00 33.69  ? 615 ASP B C   1 
ATOM   9851  O  O   . ASP B 1 615 ? 103.849 86.783  82.114  1.00 33.69  ? 615 ASP B O   1 
ATOM   9852  C  CB  . ASP B 1 615 ? 101.696 89.321  82.728  1.00 33.69  ? 615 ASP B CB  1 
ATOM   9853  C  CG  . ASP B 1 615 ? 101.065 90.172  83.802  1.00 33.69  ? 615 ASP B CG  1 
ATOM   9854  O  OD1 . ASP B 1 615 ? 101.734 90.419  84.834  1.00 33.69  ? 615 ASP B OD1 1 
ATOM   9855  O  OD2 . ASP B 1 615 ? 99.909  90.611  83.606  1.00 33.69  ? 615 ASP B OD2 1 
ATOM   9856  N  N   . LYS B 1 616 ? 104.008 88.641  80.918  1.00 36.28  ? 616 LYS B N   1 
ATOM   9857  C  CA  . LYS B 1 616 ? 104.708 87.957  79.852  1.00 36.28  ? 616 LYS B CA  1 
ATOM   9858  C  C   . LYS B 1 616 ? 106.199 87.969  80.155  1.00 36.28  ? 616 LYS B C   1 
ATOM   9859  O  O   . LYS B 1 616 ? 106.690 88.894  80.798  1.00 36.28  ? 616 LYS B O   1 
ATOM   9860  C  CB  . LYS B 1 616 ? 104.456 88.667  78.534  1.00 36.28  ? 616 LYS B CB  1 
ATOM   9861  C  CG  . LYS B 1 616 ? 102.992 88.819  78.159  1.00 36.28  ? 616 LYS B CG  1 
ATOM   9862  C  CD  . LYS B 1 616 ? 102.844 89.721  76.937  1.00 36.28  ? 616 LYS B CD  1 
ATOM   9863  C  CE  . LYS B 1 616 ? 101.425 90.209  76.769  1.00 36.28  ? 616 LYS B CE  1 
ATOM   9864  N  NZ  . LYS B 1 616 ? 100.450 89.122  77.000  1.00 36.28  ? 616 LYS B NZ  1 
ATOM   9865  N  N   . PRO B 1 617 ? 106.953 86.966  79.706  1.00 43.73  ? 617 PRO B N   1 
ATOM   9866  C  CA  . PRO B 1 617 ? 108.401 86.986  79.958  1.00 43.73  ? 617 PRO B CA  1 
ATOM   9867  C  C   . PRO B 1 617 ? 109.127 88.025  79.118  1.00 43.73  ? 617 PRO B C   1 
ATOM   9868  O  O   . PRO B 1 617 ? 108.483 88.801  78.407  1.00 43.73  ? 617 PRO B O   1 
ATOM   9869  C  CB  . PRO B 1 617 ? 108.842 85.564  79.608  1.00 43.73  ? 617 PRO B CB  1 
ATOM   9870  C  CG  . PRO B 1 617 ? 107.608 84.772  79.624  1.00 43.73  ? 617 PRO B CG  1 
ATOM   9871  C  CD  . PRO B 1 617 ? 106.515 85.671  79.185  1.00 43.73  ? 617 PRO B CD  1 
ATOM   9872  N  N   . ARG B 1 618 ? 110.456 88.072  79.173  1.00 48.61  ? 618 ARG B N   1 
ATOM   9873  C  CA  . ARG B 1 618 ? 111.119 89.126  78.416  1.00 48.61  ? 618 ARG B CA  1 
ATOM   9874  C  C   . ARG B 1 618 ? 111.136 88.872  76.910  1.00 48.61  ? 618 ARG B C   1 
ATOM   9875  O  O   . ARG B 1 618 ? 110.685 89.719  76.135  1.00 48.61  ? 618 ARG B O   1 
ATOM   9876  C  CB  . ARG B 1 618 ? 112.546 89.277  78.926  1.00 48.61  ? 618 ARG B CB  1 
ATOM   9877  C  CG  . ARG B 1 618 ? 113.282 90.505  78.448  1.00 48.61  ? 618 ARG B CG  1 
ATOM   9878  C  CD  . ARG B 1 618 ? 112.478 91.747  78.802  1.00 48.61  ? 618 ARG B CD  1 
ATOM   9879  N  NE  . ARG B 1 618 ? 113.225 92.980  78.567  1.00 48.61  ? 618 ARG B NE  1 
ATOM   9880  C  CZ  . ARG B 1 618 ? 112.738 94.198  78.779  1.00 48.61  ? 618 ARG B CZ  1 
ATOM   9881  N  NH1 . ARG B 1 618 ? 111.505 94.343  79.233  1.00 48.61  ? 618 ARG B NH1 1 
ATOM   9882  N  NH2 . ARG B 1 618 ? 113.482 95.269  78.549  1.00 48.61  ? 618 ARG B NH2 1 
ATOM   9883  N  N   . HIS B 1 619 ? 111.614 87.699  76.474  1.00 50.57  ? 619 HIS B N   1 
ATOM   9884  C  CA  . HIS B 1 619 ? 111.791 87.486  75.036  1.00 50.57  ? 619 HIS B CA  1 
ATOM   9885  C  C   . HIS B 1 619 ? 110.490 87.214  74.300  1.00 50.57  ? 619 HIS B C   1 
ATOM   9886  O  O   . HIS B 1 619 ? 110.384 87.528  73.111  1.00 50.57  ? 619 HIS B O   1 
ATOM   9887  C  CB  . HIS B 1 619 ? 112.793 86.381  74.736  1.00 50.57  ? 619 HIS B CB  1 
ATOM   9888  C  CG  . HIS B 1 619 ? 112.462 85.068  75.345  1.00 50.57  ? 619 HIS B CG  1 
ATOM   9889  N  ND1 . HIS B 1 619 ? 112.739 84.767  76.658  1.00 50.57  ? 619 HIS B ND1 1 
ATOM   9890  C  CD2 . HIS B 1 619 ? 111.928 83.951  74.803  1.00 50.57  ? 619 HIS B CD2 1 
ATOM   9891  C  CE1 . HIS B 1 619 ? 112.365 83.526  76.907  1.00 50.57  ? 619 HIS B CE1 1 
ATOM   9892  N  NE2 . HIS B 1 619 ? 111.871 83.008  75.798  1.00 50.57  ? 619 HIS B NE2 1 
ATOM   9893  N  N   . ILE B 1 620 ? 109.507 86.628  74.978  1.00 47.33  ? 620 ILE B N   1 
ATOM   9894  C  CA  . ILE B 1 620 ? 108.183 86.451  74.394  1.00 47.33  ? 620 ILE B CA  1 
ATOM   9895  C  C   . ILE B 1 620 ? 107.523 87.791  74.175  1.00 47.33  ? 620 ILE B C   1 
ATOM   9896  O  O   . ILE B 1 620 ? 106.768 87.970  73.213  1.00 47.33  ? 620 ILE B O   1 
ATOM   9897  C  CB  . ILE B 1 620 ? 107.337 85.504  75.250  1.00 47.33  ? 620 ILE B CB  1 
ATOM   9898  C  CG1 . ILE B 1 620 ? 108.139 84.238  75.497  1.00 47.33  ? 620 ILE B CG1 1 
ATOM   9899  C  CG2 . ILE B 1 620 ? 106.041 85.156  74.564  1.00 47.33  ? 620 ILE B CG2 1 
ATOM   9900  C  CD1 . ILE B 1 620 ? 108.448 83.483  74.232  1.00 47.33  ? 620 ILE B CD1 1 
ATOM   9901  N  N   . GLN B 1 621 ? 107.773 88.745  75.055  1.00 45.95  ? 621 GLN B N   1 
ATOM   9902  C  CA  . GLN B 1 621 ? 107.203 90.062  74.849  1.00 45.95  ? 621 GLN B CA  1 
ATOM   9903  C  C   . GLN B 1 621 ? 107.845 90.728  73.639  1.00 45.95  ? 621 GLN B C   1 
ATOM   9904  O  O   . GLN B 1 621 ? 107.180 91.479  72.920  1.00 45.95  ? 621 GLN B O   1 
ATOM   9905  C  CB  . GLN B 1 621 ? 107.366 90.893  76.110  1.00 45.95  ? 621 GLN B CB  1 
ATOM   9906  C  CG  . GLN B 1 621 ? 106.505 92.123  76.154  1.00 45.95  ? 621 GLN B CG  1 
ATOM   9907  C  CD  . GLN B 1 621 ? 106.411 92.688  77.560  1.00 45.95  ? 621 GLN B CD  1 
ATOM   9908  O  OE1 . GLN B 1 621 ? 107.019 92.163  78.495  1.00 45.95  ? 621 GLN B OE1 1 
ATOM   9909  N  NE2 . GLN B 1 621 ? 105.615 93.734  77.723  1.00 45.95  ? 621 GLN B NE2 1 
ATOM   9910  N  N   . MET B 1 622 ? 109.144 90.497  73.421  1.00 54.56  ? 622 MET B N   1 
ATOM   9911  C  CA  . MET B 1 622 ? 109.791 91.001  72.209  1.00 54.56  ? 622 MET B CA  1 
ATOM   9912  C  C   . MET B 1 622 ? 109.258 90.335  70.940  1.00 54.56  ? 622 MET B C   1 
ATOM   9913  O  O   . MET B 1 622 ? 109.122 90.997  69.907  1.00 54.56  ? 622 MET B O   1 
ATOM   9914  C  CB  . MET B 1 622 ? 111.301 90.812  72.303  1.00 54.56  ? 622 MET B CB  1 
ATOM   9915  C  CG  . MET B 1 622 ? 111.936 91.647  73.388  1.00 54.56  ? 622 MET B CG  1 
ATOM   9916  S  SD  . MET B 1 622 ? 113.680 91.964  73.108  1.00 54.56  ? 622 MET B SD  1 
ATOM   9917  C  CE  . MET B 1 622 ? 114.093 92.827  74.618  1.00 54.56  ? 622 MET B CE  1 
ATOM   9918  N  N   . LYS B 1 623 ? 108.973 89.029  70.979  1.00 47.59  ? 623 LYS B N   1 
ATOM   9919  C  CA  . LYS B 1 623 ? 108.458 88.380  69.773  1.00 47.59  ? 623 LYS B CA  1 
ATOM   9920  C  C   . LYS B 1 623 ? 107.024 88.777  69.488  1.00 47.59  ? 623 LYS B C   1 
ATOM   9921  O  O   . LYS B 1 623 ? 106.621 88.863  68.325  1.00 47.59  ? 623 LYS B O   1 
ATOM   9922  C  CB  . LYS B 1 623 ? 108.552 86.863  69.832  1.00 47.59  ? 623 LYS B CB  1 
ATOM   9923  C  CG  . LYS B 1 623 ? 109.911 86.302  69.567  1.00 47.59  ? 623 LYS B CG  1 
ATOM   9924  C  CD  . LYS B 1 623 ? 110.053 84.939  70.180  1.00 47.59  ? 623 LYS B CD  1 
ATOM   9925  C  CE  . LYS B 1 623 ? 111.440 84.394  69.956  1.00 47.59  ? 623 LYS B CE  1 
ATOM   9926  N  NZ  . LYS B 1 623 ? 111.552 83.005  70.468  1.00 47.59  ? 623 LYS B NZ  1 
ATOM   9927  N  N   . LEU B 1 624 ? 106.225 88.970  70.527  1.00 49.71  ? 624 LEU B N   1 
ATOM   9928  C  CA  . LEU B 1 624 ? 104.875 89.461  70.312  1.00 49.71  ? 624 LEU B CA  1 
ATOM   9929  C  C   . LEU B 1 624 ? 104.878 90.905  69.834  1.00 49.71  ? 624 LEU B C   1 
ATOM   9930  O  O   . LEU B 1 624 ? 104.019 91.291  69.036  1.00 49.71  ? 624 LEU B O   1 
ATOM   9931  C  CB  . LEU B 1 624 ? 104.073 89.297  71.596  1.00 49.71  ? 624 LEU B CB  1 
ATOM   9932  C  CG  . LEU B 1 624 ? 102.648 89.825  71.677  1.00 49.71  ? 624 LEU B CG  1 
ATOM   9933  C  CD1 . LEU B 1 624 ? 101.817 89.277  70.565  1.00 49.71  ? 624 LEU B CD1 1 
ATOM   9934  C  CD2 . LEU B 1 624 ? 102.047 89.439  73.005  1.00 49.71  ? 624 LEU B CD2 1 
ATOM   9935  N  N   . ALA B 1 625 ? 105.838 91.709  70.287  1.00 54.72  ? 625 ALA B N   1 
ATOM   9936  C  CA  . ALA B 1 625 ? 105.939 93.082  69.804  1.00 54.72  ? 625 ALA B CA  1 
ATOM   9937  C  C   . ALA B 1 625 ? 106.362 93.147  68.342  1.00 54.72  ? 625 ALA B C   1 
ATOM   9938  O  O   . ALA B 1 625 ? 105.885 94.008  67.596  1.00 54.72  ? 625 ALA B O   1 
ATOM   9939  C  CB  . ALA B 1 625 ? 106.913 93.873  70.669  1.00 54.72  ? 625 ALA B CB  1 
ATOM   9940  N  N   . ARG B 1 626 ? 107.245 92.244  67.911  1.00 53.59  ? 626 ARG B N   1 
ATOM   9941  C  CA  . ARG B 1 626 ? 107.629 92.196  66.504  1.00 53.59  ? 626 ARG B CA  1 
ATOM   9942  C  C   . ARG B 1 626 ? 106.467 91.772  65.627  1.00 53.59  ? 626 ARG B C   1 
ATOM   9943  O  O   . ARG B 1 626 ? 106.268 92.329  64.543  1.00 53.59  ? 626 ARG B O   1 
ATOM   9944  C  CB  . ARG B 1 626 ? 108.785 91.221  66.296  1.00 53.59  ? 626 ARG B CB  1 
ATOM   9945  C  CG  . ARG B 1 626 ? 109.291 91.184  64.870  1.00 53.59  ? 626 ARG B CG  1 
ATOM   9946  C  CD  . ARG B 1 626 ? 110.438 90.222  64.686  1.00 53.59  ? 626 ARG B CD  1 
ATOM   9947  N  NE  . ARG B 1 626 ? 111.504 90.413  65.655  1.00 53.59  ? 626 ARG B NE  1 
ATOM   9948  C  CZ  . ARG B 1 626 ? 112.145 89.411  66.244  1.00 53.59  ? 626 ARG B CZ  1 
ATOM   9949  N  NH1 . ARG B 1 626 ? 111.823 88.162  65.950  1.00 53.59  ? 626 ARG B NH1 1 
ATOM   9950  N  NH2 . ARG B 1 626 ? 113.110 89.654  67.119  1.00 53.59  ? 626 ARG B NH2 1 
ATOM   9951  N  N   . LEU B 1 627 ? 105.672 90.812  66.097  1.00 57.36  ? 627 LEU B N   1 
ATOM   9952  C  CA  . LEU B 1 627 ? 104.504 90.386  65.343  1.00 57.36  ? 627 LEU B CA  1 
ATOM   9953  C  C   . LEU B 1 627 ? 103.457 91.480  65.246  1.00 57.36  ? 627 LEU B C   1 
ATOM   9954  O  O   . LEU B 1 627 ? 102.718 91.537  64.258  1.00 57.36  ? 627 LEU B O   1 
ATOM   9955  C  CB  . LEU B 1 627 ? 103.888 89.141  65.961  1.00 57.36  ? 627 LEU B CB  1 
ATOM   9956  C  CG  . LEU B 1 627 ? 103.158 88.350  64.882  1.00 57.36  ? 627 LEU B CG  1 
ATOM   9957  C  CD1 . LEU B 1 627 ? 104.148 87.949  63.812  1.00 57.36  ? 627 LEU B CD1 1 
ATOM   9958  C  CD2 . LEU B 1 627 ? 102.451 87.149  65.417  1.00 57.36  ? 627 LEU B CD2 1 
ATOM   9959  N  N   . GLU B 1 628 ? 103.373 92.357  66.240  1.00 61.01  ? 628 GLU B N   1 
ATOM   9960  C  CA  . GLU B 1 628 ? 102.446 93.470  66.104  1.00 61.01  ? 628 GLU B CA  1 
ATOM   9961  C  C   . GLU B 1 628 ? 102.995 94.507  65.142  1.00 61.01  ? 628 GLU B C   1 
ATOM   9962  O  O   . GLU B 1 628 ? 102.242 95.089  64.355  1.00 61.01  ? 628 GLU B O   1 
ATOM   9963  C  CB  . GLU B 1 628 ? 102.152 94.095  67.459  1.00 61.01  ? 628 GLU B CB  1 
ATOM   9964  C  CG  . GLU B 1 628 ? 100.951 93.482  68.123  1.00 61.01  ? 628 GLU B CG  1 
ATOM   9965  C  CD  . GLU B 1 628 ? 99.668  94.155  67.699  1.00 61.01  ? 628 GLU B CD  1 
ATOM   9966  O  OE1 . GLU B 1 628 ? 99.742  95.213  67.042  1.00 61.01  ? 628 GLU B OE1 1 
ATOM   9967  O  OE2 . GLU B 1 628 ? 98.584  93.629  68.017  1.00 61.01  ? 628 GLU B OE2 1 
ATOM   9968  N  N   . PHE B 1 629 ? 104.300 94.766  65.206  1.00 67.58  ? 629 PHE B N   1 
ATOM   9969  C  CA  . PHE B 1 629 ? 104.881 95.773  64.334  1.00 67.58  ? 629 PHE B CA  1 
ATOM   9970  C  C   . PHE B 1 629 ? 104.888 95.313  62.887  1.00 67.58  ? 629 PHE B C   1 
ATOM   9971  O  O   . PHE B 1 629 ? 104.713 96.118  61.971  1.00 67.58  ? 629 PHE B O   1 
ATOM   9972  C  CB  . PHE B 1 629 ? 106.299 96.086  64.799  1.00 67.58  ? 629 PHE B CB  1 
ATOM   9973  C  CG  . PHE B 1 629 ? 107.026 97.051  63.922  1.00 67.58  ? 629 PHE B CG  1 
ATOM   9974  C  CD1 . PHE B 1 629 ? 106.680 98.384  63.897  1.00 67.58  ? 629 PHE B CD1 1 
ATOM   9975  C  CD2 . PHE B 1 629 ? 108.075 96.617  63.133  1.00 67.58  ? 629 PHE B CD2 1 
ATOM   9976  C  CE1 . PHE B 1 629 ? 107.355 99.266  63.084  1.00 67.58  ? 629 PHE B CE1 1 
ATOM   9977  C  CE2 . PHE B 1 629 ? 108.755 97.489  62.325  1.00 67.58  ? 629 PHE B CE2 1 
ATOM   9978  C  CZ  . PHE B 1 629 ? 108.394 98.816  62.298  1.00 67.58  ? 629 PHE B CZ  1 
ATOM   9979  N  N   . GLU B 1 630 ? 105.063 94.012  62.664  1.00 67.80  ? 630 GLU B N   1 
ATOM   9980  C  CA  . GLU B 1 630 ? 104.996 93.485  61.307  1.00 67.80  ? 630 GLU B CA  1 
ATOM   9981  C  C   . GLU B 1 630 ? 103.595 93.576  60.720  1.00 67.80  ? 630 GLU B C   1 
ATOM   9982  O  O   . GLU B 1 630 ? 103.436 93.884  59.535  1.00 67.80  ? 630 GLU B O   1 
ATOM   9983  C  CB  . GLU B 1 630 ? 105.482 92.040  61.285  1.00 67.80  ? 630 GLU B CB  1 
ATOM   9984  C  CG  . GLU B 1 630 ? 106.160 91.649  59.997  1.00 67.80  ? 630 GLU B CG  1 
ATOM   9985  C  CD  . GLU B 1 630 ? 106.731 90.254  60.046  1.00 67.80  ? 630 GLU B CD  1 
ATOM   9986  O  OE1 . GLU B 1 630 ? 106.103 89.372  60.668  1.00 67.80  ? 630 GLU B OE1 1 
ATOM   9987  O  OE2 . GLU B 1 630 ? 107.815 90.038  59.467  1.00 67.80  ? 630 GLU B OE2 1 
ATOM   9988  N  N   . SER B 1 631 ? 102.574 93.324  61.535  1.00 72.05  ? 631 SER B N   1 
ATOM   9989  C  CA  . SER B 1 631 ? 101.195 93.461  61.085  1.00 72.05  ? 631 SER B CA  1 
ATOM   9990  C  C   . SER B 1 631 ? 100.783 94.909  60.873  1.00 72.05  ? 631 SER B C   1 
ATOM   9991  O  O   . SER B 1 631 ? 99.979  95.195  59.979  1.00 72.05  ? 631 SER B O   1 
ATOM   9992  C  CB  . SER B 1 631 ? 100.253 92.800  62.087  1.00 72.05  ? 631 SER B CB  1 
ATOM   9993  O  OG  . SER B 1 631 ? 100.434 93.348  63.378  1.00 72.05  ? 631 SER B OG  1 
ATOM   9994  N  N   . LEU B 1 632 ? 101.298 95.823  61.690  1.00 71.96  ? 632 LEU B N   1 
ATOM   9995  C  CA  . LEU B 1 632 ? 101.000 97.239  61.512  1.00 71.96  ? 632 LEU B CA  1 
ATOM   9996  C  C   . LEU B 1 632 ? 101.639 97.789  60.240  1.00 71.96  ? 632 LEU B C   1 
ATOM   9997  O  O   . LEU B 1 632 ? 101.041 98.616  59.545  1.00 71.96  ? 632 LEU B O   1 
ATOM   9998  C  CB  . LEU B 1 632 ? 101.446 98.013  62.748  1.00 71.96  ? 632 LEU B CB  1 
ATOM   9999  C  CG  . LEU B 1 632 ? 101.354 99.528  62.690  1.00 71.96  ? 632 LEU B CG  1 
ATOM   10000 C  CD1 . LEU B 1 632 ? 99.895  99.895  62.601  1.00 71.96  ? 632 LEU B CD1 1 
ATOM   10001 C  CD2 . LEU B 1 632 ? 101.985 100.150 63.912  1.00 71.96  ? 632 LEU B CD2 1 
ATOM   10002 N  N   . GLU B 1 633 ? 102.844 97.326  59.911  1.00 75.86  ? 633 GLU B N   1 
ATOM   10003 C  CA  . GLU B 1 633 ? 103.499 97.732  58.670  1.00 75.86  ? 633 GLU B CA  1 
ATOM   10004 C  C   . GLU B 1 633 ? 102.799 97.178  57.437  1.00 75.86  ? 633 GLU B C   1 
ATOM   10005 O  O   . GLU B 1 633 ? 102.823 97.811  56.376  1.00 75.86  ? 633 GLU B O   1 
ATOM   10006 C  CB  . GLU B 1 633 ? 104.963 97.305  58.672  1.00 75.86  ? 633 GLU B CB  1 
ATOM   10007 C  CG  . GLU B 1 633 ? 105.835 98.055  59.657  1.00 75.86  ? 633 GLU B CG  1 
ATOM   10008 C  CD  . GLU B 1 633 ? 105.686 99.549  59.560  1.00 75.86  ? 633 GLU B CD  1 
ATOM   10009 O  OE1 . GLU B 1 633 ? 105.790 100.092 58.441  1.00 75.86  ? 633 GLU B OE1 1 
ATOM   10010 O  OE2 . GLU B 1 633 ? 105.468 100.185 60.609  1.00 75.86  ? 633 GLU B OE2 1 
ATOM   10011 N  N   . ALA B 1 634 ? 102.182 95.996  57.547  1.00 77.17  ? 634 ALA B N   1 
ATOM   10012 C  CA  . ALA B 1 634 ? 101.392 95.464  56.436  1.00 77.17  ? 634 ALA B CA  1 
ATOM   10013 C  C   . ALA B 1 634 ? 100.189 96.347  56.124  1.00 77.17  ? 634 ALA B C   1 
ATOM   10014 O  O   . ALA B 1 634 ? 99.832  96.522  54.952  1.00 77.17  ? 634 ALA B O   1 
ATOM   10015 C  CB  . ALA B 1 634 ? 100.942 94.038  56.751  1.00 77.17  ? 634 ALA B CB  1 
ATOM   10016 N  N   . LEU B 1 635 ? 99.533  96.884  57.154  1.00 75.31  ? 635 LEU B N   1 
ATOM   10017 C  CA  . LEU B 1 635 ? 98.447  97.830  56.921  1.00 75.31  ? 635 LEU B CA  1 
ATOM   10018 C  C   . LEU B 1 635 ? 98.995  99.104  56.293  1.00 75.31  ? 635 LEU B C   1 
ATOM   10019 O  O   . LEU B 1 635 ? 98.349  99.723  55.440  1.00 75.31  ? 635 LEU B O   1 
ATOM   10020 C  CB  . LEU B 1 635 ? 97.709  98.136  58.222  1.00 75.31  ? 635 LEU B CB  1 
ATOM   10021 C  CG  . LEU B 1 635 ? 96.802  97.044  58.781  1.00 75.31  ? 635 LEU B CG  1 
ATOM   10022 C  CD1 . LEU B 1 635 ? 95.881  97.627  59.826  1.00 75.31  ? 635 LEU B CD1 1 
ATOM   10023 C  CD2 . LEU B 1 635 ? 95.997  96.388  57.684  1.00 75.31  ? 635 LEU B CD2 1 
ATOM   10024 N  N   . LYS B 1 636 ? 100.187 99.507  56.730  1.00 80.99  ? 636 LYS B N   1 
ATOM   10025 C  CA  . LYS B 1 636 ? 100.871 100.673 56.194  1.00 80.99  ? 636 LYS B CA  1 
ATOM   10026 C  C   . LYS B 1 636 ? 101.277 100.464 54.742  1.00 80.99  ? 636 LYS B C   1 
ATOM   10027 O  O   . LYS B 1 636 ? 101.220 101.405 53.944  1.00 80.99  ? 636 LYS B O   1 
ATOM   10028 C  CB  . LYS B 1 636 ? 102.091 100.993 57.053  1.00 80.99  ? 636 LYS B CB  1 
ATOM   10029 C  CG  . LYS B 1 636 ? 102.703 102.354 56.803  1.00 80.99  ? 636 LYS B CG  1 
ATOM   10030 C  CD  . LYS B 1 636 ? 103.600 102.731 57.963  1.00 80.99  ? 636 LYS B CD  1 
ATOM   10031 C  CE  . LYS B 1 636 ? 104.264 104.080 57.761  1.00 80.99  ? 636 LYS B CE  1 
ATOM   10032 N  NZ  . LYS B 1 636 ? 105.165 104.423 58.903  1.00 80.99  ? 636 LYS B NZ  1 
ATOM   10033 N  N   . GLN B 1 637 ? 101.690 99.250  54.380  1.00 88.95  ? 637 GLN B N   1 
ATOM   10034 C  CA  . GLN B 1 637 ? 102.058 98.968  52.999  1.00 88.95  ? 637 GLN B CA  1 
ATOM   10035 C  C   . GLN B 1 637 ? 100.869 98.948  52.050  1.00 88.95  ? 637 GLN B C   1 
ATOM   10036 O  O   . GLN B 1 637 ? 101.018 99.366  50.897  1.00 88.95  ? 637 GLN B O   1 
ATOM   10037 C  CB  . GLN B 1 637 ? 102.786 97.628  52.911  1.00 88.95  ? 637 GLN B CB  1 
ATOM   10038 C  CG  . GLN B 1 637 ? 103.645 97.480  51.673  1.00 88.95  ? 637 GLN B CG  1 
ATOM   10039 C  CD  . GLN B 1 637 ? 104.759 98.506  51.624  1.00 88.95  ? 637 GLN B CD  1 
ATOM   10040 O  OE1 . GLN B 1 637 ? 105.764 98.383  52.326  1.00 88.95  ? 637 GLN B OE1 1 
ATOM   10041 N  NE2 . GLN B 1 637 ? 104.585 99.529  50.798  1.00 88.95  ? 637 GLN B NE2 1 
ATOM   10042 N  N   . GLN B 1 638 ? 99.697  98.486  52.498  1.00 86.51  ? 638 GLN B N   1 
ATOM   10043 C  CA  . GLN B 1 638 ? 98.515  98.562  51.641  1.00 86.51  ? 638 GLN B CA  1 
ATOM   10044 C  C   . GLN B 1 638 ? 98.042  100.002 51.486  1.00 86.51  ? 638 GLN B C   1 
ATOM   10045 O  O   . GLN B 1 638 ? 97.401  100.343 50.486  1.00 86.51  ? 638 GLN B O   1 
ATOM   10046 C  CB  . GLN B 1 638 ? 97.393  97.692  52.206  1.00 86.51  ? 638 GLN B CB  1 
ATOM   10047 N  N   . GLN B 1 639 ? 98.351  100.850 52.467  1.00 91.86  ? 639 GLN B N   1 
ATOM   10048 C  CA  . GLN B 1 639 ? 98.071  102.277 52.376  1.00 91.86  ? 639 GLN B CA  1 
ATOM   10049 C  C   . GLN B 1 639 ? 99.100  102.981 51.497  1.00 91.86  ? 639 GLN B C   1 
ATOM   10050 O  O   . GLN B 1 639 ? 98.759  103.916 50.765  1.00 91.86  ? 639 GLN B O   1 
ATOM   10051 C  CB  . GLN B 1 639 ? 98.041  102.899 53.773  1.00 91.86  ? 639 GLN B CB  1 
ATOM   10052 N  N   . MET B 1 640 ? 100.361 102.562 51.575  1.00 84.15  ? 640 MET B N   1 
ATOM   10053 C  CA  . MET B 1 640 ? 101.452 103.255 50.904  1.00 84.15  ? 640 MET B CA  1 
ATOM   10054 C  C   . MET B 1 640 ? 101.407 103.032 49.400  1.00 84.15  ? 640 MET B C   1 
ATOM   10055 O  O   . MET B 1 640 ? 100.872 103.859 48.660  1.00 84.15  ? 640 MET B O   1 
ATOM   10056 C  CB  . MET B 1 640 ? 102.801 102.790 51.448  1.00 84.15  ? 640 MET B CB  1 
HETATM 10057 CA CA  . CA  C 2 .   ? 94.486  124.551 92.389  1.00 52.25  ? 701 CA  A CA  1 
HETATM 10058 CA CA  . CA  D 2 .   ? 94.872  122.516 88.634  1.00 30.02  ? 702 CA  A CA  1 
HETATM 10059 CA CA  . CA  E 2 .   ? 85.513  96.751  87.432  1.00 17.07  ? 703 CA  A CA  1 
HETATM 10060 CA CA  . CA  F 2 .   ? 92.998  62.788  92.393  1.00 50.72  ? 701 CA  B CA  1 
HETATM 10061 CA CA  . CA  G 2 .   ? 92.615  64.818  88.635  1.00 27.05  ? 702 CA  B CA  1 
HETATM 10062 CA CA  . CA  H 2 .   ? 102.091 90.536  87.362  1.00 16.98  ? 703 CA  B CA  1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   LYS 2   2   ?   ?   ?   A . n 
A 1 3   VAL 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   LEU 5   5   ?   ?   ?   A . n 
A 1 6   SER 6   6   ?   ?   ?   A . n 
A 1 7   ALA 7   7   ?   ?   ?   A . n 
A 1 8   LEU 8   8   ?   ?   ?   A . n 
A 1 9   ASP 9   9   ?   ?   ?   A . n 
A 1 10  THR 10  10  ?   ?   ?   A . n 
A 1 11  SER 11  11  ?   ?   ?   A . n 
A 1 12  GLU 12  12  ?   ?   ?   A . n 
A 1 13  SER 13  13  ?   ?   ?   A . n 
A 1 14  SER 14  14  14  SER SER A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  THR 16  16  16  THR THR A . n 
A 1 17  PRO 17  17  17  PRO PRO A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  ILE 21  21  21  ILE ILE A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ASP 26  26  26  ASP ASP A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  GLU 29  29  29  GLU GLU A . n 
A 1 30  GLU 30  30  30  GLU GLU A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  LYS 32  32  32  LYS LYS A . n 
A 1 33  GLU 33  33  33  GLU GLU A . n 
A 1 34  TRP 34  34  34  TRP TRP A . n 
A 1 35  LEU 35  35  35  LEU LEU A . n 
A 1 36  LYS 36  36  36  LYS LYS A . n 
A 1 37  ASN 37  37  37  ASN ASN A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  ILE 39  39  39  ILE ILE A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  ASP 45  45  45  ASP ASP A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  ARG 53  53  53  ARG ARG A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ASN 57  57  57  ASN ASN A . n 
A 1 58  LYS 58  58  58  LYS LYS A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  GLN 61  61  61  GLN GLN A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  THR 63  63  63  THR THR A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  GLN 67  67  67  GLN GLN A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  LEU 69  69  69  LEU LEU A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  LEU 71  71  71  LEU LEU A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  GLY 73  73  73  GLY GLY A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  SER 75  75  75  SER SER A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  MET 79  79  79  MET MET A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  VAL 86  86  86  VAL VAL A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  LYS 90  90  90  LYS LYS A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  CYS 92  92  92  CYS CYS A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ASN 95  95  95  ASN ASN A . n 
A 1 96  THR 96  96  96  THR THR A . n 
A 1 97  MET 97  97  97  MET MET A . n 
A 1 98  ARG 98  98  98  ARG ARG A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 PHE 100 100 100 PHE PHE A . n 
A 1 101 THR 101 101 101 THR THR A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 THR 104 104 104 THR THR A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 ASN 107 107 107 ASN ASN A . n 
A 1 108 PHE 108 108 108 PHE PHE A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ASP 113 113 113 ASP ASP A . n 
A 1 114 ASN 114 114 114 ASN ASN A . n 
A 1 115 ASN 115 115 115 ASN ASN A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 ALA 122 122 122 ALA ALA A . n 
A 1 123 GLU 123 123 123 GLU GLU A . n 
A 1 124 CYS 124 124 124 CYS CYS A . n 
A 1 125 GLN 125 125 125 GLN GLN A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LYS 129 129 129 LYS LYS A . n 
A 1 130 HIS 130 130 130 HIS HIS A . n 
A 1 131 GLU 131 131 131 GLU GLU A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 GLU 133 133 133 GLU GLU A . n 
A 1 134 ASN 134 134 134 ASN ASN A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ARG 136 136 136 ARG ARG A . n 
A 1 137 ALA 137 137 137 ALA ALA A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 ASP 139 139 139 ASP ASP A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 ILE 143 143 143 ILE ILE A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 GLY 145 145 145 GLY GLY A . n 
A 1 146 TYR 146 146 146 TYR TYR A . n 
A 1 147 PRO 147 147 147 PRO PRO A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 ALA 149 149 149 ALA ALA A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 LEU 151 151 151 LEU LEU A . n 
A 1 152 TYR 152 152 152 TYR TYR A . n 
A 1 153 PRO 153 153 153 PRO PRO A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 ARG 159 159 159 ARG ARG A . n 
A 1 160 ARG 160 160 160 ARG ARG A . n 
A 1 161 LEU 161 161 161 LEU LEU A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 THR 163 163 163 THR THR A . n 
A 1 164 SER 164 164 164 SER SER A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 ILE 166 166 166 ILE ILE A . n 
A 1 167 VAL 167 167 167 VAL VAL A . n 
A 1 168 ILE 168 168 168 ILE ILE A . n 
A 1 169 GLN 169 169 169 GLN GLN A . n 
A 1 170 VAL 170 170 170 VAL VAL A . n 
A 1 171 PHE 171 171 171 PHE PHE A . n 
A 1 172 PRO 172 172 172 PRO PRO A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 HIS 174 174 174 HIS HIS A . n 
A 1 175 ASP 175 175 175 ASP ASP A . n 
A 1 176 SER 176 176 176 SER SER A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 LYS 180 180 180 LYS LYS A . n 
A 1 181 LYS 181 181 181 LYS LYS A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 GLU 183 183 183 GLU GLU A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 TRP 186 186 186 TRP TRP A . n 
A 1 187 TYR 187 187 187 TYR TYR A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 ARG 189 189 189 ARG ARG A . n 
A 1 190 PHE 190 190 190 PHE PHE A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 LYS 193 193 193 LYS LYS A . n 
A 1 194 TYR 194 194 194 TYR TYR A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 ILE 197 197 197 ILE ILE A . n 
A 1 198 ASP 198 198 198 ASP ASP A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 ARG 201 201 201 ARG ARG A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 TYR 203 203 203 TYR TYR A . n 
A 1 204 PHE 204 204 204 PHE PHE A . n 
A 1 205 GLY 205 205 205 GLY GLY A . n 
A 1 206 GLU 206 206 206 GLU GLU A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 ALA 209 209 209 ALA ALA A . n 
A 1 210 LEU 210 210 210 LEU LEU A . n 
A 1 211 TYR 211 211 211 TYR TYR A . n 
A 1 212 PHE 212 212 212 PHE PHE A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 GLU 216 216 216 GLU GLU A . n 
A 1 217 TYR 217 217 217 TYR TYR A . n 
A 1 218 PHE 218 218 218 PHE PHE A . n 
A 1 219 THR 219 219 219 THR THR A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 ALA 221 221 221 ALA ALA A . n 
A 1 222 LEU 222 222 222 LEU LEU A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 PRO 224 224 224 PRO PRO A . n 
A 1 225 MET 225 225 225 MET MET A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 GLY 229 229 229 GLY GLY A . n 
A 1 230 LEU 230 230 230 LEU LEU A . n 
A 1 231 PRO 231 231 231 PRO PRO A . n 
A 1 232 TYR 232 232 232 TYR TYR A . n 
A 1 233 TYR 233 233 233 TYR TYR A . n 
A 1 234 LEU 234 234 234 LEU LEU A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 GLU 238 238 238 GLU GLU A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 TYR 240 240 240 TYR TYR A . n 
A 1 241 ASP 241 241 241 ASP ASP A . n 
A 1 242 LYS 242 242 242 LYS LYS A . n 
A 1 243 TYR 243 243 243 TYR TYR A . n 
A 1 244 VAL 244 244 244 VAL VAL A . n 
A 1 245 ILE 245 245 245 ILE ILE A . n 
A 1 246 PHE 246 246 246 PHE PHE A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 SER 248 248 248 SER SER A . n 
A 1 249 PHE 249 249 249 PHE PHE A . n 
A 1 250 ASN 250 250 250 ASN ASN A . n 
A 1 251 LEU 251 251 251 LEU LEU A . n 
A 1 252 ILE 252 252 252 ILE ILE A . n 
A 1 253 TRP 253 253 253 TRP TRP A . n 
A 1 254 SER 254 254 254 SER SER A . n 
A 1 255 THR 255 255 255 THR THR A . n 
A 1 256 VAL 256 256 256 VAL VAL A . n 
A 1 257 ILE 257 257 257 ILE ILE A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 LEU 260 260 260 LEU LEU A . n 
A 1 261 TRP 261 261 261 TRP TRP A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 ARG 263 263 263 ARG ARG A . n 
A 1 264 GLY 264 264 264 GLY GLY A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 ALA 266 266 266 ALA ALA A . n 
A 1 267 ASN 267 267 267 ASN ASN A . n 
A 1 268 MET 268 268 268 MET MET A . n 
A 1 269 THR 269 269 269 THR THR A . n 
A 1 270 TYR 270 270 270 TYR TYR A . n 
A 1 271 ARG 271 271 271 ARG ARG A . n 
A 1 272 TRP 272 272 272 TRP TRP A . n 
A 1 273 GLY 273 273 273 GLY GLY A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 LEU 275 275 275 LEU LEU A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 LYS 278 278 278 LYS LYS A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 PHE 281 281 281 PHE PHE A . n 
A 1 282 GLU 282 282 282 GLU GLU A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 PRO 284 284 284 PRO PRO A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 GLY 287 287 287 GLY GLY A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 HIS 289 289 289 HIS HIS A . n 
A 1 290 GLY 290 290 290 GLY GLY A . n 
A 1 291 VAL 291 291 291 VAL VAL A . n 
A 1 292 LEU 292 292 292 LEU LEU A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 ILE 294 294 294 ILE ILE A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 ILE 297 297 297 ILE ILE A . n 
A 1 298 THR 298 298 298 THR THR A . n 
A 1 299 GLY 299 299 299 GLY GLY A . n 
A 1 300 LYS 300 300 300 LYS LYS A . n 
A 1 301 GLU 301 301 301 GLU GLU A . n 
A 1 302 GLU 302 302 302 GLU GLU A . n 
A 1 303 PRO 303 303 303 PRO PRO A . n 
A 1 304 LEU 304 304 304 LEU LEU A . n 
A 1 305 TYR 305 305 305 TYR TYR A . n 
A 1 306 PRO 306 306 306 PRO PRO A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 TYR 308 308 308 TYR TYR A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 ARG 310 310 310 ARG ARG A . n 
A 1 311 GLN 311 311 311 GLN GLN A . n 
A 1 312 LEU 312 312 312 LEU LEU A . n 
A 1 313 ARG 313 313 313 ARG ARG A . n 
A 1 314 ILE 314 314 314 ILE ILE A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 LEU 316 316 316 LEU LEU A . n 
A 1 317 VAL 317 317 317 VAL VAL A . n 
A 1 318 SER 318 318 318 SER SER A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 PHE 321 321 321 PHE PHE A . n 
A 1 322 VAL 322 322 322 VAL VAL A . n 
A 1 323 CYS 323 323 323 CYS CYS A . n 
A 1 324 LEU 324 324 324 LEU LEU A . n 
A 1 325 CYS 325 325 325 CYS CYS A . n 
A 1 326 LEU 326 326 326 LEU LEU A . n 
A 1 327 TYR 327 327 327 TYR TYR A . n 
A 1 328 PHE 328 328 328 PHE PHE A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 TYR 331 331 331 TYR TYR A . n 
A 1 332 VAL 332 332 332 VAL VAL A . n 
A 1 333 MET 333 333 333 MET MET A . n 
A 1 334 MET 334 334 334 MET MET A . n 
A 1 335 ILE 335 335 335 ILE ILE A . n 
A 1 336 TYR 336 336 336 TYR TYR A . n 
A 1 337 PHE 337 337 337 PHE PHE A . n 
A 1 338 ASP 338 338 338 ASP ASP A . n 
A 1 339 MET 339 339 339 MET MET A . n 
A 1 340 GLU 340 340 340 GLU GLU A . n 
A 1 341 VAL 341 341 341 VAL VAL A . n 
A 1 342 TRP 342 342 342 TRP TRP A . n 
A 1 343 ALA 343 343 343 ALA ALA A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 GLY 345 345 345 GLY GLY A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 HIS 347 347 347 HIS HIS A . n 
A 1 348 GLU 348 348 348 GLU GLU A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 SER 350 350 350 SER SER A . n 
A 1 351 GLY 351 351 351 GLY GLY A . n 
A 1 352 SER 352 352 352 SER SER A . n 
A 1 353 GLU 353 353 353 GLU GLU A . n 
A 1 354 TRP 354 354 354 TRP TRP A . n 
A 1 355 THR 355 355 355 THR THR A . n 
A 1 356 SER 356 356 356 SER SER A . n 
A 1 357 VAL 357 357 357 VAL VAL A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 LEU 359 359 359 LEU LEU A . n 
A 1 360 TYR 360 360 360 TYR TYR A . n 
A 1 361 VAL 361 361 361 VAL VAL A . n 
A 1 362 PRO 362 362 362 PRO PRO A . n 
A 1 363 SER 363 363 363 SER SER A . n 
A 1 364 ILE 364 364 364 ILE ILE A . n 
A 1 365 ILE 365 365 365 ILE ILE A . n 
A 1 366 TYR 366 366 366 TYR TYR A . n 
A 1 367 ALA 367 367 367 ALA ALA A . n 
A 1 368 ILE 368 368 368 ILE ILE A . n 
A 1 369 VAL 369 369 369 VAL VAL A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 ILE 372 372 372 ILE ILE A . n 
A 1 373 MET 373 373 373 MET MET A . n 
A 1 374 ASN 374 374 374 ASN ASN A . n 
A 1 375 ARG 375 375 375 ARG ARG A . n 
A 1 376 LEU 376 376 376 LEU LEU A . n 
A 1 377 TYR 377 377 377 TYR TYR A . n 
A 1 378 ARG 378 378 378 ARG ARG A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 ALA 380 380 380 ALA ALA A . n 
A 1 381 ALA 381 381 381 ALA ALA A . n 
A 1 382 GLU 382 382 382 GLU GLU A . n 
A 1 383 PHE 383 383 383 PHE PHE A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 THR 385 385 385 THR THR A . n 
A 1 386 SER 386 386 386 SER SER A . n 
A 1 387 TRP 387 387 387 TRP TRP A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 ASN 389 389 389 ASN ASN A . n 
A 1 390 HIS 390 390 390 HIS HIS A . n 
A 1 391 ARG 391 391 391 ARG ARG A . n 
A 1 392 LEU 392 392 392 LEU LEU A . n 
A 1 393 GLU 393 393 393 GLU GLU A . n 
A 1 394 SER 394 394 394 SER SER A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 TYR 396 396 396 TYR TYR A . n 
A 1 397 GLN 397 397 397 GLN GLN A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 HIS 399 399 399 HIS HIS A . n 
A 1 400 LEU 400 400 400 LEU LEU A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 LYS 403 403 403 LYS LYS A . n 
A 1 404 VAL 404 404 404 VAL VAL A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 VAL 406 406 406 VAL VAL A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 ASN 408 408 408 ASN ASN A . n 
A 1 409 PHE 409 409 409 PHE PHE A . n 
A 1 410 LEU 410 410 410 LEU LEU A . n 
A 1 411 ASN 411 411 411 ASN ASN A . n 
A 1 412 CYS 412 412 412 CYS CYS A . n 
A 1 413 PHE 413 413 413 PHE PHE A . n 
A 1 414 ALA 414 414 414 ALA ALA A . n 
A 1 415 SER 415 415 415 SER SER A . n 
A 1 416 LEU 416 416 416 LEU LEU A . n 
A 1 417 PHE 417 417 417 PHE PHE A . n 
A 1 418 TYR 418 418 418 TYR TYR A . n 
A 1 419 ILE 419 419 419 ILE ILE A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 PHE 421 421 421 PHE PHE A . n 
A 1 422 VAL 422 422 422 VAL VAL A . n 
A 1 423 LEU 423 423 423 LEU LEU A . n 
A 1 424 LYS 424 424 424 LYS LYS A . n 
A 1 425 ASP 425 425 425 ASP ASP A . n 
A 1 426 MET 426 426 426 MET MET A . n 
A 1 427 LYS 427 427 427 LYS LYS A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 LEU 429 429 429 LEU LEU A . n 
A 1 430 ARG 430 430 430 ARG ARG A . n 
A 1 431 GLN 431 431 431 GLN GLN A . n 
A 1 432 SER 432 432 432 SER SER A . n 
A 1 433 LEU 433 433 433 LEU LEU A . n 
A 1 434 ALA 434 434 434 ALA ALA A . n 
A 1 435 THR 435 435 435 THR THR A . n 
A 1 436 LEU 436 436 436 LEU LEU A . n 
A 1 437 LEU 437 437 437 LEU LEU A . n 
A 1 438 ILE 438 438 438 ILE ILE A . n 
A 1 439 THR 439 439 439 THR THR A . n 
A 1 440 SER 440 440 440 SER SER A . n 
A 1 441 GLN 441 441 441 GLN GLN A . n 
A 1 442 ILE 442 442 442 ILE ILE A . n 
A 1 443 LEU 443 443 443 LEU LEU A . n 
A 1 444 ASN 444 444 444 ASN ASN A . n 
A 1 445 GLN 445 445 445 GLN GLN A . n 
A 1 446 ILE 446 446 446 ILE ILE A . n 
A 1 447 MET 447 447 447 MET MET A . n 
A 1 448 GLU 448 448 448 GLU GLU A . n 
A 1 449 SER 449 449 449 SER SER A . n 
A 1 450 PHE 450 450 450 PHE PHE A . n 
A 1 451 LEU 451 451 451 LEU LEU A . n 
A 1 452 PRO 452 452 452 PRO PRO A . n 
A 1 453 TYR 453 453 453 TYR TYR A . n 
A 1 454 TRP 454 454 454 TRP TRP A . n 
A 1 455 LEU 455 455 455 LEU LEU A . n 
A 1 456 GLN 456 456 456 GLN GLN A . n 
A 1 457 ARG 457 457 457 ARG ARG A . n 
A 1 458 LYS 458 458 458 LYS LYS A . n 
A 1 459 HIS 459 459 459 HIS HIS A . n 
A 1 460 GLY 460 460 460 GLY GLY A . n 
A 1 461 VAL 461 461 461 VAL VAL A . n 
A 1 462 ARG 462 462 462 ARG ARG A . n 
A 1 463 VAL 463 463 463 VAL VAL A . n 
A 1 464 LYS 464 464 464 LYS LYS A . n 
A 1 465 ARG 465 465 465 ARG ARG A . n 
A 1 466 LYS 466 466 466 LYS LYS A . n 
A 1 467 VAL 467 467 467 VAL VAL A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 ALA 469 469 469 ALA ALA A . n 
A 1 470 LEU 470 470 470 LEU LEU A . n 
A 1 471 LYS 471 471 471 LYS LYS A . n 
A 1 472 ALA 472 472 472 ALA ALA A . n 
A 1 473 ASP 473 473 473 ASP ASP A . n 
A 1 474 ILE 474 474 474 ILE ILE A . n 
A 1 475 ASP 475 475 475 ASP ASP A . n 
A 1 476 ALA 476 476 476 ALA ALA A . n 
A 1 477 THR 477 477 477 THR THR A . n 
A 1 478 LEU 478 478 478 LEU LEU A . n 
A 1 479 TYR 479 479 479 TYR TYR A . n 
A 1 480 GLU 480 480 480 GLU GLU A . n 
A 1 481 GLN 481 481 481 GLN GLN A . n 
A 1 482 VAL 482 482 482 VAL VAL A . n 
A 1 483 ILE 483 483 483 ILE ILE A . n 
A 1 484 LEU 484 484 484 LEU LEU A . n 
A 1 485 GLU 485 485 485 GLU GLU A . n 
A 1 486 LYS 486 486 486 LYS LYS A . n 
A 1 487 GLU 487 487 487 GLU GLU A . n 
A 1 488 MET 488 488 488 MET MET A . n 
A 1 489 GLY 489 489 489 GLY GLY A . n 
A 1 490 THR 490 490 490 THR THR A . n 
A 1 491 TYR 491 491 491 TYR TYR A . n 
A 1 492 LEU 492 492 492 LEU LEU A . n 
A 1 493 GLY 493 493 493 GLY GLY A . n 
A 1 494 THR 494 494 494 THR THR A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 ASP 496 496 496 ASP ASP A . n 
A 1 497 ASP 497 497 497 ASP ASP A . n 
A 1 498 TYR 498 498 498 TYR TYR A . n 
A 1 499 LEU 499 499 499 LEU LEU A . n 
A 1 500 GLU 500 500 500 GLU GLU A . n 
A 1 501 LEU 501 501 501 LEU LEU A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 LEU 503 503 503 LEU LEU A . n 
A 1 504 GLN 504 504 504 GLN GLN A . n 
A 1 505 PHE 505 505 505 PHE PHE A . n 
A 1 506 GLY 506 506 506 GLY GLY A . n 
A 1 507 TYR 507 507 507 TYR TYR A . n 
A 1 508 VAL 508 508 508 VAL VAL A . n 
A 1 509 SER 509 509 509 SER SER A . n 
A 1 510 LEU 510 510 510 LEU LEU A . n 
A 1 511 PHE 511 511 511 PHE PHE A . n 
A 1 512 SER 512 512 512 SER SER A . n 
A 1 513 CYS 513 513 513 CYS CYS A . n 
A 1 514 VAL 514 514 514 VAL VAL A . n 
A 1 515 TYR 515 515 515 TYR TYR A . n 
A 1 516 PRO 516 516 516 PRO PRO A . n 
A 1 517 LEU 517 517 517 LEU LEU A . n 
A 1 518 ALA 518 518 518 ALA ALA A . n 
A 1 519 ALA 519 519 519 ALA ALA A . n 
A 1 520 ALA 520 520 520 ALA ALA A . n 
A 1 521 PHE 521 521 521 PHE PHE A . n 
A 1 522 ALA 522 522 522 ALA ALA A . n 
A 1 523 VAL 523 523 523 VAL VAL A . n 
A 1 524 LEU 524 524 524 LEU LEU A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 ASN 526 526 526 ASN ASN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 THR 528 528 528 THR THR A . n 
A 1 529 GLU 529 529 529 GLU GLU A . n 
A 1 530 VAL 530 530 530 VAL VAL A . n 
A 1 531 ASN 531 531 531 ASN ASN A . n 
A 1 532 SER 532 532 532 SER SER A . n 
A 1 533 ASP 533 533 533 ASP ASP A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 LEU 535 535 535 LEU LEU A . n 
A 1 536 LYS 536 536 536 LYS LYS A . n 
A 1 537 MET 537 537 537 MET MET A . n 
A 1 538 CYS 538 538 538 CYS CYS A . n 
A 1 539 ARG 539 539 539 ARG ARG A . n 
A 1 540 VAL 540 540 540 VAL VAL A . n 
A 1 541 PHE 541 541 541 PHE PHE A . n 
A 1 542 LYS 542 542 542 LYS LYS A . n 
A 1 543 ARG 543 543 543 ARG ARG A . n 
A 1 544 PRO 544 544 544 PRO PRO A . n 
A 1 545 PHE 545 545 545 PHE PHE A . n 
A 1 546 SER 546 546 546 SER SER A . n 
A 1 547 GLU 547 547 547 GLU GLU A . n 
A 1 548 PRO 548 548 548 PRO PRO A . n 
A 1 549 SER 549 549 549 SER SER A . n 
A 1 550 ALA 550 550 550 ALA ALA A . n 
A 1 551 ASN 551 551 551 ASN ASN A . n 
A 1 552 ILE 552 552 552 ILE ILE A . n 
A 1 553 GLY 553 553 553 GLY GLY A . n 
A 1 554 VAL 554 554 554 VAL VAL A . n 
A 1 555 TRP 555 555 555 TRP TRP A . n 
A 1 556 GLN 556 556 556 GLN GLN A . n 
A 1 557 LEU 557 557 557 LEU LEU A . n 
A 1 558 ALA 558 558 558 ALA ALA A . n 
A 1 559 PHE 559 559 559 PHE PHE A . n 
A 1 560 GLU 560 560 560 GLU GLU A . n 
A 1 561 THR 561 561 561 THR THR A . n 
A 1 562 MET 562 562 562 MET MET A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 VAL 564 564 564 VAL VAL A . n 
A 1 565 ILE 565 565 565 ILE ILE A . n 
A 1 566 SER 566 566 566 SER SER A . n 
A 1 567 VAL 567 567 567 VAL VAL A . n 
A 1 568 VAL 568 568 568 VAL VAL A . n 
A 1 569 THR 569 569 569 THR THR A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 CYS 571 571 571 CYS CYS A . n 
A 1 572 ALA 572 572 572 ALA ALA A . n 
A 1 573 LEU 573 573 573 LEU LEU A . n 
A 1 574 ILE 574 574 574 ILE ILE A . n 
A 1 575 GLY 575 575 575 GLY GLY A . n 
A 1 576 MET 576 576 576 MET MET A . n 
A 1 577 SER 577 577 577 SER SER A . n 
A 1 578 PRO 578 578 578 PRO PRO A . n 
A 1 579 GLN 579 579 579 GLN GLN A . n 
A 1 580 VAL 580 580 580 VAL VAL A . n 
A 1 581 ASN 581 581 581 ASN ASN A . n 
A 1 582 ALA 582 582 582 ALA ALA A . n 
A 1 583 VAL 583 583 583 VAL VAL A . n 
A 1 584 PHE 584 584 584 PHE PHE A . n 
A 1 585 PRO 585 585 585 PRO PRO A . n 
A 1 586 GLU 586 586 586 GLU GLU A . n 
A 1 587 SER 587 587 587 SER SER A . n 
A 1 588 LYS 588 588 588 LYS LYS A . n 
A 1 589 ALA 589 589 589 ALA ALA A . n 
A 1 590 ASP 590 590 590 ASP ASP A . n 
A 1 591 LEU 591 591 591 LEU LEU A . n 
A 1 592 ILE 592 592 592 ILE ILE A . n 
A 1 593 LEU 593 593 593 LEU LEU A . n 
A 1 594 ILE 594 594 594 ILE ILE A . n 
A 1 595 VAL 595 595 595 VAL VAL A . n 
A 1 596 VAL 596 596 596 VAL VAL A . n 
A 1 597 ALA 597 597 597 ALA ALA A . n 
A 1 598 VAL 598 598 598 VAL VAL A . n 
A 1 599 GLU 599 599 599 GLU GLU A . n 
A 1 600 HIS 600 600 600 HIS HIS A . n 
A 1 601 ALA 601 601 601 ALA ALA A . n 
A 1 602 LEU 602 602 602 LEU LEU A . n 
A 1 603 LEU 603 603 603 LEU LEU A . n 
A 1 604 ALA 604 604 604 ALA ALA A . n 
A 1 605 LEU 605 605 605 LEU LEU A . n 
A 1 606 LYS 606 606 606 LYS LYS A . n 
A 1 607 PHE 607 607 607 PHE PHE A . n 
A 1 608 ILE 608 608 608 ILE ILE A . n 
A 1 609 LEU 609 609 609 LEU LEU A . n 
A 1 610 ALA 610 610 610 ALA ALA A . n 
A 1 611 PHE 611 611 611 PHE PHE A . n 
A 1 612 ALA 612 612 612 ALA ALA A . n 
A 1 613 ILE 613 613 613 ILE ILE A . n 
A 1 614 PRO 614 614 614 PRO PRO A . n 
A 1 615 ASP 615 615 615 ASP ASP A . n 
A 1 616 LYS 616 616 616 LYS LYS A . n 
A 1 617 PRO 617 617 617 PRO PRO A . n 
A 1 618 ARG 618 618 618 ARG ARG A . n 
A 1 619 HIS 619 619 619 HIS HIS A . n 
A 1 620 ILE 620 620 620 ILE ILE A . n 
A 1 621 GLN 621 621 621 GLN GLN A . n 
A 1 622 MET 622 622 622 MET MET A . n 
A 1 623 LYS 623 623 623 LYS LYS A . n 
A 1 624 LEU 624 624 624 LEU LEU A . n 
A 1 625 ALA 625 625 625 ALA ALA A . n 
A 1 626 ARG 626 626 626 ARG ARG A . n 
A 1 627 LEU 627 627 627 LEU LEU A . n 
A 1 628 GLU 628 628 628 GLU GLU A . n 
A 1 629 PHE 629 629 629 PHE PHE A . n 
A 1 630 GLU 630 630 630 GLU GLU A . n 
A 1 631 SER 631 631 631 SER SER A . n 
A 1 632 LEU 632 632 632 LEU LEU A . n 
A 1 633 GLU 633 633 633 GLU GLU A . n 
A 1 634 ALA 634 634 634 ALA ALA A . n 
A 1 635 LEU 635 635 635 LEU LEU A . n 
A 1 636 LYS 636 636 636 LYS LYS A . n 
A 1 637 GLN 637 637 637 GLN GLN A . n 
A 1 638 GLN 638 638 638 GLN GLN A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
A 1 640 MET 640 640 640 MET MET A . n 
A 1 641 LYS 641 641 ?   ?   ?   A . n 
A 1 642 LEU 642 642 ?   ?   ?   A . n 
A 1 643 VAL 643 643 ?   ?   ?   A . n 
A 1 644 THR 644 644 ?   ?   ?   A . n 
A 1 645 GLU 645 645 ?   ?   ?   A . n 
A 1 646 ASN 646 646 ?   ?   ?   A . n 
A 1 647 LEU 647 647 ?   ?   ?   A . n 
A 1 648 LYS 648 648 ?   ?   ?   A . n 
A 1 649 GLU 649 649 ?   ?   ?   A . n 
A 1 650 GLU 650 650 ?   ?   ?   A . n 
A 1 651 PRO 651 651 ?   ?   ?   A . n 
A 1 652 MET 652 652 ?   ?   ?   A . n 
A 1 653 GLU 653 653 ?   ?   ?   A . n 
A 1 654 SER 654 654 ?   ?   ?   A . n 
A 1 655 GLY 655 655 ?   ?   ?   A . n 
A 1 656 LYS 656 656 ?   ?   ?   A . n 
A 1 657 GLU 657 657 ?   ?   ?   A . n 
A 1 658 LYS 658 658 ?   ?   ?   A . n 
A 1 659 ALA 659 659 ?   ?   ?   A . n 
A 1 660 THR 660 660 ?   ?   ?   A . n 
A 1 661 ALA 661 661 ?   ?   ?   A . n 
A 1 662 GLU 662 662 ?   ?   ?   A . n 
A 1 663 ASN 663 663 ?   ?   ?   A . n 
A 1 664 LEU 664 664 ?   ?   ?   A . n 
A 1 665 TYR 665 665 ?   ?   ?   A . n 
A 1 666 PHE 666 666 ?   ?   ?   A . n 
A 1 667 GLN 667 667 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   LYS 2   2   ?   ?   ?   B . n 
B 1 3   VAL 3   3   ?   ?   ?   B . n 
B 1 4   THR 4   4   ?   ?   ?   B . n 
B 1 5   LEU 5   5   ?   ?   ?   B . n 
B 1 6   SER 6   6   ?   ?   ?   B . n 
B 1 7   ALA 7   7   ?   ?   ?   B . n 
B 1 8   LEU 8   8   ?   ?   ?   B . n 
B 1 9   ASP 9   9   ?   ?   ?   B . n 
B 1 10  THR 10  10  ?   ?   ?   B . n 
B 1 11  SER 11  11  ?   ?   ?   B . n 
B 1 12  GLU 12  12  ?   ?   ?   B . n 
B 1 13  SER 13  13  ?   ?   ?   B . n 
B 1 14  SER 14  14  14  SER SER B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  THR 16  16  16  THR THR B . n 
B 1 17  PRO 17  17  17  PRO PRO B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  VAL 20  20  20  VAL VAL B . n 
B 1 21  ILE 21  21  21  ILE ILE B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  LEU 23  23  23  LEU LEU B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  GLN 25  25  25  GLN GLN B . n 
B 1 26  ASP 26  26  26  ASP ASP B . n 
B 1 27  VAL 27  27  27  VAL VAL B . n 
B 1 28  LYS 28  28  28  LYS LYS B . n 
B 1 29  GLU 29  29  29  GLU GLU B . n 
B 1 30  GLU 30  30  30  GLU GLU B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  LYS 32  32  32  LYS LYS B . n 
B 1 33  GLU 33  33  33  GLU GLU B . n 
B 1 34  TRP 34  34  34  TRP TRP B . n 
B 1 35  LEU 35  35  35  LEU LEU B . n 
B 1 36  LYS 36  36  36  LYS LYS B . n 
B 1 37  ASN 37  37  37  ASN ASN B . n 
B 1 38  ARG 38  38  38  ARG ARG B . n 
B 1 39  ILE 39  39  39  ILE ILE B . n 
B 1 40  ILE 40  40  40  ILE ILE B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  LYS 42  42  42  LYS LYS B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  LYS 44  44  44  LYS LYS B . n 
B 1 45  ASP 45  45  45  ASP ASP B . n 
B 1 46  GLY 46  46  46  GLY GLY B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  GLN 49  49  49  GLN GLN B . n 
B 1 50  LEU 50  50  50  LEU LEU B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PHE 52  52  52  PHE PHE B . n 
B 1 53  ARG 53  53  53  ARG ARG B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  LEU 56  56  56  LEU LEU B . n 
B 1 57  ASN 57  57  57  ASN ASN B . n 
B 1 58  LYS 58  58  58  LYS LYS B . n 
B 1 59  TYR 59  59  59  TYR TYR B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  GLN 61  61  61  GLN GLN B . n 
B 1 62  GLU 62  62  62  GLU GLU B . n 
B 1 63  THR 63  63  63  THR THR B . n 
B 1 64  LEU 64  64  64  LEU LEU B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  ASN 66  66  66  ASN ASN B . n 
B 1 67  GLN 67  67  67  GLN GLN B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  LEU 69  69  69  LEU LEU B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  LEU 71  71  71  LEU LEU B . n 
B 1 72  VAL 72  72  72  VAL VAL B . n 
B 1 73  GLY 73  73  73  GLY GLY B . n 
B 1 74  ALA 74  74  74  ALA ALA B . n 
B 1 75  SER 75  75  75  SER SER B . n 
B 1 76  LYS 76  76  76  LYS LYS B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  ARG 78  78  78  ARG ARG B . n 
B 1 79  MET 79  79  79  MET MET B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  VAL 86  86  86  VAL VAL B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  LYS 90  90  90  LYS LYS B . n 
B 1 91  GLU 91  91  91  GLU GLU B . n 
B 1 92  CYS 92  92  92  CYS CYS B . n 
B 1 93  ASN 93  93  93  ASN ASN B . n 
B 1 94  ASP 94  94  94  ASP ASP B . n 
B 1 95  ASN 95  95  95  ASN ASN B . n 
B 1 96  THR 96  96  96  THR THR B . n 
B 1 97  MET 97  97  97  MET MET B . n 
B 1 98  ARG 98  98  98  ARG ARG B . n 
B 1 99  ALA 99  99  99  ALA ALA B . n 
B 1 100 PHE 100 100 100 PHE PHE B . n 
B 1 101 THR 101 101 101 THR THR B . n 
B 1 102 TYR 102 102 102 TYR TYR B . n 
B 1 103 ARG 103 103 103 ARG ARG B . n 
B 1 104 THR 104 104 104 THR THR B . n 
B 1 105 ARG 105 105 105 ARG ARG B . n 
B 1 106 GLN 106 106 106 GLN GLN B . n 
B 1 107 ASN 107 107 107 ASN ASN B . n 
B 1 108 PHE 108 108 108 PHE PHE B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 ASP 113 113 113 ASP ASP B . n 
B 1 114 ASN 114 114 114 ASN ASN B . n 
B 1 115 ASN 115 115 115 ASN ASN B . n 
B 1 116 ASP 116 116 116 ASP ASP B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 LEU 119 119 119 LEU LEU B . n 
B 1 120 THR 120 120 120 THR THR B . n 
B 1 121 MET 121 121 121 MET MET B . n 
B 1 122 ALA 122 122 122 ALA ALA B . n 
B 1 123 GLU 123 123 123 GLU GLU B . n 
B 1 124 CYS 124 124 124 CYS CYS B . n 
B 1 125 GLN 125 125 125 GLN GLN B . n 
B 1 126 PHE 126 126 126 PHE PHE B . n 
B 1 127 ILE 127 127 127 ILE ILE B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 LYS 129 129 129 LYS LYS B . n 
B 1 130 HIS 130 130 130 HIS HIS B . n 
B 1 131 GLU 131 131 131 GLU GLU B . n 
B 1 132 LEU 132 132 132 LEU LEU B . n 
B 1 133 GLU 133 133 133 GLU GLU B . n 
B 1 134 ASN 134 134 134 ASN ASN B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 ARG 136 136 136 ARG ARG B . n 
B 1 137 ALA 137 137 137 ALA ALA B . n 
B 1 138 LYS 138 138 138 LYS LYS B . n 
B 1 139 ASP 139 139 139 ASP ASP B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 MET 142 142 142 MET MET B . n 
B 1 143 ILE 143 143 143 ILE ILE B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 GLY 145 145 145 GLY GLY B . n 
B 1 146 TYR 146 146 146 TYR TYR B . n 
B 1 147 PRO 147 147 147 PRO PRO B . n 
B 1 148 GLN 148 148 148 GLN GLN B . n 
B 1 149 ALA 149 149 149 ALA ALA B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 LEU 151 151 151 LEU LEU B . n 
B 1 152 TYR 152 152 152 TYR TYR B . n 
B 1 153 PRO 153 153 153 PRO PRO B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 LEU 157 157 157 LEU LEU B . n 
B 1 158 LEU 158 158 158 LEU LEU B . n 
B 1 159 ARG 159 159 159 ARG ARG B . n 
B 1 160 ARG 160 160 160 ARG ARG B . n 
B 1 161 LEU 161 161 161 LEU LEU B . n 
B 1 162 LEU 162 162 162 LEU LEU B . n 
B 1 163 THR 163 163 163 THR THR B . n 
B 1 164 SER 164 164 164 SER SER B . n 
B 1 165 GLY 165 165 165 GLY GLY B . n 
B 1 166 ILE 166 166 166 ILE ILE B . n 
B 1 167 VAL 167 167 167 VAL VAL B . n 
B 1 168 ILE 168 168 168 ILE ILE B . n 
B 1 169 GLN 169 169 169 GLN GLN B . n 
B 1 170 VAL 170 170 170 VAL VAL B . n 
B 1 171 PHE 171 171 171 PHE PHE B . n 
B 1 172 PRO 172 172 172 PRO PRO B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 HIS 174 174 174 HIS HIS B . n 
B 1 175 ASP 175 175 175 ASP ASP B . n 
B 1 176 SER 176 176 176 SER SER B . n 
B 1 177 GLU 177 177 177 GLU GLU B . n 
B 1 178 ALA 178 178 178 ALA ALA B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 LYS 180 180 180 LYS LYS B . n 
B 1 181 LYS 181 181 181 LYS LYS B . n 
B 1 182 LEU 182 182 182 LEU LEU B . n 
B 1 183 GLU 183 183 183 GLU GLU B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 TRP 186 186 186 TRP TRP B . n 
B 1 187 TYR 187 187 187 TYR TYR B . n 
B 1 188 THR 188 188 188 THR THR B . n 
B 1 189 ARG 189 189 189 ARG ARG B . n 
B 1 190 PHE 190 190 190 PHE PHE B . n 
B 1 191 ALA 191 191 191 ALA ALA B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 LYS 193 193 193 LYS LYS B . n 
B 1 194 TYR 194 194 194 TYR TYR B . n 
B 1 195 GLN 195 195 195 GLN GLN B . n 
B 1 196 PRO 196 196 196 PRO PRO B . n 
B 1 197 ILE 197 197 197 ILE ILE B . n 
B 1 198 ASP 198 198 198 ASP ASP B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 ARG 201 201 201 ARG ARG B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 TYR 203 203 203 TYR TYR B . n 
B 1 204 PHE 204 204 204 PHE PHE B . n 
B 1 205 GLY 205 205 205 GLY GLY B . n 
B 1 206 GLU 206 206 206 GLU GLU B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ILE 208 208 208 ILE ILE B . n 
B 1 209 ALA 209 209 209 ALA ALA B . n 
B 1 210 LEU 210 210 210 LEU LEU B . n 
B 1 211 TYR 211 211 211 TYR TYR B . n 
B 1 212 PHE 212 212 212 PHE PHE B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 PHE 214 214 214 PHE PHE B . n 
B 1 215 LEU 215 215 215 LEU LEU B . n 
B 1 216 GLU 216 216 216 GLU GLU B . n 
B 1 217 TYR 217 217 217 TYR TYR B . n 
B 1 218 PHE 218 218 218 PHE PHE B . n 
B 1 219 THR 219 219 219 THR THR B . n 
B 1 220 PHE 220 220 220 PHE PHE B . n 
B 1 221 ALA 221 221 221 ALA ALA B . n 
B 1 222 LEU 222 222 222 LEU LEU B . n 
B 1 223 ILE 223 223 223 ILE ILE B . n 
B 1 224 PRO 224 224 224 PRO PRO B . n 
B 1 225 MET 225 225 225 MET MET B . n 
B 1 226 ALA 226 226 226 ALA ALA B . n 
B 1 227 VAL 227 227 227 VAL VAL B . n 
B 1 228 ILE 228 228 228 ILE ILE B . n 
B 1 229 GLY 229 229 229 GLY GLY B . n 
B 1 230 LEU 230 230 230 LEU LEU B . n 
B 1 231 PRO 231 231 231 PRO PRO B . n 
B 1 232 TYR 232 232 232 TYR TYR B . n 
B 1 233 TYR 233 233 233 TYR TYR B . n 
B 1 234 LEU 234 234 234 LEU LEU B . n 
B 1 235 PHE 235 235 235 PHE PHE B . n 
B 1 236 VAL 236 236 236 VAL VAL B . n 
B 1 237 TRP 237 237 237 TRP TRP B . n 
B 1 238 GLU 238 238 238 GLU GLU B . n 
B 1 239 ASP 239 239 239 ASP ASP B . n 
B 1 240 TYR 240 240 240 TYR TYR B . n 
B 1 241 ASP 241 241 241 ASP ASP B . n 
B 1 242 LYS 242 242 242 LYS LYS B . n 
B 1 243 TYR 243 243 243 TYR TYR B . n 
B 1 244 VAL 244 244 244 VAL VAL B . n 
B 1 245 ILE 245 245 245 ILE ILE B . n 
B 1 246 PHE 246 246 246 PHE PHE B . n 
B 1 247 ALA 247 247 247 ALA ALA B . n 
B 1 248 SER 248 248 248 SER SER B . n 
B 1 249 PHE 249 249 249 PHE PHE B . n 
B 1 250 ASN 250 250 250 ASN ASN B . n 
B 1 251 LEU 251 251 251 LEU LEU B . n 
B 1 252 ILE 252 252 252 ILE ILE B . n 
B 1 253 TRP 253 253 253 TRP TRP B . n 
B 1 254 SER 254 254 254 SER SER B . n 
B 1 255 THR 255 255 255 THR THR B . n 
B 1 256 VAL 256 256 256 VAL VAL B . n 
B 1 257 ILE 257 257 257 ILE ILE B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 GLU 259 259 259 GLU GLU B . n 
B 1 260 LEU 260 260 260 LEU LEU B . n 
B 1 261 TRP 261 261 261 TRP TRP B . n 
B 1 262 LYS 262 262 262 LYS LYS B . n 
B 1 263 ARG 263 263 263 ARG ARG B . n 
B 1 264 GLY 264 264 264 GLY GLY B . n 
B 1 265 CYS 265 265 265 CYS CYS B . n 
B 1 266 ALA 266 266 266 ALA ALA B . n 
B 1 267 ASN 267 267 267 ASN ASN B . n 
B 1 268 MET 268 268 268 MET MET B . n 
B 1 269 THR 269 269 269 THR THR B . n 
B 1 270 TYR 270 270 270 TYR TYR B . n 
B 1 271 ARG 271 271 271 ARG ARG B . n 
B 1 272 TRP 272 272 272 TRP TRP B . n 
B 1 273 GLY 273 273 273 GLY GLY B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 LEU 275 275 275 LEU LEU B . n 
B 1 276 LEU 276 276 276 LEU LEU B . n 
B 1 277 MET 277 277 277 MET MET B . n 
B 1 278 LYS 278 278 278 LYS LYS B . n 
B 1 279 ARG 279 279 279 ARG ARG B . n 
B 1 280 LYS 280 280 280 LYS LYS B . n 
B 1 281 PHE 281 281 281 PHE PHE B . n 
B 1 282 GLU 282 282 282 GLU GLU B . n 
B 1 283 GLU 283 283 283 GLU GLU B . n 
B 1 284 PRO 284 284 284 PRO PRO B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 GLY 287 287 287 GLY GLY B . n 
B 1 288 PHE 288 288 288 PHE PHE B . n 
B 1 289 HIS 289 289 289 HIS HIS B . n 
B 1 290 GLY 290 290 290 GLY GLY B . n 
B 1 291 VAL 291 291 291 VAL VAL B . n 
B 1 292 LEU 292 292 292 LEU LEU B . n 
B 1 293 GLY 293 293 293 GLY GLY B . n 
B 1 294 ILE 294 294 294 ILE ILE B . n 
B 1 295 ASN 295 295 295 ASN ASN B . n 
B 1 296 SER 296 296 296 SER SER B . n 
B 1 297 ILE 297 297 297 ILE ILE B . n 
B 1 298 THR 298 298 298 THR THR B . n 
B 1 299 GLY 299 299 299 GLY GLY B . n 
B 1 300 LYS 300 300 300 LYS LYS B . n 
B 1 301 GLU 301 301 301 GLU GLU B . n 
B 1 302 GLU 302 302 302 GLU GLU B . n 
B 1 303 PRO 303 303 303 PRO PRO B . n 
B 1 304 LEU 304 304 304 LEU LEU B . n 
B 1 305 TYR 305 305 305 TYR TYR B . n 
B 1 306 PRO 306 306 306 PRO PRO B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 TYR 308 308 308 TYR TYR B . n 
B 1 309 LYS 309 309 309 LYS LYS B . n 
B 1 310 ARG 310 310 310 ARG ARG B . n 
B 1 311 GLN 311 311 311 GLN GLN B . n 
B 1 312 LEU 312 312 312 LEU LEU B . n 
B 1 313 ARG 313 313 313 ARG ARG B . n 
B 1 314 ILE 314 314 314 ILE ILE B . n 
B 1 315 TYR 315 315 315 TYR TYR B . n 
B 1 316 LEU 316 316 316 LEU LEU B . n 
B 1 317 VAL 317 317 317 VAL VAL B . n 
B 1 318 SER 318 318 318 SER SER B . n 
B 1 319 LEU 319 319 319 LEU LEU B . n 
B 1 320 PRO 320 320 320 PRO PRO B . n 
B 1 321 PHE 321 321 321 PHE PHE B . n 
B 1 322 VAL 322 322 322 VAL VAL B . n 
B 1 323 CYS 323 323 323 CYS CYS B . n 
B 1 324 LEU 324 324 324 LEU LEU B . n 
B 1 325 CYS 325 325 325 CYS CYS B . n 
B 1 326 LEU 326 326 326 LEU LEU B . n 
B 1 327 TYR 327 327 327 TYR TYR B . n 
B 1 328 PHE 328 328 328 PHE PHE B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 TYR 331 331 331 TYR TYR B . n 
B 1 332 VAL 332 332 332 VAL VAL B . n 
B 1 333 MET 333 333 333 MET MET B . n 
B 1 334 MET 334 334 334 MET MET B . n 
B 1 335 ILE 335 335 335 ILE ILE B . n 
B 1 336 TYR 336 336 336 TYR TYR B . n 
B 1 337 PHE 337 337 337 PHE PHE B . n 
B 1 338 ASP 338 338 338 ASP ASP B . n 
B 1 339 MET 339 339 339 MET MET B . n 
B 1 340 GLU 340 340 340 GLU GLU B . n 
B 1 341 VAL 341 341 341 VAL VAL B . n 
B 1 342 TRP 342 342 342 TRP TRP B . n 
B 1 343 ALA 343 343 343 ALA ALA B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 GLY 345 345 345 GLY GLY B . n 
B 1 346 LEU 346 346 346 LEU LEU B . n 
B 1 347 HIS 347 347 347 HIS HIS B . n 
B 1 348 GLU 348 348 348 GLU GLU B . n 
B 1 349 ASN 349 349 349 ASN ASN B . n 
B 1 350 SER 350 350 350 SER SER B . n 
B 1 351 GLY 351 351 351 GLY GLY B . n 
B 1 352 SER 352 352 352 SER SER B . n 
B 1 353 GLU 353 353 353 GLU GLU B . n 
B 1 354 TRP 354 354 354 TRP TRP B . n 
B 1 355 THR 355 355 355 THR THR B . n 
B 1 356 SER 356 356 356 SER SER B . n 
B 1 357 VAL 357 357 357 VAL VAL B . n 
B 1 358 LEU 358 358 358 LEU LEU B . n 
B 1 359 LEU 359 359 359 LEU LEU B . n 
B 1 360 TYR 360 360 360 TYR TYR B . n 
B 1 361 VAL 361 361 361 VAL VAL B . n 
B 1 362 PRO 362 362 362 PRO PRO B . n 
B 1 363 SER 363 363 363 SER SER B . n 
B 1 364 ILE 364 364 364 ILE ILE B . n 
B 1 365 ILE 365 365 365 ILE ILE B . n 
B 1 366 TYR 366 366 366 TYR TYR B . n 
B 1 367 ALA 367 367 367 ALA ALA B . n 
B 1 368 ILE 368 368 368 ILE ILE B . n 
B 1 369 VAL 369 369 369 VAL VAL B . n 
B 1 370 ILE 370 370 370 ILE ILE B . n 
B 1 371 GLU 371 371 371 GLU GLU B . n 
B 1 372 ILE 372 372 372 ILE ILE B . n 
B 1 373 MET 373 373 373 MET MET B . n 
B 1 374 ASN 374 374 374 ASN ASN B . n 
B 1 375 ARG 375 375 375 ARG ARG B . n 
B 1 376 LEU 376 376 376 LEU LEU B . n 
B 1 377 TYR 377 377 377 TYR TYR B . n 
B 1 378 ARG 378 378 378 ARG ARG B . n 
B 1 379 TYR 379 379 379 TYR TYR B . n 
B 1 380 ALA 380 380 380 ALA ALA B . n 
B 1 381 ALA 381 381 381 ALA ALA B . n 
B 1 382 GLU 382 382 382 GLU GLU B . n 
B 1 383 PHE 383 383 383 PHE PHE B . n 
B 1 384 LEU 384 384 384 LEU LEU B . n 
B 1 385 THR 385 385 385 THR THR B . n 
B 1 386 SER 386 386 386 SER SER B . n 
B 1 387 TRP 387 387 387 TRP TRP B . n 
B 1 388 GLU 388 388 388 GLU GLU B . n 
B 1 389 ASN 389 389 389 ASN ASN B . n 
B 1 390 HIS 390 390 390 HIS HIS B . n 
B 1 391 ARG 391 391 391 ARG ARG B . n 
B 1 392 LEU 392 392 392 LEU LEU B . n 
B 1 393 GLU 393 393 393 GLU GLU B . n 
B 1 394 SER 394 394 394 SER SER B . n 
B 1 395 ALA 395 395 395 ALA ALA B . n 
B 1 396 TYR 396 396 396 TYR TYR B . n 
B 1 397 GLN 397 397 397 GLN GLN B . n 
B 1 398 ASN 398 398 398 ASN ASN B . n 
B 1 399 HIS 399 399 399 HIS HIS B . n 
B 1 400 LEU 400 400 400 LEU LEU B . n 
B 1 401 ILE 401 401 401 ILE ILE B . n 
B 1 402 LEU 402 402 402 LEU LEU B . n 
B 1 403 LYS 403 403 403 LYS LYS B . n 
B 1 404 VAL 404 404 404 VAL VAL B . n 
B 1 405 LEU 405 405 405 LEU LEU B . n 
B 1 406 VAL 406 406 406 VAL VAL B . n 
B 1 407 PHE 407 407 407 PHE PHE B . n 
B 1 408 ASN 408 408 408 ASN ASN B . n 
B 1 409 PHE 409 409 409 PHE PHE B . n 
B 1 410 LEU 410 410 410 LEU LEU B . n 
B 1 411 ASN 411 411 411 ASN ASN B . n 
B 1 412 CYS 412 412 412 CYS CYS B . n 
B 1 413 PHE 413 413 413 PHE PHE B . n 
B 1 414 ALA 414 414 414 ALA ALA B . n 
B 1 415 SER 415 415 415 SER SER B . n 
B 1 416 LEU 416 416 416 LEU LEU B . n 
B 1 417 PHE 417 417 417 PHE PHE B . n 
B 1 418 TYR 418 418 418 TYR TYR B . n 
B 1 419 ILE 419 419 419 ILE ILE B . n 
B 1 420 ALA 420 420 420 ALA ALA B . n 
B 1 421 PHE 421 421 421 PHE PHE B . n 
B 1 422 VAL 422 422 422 VAL VAL B . n 
B 1 423 LEU 423 423 423 LEU LEU B . n 
B 1 424 LYS 424 424 424 LYS LYS B . n 
B 1 425 ASP 425 425 425 ASP ASP B . n 
B 1 426 MET 426 426 426 MET MET B . n 
B 1 427 LYS 427 427 427 LYS LYS B . n 
B 1 428 LEU 428 428 428 LEU LEU B . n 
B 1 429 LEU 429 429 429 LEU LEU B . n 
B 1 430 ARG 430 430 430 ARG ARG B . n 
B 1 431 GLN 431 431 431 GLN GLN B . n 
B 1 432 SER 432 432 432 SER SER B . n 
B 1 433 LEU 433 433 433 LEU LEU B . n 
B 1 434 ALA 434 434 434 ALA ALA B . n 
B 1 435 THR 435 435 435 THR THR B . n 
B 1 436 LEU 436 436 436 LEU LEU B . n 
B 1 437 LEU 437 437 437 LEU LEU B . n 
B 1 438 ILE 438 438 438 ILE ILE B . n 
B 1 439 THR 439 439 439 THR THR B . n 
B 1 440 SER 440 440 440 SER SER B . n 
B 1 441 GLN 441 441 441 GLN GLN B . n 
B 1 442 ILE 442 442 442 ILE ILE B . n 
B 1 443 LEU 443 443 443 LEU LEU B . n 
B 1 444 ASN 444 444 444 ASN ASN B . n 
B 1 445 GLN 445 445 445 GLN GLN B . n 
B 1 446 ILE 446 446 446 ILE ILE B . n 
B 1 447 MET 447 447 447 MET MET B . n 
B 1 448 GLU 448 448 448 GLU GLU B . n 
B 1 449 SER 449 449 449 SER SER B . n 
B 1 450 PHE 450 450 450 PHE PHE B . n 
B 1 451 LEU 451 451 451 LEU LEU B . n 
B 1 452 PRO 452 452 452 PRO PRO B . n 
B 1 453 TYR 453 453 453 TYR TYR B . n 
B 1 454 TRP 454 454 454 TRP TRP B . n 
B 1 455 LEU 455 455 455 LEU LEU B . n 
B 1 456 GLN 456 456 456 GLN GLN B . n 
B 1 457 ARG 457 457 457 ARG ARG B . n 
B 1 458 LYS 458 458 458 LYS LYS B . n 
B 1 459 HIS 459 459 459 HIS HIS B . n 
B 1 460 GLY 460 460 460 GLY GLY B . n 
B 1 461 VAL 461 461 461 VAL VAL B . n 
B 1 462 ARG 462 462 462 ARG ARG B . n 
B 1 463 VAL 463 463 463 VAL VAL B . n 
B 1 464 LYS 464 464 464 LYS LYS B . n 
B 1 465 ARG 465 465 465 ARG ARG B . n 
B 1 466 LYS 466 466 466 LYS LYS B . n 
B 1 467 VAL 467 467 467 VAL VAL B . n 
B 1 468 GLN 468 468 468 GLN GLN B . n 
B 1 469 ALA 469 469 469 ALA ALA B . n 
B 1 470 LEU 470 470 470 LEU LEU B . n 
B 1 471 LYS 471 471 471 LYS LYS B . n 
B 1 472 ALA 472 472 472 ALA ALA B . n 
B 1 473 ASP 473 473 473 ASP ASP B . n 
B 1 474 ILE 474 474 474 ILE ILE B . n 
B 1 475 ASP 475 475 475 ASP ASP B . n 
B 1 476 ALA 476 476 476 ALA ALA B . n 
B 1 477 THR 477 477 477 THR THR B . n 
B 1 478 LEU 478 478 478 LEU LEU B . n 
B 1 479 TYR 479 479 479 TYR TYR B . n 
B 1 480 GLU 480 480 480 GLU GLU B . n 
B 1 481 GLN 481 481 481 GLN GLN B . n 
B 1 482 VAL 482 482 482 VAL VAL B . n 
B 1 483 ILE 483 483 483 ILE ILE B . n 
B 1 484 LEU 484 484 484 LEU LEU B . n 
B 1 485 GLU 485 485 485 GLU GLU B . n 
B 1 486 LYS 486 486 486 LYS LYS B . n 
B 1 487 GLU 487 487 487 GLU GLU B . n 
B 1 488 MET 488 488 488 MET MET B . n 
B 1 489 GLY 489 489 489 GLY GLY B . n 
B 1 490 THR 490 490 490 THR THR B . n 
B 1 491 TYR 491 491 491 TYR TYR B . n 
B 1 492 LEU 492 492 492 LEU LEU B . n 
B 1 493 GLY 493 493 493 GLY GLY B . n 
B 1 494 THR 494 494 494 THR THR B . n 
B 1 495 PHE 495 495 495 PHE PHE B . n 
B 1 496 ASP 496 496 496 ASP ASP B . n 
B 1 497 ASP 497 497 497 ASP ASP B . n 
B 1 498 TYR 498 498 498 TYR TYR B . n 
B 1 499 LEU 499 499 499 LEU LEU B . n 
B 1 500 GLU 500 500 500 GLU GLU B . n 
B 1 501 LEU 501 501 501 LEU LEU B . n 
B 1 502 PHE 502 502 502 PHE PHE B . n 
B 1 503 LEU 503 503 503 LEU LEU B . n 
B 1 504 GLN 504 504 504 GLN GLN B . n 
B 1 505 PHE 505 505 505 PHE PHE B . n 
B 1 506 GLY 506 506 506 GLY GLY B . n 
B 1 507 TYR 507 507 507 TYR TYR B . n 
B 1 508 VAL 508 508 508 VAL VAL B . n 
B 1 509 SER 509 509 509 SER SER B . n 
B 1 510 LEU 510 510 510 LEU LEU B . n 
B 1 511 PHE 511 511 511 PHE PHE B . n 
B 1 512 SER 512 512 512 SER SER B . n 
B 1 513 CYS 513 513 513 CYS CYS B . n 
B 1 514 VAL 514 514 514 VAL VAL B . n 
B 1 515 TYR 515 515 515 TYR TYR B . n 
B 1 516 PRO 516 516 516 PRO PRO B . n 
B 1 517 LEU 517 517 517 LEU LEU B . n 
B 1 518 ALA 518 518 518 ALA ALA B . n 
B 1 519 ALA 519 519 519 ALA ALA B . n 
B 1 520 ALA 520 520 520 ALA ALA B . n 
B 1 521 PHE 521 521 521 PHE PHE B . n 
B 1 522 ALA 522 522 522 ALA ALA B . n 
B 1 523 VAL 523 523 523 VAL VAL B . n 
B 1 524 LEU 524 524 524 LEU LEU B . n 
B 1 525 ASN 525 525 525 ASN ASN B . n 
B 1 526 ASN 526 526 526 ASN ASN B . n 
B 1 527 PHE 527 527 527 PHE PHE B . n 
B 1 528 THR 528 528 528 THR THR B . n 
B 1 529 GLU 529 529 529 GLU GLU B . n 
B 1 530 VAL 530 530 530 VAL VAL B . n 
B 1 531 ASN 531 531 531 ASN ASN B . n 
B 1 532 SER 532 532 532 SER SER B . n 
B 1 533 ASP 533 533 533 ASP ASP B . n 
B 1 534 ALA 534 534 534 ALA ALA B . n 
B 1 535 LEU 535 535 535 LEU LEU B . n 
B 1 536 LYS 536 536 536 LYS LYS B . n 
B 1 537 MET 537 537 537 MET MET B . n 
B 1 538 CYS 538 538 538 CYS CYS B . n 
B 1 539 ARG 539 539 539 ARG ARG B . n 
B 1 540 VAL 540 540 540 VAL VAL B . n 
B 1 541 PHE 541 541 541 PHE PHE B . n 
B 1 542 LYS 542 542 542 LYS LYS B . n 
B 1 543 ARG 543 543 543 ARG ARG B . n 
B 1 544 PRO 544 544 544 PRO PRO B . n 
B 1 545 PHE 545 545 545 PHE PHE B . n 
B 1 546 SER 546 546 546 SER SER B . n 
B 1 547 GLU 547 547 547 GLU GLU B . n 
B 1 548 PRO 548 548 548 PRO PRO B . n 
B 1 549 SER 549 549 549 SER SER B . n 
B 1 550 ALA 550 550 550 ALA ALA B . n 
B 1 551 ASN 551 551 551 ASN ASN B . n 
B 1 552 ILE 552 552 552 ILE ILE B . n 
B 1 553 GLY 553 553 553 GLY GLY B . n 
B 1 554 VAL 554 554 554 VAL VAL B . n 
B 1 555 TRP 555 555 555 TRP TRP B . n 
B 1 556 GLN 556 556 556 GLN GLN B . n 
B 1 557 LEU 557 557 557 LEU LEU B . n 
B 1 558 ALA 558 558 558 ALA ALA B . n 
B 1 559 PHE 559 559 559 PHE PHE B . n 
B 1 560 GLU 560 560 560 GLU GLU B . n 
B 1 561 THR 561 561 561 THR THR B . n 
B 1 562 MET 562 562 562 MET MET B . n 
B 1 563 SER 563 563 563 SER SER B . n 
B 1 564 VAL 564 564 564 VAL VAL B . n 
B 1 565 ILE 565 565 565 ILE ILE B . n 
B 1 566 SER 566 566 566 SER SER B . n 
B 1 567 VAL 567 567 567 VAL VAL B . n 
B 1 568 VAL 568 568 568 VAL VAL B . n 
B 1 569 THR 569 569 569 THR THR B . n 
B 1 570 ASN 570 570 570 ASN ASN B . n 
B 1 571 CYS 571 571 571 CYS CYS B . n 
B 1 572 ALA 572 572 572 ALA ALA B . n 
B 1 573 LEU 573 573 573 LEU LEU B . n 
B 1 574 ILE 574 574 574 ILE ILE B . n 
B 1 575 GLY 575 575 575 GLY GLY B . n 
B 1 576 MET 576 576 576 MET MET B . n 
B 1 577 SER 577 577 577 SER SER B . n 
B 1 578 PRO 578 578 578 PRO PRO B . n 
B 1 579 GLN 579 579 579 GLN GLN B . n 
B 1 580 VAL 580 580 580 VAL VAL B . n 
B 1 581 ASN 581 581 581 ASN ASN B . n 
B 1 582 ALA 582 582 582 ALA ALA B . n 
B 1 583 VAL 583 583 583 VAL VAL B . n 
B 1 584 PHE 584 584 584 PHE PHE B . n 
B 1 585 PRO 585 585 585 PRO PRO B . n 
B 1 586 GLU 586 586 586 GLU GLU B . n 
B 1 587 SER 587 587 587 SER SER B . n 
B 1 588 LYS 588 588 588 LYS LYS B . n 
B 1 589 ALA 589 589 589 ALA ALA B . n 
B 1 590 ASP 590 590 590 ASP ASP B . n 
B 1 591 LEU 591 591 591 LEU LEU B . n 
B 1 592 ILE 592 592 592 ILE ILE B . n 
B 1 593 LEU 593 593 593 LEU LEU B . n 
B 1 594 ILE 594 594 594 ILE ILE B . n 
B 1 595 VAL 595 595 595 VAL VAL B . n 
B 1 596 VAL 596 596 596 VAL VAL B . n 
B 1 597 ALA 597 597 597 ALA ALA B . n 
B 1 598 VAL 598 598 598 VAL VAL B . n 
B 1 599 GLU 599 599 599 GLU GLU B . n 
B 1 600 HIS 600 600 600 HIS HIS B . n 
B 1 601 ALA 601 601 601 ALA ALA B . n 
B 1 602 LEU 602 602 602 LEU LEU B . n 
B 1 603 LEU 603 603 603 LEU LEU B . n 
B 1 604 ALA 604 604 604 ALA ALA B . n 
B 1 605 LEU 605 605 605 LEU LEU B . n 
B 1 606 LYS 606 606 606 LYS LYS B . n 
B 1 607 PHE 607 607 607 PHE PHE B . n 
B 1 608 ILE 608 608 608 ILE ILE B . n 
B 1 609 LEU 609 609 609 LEU LEU B . n 
B 1 610 ALA 610 610 610 ALA ALA B . n 
B 1 611 PHE 611 611 611 PHE PHE B . n 
B 1 612 ALA 612 612 612 ALA ALA B . n 
B 1 613 ILE 613 613 613 ILE ILE B . n 
B 1 614 PRO 614 614 614 PRO PRO B . n 
B 1 615 ASP 615 615 615 ASP ASP B . n 
B 1 616 LYS 616 616 616 LYS LYS B . n 
B 1 617 PRO 617 617 617 PRO PRO B . n 
B 1 618 ARG 618 618 618 ARG ARG B . n 
B 1 619 HIS 619 619 619 HIS HIS B . n 
B 1 620 ILE 620 620 620 ILE ILE B . n 
B 1 621 GLN 621 621 621 GLN GLN B . n 
B 1 622 MET 622 622 622 MET MET B . n 
B 1 623 LYS 623 623 623 LYS LYS B . n 
B 1 624 LEU 624 624 624 LEU LEU B . n 
B 1 625 ALA 625 625 625 ALA ALA B . n 
B 1 626 ARG 626 626 626 ARG ARG B . n 
B 1 627 LEU 627 627 627 LEU LEU B . n 
B 1 628 GLU 628 628 628 GLU GLU B . n 
B 1 629 PHE 629 629 629 PHE PHE B . n 
B 1 630 GLU 630 630 630 GLU GLU B . n 
B 1 631 SER 631 631 631 SER SER B . n 
B 1 632 LEU 632 632 632 LEU LEU B . n 
B 1 633 GLU 633 633 633 GLU GLU B . n 
B 1 634 ALA 634 634 634 ALA ALA B . n 
B 1 635 LEU 635 635 635 LEU LEU B . n 
B 1 636 LYS 636 636 636 LYS LYS B . n 
B 1 637 GLN 637 637 637 GLN GLN B . n 
B 1 638 GLN 638 638 638 GLN GLN B . n 
B 1 639 GLN 639 639 639 GLN GLN B . n 
B 1 640 MET 640 640 640 MET MET B . n 
B 1 641 LYS 641 641 ?   ?   ?   B . n 
B 1 642 LEU 642 642 ?   ?   ?   B . n 
B 1 643 VAL 643 643 ?   ?   ?   B . n 
B 1 644 THR 644 644 ?   ?   ?   B . n 
B 1 645 GLU 645 645 ?   ?   ?   B . n 
B 1 646 ASN 646 646 ?   ?   ?   B . n 
B 1 647 LEU 647 647 ?   ?   ?   B . n 
B 1 648 LYS 648 648 ?   ?   ?   B . n 
B 1 649 GLU 649 649 ?   ?   ?   B . n 
B 1 650 GLU 650 650 ?   ?   ?   B . n 
B 1 651 PRO 651 651 ?   ?   ?   B . n 
B 1 652 MET 652 652 ?   ?   ?   B . n 
B 1 653 GLU 653 653 ?   ?   ?   B . n 
B 1 654 SER 654 654 ?   ?   ?   B . n 
B 1 655 GLY 655 655 ?   ?   ?   B . n 
B 1 656 LYS 656 656 ?   ?   ?   B . n 
B 1 657 GLU 657 657 ?   ?   ?   B . n 
B 1 658 LYS 658 658 ?   ?   ?   B . n 
B 1 659 ALA 659 659 ?   ?   ?   B . n 
B 1 660 THR 660 660 ?   ?   ?   B . n 
B 1 661 ALA 661 661 ?   ?   ?   B . n 
B 1 662 GLU 662 662 ?   ?   ?   B . n 
B 1 663 ASN 663 663 ?   ?   ?   B . n 
B 1 664 LEU 664 664 ?   ?   ?   B . n 
B 1 665 TYR 665 665 ?   ?   ?   B . n 
B 1 666 PHE 666 666 ?   ?   ?   B . n 
B 1 667 GLN 667 667 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 CA 1 701 701 CA CA A . 
D 2 CA 1 702 702 CA CA A . 
E 2 CA 1 703 703 CA CA A . 
F 2 CA 1 701 701 CA CA B . 
G 2 CA 1 702 702 CA CA B . 
H 2 CA 1 703 703 CA CA B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2280  ? 
1 MORE         -69   ? 
1 'SSA (A^2)'  61450 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 259 ? A GLU 259 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 O   ? A ALA 610 ? A ALA 610 ? 1_555 72.6  ? 
2  OE2 ? A GLU 259 ? A GLU 259 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 O   ? A ILE 613 ? A ILE 613 ? 1_555 106.5 ? 
3  O   ? A ALA 610 ? A ALA 610 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 O   ? A ILE 613 ? A ILE 613 ? 1_555 97.6  ? 
4  OE2 ? A GLU 259 ? A GLU 259 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 OD1 ? A ASP 615 ? A ASP 615 ? 1_555 115.5 ? 
5  O   ? A ALA 610 ? A ALA 610 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 OD1 ? A ASP 615 ? A ASP 615 ? 1_555 165.2 ? 
6  O   ? A ILE 613 ? A ILE 613 ? 1_555 CA ? E CA . ? A CA 703 ? 1_555 OD1 ? A ASP 615 ? A ASP 615 ? 1_555 91.9  ? 
7  OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLN 445 ? A GLN 445 ? 1_555 125.6 ? 
8  OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 67.5  ? 
9  OE1 ? A GLN 445 ? A GLN 445 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 86.8  ? 
10 OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 66.1  ? 
11 OE1 ? A GLN 445 ? A GLN 445 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 144.1 ? 
12 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 65.7  ? 
13 OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 100.8 ? 
14 OE1 ? A GLN 445 ? A GLN 445 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 133.6 ? 
15 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 115.2 ? 
16 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 52.8  ? 
17 OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 163.5 ? 
18 OE1 ? A GLN 445 ? A GLN 445 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 70.9  ? 
19 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 116.1 ? 
20 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 100.0 ? 
21 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 62.8  ? 
22 OD1 ? A ASN 444 ? A ASN 444 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 123.3 ? 
23 OE1 ? A GLN 445 ? A GLN 445 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 85.7  ? 
24 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 69.2  ? 
25 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 63.7  ? 
26 OE2 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 67.5  ? 
27 OE1 ? A GLU 529 ? A GLU 529 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 50.7  ? 
28 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 45.9  ? 
29 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 111.9 ? 
30 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 66.4  ? 
31 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 60.0  ? 
32 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 92.9  ? 
33 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 127.6 ? 
34 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 67.7  ? 
35 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 110.8 ? 
36 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 167.5 ? 
37 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 63.8  ? 
38 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 82.3  ? 
39 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 74.1  ? 
40 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 86.6  ? 
41 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 135.2 ? 
42 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 80.9  ? 
43 OE1 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 123.8 ? 
44 OE2 ? A GLU 448 ? A GLU 448 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 122.2 ? 
45 OD1 ? A ASP 497 ? A ASP 497 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 94.6  ? 
46 OE1 ? A GLU 500 ? A GLU 500 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 134.6 ? 
47 OE2 ? A GLU 529 ? A GLU 529 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 76.4  ? 
48 OD1 ? A ASP 533 ? A ASP 533 ? 1_555 CA ? D CA . ? A CA 702 ? 1_555 OD2 ? A ASP 533 ? A ASP 533 ? 1_555 49.7  ? 
49 OE2 ? B GLU 259 ? B GLU 259 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 O   ? B ALA 610 ? B ALA 610 ? 1_555 72.6  ? 
50 OE2 ? B GLU 259 ? B GLU 259 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 O   ? B ILE 613 ? B ILE 613 ? 1_555 106.5 ? 
51 O   ? B ALA 610 ? B ALA 610 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 O   ? B ILE 613 ? B ILE 613 ? 1_555 97.6  ? 
52 OE2 ? B GLU 259 ? B GLU 259 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 OD1 ? B ASP 615 ? B ASP 615 ? 1_555 115.5 ? 
53 O   ? B ALA 610 ? B ALA 610 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 OD1 ? B ASP 615 ? B ASP 615 ? 1_555 165.3 ? 
54 O   ? B ILE 613 ? B ILE 613 ? 1_555 CA ? H CA . ? B CA 703 ? 1_555 OD1 ? B ASP 615 ? B ASP 615 ? 1_555 91.9  ? 
55 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 125.6 ? 
56 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 67.5  ? 
57 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 86.8  ? 
58 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 66.1  ? 
59 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 144.1 ? 
60 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 65.7  ? 
61 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 100.8 ? 
62 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 133.6 ? 
63 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 115.2 ? 
64 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 52.8  ? 
65 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 163.5 ? 
66 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 70.9  ? 
67 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 116.1 ? 
68 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 100.0 ? 
69 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 62.8  ? 
70 OD1 ? B ASN 444 ? B ASN 444 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 123.3 ? 
71 OE1 ? B GLN 445 ? B GLN 445 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 85.7  ? 
72 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 69.2  ? 
73 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 63.7  ? 
74 OE2 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 67.5  ? 
75 OE1 ? B GLU 529 ? B GLU 529 ? 1_555 CA ? F CA . ? B CA 701 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 50.7  ? 
76 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 45.9  ? 
77 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 111.9 ? 
78 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 66.4  ? 
79 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 60.0  ? 
80 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 92.9  ? 
81 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 127.7 ? 
82 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 67.7  ? 
83 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 110.8 ? 
84 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 167.4 ? 
85 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 63.8  ? 
86 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 82.2  ? 
87 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 74.1  ? 
88 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 86.6  ? 
89 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 135.2 ? 
90 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 80.9  ? 
91 OE1 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 123.8 ? 
92 OE2 ? B GLU 448 ? B GLU 448 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 122.2 ? 
93 OD1 ? B ASP 497 ? B ASP 497 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 94.6  ? 
94 OE1 ? B GLU 500 ? B GLU 500 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 134.7 ? 
95 OE2 ? B GLU 529 ? B GLU 529 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 76.4  ? 
96 OD1 ? B ASP 533 ? B ASP 533 ? 1_555 CA ? G CA . ? B CA 702 ? 1_555 OD2 ? B ASP 533 ? B ASP 533 ? 1_555 49.7  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-05-01 
2 'Structure model' 1 1 2019-09-11 
3 'Structure model' 1 2 2019-09-18 
4 'Structure model' 1 3 2019-11-20 
5 'Structure model' 1 4 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
3 3 'Structure model' 'Data collection'     
4 3 'Structure model' 'Database references' 
5 4 'Structure model' 'Database references' 
6 5 'Structure model' Other                 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 3 'Structure model' citation        
3 3 'Structure model' citation_author 
4 4 'Structure model' citation_author 
5 5 'Structure model' atom_sites      
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                     
2  2 'Structure model' '_citation.journal_abbrev'              
3  2 'Structure model' '_citation.journal_id_CSD'              
4  2 'Structure model' '_citation.journal_id_ISSN'             
5  2 'Structure model' '_citation.pdbx_database_id_DOI'        
6  2 'Structure model' '_citation.title'                       
7  2 'Structure model' '_citation.year'                        
8  3 'Structure model' '_citation.journal_volume'              
9  3 'Structure model' '_citation.page_first'                  
10 3 'Structure model' '_citation.page_last'                   
11 3 'Structure model' '_citation.pdbx_database_id_PubMed'     
12 3 'Structure model' '_citation.title'                       
13 4 'Structure model' '_citation_author.identifier_ORCID'     
14 5 'Structure model' '_atom_sites.fract_transf_matrix[1][1]' 
15 5 'Structure model' '_atom_sites.fract_transf_matrix[2][2]' 
16 5 'Structure model' '_atom_sites.fract_transf_matrix[3][3]' 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                1.14_3260: 
_software.pdbx_ordinal           1 
# 
_em_3d_fitting.entry_id          6R7Y 
_em_3d_fitting.id                1 
_em_3d_fitting.details           
;Refined using phenix.real_space_refine with NCS constraints and model reference restraints used (PDB id: TBC) against RELION3 post-processed map.
;
_em_3d_fitting.overall_b_value   176 
_em_3d_fitting.ref_protocol      'AB INITIO MODEL' 
_em_3d_fitting.ref_space         REAL 
_em_3d_fitting.target_criteria   'Correlation coef' 
_em_3d_fitting.method            ? 
# 
_em_3d_reconstruction.entry_id                    6R7Y 
_em_3d_reconstruction.id                          1 
_em_3d_reconstruction.algorithm                   'FOURIER SPACE' 
_em_3d_reconstruction.details                     ? 
_em_3d_reconstruction.refinement_type             ? 
_em_3d_reconstruction.image_processing_id         1 
_em_3d_reconstruction.num_class_averages          1 
_em_3d_reconstruction.num_particles               53880 
_em_3d_reconstruction.resolution                  4.2 
_em_3d_reconstruction.resolution_method           'FSC 0.143 CUT-OFF' 
_em_3d_reconstruction.symmetry_type               POINT 
_em_3d_reconstruction.method                      ? 
_em_3d_reconstruction.nominal_pixel_size          ? 
_em_3d_reconstruction.actual_pixel_size           ? 
_em_3d_reconstruction.magnification_calibration   ? 
# 
_em_buffer.id            1 
_em_buffer.details       'No additional calcium added. Background levels of calcium estimated to be ca. 500nM' 
_em_buffer.pH            7.5 
_em_buffer.specimen_id   1 
_em_buffer.name          ? 
# 
_em_entity_assembly.id                   1 
_em_entity_assembly.parent_id            0 
_em_entity_assembly.details              ? 
_em_entity_assembly.name                 'Anoctamin 10' 
_em_entity_assembly.source               RECOMBINANT 
_em_entity_assembly.type                 'ORGANELLE OR CELLULAR COMPONENT' 
_em_entity_assembly.entity_id_list       1 
_em_entity_assembly.synonym              ? 
_em_entity_assembly.oligomeric_details   ? 
# 
_em_image_scans.entry_id                6R7Y 
_em_image_scans.id                      1 
_em_image_scans.dimension_height        ? 
_em_image_scans.dimension_width         ? 
_em_image_scans.frames_per_image        20 
_em_image_scans.image_recording_id      1 
_em_image_scans.sampling_size           ? 
_em_image_scans.scanner_model           ? 
_em_image_scans.used_frames_per_image   1-20 
_em_image_scans.citation_id             ? 
_em_image_scans.number_digital_images   ? 
_em_image_scans.od_range                ? 
_em_image_scans.quant_bit_size          ? 
_em_image_scans.details                 ? 
# 
_em_imaging.id                              1 
_em_imaging.entry_id                        6R7Y 
_em_imaging.accelerating_voltage            300 
_em_imaging.alignment_procedure             'COMA FREE' 
_em_imaging.c2_aperture_diameter            50.0 
_em_imaging.calibrated_defocus_max          ? 
_em_imaging.calibrated_defocus_min          ? 
_em_imaging.calibrated_magnification        ? 
_em_imaging.cryogen                         NITROGEN 
_em_imaging.details                         ? 
_em_imaging.electron_source                 'FIELD EMISSION GUN' 
_em_imaging.illumination_mode               'SPOT SCAN' 
_em_imaging.microscope_model                'FEI TITAN KRIOS' 
_em_imaging.mode                            'BRIGHT FIELD' 
_em_imaging.nominal_cs                      2.7 
_em_imaging.nominal_defocus_max             2750 
_em_imaging.nominal_defocus_min             1000 
_em_imaging.nominal_magnification           ? 
_em_imaging.recording_temperature_maximum   ? 
_em_imaging.recording_temperature_minimum   ? 
_em_imaging.residual_tilt                   ? 
_em_imaging.specimen_holder_model           'FEI TITAN KRIOS AUTOGRID HOLDER' 
_em_imaging.specimen_id                     1 
_em_imaging.citation_id                     ? 
_em_imaging.date                            ? 
_em_imaging.temperature                     ? 
_em_imaging.tilt_angle_min                  ? 
_em_imaging.tilt_angle_max                  ? 
_em_imaging.astigmatism                     ? 
_em_imaging.detector_distance               ? 
_em_imaging.electron_beam_tilt_params       ? 
_em_imaging.specimen_holder_type            ? 
# 
_em_sample_support.id               1 
_em_sample_support.specimen_id      1 
_em_sample_support.details          ? 
_em_sample_support.grid_material    GOLD 
_em_sample_support.grid_mesh_size   300 
_em_sample_support.grid_type        'Quantifoil R1.2/1.3' 
_em_sample_support.method           ? 
_em_sample_support.film_material    ? 
# 
_em_vitrification.id                    1 
_em_vitrification.specimen_id           1 
_em_vitrification.chamber_temperature   278 
_em_vitrification.cryogen_name          ETHANE 
_em_vitrification.details               'blot for 4.5sec prior to plunging' 
_em_vitrification.humidity              100 
_em_vitrification.instrument            'FEI VITROBOT MARK IV' 
_em_vitrification.entry_id              6R7Y 
_em_vitrification.citation_id           ? 
_em_vitrification.method                ? 
_em_vitrification.temp                  ? 
_em_vitrification.time_resolved_state   ? 
# 
_em_experiment.entry_id                6R7Y 
_em_experiment.id                      1 
_em_experiment.aggregation_state       PARTICLE 
_em_experiment.reconstruction_method   'SINGLE PARTICLE' 
_em_experiment.entity_assembly_id      1 
# 
_em_single_particle_entity.entry_id              6R7Y 
_em_single_particle_entity.id                    1 
_em_single_particle_entity.image_processing_id   1 
_em_single_particle_entity.point_symmetry        C2 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 94  ? ? -97.36  30.09  
2  1 ARG A 189 ? ? -150.54 -24.28 
3  1 VAL A 236 ? ? 36.39   79.76  
4  1 TRP A 354 ? ? -94.48  43.32  
5  1 ASP A 473 ? ? -91.78  51.87  
6  1 LEU A 492 ? ? -92.50  52.17  
7  1 TYR A 515 ? ? -157.44 80.00  
8  1 ASP B 94  ? ? -97.38  30.13  
9  1 ARG B 189 ? ? -150.51 -24.25 
10 1 VAL B 236 ? ? 36.52   79.76  
11 1 TRP B 354 ? ? -94.45  43.35  
12 1 ASP B 473 ? ? -91.75  51.79  
13 1 LEU B 492 ? ? -92.49  52.17  
14 1 TYR B 515 ? ? -157.51 79.94  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ASP 26  ? CG  ? A ASP 26  CG  
2   1 Y 1 A ASP 26  ? OD1 ? A ASP 26  OD1 
3   1 Y 1 A ASP 26  ? OD2 ? A ASP 26  OD2 
4   1 Y 1 A GLU 30  ? CD  ? A GLU 30  CD  
5   1 Y 1 A GLU 30  ? OE1 ? A GLU 30  OE1 
6   1 Y 1 A GLU 30  ? OE2 ? A GLU 30  OE2 
7   1 Y 1 A GLN 61  ? CG  ? A GLN 61  CG  
8   1 Y 1 A GLN 61  ? CD  ? A GLN 61  CD  
9   1 Y 1 A GLN 61  ? OE1 ? A GLN 61  OE1 
10  1 Y 1 A GLN 61  ? NE2 ? A GLN 61  NE2 
11  1 Y 1 A GLU 62  ? CG  ? A GLU 62  CG  
12  1 Y 1 A GLU 62  ? CD  ? A GLU 62  CD  
13  1 Y 1 A GLU 62  ? OE1 ? A GLU 62  OE1 
14  1 Y 1 A GLU 62  ? OE2 ? A GLU 62  OE2 
15  1 Y 1 A GLU 84  ? CG  ? A GLU 84  CG  
16  1 Y 1 A GLU 84  ? CD  ? A GLU 84  CD  
17  1 Y 1 A GLU 84  ? OE1 ? A GLU 84  OE1 
18  1 Y 1 A GLU 84  ? OE2 ? A GLU 84  OE2 
19  1 Y 1 A GLU 133 ? CG  ? A GLU 133 CG  
20  1 Y 1 A GLU 133 ? CD  ? A GLU 133 CD  
21  1 Y 1 A GLU 133 ? OE1 ? A GLU 133 OE1 
22  1 Y 1 A GLU 133 ? OE2 ? A GLU 133 OE2 
23  1 Y 1 A LYS 138 ? CE  ? A LYS 138 CE  
24  1 Y 1 A LYS 138 ? NZ  ? A LYS 138 NZ  
25  1 Y 1 A LYS 141 ? CE  ? A LYS 141 CE  
26  1 Y 1 A LYS 141 ? NZ  ? A LYS 141 NZ  
27  1 Y 1 A LYS 150 ? CG  ? A LYS 150 CG  
28  1 Y 1 A LYS 150 ? CD  ? A LYS 150 CD  
29  1 Y 1 A LYS 150 ? CE  ? A LYS 150 CE  
30  1 Y 1 A LYS 150 ? NZ  ? A LYS 150 NZ  
31  1 Y 1 A LYS 180 ? CE  ? A LYS 180 CE  
32  1 Y 1 A LYS 180 ? NZ  ? A LYS 180 NZ  
33  1 Y 1 A ARG 189 ? CG  ? A ARG 189 CG  
34  1 Y 1 A ARG 189 ? CD  ? A ARG 189 CD  
35  1 Y 1 A ARG 189 ? NE  ? A ARG 189 NE  
36  1 Y 1 A ARG 189 ? CZ  ? A ARG 189 CZ  
37  1 Y 1 A ARG 189 ? NH1 ? A ARG 189 NH1 
38  1 Y 1 A ARG 189 ? NH2 ? A ARG 189 NH2 
39  1 Y 1 A LEU 192 ? CG  ? A LEU 192 CG  
40  1 Y 1 A LEU 192 ? CD1 ? A LEU 192 CD1 
41  1 Y 1 A LEU 192 ? CD2 ? A LEU 192 CD2 
42  1 Y 1 A LYS 193 ? CG  ? A LYS 193 CG  
43  1 Y 1 A LYS 193 ? CD  ? A LYS 193 CD  
44  1 Y 1 A LYS 193 ? CE  ? A LYS 193 CE  
45  1 Y 1 A LYS 193 ? NZ  ? A LYS 193 NZ  
46  1 Y 1 A LYS 242 ? CG  ? A LYS 242 CG  
47  1 Y 1 A LYS 242 ? CD  ? A LYS 242 CD  
48  1 Y 1 A LYS 242 ? CE  ? A LYS 242 CE  
49  1 Y 1 A LYS 242 ? NZ  ? A LYS 242 NZ  
50  1 Y 1 A LYS 278 ? CG  ? A LYS 278 CG  
51  1 Y 1 A LYS 278 ? CD  ? A LYS 278 CD  
52  1 Y 1 A LYS 278 ? CE  ? A LYS 278 CE  
53  1 Y 1 A LYS 278 ? NZ  ? A LYS 278 NZ  
54  1 Y 1 A ARG 279 ? CG  ? A ARG 279 CG  
55  1 Y 1 A ARG 279 ? CD  ? A ARG 279 CD  
56  1 Y 1 A ARG 279 ? NE  ? A ARG 279 NE  
57  1 Y 1 A ARG 279 ? CZ  ? A ARG 279 CZ  
58  1 Y 1 A ARG 279 ? NH1 ? A ARG 279 NH1 
59  1 Y 1 A ARG 279 ? NH2 ? A ARG 279 NH2 
60  1 Y 1 A LYS 280 ? CG  ? A LYS 280 CG  
61  1 Y 1 A LYS 280 ? CD  ? A LYS 280 CD  
62  1 Y 1 A LYS 280 ? CE  ? A LYS 280 CE  
63  1 Y 1 A LYS 280 ? NZ  ? A LYS 280 NZ  
64  1 Y 1 A GLU 282 ? CD  ? A GLU 282 CD  
65  1 Y 1 A GLU 282 ? OE1 ? A GLU 282 OE1 
66  1 Y 1 A GLU 282 ? OE2 ? A GLU 282 OE2 
67  1 Y 1 A GLU 302 ? CG  ? A GLU 302 CG  
68  1 Y 1 A GLU 302 ? CD  ? A GLU 302 CD  
69  1 Y 1 A GLU 302 ? OE1 ? A GLU 302 OE1 
70  1 Y 1 A GLU 302 ? OE2 ? A GLU 302 OE2 
71  1 Y 1 A GLU 348 ? CG  ? A GLU 348 CG  
72  1 Y 1 A GLU 348 ? CD  ? A GLU 348 CD  
73  1 Y 1 A GLU 348 ? OE1 ? A GLU 348 OE1 
74  1 Y 1 A GLU 348 ? OE2 ? A GLU 348 OE2 
75  1 Y 1 A SER 352 ? OG  ? A SER 352 OG  
76  1 Y 1 A LYS 424 ? CD  ? A LYS 424 CD  
77  1 Y 1 A LYS 424 ? CE  ? A LYS 424 CE  
78  1 Y 1 A LYS 424 ? NZ  ? A LYS 424 NZ  
79  1 Y 1 A LYS 466 ? CE  ? A LYS 466 CE  
80  1 Y 1 A LYS 466 ? NZ  ? A LYS 466 NZ  
81  1 Y 1 A LYS 471 ? CG  ? A LYS 471 CG  
82  1 Y 1 A LYS 471 ? CD  ? A LYS 471 CD  
83  1 Y 1 A LYS 471 ? CE  ? A LYS 471 CE  
84  1 Y 1 A LYS 471 ? NZ  ? A LYS 471 NZ  
85  1 Y 1 A ASP 473 ? CG  ? A ASP 473 CG  
86  1 Y 1 A ASP 473 ? OD1 ? A ASP 473 OD1 
87  1 Y 1 A ASP 473 ? OD2 ? A ASP 473 OD2 
88  1 Y 1 A ASP 475 ? CG  ? A ASP 475 CG  
89  1 Y 1 A ASP 475 ? OD1 ? A ASP 475 OD1 
90  1 Y 1 A ASP 475 ? OD2 ? A ASP 475 OD2 
91  1 Y 1 A GLU 586 ? CG  ? A GLU 586 CG  
92  1 Y 1 A GLU 586 ? CD  ? A GLU 586 CD  
93  1 Y 1 A GLU 586 ? OE1 ? A GLU 586 OE1 
94  1 Y 1 A GLU 586 ? OE2 ? A GLU 586 OE2 
95  1 Y 1 A GLN 638 ? CG  ? A GLN 638 CG  
96  1 Y 1 A GLN 638 ? CD  ? A GLN 638 CD  
97  1 Y 1 A GLN 638 ? OE1 ? A GLN 638 OE1 
98  1 Y 1 A GLN 638 ? NE2 ? A GLN 638 NE2 
99  1 Y 1 A GLN 639 ? CG  ? A GLN 639 CG  
100 1 Y 1 A GLN 639 ? CD  ? A GLN 639 CD  
101 1 Y 1 A GLN 639 ? OE1 ? A GLN 639 OE1 
102 1 Y 1 A GLN 639 ? NE2 ? A GLN 639 NE2 
103 1 Y 1 A MET 640 ? CG  ? A MET 640 CG  
104 1 Y 1 A MET 640 ? SD  ? A MET 640 SD  
105 1 Y 1 A MET 640 ? CE  ? A MET 640 CE  
106 1 Y 1 B ASP 26  ? CG  ? B ASP 26  CG  
107 1 Y 1 B ASP 26  ? OD1 ? B ASP 26  OD1 
108 1 Y 1 B ASP 26  ? OD2 ? B ASP 26  OD2 
109 1 Y 1 B GLU 30  ? CD  ? B GLU 30  CD  
110 1 Y 1 B GLU 30  ? OE1 ? B GLU 30  OE1 
111 1 Y 1 B GLU 30  ? OE2 ? B GLU 30  OE2 
112 1 Y 1 B GLN 61  ? CG  ? B GLN 61  CG  
113 1 Y 1 B GLN 61  ? CD  ? B GLN 61  CD  
114 1 Y 1 B GLN 61  ? OE1 ? B GLN 61  OE1 
115 1 Y 1 B GLN 61  ? NE2 ? B GLN 61  NE2 
116 1 Y 1 B GLU 62  ? CG  ? B GLU 62  CG  
117 1 Y 1 B GLU 62  ? CD  ? B GLU 62  CD  
118 1 Y 1 B GLU 62  ? OE1 ? B GLU 62  OE1 
119 1 Y 1 B GLU 62  ? OE2 ? B GLU 62  OE2 
120 1 Y 1 B GLU 84  ? CG  ? B GLU 84  CG  
121 1 Y 1 B GLU 84  ? CD  ? B GLU 84  CD  
122 1 Y 1 B GLU 84  ? OE1 ? B GLU 84  OE1 
123 1 Y 1 B GLU 84  ? OE2 ? B GLU 84  OE2 
124 1 Y 1 B GLU 133 ? CG  ? B GLU 133 CG  
125 1 Y 1 B GLU 133 ? CD  ? B GLU 133 CD  
126 1 Y 1 B GLU 133 ? OE1 ? B GLU 133 OE1 
127 1 Y 1 B GLU 133 ? OE2 ? B GLU 133 OE2 
128 1 Y 1 B LYS 138 ? CE  ? B LYS 138 CE  
129 1 Y 1 B LYS 138 ? NZ  ? B LYS 138 NZ  
130 1 Y 1 B LYS 141 ? CE  ? B LYS 141 CE  
131 1 Y 1 B LYS 141 ? NZ  ? B LYS 141 NZ  
132 1 Y 1 B LYS 150 ? CG  ? B LYS 150 CG  
133 1 Y 1 B LYS 150 ? CD  ? B LYS 150 CD  
134 1 Y 1 B LYS 150 ? CE  ? B LYS 150 CE  
135 1 Y 1 B LYS 150 ? NZ  ? B LYS 150 NZ  
136 1 Y 1 B LYS 180 ? CE  ? B LYS 180 CE  
137 1 Y 1 B LYS 180 ? NZ  ? B LYS 180 NZ  
138 1 Y 1 B ARG 189 ? CG  ? B ARG 189 CG  
139 1 Y 1 B ARG 189 ? CD  ? B ARG 189 CD  
140 1 Y 1 B ARG 189 ? NE  ? B ARG 189 NE  
141 1 Y 1 B ARG 189 ? CZ  ? B ARG 189 CZ  
142 1 Y 1 B ARG 189 ? NH1 ? B ARG 189 NH1 
143 1 Y 1 B ARG 189 ? NH2 ? B ARG 189 NH2 
144 1 Y 1 B LEU 192 ? CG  ? B LEU 192 CG  
145 1 Y 1 B LEU 192 ? CD1 ? B LEU 192 CD1 
146 1 Y 1 B LEU 192 ? CD2 ? B LEU 192 CD2 
147 1 Y 1 B LYS 193 ? CG  ? B LYS 193 CG  
148 1 Y 1 B LYS 193 ? CD  ? B LYS 193 CD  
149 1 Y 1 B LYS 193 ? CE  ? B LYS 193 CE  
150 1 Y 1 B LYS 193 ? NZ  ? B LYS 193 NZ  
151 1 Y 1 B LYS 242 ? CG  ? B LYS 242 CG  
152 1 Y 1 B LYS 242 ? CD  ? B LYS 242 CD  
153 1 Y 1 B LYS 242 ? CE  ? B LYS 242 CE  
154 1 Y 1 B LYS 242 ? NZ  ? B LYS 242 NZ  
155 1 Y 1 B LYS 278 ? CG  ? B LYS 278 CG  
156 1 Y 1 B LYS 278 ? CD  ? B LYS 278 CD  
157 1 Y 1 B LYS 278 ? CE  ? B LYS 278 CE  
158 1 Y 1 B LYS 278 ? NZ  ? B LYS 278 NZ  
159 1 Y 1 B ARG 279 ? CG  ? B ARG 279 CG  
160 1 Y 1 B ARG 279 ? CD  ? B ARG 279 CD  
161 1 Y 1 B ARG 279 ? NE  ? B ARG 279 NE  
162 1 Y 1 B ARG 279 ? CZ  ? B ARG 279 CZ  
163 1 Y 1 B ARG 279 ? NH1 ? B ARG 279 NH1 
164 1 Y 1 B ARG 279 ? NH2 ? B ARG 279 NH2 
165 1 Y 1 B LYS 280 ? CG  ? B LYS 280 CG  
166 1 Y 1 B LYS 280 ? CD  ? B LYS 280 CD  
167 1 Y 1 B LYS 280 ? CE  ? B LYS 280 CE  
168 1 Y 1 B LYS 280 ? NZ  ? B LYS 280 NZ  
169 1 Y 1 B GLU 282 ? CD  ? B GLU 282 CD  
170 1 Y 1 B GLU 282 ? OE1 ? B GLU 282 OE1 
171 1 Y 1 B GLU 282 ? OE2 ? B GLU 282 OE2 
172 1 Y 1 B GLU 302 ? CG  ? B GLU 302 CG  
173 1 Y 1 B GLU 302 ? CD  ? B GLU 302 CD  
174 1 Y 1 B GLU 302 ? OE1 ? B GLU 302 OE1 
175 1 Y 1 B GLU 302 ? OE2 ? B GLU 302 OE2 
176 1 Y 1 B GLU 348 ? CG  ? B GLU 348 CG  
177 1 Y 1 B GLU 348 ? CD  ? B GLU 348 CD  
178 1 Y 1 B GLU 348 ? OE1 ? B GLU 348 OE1 
179 1 Y 1 B GLU 348 ? OE2 ? B GLU 348 OE2 
180 1 Y 1 B SER 352 ? OG  ? B SER 352 OG  
181 1 Y 1 B LYS 424 ? CD  ? B LYS 424 CD  
182 1 Y 1 B LYS 424 ? CE  ? B LYS 424 CE  
183 1 Y 1 B LYS 424 ? NZ  ? B LYS 424 NZ  
184 1 Y 1 B LYS 466 ? CE  ? B LYS 466 CE  
185 1 Y 1 B LYS 466 ? NZ  ? B LYS 466 NZ  
186 1 Y 1 B LYS 471 ? CG  ? B LYS 471 CG  
187 1 Y 1 B LYS 471 ? CD  ? B LYS 471 CD  
188 1 Y 1 B LYS 471 ? CE  ? B LYS 471 CE  
189 1 Y 1 B LYS 471 ? NZ  ? B LYS 471 NZ  
190 1 Y 1 B ASP 473 ? CG  ? B ASP 473 CG  
191 1 Y 1 B ASP 473 ? OD1 ? B ASP 473 OD1 
192 1 Y 1 B ASP 473 ? OD2 ? B ASP 473 OD2 
193 1 Y 1 B ASP 475 ? CG  ? B ASP 475 CG  
194 1 Y 1 B ASP 475 ? OD1 ? B ASP 475 OD1 
195 1 Y 1 B ASP 475 ? OD2 ? B ASP 475 OD2 
196 1 Y 1 B GLU 586 ? CG  ? B GLU 586 CG  
197 1 Y 1 B GLU 586 ? CD  ? B GLU 586 CD  
198 1 Y 1 B GLU 586 ? OE1 ? B GLU 586 OE1 
199 1 Y 1 B GLU 586 ? OE2 ? B GLU 586 OE2 
200 1 Y 1 B GLN 638 ? CG  ? B GLN 638 CG  
201 1 Y 1 B GLN 638 ? CD  ? B GLN 638 CD  
202 1 Y 1 B GLN 638 ? OE1 ? B GLN 638 OE1 
203 1 Y 1 B GLN 638 ? NE2 ? B GLN 638 NE2 
204 1 Y 1 B GLN 639 ? CG  ? B GLN 639 CG  
205 1 Y 1 B GLN 639 ? CD  ? B GLN 639 CD  
206 1 Y 1 B GLN 639 ? OE1 ? B GLN 639 OE1 
207 1 Y 1 B GLN 639 ? NE2 ? B GLN 639 NE2 
208 1 Y 1 B MET 640 ? CG  ? B MET 640 CG  
209 1 Y 1 B MET 640 ? SD  ? B MET 640 SD  
210 1 Y 1 B MET 640 ? CE  ? B MET 640 CE  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A LYS 2   ? A LYS 2   
3  1 Y 1 A VAL 3   ? A VAL 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A LEU 5   ? A LEU 5   
6  1 Y 1 A SER 6   ? A SER 6   
7  1 Y 1 A ALA 7   ? A ALA 7   
8  1 Y 1 A LEU 8   ? A LEU 8   
9  1 Y 1 A ASP 9   ? A ASP 9   
10 1 Y 1 A THR 10  ? A THR 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A GLU 12  ? A GLU 12  
13 1 Y 1 A SER 13  ? A SER 13  
14 1 Y 1 A LYS 641 ? A LYS 641 
15 1 Y 1 A LEU 642 ? A LEU 642 
16 1 Y 1 A VAL 643 ? A VAL 643 
17 1 Y 1 A THR 644 ? A THR 644 
18 1 Y 1 A GLU 645 ? A GLU 645 
19 1 Y 1 A ASN 646 ? A ASN 646 
20 1 Y 1 A LEU 647 ? A LEU 647 
21 1 Y 1 A LYS 648 ? A LYS 648 
22 1 Y 1 A GLU 649 ? A GLU 649 
23 1 Y 1 A GLU 650 ? A GLU 650 
24 1 Y 1 A PRO 651 ? A PRO 651 
25 1 Y 1 A MET 652 ? A MET 652 
26 1 Y 1 A GLU 653 ? A GLU 653 
27 1 Y 1 A SER 654 ? A SER 654 
28 1 Y 1 A GLY 655 ? A GLY 655 
29 1 Y 1 A LYS 656 ? A LYS 656 
30 1 Y 1 A GLU 657 ? A GLU 657 
31 1 Y 1 A LYS 658 ? A LYS 658 
32 1 Y 1 A ALA 659 ? A ALA 659 
33 1 Y 1 A THR 660 ? A THR 660 
34 1 Y 1 A ALA 661 ? A ALA 661 
35 1 Y 1 A GLU 662 ? A GLU 662 
36 1 Y 1 A ASN 663 ? A ASN 663 
37 1 Y 1 A LEU 664 ? A LEU 664 
38 1 Y 1 A TYR 665 ? A TYR 665 
39 1 Y 1 A PHE 666 ? A PHE 666 
40 1 Y 1 A GLN 667 ? A GLN 667 
41 1 Y 1 B MET 1   ? B MET 1   
42 1 Y 1 B LYS 2   ? B LYS 2   
43 1 Y 1 B VAL 3   ? B VAL 3   
44 1 Y 1 B THR 4   ? B THR 4   
45 1 Y 1 B LEU 5   ? B LEU 5   
46 1 Y 1 B SER 6   ? B SER 6   
47 1 Y 1 B ALA 7   ? B ALA 7   
48 1 Y 1 B LEU 8   ? B LEU 8   
49 1 Y 1 B ASP 9   ? B ASP 9   
50 1 Y 1 B THR 10  ? B THR 10  
51 1 Y 1 B SER 11  ? B SER 11  
52 1 Y 1 B GLU 12  ? B GLU 12  
53 1 Y 1 B SER 13  ? B SER 13  
54 1 Y 1 B LYS 641 ? B LYS 641 
55 1 Y 1 B LEU 642 ? B LEU 642 
56 1 Y 1 B VAL 643 ? B VAL 643 
57 1 Y 1 B THR 644 ? B THR 644 
58 1 Y 1 B GLU 645 ? B GLU 645 
59 1 Y 1 B ASN 646 ? B ASN 646 
60 1 Y 1 B LEU 647 ? B LEU 647 
61 1 Y 1 B LYS 648 ? B LYS 648 
62 1 Y 1 B GLU 649 ? B GLU 649 
63 1 Y 1 B GLU 650 ? B GLU 650 
64 1 Y 1 B PRO 651 ? B PRO 651 
65 1 Y 1 B MET 652 ? B MET 652 
66 1 Y 1 B GLU 653 ? B GLU 653 
67 1 Y 1 B SER 654 ? B SER 654 
68 1 Y 1 B GLY 655 ? B GLY 655 
69 1 Y 1 B LYS 656 ? B LYS 656 
70 1 Y 1 B GLU 657 ? B GLU 657 
71 1 Y 1 B LYS 658 ? B LYS 658 
72 1 Y 1 B ALA 659 ? B ALA 659 
73 1 Y 1 B THR 660 ? B THR 660 
74 1 Y 1 B ALA 661 ? B ALA 661 
75 1 Y 1 B GLU 662 ? B GLU 662 
76 1 Y 1 B ASN 663 ? B ASN 663 
77 1 Y 1 B LEU 664 ? B LEU 664 
78 1 Y 1 B TYR 665 ? B TYR 665 
79 1 Y 1 B PHE 666 ? B PHE 666 
80 1 Y 1 B GLN 667 ? B GLN 667 
# 
loop_
_em_buffer_component.buffer_id 
_em_buffer_component.id 
_e