data_6RKU
# 
_entry.id   6RKU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.335 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6RKU         
WWPDB D_1292101902 
EMDB  EMD-4910     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'E. coli DNA Gyrase - DNA binding and cleavage domain in State 1' 
_pdbx_database_related.db_id          EMD-4910 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6RKU 
_pdbx_database_status.recvd_initial_deposition_date   2019-04-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Vanden Broeck, A.' 1 0000-0003-0930-4249 
'Lamour, V.'        2 0000-0001-7793-4029 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                4935 
_citation.page_last                 4935 
_citation.title                     'Cryo-EM structure of the complete E. coli DNA gyrase nucleoprotein complex.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/s41467-019-12914-y 
_citation.pdbx_database_id_PubMed   31666516 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Vanden Broeck, A.' 1 ? 
primary 'Lotz, C.'          2 ? 
primary 'Ortiz, J.'         3 ? 
primary 'Lamour, V.'        4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6RKU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6RKU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA gyrase subunit A' 97088.586 2 5.6.2.3 ? ? 'GyrA subunit DNA Binding and cleavage domain' 
2 polymer     man 'DNA gyrase subunit B' 90073.922 2 5.6.2.3 ? ? 'GyrB subunit DNA Binding and cleavage domain' 
3 polymer     syn 'DNA Strand 1' 4288.818  2 ?       ? ? ?                                              
4 polymer     syn 'DNA Strand 2' 5506.578  2 ?       ? ? ?                                              
5 non-polymer syn 
;(3~{R})-3-[[4-(3,4-dihydro-2~{H}-pyrano[2,3-c]pyridin-6-ylmethylamino)piperidin-1-yl]methyl]-1,4,7-triazatricyclo[6.3.1.0^{4,12}]dodeca-6,8(12),9-triene-5,11-dione
;
448.518   1 ?       ? ? ?                                              
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'Type IIA topoisomerase subunit GyrB' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPH
GDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMP
TKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNL
YSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHA
PTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVVVTLSHQGYVKYQPLSEYEAQ
RRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEF
EEGVKVFMATANGTVKKTVLTEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERNGLVVGAVQVDDCDQIMMITD
AGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVAEPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE
;
;MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPH
GDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMP
TKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNL
YSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHA
PTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVVVTLSHQGYVKYQPLSEYEAQ
RRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEF
EEGVKVFMATANGTVKKTVLTEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERNGLVVGAVQVDDCDQIMMITD
AGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVAEPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE
;
A,C ? 
2 'polypeptide(L)'        no no 
;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT
GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET
EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNI
FYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLI
AVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREMTRRKGALDL
AGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGR
DEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIA
LDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQTVTRWVNALVSELNDK
EQHGSQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFE
QALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAA
NIDI
;
;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT
GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET
EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNI
FYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLI
AVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREMTRRKGALDL
AGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGR
DEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIA
LDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQTVTRWVNALVSELNDK
EQHGSQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFE
QALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAA
NIDI
;
B,D ? 
3 polydeoxyribonucleotide no no '(DA)(DT)(DC)(DA)(DT)(DA)(DA)(DG)(DC)(DC)(DG)(DT)(DA)(DG)' ATCATAAGCCGTAG F,E ? 
4 polydeoxyribonucleotide no no '(DG)(DT)(DA)(DC)(DC)(DT)(DA)(DC)(DG)(DG)(DC)(DT)(DT)(DA)(DT)(DG)(DA)(DT)' GTACCTACGGCTTATGAT G,H 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASP n 
1 4   LEU n 
1 5   ALA n 
1 6   ARG n 
1 7   GLU n 
1 8   ILE n 
1 9   THR n 
1 10  PRO n 
1 11  VAL n 
1 12  ASN n 
1 13  ILE n 
1 14  GLU n 
1 15  GLU n 
1 16  GLU n 
1 17  LEU n 
1 18  LYS n 
1 19  SER n 
1 20  SER n 
1 21  TYR n 
1 22  LEU n 
1 23  ASP n 
1 24  TYR n 
1 25  ALA n 
1 26  MET n 
1 27  SER n 
1 28  VAL n 
1 29  ILE n 
1 30  VAL n 
1 31  GLY n 
1 32  ARG n 
1 33  ALA n 
1 34  LEU n 
1 35  PRO n 
1 36  ASP n 
1 37  VAL n 
1 38  ARG n 
1 39  ASP n 
1 40  GLY n 
1 41  LEU n 
1 42  LYS n 
1 43  PRO n 
1 44  VAL n 
1 45  HIS n 
1 46  ARG n 
1 47  ARG n 
1 48  VAL n 
1 49  LEU n 
1 50  TYR n 
1 51  ALA n 
1 52  MET n 
1 53  ASN n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  ASN n 
1 58  ASP n 
1 59  TRP n 
1 60  ASN n 
1 61  LYS n 
1 62  ALA n 
1 63  TYR n 
1 64  LYS n 
1 65  LYS n 
1 66  SER n 
1 67  ALA n 
1 68  ARG n 
1 69  VAL n 
1 70  VAL n 
1 71  GLY n 
1 72  ASP n 
1 73  VAL n 
1 74  ILE n 
1 75  GLY n 
1 76  LYS n 
1 77  TYR n 
1 78  HIS n 
1 79  PRO n 
1 80  HIS n 
1 81  GLY n 
1 82  ASP n 
1 83  SER n 
1 84  ALA n 
1 85  VAL n 
1 86  TYR n 
1 87  ASP n 
1 88  THR n 
1 89  ILE n 
1 90  VAL n 
1 91  ARG n 
1 92  MET n 
1 93  ALA n 
1 94  GLN n 
1 95  PRO n 
1 96  PHE n 
1 97  SER n 
1 98  LEU n 
1 99  ARG n 
1 100 TYR n 
1 101 MET n 
1 102 LEU n 
1 103 VAL n 
1 104 ASP n 
1 105 GLY n 
1 106 GLN n 
1 107 GLY n 
1 108 ASN n 
1 109 PHE n 
1 110 GLY n 
1 111 SER n 
1 112 ILE n 
1 113 ASP n 
1 114 GLY n 
1 115 ASP n 
1 116 SER n 
1 117 ALA n 
1 118 ALA n 
1 119 ALA n 
1 120 MET n 
1 121 ARG n 
1 122 TYR n 
1 123 THR n 
1 124 GLU n 
1 125 ILE n 
1 126 ARG n 
1 127 LEU n 
1 128 ALA n 
1 129 LYS n 
1 130 ILE n 
1 131 ALA n 
1 132 HIS n 
1 133 GLU n 
1 134 LEU n 
1 135 MET n 
1 136 ALA n 
1 137 ASP n 
1 138 LEU n 
1 139 GLU n 
1 140 LYS n 
1 141 GLU n 
1 142 THR n 
1 143 VAL n 
1 144 ASP n 
1 145 PHE n 
1 146 VAL n 
1 147 ASP n 
1 148 ASN n 
1 149 TYR n 
1 150 ASP n 
1 151 GLY n 
1 152 THR n 
1 153 GLU n 
1 154 LYS n 
1 155 ILE n 
1 156 PRO n 
1 157 ASP n 
1 158 VAL n 
1 159 MET n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ILE n 
1 164 PRO n 
1 165 ASN n 
1 166 LEU n 
1 167 LEU n 
1 168 VAL n 
1 169 ASN n 
1 170 GLY n 
1 171 SER n 
1 172 SER n 
1 173 GLY n 
1 174 ILE n 
1 175 ALA n 
1 176 VAL n 
1 177 GLY n 
1 178 MET n 
1 179 ALA n 
1 180 THR n 
1 181 ASN n 
1 182 ILE n 
1 183 PRO n 
1 184 PRO n 
1 185 HIS n 
1 186 ASN n 
1 187 LEU n 
1 188 THR n 
1 189 GLU n 
1 190 VAL n 
1 191 ILE n 
1 192 ASN n 
1 193 GLY n 
1 194 CYS n 
1 195 LEU n 
1 196 ALA n 
1 197 TYR n 
1 198 ILE n 
1 199 ASP n 
1 200 ASP n 
1 201 GLU n 
1 202 ASP n 
1 203 ILE n 
1 204 SER n 
1 205 ILE n 
1 206 GLU n 
1 207 GLY n 
1 208 LEU n 
1 209 MET n 
1 210 GLU n 
1 211 HIS n 
1 212 ILE n 
1 213 PRO n 
1 214 GLY n 
1 215 PRO n 
1 216 ASP n 
1 217 PHE n 
1 218 PRO n 
1 219 THR n 
1 220 ALA n 
1 221 ALA n 
1 222 ILE n 
1 223 ILE n 
1 224 ASN n 
1 225 GLY n 
1 226 ARG n 
1 227 ARG n 
1 228 GLY n 
1 229 ILE n 
1 230 GLU n 
1 231 GLU n 
1 232 ALA n 
1 233 TYR n 
1 234 ARG n 
1 235 THR n 
1 236 GLY n 
1 237 ARG n 
1 238 GLY n 
1 239 LYS n 
1 240 VAL n 
1 241 TYR n 
1 242 ILE n 
1 243 ARG n 
1 244 ALA n 
1 245 ARG n 
1 246 ALA n 
1 247 GLU n 
1 248 VAL n 
1 249 GLU n 
1 250 VAL n 
1 251 ASP n 
1 252 ALA n 
1 253 LYS n 
1 254 THR n 
1 255 GLY n 
1 256 ARG n 
1 257 GLU n 
1 258 THR n 
1 259 ILE n 
1 260 ILE n 
1 261 VAL n 
1 262 HIS n 
1 263 GLU n 
1 264 ILE n 
1 265 PRO n 
1 266 TYR n 
1 267 GLN n 
1 268 VAL n 
1 269 ASN n 
1 270 LYS n 
1 271 ALA n 
1 272 ARG n 
1 273 LEU n 
1 274 ILE n 
1 275 GLU n 
1 276 LYS n 
1 277 ILE n 
1 278 ALA n 
1 279 GLU n 
1 280 LEU n 
1 281 VAL n 
1 282 LYS n 
1 283 GLU n 
1 284 LYS n 
1 285 ARG n 
1 286 VAL n 
1 287 GLU n 
1 288 GLY n 
1 289 ILE n 
1 290 SER n 
1 291 ALA n 
1 292 LEU n 
1 293 ARG n 
1 294 ASP n 
1 295 GLU n 
1 296 SER n 
1 297 ASP n 
1 298 LYS n 
1 299 ASP n 
1 300 GLY n 
1 301 MET n 
1 302 ARG n 
1 303 ILE n 
1 304 VAL n 
1 305 ILE n 
1 306 GLU n 
1 307 VAL n 
1 308 LYS n 
1 309 ARG n 
1 310 ASP n 
1 311 ALA n 
1 312 VAL n 
1 313 GLY n 
1 314 GLU n 
1 315 VAL n 
1 316 VAL n 
1 317 LEU n 
1 318 ASN n 
1 319 ASN n 
1 320 LEU n 
1 321 TYR n 
1 322 SER n 
1 323 GLN n 
1 324 THR n 
1 325 GLN n 
1 326 LEU n 
1 327 GLN n 
1 328 VAL n 
1 329 SER n 
1 330 PHE n 
1 331 GLY n 
1 332 ILE n 
1 333 ASN n 
1 334 MET n 
1 335 VAL n 
1 336 ALA n 
1 337 LEU n 
1 338 HIS n 
1 339 HIS n 
1 340 GLY n 
1 341 GLN n 
1 342 PRO n 
1 343 LYS n 
1 344 ILE n 
1 345 MET n 
1 346 ASN n 
1 347 LEU n 
1 348 LYS n 
1 349 ASP n 
1 350 ILE n 
1 351 ILE n 
1 352 ALA n 
1 353 ALA n 
1 354 PHE n 
1 355 VAL n 
1 356 ARG n 
1 357 HIS n 
1 358 ARG n 
1 359 ARG n 
1 360 GLU n 
1 361 VAL n 
1 362 VAL n 
1 363 THR n 
1 364 ARG n 
1 365 ARG n 
1 366 THR n 
1 367 ILE n 
1 368 PHE n 
1 369 GLU n 
1 370 LEU n 
1 371 ARG n 
1 372 LYS n 
1 373 ALA n 
1 374 ARG n 
1 375 ASP n 
1 376 ARG n 
1 377 ALA n 
1 378 HIS n 
1 379 ILE n 
1 380 LEU n 
1 381 GLU n 
1 382 ALA n 
1 383 LEU n 
1 384 ALA n 
1 385 VAL n 
1 386 ALA n 
1 387 LEU n 
1 388 ALA n 
1 389 ASN n 
1 390 ILE n 
1 391 ASP n 
1 392 PRO n 
1 393 ILE n 
1 394 ILE n 
1 395 GLU n 
1 396 LEU n 
1 397 ILE n 
1 398 ARG n 
1 399 HIS n 
1 400 ALA n 
1 401 PRO n 
1 402 THR n 
1 403 PRO n 
1 404 ALA n 
1 405 GLU n 
1 406 ALA n 
1 407 LYS n 
1 408 THR n 
1 409 ALA n 
1 410 LEU n 
1 411 VAL n 
1 412 ALA n 
1 413 ASN n 
1 414 PRO n 
1 415 TRP n 
1 416 GLN n 
1 417 LEU n 
1 418 GLY n 
1 419 ASN n 
1 420 VAL n 
1 421 ALA n 
1 422 ALA n 
1 423 MET n 
1 424 LEU n 
1 425 GLU n 
1 426 ARG n 
1 427 ALA n 
1 428 GLY n 
1 429 ASP n 
1 430 ASP n 
1 431 ALA n 
1 432 ALA n 
1 433 ARG n 
1 434 PRO n 
1 435 GLU n 
1 436 TRP n 
1 437 LEU n 
1 438 GLU n 
1 439 PRO n 
1 440 GLU n 
1 441 PHE n 
1 442 GLY n 
1 443 VAL n 
1 444 ARG n 
1 445 ASP n 
1 446 GLY n 
1 447 LEU n 
1 448 TYR n 
1 449 TYR n 
1 450 LEU n 
1 451 THR n 
1 452 GLU n 
1 453 GLN n 
1 454 GLN n 
1 455 ALA n 
1 456 GLN n 
1 457 ALA n 
1 458 ILE n 
1 459 LEU n 
1 460 ASP n 
1 461 LEU n 
1 462 ARG n 
1 463 LEU n 
1 464 GLN n 
1 465 LYS n 
1 466 LEU n 
1 467 THR n 
1 468 GLY n 
1 469 LEU n 
1 470 GLU n 
1 471 HIS n 
1 472 GLU n 
1 473 LYS n 
1 474 LEU n 
1 475 LEU n 
1 476 ASP n 
1 477 GLU n 
1 478 TYR n 
1 479 LYS n 
1 480 GLU n 
1 481 LEU n 
1 482 LEU n 
1 483 ASP n 
1 484 GLN n 
1 485 ILE n 
1 486 ALA n 
1 487 GLU n 
1 488 LEU n 
1 489 LEU n 
1 490 ARG n 
1 491 ILE n 
1 492 LEU n 
1 493 GLY n 
1 494 SER n 
1 495 ALA n 
1 496 ASP n 
1 497 ARG n 
1 498 LEU n 
1 499 MET n 
1 500 GLU n 
1 501 VAL n 
1 502 ILE n 
1 503 ARG n 
1 504 GLU n 
1 505 GLU n 
1 506 LEU n 
1 507 GLU n 
1 508 LEU n 
1 509 VAL n 
1 510 ARG n 
1 511 GLU n 
1 512 GLN n 
1 513 PHE n 
1 514 GLY n 
1 515 ASP n 
1 516 LYS n 
1 517 ARG n 
1 518 ARG n 
1 519 THR n 
1 520 GLU n 
1 521 ILE n 
1 522 THR n 
1 523 ALA n 
1 524 ASN n 
1 525 SER n 
1 526 ALA n 
1 527 ASP n 
1 528 ILE n 
1 529 ASN n 
1 530 LEU n 
1 531 GLU n 
1 532 ASP n 
1 533 LEU n 
1 534 ILE n 
1 535 THR n 
1 536 GLN n 
1 537 GLU n 
1 538 ASP n 
1 539 VAL n 
1 540 VAL n 
1 541 VAL n 
1 542 THR n 
1 543 LEU n 
1 544 SER n 
1 545 HIS n 
1 546 GLN n 
1 547 GLY n 
1 548 TYR n 
1 549 VAL n 
1 550 LYS n 
1 551 TYR n 
1 552 GLN n 
1 553 PRO n 
1 554 LEU n 
1 555 SER n 
1 556 GLU n 
1 557 TYR n 
1 558 GLU n 
1 559 ALA n 
1 560 GLN n 
1 561 ARG n 
1 562 ARG n 
1 563 GLY n 
1 564 GLY n 
1 565 LYS n 
1 566 GLY n 
1 567 LYS n 
1 568 SER n 
1 569 ALA n 
1 570 ALA n 
1 571 ARG n 
1 572 ILE n 
1 573 LYS n 
1 574 GLU n 
1 575 GLU n 
1 576 ASP n 
1 577 PHE n 
1 578 ILE n 
1 579 ASP n 
1 580 ARG n 
1 581 LEU n 
1 582 LEU n 
1 583 VAL n 
1 584 ALA n 
1 585 ASN n 
1 586 THR n 
1 587 HIS n 
1 588 ASP n 
1 589 HIS n 
1 590 ILE n 
1 591 LEU n 
1 592 CYS n 
1 593 PHE n 
1 594 SER n 
1 595 SER n 
1 596 ARG n 
1 597 GLY n 
1 598 ARG n 
1 599 VAL n 
1 600 TYR n 
1 601 SER n 
1 602 MET n 
1 603 LYS n 
1 604 VAL n 
1 605 TYR n 
1 606 GLN n 
1 607 LEU n 
1 608 PRO n 
1 609 GLU n 
1 610 ALA n 
1 611 THR n 
1 612 ARG n 
1 613 GLY n 
1 614 ALA n 
1 615 ARG n 
1 616 GLY n 
1 617 ARG n 
1 618 PRO n 
1 619 ILE n 
1 620 VAL n 
1 621 ASN n 
1 622 LEU n 
1 623 LEU n 
1 624 PRO n 
1 625 LEU n 
1 626 GLU n 
1 627 GLN n 
1 628 ASP n 
1 629 GLU n 
1 630 ARG n 
1 631 ILE n 
1 632 THR n 
1 633 ALA n 
1 634 ILE n 
1 635 LEU n 
1 636 PRO n 
1 637 VAL n 
1 638 THR n 
1 639 GLU n 
1 640 PHE n 
1 641 GLU n 
1 642 GLU n 
1 643 GLY n 
1 644 VAL n 
1 645 LYS n 
1 646 VAL n 
1 647 PHE n 
1 648 MET n 
1 649 ALA n 
1 650 THR n 
1 651 ALA n 
1 652 ASN n 
1 653 GLY n 
1 654 THR n 
1 655 VAL n 
1 656 LYS n 
1 657 LYS n 
1 658 THR n 
1 659 VAL n 
1 660 LEU n 
1 661 THR n 
1 662 GLU n 
1 663 PHE n 
1 664 ASN n 
1 665 ARG n 
1 666 LEU n 
1 667 ARG n 
1 668 THR n 
1 669 ALA n 
1 670 GLY n 
1 671 LYS n 
1 672 VAL n 
1 673 ALA n 
1 674 ILE n 
1 675 LYS n 
1 676 LEU n 
1 677 VAL n 
1 678 ASP n 
1 679 GLY n 
1 680 ASP n 
1 681 GLU n 
1 682 LEU n 
1 683 ILE n 
1 684 GLY n 
1 685 VAL n 
1 686 ASP n 
1 687 LEU n 
1 688 THR n 
1 689 SER n 
1 690 GLY n 
1 691 GLU n 
1 692 ASP n 
1 693 GLU n 
1 694 VAL n 
1 695 MET n 
1 696 LEU n 
1 697 PHE n 
1 698 SER n 
1 699 ALA n 
1 700 GLU n 
1 701 GLY n 
1 702 LYS n 
1 703 VAL n 
1 704 VAL n 
1 705 ARG n 
1 706 PHE n 
1 707 LYS n 
1 708 GLU n 
1 709 SER n 
1 710 SER n 
1 711 VAL n 
1 712 ARG n 
1 713 ALA n 
1 714 MET n 
1 715 GLY n 
1 716 CYS n 
1 717 ASN n 
1 718 THR n 
1 719 THR n 
1 720 GLY n 
1 721 VAL n 
1 722 ARG n 
1 723 GLY n 
1 724 ILE n 
1 725 ARG n 
1 726 LEU n 
1 727 GLY n 
1 728 GLU n 
1 729 GLY n 
1 730 ASP n 
1 731 LYS n 
1 732 VAL n 
1 733 VAL n 
1 734 SER n 
1 735 LEU n 
1 736 ILE n 
1 737 VAL n 
1 738 PRO n 
1 739 ARG n 
1 740 GLY n 
1 741 ASP n 
1 742 GLY n 
1 743 ALA n 
1 744 ILE n 
1 745 LEU n 
1 746 THR n 
1 747 ALA n 
1 748 THR n 
1 749 GLN n 
1 750 ASN n 
1 751 GLY n 
1 752 TYR n 
1 753 GLY n 
1 754 LYS n 
1 755 ARG n 
1 756 THR n 
1 757 ALA n 
1 758 VAL n 
1 759 ALA n 
1 760 GLU n 
1 761 TYR n 
1 762 PRO n 
1 763 THR n 
1 764 LYS n 
1 765 SER n 
1 766 ARG n 
1 767 ALA n 
1 768 THR n 
1 769 LYS n 
1 770 GLY n 
1 771 VAL n 
1 772 ILE n 
1 773 SER n 
1 774 ILE n 
1 775 LYS n 
1 776 VAL n 
1 777 THR n 
1 778 GLU n 
1 779 ARG n 
1 780 ASN n 
1 781 GLY n 
1 782 LEU n 
1 783 VAL n 
1 784 VAL n 
1 785 GLY n 
1 786 ALA n 
1 787 VAL n 
1 788 GLN n 
1 789 VAL n 
1 790 ASP n 
1 791 ASP n 
1 792 CYS n 
1 793 ASP n 
1 794 GLN n 
1 795 ILE n 
1 796 MET n 
1 797 MET n 
1 798 ILE n 
1 799 THR n 
1 800 ASP n 
1 801 ALA n 
1 802 GLY n 
1 803 THR n 
1 804 LEU n 
1 805 VAL n 
1 806 ARG n 
1 807 THR n 
1 808 ARG n 
1 809 VAL n 
1 810 SER n 
1 811 GLU n 
1 812 ILE n 
1 813 SER n 
1 814 ILE n 
1 815 VAL n 
1 816 GLY n 
1 817 ARG n 
1 818 ASN n 
1 819 THR n 
1 820 GLN n 
1 821 GLY n 
1 822 VAL n 
1 823 ILE n 
1 824 LEU n 
1 825 ILE n 
1 826 ARG n 
1 827 THR n 
1 828 ALA n 
1 829 GLU n 
1 830 ASP n 
1 831 GLU n 
1 832 ASN n 
1 833 VAL n 
1 834 VAL n 
1 835 GLY n 
1 836 LEU n 
1 837 GLN n 
1 838 ARG n 
1 839 VAL n 
1 840 ALA n 
1 841 GLU n 
1 842 PRO n 
1 843 VAL n 
1 844 ASP n 
1 845 GLU n 
1 846 GLU n 
1 847 ASP n 
1 848 LEU n 
1 849 ASP n 
1 850 THR n 
1 851 ILE n 
1 852 ASP n 
1 853 GLY n 
1 854 SER n 
1 855 ALA n 
1 856 ALA n 
1 857 GLU n 
1 858 GLY n 
1 859 ASP n 
1 860 ASP n 
1 861 GLU n 
1 862 ILE n 
1 863 ALA n 
1 864 PRO n 
1 865 GLU n 
1 866 VAL n 
1 867 ASP n 
1 868 VAL n 
1 869 ASP n 
1 870 ASP n 
1 871 GLU n 
1 872 PRO n 
1 873 GLU n 
1 874 GLU n 
1 875 GLU n 
2 1   MET n 
2 2   SER n 
2 3   ASN n 
2 4   SER n 
2 5   TYR n 
2 6   ASP n 
2 7   SER n 
2 8   SER n 
2 9   SER n 
2 10  ILE n 
2 11  LYS n 
2 12  VAL n 
2 13  LEU n 
2 14  LYS n 
2 15  GLY n 
2 16  LEU n 
2 17  ASP n 
2 18  ALA n 
2 19  VAL n 
2 20  ARG n 
2 21  LYS n 
2 22  ARG n 
2 23  PRO n 
2 24  GLY n 
2 25  MET n 
2 26  TYR n 
2 27  ILE n 
2 28  GLY n 
2 29  ASP n 
2 30  THR n 
2 31  ASP n 
2 32  ASP n 
2 33  GLY n 
2 34  THR n 
2 35  GLY n 
2 36  LEU n 
2 37  HIS n 
2 38  HIS n 
2 39  MET n 
2 40  VAL n 
2 41  PHE n 
2 42  GLU n 
2 43  VAL n 
2 44  VAL n 
2 45  ASP n 
2 46  ASN n 
2 47  ALA n 
2 48  ILE n 
2 49  ASP n 
2 50  GLU n 
2 51  ALA n 
2 52  LEU n 
2 53  ALA n 
2 54  GLY n 
2 55  HIS n 
2 56  CYS n 
2 57  LYS n 
2 58  GLU n 
2 59  ILE n 
2 60  ILE n 
2 61  VAL n 
2 62  THR n 
2 63  ILE n 
2 64  HIS n 
2 65  ALA n 
2 66  ASP n 
2 67  ASN n 
2 68  SER n 
2 69  VAL n 
2 70  SER n 
2 71  VAL n 
2 72  GLN n 
2 73  ASP n 
2 74  ASP n 
2 75  GLY n 
2 76  ARG n 
2 77  GLY n 
2 78  ILE n 
2 79  PRO n 
2 80  THR n 
2 81  GLY n 
2 82  ILE n 
2 83  HIS n 
2 84  PRO n 
2 85  GLU n 
2 86  GLU n 
2 87  GLY n 
2 88  VAL n 
2 89  SER n 
2 90  ALA n 
2 91  ALA n 
2 92  GLU n 
2 93  VAL n 
2 94  ILE n 
2 95  MET n 
2 96  THR n 
2 97  VAL n 
2 98  LEU n 
2 99  HIS n 
2 100 ALA n 
2 101 GLY n 
2 102 GLY n 
2 103 LYS n 
2 104 PHE n 
2 105 ASP n 
2 106 ASP n 
2 107 ASN n 
2 108 SER n 
2 109 TYR n 
2 110 LYS n 
2 111 VAL n 
2 112 SER n 
2 113 GLY n 
2 114 GLY n 
2 115 LEU n 
2 116 HIS n 
2 117 GLY n 
2 118 VAL n 
2 119 GLY n 
2 120 VAL n 
2 121 SER n 
2 122 VAL n 
2 123 VAL n 
2 124 ASN n 
2 125 ALA n 
2 126 LEU n 
2 127 SER n 
2 128 GLN n 
2 129 LYS n 
2 130 LEU n 
2 131 GLU n 
2 132 LEU n 
2 133 VAL n 
2 134 ILE n 
2 135 GLN n 
2 136 ARG n 
2 137 GLU n 
2 138 GLY n 
2 139 LYS n 
2 140 ILE n 
2 141 HIS n 
2 142 ARG n 
2 143 GLN n 
2 144 ILE n 
2 145 TYR n 
2 146 GLU n 
2 147 HIS n 
2 148 GLY n 
2 149 VAL n 
2 150 PRO n 
2 151 GLN n 
2 152 ALA n 
2 153 PRO n 
2 154 LEU n 
2 155 ALA n 
2 156 VAL n 
2 157 THR n 
2 158 GLY n 
2 159 GLU n 
2 160 THR n 
2 161 GLU n 
2 162 LYS n 
2 163 THR n 
2 164 GLY n 
2 165 THR n 
2 166 MET n 
2 167 VAL n 
2 168 ARG n 
2 169 PHE n 
2 170 TRP n 
2 171 PRO n 
2 172 SER n 
2 173 LEU n 
2 174 GLU n 
2 175 THR n 
2 176 PHE n 
2 177 THR n 
2 178 ASN n 
2 179 VAL n 
2 180 THR n 
2 181 GLU n 
2 182 PHE n 
2 183 GLU n 
2 184 TYR n 
2 185 GLU n 
2 186 ILE n 
2 187 LEU n 
2 188 ALA n 
2 189 LYS n 
2 190 ARG n 
2 191 LEU n 
2 192 ARG n 
2 193 GLU n 
2 194 LEU n 
2 195 SER n 
2 196 PHE n 
2 197 LEU n 
2 198 ASN n 
2 199 SER n 
2 200 GLY n 
2 201 VAL n 
2 202 SER n 
2 203 ILE n 
2 204 ARG n 
2 205 LEU n 
2 206 ARG n 
2 207 ASP n 
2 208 LYS n 
2 209 ARG n 
2 210 ASP n 
2 211 GLY n 
2 212 LYS n 
2 213 GLU n 
2 214 ASP n 
2 215 HIS n 
2 216 PHE n 
2 217 HIS n 
2 218 TYR n 
2 219 GLU n 
2 220 GLY n 
2 221 GLY n 
2 222 ILE n 
2 223 LYS n 
2 224 ALA n 
2 225 PHE n 
2 226 VAL n 
2 227 GLU n 
2 228 TYR n 
2 229 LEU n 
2 230 ASN n 
2 231 LYS n 
2 232 ASN n 
2 233 LYS n 
2 234 THR n 
2 235 PRO n 
2 236 ILE n 
2 237 HIS n 
2 238 PRO n 
2 239 ASN n 
2 240 ILE n 
2 241 PHE n 
2 242 TYR n 
2 243 PHE n 
2 244 SER n 
2 245 THR n 
2 246 GLU n 
2 247 LYS n 
2 248 ASP n 
2 249 GLY n 
2 250 ILE n 
2 251 GLY n 
2 252 VAL n 
2 253 GLU n 
2 254 VAL n 
2 255 ALA n 
2 256 LEU n 
2 257 GLN n 
2 258 TRP n 
2 259 ASN n 
2 260 ASP n 
2 261 GLY n 
2 262 PHE n 
2 263 GLN n 
2 264 GLU n 
2 265 ASN n 
2 266 ILE n 
2 267 TYR n 
2 268 CYS n 
2 269 PHE n 
2 270 THR n 
2 271 ASN n 
2 272 ASN n 
2 273 ILE n 
2 274 PRO n 
2 275 GLN n 
2 276 ARG n 
2 277 ASP n 
2 278 GLY n 
2 279 GLY n 
2 280 THR n 
2 281 HIS n 
2 282 LEU n 
2 283 ALA n 
2 284 GLY n 
2 285 PHE n 
2 286 ARG n 
2 287 ALA n 
2 288 ALA n 
2 289 MET n 
2 290 THR n 
2 291 ARG n 
2 292 THR n 
2 293 LEU n 
2 294 ASN n 
2 295 ALA n 
2 296 TYR n 
2 297 MET n 
2 298 ASP n 
2 299 LYS n 
2 300 GLU n 
2 301 GLY n 
2 302 TYR n 
2 303 SER n 
2 304 LYS n 
2 305 LYS n 
2 306 ALA n 
2 307 LYS n 
2 308 VAL n 
2 309 SER n 
2 310 ALA n 
2 311 THR n 
2 312 GLY n 
2 313 ASP n 
2 314 ASP n 
2 315 ALA n 
2 316 ARG n 
2 317 GLU n 
2 318 GLY n 
2 319 LEU n 
2 320 ILE n 
2 321 ALA n 
2 322 VAL n 
2 323 VAL n 
2 324 SER n 
2 325 VAL n 
2 326 LYS n 
2 327 VAL n 
2 328 PRO n 
2 329 ASP n 
2 330 PRO n 
2 331 LYS n 
2 332 PHE n 
2 333 SER n 
2 334 SER n 
2 335 GLN n 
2 336 THR n 
2 337 LYS n 
2 338 ASP n 
2 339 LYS n 
2 340 LEU n 
2 341 VAL n 
2 342 SER n 
2 343 SER n 
2 344 GLU n 
2 345 VAL n 
2 346 LYS n 
2 347 SER n 
2 348 ALA n 
2 349 VAL n 
2 350 GLU n 
2 351 GLN n 
2 352 GLN n 
2 353 MET n 
2 354 ASN n 
2 355 GLU n 
2 356 LEU n 
2 357 LEU n 
2 358 ALA n 
2 359 GLU n 
2 360 TYR n 
2 361 LEU n 
2 362 LEU n 
2 363 GLU n 
2 364 ASN n 
2 365 PRO n 
2 366 THR n 
2 367 ASP n 
2 368 ALA n 
2 369 LYS n 
2 370 ILE n 
2 371 VAL n 
2 372 VAL n 
2 373 GLY n 
2 374 LYS n 
2 375 ILE n 
2 376 ILE n 
2 377 ASP n 
2 378 ALA n 
2 379 ALA n 
2 380 ARG n 
2 381 ALA n 
2 382 ARG n 
2 383 GLU n 
2 384 ALA n 
2 385 ALA n 
2 386 ARG n 
2 387 ARG n 
2 388 ALA n 
2 389 ARG n 
2 390 GLU n 
2 391 MET n 
2 392 THR n 
2 393 ARG n 
2 394 ARG n 
2 395 LYS n 
2 396 GLY n 
2 397 ALA n 
2 398 LEU n 
2 399 ASP n 
2 400 LEU n 
2 401 ALA n 
2 402 GLY n 
2 403 LEU n 
2 404 PRO n 
2 405 GLY n 
2 406 LYS n 
2 407 LEU n 
2 408 ALA n 
2 409 ASP n 
2 410 CYS n 
2 411 GLN n 
2 412 GLU n 
2 413 ARG n 
2 414 ASP n 
2 415 PRO n 
2 416 ALA n 
2 417 LEU n 
2 418 SER n 
2 419 GLU n 
2 420 LEU n 
2 421 TYR n 
2 422 LEU n 
2 423 VAL n 
2 424 GLU n 
2 425 GLY n 
2 426 ASP n 
2 427 SER n 
2 428 ALA n 
2 429 GLY n 
2 430 GLY n 
2 431 SER n 
2 432 ALA n 
2 433 LYS n 
2 434 GLN n 
2 435 GLY n 
2 436 ARG n 
2 437 ASN n 
2 438 ARG n 
2 439 LYS n 
2 440 ASN n 
2 441 GLN n 
2 442 ALA n 
2 443 ILE n 
2 444 LEU n 
2 445 PRO n 
2 446 LEU n 
2 447 LYS n 
2 448 GLY n 
2 449 LYS n 
2 450 ILE n 
2 451 LEU n 
2 452 ASN n 
2 453 VAL n 
2 454 GLU n 
2 455 LYS n 
2 456 ALA n 
2 457 ARG n 
2 458 PHE n 
2 459 ASP n 
2 460 LYS n 
2 461 MET n 
2 462 LEU n 
2 463 SER n 
2 464 SER n 
2 465 GLN n 
2 466 GLU n 
2 467 VAL n 
2 468 ALA n 
2 469 THR n 
2 470 LEU n 
2 471 ILE n 
2 472 THR n 
2 473 ALA n 
2 474 LEU n 
2 475 GLY n 
2 476 CYS n 
2 477 GLY n 
2 478 ILE n 
2 479 GLY n 
2 480 ARG n 
2 481 ASP n 
2 482 GLU n 
2 483 TYR n 
2 484 ASN n 
2 485 PRO n 
2 486 ASP n 
2 487 LYS n 
2 488 LEU n 
2 489 ARG n 
2 490 TYR n 
2 491 HIS n 
2 492 SER n 
2 493 ILE n 
2 494 ILE n 
2 495 ILE n 
2 496 MET n 
2 497 THR n 
2 498 ASP n 
2 499 ALA n 
2 500 ASP n 
2 501 VAL n 
2 502 ASP n 
2 503 GLY n 
2 504 SER n 
2 505 HIS n 
2 506 ILE n 
2 507 ARG n 
2 508 THR n 
2 509 LEU n 
2 510 LEU n 
2 511 LEU n 
2 512 THR n 
2 513 PHE n 
2 514 PHE n 
2 515 TYR n 
2 516 ARG n 
2 517 GLN n 
2 518 MET n 
2 519 PRO n 
2 520 GLU n 
2 521 ILE n 
2 522 VAL n 
2 523 GLU n 
2 524 ARG n 
2 525 GLY n 
2 526 HIS n 
2 527 VAL n 
2 528 TYR n 
2 529 ILE n 
2 530 ALA n 
2 531 GLN n 
2 532 PRO n 
2 533 PRO n 
2 534 LEU n 
2 535 TYR n 
2 536 LYS n 
2 537 VAL n 
2 538 LYS n 
2 539 LYS n 
2 540 GLY n 
2 541 LYS n 
2 542 GLN n 
2 543 GLU n 
2 544 GLN n 
2 545 TYR n 
2 546 ILE n 
2 547 LYS n 
2 548 ASP n 
2 549 ASP n 
2 550 GLU n 
2 551 ALA n 
2 552 MET n 
2 553 ASP n 
2 554 GLN n 
2 555 TYR n 
2 556 GLN n 
2 557 ILE n 
2 558 SER n 
2 559 ILE n 
2 560 ALA n 
2 561 LEU n 
2 562 ASP n 
2 563 GLY n 
2 564 ALA n 
2 565 THR n 
2 566 LEU n 
2 567 HIS n 
2 568 THR n 
2 569 ASN n 
2 570 ALA n 
2 571 SER n 
2 572 ALA n 
2 573 PRO n 
2 574 ALA n 
2 575 LEU n 
2 576 ALA n 
2 577 GLY n 
2 578 GLU n 
2 579 ALA n 
2 580 LEU n 
2 581 GLU n 
2 582 LYS n 
2 583 LEU n 
2 584 VAL n 
2 585 SER n 
2 586 GLU n 
2 587 TYR n 
2 588 ASN n 
2 589 ALA n 
2 590 THR n 
2 591 GLN n 
2 592 LYS n 
2 593 MET n 
2 594 ILE n 
2 595 ASN n 
2 596 ARG n 
2 597 MET n 
2 598 GLU n 
2 599 ARG n 
2 600 ARG n 
2 601 TYR n 
2 602 PRO n 
2 603 LYS n 
2 604 ALA n 
2 605 MET n 
2 606 LEU n 
2 607 LYS n 
2 608 GLU n 
2 609 LEU n 
2 610 ILE n 
2 611 TYR n 
2 612 GLN n 
2 613 PRO n 
2 614 THR n 
2 615 LEU n 
2 616 THR n 
2 617 GLU n 
2 618 ALA n 
2 619 ASP n 
2 620 LEU n 
2 621 SER n 
2 622 ASP n 
2 623 GLU n 
2 624 GLN n 
2 625 THR n 
2 626 VAL n 
2 627 THR n 
2 628 ARG n 
2 629 TRP n 
2 630 VAL n 
2 631 ASN n 
2 632 ALA n 
2 633 LEU n 
2 634 VAL n 
2 635 SER n 
2 636 GLU n 
2 637 LEU n 
2 638 ASN n 
2 639 ASP n 
2 640 LYS n 
2 641 GLU n 
2 642 GLN n 
2 643 HIS n 
2 644 GLY n 
2 645 SER n 
2 646 GLN n 
2 647 TRP n 
2 648 LYS n 
2 649 PHE n 
2 650 ASP n 
2 651 VAL n 
2 652 HIS n 
2 653 THR n 
2 654 ASN n 
2 655 ALA n 
2 656 GLU n 
2 657 GLN n 
2 658 ASN n 
2 659 LEU n 
2 660 PHE n 
2 661 GLU n 
2 662 PRO n 
2 663 ILE n 
2 664 VAL n 
2 665 ARG n 
2 666 VAL n 
2 667 ARG n 
2 668 THR n 
2 669 HIS n 
2 670 GLY n 
2 671 VAL n 
2 672 ASP n 
2 673 THR n 
2 674 ASP n 
2 675 TYR n 
2 676 PRO n 
2 677 LEU n 
2 678 ASP n 
2 679 HIS n 
2 680 GLU n 
2 681 PHE n 
2 682 ILE n 
2 683 THR n 
2 684 GLY n 
2 685 GLY n 
2 686 GLU n 
2 687 TYR n 
2 688 ARG n 
2 689 ARG n 
2 690 ILE n 
2 691 CYS n 
2 692 THR n 
2 693 LEU n 
2 694 GLY n 
2 695 GLU n 
2 696 LYS n 
2 697 LEU n 
2 698 ARG n 
2 699 GLY n 
2 700 LEU n 
2 701 LEU n 
2 702 GLU n 
2 703 GLU n 
2 704 ASP n 
2 705 ALA n 
2 706 PHE n 
2 707 ILE n 
2 708 GLU n 
2 709 ARG n 
2 710 GLY n 
2 711 GLU n 
2 712 ARG n 
2 713 ARG n 
2 714 GLN n 
2 715 PRO n 
2 716 VAL n 
2 717 ALA n 
2 718 SER n 
2 719 PHE n 
2 720 GLU n 
2 721 GLN n 
2 722 ALA n 
2 723 LEU n 
2 724 ASP n 
2 725 TRP n 
2 726 LEU n 
2 727 VAL n 
2 728 LYS n 
2 729 GLU n 
2 730 SER n 
2 731 ARG n 
2 732 ARG n 
2 733 GLY n 
2 734 LEU n 
2 735 SER n 
2 736 ILE n 
2 737 GLN n 
2 738 ARG n 
2 739 TYR n 
2 740 LYS n 
2 741 GLY n 
2 742 LEU n 
2 743 GLY n 
2 744 GLU n 
2 745 MET n 
2 746 ASN n 
2 747 PRO n 
2 748 GLU n 
2 749 GLN n 
2 750 LEU n 
2 751 TRP n 
2 752 GLU n 
2 753 THR n 
2 754 THR n 
2 755 MET n 
2 756 ASP n 
2 757 PRO n 
2 758 GLU n 
2 759 SER n 
2 760 ARG n 
2 761 ARG n 
2 762 MET n 
2 763 LEU n 
2 764 ARG n 
2 765 VAL n 
2 766 THR n 
2 767 VAL n 
2 768 LYS n 
2 769 ASP n 
2 770 ALA n 
2 771 ILE n 
2 772 ALA n 
2 773 ALA n 
2 774 ASP n 
2 775 GLN n 
2 776 LEU n 
2 777 PHE n 
2 778 THR n 
2 779 THR n 
2 780 LEU n 
2 781 MET n 
2 782 GLY n 
2 783 ASP n 
2 784 ALA n 
2 785 VAL n 
2 786 GLU n 
2 787 PRO n 
2 788 ARG n 
2 789 ARG n 
2 790 ALA n 
2 791 PHE n 
2 792 ILE n 
2 793 GLU n 
2 794 GLU n 
2 795 ASN n 
2 796 ALA n 
2 797 LEU n 
2 798 LYS n 
2 799 ALA n 
2 800 ALA n 
2 801 ASN n 
2 802 ILE n 
2 803 ASP n 
2 804 ILE n 
3 1   DA  n 
3 2   DT  n 
3 3   DC  n 
3 4   DA  n 
3 5   DT  n 
3 6   DA  n 
3 7   DA  n 
3 8   DG  n 
3 9   DC  n 
3 10  DC  n 
3 11  DG  n 
3 12  DT  n 
3 13  DA  n 
3 14  DG  n 
4 1   DG  n 
4 2   DT  n 
4 3   DA  n 
4 4   DC  n 
4 5   DC  n 
4 6   DT  n 
4 7   DA  n 
4 8   DC  n 
4 9   DG  n 
4 10  DG  n 
4 11  DC  n 
4 12  DT  n 
4 13  DT  n 
4 14  DA  n 
4 15  DT  n 
4 16  DG  n 
4 17  DA  n 
4 18  DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 875 ? ? 'gyrA, hisW, nalA, parD, b2231, JW2225'                        ? ? ? ? ? ? 
'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
2 1 sample 'Biological sequence' 1 804 ? ? 'gyrB, acrB, cou, himB, hisU, nalC, parA, pcbA, b3699, JW5625' ? ? ? ? ? ? 
'Escherichia coli (strain K12)' 83333 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
3 1 sample 1 14 'Escherichia coli' ? 562 ? 
4 1 sample 1 18 'Escherichia coli' ? 562 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP GYRA_ECOLI P0AES4 ? 1 
;MSDLAREITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPVHRRVLYAMNVLGNDWNKAYKKSARVVGDVIGKYHPH
GDSAVYDTIVRMAQPFSLRYMLVDGQGNFGSIDGDSAAAMRYTEIRLAKIAHELMADLEKETVDFVDNYDGTEKIPDVMP
TKIPNLLVNGSSGIAVGMATNIPPHNLTEVINGCLAYIDDEDISIEGLMEHIPGPDFPTAAIINGRRGIEEAYRTGRGKV
YIRARAEVEVDAKTGRETIIVHEIPYQVNKARLIEKIAELVKEKRVEGISALRDESDKDGMRIVIEVKRDAVGEVVLNNL
YSQTQLQVSFGINMVALHHGQPKIMNLKDIIAAFVRHRREVVTRRTIFELRKARDRAHILEALAVALANIDPIIELIRHA
PTPAEAKTALVANPWQLGNVAAMLERAGDDAARPEWLEPEFGVRDGLYYLTEQQAQAILDLRLQKLTGLEHEKLLDEYKE
LLDQIAELLRILGSADRLMEVIREELELVREQFGDKRRTEITANSADINLEDLITQEDVVVTLSHQGYVKYQPLSEYEAQ
RRGGKGKSAARIKEEDFIDRLLVANTHDHILCFSSRGRVYSMKVYQLPEATRGARGRPIVNLLPLEQDERITAILPVTEF
EEGVKVFMATANGTVKKTVLTEFNRLRTAGKVAIKLVDGDELIGVDLTSGEDEVMLFSAEGKVVRFKESSVRAMGCNTTG
VRGIRLGEGDKVVSLIVPRGDGAILTATQNGYGKRTAVAEYPTKSRATKGVISIKVTERNGLVVGAVQVDDCDQIMMITD
AGTLVRTRVSEISIVGRNTQGVILIRTAEDENVVGLQRVAEPVDEEDLDTIDGSAAEGDDEIAPEVDVDDEPEEE
;
1 
2 UNP GYRB_ECOLI P0AES6 ? 2 
;MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVDNAIDEALAGHCKEIIVTIHADNSVSVQDDGRGIPT
GIHPEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYEHGVPQAPLAVTGET
EKTGTMVRFWPSLETFTNVTEFEYEILAKRLRELSFLNSGVSIRLRDKRDGKEDHFHYEGGIKAFVEYLNKNKTPIHPNI
FYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLI
AVVSVKVPDPKFSSQTKDKLVSSEVKSAVEQQMNELLAEYLLENPTDAKIVVGKIIDAARAREAARRAREMTRRKGALDL
AGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGR
DEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQISIA
LDGATLHTNASAPALAGEALEKLVSEYNATQKMINRMERRYPKAMLKELIYQPTLTEADLSDEQTVTRWVNALVSELNDK
EQHGSQWKFDVHTNAEQNLFEPIVRVRTHGVDTDYPLDHEFITGGEYRRICTLGEKLRGLLEEDAFIERGERRQPVASFE
QALDWLVKESRRGLSIQRYKGLGEMNPEQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKAA
NIDI
;
1 
3 PDB 6RKU       6RKU   ? 3 ? 1 
4 PDB 6RKU       6RKU   ? 4 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6RKU A 1 ? 875 ? P0AES4 1  ? 875 ? 1  875 
2 2 6RKU B 1 ? 804 ? P0AES6 1  ? 804 ? 1  804 
3 1 6RKU C 1 ? 875 ? P0AES4 1  ? 875 ? 1  875 
4 2 6RKU D 1 ? 804 ? P0AES6 1  ? 804 ? 1  804 
5 3 6RKU F 1 ? 14  ? 6RKU   1  ? 14  ? 1  14  
6 3 6RKU E 1 ? 14  ? 6RKU   1  ? 14  ? 1  14  
7 4 6RKU G 1 ? 18  ? 6RKU   15 ? 32  ? 15 32  
8 4 6RKU H 1 ? 18  ? 6RKU   15 ? 32  ? 15 32  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2'     131.173 
JHN non-polymer         . 
;(3~{R})-3-[[4-(3,4-dihydro-2~{H}-pyrano[2,3-c]pyridin-6-ylmethylamino)piperidin-1-yl]methyl]-1,4,7-triazatricyclo[6.3.1.0^{4,12}]dodeca-6,8(12),9-triene-5,11-dione
;
? 'C24 H28 N6 O3'   448.518 
LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6RKU 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 6RKU 
_refine.pdbx_diffrn_id                           ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            . 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.003  ? 15924 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.535  ? 21802 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 12.934 ? 9552  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.039  ? 2450  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.021  ? 2694  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6RKU 
_struct.title                        'E. coli DNA Gyrase - DNA binding and cleavage domain in State 1' 
_struct.pdbx_descriptor              'DNA gyrase subunit A, DNA gyrase subunit B/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6RKU 
_struct_keywords.text            'Isomerase, Complex, DNA Gyrase, Inhibitor, DNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   ISOMERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 15  ? ARG A 32  ? GLU A 15  ARG A 32  1 ? 18 
HELX_P HELX_P2  AA2 LYS A 42  ? GLY A 56  ? LYS A 42  GLY A 56  1 ? 15 
HELX_P HELX_P3  AA3 SER A 66  ? TYR A 77  ? SER A 66  TYR A 77  1 ? 12 
HELX_P HELX_P4  AA4 ASP A 82  ? GLN A 94  ? ASP A 82  GLN A 94  1 ? 13 
HELX_P HELX_P5  AA5 PRO A 95  ? LEU A 98  ? PRO A 95  LEU A 98  5 ? 4  
HELX_P HELX_P6  AA6 ILE A 130 ? MET A 135 ? ILE A 130 MET A 135 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 164 ? ASN A 169 ? PRO A 164 ASN A 169 1 ? 6  
HELX_P HELX_P8  AA8 ASN A 186 ? ASP A 200 ? ASN A 186 ASP A 200 1 ? 15 
HELX_P HELX_P9  AA9 SER A 204 ? ILE A 212 ? SER A 204 ILE A 212 1 ? 9  
HELX_P HELX_P10 AB1 GLY A 225 ? THR A 235 ? GLY A 225 THR A 235 1 ? 11 
HELX_P HELX_P11 AB2 ASN A 269 ? GLU A 283 ? ASN A 269 GLU A 283 1 ? 15 
HELX_P HELX_P12 AB3 GLY A 313 ? THR A 324 ? GLY A 313 THR A 324 1 ? 12 
HELX_P HELX_P13 AB4 ASN A 346 ? ASN A 389 ? ASN A 346 ASN A 389 1 ? 44 
HELX_P HELX_P14 AB5 ILE A 390 ? ALA A 400 ? ILE A 390 ALA A 400 1 ? 11 
HELX_P HELX_P15 AB6 THR A 402 ? ASN A 413 ? THR A 402 ASN A 413 1 ? 12 
HELX_P HELX_P16 AB7 GLY A 418 ? ALA A 422 ? GLY A 418 ALA A 422 5 ? 5  
HELX_P HELX_P17 AB8 THR A 451 ? ASP A 460 ? THR A 451 ASP A 460 1 ? 10 
HELX_P HELX_P18 AB9 LEU A 469 ? SER A 494 ? LEU A 469 SER A 494 1 ? 26 
HELX_P HELX_P19 AC1 SER A 494 ? GLY A 514 ? SER A 494 GLY A 514 1 ? 21 
HELX_P HELX_P20 AC2 GLY B 425 ? ARG B 436 ? GLY B 425 ARG B 436 1 ? 12 
HELX_P HELX_P21 AC3 GLN B 465 ? THR B 472 ? GLN B 465 THR B 472 1 ? 8  
HELX_P HELX_P22 AC4 ASP B 500 ? MET B 518 ? ASP B 500 MET B 518 1 ? 19 
HELX_P HELX_P23 AC5 MET B 518 ? ARG B 524 ? MET B 518 ARG B 524 1 ? 7  
HELX_P HELX_P24 AC6 ASP B 548 ? LEU B 561 ? ASP B 548 LEU B 561 1 ? 14 
HELX_P HELX_P25 AC7 GLY B 577 ? GLU B 598 ? GLY B 577 GLU B 598 1 ? 22 
HELX_P HELX_P26 AC8 PRO B 602 ? LEU B 609 ? PRO B 602 LEU B 609 1 ? 8  
HELX_P HELX_P27 AC9 THR B 616 ? SER B 621 ? THR B 616 SER B 621 5 ? 6  
HELX_P HELX_P28 AD1 ASP B 622 ? GLU B 641 ? ASP B 622 GLU B 641 1 ? 20 
HELX_P HELX_P29 AD2 ASP B 678 ? GLY B 684 ? ASP B 678 GLY B 684 1 ? 7  
HELX_P HELX_P30 AD3 GLY B 684 ? GLY B 699 ? GLY B 684 GLY B 699 1 ? 16 
HELX_P HELX_P31 AD4 SER B 718 ? ARG B 732 ? SER B 718 ARG B 732 1 ? 15 
HELX_P HELX_P32 AD5 GLY B 741 ? MET B 745 ? GLY B 741 MET B 745 5 ? 5  
HELX_P HELX_P33 AD6 ASN B 746 ? MET B 755 ? ASN B 746 MET B 755 1 ? 10 
HELX_P HELX_P34 AD7 ALA B 772 ? PHE B 777 ? ALA B 772 PHE B 777 1 ? 6  
HELX_P HELX_P35 AD8 LEU B 780 ? GLU B 786 ? LEU B 780 GLU B 786 1 ? 7  
HELX_P HELX_P36 AD9 GLU C 15  ? ARG C 32  ? GLU C 15  ARG C 32  1 ? 18 
HELX_P HELX_P37 AE1 LYS C 42  ? GLY C 56  ? LYS C 42  GLY C 56  1 ? 15 
HELX_P HELX_P38 AE2 SER C 66  ? TYR C 77  ? SER C 66  TYR C 77  1 ? 12 
HELX_P HELX_P39 AE3 ASP C 82  ? GLN C 94  ? ASP C 82  GLN C 94  1 ? 13 
HELX_P HELX_P40 AE4 PRO C 95  ? LEU C 98  ? PRO C 95  LEU C 98  5 ? 4  
HELX_P HELX_P41 AE5 ILE C 130 ? MET C 135 ? ILE C 130 MET C 135 1 ? 6  
HELX_P HELX_P42 AE6 PRO C 164 ? ASN C 169 ? PRO C 164 ASN C 169 1 ? 6  
HELX_P HELX_P43 AE7 ASN C 186 ? ASP C 200 ? ASN C 186 ASP C 200 1 ? 15 
HELX_P HELX_P44 AE8 SER C 204 ? ILE C 212 ? SER C 204 ILE C 212 1 ? 9  
HELX_P HELX_P45 AE9 GLY C 225 ? THR C 235 ? GLY C 225 THR C 235 1 ? 11 
HELX_P HELX_P46 AF1 ASN C 269 ? GLU C 283 ? ASN C 269 GLU C 283 1 ? 15 
HELX_P HELX_P47 AF2 GLY C 313 ? THR C 324 ? GLY C 313 THR C 324 1 ? 12 
HELX_P HELX_P48 AF3 ASN C 346 ? ASN C 389 ? ASN C 346 ASN C 389 1 ? 44 
HELX_P HELX_P49 AF4 ILE C 390 ? ALA C 400 ? ILE C 390 ALA C 400 1 ? 11 
HELX_P HELX_P50 AF5 THR C 402 ? ASN C 413 ? THR C 402 ASN C 413 1 ? 12 
HELX_P HELX_P51 AF6 GLY C 418 ? ALA C 422 ? GLY C 418 ALA C 422 5 ? 5  
HELX_P HELX_P52 AF7 THR C 451 ? ASP C 460 ? THR C 451 ASP C 460 1 ? 10 
HELX_P HELX_P53 AF8 LEU C 469 ? SER C 494 ? LEU C 469 SER C 494 1 ? 26 
HELX_P HELX_P54 AF9 SER C 494 ? GLY C 514 ? SER C 494 GLY C 514 1 ? 21 
HELX_P HELX_P55 AG1 GLY D 425 ? ARG D 436 ? GLY D 425 ARG D 436 1 ? 12 
HELX_P HELX_P56 AG2 GLN D 465 ? THR D 472 ? GLN D 465 THR D 472 1 ? 8  
HELX_P HELX_P57 AG3 ASP D 500 ? MET D 518 ? ASP D 500 MET D 518 1 ? 19 
HELX_P HELX_P58 AG4 MET D 518 ? ARG D 524 ? MET D 518 ARG D 524 1 ? 7  
HELX_P HELX_P59 AG5 ASP D 548 ? LEU D 561 ? ASP D 548 LEU D 561 1 ? 14 
HELX_P HELX_P60 AG6 GLY D 577 ? GLU D 598 ? GLY D 577 GLU D 598 1 ? 22 
HELX_P HELX_P61 AG7 PRO D 602 ? LEU D 609 ? PRO D 602 LEU D 609 1 ? 8  
HELX_P HELX_P62 AG8 THR D 616 ? SER D 621 ? THR D 616 SER D 621 5 ? 6  
HELX_P HELX_P63 AG9 ASP D 622 ? GLU D 641 ? ASP D 622 GLU D 641 1 ? 20 
HELX_P HELX_P64 AH1 ASP D 678 ? GLY D 684 ? ASP D 678 GLY D 684 1 ? 7  
HELX_P HELX_P65 AH2 GLY D 684 ? GLY D 699 ? GLY D 684 GLY D 699 1 ? 16 
HELX_P HELX_P66 AH3 SER D 718 ? ARG D 732 ? SER D 718 ARG D 732 1 ? 15 
HELX_P HELX_P67 AH4 GLY D 741 ? MET D 745 ? GLY D 741 MET D 745 5 ? 5  
HELX_P HELX_P68 AH5 ASN D 746 ? MET D 755 ? ASN D 746 MET D 755 1 ? 10 
HELX_P HELX_P69 AH6 ALA D 772 ? PHE D 777 ? ALA D 772 PHE D 777 1 ? 6  
HELX_P HELX_P70 AH7 LEU D 780 ? GLU D 786 ? LEU D 780 GLU D 786 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? F DA 1  N1 ? ? ? 1_555 G DT 18 N3 ? ? E DA 1  G DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? F DA 1  N6 ? ? ? 1_555 G DT 18 O4 ? ? E DA 1  G DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? F DT 2  N3 ? ? ? 1_555 G DA 17 N1 ? ? E DT 2  G DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? F DT 2  O4 ? ? ? 1_555 G DA 17 N6 ? ? E DT 2  G DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? F DC 3  N3 ? ? ? 1_555 G DG 16 N1 ? ? E DC 3  G DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? F DC 3  N4 ? ? ? 1_555 G DG 16 O6 ? ? E DC 3  G DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? F DC 3  O2 ? ? ? 1_555 G DG 16 N2 ? ? E DC 3  G DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? F DA 4  N1 ? ? ? 1_555 G DT 15 N3 ? ? E DA 4  G DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? F DA 4  N6 ? ? ? 1_555 G DT 15 O4 ? ? E DA 4  G DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? F DT 5  N3 ? ? ? 1_555 G DA 14 N1 ? ? E DT 5  G DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? F DT 5  O4 ? ? ? 1_555 G DA 14 N6 ? ? E DT 5  G DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? F DA 6  N1 ? ? ? 1_555 G DT 13 N3 ? ? E DA 6  G DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? F DA 6  N6 ? ? ? 1_555 G DT 13 O4 ? ? E DA 6  G DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? F DA 7  N1 ? ? ? 1_555 G DT 12 N3 ? ? E DA 7  G DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? F DA 7  N6 ? ? ? 1_555 G DT 12 O4 ? ? E DA 7  G DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? F DG 8  N1 ? ? ? 1_555 G DC 11 N3 ? ? E DG 8  G DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? F DG 8  N2 ? ? ? 1_555 G DC 11 O2 ? ? E DG 8  G DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? F DG 8  O6 ? ? ? 1_555 G DC 11 N4 ? ? E DG 8  G DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? F DC 9  N3 ? ? ? 1_555 G DG 10 N1 ? ? E DC 9  G DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? F DC 9  N4 ? ? ? 1_555 G DG 10 O6 ? ? E DC 9  G DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? F DC 9  O2 ? ? ? 1_555 G DG 10 N2 ? ? E DC 9  G DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? F DC 10 N3 ? ? ? 1_555 G DG 9  N1 ? ? E DC 10 G DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? F DC 10 N4 ? ? ? 1_555 G DG 9  O6 ? ? E DC 10 G DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? F DC 10 O2 ? ? ? 1_555 G DG 9  N2 ? ? E DC 10 G DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? F DG 11 N1 ? ? ? 1_555 G DC 8  N3 ? ? E DG 11 G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? F DG 11 N2 ? ? ? 1_555 G DC 8  O2 ? ? E DG 11 G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? F DG 11 O6 ? ? ? 1_555 G DC 8  N4 ? ? E DG 11 G DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? F DT 12 N3 ? ? ? 1_555 G DA 7  N1 ? ? E DT 12 G DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? F DT 12 O4 ? ? ? 1_555 G DA 7  N6 ? ? E DT 12 G DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? F DA 13 N1 ? ? ? 1_555 G DT 6  N3 ? ? E DA 13 G DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? F DA 13 N6 ? ? ? 1_555 G DT 6  O4 ? ? E DA 13 G DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? F DG 14 N1 ? ? ? 1_555 G DC 5  N3 ? ? E DG 14 G DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? F DG 14 N2 ? ? ? 1_555 G DC 5  O2 ? ? E DG 14 G DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? F DG 14 O6 ? ? ? 1_555 G DC 5  N4 ? ? E DG 14 G DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog35 hydrog ? ? E DA 1  N1 ? ? ? 1_555 H DT 18 N3 ? ? F DA 1  H DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog36 hydrog ? ? E DA 1  N6 ? ? ? 1_555 H DT 18 O4 ? ? F DA 1  H DT 32 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog37 hydrog ? ? E DT 2  N3 ? ? ? 1_555 H DA 17 N1 ? ? F DT 2  H DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog38 hydrog ? ? E DT 2  O4 ? ? ? 1_555 H DA 17 N6 ? ? F DT 2  H DA 31 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog39 hydrog ? ? E DC 3  N3 ? ? ? 1_555 H DG 16 N1 ? ? F DC 3  H DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog40 hydrog ? ? E DC 3  N4 ? ? ? 1_555 H DG 16 O6 ? ? F DC 3  H DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog41 hydrog ? ? E DC 3  O2 ? ? ? 1_555 H DG 16 N2 ? ? F DC 3  H DG 30 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog42 hydrog ? ? E DA 4  N1 ? ? ? 1_555 H DT 15 N3 ? ? F DA 4  H DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog43 hydrog ? ? E DA 4  N6 ? ? ? 1_555 H DT 15 O4 ? ? F DA 4  H DT 29 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog44 hydrog ? ? E DT 5  N3 ? ? ? 1_555 H DA 14 N1 ? ? F DT 5  H DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog45 hydrog ? ? E DT 5  O4 ? ? ? 1_555 H DA 14 N6 ? ? F DT 5  H DA 28 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog46 hydrog ? ? E DA 6  N1 ? ? ? 1_555 H DT 13 N3 ? ? F DA 6  H DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog47 hydrog ? ? E DA 6  N6 ? ? ? 1_555 H DT 13 O4 ? ? F DA 6  H DT 27 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog48 hydrog ? ? E DA 7  N1 ? ? ? 1_555 H DT 12 N3 ? ? F DA 7  H DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog49 hydrog ? ? E DA 7  N6 ? ? ? 1_555 H DT 12 O4 ? ? F DA 7  H DT 26 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog50 hydrog ? ? E DG 8  N1 ? ? ? 1_555 H DC 11 N3 ? ? F DG 8  H DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog51 hydrog ? ? E DG 8  N2 ? ? ? 1_555 H DC 11 O2 ? ? F DG 8  H DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog52 hydrog ? ? E DG 8  O6 ? ? ? 1_555 H DC 11 N4 ? ? F DG 8  H DC 25 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog53 hydrog ? ? E DC 9  N3 ? ? ? 1_555 H DG 10 N1 ? ? F DC 9  H DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog54 hydrog ? ? E DC 9  N4 ? ? ? 1_555 H DG 10 O6 ? ? F DC 9  H DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog55 hydrog ? ? E DC 9  O2 ? ? ? 1_555 H DG 10 N2 ? ? F DC 9  H DG 24 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog56 hydrog ? ? E DC 10 N3 ? ? ? 1_555 H DG 9  N1 ? ? F DC 10 H DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog57 hydrog ? ? E DC 10 N4 ? ? ? 1_555 H DG 9  O6 ? ? F DC 10 H DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog58 hydrog ? ? E DC 10 O2 ? ? ? 1_555 H DG 9  N2 ? ? F DC 10 H DG 23 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog59 hydrog ? ? E DG 11 N1 ? ? ? 1_555 H DC 8  N3 ? ? F DG 11 H DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog60 hydrog ? ? E DG 11 N2 ? ? ? 1_555 H DC 8  O2 ? ? F DG 11 H DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog61 hydrog ? ? E DG 11 O6 ? ? ? 1_555 H DC 8  N4 ? ? F DG 11 H DC 22 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog62 hydrog ? ? E DT 12 N3 ? ? ? 1_555 H DA 7  N1 ? ? F DT 12 H DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog63 hydrog ? ? E DT 12 O4 ? ? ? 1_555 H DA 7  N6 ? ? F DT 12 H DA 21 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog64 hydrog ? ? E DA 13 N1 ? ? ? 1_555 H DT 6  N3 ? ? F DA 13 H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog65 hydrog ? ? E DA 13 N6 ? ? ? 1_555 H DT 6  O4 ? ? F DA 13 H DT 20 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog66 hydrog ? ? E DG 14 N1 ? ? ? 1_555 H DC 5  N3 ? ? F DG 14 H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog67 hydrog ? ? E DG 14 N2 ? ? ? 1_555 H DC 5  O2 ? ? F DG 14 H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog68 hydrog ? ? E DG 14 O6 ? ? ? 1_555 H DC 5  N4 ? ? F DG 14 H DC 19 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog69 hydrog ? ? G DG 1  N1 ? ? ? 1_555 H DC 4  N3 ? ? G DG 15 H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog70 hydrog ? ? G DG 1  N2 ? ? ? 1_555 H DC 4  O2 ? ? G DG 15 H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog71 hydrog ? ? G DG 1  O6 ? ? ? 1_555 H DC 4  N4 ? ? G DG 15 H DC 18 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog72 hydrog ? ? G DT 2  N3 ? ? ? 1_555 H DA 3  N1 ? ? G DT 16 H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog73 hydrog ? ? G DT 2  O4 ? ? ? 1_555 H DA 3  N6 ? ? G DT 16 H DA 17 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog74 hydrog ? ? G DA 3  N1 ? ? ? 1_555 H DT 2  N3 ? ? G DA 17 H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog75 hydrog ? ? G DA 3  N6 ? ? ? 1_555 H DT 2  O4 ? ? G DA 17 H DT 16 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog76 hydrog ? ? G DC 4  N3 ? ? ? 1_555 H DG 1  N1 ? ? G DC 18 H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog77 hydrog ? ? G DC 4  N4 ? ? ? 1_555 H DG 1  O6 ? ? G DC 18 H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog78 hydrog ? ? G DC 4  O2 ? ? ? 1_555 H DG 1  N2 ? ? G DC 18 H DG 15 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 709 B . ? ARG 709 B GLY 710 B ? GLY 710 B 1 -7.54 
2 ARG 709 D . ? ARG 709 D GLY 710 D ? GLY 710 D 1 -7.62 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 3 ? 
AA9 ? 3 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 2 ? 
AB6 ? 4 ? 
AB7 ? 3 ? 
AB8 ? 3 ? 
AB9 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? parallel      
AB6 2 3 ? parallel      
AB6 3 4 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 64  ? LYS A 65  ? LYS A 64  LYS A 65  
AA1 2 GLU A 124 ? LEU A 127 ? GLU A 124 LEU A 127 
AA1 3 VAL A 103 ? GLN A 106 ? VAL A 103 GLN A 106 
AA2 1 PHE A 145 ? ASP A 147 ? PHE A 145 ASP A 147 
AA2 2 LYS A 154 ? PRO A 156 ? LYS A 154 PRO A 156 
AA3 1 GLN A 327 ? ASN A 333 ? GLN A 327 ASN A 333 
AA3 2 ARG A 237 ? ARG A 243 ? ARG A 237 ARG A 243 
AA3 3 ILE A 222 ? ILE A 223 ? ILE A 222 ILE A 223 
AA3 4 GLU A 520 ? ILE A 521 ? GLU A 520 ILE A 521 
AA4 1 ARG A 245 ? VAL A 250 ? ARG A 245 VAL A 250 
AA4 2 GLU A 257 ? GLU A 263 ? GLU A 257 GLU A 263 
AA4 3 ILE A 303 ? VAL A 307 ? ILE A 303 VAL A 307 
AA4 4 ILE A 289 ? ASP A 294 ? ILE A 289 ASP A 294 
AA5 1 VAL A 335 ? LEU A 337 ? VAL A 335 LEU A 337 
AA5 2 PRO A 342 ? ILE A 344 ? PRO A 342 ILE A 344 
AA6 1 GLN B 441 ? LEU B 446 ? GLN B 441 LEU B 446 
AA6 2 GLU B 419 ? GLU B 424 ? GLU B 419 GLU B 424 
AA6 3 ILE B 493 ? ILE B 495 ? ILE B 493 ILE B 495 
AA6 4 VAL B 527 ? ILE B 529 ? VAL B 527 ILE B 529 
AA7 1 GLN B 542 ? ILE B 546 ? GLN B 542 ILE B 546 
AA7 2 TYR B 535 ? LYS B 539 ? TYR B 535 LYS B 539 
AA7 3 SER B 735 ? ARG B 738 ? SER B 735 ARG B 738 
AA8 1 LEU B 575 ? ALA B 576 ? LEU B 575 ALA B 576 
AA8 2 THR B 565 ? LEU B 566 ? THR B 565 LEU B 566 
AA8 3 ILE B 707 ? GLU B 708 ? ILE B 707 GLU B 708 
AA9 1 GLN B 646 ? THR B 653 ? GLN B 646 THR B 653 
AA9 2 PHE B 660 ? ARG B 667 ? PHE B 660 ARG B 667 
AA9 3 ASP B 672 ? PRO B 676 ? ASP B 672 PRO B 676 
AB1 1 LYS C 64  ? LYS C 65  ? LYS C 64  LYS C 65  
AB1 2 GLU C 124 ? LEU C 127 ? GLU C 124 LEU C 127 
AB1 3 VAL C 103 ? GLN C 106 ? VAL C 103 GLN C 106 
AB2 1 PHE C 145 ? ASP C 147 ? PHE C 145 ASP C 147 
AB2 2 LYS C 154 ? PRO C 156 ? LYS C 154 PRO C 156 
AB3 1 GLN C 327 ? ASN C 333 ? GLN C 327 ASN C 333 
AB3 2 ARG C 237 ? ARG C 243 ? ARG C 237 ARG C 243 
AB3 3 ILE C 222 ? ILE C 223 ? ILE C 222 ILE C 223 
AB3 4 GLU C 520 ? ILE C 521 ? GLU C 520 ILE C 521 
AB4 1 ARG C 245 ? VAL C 250 ? ARG C 245 VAL C 250 
AB4 2 GLU C 257 ? GLU C 263 ? GLU C 257 GLU C 263 
AB4 3 ILE C 303 ? VAL C 307 ? ILE C 303 VAL C 307 
AB4 4 ILE C 289 ? ASP C 294 ? ILE C 289 ASP C 294 
AB5 1 VAL C 335 ? LEU C 337 ? VAL C 335 LEU C 337 
AB5 2 PRO C 342 ? ILE C 344 ? PRO C 342 ILE C 344 
AB6 1 GLN D 441 ? LEU D 446 ? GLN D 441 LEU D 446 
AB6 2 GLU D 419 ? GLU D 424 ? GLU D 419 GLU D 424 
AB6 3 ILE D 493 ? ILE D 495 ? ILE D 493 ILE D 495 
AB6 4 VAL D 527 ? ILE D 529 ? VAL D 527 ILE D 529 
AB7 1 GLN D 542 ? ILE D 546 ? GLN D 542 ILE D 546 
AB7 2 TYR D 535 ? LYS D 539 ? TYR D 535 LYS D 539 
AB7 3 SER D 735 ? ARG D 738 ? SER D 735 ARG D 738 
AB8 1 LEU D 575 ? ALA D 576 ? LEU D 575 ALA D 576 
AB8 2 THR D 565 ? LEU D 566 ? THR D 565 LEU D 566 
AB8 3 ILE D 707 ? GLU D 708 ? ILE D 707 GLU D 708 
AB9 1 GLN D 646 ? THR D 653 ? GLN D 646 THR D 653 
AB9 2 PHE D 660 ? ARG D 667 ? PHE D 660 ARG D 667 
AB9 3 ASP D 672 ? PRO D 676 ? ASP D 672 PRO D 676 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 64  ? N LYS A 64  O ILE A 125 ? O ILE A 125 
AA1 2 3 O GLU A 124 ? O GLU A 124 N GLN A 106 ? N GLN A 106 
AA2 1 2 N VAL A 146 ? N VAL A 146 O ILE A 155 ? O ILE A 155 
AA3 1 2 O VAL A 328 ? O VAL A 328 N ILE A 242 ? N ILE A 242 
AA3 2 3 O ARG A 243 ? O ARG A 243 N ILE A 222 ? N ILE A 222 
AA3 3 4 N ILE A 223 ? N ILE A 223 O GLU A 520 ? O GLU A 520 
AA4 1 2 N GLU A 249 ? N GLU A 249 O THR A 258 ? O THR A 258 
AA4 2 3 N ILE A 259 ? N ILE A 259 O ILE A 305 ? O ILE A 305 
AA4 3 4 O GLU A 306 ? O GLU A 306 N SER A 290 ? N SER A 290 
AA5 1 2 N ALA A 336 ? N ALA A 336 O LYS A 343 ? O LYS A 343 
AA6 1 2 O LEU B 444 ? O LEU B 444 N TYR B 421 ? N TYR B 421 
AA6 2 3 N LEU B 420 ? N LEU B 420 O ILE B 494 ? O ILE B 494 
AA6 3 4 N ILE B 495 ? N ILE B 495 O TYR B 528 ? O TYR B 528 
AA7 1 2 O ILE B 546 ? O ILE B 546 N TYR B 535 ? N TYR B 535 
AA7 2 3 N LYS B 536 ? N LYS B 536 O GLN B 737 ? O GLN B 737 
AA8 1 2 O LEU B 575 ? O LEU B 575 N LEU B 566 ? N LEU B 566 
AA8 2 3 N THR B 565 ? N THR B 565 O GLU B 708 ? O GLU B 708 
AA9 1 2 N LYS B 648 ? N LYS B 648 O ARG B 665 ? O ARG B 665 
AA9 2 3 N VAL B 666 ? N VAL B 666 O THR B 673 ? O THR B 673 
AB1 1 2 N LYS C 64  ? N LYS C 64  O ILE C 125 ? O ILE C 125 
AB1 2 3 O GLU C 124 ? O GLU C 124 N GLN C 106 ? N GLN C 106 
AB2 1 2 N VAL C 146 ? N VAL C 146 O ILE C 155 ? O ILE C 155 
AB3 1 2 O VAL C 328 ? O VAL C 328 N ILE C 242 ? N ILE C 242 
AB3 2 3 O ARG C 243 ? O ARG C 243 N ILE C 222 ? N ILE C 222 
AB3 3 4 N ILE C 223 ? N ILE C 223 O GLU C 520 ? O GLU C 520 
AB4 1 2 N GLU C 249 ? N GLU C 249 O THR C 258 ? O THR C 258 
AB4 2 3 N ILE C 259 ? N ILE C 259 O ILE C 305 ? O ILE C 305 
AB4 3 4 O GLU C 306 ? O GLU C 306 N SER C 290 ? N SER C 290 
AB5 1 2 N ALA C 336 ? N ALA C 336 O LYS C 343 ? O LYS C 343 
AB6 1 2 O LEU D 444 ? O LEU D 444 N TYR D 421 ? N TYR D 421 
AB6 2 3 N LEU D 420 ? N LEU D 420 O ILE D 494 ? O ILE D 494 
AB6 3 4 N ILE D 495 ? N ILE D 495 O TYR D 528 ? O TYR D 528 
AB7 1 2 O ILE D 546 ? O ILE D 546 N TYR D 535 ? N TYR D 535 
AB7 2 3 N LYS D 536 ? N LYS D 536 O GLN D 737 ? O GLN D 737 
AB8 1 2 O LEU D 575 ? O LEU D 575 N LEU D 566 ? N LEU D 566 
AB8 2 3 N THR D 565 ? N THR D 565 O GLU D 708 ? O GLU D 708 
AB9 1 2 N LYS D 648 ? N LYS D 648 O ARG D 665 ? O ARG D 665 
AB9 2 3 N VAL D 666 ? N VAL D 666 O THR D 673 ? O THR D 673 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    G 
_struct_site.pdbx_auth_comp_id    JHN 
_struct_site.pdbx_auth_seq_id     101 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    8 
_struct_site.details              'binding site for residue JHN G 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 8 ASP A 82  ? ASP A 82  . ? 1_555 ? 
2 AC1 8 MET A 120 ? MET A 120 . ? 1_555 ? 
3 AC1 8 ASP C 82  ? ASP C 82  . ? 1_555 ? 
4 AC1 8 MET C 120 ? MET C 120 . ? 1_555 ? 
5 AC1 8 DT  G 2   ? DT  G 16  . ? 1_555 ? 
6 AC1 8 DA  G 3   ? DA  G 17  . ? 1_555 ? 
7 AC1 8 DT  H 2   ? DT  H 16  . ? 1_555 ? 
8 AC1 8 DA  H 3   ? DA  H 17  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6RKU 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ILE A 1 8   ? 187.075 127.728 149.248 1.00 130.77 ? 8   ILE A N     1 
ATOM   2     C CA    . ILE A 1 8   ? 188.124 128.500 148.596 1.00 130.77 ? 8   ILE A CA    1 
ATOM   3     C C     . ILE A 1 8   ? 188.213 129.881 149.235 1.00 130.77 ? 8   ILE A C     1 
ATOM   4     O O     . ILE A 1 8   ? 187.421 130.769 148.923 1.00 130.77 ? 8   ILE A O     1 
ATOM   5     C CB    . ILE A 1 8   ? 187.872 128.607 147.086 1.00 130.77 ? 8   ILE A CB    1 
ATOM   6     C CG1   . ILE A 1 8   ? 187.821 127.215 146.457 1.00 130.77 ? 8   ILE A CG1   1 
ATOM   7     C CG2   . ILE A 1 8   ? 188.957 129.443 146.426 1.00 130.77 ? 8   ILE A CG2   1 
ATOM   8     C CD1   . ILE A 1 8   ? 187.304 127.208 145.037 1.00 130.77 ? 8   ILE A CD1   1 
ATOM   9     N N     . THR A 1 9   ? 189.175 130.058 150.141 1.00 130.94 ? 9   THR A N     1 
ATOM   10    C CA    . THR A 1 9   ? 189.355 131.313 150.870 1.00 130.94 ? 9   THR A CA    1 
ATOM   11    C C     . THR A 1 9   ? 190.811 131.745 150.772 1.00 130.94 ? 9   THR A C     1 
ATOM   12    O O     . THR A 1 9   ? 191.623 131.438 151.655 1.00 130.94 ? 9   THR A O     1 
ATOM   13    C CB    . THR A 1 9   ? 188.934 131.172 152.332 1.00 130.94 ? 9   THR A CB    1 
ATOM   14    O OG1   . THR A 1 9   ? 189.751 130.185 152.973 1.00 130.94 ? 9   THR A OG1   1 
ATOM   15    C CG2   . THR A 1 9   ? 187.479 130.754 152.432 1.00 130.94 ? 9   THR A CG2   1 
ATOM   16    N N     . PRO A 1 10  ? 191.179 132.462 149.713 1.00 126.31 ? 10  PRO A N     1 
ATOM   17    C CA    . PRO A 1 10  ? 192.554 132.957 149.606 1.00 126.31 ? 10  PRO A CA    1 
ATOM   18    C C     . PRO A 1 10  ? 192.818 134.073 150.602 1.00 126.31 ? 10  PRO A C     1 
ATOM   19    O O     . PRO A 1 10  ? 191.983 134.951 150.828 1.00 126.31 ? 10  PRO A O     1 
ATOM   20    C CB    . PRO A 1 10  ? 192.636 133.468 148.165 1.00 126.31 ? 10  PRO A CB    1 
ATOM   21    C CG    . PRO A 1 10  ? 191.232 133.820 147.820 1.00 126.31 ? 10  PRO A CG    1 
ATOM   22    C CD    . PRO A 1 10  ? 190.366 132.825 148.541 1.00 126.31 ? 10  PRO A CD    1 
ATOM   23    N N     . VAL A 1 11  ? 193.999 134.028 151.198 1.00 122.46 ? 11  VAL A N     1 
ATOM   24    C CA    . VAL A 1 11  ? 194.386 135.013 152.198 1.00 122.46 ? 11  VAL A CA    1 
ATOM   25    C C     . VAL A 1 11  ? 194.572 136.362 151.522 1.00 122.46 ? 11  VAL A C     1 
ATOM   26    O O     . VAL A 1 11  ? 195.170 136.456 150.444 1.00 122.46 ? 11  VAL A O     1 
ATOM   27    C CB    . VAL A 1 11  ? 195.667 134.569 152.922 1.00 122.46 ? 11  VAL A CB    1 
ATOM   28    C CG1   . VAL A 1 11  ? 196.114 135.629 153.916 1.00 122.46 ? 11  VAL A CG1   1 
ATOM   29    C CG2   . VAL A 1 11  ? 195.444 133.236 153.615 1.00 122.46 ? 11  VAL A CG2   1 
ATOM   30    N N     . ASN A 1 12  ? 194.055 137.413 152.151 1.00 124.22 ? 12  ASN A N     1 
ATOM   31    C CA    . ASN A 1 12  ? 194.200 138.766 151.640 1.00 124.22 ? 12  ASN A CA    1 
ATOM   32    C C     . ASN A 1 12  ? 194.783 139.664 152.718 1.00 124.22 ? 12  ASN A C     1 
ATOM   33    O O     . ASN A 1 12  ? 194.440 139.543 153.897 1.00 124.22 ? 12  ASN A O     1 
ATOM   34    C CB    . ASN A 1 12  ? 192.867 139.338 151.163 1.00 124.22 ? 12  ASN A CB    1 
ATOM   35    C CG    . ASN A 1 12  ? 193.024 140.672 150.462 1.00 124.22 ? 12  ASN A CG    1 
ATOM   36    O OD1   . ASN A 1 12  ? 194.131 141.196 150.341 1.00 124.22 ? 12  ASN A OD1   1 
ATOM   37    N ND2   . ASN A 1 12  ? 191.915 141.230 149.997 1.00 124.22 ? 12  ASN A ND2   1 
ATOM   38    N N     . ILE A 1 13  ? 195.663 140.571 152.295 1.00 124.47 ? 13  ILE A N     1 
ATOM   39    C CA    . ILE A 1 13  ? 196.263 141.517 153.220 1.00 124.47 ? 13  ILE A CA    1 
ATOM   40    C C     . ILE A 1 13  ? 195.222 142.547 153.650 1.00 124.47 ? 13  ILE A C     1 
ATOM   41    O O     . ILE A 1 13  ? 194.162 142.702 153.032 1.00 124.47 ? 13  ILE A O     1 
ATOM   42    C CB    . ILE A 1 13  ? 197.486 142.187 152.572 1.00 124.47 ? 13  ILE A CB    1 
ATOM   43    C CG1   . ILE A 1 13  ? 198.407 142.791 153.631 1.00 124.47 ? 13  ILE A CG1   1 
ATOM   44    C CG2   . ILE A 1 13  ? 197.048 143.242 151.575 1.00 124.47 ? 13  ILE A CG2   1 
ATOM   45    C CD1   . ILE A 1 13  ? 199.079 141.752 154.485 1.00 124.47 ? 13  ILE A CD1   1 
ATOM   46    N N     . GLU A 1 14  ? 195.525 143.252 154.740 1.00 123.89 ? 14  GLU A N     1 
ATOM   47    C CA    . GLU A 1 14  ? 194.631 144.288 155.240 1.00 123.89 ? 14  GLU A CA    1 
ATOM   48    C C     . GLU A 1 14  ? 194.667 145.550 154.388 1.00 123.89 ? 14  GLU A C     1 
ATOM   49    O O     . GLU A 1 14  ? 193.719 146.340 154.440 1.00 123.89 ? 14  GLU A O     1 
ATOM   50    C CB    . GLU A 1 14  ? 194.988 144.612 156.693 1.00 123.89 ? 14  GLU A CB    1 
ATOM   51    C CG    . GLU A 1 14  ? 193.964 145.442 157.447 1.00 123.89 ? 14  GLU A CG    1 
ATOM   52    C CD    . GLU A 1 14  ? 194.146 146.925 157.221 1.00 123.89 ? 14  GLU A CD    1 
ATOM   53    O OE1   . GLU A 1 14  ? 195.284 147.343 156.925 1.00 123.89 ? 14  GLU A OE1   1 
ATOM   54    O OE2   . GLU A 1 14  ? 193.154 147.671 157.333 1.00 123.89 ? 14  GLU A OE2   1 
ATOM   55    N N     . GLU A 1 15  ? 195.715 145.736 153.583 1.00 127.09 ? 15  GLU A N     1 
ATOM   56    C CA    . GLU A 1 15  ? 195.877 146.905 152.722 1.00 127.09 ? 15  GLU A CA    1 
ATOM   57    C C     . GLU A 1 15  ? 194.707 147.115 151.763 1.00 127.09 ? 15  GLU A C     1 
ATOM   58    O O     . GLU A 1 15  ? 194.614 148.186 151.155 1.00 127.09 ? 15  GLU A O     1 
ATOM   59    C CB    . GLU A 1 15  ? 197.198 146.767 151.957 1.00 127.09 ? 15  GLU A CB    1 
ATOM   60    C CG    . GLU A 1 15  ? 197.633 147.962 151.132 1.00 127.09 ? 15  GLU A CG    1 
ATOM   61    C CD    . GLU A 1 15  ? 197.093 147.907 149.720 1.00 127.09 ? 15  GLU A CD    1 
ATOM   62    O OE1   . GLU A 1 15  ? 196.847 146.788 149.225 1.00 127.09 ? 15  GLU A OE1   1 
ATOM   63    O OE2   . GLU A 1 15  ? 196.907 148.976 149.107 1.00 127.09 ? 15  GLU A OE2   1 
ATOM   64    N N     . GLU A 1 16  ? 193.797 146.142 151.643 1.00 126.16 ? 16  GLU A N     1 
ATOM   65    C CA    . GLU A 1 16  ? 192.648 146.281 150.752 1.00 126.16 ? 16  GLU A CA    1 
ATOM   66    C C     . GLU A 1 16  ? 191.850 147.550 151.040 1.00 126.16 ? 16  GLU A C     1 
ATOM   67    O O     . GLU A 1 16  ? 191.162 148.069 150.153 1.00 126.16 ? 16  GLU A O     1 
ATOM   68    C CB    . GLU A 1 16  ? 191.752 145.049 150.878 1.00 126.16 ? 16  GLU A CB    1 
ATOM   69    C CG    . GLU A 1 16  ? 190.538 145.049 149.973 1.00 126.16 ? 16  GLU A CG    1 
ATOM   70    C CD    . GLU A 1 16  ? 190.905 144.975 148.507 1.00 126.16 ? 16  GLU A CD    1 
ATOM   71    O OE1   . GLU A 1 16  ? 191.987 144.439 148.187 1.00 126.16 ? 16  GLU A OE1   1 
ATOM   72    O OE2   . GLU A 1 16  ? 190.109 145.453 147.672 1.00 126.16 ? 16  GLU A OE2   1 
ATOM   73    N N     . LEU A 1 17  ? 191.937 148.067 152.267 1.00 116.44 ? 17  LEU A N     1 
ATOM   74    C CA    . LEU A 1 17  ? 191.196 149.273 152.621 1.00 116.44 ? 17  LEU A CA    1 
ATOM   75    C C     . LEU A 1 17  ? 191.608 150.458 151.757 1.00 116.44 ? 17  LEU A C     1 
ATOM   76    O O     . LEU A 1 17  ? 190.764 151.275 151.371 1.00 116.44 ? 17  LEU A O     1 
ATOM   77    C CB    . LEU A 1 17  ? 191.402 149.591 154.103 1.00 116.44 ? 17  LEU A CB    1 
ATOM   78    C CG    . LEU A 1 17  ? 190.586 150.722 154.733 1.00 116.44 ? 17  LEU A CG    1 
ATOM   79    C CD1   . LEU A 1 17  ? 190.332 150.424 156.199 1.00 116.44 ? 17  LEU A CD1   1 
ATOM   80    C CD2   . LEU A 1 17  ? 191.296 152.058 154.595 1.00 116.44 ? 17  LEU A CD2   1 
ATOM   81    N N     . LYS A 1 18  ? 192.900 150.576 151.448 1.00 112.95 ? 18  LYS A N     1 
ATOM   82    C CA    . LYS A 1 18  ? 193.369 151.745 150.713 1.00 112.95 ? 18  LYS A CA    1 
ATOM   83    C C     . LYS A 1 18  ? 192.868 151.738 149.276 1.00 112.95 ? 18  LYS A C     1 
ATOM   84    O O     . LYS A 1 18  ? 192.515 152.789 148.730 1.00 112.95 ? 18  LYS A O     1 
ATOM   85    C CB    . LYS A 1 18  ? 194.894 151.812 150.743 1.00 112.95 ? 18  LYS A CB    1 
ATOM   86    C CG    . LYS A 1 18  ? 195.458 153.039 150.048 1.00 112.95 ? 18  LYS A CG    1 
ATOM   87    C CD    . LYS A 1 18  ? 196.959 153.142 150.226 1.00 112.95 ? 18  LYS A CD    1 
ATOM   88    C CE    . LYS A 1 18  ? 197.683 152.106 149.389 1.00 112.95 ? 18  LYS A CE    1 
ATOM   89    N NZ    . LYS A 1 18  ? 197.553 152.389 147.935 1.00 112.95 ? 18  LYS A NZ    1 
ATOM   90    N N     . SER A 1 19  ? 192.829 150.563 148.647 1.00 111.85 ? 19  SER A N     1 
ATOM   91    C CA    . SER A 1 19  ? 192.444 150.496 147.241 1.00 111.85 ? 19  SER A CA    1 
ATOM   92    C C     . SER A 1 19  ? 190.983 150.875 147.045 1.00 111.85 ? 19  SER A C     1 
ATOM   93    O O     . SER A 1 19  ? 190.640 151.578 146.087 1.00 111.85 ? 19  SER A O     1 
ATOM   94    C CB    . SER A 1 19  ? 192.712 149.098 146.691 1.00 111.85 ? 19  SER A CB    1 
ATOM   95    O OG    . SER A 1 19  ? 192.313 149.008 145.336 1.00 111.85 ? 19  SER A OG    1 
ATOM   96    N N     . SER A 1 20  ? 190.107 150.422 147.942 1.00 111.88 ? 20  SER A N     1 
ATOM   97    C CA    . SER A 1 20  ? 188.683 150.698 147.782 1.00 111.88 ? 20  SER A CA    1 
ATOM   98    C C     . SER A 1 20  ? 188.373 152.172 148.009 1.00 111.88 ? 20  SER A C     1 
ATOM   99    O O     . SER A 1 20  ? 187.681 152.800 147.200 1.00 111.88 ? 20  SER A O     1 
ATOM   100   C CB    . SER A 1 20  ? 187.873 149.827 148.738 1.00 111.88 ? 20  SER A CB    1 
ATOM   101   O OG    . SER A 1 20  ? 188.040 148.455 148.431 1.00 111.88 ? 20  SER A OG    1 
ATOM   102   N N     . TYR A 1 21  ? 188.876 152.741 149.107 1.00 105.25 ? 21  TYR A N     1 
ATOM   103   C CA    . TYR A 1 21  ? 188.580 154.135 149.421 1.00 105.25 ? 21  TYR A CA    1 
ATOM   104   C C     . TYR A 1 21  ? 189.113 155.070 148.345 1.00 105.25 ? 21  TYR A C     1 
ATOM   105   O O     . TYR A 1 21  ? 188.435 156.027 147.948 1.00 105.25 ? 21  TYR A O     1 
ATOM   106   C CB    . TYR A 1 21  ? 189.172 154.497 150.780 1.00 105.25 ? 21  TYR A CB    1 
ATOM   107   C CG    . TYR A 1 21  ? 188.870 155.906 151.219 1.00 105.25 ? 21  TYR A CG    1 
ATOM   108   C CD1   . TYR A 1 21  ? 187.631 156.236 151.746 1.00 105.25 ? 21  TYR A CD1   1 
ATOM   109   C CD2   . TYR A 1 21  ? 189.821 156.907 151.102 1.00 105.25 ? 21  TYR A CD2   1 
ATOM   110   C CE1   . TYR A 1 21  ? 187.350 157.522 152.150 1.00 105.25 ? 21  TYR A CE1   1 
ATOM   111   C CE2   . TYR A 1 21  ? 189.548 158.196 151.502 1.00 105.25 ? 21  TYR A CE2   1 
ATOM   112   C CZ    . TYR A 1 21  ? 188.311 158.498 152.025 1.00 105.25 ? 21  TYR A CZ    1 
ATOM   113   O OH    . TYR A 1 21  ? 188.033 159.783 152.426 1.00 105.25 ? 21  TYR A OH    1 
ATOM   114   N N     . LEU A 1 22  ? 190.332 154.812 147.867 1.00 107.01 ? 22  LEU A N     1 
ATOM   115   C CA    . LEU A 1 22  ? 190.902 155.642 146.813 1.00 107.01 ? 22  LEU A CA    1 
ATOM   116   C C     . LEU A 1 22  ? 190.036 155.597 145.562 1.00 107.01 ? 22  LEU A C     1 
ATOM   117   O O     . LEU A 1 22  ? 189.851 156.618 144.889 1.00 107.01 ? 22  LEU A O     1 
ATOM   118   C CB    . LEU A 1 22  ? 192.331 155.186 146.513 1.00 107.01 ? 22  LEU A CB    1 
ATOM   119   C CG    . LEU A 1 22  ? 193.235 156.051 145.630 1.00 107.01 ? 22  LEU A CG    1 
ATOM   120   C CD1   . LEU A 1 22  ? 192.958 155.867 144.142 1.00 107.01 ? 22  LEU A CD1   1 
ATOM   121   C CD2   . LEU A 1 22  ? 193.083 157.508 146.023 1.00 107.01 ? 22  LEU A CD2   1 
ATOM   122   N N     . ASP A 1 23  ? 189.493 154.422 145.240 1.00 109.11 ? 23  ASP A N     1 
ATOM   123   C CA    . ASP A 1 23  ? 188.594 154.311 144.098 1.00 109.11 ? 23  ASP A CA    1 
ATOM   124   C C     . ASP A 1 23  ? 187.359 155.181 144.288 1.00 109.11 ? 23  ASP A C     1 
ATOM   125   O O     . ASP A 1 23  ? 186.944 155.895 143.367 1.00 109.11 ? 23  ASP A O     1 
ATOM   126   C CB    . ASP A 1 23  ? 188.196 152.851 143.892 1.00 109.11 ? 23  ASP A CB    1 
ATOM   127   C CG    . ASP A 1 23  ? 187.483 152.618 142.578 1.00 109.11 ? 23  ASP A CG    1 
ATOM   128   O OD1   . ASP A 1 23  ? 187.298 153.584 141.810 1.00 109.11 ? 23  ASP A OD1   1 
ATOM   129   O OD2   . ASP A 1 23  ? 187.102 151.460 142.312 1.00 109.11 ? 23  ASP A OD2   1 
ATOM   130   N N     . TYR A 1 24  ? 186.760 155.133 145.478 1.00 101.14 ? 24  TYR A N     1 
ATOM   131   C CA    . TYR A 1 24  ? 185.589 155.956 145.755 1.00 101.14 ? 24  TYR A CA    1 
ATOM   132   C C     . TYR A 1 24  ? 185.901 157.436 145.595 1.00 101.14 ? 24  TYR A C     1 
ATOM   133   O O     . TYR A 1 24  ? 185.135 158.176 144.964 1.00 101.14 ? 24  TYR A O     1 
ATOM   134   C CB    . TYR A 1 24  ? 185.076 155.673 147.163 1.00 101.14 ? 24  TYR A CB    1 
ATOM   135   C CG    . TYR A 1 24  ? 183.900 156.526 147.563 1.00 101.14 ? 24  TYR A CG    1 
ATOM   136   C CD1   . TYR A 1 24  ? 182.636 156.281 147.054 1.00 101.14 ? 24  TYR A CD1   1 
ATOM   137   C CD2   . TYR A 1 24  ? 184.055 157.575 148.457 1.00 101.14 ? 24  TYR A CD2   1 
ATOM   138   C CE1   . TYR A 1 24  ? 181.558 157.057 147.421 1.00 101.14 ? 24  TYR A CE1   1 
ATOM   139   C CE2   . TYR A 1 24  ? 182.984 158.357 148.830 1.00 101.14 ? 24  TYR A CE2   1 
ATOM   140   C CZ    . TYR A 1 24  ? 181.738 158.094 148.310 1.00 101.14 ? 24  TYR A CZ    1 
ATOM   141   O OH    . TYR A 1 24  ? 180.664 158.870 148.678 1.00 101.14 ? 24  TYR A OH    1 
ATOM   142   N N     . ALA A 1 25  ? 187.017 157.889 146.168 1.00 94.51  ? 25  ALA A N     1 
ATOM   143   C CA    . ALA A 1 25  ? 187.361 159.304 146.080 1.00 94.51  ? 25  ALA A CA    1 
ATOM   144   C C     . ALA A 1 25  ? 187.608 159.726 144.638 1.00 94.51  ? 25  ALA A C     1 
ATOM   145   O O     . ALA A 1 25  ? 187.129 160.781 144.199 1.00 94.51  ? 25  ALA A O     1 
ATOM   146   C CB    . ALA A 1 25  ? 188.585 159.600 146.942 1.00 94.51  ? 25  ALA A CB    1 
ATOM   147   N N     . MET A 1 26  ? 188.362 158.919 143.889 1.00 101.09 ? 26  MET A N     1 
ATOM   148   C CA    . MET A 1 26  ? 188.668 159.267 142.507 1.00 101.09 ? 26  MET A CA    1 
ATOM   149   C C     . MET A 1 26  ? 187.408 159.286 141.654 1.00 101.09 ? 26  MET A C     1 
ATOM   150   O O     . MET A 1 26  ? 187.288 160.099 140.731 1.00 101.09 ? 26  MET A O     1 
ATOM   151   C CB    . MET A 1 26  ? 189.690 158.286 141.937 1.00 101.09 ? 26  MET A CB    1 
ATOM   152   C CG    . MET A 1 26  ? 190.186 158.650 140.555 1.00 101.09 ? 26  MET A CG    1 
ATOM   153   S SD    . MET A 1 26  ? 191.064 160.221 140.557 1.00 101.09 ? 26  MET A SD    1 
ATOM   154   C CE    . MET A 1 26  ? 192.580 159.759 141.390 1.00 101.09 ? 26  MET A CE    1 
ATOM   155   N N     . SER A 1 27  ? 186.455 158.401 141.947 1.00 92.59  ? 27  SER A N     1 
ATOM   156   C CA    . SER A 1 27  ? 185.201 158.417 141.205 1.00 92.59  ? 27  SER A CA    1 
ATOM   157   C C     . SER A 1 27  ? 184.383 159.656 141.536 1.00 92.59  ? 27  SER A C     1 
ATOM   158   O O     . SER A 1 27  ? 183.873 160.331 140.633 1.00 92.59  ? 27  SER A O     1 
ATOM   159   C CB    . SER A 1 27  ? 184.398 157.153 141.503 1.00 92.59  ? 27  SER A CB    1 
ATOM   160   O OG    . SER A 1 27  ? 183.152 157.175 140.831 1.00 92.59  ? 27  SER A OG    1 
ATOM   161   N N     . VAL A 1 28  ? 184.247 159.971 142.826 1.00 92.49  ? 28  VAL A N     1 
ATOM   162   C CA    . VAL A 1 28  ? 183.412 161.100 143.229 1.00 92.49  ? 28  VAL A CA    1 
ATOM   163   C C     . VAL A 1 28  ? 183.964 162.402 142.668 1.00 92.49  ? 28  VAL A C     1 
ATOM   164   O O     . VAL A 1 28  ? 183.245 163.162 142.008 1.00 92.49  ? 28  VAL A O     1 
ATOM   165   C CB    . VAL A 1 28  ? 183.284 161.161 144.760 1.00 92.49  ? 28  VAL A CB    1 
ATOM   166   C CG1   . VAL A 1 28  ? 182.579 162.439 145.169 1.00 92.49  ? 28  VAL A CG1   1 
ATOM   167   C CG2   . VAL A 1 28  ? 182.519 159.959 145.271 1.00 92.49  ? 28  VAL A CG2   1 
ATOM   168   N N     . ILE A 1 29  ? 185.253 162.668 142.907 1.00 96.36  ? 29  ILE A N     1 
ATOM   169   C CA    . ILE A 1 29  ? 185.839 163.951 142.521 1.00 96.36  ? 29  ILE A CA    1 
ATOM   170   C C     . ILE A 1 29  ? 185.668 164.201 141.029 1.00 96.36  ? 29  ILE A C     1 
ATOM   171   O O     . ILE A 1 29  ? 185.476 165.342 140.593 1.00 96.36  ? 29  ILE A O     1 
ATOM   172   C CB    . ILE A 1 29  ? 187.321 164.003 142.935 1.00 96.36  ? 29  ILE A CB    1 
ATOM   173   C CG1   . ILE A 1 29  ? 187.450 163.959 144.455 1.00 96.36  ? 29  ILE A CG1   1 
ATOM   174   C CG2   . ILE A 1 29  ? 187.994 165.248 142.388 1.00 96.36  ? 29  ILE A CG2   1 
ATOM   175   C CD1   . ILE A 1 29  ? 188.868 163.764 144.934 1.00 96.36  ? 29  ILE A CD1   1 
ATOM   176   N N     . VAL A 1 30  ? 185.713 163.143 140.225 1.00 89.99  ? 30  VAL A N     1 
ATOM   177   C CA    . VAL A 1 30  ? 185.635 163.325 138.782 1.00 89.99  ? 30  VAL A CA    1 
ATOM   178   C C     . VAL A 1 30  ? 184.187 163.396 138.313 1.00 89.99  ? 30  VAL A C     1 
ATOM   179   O O     . VAL A 1 30  ? 183.865 164.138 137.378 1.00 89.99  ? 30  VAL A O     1 
ATOM   180   C CB    . VAL A 1 30  ? 186.414 162.207 138.068 1.00 89.99  ? 30  VAL A CB    1 
ATOM   181   C CG1   . VAL A 1 30  ? 186.237 162.305 136.563 1.00 89.99  ? 30  VAL A CG1   1 
ATOM   182   C CG2   . VAL A 1 30  ? 187.885 162.285 138.430 1.00 89.99  ? 30  VAL A CG2   1 
ATOM   183   N N     . GLY A 1 31  ? 183.283 162.657 138.952 1.00 87.50  ? 31  GLY A N     1 
ATOM   184   C CA    . GLY A 1 31  ? 181.965 162.492 138.386 1.00 87.50  ? 31  GLY A CA    1 
ATOM   185   C C     . GLY A 1 31  ? 180.793 163.164 139.065 1.00 87.50  ? 31  GLY A C     1 
ATOM   186   O O     . GLY A 1 31  ? 179.716 163.220 138.465 1.00 87.50  ? 31  GLY A O     1 
ATOM   187   N N     . ARG A 1 32  ? 180.941 163.676 140.287 1.00 88.68  ? 32  ARG A N     1 
ATOM   188   C CA    . ARG A 1 32  ? 179.742 164.111 140.995 1.00 88.68  ? 32  ARG A CA    1 
ATOM   189   C C     . ARG A 1 32  ? 179.697 165.603 141.300 1.00 88.68  ? 32  ARG A C     1 
ATOM   190   O O     . ARG A 1 32  ? 178.736 166.283 140.928 1.00 88.68  ? 32  ARG A O     1 
ATOM   191   C CB    . ARG A 1 32  ? 179.592 163.327 142.298 1.00 88.68  ? 32  ARG A CB    1 
ATOM   192   C CG    . ARG A 1 32  ? 178.324 163.658 143.061 1.00 88.68  ? 32  ARG A CG    1 
ATOM   193   C CD    . ARG A 1 32  ? 178.176 162.793 144.300 1.00 88.68  ? 32  ARG A CD    1 
ATOM   194   N NE    . ARG A 1 32  ? 177.943 161.393 143.962 1.00 88.68  ? 32  ARG A NE    1 
ATOM   195   C CZ    . ARG A 1 32  ? 177.918 160.407 144.850 1.00 88.68  ? 32  ARG A CZ    1 
ATOM   196   N NH1   . ARG A 1 32  ? 178.106 160.667 146.136 1.00 88.68  ? 32  ARG A NH1   1 
ATOM   197   N NH2   . ARG A 1 32  ? 177.700 159.162 144.455 1.00 88.68  ? 32  ARG A NH2   1 
ATOM   198   N N     . ALA A 1 33  ? 180.718 166.128 141.975 1.00 83.04  ? 33  ALA A N     1 
ATOM   199   C CA    . ALA A 1 33  ? 180.581 167.455 142.566 1.00 83.04  ? 33  ALA A CA    1 
ATOM   200   C C     . ALA A 1 33  ? 181.139 168.557 141.673 1.00 83.04  ? 33  ALA A C     1 
ATOM   201   O O     . ALA A 1 33  ? 180.406 169.475 141.290 1.00 83.04  ? 33  ALA A O     1 
ATOM   202   C CB    . ALA A 1 33  ? 181.264 167.489 143.933 1.00 83.04  ? 33  ALA A CB    1 
ATOM   203   N N     . LEU A 1 34  ? 182.418 168.488 141.337 1.00 87.49  ? 34  LEU A N     1 
ATOM   204   C CA    . LEU A 1 34  ? 183.093 169.624 140.719 1.00 87.49  ? 34  LEU A CA    1 
ATOM   205   C C     . LEU A 1 34  ? 182.590 169.843 139.296 1.00 87.49  ? 34  LEU A C     1 
ATOM   206   O O     . LEU A 1 34  ? 182.507 168.886 138.519 1.00 87.49  ? 34  LEU A O     1 
ATOM   207   C CB    . LEU A 1 34  ? 184.598 169.405 140.707 1.00 87.49  ? 34  LEU A CB    1 
ATOM   208   C CG    . LEU A 1 34  ? 185.247 169.374 142.088 1.00 87.49  ? 34  LEU A CG    1 
ATOM   209   C CD1   . LEU A 1 34  ? 186.722 169.039 141.977 1.00 87.49  ? 34  LEU A CD1   1 
ATOM   210   C CD2   . LEU A 1 34  ? 185.045 170.703 142.789 1.00 87.49  ? 34  LEU A CD2   1 
ATOM   211   N N     . PRO A 1 35  ? 182.248 171.071 138.924 1.00 91.62  ? 35  PRO A N     1 
ATOM   212   C CA    . PRO A 1 35  ? 181.833 171.350 137.548 1.00 91.62  ? 35  PRO A CA    1 
ATOM   213   C C     . PRO A 1 35  ? 183.036 171.465 136.620 1.00 91.62  ? 35  PRO A C     1 
ATOM   214   O O     . PRO A 1 35  ? 184.188 171.308 137.021 1.00 91.62  ? 35  PRO A O     1 
ATOM   215   C CB    . PRO A 1 35  ? 181.105 172.689 137.671 1.00 91.62  ? 35  PRO A CB    1 
ATOM   216   C CG    . PRO A 1 35  ? 181.762 173.347 138.830 1.00 91.62  ? 35  PRO A CG    1 
ATOM   217   C CD    . PRO A 1 35  ? 182.111 172.250 139.793 1.00 91.62  ? 35  PRO A CD    1 
ATOM   218   N N     . ASP A 1 36  ? 182.742 171.753 135.356 1.00 101.37 ? 36  ASP A N     1 
ATOM   219   C CA    . ASP A 1 36  ? 183.755 171.887 134.321 1.00 101.37 ? 36  ASP A CA    1 
ATOM   220   C C     . ASP A 1 36  ? 183.971 173.355 133.982 1.00 101.37 ? 36  ASP A C     1 
ATOM   221   O O     . ASP A 1 36  ? 183.081 174.188 134.168 1.00 101.37 ? 36  ASP A O     1 
ATOM   222   C CB    . ASP A 1 36  ? 183.353 171.117 133.061 1.00 101.37 ? 36  ASP A CB    1 
ATOM   223   C CG    . ASP A 1 36  ? 183.374 169.619 133.266 1.00 101.37 ? 36  ASP A CG    1 
ATOM   224   O OD1   . ASP A 1 36  ? 184.177 169.145 134.096 1.00 101.37 ? 36  ASP A OD1   1 
ATOM   225   O OD2   . ASP A 1 36  ? 182.588 168.915 132.599 1.00 101.37 ? 36  ASP A OD2   1 
ATOM   226   N N     . VAL A 1 37  ? 185.166 173.667 133.480 1.00 98.86  ? 37  VAL A N     1 
ATOM   227   C CA    . VAL A 1 37  ? 185.463 175.046 133.105 1.00 98.86  ? 37  VAL A CA    1 
ATOM   228   C C     . VAL A 1 37  ? 184.839 175.387 131.762 1.00 98.86  ? 37  VAL A C     1 
ATOM   229   O O     . VAL A 1 37  ? 184.644 176.565 131.440 1.00 98.86  ? 37  VAL A O     1 
ATOM   230   C CB    . VAL A 1 37  ? 186.982 175.288 133.087 1.00 98.86  ? 37  VAL A CB    1 
ATOM   231   C CG1   . VAL A 1 37  ? 187.562 175.085 134.466 1.00 98.86  ? 37  VAL A CG1   1 
ATOM   232   C CG2   . VAL A 1 37  ? 187.652 174.370 132.080 1.00 98.86  ? 37  VAL A CG2   1 
ATOM   233   N N     . ARG A 1 38  ? 184.516 174.377 130.956 1.00 91.39  ? 38  ARG A N     1 
ATOM   234   C CA    . ARG A 1 38  ? 184.066 174.649 129.597 1.00 91.39  ? 38  ARG A CA    1 
ATOM   235   C C     . ARG A 1 38  ? 182.598 175.049 129.544 1.00 91.39  ? 38  ARG A C     1 
ATOM   236   O O     . ARG A 1 38  ? 182.201 175.822 128.666 1.00 91.39  ? 38  ARG A O     1 
ATOM   237   C CB    . ARG A 1 38  ? 184.333 173.438 128.706 1.00 91.39  ? 38  ARG A CB    1 
ATOM   238   C CG    . ARG A 1 38  ? 185.805 173.255 128.389 1.00 91.39  ? 38  ARG A CG    1 
ATOM   239   C CD    . ARG A 1 38  ? 186.054 172.038 127.523 1.00 91.39  ? 38  ARG A CD    1 
ATOM   240   N NE    . ARG A 1 38  ? 185.868 170.795 128.261 1.00 91.39  ? 38  ARG A NE    1 
ATOM   241   C CZ    . ARG A 1 38  ? 185.918 169.588 127.710 1.00 91.39  ? 38  ARG A CZ    1 
ATOM   242   N NH1   . ARG A 1 38  ? 186.145 169.461 126.410 1.00 91.39  ? 38  ARG A NH1   1 
ATOM   243   N NH2   . ARG A 1 38  ? 185.745 168.509 128.459 1.00 91.39  ? 38  ARG A NH2   1 
ATOM   244   N N     . ASP A 1 39  ? 181.773 174.546 130.461 1.00 97.86  ? 39  ASP A N     1 
ATOM   245   C CA    . ASP A 1 39  ? 180.365 174.922 130.487 1.00 97.86  ? 39  ASP A CA    1 
ATOM   246   C C     . ASP A 1 39  ? 179.825 175.212 131.879 1.00 97.86  ? 39  ASP A C     1 
ATOM   247   O O     . ASP A 1 39  ? 178.734 175.781 131.989 1.00 97.86  ? 39  ASP A O     1 
ATOM   248   C CB    . ASP A 1 39  ? 179.507 173.836 129.828 1.00 97.86  ? 39  ASP A CB    1 
ATOM   249   C CG    . ASP A 1 39  ? 179.600 172.507 130.541 1.00 97.86  ? 39  ASP A CG    1 
ATOM   250   O OD1   . ASP A 1 39  ? 180.404 172.390 131.488 1.00 97.86  ? 39  ASP A OD1   1 
ATOM   251   O OD2   . ASP A 1 39  ? 178.858 171.578 130.157 1.00 97.86  ? 39  ASP A OD2   1 
ATOM   252   N N     . GLY A 1 40  ? 180.539 174.844 132.939 1.00 97.86  ? 40  GLY A N     1 
ATOM   253   C CA    . GLY A 1 40  ? 180.050 175.081 134.283 1.00 97.86  ? 40  GLY A CA    1 
ATOM   254   C C     . GLY A 1 40  ? 178.756 174.352 134.573 1.00 97.86  ? 40  GLY A C     1 
ATOM   255   O O     . GLY A 1 40  ? 177.765 174.967 134.976 1.00 97.86  ? 40  GLY A O     1 
ATOM   256   N N     . LEU A 1 41  ? 178.753 173.038 134.364 1.00 90.05  ? 41  LEU A N     1 
ATOM   257   C CA    . LEU A 1 41  ? 177.559 172.228 134.548 1.00 90.05  ? 41  LEU A CA    1 
ATOM   258   C C     . LEU A 1 41  ? 177.928 170.913 135.211 1.00 90.05  ? 41  LEU A C     1 
ATOM   259   O O     . LEU A 1 41  ? 178.835 170.214 134.749 1.00 90.05  ? 41  LEU A O     1 
ATOM   260   C CB    . LEU A 1 41  ? 176.865 171.960 133.210 1.00 90.05  ? 41  LEU A CB    1 
ATOM   261   C CG    . LEU A 1 41  ? 176.250 173.176 132.525 1.00 90.05  ? 41  LEU A CG    1 
ATOM   262   C CD1   . LEU A 1 41  ? 175.734 172.800 131.152 1.00 90.05  ? 41  LEU A CD1   1 
ATOM   263   C CD2   . LEU A 1 41  ? 175.137 173.742 133.383 1.00 90.05  ? 41  LEU A CD2   1 
ATOM   264   N N     . LYS A 1 42  ? 177.226 170.581 136.288 1.00 87.41  ? 42  LYS A N     1 
ATOM   265   C CA    . LYS A 1 42  ? 177.365 169.267 136.882 1.00 87.41  ? 42  LYS A CA    1 
ATOM   266   C C     . LYS A 1 42  ? 176.727 168.223 135.967 1.00 87.41  ? 42  LYS A C     1 
ATOM   267   O O     . LYS A 1 42  ? 175.829 168.542 135.183 1.00 87.41  ? 42  LYS A O     1 
ATOM   268   C CB    . LYS A 1 42  ? 176.705 169.233 138.256 1.00 87.41  ? 42  LYS A CB    1 
ATOM   269   C CG    . LYS A 1 42  ? 177.389 170.104 139.294 1.00 87.41  ? 42  LYS A CG    1 
ATOM   270   C CD    . LYS A 1 42  ? 176.666 170.019 140.625 1.00 87.41  ? 42  LYS A CD    1 
ATOM   271   C CE    . LYS A 1 42  ? 177.315 170.906 141.670 1.00 87.41  ? 42  LYS A CE    1 
ATOM   272   N NZ    . LYS A 1 42  ? 176.582 170.847 142.964 1.00 87.41  ? 42  LYS A NZ    1 
ATOM   273   N N     . PRO A 1 43  ? 177.179 166.969 136.038 1.00 86.28  ? 43  PRO A N     1 
ATOM   274   C CA    . PRO A 1 43  ? 176.620 165.944 135.142 1.00 86.28  ? 43  PRO A CA    1 
ATOM   275   C C     . PRO A 1 43  ? 175.119 165.760 135.281 1.00 86.28  ? 43  PRO A C     1 
ATOM   276   O O     . PRO A 1 43  ? 174.452 165.421 134.294 1.00 86.28  ? 43  PRO A O     1 
ATOM   277   C CB    . PRO A 1 43  ? 177.386 164.679 135.546 1.00 86.28  ? 43  PRO A CB    1 
ATOM   278   C CG    . PRO A 1 43  ? 178.661 165.187 136.120 1.00 86.28  ? 43  PRO A CG    1 
ATOM   279   C CD    . PRO A 1 43  ? 178.304 166.452 136.832 1.00 86.28  ? 43  PRO A CD    1 
ATOM   280   N N     . VAL A 1 44  ? 174.564 165.979 136.474 1.00 83.81  ? 44  VAL A N     1 
ATOM   281   C CA    . VAL A 1 44  ? 173.124 165.828 136.663 1.00 83.81  ? 44  VAL A CA    1 
ATOM   282   C C     . VAL A 1 44  ? 172.368 166.834 135.805 1.00 83.81  ? 44  VAL A C     1 
ATOM   283   O O     . VAL A 1 44  ? 171.418 166.484 135.092 1.00 83.81  ? 44  VAL A O     1 
ATOM   284   C CB    . VAL A 1 44  ? 172.763 165.974 138.150 1.00 83.81  ? 44  VAL A CB    1 
ATOM   285   C CG1   . VAL A 1 44  ? 171.261 165.945 138.332 1.00 83.81  ? 44  VAL A CG1   1 
ATOM   286   C CG2   . VAL A 1 44  ? 173.423 164.877 138.964 1.00 83.81  ? 44  VAL A CG2   1 
ATOM   287   N N     . HIS A 1 45  ? 172.772 168.105 135.875 1.00 87.65  ? 45  HIS A N     1 
ATOM   288   C CA    . HIS A 1 45  ? 172.145 169.131 135.050 1.00 87.65  ? 45  HIS A CA    1 
ATOM   289   C C     . HIS A 1 45  ? 172.281 168.794 133.574 1.00 87.65  ? 45  HIS A C     1 
ATOM   290   O O     . HIS A 1 45  ? 171.337 168.970 132.793 1.00 87.65  ? 45  HIS A O     1 
ATOM   291   C CB    . HIS A 1 45  ? 172.772 170.492 135.344 1.00 87.65  ? 45  HIS A CB    1 
ATOM   292   C CG    . HIS A 1 45  ? 172.579 170.954 136.754 1.00 87.65  ? 45  HIS A CG    1 
ATOM   293   N ND1   . HIS A 1 45  ? 173.474 170.665 137.760 1.00 87.65  ? 45  HIS A ND1   1 
ATOM   294   C CD2   . HIS A 1 45  ? 171.590 171.679 137.326 1.00 87.65  ? 45  HIS A CD2   1 
ATOM   295   C CE1   . HIS A 1 45  ? 173.048 171.197 138.892 1.00 87.65  ? 45  HIS A CE1   1 
ATOM   296   N NE2   . HIS A 1 45  ? 171.906 171.817 138.656 1.00 87.65  ? 45  HIS A NE2   1 
ATOM   297   N N     . ARG A 1 46  ? 173.455 168.301 133.179 1.00 91.84  ? 46  ARG A N     1 
ATOM   298   C CA    . ARG A 1 46  ? 173.679 167.897 131.798 1.00 91.84  ? 46  ARG A CA    1 
ATOM   299   C C     . ARG A 1 46  ? 172.664 166.857 131.350 1.00 91.84  ? 46  ARG A C     1 
ATOM   300   O O     . ARG A 1 46  ? 172.010 167.020 130.312 1.00 91.84  ? 46  ARG A O     1 
ATOM   301   C CB    . ARG A 1 46  ? 175.091 167.343 131.654 1.00 91.84  ? 46  ARG A CB    1 
ATOM   302   C CG    . ARG A 1 46  ? 175.463 166.968 130.252 1.00 91.84  ? 46  ARG A CG    1 
ATOM   303   C CD    . ARG A 1 46  ? 176.874 166.427 130.218 1.00 91.84  ? 46  ARG A CD    1 
ATOM   304   N NE    . ARG A 1 46  ? 177.805 167.380 130.804 1.00 91.84  ? 46  ARG A NE    1 
ATOM   305   C CZ    . ARG A 1 46  ? 178.213 168.482 130.191 1.00 91.84  ? 46  ARG A CZ    1 
ATOM   306   N NH1   . ARG A 1 46  ? 179.070 169.300 130.785 1.00 91.84  ? 46  ARG A NH1   1 
ATOM   307   N NH2   . ARG A 1 46  ? 177.739 168.774 128.989 1.00 91.84  ? 46  ARG A NH2   1 
ATOM   308   N N     . ARG A 1 47  ? 172.533 165.773 132.113 1.00 93.13  ? 47  ARG A N     1 
ATOM   309   C CA    . ARG A 1 47  ? 171.650 164.694 131.697 1.00 93.13  ? 47  ARG A CA    1 
ATOM   310   C C     . ARG A 1 47  ? 170.196 165.141 131.705 1.00 93.13  ? 47  ARG A C     1 
ATOM   311   O O     . ARG A 1 47  ? 169.419 164.755 130.824 1.00 93.13  ? 47  ARG A O     1 
ATOM   312   C CB    . ARG A 1 47  ? 171.861 163.480 132.596 1.00 93.13  ? 47  ARG A CB    1 
ATOM   313   C CG    . ARG A 1 47  ? 173.242 162.875 132.442 1.00 93.13  ? 47  ARG A CG    1 
ATOM   314   C CD    . ARG A 1 47  ? 173.441 161.696 133.366 1.00 93.13  ? 47  ARG A CD    1 
ATOM   315   N NE    . ARG A 1 47  ? 174.789 161.151 133.259 1.00 93.13  ? 47  ARG A NE    1 
ATOM   316   C CZ    . ARG A 1 47  ? 175.252 160.158 134.009 1.00 93.13  ? 47  ARG A CZ    1 
ATOM   317   N NH1   . ARG A 1 47  ? 174.474 159.599 134.925 1.00 93.13  ? 47  ARG A NH1   1 
ATOM   318   N NH2   . ARG A 1 47  ? 176.493 159.724 133.845 1.00 93.13  ? 47  ARG A NH2   1 
ATOM   319   N N     . VAL A 1 48  ? 169.813 165.979 132.670 1.00 89.94  ? 48  VAL A N     1 
ATOM   320   C CA    . VAL A 1 48  ? 168.439 166.471 132.703 1.00 89.94  ? 48  VAL A CA    1 
ATOM   321   C C     . VAL A 1 48  ? 168.135 167.310 131.468 1.00 89.94  ? 48  VAL A C     1 
ATOM   322   O O     . VAL A 1 48  ? 167.094 167.134 130.820 1.00 89.94  ? 48  VAL A O     1 
ATOM   323   C CB    . VAL A 1 48  ? 168.184 167.256 134.001 1.00 89.94  ? 48  VAL A CB    1 
ATOM   324   C CG1   . VAL A 1 48  ? 166.835 167.931 133.946 1.00 89.94  ? 48  VAL A CG1   1 
ATOM   325   C CG2   . VAL A 1 48  ? 168.249 166.322 135.190 1.00 89.94  ? 48  VAL A CG2   1 
ATOM   326   N N     . LEU A 1 49  ? 169.030 168.240 131.124 1.00 92.96  ? 49  LEU A N     1 
ATOM   327   C CA    . LEU A 1 49  ? 168.799 169.069 129.946 1.00 92.96  ? 49  LEU A CA    1 
ATOM   328   C C     . LEU A 1 49  ? 168.760 168.227 128.678 1.00 92.96  ? 49  LEU A C     1 
ATOM   329   O O     . LEU A 1 49  ? 167.915 168.448 127.801 1.00 92.96  ? 49  LEU A O     1 
ATOM   330   C CB    . LEU A 1 49  ? 169.874 170.148 129.839 1.00 92.96  ? 49  LEU A CB    1 
ATOM   331   C CG    . LEU A 1 49  ? 169.831 171.219 130.926 1.00 92.96  ? 49  LEU A CG    1 
ATOM   332   C CD1   . LEU A 1 49  ? 171.008 172.167 130.791 1.00 92.96  ? 49  LEU A CD1   1 
ATOM   333   C CD2   . LEU A 1 49  ? 168.520 171.974 130.857 1.00 92.96  ? 49  LEU A CD2   1 
ATOM   334   N N     . TYR A 1 50  ? 169.663 167.251 128.565 1.00 95.25  ? 50  TYR A N     1 
ATOM   335   C CA    . TYR A 1 50  ? 169.668 166.408 127.377 1.00 95.25  ? 50  TYR A CA    1 
ATOM   336   C C     . TYR A 1 50  ? 168.377 165.611 127.263 1.00 95.25  ? 50  TYR A C     1 
ATOM   337   O O     . TYR A 1 50  ? 167.831 165.456 126.166 1.00 95.25  ? 50  TYR A O     1 
ATOM   338   C CB    . TYR A 1 50  ? 170.875 165.474 127.391 1.00 95.25  ? 50  TYR A CB    1 
ATOM   339   C CG    . TYR A 1 50  ? 170.953 164.602 126.165 1.00 95.25  ? 50  TYR A CG    1 
ATOM   340   C CD1   . TYR A 1 50  ? 171.331 165.130 124.943 1.00 95.25  ? 50  TYR A CD1   1 
ATOM   341   C CD2   . TYR A 1 50  ? 170.645 163.254 126.229 1.00 95.25  ? 50  TYR A CD2   1 
ATOM   342   C CE1   . TYR A 1 50  ? 171.400 164.341 123.817 1.00 95.25  ? 50  TYR A CE1   1 
ATOM   343   C CE2   . TYR A 1 50  ? 170.714 162.455 125.110 1.00 95.25  ? 50  TYR A CE2   1 
ATOM   344   C CZ    . TYR A 1 50  ? 171.092 163.003 123.907 1.00 95.25  ? 50  TYR A CZ    1 
ATOM   345   O OH    . TYR A 1 50  ? 171.161 162.211 122.786 1.00 95.25  ? 50  TYR A OH    1 
ATOM   346   N N     . ALA A 1 51  ? 167.868 165.105 128.388 1.00 92.03  ? 51  ALA A N     1 
ATOM   347   C CA    . ALA A 1 51  ? 166.615 164.363 128.352 1.00 92.03  ? 51  ALA A CA    1 
ATOM   348   C C     . ALA A 1 51  ? 165.457 165.263 127.949 1.00 92.03  ? 51  ALA A C     1 
ATOM   349   O O     . ALA A 1 51  ? 164.604 164.869 127.143 1.00 92.03  ? 51  ALA A O     1 
ATOM   350   C CB    . ALA A 1 51  ? 166.346 163.716 129.708 1.00 92.03  ? 51  ALA A CB    1 
ATOM   351   N N     . MET A 1 52  ? 165.408 166.479 128.498 1.00 99.59  ? 52  MET A N     1 
ATOM   352   C CA    . MET A 1 52  ? 164.338 167.398 128.127 1.00 99.59  ? 52  MET A CA    1 
ATOM   353   C C     . MET A 1 52  ? 164.397 167.747 126.648 1.00 99.59  ? 52  MET A C     1 
ATOM   354   O O     . MET A 1 52  ? 163.358 167.933 126.005 1.00 99.59  ? 52  MET A O     1 
ATOM   355   C CB    . MET A 1 52  ? 164.403 168.669 128.971 1.00 99.59  ? 52  MET A CB    1 
ATOM   356   C CG    . MET A 1 52  ? 164.009 168.485 130.418 1.00 99.59  ? 52  MET A CG    1 
ATOM   357   S SD    . MET A 1 52  ? 164.067 170.051 131.303 1.00 99.59  ? 52  MET A SD    1 
ATOM   358   C CE    . MET A 1 52  ? 163.672 169.518 132.961 1.00 99.59  ? 52  MET A CE    1 
ATOM   359   N N     . ASN A 1 53  ? 165.603 167.845 126.088 1.00 99.36  ? 53  ASN A N     1 
ATOM   360   C CA    . ASN A 1 53  ? 165.708 168.165 124.669 1.00 99.36  ? 53  ASN A CA    1 
ATOM   361   C C     . ASN A 1 53  ? 165.299 166.977 123.808 1.00 99.36  ? 53  ASN A C     1 
ATOM   362   O O     . ASN A 1 53  ? 164.610 167.144 122.795 1.00 99.36  ? 53  ASN A O     1 
ATOM   363   C CB    . ASN A 1 53  ? 167.127 168.610 124.328 1.00 99.36  ? 53  ASN A CB    1 
ATOM   364   C CG    . ASN A 1 53  ? 167.223 169.239 122.953 1.00 99.36  ? 53  ASN A CG    1 
ATOM   365   O OD1   . ASN A 1 53  ? 166.227 169.357 122.240 1.00 99.36  ? 53  ASN A OD1   1 
ATOM   366   N ND2   . ASN A 1 53  ? 168.426 169.645 122.572 1.00 99.36  ? 53  ASN A ND2   1 
ATOM   367   N N     . VAL A 1 54  ? 165.712 165.768 124.195 1.00 99.63  ? 54  VAL A N     1 
ATOM   368   C CA    . VAL A 1 54  ? 165.363 164.581 123.417 1.00 99.63  ? 54  VAL A CA    1 
ATOM   369   C C     . VAL A 1 54  ? 163.859 164.349 123.442 1.00 99.63  ? 54  VAL A C     1 
ATOM   370   O O     . VAL A 1 54  ? 163.260 163.953 122.435 1.00 99.63  ? 54  VAL A O     1 
ATOM   371   C CB    . VAL A 1 54  ? 166.133 163.353 123.936 1.00 99.63  ? 54  VAL A CB    1 
ATOM   372   C CG1   . VAL A 1 54  ? 165.621 162.088 123.274 1.00 99.63  ? 54  VAL A CG1   1 
ATOM   373   C CG2   . VAL A 1 54  ? 167.616 163.513 123.667 1.00 99.63  ? 54  VAL A CG2   1 
ATOM   374   N N     . LEU A 1 55  ? 163.224 164.595 124.588 1.00 99.27  ? 55  LEU A N     1 
ATOM   375   C CA    . LEU A 1 55  ? 161.782 164.397 124.679 1.00 99.27  ? 55  LEU A CA    1 
ATOM   376   C C     . LEU A 1 55  ? 161.036 165.357 123.759 1.00 99.27  ? 55  LEU A C     1 
ATOM   377   O O     . LEU A 1 55  ? 159.949 165.036 123.265 1.00 99.27  ? 55  LEU A O     1 
ATOM   378   C CB    . LEU A 1 55  ? 161.326 164.557 126.130 1.00 99.27  ? 55  LEU A CB    1 
ATOM   379   C CG    . LEU A 1 55  ? 159.887 164.178 126.483 1.00 99.27  ? 55  LEU A CG    1 
ATOM   380   C CD1   . LEU A 1 55  ? 159.829 163.653 127.903 1.00 99.27  ? 55  LEU A CD1   1 
ATOM   381   C CD2   . LEU A 1 55  ? 158.949 165.365 126.331 1.00 99.27  ? 55  LEU A CD2   1 
ATOM   382   N N     . GLY A 1 56  ? 161.601 166.535 123.516 1.00 100.91 ? 56  GLY A N     1 
ATOM   383   C CA    . GLY A 1 56  ? 160.984 167.485 122.612 1.00 100.91 ? 56  GLY A CA    1 
ATOM   384   C C     . GLY A 1 56  ? 160.092 168.486 123.314 1.00 100.91 ? 56  GLY A C     1 
ATOM   385   O O     . GLY A 1 56  ? 158.976 168.761 122.862 1.00 100.91 ? 56  GLY A O     1 
ATOM   386   N N     . ASN A 1 57  ? 160.573 169.037 124.426 1.00 105.50 ? 57  ASN A N     1 
ATOM   387   C CA    . ASN A 1 57  ? 159.803 169.992 125.219 1.00 105.50 ? 57  ASN A CA    1 
ATOM   388   C C     . ASN A 1 57  ? 160.471 171.360 125.112 1.00 105.50 ? 57  ASN A C     1 
ATOM   389   O O     . ASN A 1 57  ? 161.330 171.732 125.910 1.00 105.50 ? 57  ASN A O     1 
ATOM   390   C CB    . ASN A 1 57  ? 159.698 169.518 126.663 1.00 105.50 ? 57  ASN A CB    1 
ATOM   391   C CG    . ASN A 1 57  ? 158.731 170.346 127.477 1.00 105.50 ? 57  ASN A CG    1 
ATOM   392   O OD1   . ASN A 1 57  ? 158.152 171.311 126.982 1.00 105.50 ? 57  ASN A OD1   1 
ATOM   393   N ND2   . ASN A 1 57  ? 158.546 169.969 128.736 1.00 105.50 ? 57  ASN A ND2   1 
ATOM   394   N N     . ASP A 1 58  ? 160.055 172.120 124.104 1.00 108.83 ? 58  ASP A N     1 
ATOM   395   C CA    . ASP A 1 58  ? 160.601 173.450 123.883 1.00 108.83 ? 58  ASP A CA    1 
ATOM   396   C C     . ASP A 1 58  ? 159.853 174.478 124.730 1.00 108.83 ? 58  ASP A C     1 
ATOM   397   O O     . ASP A 1 58  ? 159.003 174.144 125.559 1.00 108.83 ? 58  ASP A O     1 
ATOM   398   C CB    . ASP A 1 58  ? 160.546 173.806 122.401 1.00 108.83 ? 58  ASP A CB    1 
ATOM   399   C CG    . ASP A 1 58  ? 161.525 173.000 121.576 1.00 108.83 ? 58  ASP A CG    1 
ATOM   400   O OD1   . ASP A 1 58  ? 162.576 172.603 122.122 1.00 108.83 ? 58  ASP A OD1   1 
ATOM   401   O OD2   . ASP A 1 58  ? 161.248 172.764 120.383 1.00 108.83 ? 58  ASP A OD2   1 
ATOM   402   N N     . TRP A 1 59  ? 160.175 175.754 124.516 1.00 97.85  ? 59  TRP A N     1 
ATOM   403   C CA    . TRP A 1 59  ? 159.600 176.808 125.344 1.00 97.85  ? 59  TRP A CA    1 
ATOM   404   C C     . TRP A 1 59  ? 158.229 177.244 124.843 1.00 97.85  ? 59  TRP A C     1 
ATOM   405   O O     . TRP A 1 59  ? 157.367 177.621 125.643 1.00 97.85  ? 59  TRP A O     1 
ATOM   406   C CB    . TRP A 1 59  ? 160.546 178.007 125.401 1.00 97.85  ? 59  TRP A CB    1 
ATOM   407   C CG    . TRP A 1 59  ? 160.805 178.639 124.072 1.00 97.85  ? 59  TRP A CG    1 
ATOM   408   C CD1   . TRP A 1 59  ? 161.805 178.330 123.200 1.00 97.85  ? 59  TRP A CD1   1 
ATOM   409   C CD2   . TRP A 1 59  ? 160.054 179.693 123.463 1.00 97.85  ? 59  TRP A CD2   1 
ATOM   410   N NE1   . TRP A 1 59  ? 161.725 179.127 122.086 1.00 97.85  ? 59  TRP A NE1   1 
ATOM   411   C CE2   . TRP A 1 59  ? 160.656 179.972 122.223 1.00 97.85  ? 59  TRP A CE2   1 
ATOM   412   C CE3   . TRP A 1 59  ? 158.929 180.427 123.847 1.00 97.85  ? 59  TRP A CE3   1 
ATOM   413   C CZ2   . TRP A 1 59  ? 160.173 180.952 121.364 1.00 97.85  ? 59  TRP A CZ2   1 
ATOM   414   C CZ3   . TRP A 1 59  ? 158.450 181.399 122.992 1.00 97.85  ? 59  TRP A CZ3   1 
ATOM   415   C CH2   . TRP A 1 59  ? 159.072 181.654 121.766 1.00 97.85  ? 59  TRP A CH2   1 
ATOM   416   N N     . ASN A 1 60  ? 158.009 177.203 123.528 1.00 105.93 ? 60  ASN A N     1 
ATOM   417   C CA    . ASN A 1 60  ? 156.765 177.672 122.928 1.00 105.93 ? 60  ASN A CA    1 
ATOM   418   C C     . ASN A 1 60  ? 155.700 176.585 122.841 1.00 105.93 ? 60  ASN A C     1 
ATOM   419   O O     . ASN A 1 60  ? 154.793 176.678 122.005 1.00 105.93 ? 60  ASN A O     1 
ATOM   420   C CB    . ASN A 1 60  ? 157.045 178.258 121.544 1.00 105.93 ? 60  ASN A CB    1 
ATOM   421   C CG    . ASN A 1 60  ? 157.687 177.256 120.606 1.00 105.93 ? 60  ASN A CG    1 
ATOM   422   O OD1   . ASN A 1 60  ? 157.863 176.088 120.949 1.00 105.93 ? 60  ASN A OD1   1 
ATOM   423   N ND2   . ASN A 1 60  ? 158.038 177.710 119.410 1.00 105.93 ? 60  ASN A ND2   1 
ATOM   424   N N     . LYS A 1 61  ? 155.785 175.558 123.680 1.00 100.92 ? 61  LYS A N     1 
ATOM   425   C CA    . LYS A 1 61  ? 154.819 174.473 123.692 1.00 100.92 ? 61  LYS A CA    1 
ATOM   426   C C     . LYS A 1 61  ? 154.108 174.425 125.038 1.00 100.92 ? 61  LYS A C     1 
ATOM   427   O O     . LYS A 1 61  ? 154.408 175.197 125.952 1.00 100.92 ? 61  LYS A O     1 
ATOM   428   C CB    . LYS A 1 61  ? 155.492 173.127 123.410 1.00 100.92 ? 61  LYS A CB    1 
ATOM   429   C CG    . LYS A 1 61  ? 156.037 172.991 122.002 1.00 100.92 ? 61  LYS A CG    1 
ATOM   430   C CD    . LYS A 1 61  ? 156.667 171.626 121.805 1.00 100.92 ? 61  LYS A CD    1 
ATOM   431   C CE    . LYS A 1 61  ? 157.239 171.473 120.410 1.00 100.92 ? 61  LYS A CE    1 
ATOM   432   N NZ    . LYS A 1 61  ? 157.872 170.138 120.230 1.00 100.92 ? 61  LYS A NZ    1 
ATOM   433   N N     . ALA A 1 62  ? 153.154 173.505 125.148 1.00 97.19  ? 62  ALA A N     1 
ATOM   434   C CA    . ALA A 1 62  ? 152.413 173.351 126.388 1.00 97.19  ? 62  ALA A CA    1 
ATOM   435   C C     . ALA A 1 62  ? 153.288 172.710 127.460 1.00 97.19  ? 62  ALA A C     1 
ATOM   436   O O     . ALA A 1 62  ? 154.286 172.045 127.174 1.00 97.19  ? 62  ALA A O     1 
ATOM   437   C CB    . ALA A 1 62  ? 151.158 172.511 126.162 1.00 97.19  ? 62  ALA A CB    1 
ATOM   438   N N     . TYR A 1 63  ? 152.896 172.918 128.714 1.00 96.49  ? 63  TYR A N     1 
ATOM   439   C CA    . TYR A 1 63  ? 153.649 172.384 129.835 1.00 96.49  ? 63  TYR A CA    1 
ATOM   440   C C     . TYR A 1 63  ? 153.495 170.867 129.911 1.00 96.49  ? 63  TYR A C     1 
ATOM   441   O O     . TYR A 1 63  ? 152.685 170.257 129.210 1.00 96.49  ? 63  TYR A O     1 
ATOM   442   C CB    . TYR A 1 63  ? 153.189 173.027 131.141 1.00 96.49  ? 63  TYR A CB    1 
ATOM   443   C CG    . TYR A 1 63  ? 153.502 174.499 131.240 1.00 96.49  ? 63  TYR A CG    1 
ATOM   444   C CD1   . TYR A 1 63  ? 154.766 174.935 131.607 1.00 96.49  ? 63  TYR A CD1   1 
ATOM   445   C CD2   . TYR A 1 63  ? 152.536 175.453 130.964 1.00 96.49  ? 63  TYR A CD2   1 
ATOM   446   C CE1   . TYR A 1 63  ? 155.055 176.280 131.701 1.00 96.49  ? 63  TYR A CE1   1 
ATOM   447   C CE2   . TYR A 1 63  ? 152.818 176.799 131.052 1.00 96.49  ? 63  TYR A CE2   1 
ATOM   448   C CZ    . TYR A 1 63  ? 154.079 177.207 131.420 1.00 96.49  ? 63  TYR A CZ    1 
ATOM   449   O OH    . TYR A 1 63  ? 154.364 178.548 131.510 1.00 96.49  ? 63  TYR A OH    1 
ATOM   450   N N     . LYS A 1 64  ? 154.294 170.257 130.784 1.00 92.14  ? 64  LYS A N     1 
ATOM   451   C CA    . LYS A 1 64  ? 154.266 168.818 130.990 1.00 92.14  ? 64  LYS A CA    1 
ATOM   452   C C     . LYS A 1 64  ? 154.446 168.521 132.470 1.00 92.14  ? 64  LYS A C     1 
ATOM   453   O O     . LYS A 1 64  ? 155.026 169.318 133.212 1.00 92.14  ? 64  LYS A O     1 
ATOM   454   C CB    . LYS A 1 64  ? 155.355 168.109 130.178 1.00 92.14  ? 64  LYS A CB    1 
ATOM   455   C CG    . LYS A 1 64  ? 155.147 168.184 128.679 1.00 92.14  ? 64  LYS A CG    1 
ATOM   456   C CD    . LYS A 1 64  ? 156.223 167.429 127.925 1.00 92.14  ? 64  LYS A CD    1 
ATOM   457   C CE    . LYS A 1 64  ? 156.040 167.588 126.426 1.00 92.14  ? 64  LYS A CE    1 
ATOM   458   N NZ    . LYS A 1 64  ? 154.797 166.922 125.948 1.00 92.14  ? 64  LYS A NZ    1 
ATOM   459   N N     . LYS A 1 65  ? 153.943 167.366 132.893 1.00 91.94  ? 65  LYS A N     1 
ATOM   460   C CA    . LYS A 1 65  ? 154.056 166.974 134.289 1.00 91.94  ? 65  LYS A CA    1 
ATOM   461   C C     . LYS A 1 65  ? 155.485 166.567 134.624 1.00 91.94  ? 65  LYS A C     1 
ATOM   462   O O     . LYS A 1 65  ? 156.221 166.042 133.785 1.00 91.94  ? 65  LYS A O     1 
ATOM   463   C CB    . LYS A 1 65  ? 153.103 165.824 134.600 1.00 91.94  ? 65  LYS A CB    1 
ATOM   464   C CG    . LYS A 1 65  ? 151.641 166.181 134.451 1.00 91.94  ? 65  LYS A CG    1 
ATOM   465   C CD    . LYS A 1 65  ? 151.218 167.169 135.522 1.00 91.94  ? 65  LYS A CD    1 
ATOM   466   C CE    . LYS A 1 65  ? 149.746 167.515 135.402 1.00 91.94  ? 65  LYS A CE    1 
ATOM   467   N NZ    . LYS A 1 65  ? 148.884 166.350 135.740 1.00 91.94  ? 65  LYS A NZ    1 
ATOM   468   N N     . SER A 1 66  ? 155.872 166.812 135.877 1.00 94.23  ? 66  SER A N     1 
ATOM   469   C CA    . SER A 1 66  ? 157.230 166.499 136.306 1.00 94.23  ? 66  SER A CA    1 
ATOM   470   C C     . SER A 1 66  ? 157.485 164.999 136.321 1.00 94.23  ? 66  SER A C     1 
ATOM   471   O O     . SER A 1 66  ? 158.635 164.566 136.169 1.00 94.23  ? 66  SER A O     1 
ATOM   472   C CB    . SER A 1 66  ? 157.487 167.085 137.692 1.00 94.23  ? 66  SER A CB    1 
ATOM   473   O OG    . SER A 1 66  ? 157.395 168.496 137.671 1.00 94.23  ? 66  SER A OG    1 
ATOM   474   N N     . ALA A 1 67  ? 156.433 164.199 136.505 1.00 93.51  ? 67  ALA A N     1 
ATOM   475   C CA    . ALA A 1 67  ? 156.608 162.757 136.626 1.00 93.51  ? 67  ALA A CA    1 
ATOM   476   C C     . ALA A 1 67  ? 157.230 162.166 135.370 1.00 93.51  ? 67  ALA A C     1 
ATOM   477   O O     . ALA A 1 67  ? 158.109 161.304 135.456 1.00 93.51  ? 67  ALA A O     1 
ATOM   478   C CB    . ALA A 1 67  ? 155.267 162.089 136.923 1.00 93.51  ? 67  ALA A CB    1 
ATOM   479   N N     . ARG A 1 68  ? 156.790 162.620 134.195 1.00 85.93  ? 68  ARG A N     1 
ATOM   480   C CA    . ARG A 1 68  ? 157.343 162.103 132.948 1.00 85.93  ? 68  ARG A CA    1 
ATOM   481   C C     . ARG A 1 68  ? 158.848 162.326 132.880 1.00 85.93  ? 68  ARG A C     1 
ATOM   482   O O     . ARG A 1 68  ? 159.616 161.388 132.635 1.00 85.93  ? 68  ARG A O     1 
ATOM   483   C CB    . ARG A 1 68  ? 156.651 162.763 131.757 1.00 85.93  ? 68  ARG A CB    1 
ATOM   484   C CG    . ARG A 1 68  ? 155.199 162.369 131.583 1.00 85.93  ? 68  ARG A CG    1 
ATOM   485   C CD    . ARG A 1 68  ? 154.565 163.133 130.436 1.00 85.93  ? 68  ARG A CD    1 
ATOM   486   N NE    . ARG A 1 68  ? 155.217 162.842 129.164 1.00 85.93  ? 68  ARG A NE    1 
ATOM   487   C CZ    . ARG A 1 68  ? 154.895 161.823 128.376 1.00 85.93  ? 68  ARG A CZ    1 
ATOM   488   N NH1   . ARG A 1 68  ? 153.929 160.989 128.731 1.00 85.93  ? 68  ARG A NH1   1 
ATOM   489   N NH2   . ARG A 1 68  ? 155.541 161.633 127.235 1.00 85.93  ? 68  ARG A NH2   1 
ATOM   490   N N     . VAL A 1 69  ? 159.285 163.565 133.106 1.00 87.01  ? 69  VAL A N     1 
ATOM   491   C CA    . VAL A 1 69  ? 160.703 163.888 132.989 1.00 87.01  ? 69  VAL A CA    1 
ATOM   492   C C     . VAL A 1 69  ? 161.513 163.137 134.037 1.00 87.01  ? 69  VAL A C     1 
ATOM   493   O O     . VAL A 1 69  ? 162.576 162.579 133.736 1.00 87.01  ? 69  VAL A O     1 
ATOM   494   C CB    . VAL A 1 69  ? 160.910 165.407 133.099 1.00 87.01  ? 69  VAL A CB    1 
ATOM   495   C CG1   . VAL A 1 69  ? 162.388 165.741 133.062 1.00 87.01  ? 69  VAL A CG1   1 
ATOM   496   C CG2   . VAL A 1 69  ? 160.169 166.119 131.985 1.00 87.01  ? 69  VAL A CG2   1 
ATOM   497   N N     . VAL A 1 70  ? 161.029 163.112 135.280 1.00 89.28  ? 70  VAL A N     1 
ATOM   498   C CA    . VAL A 1 70  ? 161.774 162.445 136.345 1.00 89.28  ? 70  VAL A CA    1 
ATOM   499   C C     . VAL A 1 70  ? 161.912 160.959 136.045 1.00 89.28  ? 70  VAL A C     1 
ATOM   500   O O     . VAL A 1 70  ? 163.003 160.384 136.151 1.00 89.28  ? 70  VAL A O     1 
ATOM   501   C CB    . VAL A 1 70  ? 161.100 162.688 137.706 1.00 89.28  ? 70  VAL A CB    1 
ATOM   502   C CG1   . VAL A 1 70  ? 161.776 161.861 138.780 1.00 89.28  ? 70  VAL A CG1   1 
ATOM   503   C CG2   . VAL A 1 70  ? 161.162 164.158 138.061 1.00 89.28  ? 70  VAL A CG2   1 
ATOM   504   N N     . GLY A 1 71  ? 160.809 160.315 135.661 1.00 90.29  ? 71  GLY A N     1 
ATOM   505   C CA    . GLY A 1 71  ? 160.865 158.901 135.346 1.00 90.29  ? 71  GLY A CA    1 
ATOM   506   C C     . GLY A 1 71  ? 161.777 158.604 134.175 1.00 90.29  ? 71  GLY A C     1 
ATOM   507   O O     . GLY A 1 71  ? 162.532 157.631 134.198 1.00 90.29  ? 71  GLY A O     1 
ATOM   508   N N     . ASP A 1 72  ? 161.739 159.449 133.143 1.00 92.48  ? 72  ASP A N     1 
ATOM   509   C CA    . ASP A 1 72  ? 162.598 159.218 131.989 1.00 92.48  ? 72  ASP A CA    1 
ATOM   510   C C     . ASP A 1 72  ? 164.070 159.345 132.363 1.00 92.48  ? 72  ASP A C     1 
ATOM   511   O O     . ASP A 1 72  ? 164.900 158.522 131.951 1.00 92.48  ? 72  ASP A O     1 
ATOM   512   C CB    . ASP A 1 72  ? 162.241 160.192 130.871 1.00 92.48  ? 72  ASP A CB    1 
ATOM   513   C CG    . ASP A 1 72  ? 162.949 159.871 129.579 1.00 92.48  ? 72  ASP A CG    1 
ATOM   514   O OD1   . ASP A 1 72  ? 162.537 158.902 128.907 1.00 92.48  ? 72  ASP A OD1   1 
ATOM   515   O OD2   . ASP A 1 72  ? 163.917 160.583 129.238 1.00 92.48  ? 72  ASP A OD2   1 
ATOM   516   N N     . VAL A 1 73  ? 164.411 160.369 133.151 1.00 89.17  ? 73  VAL A N     1 
ATOM   517   C CA    . VAL A 1 73  ? 165.799 160.555 133.563 1.00 89.17  ? 73  VAL A CA    1 
ATOM   518   C C     . VAL A 1 73  ? 166.267 159.384 134.415 1.00 89.17  ? 73  VAL A C     1 
ATOM   519   O O     . VAL A 1 73  ? 167.389 158.889 134.251 1.00 89.17  ? 73  VAL A O     1 
ATOM   520   C CB    . VAL A 1 73  ? 165.967 161.894 134.302 1.00 89.17  ? 73  VAL A CB    1 
ATOM   521   C CG1   . VAL A 1 73  ? 167.360 162.000 134.887 1.00 89.17  ? 73  VAL A CG1   1 
ATOM   522   C CG2   . VAL A 1 73  ? 165.711 163.047 133.356 1.00 89.17  ? 73  VAL A CG2   1 
ATOM   523   N N     . ILE A 1 74  ? 165.422 158.921 135.339 1.00 88.25  ? 74  ILE A N     1 
ATOM   524   C CA    . ILE A 1 74  ? 165.808 157.776 136.157 1.00 88.25  ? 74  ILE A CA    1 
ATOM   525   C C     . ILE A 1 74  ? 165.955 156.529 135.299 1.00 88.25  ? 74  ILE A C     1 
ATOM   526   O O     . ILE A 1 74  ? 166.832 155.693 135.549 1.00 88.25  ? 74  ILE A O     1 
ATOM   527   C CB    . ILE A 1 74  ? 164.792 157.560 137.292 1.00 88.25  ? 74  ILE A CB    1 
ATOM   528   C CG1   . ILE A 1 74  ? 164.784 158.758 138.237 1.00 88.25  ? 74  ILE A CG1   1 
ATOM   529   C CG2   . ILE A 1 74  ? 165.111 156.295 138.067 1.00 88.25  ? 74  ILE A CG2   1 
ATOM   530   C CD1   . ILE A 1 74  ? 163.641 158.737 139.220 1.00 88.25  ? 74  ILE A CD1   1 
ATOM   531   N N     . GLY A 1 75  ? 165.130 156.391 134.267 1.00 87.89  ? 75  GLY A N     1 
ATOM   532   C CA    . GLY A 1 75  ? 165.142 155.198 133.450 1.00 87.89  ? 75  GLY A CA    1 
ATOM   533   C C     . GLY A 1 75  ? 166.324 155.077 132.515 1.00 87.89  ? 75  GLY A C     1 
ATOM   534   O O     . GLY A 1 75  ? 166.926 154.004 132.424 1.00 87.89  ? 75  GLY A O     1 
ATOM   535   N N     . LYS A 1 76  ? 166.681 156.155 131.818 1.00 91.10  ? 76  LYS A N     1 
ATOM   536   C CA    . LYS A 1 76  ? 167.677 156.033 130.759 1.00 91.10  ? 76  LYS A CA    1 
ATOM   537   C C     . LYS A 1 76  ? 169.065 156.535 131.130 1.00 91.10  ? 76  LYS A C     1 
ATOM   538   O O     . LYS A 1 76  ? 170.051 156.000 130.616 1.00 91.10  ? 76  LYS A O     1 
ATOM   539   C CB    . LYS A 1 76  ? 167.221 156.774 129.500 1.00 91.10  ? 76  LYS A CB    1 
ATOM   540   C CG    . LYS A 1 76  ? 166.025 156.160 128.816 1.00 91.10  ? 76  LYS A CG    1 
ATOM   541   C CD    . LYS A 1 76  ? 165.828 156.770 127.444 1.00 91.10  ? 76  LYS A CD    1 
ATOM   542   C CE    . LYS A 1 76  ? 165.341 158.196 127.549 1.00 91.10  ? 76  LYS A CE    1 
ATOM   543   N NZ    . LYS A 1 76  ? 165.039 158.773 126.214 1.00 91.10  ? 76  LYS A NZ    1 
ATOM   544   N N     . TYR A 1 77  ? 169.188 157.536 131.982 1.00 92.55  ? 77  TYR A N     1 
ATOM   545   C CA    . TYR A 1 77  ? 170.517 158.132 132.040 1.00 92.55  ? 77  TYR A CA    1 
ATOM   546   C C     . TYR A 1 77  ? 171.115 158.213 133.436 1.00 92.55  ? 77  TYR A C     1 
ATOM   547   O O     . TYR A 1 77  ? 172.320 158.002 133.589 1.00 92.55  ? 77  TYR A O     1 
ATOM   548   C CB    . TYR A 1 77  ? 170.465 159.533 131.422 1.00 92.55  ? 77  TYR A CB    1 
ATOM   549   C CG    . TYR A 1 77  ? 170.073 159.525 129.965 1.00 92.55  ? 77  TYR A CG    1 
ATOM   550   C CD1   . TYR A 1 77  ? 170.988 159.186 128.983 1.00 92.55  ? 77  TYR A CD1   1 
ATOM   551   C CD2   . TYR A 1 77  ? 168.787 159.862 129.573 1.00 92.55  ? 77  TYR A CD2   1 
ATOM   552   C CE1   . TYR A 1 77  ? 170.633 159.178 127.652 1.00 92.55  ? 77  TYR A CE1   1 
ATOM   553   C CE2   . TYR A 1 77  ? 168.423 159.858 128.246 1.00 92.55  ? 77  TYR A CE2   1 
ATOM   554   C CZ    . TYR A 1 77  ? 169.349 159.515 127.290 1.00 92.55  ? 77  TYR A CZ    1 
ATOM   555   O OH    . TYR A 1 77  ? 168.991 159.510 125.964 1.00 92.55  ? 77  TYR A OH    1 
ATOM   556   N N     . HIS A 1 78  ? 170.316 158.512 134.459 1.00 96.40  ? 78  HIS A N     1 
ATOM   557   C CA    . HIS A 1 78  ? 170.832 158.814 135.793 1.00 96.40  ? 78  HIS A CA    1 
ATOM   558   C C     . HIS A 1 78  ? 170.208 157.866 136.809 1.00 96.40  ? 78  HIS A C     1 
ATOM   559   O O     . HIS A 1 78  ? 169.157 158.172 137.395 1.00 96.40  ? 78  HIS A O     1 
ATOM   560   C CB    . HIS A 1 78  ? 170.553 160.272 136.154 1.00 96.40  ? 78  HIS A CB    1 
ATOM   561   C CG    . HIS A 1 78  ? 171.275 160.739 137.376 1.00 96.40  ? 78  HIS A CG    1 
ATOM   562   N ND1   . HIS A 1 78  ? 170.768 160.578 138.647 1.00 96.40  ? 78  HIS A ND1   1 
ATOM   563   C CD2   . HIS A 1 78  ? 172.461 161.374 137.521 1.00 96.40  ? 78  HIS A CD2   1 
ATOM   564   C CE1   . HIS A 1 78  ? 171.613 161.091 139.523 1.00 96.40  ? 78  HIS A CE1   1 
ATOM   565   N NE2   . HIS A 1 78  ? 172.649 161.579 138.866 1.00 96.40  ? 78  HIS A NE2   1 
ATOM   566   N N     . PRO A 1 79  ? 170.815 156.705 137.044 1.00 94.01  ? 79  PRO A N     1 
ATOM   567   C CA    . PRO A 1 79  ? 170.246 155.714 137.978 1.00 94.01  ? 79  PRO A CA    1 
ATOM   568   C C     . PRO A 1 79  ? 170.679 155.930 139.425 1.00 94.01  ? 79  PRO A C     1 
ATOM   569   O O     . PRO A 1 79  ? 171.450 155.155 140.008 1.00 94.01  ? 79  PRO A O     1 
ATOM   570   C CB    . PRO A 1 79  ? 170.772 154.394 137.409 1.00 94.01  ? 79  PRO A CB    1 
ATOM   571   C CG    . PRO A 1 79  ? 172.091 154.766 136.815 1.00 94.01  ? 79  PRO A CG    1 
ATOM   572   C CD    . PRO A 1 79  ? 171.932 156.157 136.264 1.00 94.01  ? 79  PRO A CD    1 
ATOM   573   N N     . HIS A 1 80  ? 170.191 157.005 140.039 1.00 96.61  ? 80  HIS A N     1 
ATOM   574   C CA    . HIS A 1 80  ? 170.542 157.322 141.423 1.00 96.61  ? 80  HIS A CA    1 
ATOM   575   C C     . HIS A 1 80  ? 169.323 157.830 142.188 1.00 96.61  ? 80  HIS A C     1 
ATOM   576   O O     . HIS A 1 80  ? 169.383 158.823 142.912 1.00 96.61  ? 80  HIS A O     1 
ATOM   577   C CB    . HIS A 1 80  ? 171.688 158.326 141.462 1.00 96.61  ? 80  HIS A CB    1 
ATOM   578   C CG    . HIS A 1 80  ? 172.973 157.782 140.927 1.00 96.61  ? 80  HIS A CG    1 
ATOM   579   N ND1   . HIS A 1 80  ? 173.292 157.819 139.587 1.00 96.61  ? 80  HIS A ND1   1 
ATOM   580   C CD2   . HIS A 1 80  ? 174.015 157.182 141.547 1.00 96.61  ? 80  HIS A CD2   1 
ATOM   581   C CE1   . HIS A 1 80  ? 174.478 157.266 139.405 1.00 96.61  ? 80  HIS A CE1   1 
ATOM   582   N NE2   . HIS A 1 80  ? 174.939 156.872 140.578 1.00 96.61  ? 80  HIS A NE2   1 
ATOM   583   N N     . GLY A 1 81  ? 168.195 157.150 142.034 1.00 98.58  ? 81  GLY A N     1 
ATOM   584   C CA    . GLY A 1 81  ? 167.020 157.521 142.793 1.00 98.58  ? 81  GLY A CA    1 
ATOM   585   C C     . GLY A 1 81  ? 166.278 158.693 142.176 1.00 98.58  ? 81  GLY A C     1 
ATOM   586   O O     . GLY A 1 81  ? 166.451 159.036 141.003 1.00 98.58  ? 81  GLY A O     1 
ATOM   587   N N     . ASP A 1 82  ? 165.446 159.319 142.993 1.00 107.87 ? 82  ASP A N     1 
ATOM   588   C CA    . ASP A 1 82  ? 164.532 160.354 142.522 1.00 107.87 ? 82  ASP A CA    1 
ATOM   589   C C     . ASP A 1 82  ? 164.625 161.655 143.301 1.00 107.87 ? 82  ASP A C     1 
ATOM   590   O O     . ASP A 1 82  ? 164.468 162.727 142.710 1.00 107.87 ? 82  ASP A O     1 
ATOM   591   C CB    . ASP A 1 82  ? 163.097 159.825 142.588 1.00 107.87 ? 82  ASP A CB    1 
ATOM   592   C CG    . ASP A 1 82  ? 162.695 159.415 143.990 1.00 107.87 ? 82  ASP A CG    1 
ATOM   593   O OD1   . ASP A 1 82  ? 163.550 159.465 144.900 1.00 107.87 ? 82  ASP A OD1   1 
ATOM   594   O OD2   . ASP A 1 82  ? 161.521 159.044 144.186 1.00 107.87 ? 82  ASP A OD2   1 
ATOM   595   N N     . SER A 1 83  ? 164.855 161.587 144.614 1.00 101.46 ? 83  SER A N     1 
ATOM   596   C CA    . SER A 1 83  ? 164.810 162.789 145.438 1.00 101.46 ? 83  SER A CA    1 
ATOM   597   C C     . SER A 1 83  ? 165.862 163.799 145.003 1.00 101.46 ? 83  SER A C     1 
ATOM   598   O O     . SER A 1 83  ? 165.573 164.996 144.888 1.00 101.46 ? 83  SER A O     1 
ATOM   599   C CB    . SER A 1 83  ? 164.995 162.421 146.908 1.00 101.46 ? 83  SER A CB    1 
ATOM   600   O OG    . SER A 1 83  ? 166.299 161.921 147.144 1.00 101.46 ? 83  SER A OG    1 
ATOM   601   N N     . ALA A 1 84  ? 167.090 163.336 144.760 1.00 99.83  ? 84  ALA A N     1 
ATOM   602   C CA    . ALA A 1 84  ? 168.146 164.243 144.328 1.00 99.83  ? 84  ALA A CA    1 
ATOM   603   C C     . ALA A 1 84  ? 167.795 164.907 143.004 1.00 99.83  ? 84  ALA A C     1 
ATOM   604   O O     . ALA A 1 84  ? 167.968 166.121 142.843 1.00 99.83  ? 84  ALA A O     1 
ATOM   605   C CB    . ALA A 1 84  ? 169.470 163.489 144.217 1.00 99.83  ? 84  ALA A CB    1 
ATOM   606   N N     . VAL A 1 85  ? 167.290 164.126 142.047 1.00 93.94  ? 85  VAL A N     1 
ATOM   607   C CA    . VAL A 1 85  ? 166.949 164.678 140.740 1.00 93.94  ? 85  VAL A CA    1 
ATOM   608   C C     . VAL A 1 85  ? 165.850 165.721 140.871 1.00 93.94  ? 85  VAL A C     1 
ATOM   609   O O     . VAL A 1 85  ? 165.933 166.810 140.287 1.00 93.94  ? 85  VAL A O     1 
ATOM   610   C CB    . VAL A 1 85  ? 166.544 163.549 139.778 1.00 93.94  ? 85  VAL A CB    1 
ATOM   611   C CG1   . VAL A 1 85  ? 166.075 164.126 138.460 1.00 93.94  ? 85  VAL A CG1   1 
ATOM   612   C CG2   . VAL A 1 85  ? 167.707 162.605 139.563 1.00 93.94  ? 85  VAL A CG2   1 
ATOM   613   N N     . TYR A 1 86  ? 164.807 165.414 141.644 1.00 94.99  ? 86  TYR A N     1 
ATOM   614   C CA    . TYR A 1 86  ? 163.702 166.355 141.768 1.00 94.99  ? 86  TYR A CA    1 
ATOM   615   C C     . TYR A 1 86  ? 164.124 167.617 142.506 1.00 94.99  ? 86  TYR A C     1 
ATOM   616   O O     . TYR A 1 86  ? 163.685 168.718 142.154 1.00 94.99  ? 86  TYR A O     1 
ATOM   617   C CB    . TYR A 1 86  ? 162.517 165.698 142.467 1.00 94.99  ? 86  TYR A CB    1 
ATOM   618   C CG    . TYR A 1 86  ? 161.327 166.613 142.583 1.00 94.99  ? 86  TYR A CG    1 
ATOM   619   C CD1   . TYR A 1 86  ? 160.585 166.956 141.464 1.00 94.99  ? 86  TYR A CD1   1 
ATOM   620   C CD2   . TYR A 1 86  ? 160.938 167.126 143.809 1.00 94.99  ? 86  TYR A CD2   1 
ATOM   621   C CE1   . TYR A 1 86  ? 159.496 167.795 141.561 1.00 94.99  ? 86  TYR A CE1   1 
ATOM   622   C CE2   . TYR A 1 86  ? 159.846 167.961 143.917 1.00 94.99  ? 86  TYR A CE2   1 
ATOM   623   C CZ    . TYR A 1 86  ? 159.128 168.292 142.790 1.00 94.99  ? 86  TYR A CZ    1 
ATOM   624   O OH    . TYR A 1 86  ? 158.040 169.124 142.895 1.00 94.99  ? 86  TYR A OH    1 
ATOM   625   N N     . ASP A 1 87  ? 164.981 167.486 143.520 1.00 96.42  ? 87  ASP A N     1 
ATOM   626   C CA    . ASP A 1 87  ? 165.484 168.671 144.200 1.00 96.42  ? 87  ASP A CA    1 
ATOM   627   C C     . ASP A 1 87  ? 166.327 169.523 143.265 1.00 96.42  ? 87  ASP A C     1 
ATOM   628   O O     . ASP A 1 87  ? 166.241 170.756 143.293 1.00 96.42  ? 87  ASP A O     1 
ATOM   629   C CB    . ASP A 1 87  ? 166.291 168.268 145.431 1.00 96.42  ? 87  ASP A CB    1 
ATOM   630   C CG    . ASP A 1 87  ? 165.428 167.666 146.515 1.00 96.42  ? 87  ASP A CG    1 
ATOM   631   O OD1   . ASP A 1 87  ? 164.235 168.026 146.590 1.00 96.42  ? 87  ASP A OD1   1 
ATOM   632   O OD2   . ASP A 1 87  ? 165.940 166.833 147.292 1.00 96.42  ? 87  ASP A OD2   1 
ATOM   633   N N     . THR A 1 88  ? 167.141 168.884 142.423 1.00 91.10  ? 88  THR A N     1 
ATOM   634   C CA    . THR A 1 88  ? 167.933 169.635 141.458 1.00 91.10  ? 88  THR A CA    1 
ATOM   635   C C     . THR A 1 88  ? 167.038 170.385 140.482 1.00 91.10  ? 88  THR A C     1 
ATOM   636   O O     . THR A 1 88  ? 167.318 171.535 140.126 1.00 91.10  ? 88  THR A O     1 
ATOM   637   C CB    . THR A 1 88  ? 168.874 168.694 140.711 1.00 91.10  ? 88  THR A CB    1 
ATOM   638   O OG1   . THR A 1 88  ? 169.736 168.042 141.650 1.00 91.10  ? 88  THR A OG1   1 
ATOM   639   C CG2   . THR A 1 88  ? 169.719 169.467 139.719 1.00 91.10  ? 88  THR A CG2   1 
ATOM   640   N N     . ILE A 1 89  ? 165.949 169.752 140.044 1.00 83.06  ? 89  ILE A N     1 
ATOM   641   C CA    . ILE A 1 89  ? 165.027 170.423 139.132 1.00 83.06  ? 89  ILE A CA    1 
ATOM   642   C C     . ILE A 1 89  ? 164.360 171.607 139.819 1.00 83.06  ? 89  ILE A C     1 
ATOM   643   O O     . ILE A 1 89  ? 164.264 172.700 139.249 1.00 83.06  ? 89  ILE A O     1 
ATOM   644   C CB    . ILE A 1 89  ? 163.989 169.427 138.588 1.00 83.06  ? 89  ILE A CB    1 
ATOM   645   C CG1   . ILE A 1 89  ? 164.674 168.371 137.724 1.00 83.06  ? 89  ILE A CG1   1 
ATOM   646   C CG2   . ILE A 1 89  ? 162.928 170.152 137.789 1.00 83.06  ? 89  ILE A CG2   1 
ATOM   647   C CD1   . ILE A 1 89  ? 163.775 167.223 137.352 1.00 83.06  ? 89  ILE A CD1   1 
ATOM   648   N N     . VAL A 1 90  ? 163.893 171.413 141.054 1.00 86.00  ? 90  VAL A N     1 
ATOM   649   C CA    . VAL A 1 90  ? 163.219 172.495 141.768 1.00 86.00  ? 90  VAL A CA    1 
ATOM   650   C C     . VAL A 1 90  ? 164.177 173.653 142.012 1.00 86.00  ? 90  VAL A C     1 
ATOM   651   O O     . VAL A 1 90  ? 163.780 174.824 141.982 1.00 86.00  ? 90  VAL A O     1 
ATOM   652   C CB    . VAL A 1 90  ? 162.612 171.974 143.082 1.00 86.00  ? 90  VAL A CB    1 
ATOM   653   C CG1   . VAL A 1 90  ? 162.056 173.119 143.907 1.00 86.00  ? 90  VAL A CG1   1 
ATOM   654   C CG2   . VAL A 1 90  ? 161.517 170.970 142.787 1.00 86.00  ? 90  VAL A CG2   1 
ATOM   655   N N     . ARG A 1 91  ? 165.454 173.349 142.241 1.00 87.30  ? 91  ARG A N     1 
ATOM   656   C CA    . ARG A 1 91  ? 166.423 174.400 142.534 1.00 87.30  ? 91  ARG A CA    1 
ATOM   657   C C     . ARG A 1 91  ? 166.569 175.357 141.358 1.00 87.30  ? 91  ARG A C     1 
ATOM   658   O O     . ARG A 1 91  ? 166.714 176.570 141.545 1.00 87.30  ? 91  ARG A O     1 
ATOM   659   C CB    . ARG A 1 91  ? 167.770 173.776 142.902 1.00 87.30  ? 91  ARG A CB    1 
ATOM   660   C CG    . ARG A 1 91  ? 168.844 174.777 143.297 1.00 87.30  ? 91  ARG A CG    1 
ATOM   661   C CD    . ARG A 1 91  ? 169.762 175.103 142.132 1.00 87.30  ? 91  ARG A CD    1 
ATOM   662   N NE    . ARG A 1 91  ? 170.814 176.041 142.511 1.00 87.30  ? 91  ARG A NE    1 
ATOM   663   C CZ    . ARG A 1 91  ? 171.981 175.684 143.033 1.00 87.30  ? 91  ARG A CZ    1 
ATOM   664   N NH1   . ARG A 1 91  ? 172.253 174.404 143.241 1.00 87.30  ? 91  ARG A NH1   1 
ATOM   665   N NH2   . ARG A 1 91  ? 172.877 176.608 143.348 1.00 87.30  ? 91  ARG A NH2   1 
ATOM   666   N N     . MET A 1 92  ? 166.527 174.832 140.133 1.00 87.21  ? 92  MET A N     1 
ATOM   667   C CA    . MET A 1 92  ? 166.765 175.676 138.967 1.00 87.21  ? 92  MET A CA    1 
ATOM   668   C C     . MET A 1 92  ? 165.584 176.598 138.690 1.00 87.21  ? 92  MET A C     1 
ATOM   669   O O     . MET A 1 92  ? 165.751 177.666 138.091 1.00 87.21  ? 92  MET A O     1 
ATOM   670   C CB    . MET A 1 92  ? 167.064 174.811 137.746 1.00 87.21  ? 92  MET A CB    1 
ATOM   671   C CG    . MET A 1 92  ? 168.378 174.065 137.829 1.00 87.21  ? 92  MET A CG    1 
ATOM   672   S SD    . MET A 1 92  ? 168.707 173.100 136.347 1.00 87.21  ? 92  MET A SD    1 
ATOM   673   C CE    . MET A 1 92  ? 167.570 171.739 136.580 1.00 87.21  ? 92  MET A CE    1 
ATOM   674   N N     . ALA A 1 93  ? 164.383 176.204 139.113 1.00 89.04  ? 93  ALA A N     1 
ATOM   675   C CA    . ALA A 1 93  ? 163.198 176.979 138.761 1.00 89.04  ? 93  ALA A CA    1 
ATOM   676   C C     . ALA A 1 93  ? 163.056 178.219 139.637 1.00 89.04  ? 93  ALA A C     1 
ATOM   677   O O     . ALA A 1 93  ? 162.393 179.187 139.247 1.00 89.04  ? 93  ALA A O     1 
ATOM   678   C CB    . ALA A 1 93  ? 161.952 176.105 138.865 1.00 89.04  ? 93  ALA A CB    1 
ATOM   679   N N     . GLN A 1 94  ? 163.662 178.210 140.817 1.00 94.56  ? 94  GLN A N     1 
ATOM   680   C CA    . GLN A 1 94  ? 163.485 179.321 141.737 1.00 94.56  ? 94  GLN A CA    1 
ATOM   681   C C     . GLN A 1 94  ? 164.182 180.569 141.200 1.00 94.56  ? 94  GLN A C     1 
ATOM   682   O O     . GLN A 1 94  ? 165.362 180.516 140.839 1.00 94.56  ? 94  GLN A O     1 
ATOM   683   C CB    . GLN A 1 94  ? 164.030 178.967 143.118 1.00 94.56  ? 94  GLN A CB    1 
ATOM   684   C CG    . GLN A 1 94  ? 163.249 177.880 143.823 1.00 94.56  ? 94  GLN A CG    1 
ATOM   685   C CD    . GLN A 1 94  ? 163.813 177.557 145.186 1.00 94.56  ? 94  GLN A CD    1 
ATOM   686   O OE1   . GLN A 1 94  ? 164.839 178.101 145.590 1.00 94.56  ? 94  GLN A OE1   1 
ATOM   687   N NE2   . GLN A 1 94  ? 163.143 176.668 145.907 1.00 94.56  ? 94  GLN A NE2   1 
ATOM   688   N N     . PRO A 1 95  ? 163.487 181.701 141.130 1.00 95.73  ? 95  PRO A N     1 
ATOM   689   C CA    . PRO A 1 95  ? 164.122 182.933 140.645 1.00 95.73  ? 95  PRO A CA    1 
ATOM   690   C C     . PRO A 1 95  ? 165.154 183.473 141.618 1.00 95.73  ? 95  PRO A C     1 
ATOM   691   O O     . PRO A 1 95  ? 166.198 183.989 141.209 1.00 95.73  ? 95  PRO A O     1 
ATOM   692   C CB    . PRO A 1 95  ? 162.940 183.901 140.501 1.00 95.73  ? 95  PRO A CB    1 
ATOM   693   C CG    . PRO A 1 95  ? 161.736 183.024 140.406 1.00 95.73  ? 95  PRO A CG    1 
ATOM   694   C CD    . PRO A 1 95  ? 162.034 181.856 141.288 1.00 95.73  ? 95  PRO A CD    1 
ATOM   695   N N     . PHE A 1 96  ? 164.874 183.354 142.912 1.00 99.02  ? 96  PHE A N     1 
ATOM   696   C CA    . PHE A 1 96  ? 165.722 183.916 143.952 1.00 99.02  ? 96  PHE A CA    1 
ATOM   697   C C     . PHE A 1 96  ? 166.924 183.041 144.280 1.00 99.02  ? 96  PHE A C     1 
ATOM   698   O O     . PHE A 1 96  ? 167.556 183.244 145.320 1.00 99.02  ? 96  PHE A O     1 
ATOM   699   C CB    . PHE A 1 96  ? 164.901 184.166 145.219 1.00 99.02  ? 96  PHE A CB    1 
ATOM   700   C CG    . PHE A 1 96  ? 164.331 182.918 145.830 1.00 99.02  ? 96  PHE A CG    1 
ATOM   701   C CD1   . PHE A 1 96  ? 163.102 182.432 145.423 1.00 99.02  ? 96  PHE A CD1   1 
ATOM   702   C CD2   . PHE A 1 96  ? 165.015 182.243 146.824 1.00 99.02  ? 96  PHE A CD2   1 
ATOM   703   C CE1   . PHE A 1 96  ? 162.573 181.290 145.985 1.00 99.02  ? 96  PHE A CE1   1 
ATOM   704   C CE2   . PHE A 1 96  ? 164.491 181.100 147.389 1.00 99.02  ? 96  PHE A CE2   1 
ATOM   705   C CZ    . PHE A 1 96  ? 163.268 180.623 146.969 1.00 99.02  ? 96  PHE A CZ    1 
ATOM   706   N N     . SER A 1 97  ? 167.254 182.076 143.424 1.00 94.37  ? 97  SER A N     1 
ATOM   707   C CA    . SER A 1 97  ? 168.411 181.224 143.638 1.00 94.37  ? 97  SER A CA    1 
ATOM   708   C C     . SER A 1 97  ? 169.359 181.172 142.452 1.00 94.37  ? 97  SER A C     1 
ATOM   709   O O     . SER A 1 97  ? 170.465 180.640 142.593 1.00 94.37  ? 97  SER A O     1 
ATOM   710   C CB    . SER A 1 97  ? 167.972 179.794 143.987 1.00 94.37  ? 97  SER A CB    1 
ATOM   711   O OG    . SER A 1 97  ? 169.096 178.958 144.187 1.00 94.37  ? 97  SER A OG    1 
ATOM   712   N N     . LEU A 1 98  ? 168.966 181.697 141.295 1.00 95.30  ? 98  LEU A N     1 
ATOM   713   C CA    . LEU A 1 98  ? 169.835 181.764 140.130 1.00 95.30  ? 98  LEU A CA    1 
ATOM   714   C C     . LEU A 1 98  ? 169.648 183.107 139.447 1.00 95.30  ? 98  LEU A C     1 
ATOM   715   O O     . LEU A 1 98  ? 168.527 183.613 139.356 1.00 95.30  ? 98  LEU A O     1 
ATOM   716   C CB    . LEU A 1 98  ? 169.547 180.631 139.141 1.00 95.30  ? 98  LEU A CB    1 
ATOM   717   C CG    . LEU A 1 98  ? 169.897 179.222 139.607 1.00 95.30  ? 98  LEU A CG    1 
ATOM   718   C CD1   . LEU A 1 98  ? 169.432 178.200 138.589 1.00 95.30  ? 98  LEU A CD1   1 
ATOM   719   C CD2   . LEU A 1 98  ? 171.390 179.106 139.837 1.00 95.30  ? 98  LEU A CD2   1 
ATOM   720   N N     . ARG A 1 99  ? 170.752 183.682 138.969 1.00 95.11  ? 99  ARG A N     1 
ATOM   721   C CA    . ARG A 1 99  ? 170.671 184.970 138.291 1.00 95.11  ? 99  ARG A CA    1 
ATOM   722   C C     . ARG A 1 99  ? 169.888 184.856 136.990 1.00 95.11  ? 99  ARG A C     1 
ATOM   723   O O     . ARG A 1 99  ? 169.144 185.772 136.622 1.00 95.11  ? 99  ARG A O     1 
ATOM   724   C CB    . ARG A 1 99  ? 172.074 185.514 138.031 1.00 95.11  ? 99  ARG A CB    1 
ATOM   725   C CG    . ARG A 1 99  ? 172.097 186.851 137.321 1.00 95.11  ? 99  ARG A CG    1 
ATOM   726   C CD    . ARG A 1 99  ? 171.478 187.938 138.176 1.00 95.11  ? 99  ARG A CD    1 
ATOM   727   N NE    . ARG A 1 99  ? 171.539 189.239 137.521 1.00 95.11  ? 99  ARG A NE    1 
ATOM   728   C CZ    . ARG A 1 99  ? 170.640 189.673 136.646 1.00 95.11  ? 99  ARG A CZ    1 
ATOM   729   N NH1   . ARG A 1 99  ? 170.771 190.871 136.096 1.00 95.11  ? 99  ARG A NH1   1 
ATOM   730   N NH2   . ARG A 1 99  ? 169.611 188.906 136.317 1.00 95.11  ? 99  ARG A NH2   1 
ATOM   731   N N     . TYR A 1 100 ? 170.037 183.738 136.285 1.00 93.58  ? 100 TYR A N     1 
ATOM   732   C CA    . TYR A 1 100 ? 169.302 183.476 135.049 1.00 93.58  ? 100 TYR A CA    1 
ATOM   733   C C     . TYR A 1 100 ? 168.762 182.054 135.124 1.00 93.58  ? 100 TYR A C     1 
ATOM   734   O O     . TYR A 1 100 ? 169.503 181.092 134.903 1.00 93.58  ? 100 TYR A O     1 
ATOM   735   C CB    . TYR A 1 100 ? 170.188 183.669 133.827 1.00 93.58  ? 100 TYR A CB    1 
ATOM   736   C CG    . TYR A 1 100 ? 170.629 185.095 133.628 1.00 93.58  ? 100 TYR A CG    1 
ATOM   737   C CD1   . TYR A 1 100 ? 169.782 186.028 133.052 1.00 93.58  ? 100 TYR A CD1   1 
ATOM   738   C CD2   . TYR A 1 100 ? 171.891 185.509 134.019 1.00 93.58  ? 100 TYR A CD2   1 
ATOM   739   C CE1   . TYR A 1 100 ? 170.182 187.335 132.871 1.00 93.58  ? 100 TYR A CE1   1 
ATOM   740   C CE2   . TYR A 1 100 ? 172.300 186.812 133.841 1.00 93.58  ? 100 TYR A CE2   1 
ATOM   741   C CZ    . TYR A 1 100 ? 171.442 187.721 133.268 1.00 93.58  ? 100 TYR A CZ    1 
ATOM   742   O OH    . TYR A 1 100 ? 171.850 189.021 133.092 1.00 93.58  ? 100 TYR A OH    1 
ATOM   743   N N     . MET A 1 101 ? 167.477 181.923 135.438 1.00 98.51  ? 101 MET A N     1 
ATOM   744   C CA    . MET A 1 101 ? 166.866 180.610 135.562 1.00 98.51  ? 101 MET A CA    1 
ATOM   745   C C     . MET A 1 101 ? 166.863 179.888 134.220 1.00 98.51  ? 101 MET A C     1 
ATOM   746   O O     . MET A 1 101 ? 166.909 180.507 133.155 1.00 98.51  ? 101 MET A O     1 
ATOM   747   C CB    . MET A 1 101 ? 165.439 180.736 136.088 1.00 98.51  ? 101 MET A CB    1 
ATOM   748   C CG    . MET A 1 101 ? 164.504 181.455 135.140 1.00 98.51  ? 101 MET A CG    1 
ATOM   749   S SD    . MET A 1 101 ? 162.869 181.700 135.849 1.00 98.51  ? 101 MET A SD    1 
ATOM   750   C CE    . MET A 1 101 ? 163.219 182.994 137.033 1.00 98.51  ? 101 MET A CE    1 
ATOM   751   N N     . LEU A 1 102 ? 166.814 178.559 134.282 1.00 87.01  ? 102 LEU A N     1 
ATOM   752   C CA    . LEU A 1 102 ? 166.837 177.727 133.088 1.00 87.01  ? 102 LEU A CA    1 
ATOM   753   C C     . LEU A 1 102 ? 165.549 176.960 132.851 1.00 87.01  ? 102 LEU A C     1 
ATOM   754   O O     . LEU A 1 102 ? 165.176 176.753 131.696 1.00 87.01  ? 102 LEU A O     1 
ATOM   755   C CB    . LEU A 1 102 ? 167.993 176.725 133.161 1.00 87.01  ? 102 LEU A CB    1 
ATOM   756   C CG    . LEU A 1 102 ? 169.389 177.341 133.137 1.00 87.01  ? 102 LEU A CG    1 
ATOM   757   C CD1   . LEU A 1 102 ? 170.443 176.274 133.357 1.00 87.01  ? 102 LEU A CD1   1 
ATOM   758   C CD2   . LEU A 1 102 ? 169.617 178.061 131.824 1.00 87.01  ? 102 LEU A CD2   1 
ATOM   759   N N     . VAL A 1 103 ? 164.863 176.540 133.904 1.00 93.00  ? 103 VAL A N     1 
ATOM   760   C CA    . VAL A 1 103 ? 163.670 175.713 133.789 1.00 93.00  ? 103 VAL A CA    1 
ATOM   761   C C     . VAL A 1 103 ? 162.482 176.571 134.202 1.00 93.00  ? 103 VAL A C     1 
ATOM   762   O O     . VAL A 1 103 ? 162.248 176.800 135.393 1.00 93.00  ? 103 VAL A O     1 
ATOM   763   C CB    . VAL A 1 103 ? 163.771 174.446 134.641 1.00 93.00  ? 103 VAL A CB    1 
ATOM   764   C CG1   . VAL A 1 103 ? 162.484 173.649 134.552 1.00 93.00  ? 103 VAL A CG1   1 
ATOM   765   C CG2   . VAL A 1 103 ? 164.955 173.610 134.197 1.00 93.00  ? 103 VAL A CG2   1 
ATOM   766   N N     . ASP A 1 104 ? 161.727 177.049 133.218 1.00 105.83 ? 104 ASP A N     1 
ATOM   767   C CA    . ASP A 1 104 ? 160.520 177.818 133.486 1.00 105.83 ? 104 ASP A CA    1 
ATOM   768   C C     . ASP A 1 104 ? 159.418 176.871 133.940 1.00 105.83 ? 104 ASP A C     1 
ATOM   769   O O     . ASP A 1 104 ? 159.031 175.962 133.200 1.00 105.83 ? 104 ASP A O     1 
ATOM   770   C CB    . ASP A 1 104 ? 160.093 178.588 132.240 1.00 105.83 ? 104 ASP A CB    1 
ATOM   771   C CG    . ASP A 1 104 ? 158.991 179.586 132.521 1.00 105.83 ? 104 ASP A CG    1 
ATOM   772   O OD1   . ASP A 1 104 ? 158.555 179.682 133.687 1.00 105.83 ? 104 ASP A OD1   1 
ATOM   773   O OD2   . ASP A 1 104 ? 158.558 180.275 131.574 1.00 105.83 ? 104 ASP A OD2   1 
ATOM   774   N N     . GLY A 1 105 ? 158.909 177.085 135.149 1.00 107.59 ? 105 GLY A N     1 
ATOM   775   C CA    . GLY A 1 105 ? 157.916 176.188 135.704 1.00 107.59 ? 105 GLY A CA    1 
ATOM   776   C C     . GLY A 1 105 ? 156.605 176.855 136.060 1.00 107.59 ? 105 GLY A C     1 
ATOM   777   O O     . GLY A 1 105 ? 156.386 178.026 135.737 1.00 107.59 ? 105 GLY A O     1 
ATOM   778   N N     . GLN A 1 106 ? 155.725 176.115 136.731 1.00 109.70 ? 106 GLN A N     1 
ATOM   779   C CA    . GLN A 1 106 ? 154.410 176.636 137.099 1.00 109.70 ? 106 GLN A CA    1 
ATOM   780   C C     . GLN A 1 106 ? 153.884 175.815 138.267 1.00 109.70 ? 106 GLN A C     1 
ATOM   781   O O     . GLN A 1 106 ? 153.571 174.633 138.098 1.00 109.70 ? 106 GLN A O     1 
ATOM   782   C CB    . GLN A 1 106 ? 153.456 176.576 135.916 1.00 109.70 ? 106 GLN A CB    1 
ATOM   783   C CG    . GLN A 1 106 ? 152.077 177.122 136.214 1.00 109.70 ? 106 GLN A CG    1 
ATOM   784   C CD    . GLN A 1 106 ? 151.165 177.071 135.009 1.00 109.70 ? 106 GLN A CD    1 
ATOM   785   O OE1   . GLN A 1 106 ? 151.555 176.597 133.943 1.00 109.70 ? 106 GLN A OE1   1 
ATOM   786   N NE2   . GLN A 1 106 ? 149.941 177.556 135.173 1.00 109.70 ? 106 GLN A NE2   1 
ATOM   787   N N     . GLY A 1 107 ? 153.779 176.436 139.430 1.00 111.00 ? 107 GLY A N     1 
ATOM   788   C CA    . GLY A 1 107 ? 153.291 175.779 140.618 1.00 111.00 ? 107 GLY A CA    1 
ATOM   789   C C     . GLY A 1 107 ? 154.034 176.270 141.838 1.00 111.00 ? 107 GLY A C     1 
ATOM   790   O O     . GLY A 1 107 ? 154.853 177.184 141.769 1.00 111.00 ? 107 GLY A O     1 
ATOM   791   N N     . ASN A 1 108 ? 153.741 175.646 142.974 1.00 112.81 ? 108 ASN A N     1 
ATOM   792   C CA    . ASN A 1 108 ? 154.357 176.024 144.242 1.00 112.81 ? 108 ASN A CA    1 
ATOM   793   C C     . ASN A 1 108 ? 155.793 175.522 144.265 1.00 112.81 ? 108 ASN A C     1 
ATOM   794   O O     . ASN A 1 108 ? 156.051 174.345 144.521 1.00 112.81 ? 108 ASN A O     1 
ATOM   795   C CB    . ASN A 1 108 ? 153.561 175.457 145.410 1.00 112.81 ? 108 ASN A CB    1 
ATOM   796   C CG    . ASN A 1 108 ? 154.031 175.992 146.745 1.00 112.81 ? 108 ASN A CG    1 
ATOM   797   O OD1   . ASN A 1 108 ? 154.963 176.793 146.814 1.00 112.81 ? 108 ASN A OD1   1 
ATOM   798   N ND2   . ASN A 1 108 ? 153.389 175.548 147.818 1.00 112.81 ? 108 ASN A ND2   1 
ATOM   799   N N     . PHE A 1 109 ? 156.739 176.422 144.005 1.00 99.65  ? 109 PHE A N     1 
ATOM   800   C CA    . PHE A 1 109 ? 158.159 176.106 144.037 1.00 99.65  ? 109 PHE A CA    1 
ATOM   801   C C     . PHE A 1 109 ? 158.838 176.613 145.301 1.00 99.65  ? 109 PHE A C     1 
ATOM   802   O O     . PHE A 1 109 ? 160.060 176.791 145.312 1.00 99.65  ? 109 PHE A O     1 
ATOM   803   C CB    . PHE A 1 109 ? 158.854 176.681 142.805 1.00 99.65  ? 109 PHE A CB    1 
ATOM   804   C CG    . PHE A 1 109 ? 158.521 175.963 141.535 1.00 99.65  ? 109 PHE A CG    1 
ATOM   805   C CD1   . PHE A 1 109 ? 157.971 174.697 141.563 1.00 99.65  ? 109 PHE A CD1   1 
ATOM   806   C CD2   . PHE A 1 109 ? 158.754 176.559 140.311 1.00 99.65  ? 109 PHE A CD2   1 
ATOM   807   C CE1   . PHE A 1 109 ? 157.667 174.036 140.393 1.00 99.65  ? 109 PHE A CE1   1 
ATOM   808   C CE2   . PHE A 1 109 ? 158.449 175.904 139.140 1.00 99.65  ? 109 PHE A CE2   1 
ATOM   809   C CZ    . PHE A 1 109 ? 157.905 174.641 139.181 1.00 99.65  ? 109 PHE A CZ    1 
ATOM   810   N N     . GLY A 1 110 ? 158.076 176.850 146.361 1.00 115.10 ? 110 GLY A N     1 
ATOM   811   C CA    . GLY A 1 110 ? 158.636 177.401 147.578 1.00 115.10 ? 110 GLY A CA    1 
ATOM   812   C C     . GLY A 1 110 ? 158.986 178.868 147.412 1.00 115.10 ? 110 GLY A C     1 
ATOM   813   O O     . GLY A 1 110 ? 158.799 179.476 146.360 1.00 115.10 ? 110 GLY A O     1 
ATOM   814   N N     . SER A 1 111 ? 159.507 179.444 148.490 1.00 123.21 ? 111 SER A N     1 
ATOM   815   C CA    . SER A 1 111 ? 159.894 180.847 148.487 1.00 123.21 ? 111 SER A CA    1 
ATOM   816   C C     . SER A 1 111 ? 160.996 181.051 149.519 1.00 123.21 ? 111 SER A C     1 
ATOM   817   O O     . SER A 1 111 ? 161.546 180.091 150.066 1.00 123.21 ? 111 SER A O     1 
ATOM   818   C CB    . SER A 1 111 ? 158.682 181.746 148.759 1.00 123.21 ? 111 SER A CB    1 
ATOM   819   O OG    . SER A 1 111 ? 158.195 181.553 150.075 1.00 123.21 ? 111 SER A OG    1 
ATOM   820   N N     . ILE A 1 112 ? 161.309 182.319 149.790 1.00 120.39 ? 112 ILE A N     1 
ATOM   821   C CA    . ILE A 1 112 ? 162.380 182.654 150.719 1.00 120.39 ? 112 ILE A CA    1 
ATOM   822   C C     . ILE A 1 112 ? 162.031 182.291 152.155 1.00 120.39 ? 112 ILE A C     1 
ATOM   823   O O     . ILE A 1 112 ? 162.924 182.218 153.005 1.00 120.39 ? 112 ILE A O     1 
ATOM   824   C CB    . ILE A 1 112 ? 162.716 184.154 150.594 1.00 120.39 ? 112 ILE A CB    1 
ATOM   825   C CG1   . ILE A 1 112 ? 164.065 184.465 151.241 1.00 120.39 ? 112 ILE A CG1   1 
ATOM   826   C CG2   . ILE A 1 112 ? 161.614 184.998 151.209 1.00 120.39 ? 112 ILE A CG2   1 
ATOM   827   C CD1   . ILE A 1 112 ? 165.236 183.820 150.537 1.00 120.39 ? 112 ILE A CD1   1 
ATOM   828   N N     . ASP A 1 113 ? 160.755 182.038 152.446 1.00 131.93 ? 113 ASP A N     1 
ATOM   829   C CA    . ASP A 1 113 ? 160.338 181.700 153.802 1.00 131.93 ? 113 ASP A CA    1 
ATOM   830   C C     . ASP A 1 113 ? 160.803 180.323 154.248 1.00 131.93 ? 113 ASP A C     1 
ATOM   831   O O     . ASP A 1 113 ? 160.527 179.939 155.389 1.00 131.93 ? 113 ASP A O     1 
ATOM   832   C CB    . ASP A 1 113 ? 158.816 181.784 153.918 1.00 131.93 ? 113 ASP A CB    1 
ATOM   833   C CG    . ASP A 1 113 ? 158.304 183.204 153.835 1.00 131.93 ? 113 ASP A CG    1 
ATOM   834   O OD1   . ASP A 1 113 ? 159.044 184.125 154.236 1.00 131.93 ? 113 ASP A OD1   1 
ATOM   835   O OD2   . ASP A 1 113 ? 157.162 183.401 153.369 1.00 131.93 ? 113 ASP A OD2   1 
ATOM   836   N N     . GLY A 1 114 ? 161.492 179.572 153.394 1.00 131.25 ? 114 GLY A N     1 
ATOM   837   C CA    . GLY A 1 114 ? 161.922 178.236 153.738 1.00 131.25 ? 114 GLY A CA    1 
ATOM   838   C C     . GLY A 1 114 ? 160.905 177.150 153.471 1.00 131.25 ? 114 GLY A C     1 
ATOM   839   O O     . GLY A 1 114 ? 161.187 175.979 153.754 1.00 131.25 ? 114 GLY A O     1 
ATOM   840   N N     . ASP A 1 115 ? 159.735 177.494 152.941 1.00 127.44 ? 115 ASP A N     1 
ATOM   841   C CA    . ASP A 1 115 ? 158.729 176.488 152.632 1.00 127.44 ? 115 ASP A CA    1 
ATOM   842   C C     . ASP A 1 115 ? 159.175 175.650 151.442 1.00 127.44 ? 115 ASP A C     1 
ATOM   843   O O     . ASP A 1 115 ? 159.601 176.186 150.415 1.00 127.44 ? 115 ASP A O     1 
ATOM   844   C CB    . ASP A 1 115 ? 157.386 177.152 152.337 1.00 127.44 ? 115 ASP A CB    1 
ATOM   845   C CG    . ASP A 1 115 ? 156.773 177.793 153.563 1.00 127.44 ? 115 ASP A CG    1 
ATOM   846   O OD1   . ASP A 1 115 ? 157.044 177.312 154.683 1.00 127.44 ? 115 ASP A OD1   1 
ATOM   847   O OD2   . ASP A 1 115 ? 156.018 178.774 153.406 1.00 127.44 ? 115 ASP A OD2   1 
ATOM   848   N N     . SER A 1 116 ? 159.079 174.333 151.583 1.00 119.37 ? 116 SER A N     1 
ATOM   849   C CA    . SER A 1 116 ? 159.467 173.438 150.508 1.00 119.37 ? 116 SER A CA    1 
ATOM   850   C C     . SER A 1 116 ? 158.422 173.450 149.398 1.00 119.37 ? 116 SER A C     1 
ATOM   851   O O     . SER A 1 116 ? 157.272 173.851 149.593 1.00 119.37 ? 116 SER A O     1 
ATOM   852   C CB    . SER A 1 116 ? 159.657 172.017 151.035 1.00 119.37 ? 116 SER A CB    1 
ATOM   853   O OG    . SER A 1 116 ? 160.719 171.961 151.970 1.00 119.37 ? 116 SER A OG    1 
ATOM   854   N N     . ALA A 1 117 ? 158.839 172.999 148.220 1.00 110.95 ? 117 ALA A N     1 
ATOM   855   C CA    . ALA A 1 117 ? 157.936 172.949 147.084 1.00 110.95 ? 117 ALA A CA    1 
ATOM   856   C C     . ALA A 1 117 ? 156.945 171.799 147.242 1.00 110.95 ? 117 ALA A C     1 
ATOM   857   O O     . ALA A 1 117 ? 157.068 170.948 148.127 1.00 110.95 ? 117 ALA A O     1 
ATOM   858   C CB    . ALA A 1 117 ? 158.722 172.803 145.782 1.00 110.95 ? 117 ALA A CB    1 
ATOM   859   N N     . ALA A 1 118 ? 155.950 171.780 146.361 1.00 107.41 ? 118 ALA A N     1 
ATOM   860   C CA    . ALA A 1 118 ? 154.922 170.754 146.407 1.00 107.41 ? 118 ALA A CA    1 
ATOM   861   C C     . ALA A 1 118 ? 155.474 169.428 145.890 1.00 107.41 ? 118 ALA A C     1 
ATOM   862   O O     . ALA A 1 118 ? 156.634 169.318 145.483 1.00 107.41 ? 118 ALA A O     1 
ATOM   863   C CB    . ALA A 1 118 ? 153.702 171.192 145.603 1.00 107.41 ? 118 ALA A CB    1 
ATOM   864   N N     . ALA A 1 119 ? 154.626 168.404 145.906 1.00 103.09 ? 119 ALA A N     1 
ATOM   865   C CA    . ALA A 1 119 ? 155.026 167.094 145.425 1.00 103.09 ? 119 ALA A CA    1 
ATOM   866   C C     . ALA A 1 119 ? 155.266 167.130 143.918 1.00 103.09 ? 119 ALA A C     1 
ATOM   867   O O     . ALA A 1 119 ? 154.890 168.074 143.219 1.00 103.09 ? 119 ALA A O     1 
ATOM   868   C CB    . ALA A 1 119 ? 153.965 166.050 145.770 1.00 103.09 ? 119 ALA A CB    1 
ATOM   869   N N     . MET A 1 120 ? 155.901 166.075 143.415 1.00 106.83 ? 120 MET A N     1 
ATOM   870   C CA    . MET A 1 120 ? 156.241 166.000 142.001 1.00 106.83 ? 120 MET A CA    1 
ATOM   871   C C     . MET A 1 120 ? 155.069 165.586 141.123 1.00 106.83 ? 120 MET A C     1 
ATOM   872   O O     . MET A 1 120 ? 155.280 165.286 139.944 1.00 106.83 ? 120 MET A O     1 
ATOM   873   C CB    . MET A 1 120 ? 157.407 165.032 141.789 1.00 106.83 ? 120 MET A CB    1 
ATOM   874   C CG    . MET A 1 120 ? 157.095 163.590 142.123 1.00 106.83 ? 120 MET A CG    1 
ATOM   875   S SD    . MET A 1 120 ? 158.549 162.542 141.941 1.00 106.83 ? 120 MET A SD    1 
ATOM   876   C CE    . MET A 1 120 ? 159.494 163.023 143.382 1.00 106.83 ? 120 MET A CE    1 
ATOM   877   N N     . ARG A 1 121 ? 153.852 165.556 141.657 1.00 103.69 ? 121 ARG A N     1 
ATOM   878   C CA    . ARG A 1 121 ? 152.672 165.208 140.880 1.00 103.69 ? 121 ARG A CA    1 
ATOM   879   C C     . ARG A 1 121 ? 151.754 166.399 140.646 1.00 103.69 ? 121 ARG A C     1 
ATOM   880   O O     . ARG A 1 121 ? 150.620 166.215 140.194 1.00 103.69 ? 121 ARG A O     1 
ATOM   881   C CB    . ARG A 1 121 ? 151.905 164.077 141.566 1.00 103.69 ? 121 ARG A CB    1 
ATOM   882   C CG    . ARG A 1 121 ? 151.311 164.451 142.910 1.00 103.69 ? 121 ARG A CG    1 
ATOM   883   C CD    . ARG A 1 121 ? 150.630 163.257 143.556 1.00 103.69 ? 121 ARG A CD    1 
ATOM   884   N NE    . ARG A 1 121 ? 149.469 162.813 142.793 1.00 103.69 ? 121 ARG A NE    1 
ATOM   885   C CZ    . ARG A 1 121 ? 148.253 163.334 142.913 1.00 103.69 ? 121 ARG A CZ    1 
ATOM   886   N NH1   . ARG A 1 121 ? 147.255 162.868 142.175 1.00 103.69 ? 121 ARG A NH1   1 
ATOM   887   N NH2   . ARG A 1 121 ? 148.033 164.320 143.771 1.00 103.69 ? 121 ARG A NH2   1 
ATOM   888   N N     . TYR A 1 122 ? 152.214 167.608 140.939 1.00 106.42 ? 122 TYR A N     1 
ATOM   889   C CA    . TYR A 1 122 ? 151.421 168.814 140.738 1.00 106.42 ? 122 TYR A CA    1 
ATOM   890   C C     . TYR A 1 122 ? 152.077 169.815 139.805 1.00 106.42 ? 122 TYR A C     1 
ATOM   891   O O     . TYR A 1 122 ? 151.379 170.503 139.058 1.00 106.42 ? 122 TYR A O     1 
ATOM   892   C CB    . TYR A 1 122 ? 151.147 169.499 142.083 1.00 106.42 ? 122 TYR A CB    1 
ATOM   893   C CG    . TYR A 1 122 ? 150.258 168.714 143.015 1.00 106.42 ? 122 TYR A CG    1 
ATOM   894   C CD1   . TYR A 1 122 ? 148.879 168.726 142.864 1.00 106.42 ? 122 TYR A CD1   1 
ATOM   895   C CD2   . TYR A 1 122 ? 150.796 167.970 144.054 1.00 106.42 ? 122 TYR A CD2   1 
ATOM   896   C CE1   . TYR A 1 122 ? 148.062 168.013 143.718 1.00 106.42 ? 122 TYR A CE1   1 
ATOM   897   C CE2   . TYR A 1 122 ? 149.988 167.255 144.913 1.00 106.42 ? 122 TYR A CE2   1 
ATOM   898   C CZ    . TYR A 1 122 ? 148.623 167.280 144.741 1.00 106.42 ? 122 TYR A CZ    1 
ATOM   899   O OH    . TYR A 1 122 ? 147.814 166.567 145.595 1.00 106.42 ? 122 TYR A OH    1 
ATOM   900   N N     . THR A 1 123 ? 153.401 169.915 139.825 1.00 106.01 ? 123 THR A N     1 
ATOM   901   C CA    . THR A 1 123 ? 154.091 170.973 139.108 1.00 106.01 ? 123 THR A CA    1 
ATOM   902   C C     . THR A 1 123 ? 154.147 170.682 137.612 1.00 106.01 ? 123 THR A C     1 
ATOM   903   O O     . THR A 1 123 ? 153.931 169.556 137.158 1.00 106.01 ? 123 THR A O     1 
ATOM   904   C CB    . THR A 1 123 ? 155.506 171.146 139.652 1.00 106.01 ? 123 THR A CB    1 
ATOM   905   O OG1   . THR A 1 123 ? 156.256 169.950 139.414 1.00 106.01 ? 123 THR A OG1   1 
ATOM   906   C CG2   . THR A 1 123 ? 155.460 171.407 141.145 1.00 106.01 ? 123 THR A CG2   1 
ATOM   907   N N     . GLU A 1 124 ? 154.443 171.728 136.845 1.00 107.60 ? 124 GLU A N     1 
ATOM   908   C CA    . GLU A 1 124 ? 154.606 171.641 135.402 1.00 107.60 ? 124 GLU A CA    1 
ATOM   909   C C     . GLU A 1 124 ? 155.841 172.430 135.001 1.00 107.60 ? 124 GLU A C     1 
ATOM   910   O O     . GLU A 1 124 ? 156.103 173.504 135.551 1.00 107.60 ? 124 GLU A O     1 
ATOM   911   C CB    . GLU A 1 124 ? 153.379 172.183 134.671 1.00 107.60 ? 124 GLU A CB    1 
ATOM   912   C CG    . GLU A 1 124 ? 152.121 171.365 134.885 1.00 107.60 ? 124 GLU A CG    1 
ATOM   913   C CD    . GLU A 1 124 ? 150.917 171.963 134.187 1.00 107.60 ? 124 GLU A CD    1 
ATOM   914   O OE1   . GLU A 1 124 ? 151.039 173.080 133.641 1.00 107.60 ? 124 GLU A OE1   1 
ATOM   915   O OE2   . GLU A 1 124 ? 149.847 171.318 134.186 1.00 107.60 ? 124 GLU A OE2   1 
ATOM   916   N N     . ILE A 1 125 ? 156.603 171.899 134.044 1.00 92.88  ? 125 ILE A N     1 
ATOM   917   C CA    . ILE A 1 125 ? 157.884 172.480 133.666 1.00 92.88  ? 125 ILE A CA    1 
ATOM   918   C C     . ILE A 1 125 ? 158.041 172.470 132.153 1.00 92.88  ? 125 ILE A C     1 
ATOM   919   O O     . ILE A 1 125 ? 157.378 171.718 131.436 1.00 92.88  ? 125 ILE A O     1 
ATOM   920   C CB    . ILE A 1 125 ? 159.071 171.737 134.315 1.00 92.88  ? 125 ILE A CB    1 
ATOM   921   C CG1   . ILE A 1 125 ? 159.075 170.274 133.883 1.00 92.88  ? 125 ILE A CG1   1 
ATOM   922   C CG2   . ILE A 1 125 ? 159.020 171.848 135.825 1.00 92.88  ? 125 ILE A CG2   1 
ATOM   923   C CD1   . ILE A 1 125 ? 160.307 169.525 134.310 1.00 92.88  ? 125 ILE A CD1   1 
ATOM   924   N N     . ARG A 1 126 ? 158.938 173.329 131.679 1.00 98.06  ? 126 ARG A N     1 
ATOM   925   C CA    . ARG A 1 126 ? 159.354 173.389 130.284 1.00 98.06  ? 126 ARG A CA    1 
ATOM   926   C C     . ARG A 1 126 ? 160.595 174.266 130.224 1.00 98.06  ? 126 ARG A C     1 
ATOM   927   O O     . ARG A 1 126 ? 160.890 175.018 131.156 1.00 98.06  ? 126 ARG A O     1 
ATOM   928   C CB    . ARG A 1 126 ? 158.253 173.937 129.376 1.00 98.06  ? 126 ARG A CB    1 
ATOM   929   C CG    . ARG A 1 126 ? 157.915 175.389 129.635 1.00 98.06  ? 126 ARG A CG    1 
ATOM   930   C CD    . ARG A 1 126 ? 156.802 175.863 128.721 1.00 98.06  ? 126 ARG A CD    1 
ATOM   931   N NE    . ARG A 1 126 ? 156.459 177.260 128.963 1.00 98.06  ? 126 ARG A NE    1 
ATOM   932   C CZ    . ARG A 1 126 ? 155.532 177.927 128.287 1.00 98.06  ? 126 ARG A CZ    1 
ATOM   933   N NH1   . ARG A 1 126 ? 154.852 177.325 127.321 1.00 98.06  ? 126 ARG A NH1   1 
ATOM   934   N NH2   . ARG A 1 126 ? 155.285 179.196 128.574 1.00 98.06  ? 126 ARG A NH2   1 
ATOM   935   N N     . LEU A 1 127 ? 161.316 174.169 129.114 1.00 91.40  ? 127 LEU A N     1 
ATOM   936   C CA    . LEU A 1 127 ? 162.548 174.925 128.975 1.00 91.40  ? 127 LEU A CA    1 
ATOM   937   C C     . LEU A 1 127 ? 162.257 176.408 128.771 1.00 91.40  ? 127 LEU A C     1 
ATOM   938   O O     . LEU A 1 127 ? 161.164 176.805 128.361 1.00 91.40  ? 127 LEU A O     1 
ATOM   939   C CB    . LEU A 1 127 ? 163.376 174.393 127.808 1.00 91.40  ? 127 LEU A CB    1 
ATOM   940   C CG    . LEU A 1 127 ? 163.905 172.974 127.992 1.00 91.40  ? 127 LEU A CG    1 
ATOM   941   C CD1   . LEU A 1 127 ? 164.624 172.507 126.741 1.00 91.40  ? 127 LEU A CD1   1 
ATOM   942   C CD2   . LEU A 1 127 ? 164.820 172.915 129.194 1.00 91.40  ? 127 LEU A CD2   1 
ATOM   943   N N     . ALA A 1 128 ? 163.257 177.229 129.071 1.00 93.91  ? 128 ALA A N     1 
ATOM   944   C CA    . ALA A 1 128 ? 163.180 178.668 128.875 1.00 93.91  ? 128 ALA A CA    1 
ATOM   945   C C     . ALA A 1 128 ? 163.888 179.063 127.585 1.00 93.91  ? 128 ALA A C     1 
ATOM   946   O O     . ALA A 1 128 ? 164.619 178.277 126.979 1.00 93.91  ? 128 ALA A O     1 
ATOM   947   C CB    . ALA A 1 128 ? 163.787 179.408 130.068 1.00 93.91  ? 128 ALA A CB    1 
ATOM   948   N N     . LYS A 1 129 ? 163.660 180.310 127.165 1.00 100.19 ? 129 LYS A N     1 
ATOM   949   C CA    . LYS A 1 129 ? 164.235 180.779 125.908 1.00 100.19 ? 129 LYS A CA    1 
ATOM   950   C C     . LYS A 1 129 ? 165.755 180.745 125.936 1.00 100.19 ? 129 LYS A C     1 
ATOM   951   O O     . LYS A 1 129 ? 166.386 180.459 124.914 1.00 100.19 ? 129 LYS A O     1 
ATOM   952   C CB    . LYS A 1 129 ? 163.748 182.191 125.595 1.00 100.19 ? 129 LYS A CB    1 
ATOM   953   C CG    . LYS A 1 129 ? 162.280 182.272 125.228 1.00 100.19 ? 129 LYS A CG    1 
ATOM   954   C CD    . LYS A 1 129 ? 161.888 183.695 124.882 1.00 100.19 ? 129 LYS A CD    1 
ATOM   955   C CE    . LYS A 1 129 ? 160.414 183.790 124.543 1.00 100.19 ? 129 LYS A CE    1 
ATOM   956   N NZ    . LYS A 1 129 ? 160.012 185.182 124.208 1.00 100.19 ? 129 LYS A NZ    1 
ATOM   957   N N     . ILE A 1 130 ? 166.359 181.028 127.089 1.00 97.52  ? 130 ILE A N     1 
ATOM   958   C CA    . ILE A 1 130 ? 167.812 181.006 127.178 1.00 97.52  ? 130 ILE A CA    1 
ATOM   959   C C     . ILE A 1 130 ? 168.360 179.586 127.141 1.00 97.52  ? 130 ILE A C     1 
ATOM   960   O O     . ILE A 1 130 ? 169.548 179.394 126.856 1.00 97.52  ? 130 ILE A O     1 
ATOM   961   C CB    . ILE A 1 130 ? 168.279 181.732 128.451 1.00 97.52  ? 130 ILE A CB    1 
ATOM   962   C CG1   . ILE A 1 130 ? 169.777 182.023 128.388 1.00 97.52  ? 130 ILE A CG1   1 
ATOM   963   C CG2   . ILE A 1 130 ? 167.957 180.907 129.679 1.00 97.52  ? 130 ILE A CG2   1 
ATOM   964   C CD1   . ILE A 1 130 ? 170.251 182.985 129.444 1.00 97.52  ? 130 ILE A CD1   1 
ATOM   965   N N     . ALA A 1 131 ? 167.522 178.580 127.394 1.00 102.77 ? 131 ALA A N     1 
ATOM   966   C CA    . ALA A 1 131 ? 168.015 177.208 127.441 1.00 102.77 ? 131 ALA A CA    1 
ATOM   967   C C     . ALA A 1 131 ? 168.459 176.727 126.067 1.00 102.77 ? 131 ALA A C     1 
ATOM   968   O O     . ALA A 1 131 ? 169.489 176.055 125.945 1.00 102.77 ? 131 ALA A O     1 
ATOM   969   C CB    . ALA A 1 131 ? 166.943 176.283 128.011 1.00 102.77 ? 131 ALA A CB    1 
ATOM   970   N N     . HIS A 1 132 ? 167.700 177.060 125.021 1.00 103.09 ? 132 HIS A N     1 
ATOM   971   C CA    . HIS A 1 132 ? 168.060 176.616 123.680 1.00 103.09 ? 132 HIS A CA    1 
ATOM   972   C C     . HIS A 1 132 ? 169.372 177.217 123.201 1.00 103.09 ? 132 HIS A C     1 
ATOM   973   O O     . HIS A 1 132 ? 169.965 176.698 122.250 1.00 103.09 ? 132 HIS A O     1 
ATOM   974   C CB    . HIS A 1 132 ? 166.943 176.950 122.693 1.00 103.09 ? 132 HIS A CB    1 
ATOM   975   C CG    . HIS A 1 132 ? 165.691 176.163 122.914 1.00 103.09 ? 132 HIS A CG    1 
ATOM   976   N ND1   . HIS A 1 132 ? 164.681 176.590 123.748 1.00 103.09 ? 132 HIS A ND1   1 
ATOM   977   C CD2   . HIS A 1 132 ? 165.286 174.972 122.413 1.00 103.09 ? 132 HIS A CD2   1 
ATOM   978   C CE1   . HIS A 1 132 ? 163.706 175.698 123.749 1.00 103.09 ? 132 HIS A CE1   1 
ATOM   979   N NE2   . HIS A 1 132 ? 164.049 174.707 122.946 1.00 103.09 ? 132 HIS A NE2   1 
ATOM   980   N N     . GLU A 1 133 ? 169.839 178.294 123.832 1.00 104.63 ? 133 GLU A N     1 
ATOM   981   C CA    . GLU A 1 133 ? 171.155 178.827 123.513 1.00 104.63 ? 133 GLU A CA    1 
ATOM   982   C C     . GLU A 1 133 ? 172.278 177.973 124.078 1.00 104.63 ? 133 GLU A C     1 
ATOM   983   O O     . GLU A 1 133 ? 173.397 178.019 123.557 1.00 104.63 ? 133 GLU A O     1 
ATOM   984   C CB    . GLU A 1 133 ? 171.286 180.258 124.033 1.00 104.63 ? 133 GLU A CB    1 
ATOM   985   C CG    . GLU A 1 133 ? 170.377 181.249 123.334 1.00 104.63 ? 133 GLU A CG    1 
ATOM   986   C CD    . GLU A 1 133 ? 170.737 181.434 121.875 1.00 104.63 ? 133 GLU A CD    1 
ATOM   987   O OE1   . GLU A 1 133 ? 171.934 181.320 121.537 1.00 104.63 ? 133 GLU A OE1   1 
ATOM   988   O OE2   . GLU A 1 133 ? 169.822 181.692 121.064 1.00 104.63 ? 133 GLU A OE2   1 
ATOM   989   N N     . LEU A 1 134 ? 172.007 177.196 125.127 1.00 101.19 ? 134 LEU A N     1 
ATOM   990   C CA    . LEU A 1 134 ? 173.021 176.293 125.658 1.00 101.19 ? 134 LEU A CA    1 
ATOM   991   C C     . LEU A 1 134 ? 173.249 175.115 124.723 1.00 101.19 ? 134 LEU A C     1 
ATOM   992   O O     . LEU A 1 134 ? 174.394 174.716 124.484 1.00 101.19 ? 134 LEU A O     1 
ATOM   993   C CB    . LEU A 1 134 ? 172.614 175.790 127.042 1.00 101.19 ? 134 LEU A CB    1 
ATOM   994   C CG    . LEU A 1 134 ? 172.968 176.621 128.276 1.00 101.19 ? 134 LEU A CG    1 
ATOM   995   C CD1   . LEU A 1 134 ? 174.473 176.715 128.436 1.00 101.19 ? 134 LEU A CD1   1 
ATOM   996   C CD2   . LEU A 1 134 ? 172.341 178.003 128.217 1.00 101.19 ? 134 LEU A CD2   1 
ATOM   997   N N     . MET A 1 135 ? 172.170 174.548 124.182 1.00 109.04 ? 135 MET A N     1 
ATOM   998   C CA    . MET A 1 135 ? 172.231 173.316 123.409 1.00 109.04 ? 135 MET A CA    1 
ATOM   999   C C     . MET A 1 135 ? 172.045 173.554 121.916 1.00 109.04 ? 135 MET A C     1 
ATOM   1000  O O     . MET A 1 135 ? 171.500 172.697 121.214 1.00 109.04 ? 135 MET A O     1 
ATOM   1001  C CB    . MET A 1 135 ? 171.188 172.328 123.926 1.00 109.04 ? 135 MET A CB    1 
ATOM   1002  C CG    . MET A 1 135 ? 171.418 171.915 125.366 1.00 109.04 ? 135 MET A CG    1 
ATOM   1003  S SD    . MET A 1 135 ? 170.159 170.793 125.992 1.00 109.04 ? 135 MET A SD    1 
ATOM   1004  C CE    . MET A 1 135 ? 170.597 169.296 125.117 1.00 109.04 ? 135 MET A CE    1 
ATOM   1005  N N     . ALA A 1 136 ? 172.486 174.704 121.417 1.00 109.18 ? 136 ALA A N     1 
ATOM   1006  C CA    . ALA A 1 136 ? 172.380 174.983 119.993 1.00 109.18 ? 136 ALA A CA    1 
ATOM   1007  C C     . ALA A 1 136 ? 173.392 174.158 119.210 1.00 109.18 ? 136 ALA A C     1 
ATOM   1008  O O     . ALA A 1 136 ? 174.525 173.953 119.654 1.00 109.18 ? 136 ALA A O     1 
ATOM   1009  C CB    . ALA A 1 136 ? 172.597 176.471 119.725 1.00 109.18 ? 136 ALA A CB    1 
ATOM   1010  N N     . ASP A 1 137 ? 172.970 173.680 118.037 1.00 111.71 ? 137 ASP A N     1 
ATOM   1011  C CA    . ASP A 1 137 ? 173.833 172.918 117.134 1.00 111.71 ? 137 ASP A CA    1 
ATOM   1012  C C     . ASP A 1 137 ? 174.337 171.637 117.790 1.00 111.71 ? 137 ASP A C     1 
ATOM   1013  O O     . ASP A 1 137 ? 175.535 171.348 117.792 1.00 111.71 ? 137 ASP A O     1 
ATOM   1014  C CB    . ASP A 1 137 ? 175.005 173.769 116.642 1.00 111.71 ? 137 ASP A CB    1 
ATOM   1015  C CG    . ASP A 1 137 ? 174.561 174.897 115.741 1.00 111.71 ? 137 ASP A CG    1 
ATOM   1016  O OD1   . ASP A 1 137 ? 173.529 174.738 115.057 1.00 111.71 ? 137 ASP A OD1   1 
ATOM   1017  O OD2   . ASP A 1 137 ? 175.238 175.945 115.720 1.00 111.71 ? 137 ASP A OD2   1 
ATOM   1018  N N     . LEU A 1 138 ? 173.414 170.858 118.352 1.00 106.68 ? 138 LEU A N     1 
ATOM   1019  C CA    . LEU A 1 138 ? 173.802 169.629 119.031 1.00 106.68 ? 138 LEU A CA    1 
ATOM   1020  C C     . LEU A 1 138 ? 173.886 168.445 118.078 1.00 106.68 ? 138 LEU A C     1 
ATOM   1021  O O     . LEU A 1 138 ? 174.718 167.554 118.276 1.00 106.68 ? 138 LEU A O     1 
ATOM   1022  C CB    . LEU A 1 138 ? 172.819 169.320 120.159 1.00 106.68 ? 138 LEU A CB    1 
ATOM   1023  C CG    . LEU A 1 138 ? 173.141 168.089 121.005 1.00 106.68 ? 138 LEU A CG    1 
ATOM   1024  C CD1   . LEU A 1 138 ? 174.463 168.275 121.726 1.00 106.68 ? 138 LEU A CD1   1 
ATOM   1025  C CD2   . LEU A 1 138 ? 172.022 167.806 121.992 1.00 106.68 ? 138 LEU A CD2   1 
ATOM   1026  N N     . GLU A 1 139 ? 173.049 168.419 117.045 1.00 118.40 ? 139 GLU A N     1 
ATOM   1027  C CA    . GLU A 1 139 ? 172.958 167.271 116.153 1.00 118.40 ? 139 GLU A CA    1 
ATOM   1028  C C     . GLU A 1 139 ? 173.990 167.285 115.036 1.00 118.40 ? 139 GLU A C     1 
ATOM   1029  O O     . GLU A 1 139 ? 174.116 166.285 114.321 1.00 118.40 ? 139 GLU A O     1 
ATOM   1030  C CB    . GLU A 1 139 ? 171.559 167.201 115.535 1.00 118.40 ? 139 GLU A CB    1 
ATOM   1031  C CG    . GLU A 1 139 ? 171.287 168.299 114.524 1.00 118.40 ? 139 GLU A CG    1 
ATOM   1032  C CD    . GLU A 1 139 ? 170.829 169.589 115.172 1.00 118.40 ? 139 GLU A CD    1 
ATOM   1033  O OE1   . GLU A 1 139 ? 171.006 169.741 116.400 1.00 118.40 ? 139 GLU A OE1   1 
ATOM   1034  O OE2   . GLU A 1 139 ? 170.291 170.455 114.453 1.00 118.40 ? 139 GLU A OE2   1 
ATOM   1035  N N     . LYS A 1 140 ? 174.728 168.375 114.865 1.00 110.85 ? 140 LYS A N     1 
ATOM   1036  C CA    . LYS A 1 140 ? 175.654 168.504 113.750 1.00 110.85 ? 140 LYS A CA    1 
ATOM   1037  C C     . LYS A 1 140 ? 177.046 167.973 114.062 1.00 110.85 ? 140 LYS A C     1 
ATOM   1038  O O     . LYS A 1 140 ? 178.015 168.432 113.450 1.00 110.85 ? 140 LYS A O     1 
ATOM   1039  C CB    . LYS A 1 140 ? 175.741 169.966 113.309 1.00 110.85 ? 140 LYS A CB    1 
ATOM   1040  C CG    . LYS A 1 140 ? 174.455 170.482 112.694 1.00 110.85 ? 140 LYS A CG    1 
ATOM   1041  C CD    . LYS A 1 140 ? 174.590 171.922 112.242 1.00 110.85 ? 140 LYS A CD    1 
ATOM   1042  C CE    . LYS A 1 140 ? 173.289 172.426 111.648 1.00 110.85 ? 140 LYS A CE    1 
ATOM   1043  N NZ    . LYS A 1 140 ? 173.394 173.840 111.203 1.00 110.85 ? 140 LYS A NZ    1 
ATOM   1044  N N     . GLU A 1 141 ? 177.165 167.031 114.999 1.00 114.32 ? 141 GLU A N     1 
ATOM   1045  C CA    . GLU A 1 141 ? 178.431 166.378 115.316 1.00 114.32 ? 141 GLU A CA    1 
ATOM   1046  C C     . GLU A 1 141 ? 179.481 167.379 115.778 1.00 114.32 ? 141 GLU A C     1 
ATOM   1047  O O     . GLU A 1 141 ? 180.556 167.478 115.179 1.00 114.32 ? 141 GLU A O     1 
ATOM   1048  C CB    . GLU A 1 141 ? 178.950 165.598 114.108 1.00 114.32 ? 141 GLU A CB    1 
ATOM   1049  C CG    . GLU A 1 141 ? 178.081 164.423 113.712 1.00 114.32 ? 141 GLU A CG    1 
ATOM   1050  C CD    . GLU A 1 141 ? 178.606 163.704 112.488 1.00 114.32 ? 141 GLU A CD    1 
ATOM   1051  O OE1   . GLU A 1 141 ? 179.576 164.201 111.877 1.00 114.32 ? 141 GLU A OE1   1 
ATOM   1052  O OE2   . GLU A 1 141 ? 178.050 162.642 112.136 1.00 114.32 ? 141 GLU A OE2   1 
ATOM   1053  N N     . THR A 1 142 ? 179.181 168.121 116.841 1.00 101.79 ? 142 THR A N     1 
ATOM   1054  C CA    . THR A 1 142 ? 180.114 169.103 117.370 1.00 101.79 ? 142 THR A CA    1 
ATOM   1055  C C     . THR A 1 142 ? 180.888 168.606 118.581 1.00 101.79 ? 142 THR A C     1 
ATOM   1056  O O     . THR A 1 142 ? 181.953 169.154 118.882 1.00 101.79 ? 142 THR A O     1 
ATOM   1057  C CB    . THR A 1 142 ? 179.373 170.386 117.752 1.00 101.79 ? 142 THR A CB    1 
ATOM   1058  O OG1   . THR A 1 142 ? 178.449 170.103 118.807 1.00 101.79 ? 142 THR A OG1   1 
ATOM   1059  C CG2   . THR A 1 142 ? 178.607 170.921 116.557 1.00 101.79 ? 142 THR A CG2   1 
ATOM   1060  N N     . VAL A 1 143 ? 180.382 167.595 119.282 1.00 102.74 ? 143 VAL A N     1 
ATOM   1061  C CA    . VAL A 1 143 ? 181.023 167.047 120.465 1.00 102.74 ? 143 VAL A CA    1 
ATOM   1062  C C     . VAL A 1 143 ? 181.015 165.526 120.367 1.00 102.74 ? 143 VAL A C     1 
ATOM   1063  O O     . VAL A 1 143 ? 180.504 164.947 119.410 1.00 102.74 ? 143 VAL A O     1 
ATOM   1064  C CB    . VAL A 1 143 ? 180.344 167.516 121.766 1.00 102.74 ? 143 VAL A CB    1 
ATOM   1065  C CG1   . VAL A 1 143 ? 180.455 169.021 121.906 1.00 102.74 ? 143 VAL A CG1   1 
ATOM   1066  C CG2   . VAL A 1 143 ? 178.892 167.081 121.781 1.00 102.74 ? 143 VAL A CG2   1 
ATOM   1067  N N     . ASP A 1 144 ? 181.586 164.883 121.378 1.00 110.92 ? 144 ASP A N     1 
ATOM   1068  C CA    . ASP A 1 144 ? 181.672 163.433 121.420 1.00 110.92 ? 144 ASP A CA    1 
ATOM   1069  C C     . ASP A 1 144 ? 180.517 162.845 122.221 1.00 110.92 ? 144 ASP A C     1 
ATOM   1070  O O     . ASP A 1 144 ? 179.857 163.530 123.005 1.00 110.92 ? 144 ASP A O     1 
ATOM   1071  C CB    . ASP A 1 144 ? 183.003 162.992 122.025 1.00 110.92 ? 144 ASP A CB    1 
ATOM   1072  C CG    . ASP A 1 144 ? 184.180 163.310 121.131 1.00 110.92 ? 144 ASP A CG    1 
ATOM   1073  O OD1   . ASP A 1 144 ? 183.995 163.346 119.897 1.00 110.92 ? 144 ASP A OD1   1 
ATOM   1074  O OD2   . ASP A 1 144 ? 185.289 163.524 121.661 1.00 110.92 ? 144 ASP A OD2   1 
ATOM   1075  N N     . PHE A 1 145 ? 180.281 161.553 122.016 1.00 110.99 ? 145 PHE A N     1 
ATOM   1076  C CA    . PHE A 1 145 ? 179.224 160.825 122.700 1.00 110.99 ? 145 PHE A CA    1 
ATOM   1077  C C     . PHE A 1 145 ? 179.827 159.734 123.571 1.00 110.99 ? 145 PHE A C     1 
ATOM   1078  O O     . PHE A 1 145 ? 180.762 159.042 123.158 1.00 110.99 ? 145 PHE A O     1 
ATOM   1079  C CB    . PHE A 1 145 ? 178.238 160.218 121.703 1.00 110.99 ? 145 PHE A CB    1 
ATOM   1080  C CG    . PHE A 1 145 ? 177.351 161.229 121.041 1.00 110.99 ? 145 PHE A CG    1 
ATOM   1081  C CD1   . PHE A 1 145 ? 177.206 162.495 121.577 1.00 110.99 ? 145 PHE A CD1   1 
ATOM   1082  C CD2   . PHE A 1 145 ? 176.665 160.915 119.883 1.00 110.99 ? 145 PHE A CD2   1 
ATOM   1083  C CE1   . PHE A 1 145 ? 176.392 163.428 120.974 1.00 110.99 ? 145 PHE A CE1   1 
ATOM   1084  C CE2   . PHE A 1 145 ? 175.849 161.846 119.273 1.00 110.99 ? 145 PHE A CE2   1 
ATOM   1085  C CZ    . PHE A 1 145 ? 175.713 163.104 119.820 1.00 110.99 ? 145 PHE A CZ    1 
ATOM   1086  N N     . VAL A 1 146 ? 179.286 159.589 124.776 1.00 118.66 ? 146 VAL A N     1 
ATOM   1087  C CA    . VAL A 1 146 ? 179.761 158.619 125.753 1.00 118.66 ? 146 VAL A CA    1 
ATOM   1088  C C     . VAL A 1 146 ? 178.625 157.657 126.067 1.00 118.66 ? 146 VAL A C     1 
ATOM   1089  O O     . VAL A 1 146 ? 177.460 158.062 126.139 1.00 118.66 ? 146 VAL A O     1 
ATOM   1090  C CB    . VAL A 1 146 ? 180.268 159.314 127.033 1.00 118.66 ? 146 VAL A CB    1 
ATOM   1091  C CG1   . VAL A 1 146 ? 180.722 158.292 128.063 1.00 118.66 ? 146 VAL A CG1   1 
ATOM   1092  C CG2   . VAL A 1 146 ? 181.391 160.281 126.699 1.00 118.66 ? 146 VAL A CG2   1 
ATOM   1093  N N     . ASP A 1 147 ? 178.966 156.386 126.247 1.00 129.90 ? 147 ASP A N     1 
ATOM   1094  C CA    . ASP A 1 147 ? 177.964 155.373 126.529 1.00 129.90 ? 147 ASP A CA    1 
ATOM   1095  C C     . ASP A 1 147 ? 177.377 155.559 127.925 1.00 129.90 ? 147 ASP A C     1 
ATOM   1096  O O     . ASP A 1 147 ? 177.998 156.133 128.823 1.00 129.90 ? 147 ASP A O     1 
ATOM   1097  C CB    . ASP A 1 147 ? 178.568 153.977 126.403 1.00 129.90 ? 147 ASP A CB    1 
ATOM   1098  C CG    . ASP A 1 147 ? 178.954 153.642 124.982 1.00 129.90 ? 147 ASP A CG    1 
ATOM   1099  O OD1   . ASP A 1 147 ? 178.308 154.167 124.052 1.00 129.90 ? 147 ASP A OD1   1 
ATOM   1100  O OD2   . ASP A 1 147 ? 179.906 152.857 124.793 1.00 129.90 ? 147 ASP A OD2   1 
ATOM   1101  N N     . ASN A 1 148 ? 176.159 155.055 128.098 1.00 132.81 ? 148 ASN A N     1 
ATOM   1102  C CA    . ASN A 1 148 ? 175.479 155.102 129.383 1.00 132.81 ? 148 ASN A CA    1 
ATOM   1103  C C     . ASN A 1 148 ? 175.993 153.982 130.287 1.00 132.81 ? 148 ASN A C     1 
ATOM   1104  O O     . ASN A 1 148 ? 177.012 153.343 130.013 1.00 132.81 ? 148 ASN A O     1 
ATOM   1105  C CB    . ASN A 1 148 ? 173.967 155.033 129.180 1.00 132.81 ? 148 ASN A CB    1 
ATOM   1106  C CG    . ASN A 1 148 ? 173.539 153.816 128.393 1.00 132.81 ? 148 ASN A CG    1 
ATOM   1107  O OD1   . ASN A 1 148 ? 174.361 152.979 128.028 1.00 132.81 ? 148 ASN A OD1   1 
ATOM   1108  N ND2   . ASN A 1 148 ? 172.244 153.706 128.133 1.00 132.81 ? 148 ASN A ND2   1 
ATOM   1109  N N     . TYR A 1 149 ? 175.281 153.745 131.392 1.00 130.77 ? 149 TYR A N     1 
ATOM   1110  C CA    . TYR A 1 149 ? 175.754 152.792 132.392 1.00 130.77 ? 149 TYR A CA    1 
ATOM   1111  C C     . TYR A 1 149 ? 175.820 151.375 131.833 1.00 130.77 ? 149 TYR A C     1 
ATOM   1112  O O     . TYR A 1 149 ? 176.741 150.617 132.157 1.00 130.77 ? 149 TYR A O     1 
ATOM   1113  C CB    . TYR A 1 149 ? 174.858 152.846 133.630 1.00 130.77 ? 149 TYR A CB    1 
ATOM   1114  C CG    . TYR A 1 149 ? 173.420 152.453 133.379 1.00 130.77 ? 149 TYR A CG    1 
ATOM   1115  C CD1   . TYR A 1 149 ? 172.484 153.395 132.977 1.00 130.77 ? 149 TYR A CD1   1 
ATOM   1116  C CD2   . TYR A 1 149 ? 172.994 151.145 133.561 1.00 130.77 ? 149 TYR A CD2   1 
ATOM   1117  C CE1   . TYR A 1 149 ? 171.168 153.042 132.751 1.00 130.77 ? 149 TYR A CE1   1 
ATOM   1118  C CE2   . TYR A 1 149 ? 171.681 150.784 133.337 1.00 130.77 ? 149 TYR A CE2   1 
ATOM   1119  C CZ    . TYR A 1 149 ? 170.773 151.736 132.933 1.00 130.77 ? 149 TYR A CZ    1 
ATOM   1120  O OH    . TYR A 1 149 ? 169.465 151.379 132.710 1.00 130.77 ? 149 TYR A OH    1 
ATOM   1121  N N     . ASP A 1 150 ? 174.856 150.995 130.998 1.00 139.09 ? 150 ASP A N     1 
ATOM   1122  C CA    . ASP A 1 150 ? 174.827 149.654 130.431 1.00 139.09 ? 150 ASP A CA    1 
ATOM   1123  C C     . ASP A 1 150 ? 175.342 149.596 129.000 1.00 139.09 ? 150 ASP A C     1 
ATOM   1124  O O     . ASP A 1 150 ? 175.317 148.521 128.393 1.00 139.09 ? 150 ASP A O     1 
ATOM   1125  C CB    . ASP A 1 150 ? 173.407 149.082 130.494 1.00 139.09 ? 150 ASP A CB    1 
ATOM   1126  C CG    . ASP A 1 150 ? 172.404 149.920 129.730 1.00 139.09 ? 150 ASP A CG    1 
ATOM   1127  O OD1   . ASP A 1 150 ? 172.782 150.996 129.226 1.00 139.09 ? 150 ASP A OD1   1 
ATOM   1128  O OD2   . ASP A 1 150 ? 171.234 149.498 129.628 1.00 139.09 ? 150 ASP A OD2   1 
ATOM   1129  N N     . GLY A 1 151 ? 175.796 150.716 128.445 1.00 133.98 ? 151 GLY A N     1 
ATOM   1130  C CA    . GLY A 1 151 ? 176.337 150.711 127.101 1.00 133.98 ? 151 GLY A CA    1 
ATOM   1131  C C     . GLY A 1 151 ? 175.308 150.573 126.004 1.00 133.98 ? 151 GLY A C     1 
ATOM   1132  O O     . GLY A 1 151 ? 175.579 149.921 124.991 1.00 133.98 ? 151 GLY A O     1 
ATOM   1133  N N     . THR A 1 152 ? 174.127 151.166 126.175 1.00 136.42 ? 152 THR A N     1 
ATOM   1134  C CA    . THR A 1 152 ? 173.066 151.071 125.185 1.00 136.42 ? 152 THR A CA    1 
ATOM   1135  C C     . THR A 1 152 ? 172.643 152.412 124.604 1.00 136.42 ? 152 THR A C     1 
ATOM   1136  O O     . THR A 1 152 ? 171.859 152.427 123.649 1.00 136.42 ? 152 THR A O     1 
ATOM   1137  C CB    . THR A 1 152 ? 171.829 150.385 125.784 1.00 136.42 ? 152 THR A CB    1 
ATOM   1138  O OG1   . THR A 1 152 ? 171.325 151.171 126.871 1.00 136.42 ? 152 THR A OG1   1 
ATOM   1139  C CG2   . THR A 1 152 ? 172.183 148.997 126.292 1.00 136.42 ? 152 THR A CG2   1 
ATOM   1140  N N     . GLU A 1 153 ? 173.126 153.527 125.145 1.00 133.67 ? 153 GLU A N     1 
ATOM   1141  C CA    . GLU A 1 153 ? 172.776 154.849 124.649 1.00 133.67 ? 153 GLU A CA    1 
ATOM   1142  C C     . GLU A 1 153 ? 174.028 155.710 124.558 1.00 133.67 ? 153 GLU A C     1 
ATOM   1143  O O     . GLU A 1 153 ? 175.134 155.284 124.901 1.00 133.67 ? 153 GLU A O     1 
ATOM   1144  C CB    . GLU A 1 153 ? 171.729 155.525 125.542 1.00 133.67 ? 153 GLU A CB    1 
ATOM   1145  C CG    . GLU A 1 153 ? 170.382 154.830 125.542 1.00 133.67 ? 153 GLU A CG    1 
ATOM   1146  C CD    . GLU A 1 153 ? 169.700 154.891 124.191 1.00 133.67 ? 153 GLU A CD    1 
ATOM   1147  O OE1   . GLU A 1 153 ? 169.887 155.896 123.475 1.00 133.67 ? 153 GLU A OE1   1 
ATOM   1148  O OE2   . GLU A 1 153 ? 168.981 153.931 123.844 1.00 133.67 ? 153 GLU A OE2   1 
ATOM   1149  N N     . LYS A 1 154 ? 173.839 156.937 124.086 1.00 116.37 ? 154 LYS A N     1 
ATOM   1150  C CA    . LYS A 1 154 ? 174.916 157.903 123.941 1.00 116.37 ? 154 LYS A CA    1 
ATOM   1151  C C     . LYS A 1 154 ? 174.567 159.172 124.704 1.00 116.37 ? 154 LYS A C     1 
ATOM   1152  O O     . LYS A 1 154 ? 173.404 159.585 124.742 1.00 116.37 ? 154 LYS A O     1 
ATOM   1153  C CB    . LYS A 1 154 ? 175.168 158.227 122.469 1.00 116.37 ? 154 LYS A CB    1 
ATOM   1154  C CG    . LYS A 1 154 ? 175.591 157.029 121.640 1.00 116.37 ? 154 LYS A CG    1 
ATOM   1155  C CD    . LYS A 1 154 ? 176.963 156.531 122.053 1.00 116.37 ? 154 LYS A CD    1 
ATOM   1156  C CE    . LYS A 1 154 ? 177.426 155.395 121.158 1.00 116.37 ? 154 LYS A CE    1 
ATOM   1157  N NZ    . LYS A 1 154 ? 178.756 154.873 121.572 1.00 116.37 ? 154 LYS A NZ    1 
ATOM   1158  N N     . ILE A 1 155 ? 175.577 159.783 125.315 1.00 108.22 ? 155 ILE A N     1 
ATOM   1159  C CA    . ILE A 1 155 ? 175.391 161.018 126.070 1.00 108.22 ? 155 ILE A CA    1 
ATOM   1160  C C     . ILE A 1 155 ? 176.443 162.028 125.633 1.00 108.22 ? 155 ILE A C     1 
ATOM   1161  O O     . ILE A 1 155 ? 177.627 161.681 125.529 1.00 108.22 ? 155 ILE A O     1 
ATOM   1162  C CB    . ILE A 1 155 ? 175.470 160.772 127.583 1.00 108.22 ? 155 ILE A CB    1 
ATOM   1163  C CG1   . ILE A 1 155 ? 174.315 159.889 128.051 1.00 108.22 ? 155 ILE A CG1   1 
ATOM   1164  C CG2   . ILE A 1 155 ? 175.468 162.088 128.336 1.00 108.22 ? 155 ILE A CG2   1 
ATOM   1165  C CD1   . ILE A 1 155 ? 174.630 158.417 128.064 1.00 108.22 ? 155 ILE A CD1   1 
ATOM   1166  N N     . PRO A 1 156 ? 176.063 163.272 125.357 1.00 100.75 ? 156 PRO A N     1 
ATOM   1167  C CA    . PRO A 1 156 ? 177.066 164.291 125.037 1.00 100.75 ? 156 PRO A CA    1 
ATOM   1168  C C     . PRO A 1 156 ? 177.998 164.529 126.213 1.00 100.75 ? 156 PRO A C     1 
ATOM   1169  O O     . PRO A 1 156 ? 177.580 164.546 127.371 1.00 100.75 ? 156 PRO A O     1 
ATOM   1170  C CB    . PRO A 1 156 ? 176.223 165.532 124.726 1.00 100.75 ? 156 PRO A CB    1 
ATOM   1171  C CG    . PRO A 1 156 ? 174.893 164.989 124.333 1.00 100.75 ? 156 PRO A CG    1 
ATOM   1172  C CD    . PRO A 1 156 ? 174.691 163.775 125.183 1.00 100.75 ? 156 PRO A CD    1 
ATOM   1173  N N     . ASP A 1 157 ? 179.280 164.702 125.902 1.00 104.65 ? 157 ASP A N     1 
ATOM   1174  C CA    . ASP A 1 157 ? 180.267 164.940 126.947 1.00 104.65 ? 157 ASP A CA    1 
ATOM   1175  C C     . ASP A 1 157 ? 180.170 166.364 127.477 1.00 104.65 ? 157 ASP A C     1 
ATOM   1176  O O     . ASP A 1 157 ? 179.986 166.582 128.678 1.00 104.65 ? 157 ASP A O     1 
ATOM   1177  C CB    . ASP A 1 157 ? 181.670 164.656 126.414 1.00 104.65 ? 157 ASP A CB    1 
ATOM   1178  C CG    . ASP A 1 157 ? 182.726 164.760 127.489 1.00 104.65 ? 157 ASP A CG    1 
ATOM   1179  O OD1   . ASP A 1 157 ? 182.807 163.840 128.331 1.00 104.65 ? 157 ASP A OD1   1 
ATOM   1180  O OD2   . ASP A 1 157 ? 183.475 165.759 127.490 1.00 104.65 ? 157 ASP A OD2   1 
ATOM   1181  N N     . VAL A 1 158 ? 180.307 167.350 126.595 1.00 96.41  ? 158 VAL A N     1 
ATOM   1182  C CA    . VAL A 1 158 ? 180.194 168.755 126.960 1.00 96.41  ? 158 VAL A CA    1 
ATOM   1183  C C     . VAL A 1 158 ? 179.209 169.424 126.013 1.00 96.41  ? 158 VAL A C     1 
ATOM   1184  O O     . VAL A 1 158 ? 179.140 169.080 124.829 1.00 96.41  ? 158 VAL A O     1 
ATOM   1185  C CB    . VAL A 1 158 ? 181.558 169.471 126.933 1.00 96.41  ? 158 VAL A CB    1 
ATOM   1186  C CG1   . VAL A 1 158 ? 182.484 168.876 127.981 1.00 96.41  ? 158 VAL A CG1   1 
ATOM   1187  C CG2   . VAL A 1 158 ? 182.183 169.375 125.548 1.00 96.41  ? 158 VAL A CG2   1 
ATOM   1188  N N     . MET A 1 159 ? 178.441 170.367 126.537 1.00 95.92  ? 159 MET A N     1 
ATOM   1189  C CA    . MET A 1 159 ? 177.425 171.028 125.732 1.00 95.92  ? 159 MET A CA    1 
ATOM   1190  C C     . MET A 1 159 ? 178.068 172.071 124.825 1.00 95.92  ? 159 MET A C     1 
ATOM   1191  O O     . MET A 1 159 ? 178.936 172.827 125.276 1.00 95.92  ? 159 MET A O     1 
ATOM   1192  C CB    . MET A 1 159 ? 176.379 171.683 126.629 1.00 95.92  ? 159 MET A CB    1 
ATOM   1193  C CG    . MET A 1 159 ? 175.503 170.706 127.389 1.00 95.92  ? 159 MET A CG    1 
ATOM   1194  S SD    . MET A 1 159 ? 174.483 169.717 126.283 1.00 95.92  ? 159 MET A SD    1 
ATOM   1195  C CE    . MET A 1 159 ? 173.730 168.583 127.443 1.00 95.92  ? 159 MET A CE    1 
ATOM   1196  N N     . PRO A 1 160 ? 177.683 172.142 123.556 1.00 93.80  ? 160 PRO A N     1 
ATOM   1197  C CA    . PRO A 1 160 ? 178.201 173.205 122.687 1.00 93.80  ? 160 PRO A CA    1 
ATOM   1198  C C     . PRO A 1 160 ? 177.570 174.541 123.028 1.00 93.80  ? 160 PRO A C     1 
ATOM   1199  O O     . PRO A 1 160 ? 176.660 175.005 122.335 1.00 93.80  ? 160 PRO A O     1 
ATOM   1200  C CB    . PRO A 1 160 ? 177.804 172.733 121.285 1.00 93.80  ? 160 PRO A CB    1 
ATOM   1201  C CG    . PRO A 1 160 ? 176.588 171.903 121.514 1.00 93.80  ? 160 PRO A CG    1 
ATOM   1202  C CD    . PRO A 1 160 ? 176.789 171.221 122.837 1.00 93.80  ? 160 PRO A CD    1 
ATOM   1203  N N     . THR A 1 161 ? 178.046 175.165 124.098 1.00 95.35  ? 161 THR A N     1 
ATOM   1204  C CA    . THR A 1 161 ? 177.392 176.344 124.635 1.00 95.35  ? 161 THR A CA    1 
ATOM   1205  C C     . THR A 1 161 ? 177.774 177.595 123.849 1.00 95.35  ? 161 THR A C     1 
ATOM   1206  O O     . THR A 1 161 ? 178.738 177.619 123.080 1.00 95.35  ? 161 THR A O     1 
ATOM   1207  C CB    . THR A 1 161 ? 177.752 176.530 126.105 1.00 95.35  ? 161 THR A CB    1 
ATOM   1208  O OG1   . THR A 1 161 ? 177.019 177.639 126.637 1.00 95.35  ? 161 THR A OG1   1 
ATOM   1209  C CG2   . THR A 1 161 ? 179.238 176.796 126.251 1.00 95.35  ? 161 THR A CG2   1 
ATOM   1210  N N     . LYS A 1 162 ? 176.984 178.647 124.054 1.00 92.72  ? 162 LYS A N     1 
ATOM   1211  C CA    . LYS A 1 162 ? 177.291 179.979 123.560 1.00 92.72  ? 162 LYS A CA    1 
ATOM   1212  C C     . LYS A 1 162 ? 177.438 180.990 124.684 1.00 92.72  ? 162 LYS A C     1 
ATOM   1213  O O     . LYS A 1 162 ? 177.689 182.168 124.411 1.00 92.72  ? 162 LYS A O     1 
ATOM   1214  C CB    . LYS A 1 162 ? 176.203 180.460 122.592 1.00 92.72  ? 162 LYS A CB    1 
ATOM   1215  C CG    . LYS A 1 162 ? 176.140 179.693 121.292 1.00 92.72  ? 162 LYS A CG    1 
ATOM   1216  C CD    . LYS A 1 162 ? 175.057 180.250 120.386 1.00 92.72  ? 162 LYS A CD    1 
ATOM   1217  C CE    . LYS A 1 162 ? 174.973 179.471 119.087 1.00 92.72  ? 162 LYS A CE    1 
ATOM   1218  N NZ    . LYS A 1 162 ? 173.909 180.007 118.198 1.00 92.72  ? 162 LYS A NZ    1 
ATOM   1219  N N     . ILE A 1 163 ? 177.283 180.568 125.934 1.00 97.44  ? 163 ILE A N     1 
ATOM   1220  C CA    . ILE A 1 163 ? 177.335 181.470 127.080 1.00 97.44  ? 163 ILE A CA    1 
ATOM   1221  C C     . ILE A 1 163 ? 178.286 180.894 128.121 1.00 97.44  ? 163 ILE A C     1 
ATOM   1222  O O     . ILE A 1 163 ? 178.172 179.712 128.471 1.00 97.44  ? 163 ILE A O     1 
ATOM   1223  C CB    . ILE A 1 163 ? 175.939 181.693 127.684 1.00 97.44  ? 163 ILE A CB    1 
ATOM   1224  C CG1   . ILE A 1 163 ? 175.022 182.416 126.697 1.00 97.44  ? 163 ILE A CG1   1 
ATOM   1225  C CG2   . ILE A 1 163 ? 176.041 182.465 128.986 1.00 97.44  ? 163 ILE A CG2   1 
ATOM   1226  C CD1   . ILE A 1 163 ? 174.205 181.490 125.826 1.00 97.44  ? 163 ILE A CD1   1 
ATOM   1227  N N     . PRO A 1 164 ? 179.223 181.679 128.644 1.00 100.12 ? 164 PRO A N     1 
ATOM   1228  C CA    . PRO A 1 164 ? 180.104 181.167 129.700 1.00 100.12 ? 164 PRO A CA    1 
ATOM   1229  C C     . PRO A 1 164 ? 179.360 181.001 131.015 1.00 100.12 ? 164 PRO A C     1 
ATOM   1230  O O     . PRO A 1 164 ? 179.441 181.856 131.902 1.00 100.12 ? 164 PRO A O     1 
ATOM   1231  C CB    . PRO A 1 164 ? 181.196 182.238 129.793 1.00 100.12 ? 164 PRO A CB    1 
ATOM   1232  C CG    . PRO A 1 164 ? 180.534 183.481 129.313 1.00 100.12 ? 164 PRO A CG    1 
ATOM   1233  C CD    . PRO A 1 164 ? 179.563 183.056 128.252 1.00 100.12 ? 164 PRO A CD    1 
ATOM   1234  N N     . ASN A 1 165 ? 178.629 179.891 131.139 1.00 98.18  ? 165 ASN A N     1 
ATOM   1235  C CA    . ASN A 1 165 ? 177.753 179.693 132.288 1.00 98.18  ? 165 ASN A CA    1 
ATOM   1236  C C     . ASN A 1 165 ? 178.526 179.679 133.599 1.00 98.18  ? 165 ASN A C     1 
ATOM   1237  O O     . ASN A 1 165 ? 177.993 180.094 134.635 1.00 98.18  ? 165 ASN A O     1 
ATOM   1238  C CB    . ASN A 1 165 ? 176.971 178.390 132.121 1.00 98.18  ? 165 ASN A CB    1 
ATOM   1239  C CG    . ASN A 1 165 ? 175.837 178.255 133.116 1.00 98.18  ? 165 ASN A CG    1 
ATOM   1240  O OD1   . ASN A 1 165 ? 175.576 179.154 133.911 1.00 98.18  ? 165 ASN A OD1   1 
ATOM   1241  N ND2   . ASN A 1 165 ? 175.165 177.113 133.085 1.00 98.18  ? 165 ASN A ND2   1 
ATOM   1242  N N     . LEU A 1 166 ? 179.777 179.216 133.578 1.00 92.79  ? 166 LEU A N     1 
ATOM   1243  C CA    . LEU A 1 166 ? 180.538 179.091 134.817 1.00 92.79  ? 166 LEU A CA    1 
ATOM   1244  C C     . LEU A 1 166 ? 180.668 180.430 135.532 1.00 92.79  ? 166 LEU A C     1 
ATOM   1245  O O     . LEU A 1 166 ? 180.565 180.497 136.762 1.00 92.79  ? 166 LEU A O     1 
ATOM   1246  C CB    . LEU A 1 166 ? 181.918 178.501 134.530 1.00 92.79  ? 166 LEU A CB    1 
ATOM   1247  C CG    . LEU A 1 166 ? 182.792 178.260 135.759 1.00 92.79  ? 166 LEU A CG    1 
ATOM   1248  C CD1   . LEU A 1 166 ? 182.126 177.273 136.698 1.00 92.79  ? 166 LEU A CD1   1 
ATOM   1249  C CD2   . LEU A 1 166 ? 184.160 177.758 135.342 1.00 92.79  ? 166 LEU A CD2   1 
ATOM   1250  N N     . LEU A 1 167 ? 180.885 181.508 134.781 1.00 85.56  ? 167 LEU A N     1 
ATOM   1251  C CA    . LEU A 1 167 ? 181.000 182.825 135.390 1.00 85.56  ? 167 LEU A CA    1 
ATOM   1252  C C     . LEU A 1 167 ? 179.653 183.499 135.596 1.00 85.56  ? 167 LEU A C     1 
ATOM   1253  O O     . LEU A 1 167 ? 179.567 184.456 136.372 1.00 85.56  ? 167 LEU A O     1 
ATOM   1254  C CB    . LEU A 1 167 ? 181.890 183.725 134.536 1.00 85.56  ? 167 LEU A CB    1 
ATOM   1255  C CG    . LEU A 1 167 ? 183.355 183.306 134.457 1.00 85.56  ? 167 LEU A CG    1 
ATOM   1256  C CD1   . LEU A 1 167 ? 184.105 184.189 133.477 1.00 85.56  ? 167 LEU A CD1   1 
ATOM   1257  C CD2   . LEU A 1 167 ? 183.992 183.360 135.833 1.00 85.56  ? 167 LEU A CD2   1 
ATOM   1258  N N     . VAL A 1 168 ? 178.605 183.029 134.925 1.00 85.91  ? 168 VAL A N     1 
ATOM   1259  C CA    . VAL A 1 168 ? 177.303 183.672 135.046 1.00 85.91  ? 168 VAL A CA    1 
ATOM   1260  C C     . VAL A 1 168 ? 176.586 183.210 136.306 1.00 85.91  ? 168 VAL A C     1 
ATOM   1261  O O     . VAL A 1 168 ? 176.058 184.024 137.071 1.00 85.91  ? 168 VAL A O     1 
ATOM   1262  C CB    . VAL A 1 168 ? 176.460 183.409 133.788 1.00 85.91  ? 168 VAL A CB    1 
ATOM   1263  C CG1   . VAL A 1 168 ? 175.062 183.956 133.974 1.00 85.91  ? 168 VAL A CG1   1 
ATOM   1264  C CG2   . VAL A 1 168 ? 177.119 184.038 132.579 1.00 85.91  ? 168 VAL A CG2   1 
ATOM   1265  N N     . ASN A 1 169 ? 176.557 181.902 136.545 1.00 85.75  ? 169 ASN A N     1 
ATOM   1266  C CA    . ASN A 1 169 ? 175.854 181.337 137.689 1.00 85.75  ? 169 ASN A CA    1 
ATOM   1267  C C     . ASN A 1 169 ? 176.790 180.808 138.762 1.00 85.75  ? 169 ASN A C     1 
ATOM   1268  O O     . ASN A 1 169 ? 176.590 181.087 139.947 1.00 85.75  ? 169 ASN A O     1 
ATOM   1269  C CB    . ASN A 1 169 ? 174.918 180.213 137.230 1.00 85.75  ? 169 ASN A CB    1 
ATOM   1270  C CG    . ASN A 1 169 ? 173.731 180.730 136.457 1.00 85.75  ? 169 ASN A CG    1 
ATOM   1271  O OD1   . ASN A 1 169 ? 173.137 181.745 136.818 1.00 85.75  ? 169 ASN A OD1   1 
ATOM   1272  N ND2   . ASN A 1 169 ? 173.373 180.033 135.387 1.00 85.75  ? 169 ASN A ND2   1 
ATOM   1273  N N     . GLY A 1 170 ? 177.806 180.045 138.382 1.00 86.01  ? 170 GLY A N     1 
ATOM   1274  C CA    . GLY A 1 170 ? 178.673 179.416 139.357 1.00 86.01  ? 170 GLY A CA    1 
ATOM   1275  C C     . GLY A 1 170 ? 177.949 178.305 140.095 1.00 86.01  ? 170 GLY A C     1 
ATOM   1276  O O     . GLY A 1 170 ? 176.766 178.040 139.891 1.00 86.01  ? 170 GLY A O     1 
ATOM   1277  N N     . SER A 1 171 ? 178.689 177.643 140.978 1.00 90.40  ? 171 SER A N     1 
ATOM   1278  C CA    . SER A 1 171 ? 178.144 176.526 141.733 1.00 90.40  ? 171 SER A CA    1 
ATOM   1279  C C     . SER A 1 171 ? 178.907 176.387 143.041 1.00 90.40  ? 171 SER A C     1 
ATOM   1280  O O     . SER A 1 171 ? 179.853 177.130 143.316 1.00 90.40  ? 171 SER A O     1 
ATOM   1281  C CB    . SER A 1 171 ? 178.202 175.232 140.921 1.00 90.40  ? 171 SER A CB    1 
ATOM   1282  O OG    . SER A 1 171 ? 177.712 174.143 141.682 1.00 90.40  ? 171 SER A OG    1 
ATOM   1283  N N     . SER A 1 172 ? 178.485 175.419 143.850 1.00 96.22  ? 172 SER A N     1 
ATOM   1284  C CA    . SER A 1 172 ? 179.117 175.168 145.142 1.00 96.22  ? 172 SER A CA    1 
ATOM   1285  C C     . SER A 1 172 ? 178.986 173.685 145.450 1.00 96.22  ? 172 SER A C     1 
ATOM   1286  O O     . SER A 1 172 ? 177.879 173.196 145.689 1.00 96.22  ? 172 SER A O     1 
ATOM   1287  C CB    . SER A 1 172 ? 178.478 176.010 146.240 1.00 96.22  ? 172 SER A CB    1 
ATOM   1288  O OG    . SER A 1 172 ? 178.679 177.390 146.002 1.00 96.22  ? 172 SER A OG    1 
ATOM   1289  N N     . GLY A 1 173 ? 180.113 172.976 145.448 1.00 96.85  ? 173 GLY A N     1 
ATOM   1290  C CA    . GLY A 1 173 ? 180.120 171.567 145.761 1.00 96.85  ? 173 GLY A CA    1 
ATOM   1291  C C     . GLY A 1 173 ? 181.216 171.243 146.755 1.00 96.85  ? 173 GLY A C     1 
ATOM   1292  O O     . GLY A 1 173 ? 182.149 172.018 146.966 1.00 96.85  ? 173 GLY A O     1 
ATOM   1293  N N     . ILE A 1 174 ? 181.088 170.070 147.365 1.00 96.41  ? 174 ILE A N     1 
ATOM   1294  C CA    . ILE A 1 174 ? 182.022 169.602 148.380 1.00 96.41  ? 174 ILE A CA    1 
ATOM   1295  C C     . ILE A 1 174 ? 182.415 168.167 148.052 1.00 96.41  ? 174 ILE A C     1 
ATOM   1296  O O     . ILE A 1 174 ? 181.589 167.252 148.142 1.00 96.41  ? 174 ILE A O     1 
ATOM   1297  C CB    . ILE A 1 174 ? 181.441 169.725 149.796 1.00 96.41  ? 174 ILE A CB    1 
ATOM   1298  C CG1   . ILE A 1 174 ? 180.030 169.144 149.868 1.00 96.41  ? 174 ILE A CG1   1 
ATOM   1299  C CG2   . ILE A 1 174 ? 181.424 171.170 150.240 1.00 96.41  ? 174 ILE A CG2   1 
ATOM   1300  C CD1   . ILE A 1 174 ? 179.486 169.099 151.261 1.00 96.41  ? 174 ILE A CD1   1 
ATOM   1301  N N     . ALA A 1 175 ? 183.666 167.974 147.651 1.00 102.78 ? 175 ALA A N     1 
ATOM   1302  C CA    . ALA A 1 175 ? 184.184 166.663 147.298 1.00 102.78 ? 175 ALA A CA    1 
ATOM   1303  C C     . ALA A 1 175 ? 184.852 166.021 148.513 1.00 102.78 ? 175 ALA A C     1 
ATOM   1304  O O     . ALA A 1 175 ? 184.693 166.468 149.651 1.00 102.78 ? 175 ALA A O     1 
ATOM   1305  C CB    . ALA A 1 175 ? 185.145 166.772 146.120 1.00 102.78 ? 175 ALA A CB    1 
ATOM   1306  N N     . VAL A 1 176 ? 185.612 164.951 148.276 1.00 102.04 ? 176 VAL A N     1 
ATOM   1307  C CA    . VAL A 1 176 ? 186.305 164.270 149.365 1.00 102.04 ? 176 VAL A CA    1 
ATOM   1308  C C     . VAL A 1 176 ? 187.474 165.110 149.864 1.00 102.04 ? 176 VAL A C     1 
ATOM   1309  O O     . VAL A 1 176 ? 187.732 165.189 151.070 1.00 102.04 ? 176 VAL A O     1 
ATOM   1310  C CB    . VAL A 1 176 ? 186.765 162.874 148.909 1.00 102.04 ? 176 VAL A CB    1 
ATOM   1311  C CG1   . VAL A 1 176 ? 187.584 162.202 149.994 1.00 102.04 ? 176 VAL A CG1   1 
ATOM   1312  C CG2   . VAL A 1 176 ? 185.565 162.023 148.542 1.00 102.04 ? 176 VAL A CG2   1 
ATOM   1313  N N     . GLY A 1 177 ? 188.200 165.743 148.949 1.00 104.19 ? 177 GLY A N     1 
ATOM   1314  C CA    . GLY A 1 177 ? 189.369 166.511 149.329 1.00 104.19 ? 177 GLY A CA    1 
ATOM   1315  C C     . GLY A 1 177 ? 189.264 167.994 149.049 1.00 104.19 ? 177 GLY A C     1 
ATOM   1316  O O     . GLY A 1 177 ? 189.889 168.805 149.738 1.00 104.19 ? 177 GLY A O     1 
ATOM   1317  N N     . MET A 1 178 ? 188.484 168.366 148.042 1.00 110.73 ? 178 MET A N     1 
ATOM   1318  C CA    . MET A 1 178 ? 188.384 169.746 147.601 1.00 110.73 ? 178 MET A CA    1 
ATOM   1319  C C     . MET A 1 178 ? 186.980 170.287 147.838 1.00 110.73 ? 178 MET A C     1 
ATOM   1320  O O     . MET A 1 178 ? 186.046 169.545 148.154 1.00 110.73 ? 178 MET A O     1 
ATOM   1321  C CB    . MET A 1 178 ? 188.745 169.867 146.117 1.00 110.73 ? 178 MET A CB    1 
ATOM   1322  C CG    . MET A 1 178 ? 190.182 169.491 145.801 1.00 110.73 ? 178 MET A CG    1 
ATOM   1323  S SD    . MET A 1 178 ? 191.383 170.551 146.626 1.00 110.73 ? 178 MET A SD    1 
ATOM   1324  C CE    . MET A 1 178 ? 191.142 172.085 145.736 1.00 110.73 ? 178 MET A CE    1 
ATOM   1325  N N     . ALA A 1 179 ? 186.847 171.601 147.683 1.00 106.64 ? 179 ALA A N     1 
ATOM   1326  C CA    . ALA A 1 179 ? 185.561 172.275 147.779 1.00 106.64 ? 179 ALA A CA    1 
ATOM   1327  C C     . ALA A 1 179 ? 185.643 173.577 146.997 1.00 106.64 ? 179 ALA A C     1 
ATOM   1328  O O     . ALA A 1 179 ? 186.684 174.238 146.996 1.00 106.64 ? 179 ALA A O     1 
ATOM   1329  C CB    . ALA A 1 179 ? 185.174 172.548 149.234 1.00 106.64 ? 179 ALA A CB    1 
ATOM   1330  N N     . THR A 1 180 ? 184.546 173.942 146.337 1.00 103.37 ? 180 THR A N     1 
ATOM   1331  C CA    . THR A 1 180 ? 184.534 175.088 145.441 1.00 103.37 ? 180 THR A CA    1 
ATOM   1332  C C     . THR A 1 180 ? 183.391 176.030 145.792 1.00 103.37 ? 180 THR A C     1 
ATOM   1333  O O     . THR A 1 180 ? 182.429 175.654 146.466 1.00 103.37 ? 180 THR A O     1 
ATOM   1334  C CB    . THR A 1 180 ? 184.408 174.653 143.978 1.00 103.37 ? 180 THR A CB    1 
ATOM   1335  O OG1   . THR A 1 180 ? 184.567 175.793 143.126 1.00 103.37 ? 180 THR A OG1   1 
ATOM   1336  C CG2   . THR A 1 180 ? 183.047 174.028 143.729 1.00 103.37 ? 180 THR A CG2   1 
ATOM   1337  N N     . ASN A 1 181 ? 183.517 177.272 145.321 1.00 101.05 ? 181 ASN A N     1 
ATOM   1338  C CA    . ASN A 1 181 ? 182.494 178.290 145.519 1.00 101.05 ? 181 ASN A CA    1 
ATOM   1339  C C     . ASN A 1 181 ? 182.745 179.476 144.593 1.00 101.05 ? 181 ASN A C     1 
ATOM   1340  O O     . ASN A 1 181 ? 183.833 180.060 144.613 1.00 101.05 ? 181 ASN A O     1 
ATOM   1341  C CB    . ASN A 1 181 ? 182.472 178.744 146.979 1.00 101.05 ? 181 ASN A CB    1 
ATOM   1342  C CG    . ASN A 1 181 ? 181.263 179.588 147.306 1.00 101.05 ? 181 ASN A CG    1 
ATOM   1343  O OD1   . ASN A 1 181 ? 180.428 179.860 146.444 1.00 101.05 ? 181 ASN A OD1   1 
ATOM   1344  N ND2   . ASN A 1 181 ? 181.159 180.006 148.561 1.00 101.05 ? 181 ASN A ND2   1 
ATOM   1345  N N     . ILE A 1 182 ? 181.753 179.851 143.789 1.00 86.08  ? 182 ILE A N     1 
ATOM   1346  C CA    . ILE A 1 182 ? 181.920 180.934 142.821 1.00 86.08  ? 182 ILE A CA    1 
ATOM   1347  C C     . ILE A 1 182 ? 180.694 181.840 142.821 1.00 86.08  ? 182 ILE A C     1 
ATOM   1348  O O     . ILE A 1 182 ? 179.560 181.347 142.748 1.00 86.08  ? 182 ILE A O     1 
ATOM   1349  C CB    . ILE A 1 182 ? 182.185 180.386 141.410 1.00 86.08  ? 182 ILE A CB    1 
ATOM   1350  C CG1   . ILE A 1 182 ? 183.514 179.637 141.359 1.00 86.08  ? 182 ILE A CG1   1 
ATOM   1351  C CG2   . ILE A 1 182 ? 182.188 181.513 140.399 1.00 86.08  ? 182 ILE A CG2   1 
ATOM   1352  C CD1   . ILE A 1 182 ? 183.723 178.869 140.083 1.00 86.08  ? 182 ILE A CD1   1 
ATOM   1353  N N     . PRO A 1 183 ? 180.869 183.155 142.898 1.00 85.78  ? 183 PRO A N     1 
ATOM   1354  C CA    . PRO A 1 183 ? 179.723 184.069 142.874 1.00 85.78  ? 183 PRO A CA    1 
ATOM   1355  C C     . PRO A 1 183 ? 179.213 184.269 141.459 1.00 85.78  ? 183 PRO A C     1 
ATOM   1356  O O     . PRO A 1 183 ? 179.959 184.081 140.487 1.00 85.78  ? 183 PRO A O     1 
ATOM   1357  C CB    . PRO A 1 183 ? 180.303 185.373 143.436 1.00 85.78  ? 183 PRO A CB    1 
ATOM   1358  C CG    . PRO A 1 183 ? 181.556 184.971 144.133 1.00 85.78  ? 183 PRO A CG    1 
ATOM   1359  C CD    . PRO A 1 183 ? 182.095 183.830 143.339 1.00 85.78  ? 183 PRO A CD    1 
ATOM   1360  N N     . PRO A 1 184 ? 177.950 184.654 141.301 1.00 88.89  ? 184 PRO A N     1 
ATOM   1361  C CA    . PRO A 1 184 ? 177.438 184.985 139.964 1.00 88.89  ? 184 PRO A CA    1 
ATOM   1362  C C     . PRO A 1 184 ? 178.016 186.285 139.424 1.00 88.89  ? 184 PRO A C     1 
ATOM   1363  O O     . PRO A 1 184 ? 178.798 186.954 140.105 1.00 88.89  ? 184 PRO A O     1 
ATOM   1364  C CB    . PRO A 1 184 ? 175.925 185.103 140.190 1.00 88.89  ? 184 PRO A CB    1 
ATOM   1365  C CG    . PRO A 1 184 ? 175.664 184.332 141.437 1.00 88.89  ? 184 PRO A CG    1 
ATOM   1366  C CD    . PRO A 1 184 ? 176.869 184.552 142.291 1.00 88.89  ? 184 PRO A CD    1 
ATOM   1367  N N     . HIS A 1 185 ? 177.638 186.650 138.202 1.00 92.27  ? 185 HIS A N     1 
ATOM   1368  C CA    . HIS A 1 185 ? 178.074 187.897 137.591 1.00 92.27  ? 185 HIS A CA    1 
ATOM   1369  C C     . HIS A 1 185 ? 176.973 188.391 136.663 1.00 92.27  ? 185 HIS A C     1 
ATOM   1370  O O     . HIS A 1 185 ? 175.929 187.754 136.511 1.00 92.27  ? 185 HIS A O     1 
ATOM   1371  C CB    . HIS A 1 185 ? 179.390 187.719 136.830 1.00 92.27  ? 185 HIS A CB    1 
ATOM   1372  C CG    . HIS A 1 185 ? 180.554 187.380 137.704 1.00 92.27  ? 185 HIS A CG    1 
ATOM   1373  N ND1   . HIS A 1 185 ? 180.891 186.084 138.027 1.00 92.27  ? 185 HIS A ND1   1 
ATOM   1374  C CD2   . HIS A 1 185 ? 181.462 188.169 138.324 1.00 92.27  ? 185 HIS A CD2   1 
ATOM   1375  C CE1   . HIS A 1 185 ? 181.956 186.088 138.807 1.00 92.27  ? 185 HIS A CE1   1 
ATOM   1376  N NE2   . HIS A 1 185 ? 182.323 187.342 139.003 1.00 92.27  ? 185 HIS A NE2   1 
ATOM   1377  N N     . ASN A 1 186 ? 177.214 189.537 136.037 1.00 103.69 ? 186 ASN A N     1 
ATOM   1378  C CA    . ASN A 1 186 ? 176.288 190.071 135.050 1.00 103.69 ? 186 ASN A CA    1 
ATOM   1379  C C     . ASN A 1 186 ? 176.732 189.664 133.651 1.00 103.69 ? 186 ASN A C     1 
ATOM   1380  O O     . ASN A 1 186 ? 177.918 189.449 133.394 1.00 103.69 ? 186 ASN A O     1 
ATOM   1381  C CB    . ASN A 1 186 ? 176.200 191.592 135.156 1.00 103.69 ? 186 ASN A CB    1 
ATOM   1382  C CG    . ASN A 1 186 ? 175.063 192.165 134.341 1.00 103.69 ? 186 ASN A CG    1 
ATOM   1383  O OD1   . ASN A 1 186 ? 174.348 191.436 133.655 1.00 103.69 ? 186 ASN A OD1   1 
ATOM   1384  N ND2   . ASN A 1 186 ? 174.883 193.476 134.418 1.00 103.69 ? 186 ASN A ND2   1 
ATOM   1385  N N     . LEU A 1 187 ? 175.764 189.572 132.741 1.00 100.97 ? 187 LEU A N     1 
ATOM   1386  C CA    . LEU A 1 187 ? 176.037 189.006 131.424 1.00 100.97 ? 187 LEU A CA    1 
ATOM   1387  C C     . LEU A 1 187 ? 176.771 189.988 130.516 1.00 100.97 ? 187 LEU A C     1 
ATOM   1388  O O     . LEU A 1 187 ? 177.789 189.637 129.904 1.00 100.97 ? 187 LEU A O     1 
ATOM   1389  C CB    . LEU A 1 187 ? 174.730 188.556 130.774 1.00 100.97 ? 187 LEU A CB    1 
ATOM   1390  C CG    . LEU A 1 187 ? 174.885 187.894 129.409 1.00 100.97 ? 187 LEU A CG    1 
ATOM   1391  C CD1   . LEU A 1 187 ? 175.731 186.644 129.527 1.00 100.97 ? 187 LEU A CD1   1 
ATOM   1392  C CD2   . LEU A 1 187 ? 173.527 187.564 128.827 1.00 100.97 ? 187 LEU A CD2   1 
ATOM   1393  N N     . THR A 1 188 ? 176.260 191.217 130.406 1.00 107.89 ? 188 THR A N     1 
ATOM   1394  C CA    . THR A 1 188 ? 176.827 192.178 129.464 1.00 107.89 ? 188 THR A CA    1 
ATOM   1395  C C     . THR A 1 188 ? 178.293 192.456 129.763 1.00 107.89 ? 188 THR A C     1 
ATOM   1396  O O     . THR A 1 188 ? 179.102 192.623 128.842 1.00 107.89 ? 188 THR A O     1 
ATOM   1397  C CB    . THR A 1 188 ? 176.029 193.480 129.495 1.00 107.89 ? 188 THR A CB    1 
ATOM   1398  O OG1   . THR A 1 188 ? 176.106 194.056 130.803 1.00 107.89 ? 188 THR A OG1   1 
ATOM   1399  C CG2   . THR A 1 188 ? 174.577 193.218 129.152 1.00 107.89 ? 188 THR A CG2   1 
ATOM   1400  N N     . GLU A 1 189 ? 178.658 192.505 131.043 1.00 112.45 ? 189 GLU A N     1 
ATOM   1401  C CA    . GLU A 1 189 ? 180.046 192.776 131.392 1.00 112.45 ? 189 GLU A CA    1 
ATOM   1402  C C     . GLU A 1 189 ? 180.950 191.618 130.996 1.00 112.45 ? 189 GLU A C     1 
ATOM   1403  O O     . GLU A 1 189 ? 182.068 191.832 130.514 1.00 112.45 ? 189 GLU A O     1 
ATOM   1404  C CB    . GLU A 1 189 ? 180.157 193.069 132.883 1.00 112.45 ? 189 GLU A CB    1 
ATOM   1405  C CG    . GLU A 1 189 ? 179.471 194.354 133.281 1.00 112.45 ? 189 GLU A CG    1 
ATOM   1406  C CD    . GLU A 1 189 ? 179.601 194.640 134.754 1.00 112.45 ? 189 GLU A CD    1 
ATOM   1407  O OE1   . GLU A 1 189 ? 180.081 193.755 135.493 1.00 112.45 ? 189 GLU A OE1   1 
ATOM   1408  O OE2   . GLU A 1 189 ? 179.242 195.756 135.176 1.00 112.45 ? 189 GLU A OE2   1 
ATOM   1409  N N     . VAL A 1 190 ? 180.480 190.383 131.180 1.00 104.20 ? 190 VAL A N     1 
ATOM   1410  C CA    . VAL A 1 190 ? 181.268 189.228 130.764 1.00 104.20 ? 190 VAL A CA    1 
ATOM   1411  C C     . VAL A 1 190 ? 181.443 189.225 129.251 1.00 104.20 ? 190 VAL A C     1 
ATOM   1412  O O     . VAL A 1 190 ? 182.524 188.915 128.735 1.00 104.20 ? 190 VAL A O     1 
ATOM   1413  C CB    . VAL A 1 190 ? 180.617 187.928 131.263 1.00 104.20 ? 190 VAL A CB    1 
ATOM   1414  C CG1   . VAL A 1 190 ? 181.363 186.727 130.720 1.00 104.20 ? 190 VAL A CG1   1 
ATOM   1415  C CG2   . VAL A 1 190 ? 180.605 187.896 132.777 1.00 104.20 ? 190 VAL A CG2   1 
ATOM   1416  N N     . ILE A 1 191 ? 180.390 189.585 128.516 1.00 108.24 ? 191 ILE A N     1 
ATOM   1417  C CA    . ILE A 1 191 ? 180.505 189.648 127.062 1.00 108.24 ? 191 ILE A CA    1 
ATOM   1418  C C     . ILE A 1 191 ? 181.501 190.726 126.652 1.00 108.24 ? 191 ILE A C     1 
ATOM   1419  O O     . ILE A 1 191 ? 182.307 190.532 125.733 1.00 108.24 ? 191 ILE A O     1 
ATOM   1420  C CB    . ILE A 1 191 ? 179.124 189.875 126.424 1.00 108.24 ? 191 ILE A CB    1 
ATOM   1421  C CG1   . ILE A 1 191 ? 178.189 188.721 126.771 1.00 108.24 ? 191 ILE A CG1   1 
ATOM   1422  C CG2   . ILE A 1 191 ? 179.246 190.008 124.919 1.00 108.24 ? 191 ILE A CG2   1 
ATOM   1423  C CD1   . ILE A 1 191 ? 178.671 187.384 126.268 1.00 108.24 ? 191 ILE A CD1   1 
ATOM   1424  N N     . ASN A 1 192 ? 181.465 191.876 127.326 1.00 109.00 ? 192 ASN A N     1 
ATOM   1425  C CA    . ASN A 1 192 ? 182.402 192.946 127.002 1.00 109.00 ? 192 ASN A CA    1 
ATOM   1426  C C     . ASN A 1 192 ? 183.836 192.525 127.297 1.00 109.00 ? 192 ASN A C     1 
ATOM   1427  O O     . ASN A 1 192 ? 184.755 192.834 126.528 1.00 109.00 ? 192 ASN A O     1 
ATOM   1428  C CB    . ASN A 1 192 ? 182.039 194.209 127.777 1.00 109.00 ? 192 ASN A CB    1 
ATOM   1429  C CG    . ASN A 1 192 ? 180.738 194.820 127.306 1.00 109.00 ? 192 ASN A CG    1 
ATOM   1430  O OD1   . ASN A 1 192 ? 180.471 194.887 126.108 1.00 109.00 ? 192 ASN A OD1   1 
ATOM   1431  N ND2   . ASN A 1 192 ? 179.916 195.264 128.249 1.00 109.00 ? 192 ASN A ND2   1 
ATOM   1432  N N     . GLY A 1 193 ? 184.044 191.810 128.402 1.00 113.86 ? 193 GLY A N     1 
ATOM   1433  C CA    . GLY A 1 193 ? 185.375 191.313 128.705 1.00 113.86 ? 193 GLY A CA    1 
ATOM   1434  C C     . GLY A 1 193 ? 185.862 190.307 127.681 1.00 113.86 ? 193 GLY A C     1 
ATOM   1435  O O     . GLY A 1 193 ? 187.034 190.317 127.292 1.00 113.86 ? 193 GLY A O     1 
ATOM   1436  N N     . CYS A 1 194 ? 184.969 189.424 127.229 1.00 119.75 ? 194 CYS A N     1 
ATOM   1437  C CA    . CYS A 1 194 ? 185.340 188.473 126.187 1.00 119.75 ? 194 CYS A CA    1 
ATOM   1438  C C     . CYS A 1 194 ? 185.713 189.192 124.898 1.00 119.75 ? 194 CYS A C     1 
ATOM   1439  O O     . CYS A 1 194 ? 186.680 188.816 124.227 1.00 119.75 ? 194 CYS A O     1 
ATOM   1440  C CB    . CYS A 1 194 ? 184.200 187.489 125.941 1.00 119.75 ? 194 CYS A CB    1 
ATOM   1441  S SG    . CYS A 1 194 ? 183.860 186.392 127.330 1.00 119.75 ? 194 CYS A SG    1 
ATOM   1442  N N     . LEU A 1 195 ? 184.957 190.230 124.537 1.00 114.38 ? 195 LEU A N     1 
ATOM   1443  C CA    . LEU A 1 195 ? 185.309 191.020 123.361 1.00 114.38 ? 195 LEU A CA    1 
ATOM   1444  C C     . LEU A 1 195 ? 186.681 191.661 123.522 1.00 114.38 ? 195 LEU A C     1 
ATOM   1445  O O     . LEU A 1 195 ? 187.501 191.640 122.594 1.00 114.38 ? 195 LEU A O     1 
ATOM   1446  C CB    . LEU A 1 195 ? 184.248 192.089 123.109 1.00 114.38 ? 195 LEU A CB    1 
ATOM   1447  C CG    . LEU A 1 195 ? 182.867 191.564 122.729 1.00 114.38 ? 195 LEU A CG    1 
ATOM   1448  C CD1   . LEU A 1 195 ? 181.873 192.706 122.635 1.00 114.38 ? 195 LEU A CD1   1 
ATOM   1449  C CD2   . LEU A 1 195 ? 182.935 190.797 121.423 1.00 114.38 ? 195 LEU A CD2   1 
ATOM   1450  N N     . ALA A 1 196 ? 186.947 192.233 124.697 1.00 116.09 ? 196 ALA A N     1 
ATOM   1451  C CA    . ALA A 1 196 ? 188.243 192.857 124.937 1.00 116.09 ? 196 ALA A CA    1 
ATOM   1452  C C     . ALA A 1 196 ? 189.374 191.845 124.816 1.00 116.09 ? 196 ALA A C     1 
ATOM   1453  O O     . ALA A 1 196 ? 190.434 192.151 124.258 1.00 116.09 ? 196 ALA A O     1 
ATOM   1454  C CB    . ALA A 1 196 ? 188.260 193.520 126.312 1.00 116.09 ? 196 ALA A CB    1 
ATOM   1455  N N     . TYR A 1 197 ? 189.168 190.631 125.328 1.00 112.28 ? 197 TYR A N     1 
ATOM   1456  C CA    . TYR A 1 197 ? 190.218 189.624 125.226 1.00 112.28 ? 197 TYR A CA    1 
ATOM   1457  C C     . TYR A 1 197 ? 190.373 189.113 123.801 1.00 112.28 ? 197 TYR A C     1 
ATOM   1458  O O     . TYR A 1 197 ? 191.471 188.709 123.406 1.00 112.28 ? 197 TYR A O     1 
ATOM   1459  C CB    . TYR A 1 197 ? 189.941 188.457 126.167 1.00 112.28 ? 197 TYR A CB    1 
ATOM   1460  C CG    . TYR A 1 197 ? 191.006 187.390 126.101 1.00 112.28 ? 197 TYR A CG    1 
ATOM   1461  C CD1   . TYR A 1 197 ? 192.234 187.569 126.719 1.00 112.28 ? 197 TYR A CD1   1 
ATOM   1462  C CD2   . TYR A 1 197 ? 190.791 186.212 125.403 1.00 112.28 ? 197 TYR A CD2   1 
ATOM   1463  C CE1   . TYR A 1 197 ? 193.212 186.599 126.655 1.00 112.28 ? 197 TYR A CE1   1 
ATOM   1464  C CE2   . TYR A 1 197 ? 191.762 185.237 125.333 1.00 112.28 ? 197 TYR A CE2   1 
ATOM   1465  C CZ    . TYR A 1 197 ? 192.970 185.435 125.960 1.00 112.28 ? 197 TYR A CZ    1 
ATOM   1466  O OH    . TYR A 1 197 ? 193.940 184.463 125.891 1.00 112.28 ? 197 TYR A OH    1 
ATOM   1467  N N     . ILE A 1 198 ? 189.293 189.104 123.023 1.00 110.91 ? 198 ILE A N     1 
ATOM   1468  C CA    . ILE A 1 198 ? 189.419 188.740 121.617 1.00 110.91 ? 198 ILE A CA    1 
ATOM   1469  C C     . ILE A 1 198 ? 190.221 189.796 120.870 1.00 110.91 ? 198 ILE A C     1 
ATOM   1470  O O     . ILE A 1 198 ? 191.022 189.476 119.983 1.00 110.91 ? 198 ILE A O     1 
ATOM   1471  C CB    . ILE A 1 198 ? 188.030 188.522 120.992 1.00 110.91 ? 198 ILE A CB    1 
ATOM   1472  C CG1   . ILE A 1 198 ? 187.377 187.270 121.572 1.00 110.91 ? 198 ILE A CG1   1 
ATOM   1473  C CG2   . ILE A 1 198 ? 188.126 188.413 119.487 1.00 110.91 ? 198 ILE A CG2   1 
ATOM   1474  C CD1   . ILE A 1 198 ? 185.927 187.127 121.198 1.00 110.91 ? 198 ILE A CD1   1 
ATOM   1475  N N     . ASP A 1 199 ? 190.039 191.068 121.228 1.00 127.62 ? 199 ASP A N     1 
ATOM   1476  C CA    . ASP A 1 199 ? 190.819 192.122 120.587 1.00 127.62 ? 199 ASP A CA    1 
ATOM   1477  C C     . ASP A 1 199 ? 192.300 192.011 120.926 1.00 127.62 ? 199 ASP A C     1 
ATOM   1478  O O     . ASP A 1 199 ? 193.151 192.139 120.040 1.00 127.62 ? 199 ASP A O     1 
ATOM   1479  C CB    . ASP A 1 199 ? 190.286 193.496 120.989 1.00 127.62 ? 199 ASP A CB    1 
ATOM   1480  C CG    . ASP A 1 199 ? 188.946 193.805 120.362 1.00 127.62 ? 199 ASP A CG    1 
ATOM   1481  O OD1   . ASP A 1 199 ? 188.681 193.296 119.254 1.00 127.62 ? 199 ASP A OD1   1 
ATOM   1482  O OD2   . ASP A 1 199 ? 188.160 194.559 120.973 1.00 127.62 ? 199 ASP A OD2   1 
ATOM   1483  N N     . ASP A 1 200 ? 192.628 191.769 122.193 1.00 135.47 ? 200 ASP A N     1 
ATOM   1484  C CA    . ASP A 1 200 ? 194.015 191.709 122.633 1.00 135.47 ? 200 ASP A CA    1 
ATOM   1485  C C     . ASP A 1 200 ? 194.228 190.434 123.432 1.00 135.47 ? 200 ASP A C     1 
ATOM   1486  O O     . ASP A 1 200 ? 193.507 190.172 124.398 1.00 135.47 ? 200 ASP A O     1 
ATOM   1487  C CB    . ASP A 1 200 ? 194.384 192.932 123.479 1.00 135.47 ? 200 ASP A CB    1 
ATOM   1488  C CG    . ASP A 1 200 ? 195.873 193.020 123.761 1.00 135.47 ? 200 ASP A CG    1 
ATOM   1489  O OD1   . ASP A 1 200 ? 196.626 192.135 123.304 1.00 135.47 ? 200 ASP A OD1   1 
ATOM   1490  O OD2   . ASP A 1 200 ? 196.290 193.975 124.449 1.00 135.47 ? 200 ASP A OD2   1 
ATOM   1491  N N     . GLU A 1 201 ? 195.235 189.657 123.037 1.00 135.89 ? 201 GLU A N     1 
ATOM   1492  C CA    . GLU A 1 201 ? 195.516 188.396 123.710 1.00 135.89 ? 201 GLU A CA    1 
ATOM   1493  C C     . GLU A 1 201 ? 196.249 188.602 125.029 1.00 135.89 ? 201 GLU A C     1 
ATOM   1494  O O     . GLU A 1 201 ? 196.083 187.807 125.961 1.00 135.89 ? 201 GLU A O     1 
ATOM   1495  C CB    . GLU A 1 201 ? 196.336 187.489 122.791 1.00 135.89 ? 201 GLU A CB    1 
ATOM   1496  C CG    . GLU A 1 201 ? 196.627 186.116 123.370 1.00 135.89 ? 201 GLU A CG    1 
ATOM   1497  C CD    . GLU A 1 201 ? 197.403 185.232 122.414 1.00 135.89 ? 201 GLU A CD    1 
ATOM   1498  O OE1   . GLU A 1 201 ? 197.720 185.692 121.297 1.00 135.89 ? 201 GLU A OE1   1 
ATOM   1499  O OE2   . GLU A 1 201 ? 197.701 184.076 122.783 1.00 135.89 ? 201 GLU A OE2   1 
ATOM   1500  N N     . ASP A 1 202 ? 197.052 189.660 125.134 1.00 141.08 ? 202 ASP A N     1 
ATOM   1501  C CA    . ASP A 1 202 ? 197.906 189.879 126.292 1.00 141.08 ? 202 ASP A CA    1 
ATOM   1502  C C     . ASP A 1 202 ? 197.366 190.969 127.214 1.00 141.08 ? 202 ASP A C     1 
ATOM   1503  O O     . ASP A 1 202 ? 198.140 191.781 127.731 1.00 141.08 ? 202 ASP A O     1 
ATOM   1504  C CB    . ASP A 1 202 ? 199.326 190.214 125.833 1.00 141.08 ? 202 ASP A CB    1 
ATOM   1505  C CG    . ASP A 1 202 ? 200.355 190.047 126.935 1.00 141.08 ? 202 ASP A CG    1 
ATOM   1506  O OD1   . ASP A 1 202 ? 199.976 189.664 128.061 1.00 141.08 ? 202 ASP A OD1   1 
ATOM   1507  O OD2   . ASP A 1 202 ? 201.548 190.301 126.675 1.00 141.08 ? 202 ASP A OD2   1 
ATOM   1508  N N     . ILE A 1 203 ? 196.052 191.015 127.417 1.00 133.32 ? 203 ILE A N     1 
ATOM   1509  C CA    . ILE A 1 203 ? 195.455 191.988 128.324 1.00 133.32 ? 203 ILE A CA    1 
ATOM   1510  C C     . ILE A 1 203 ? 195.901 191.674 129.747 1.00 133.32 ? 203 ILE A C     1 
ATOM   1511  O O     . ILE A 1 203 ? 196.187 190.519 130.079 1.00 133.32 ? 203 ILE A O     1 
ATOM   1512  C CB    . ILE A 1 203 ? 193.921 191.988 128.200 1.00 133.32 ? 203 ILE A CB    1 
ATOM   1513  C CG1   . ILE A 1 203 ? 193.323 193.183 128.945 1.00 133.32 ? 203 ILE A CG1   1 
ATOM   1514  C CG2   . ILE A 1 203 ? 193.345 190.685 128.721 1.00 133.32 ? 203 ILE A CG2   1 
ATOM   1515  C CD1   . ILE A 1 203 ? 191.875 193.444 128.614 1.00 133.32 ? 203 ILE A CD1   1 
ATOM   1516  N N     . SER A 1 204 ? 195.983 192.700 130.589 1.00 133.91 ? 204 SER A N     1 
ATOM   1517  C CA    . SER A 1 204 ? 196.386 192.521 131.974 1.00 133.91 ? 204 SER A CA    1 
ATOM   1518  C C     . SER A 1 204 ? 195.163 192.299 132.858 1.00 133.91 ? 204 SER A C     1 
ATOM   1519  O O     . SER A 1 204 ? 194.018 192.488 132.441 1.00 133.91 ? 204 SER A O     1 
ATOM   1520  C CB    . SER A 1 204 ? 197.178 193.731 132.464 1.00 133.91 ? 204 SER A CB    1 
ATOM   1521  O OG    . SER A 1 204 ? 196.353 194.880 132.536 1.00 133.91 ? 204 SER A OG    1 
ATOM   1522  N N     . ILE A 1 205 ? 195.420 191.896 134.104 1.00 130.39 ? 205 ILE A N     1 
ATOM   1523  C CA    . ILE A 1 205 ? 194.330 191.689 135.051 1.00 130.39 ? 205 ILE A CA    1 
ATOM   1524  C C     . ILE A 1 205 ? 193.656 193.013 135.378 1.00 130.39 ? 205 ILE A C     1 
ATOM   1525  O O     . ILE A 1 205 ? 192.439 193.073 135.589 1.00 130.39 ? 205 ILE A O     1 
ATOM   1526  C CB    . ILE A 1 205 ? 194.849 190.988 136.319 1.00 130.39 ? 205 ILE A CB    1 
ATOM   1527  C CG1   . ILE A 1 205 ? 195.517 189.663 135.955 1.00 130.39 ? 205 ILE A CG1   1 
ATOM   1528  C CG2   . ILE A 1 205 ? 193.712 190.748 137.300 1.00 130.39 ? 205 ILE A CG2   1 
ATOM   1529  C CD1   . ILE A 1 205 ? 194.591 188.681 135.280 1.00 130.39 ? 205 ILE A CD1   1 
ATOM   1530  N N     . GLU A 1 206 ? 194.433 194.096 135.417 1.00 134.61 ? 206 GLU A N     1 
ATOM   1531  C CA    . GLU A 1 206 ? 193.855 195.410 135.670 1.00 134.61 ? 206 GLU A CA    1 
ATOM   1532  C C     . GLU A 1 206 ? 192.882 195.806 134.567 1.00 134.61 ? 206 GLU A C     1 
ATOM   1533  O O     . GLU A 1 206 ? 191.820 196.377 134.842 1.00 134.61 ? 206 GLU A O     1 
ATOM   1534  C CB    . GLU A 1 206 ? 194.963 196.452 135.807 1.00 134.61 ? 206 GLU A CB    1 
ATOM   1535  C CG    . GLU A 1 206 ? 194.458 197.852 136.093 1.00 134.61 ? 206 GLU A CG    1 
ATOM   1536  C CD    . GLU A 1 206 ? 193.766 197.958 137.437 1.00 134.61 ? 206 GLU A CD    1 
ATOM   1537  O OE1   . GLU A 1 206 ? 194.090 197.159 138.342 1.00 134.61 ? 206 GLU A OE1   1 
ATOM   1538  O OE2   . GLU A 1 206 ? 192.895 198.839 137.588 1.00 134.61 ? 206 GLU A OE2   1 
ATOM   1539  N N     . GLY A 1 207 ? 193.227 195.513 133.313 1.00 128.13 ? 207 GLY A N     1 
ATOM   1540  C CA    . GLY A 1 207 ? 192.329 195.840 132.218 1.00 128.13 ? 207 GLY A CA    1 
ATOM   1541  C C     . GLY A 1 207 ? 191.016 195.087 132.297 1.00 128.13 ? 207 GLY A C     1 
ATOM   1542  O O     . GLY A 1 207 ? 189.943 195.667 132.116 1.00 128.13 ? 207 GLY A O     1 
ATOM   1543  N N     . LEU A 1 208 ? 191.081 193.783 132.571 1.00 123.72 ? 208 LEU A N     1 
ATOM   1544  C CA    . LEU A 1 208 ? 189.859 193.000 132.708 1.00 123.72 ? 208 LEU A CA    1 
ATOM   1545  C C     . LEU A 1 208 ? 189.043 193.465 133.904 1.00 123.72 ? 208 LEU A C     1 
ATOM   1546  O O     . LEU A 1 208 ? 187.808 193.503 133.847 1.00 123.72 ? 208 LEU A O     1 
ATOM   1547  C CB    . LEU A 1 208 ? 190.199 191.518 132.834 1.00 123.72 ? 208 LEU A CB    1 
ATOM   1548  C CG    . LEU A 1 208 ? 190.810 190.888 131.586 1.00 123.72 ? 208 LEU A CG    1 
ATOM   1549  C CD1   . LEU A 1 208 ? 191.243 189.461 131.862 1.00 123.72 ? 208 LEU A CD1   1 
ATOM   1550  C CD2   . LEU A 1 208 ? 189.816 190.935 130.443 1.00 123.72 ? 208 LEU A CD2   1 
ATOM   1551  N N     . MET A 1 209 ? 189.715 193.825 134.999 1.00 130.27 ? 209 MET A N     1 
ATOM   1552  C CA    . MET A 1 209 ? 188.998 194.313 136.171 1.00 130.27 ? 209 MET A CA    1 
ATOM   1553  C C     . MET A 1 209 ? 188.302 195.634 135.872 1.00 130.27 ? 209 MET A C     1 
ATOM   1554  O O     . MET A 1 209 ? 187.320 195.993 136.533 1.00 130.27 ? 209 MET A O     1 
ATOM   1555  C CB    . MET A 1 209 ? 189.960 194.458 137.349 1.00 130.27 ? 209 MET A CB    1 
ATOM   1556  C CG    . MET A 1 209 ? 189.290 194.829 138.661 1.00 130.27 ? 209 MET A CG    1 
ATOM   1557  S SD    . MET A 1 209 ? 190.449 194.880 140.040 1.00 130.27 ? 209 MET A SD    1 
ATOM   1558  C CE    . MET A 1 209 ? 189.375 195.432 141.363 1.00 130.27 ? 209 MET A CE    1 
ATOM   1559  N N     . GLU A 1 210 ? 188.790 196.369 134.871 1.00 132.85 ? 210 GLU A N     1 
ATOM   1560  C CA    . GLU A 1 210 ? 188.133 197.613 134.489 1.00 132.85 ? 210 GLU A CA    1 
ATOM   1561  C C     . GLU A 1 210 ? 186.789 197.342 133.825 1.00 132.85 ? 210 GLU A C     1 
ATOM   1562  O O     . GLU A 1 210 ? 185.818 198.074 134.049 1.00 132.85 ? 210 GLU A O     1 
ATOM   1563  C CB    . GLU A 1 210 ? 189.038 198.421 133.561 1.00 132.85 ? 210 GLU A CB    1 
ATOM   1564  C CG    . GLU A 1 210 ? 188.572 199.848 133.324 1.00 132.85 ? 210 GLU A CG    1 
ATOM   1565  C CD    . GLU A 1 210 ? 187.522 199.948 132.235 1.00 132.85 ? 210 GLU A CD    1 
ATOM   1566  O OE1   . GLU A 1 210 ? 187.524 199.091 131.326 1.00 132.85 ? 210 GLU A OE1   1 
ATOM   1567  O OE2   . GLU A 1 210 ? 186.692 200.880 132.293 1.00 132.85 ? 210 GLU A OE2   1 
ATOM   1568  N N     . HIS A 1 211 ? 186.714 196.297 132.998 1.00 124.26 ? 211 HIS A N     1 
ATOM   1569  C CA    . HIS A 1 211 ? 185.460 195.989 132.318 1.00 124.26 ? 211 HIS A CA    1 
ATOM   1570  C C     . HIS A 1 211 ? 184.480 195.291 133.251 1.00 124.26 ? 211 HIS A C     1 
ATOM   1571  O O     . HIS A 1 211 ? 183.266 195.504 133.159 1.00 124.26 ? 211 HIS A O     1 
ATOM   1572  C CB    . HIS A 1 211 ? 185.730 195.133 131.083 1.00 124.26 ? 211 HIS A CB    1 
ATOM   1573  C CG    . HIS A 1 211 ? 186.491 195.846 130.011 1.00 124.26 ? 211 HIS A CG    1 
ATOM   1574  N ND1   . HIS A 1 211 ? 187.868 195.873 129.969 1.00 124.26 ? 211 HIS A ND1   1 
ATOM   1575  C CD2   . HIS A 1 211 ? 186.068 196.559 128.940 1.00 124.26 ? 211 HIS A CD2   1 
ATOM   1576  C CE1   . HIS A 1 211 ? 188.261 196.572 128.919 1.00 124.26 ? 211 HIS A CE1   1 
ATOM   1577  N NE2   . HIS A 1 211 ? 187.188 196.999 128.278 1.00 124.26 ? 211 HIS A NE2   1 
ATOM   1578  N N     . ILE A 1 212 ? 184.983 194.453 134.148 1.00 114.51 ? 212 ILE A N     1 
ATOM   1579  C CA    . ILE A 1 212 ? 184.154 193.730 135.104 1.00 114.51 ? 212 ILE A CA    1 
ATOM   1580  C C     . ILE A 1 212 ? 184.394 194.316 136.488 1.00 114.51 ? 212 ILE A C     1 
ATOM   1581  O O     . ILE A 1 212 ? 185.391 193.998 137.142 1.00 114.51 ? 212 ILE A O     1 
ATOM   1582  C CB    . ILE A 1 212 ? 184.453 192.222 135.083 1.00 114.51 ? 212 ILE A CB    1 
ATOM   1583  C CG1   . ILE A 1 212 ? 184.135 191.633 133.710 1.00 114.51 ? 212 ILE A CG1   1 
ATOM   1584  C CG2   . ILE A 1 212 ? 183.649 191.509 136.154 1.00 114.51 ? 212 ILE A CG2   1 
ATOM   1585  C CD1   . ILE A 1 212 ? 184.623 190.214 133.538 1.00 114.51 ? 212 ILE A CD1   1 
ATOM   1586  N N     . PRO A 1 213 ? 183.508 195.190 136.966 1.00 105.74 ? 213 PRO A N     1 
ATOM   1587  C CA    . PRO A 1 213 ? 183.704 195.749 138.313 1.00 105.74 ? 213 PRO A CA    1 
ATOM   1588  C C     . PRO A 1 213 ? 183.656 194.705 139.413 1.00 105.74 ? 213 PRO A C     1 
ATOM   1589  O O     . PRO A 1 213 ? 184.608 194.592 140.195 1.00 105.74 ? 213 PRO A O     1 
ATOM   1590  C CB    . PRO A 1 213 ? 182.561 196.767 138.430 1.00 105.74 ? 213 PRO A CB    1 
ATOM   1591  C CG    . PRO A 1 213 ? 182.229 197.121 137.023 1.00 105.74 ? 213 PRO A CG    1 
ATOM   1592  C CD    . PRO A 1 213 ? 182.418 195.860 136.242 1.00 105.74 ? 213 PRO A CD    1 
ATOM   1593  N N     . GLY A 1 214 ? 182.579 193.929 139.496 1.00 100.26 ? 214 GLY A N     1 
ATOM   1594  C CA    . GLY A 1 214 ? 182.438 192.964 140.560 1.00 100.26 ? 214 GLY A CA    1 
ATOM   1595  C C     . GLY A 1 214 ? 181.294 191.993 140.355 1.00 100.26 ? 214 GLY A C     1 
ATOM   1596  O O     . GLY A 1 214 ? 180.669 191.941 139.291 1.00 100.26 ? 214 GLY A O     1 
ATOM   1597  N N     . PRO A 1 215 ? 180.999 191.198 141.385 1.00 90.65  ? 215 PRO A N     1 
ATOM   1598  C CA    . PRO A 1 215 ? 179.965 190.164 141.257 1.00 90.65  ? 215 PRO A CA    1 
ATOM   1599  C C     . PRO A 1 215 ? 178.559 190.725 141.146 1.00 90.65  ? 215 PRO A C     1 
ATOM   1600  O O     . PRO A 1 215 ? 178.355 191.942 141.131 1.00 90.65  ? 215 PRO A O     1 
ATOM   1601  C CB    . PRO A 1 215 ? 180.125 189.351 142.548 1.00 90.65  ? 215 PRO A CB    1 
ATOM   1602  C CG    . PRO A 1 215 ? 181.502 189.643 143.017 1.00 90.65  ? 215 PRO A CG    1 
ATOM   1603  C CD    . PRO A 1 215 ? 181.754 191.065 142.638 1.00 90.65  ? 215 PRO A CD    1 
ATOM   1604  N N     . ASP A 1 216 ? 177.581 189.826 141.067 1.00 100.45 ? 216 ASP A N     1 
ATOM   1605  C CA    . ASP A 1 216 ? 176.177 190.197 141.058 1.00 100.45 ? 216 ASP A CA    1 
ATOM   1606  C C     . ASP A 1 216 ? 175.393 189.106 141.771 1.00 100.45 ? 216 ASP A C     1 
ATOM   1607  O O     . ASP A 1 216 ? 175.821 187.951 141.839 1.00 100.45 ? 216 ASP A O     1 
ATOM   1608  C CB    . ASP A 1 216 ? 175.652 190.398 139.631 1.00 100.45 ? 216 ASP A CB    1 
ATOM   1609  C CG    . ASP A 1 216 ? 174.275 191.033 139.602 1.00 100.45 ? 216 ASP A CG    1 
ATOM   1610  O OD1   . ASP A 1 216 ? 173.726 191.317 140.686 1.00 100.45 ? 216 ASP A OD1   1 
ATOM   1611  O OD2   . ASP A 1 216 ? 173.738 191.245 138.495 1.00 100.45 ? 216 ASP A OD2   1 
ATOM   1612  N N     . PHE A 1 217 ? 174.237 189.482 142.303 1.00 102.18 ? 217 PHE A N     1 
ATOM   1613  C CA    . PHE A 1 217 ? 173.414 188.561 143.065 1.00 102.18 ? 217 PHE A CA    1 
ATOM   1614  C C     . PHE A 1 217 ? 171.977 188.608 142.575 1.00 102.18 ? 217 PHE A C     1 
ATOM   1615  O O     . PHE A 1 217 ? 171.544 189.617 142.011 1.00 102.18 ? 217 PHE A O     1 
ATOM   1616  C CB    . PHE A 1 217 ? 173.461 188.900 144.560 1.00 102.18 ? 217 PHE A CB    1 
ATOM   1617  C CG    . PHE A 1 217 ? 174.793 188.646 145.192 1.00 102.18 ? 217 PHE A CG    1 
ATOM   1618  C CD1   . PHE A 1 217 ? 175.155 187.370 145.582 1.00 102.18 ? 217 PHE A CD1   1 
ATOM   1619  C CD2   . PHE A 1 217 ? 175.686 189.680 145.392 1.00 102.18 ? 217 PHE A CD2   1 
ATOM   1620  C CE1   . PHE A 1 217 ? 176.379 187.131 146.164 1.00 102.18 ? 217 PHE A CE1   1 
ATOM   1621  C CE2   . PHE A 1 217 ? 176.914 189.446 145.975 1.00 102.18 ? 217 PHE A CE2   1 
ATOM   1622  C CZ    . PHE A 1 217 ? 177.260 188.170 146.361 1.00 102.18 ? 217 PHE A CZ    1 
ATOM   1623  N N     . PRO A 1 218 ? 171.214 187.528 142.768 1.00 103.72 ? 218 PRO A N     1 
ATOM   1624  C CA    . PRO A 1 218 ? 169.800 187.568 142.365 1.00 103.72 ? 218 PRO A CA    1 
ATOM   1625  C C     . PRO A 1 218 ? 169.004 188.613 143.122 1.00 103.72 ? 218 PRO A C     1 
ATOM   1626  O O     . PRO A 1 218 ? 168.124 189.259 142.541 1.00 103.72 ? 218 PRO A O     1 
ATOM   1627  C CB    . PRO A 1 218 ? 169.313 186.143 142.661 1.00 103.72 ? 218 PRO A CB    1 
ATOM   1628  C CG    . PRO A 1 218 ? 170.242 185.635 143.699 1.00 103.72 ? 218 PRO A CG    1 
ATOM   1629  C CD    . PRO A 1 218 ? 171.575 186.244 143.390 1.00 103.72 ? 218 PRO A CD    1 
ATOM   1630  N N     . THR A 1 219 ? 169.292 188.799 144.405 1.00 107.72 ? 219 THR A N     1 
ATOM   1631  C CA    . THR A 1 219 ? 168.730 189.886 145.193 1.00 107.72 ? 219 THR A CA    1 
ATOM   1632  C C     . THR A 1 219 ? 169.840 190.876 145.508 1.00 107.72 ? 219 THR A C     1 
ATOM   1633  O O     . THR A 1 219 ? 170.939 190.474 145.902 1.00 107.72 ? 219 THR A O     1 
ATOM   1634  C CB    . THR A 1 219 ? 168.095 189.370 146.484 1.00 107.72 ? 219 THR A CB    1 
ATOM   1635  O OG1   . THR A 1 219 ? 169.092 188.715 147.277 1.00 107.72 ? 219 THR A OG1   1 
ATOM   1636  C CG2   . THR A 1 219 ? 166.980 188.390 146.171 1.00 107.72 ? 219 THR A CG2   1 
ATOM   1637  N N     . ALA A 1 220 ? 169.554 192.161 145.330 1.00 111.41 ? 220 ALA A N     1 
ATOM   1638  C CA    . ALA A 1 220 ? 170.580 193.177 145.485 1.00 111.41 ? 220 ALA A CA    1 
ATOM   1639  C C     . ALA A 1 220 ? 171.032 193.279 146.939 1.00 111.41 ? 220 ALA A C     1 
ATOM   1640  O O     . ALA A 1 220 ? 170.371 192.800 147.863 1.00 111.41 ? 220 ALA A O     1 
ATOM   1641  C CB    . ALA A 1 220 ? 170.072 194.530 144.993 1.00 111.41 ? 220 ALA A CB    1 
ATOM   1642  N N     . ALA A 1 221 ? 172.189 193.904 147.127 1.00 111.80 ? 221 ALA A N     1 
ATOM   1643  C CA    . ALA A 1 221 ? 172.783 194.093 148.444 1.00 111.80 ? 221 ALA A CA    1 
ATOM   1644  C C     . ALA A 1 221 ? 173.841 195.183 148.325 1.00 111.80 ? 221 ALA A C     1 
ATOM   1645  O O     . ALA A 1 221 ? 173.907 195.898 147.319 1.00 111.80 ? 221 ALA A O     1 
ATOM   1646  C CB    . ALA A 1 221 ? 173.363 192.782 148.980 1.00 111.80 ? 221 ALA A CB    1 
ATOM   1647  N N     . ILE A 1 222 ? 174.668 195.319 149.356 1.00 107.99 ? 222 ILE A N     1 
ATOM   1648  C CA    . ILE A 1 222 ? 175.757 196.285 149.366 1.00 107.99 ? 222 ILE A CA    1 
ATOM   1649  C C     . ILE A 1 222 ? 177.045 195.557 149.719 1.00 107.99 ? 222 ILE A C     1 
ATOM   1650  O O     . ILE A 1 222 ? 177.066 194.717 150.625 1.00 107.99 ? 222 ILE A O     1 
ATOM   1651  C CB    . ILE A 1 222 ? 175.483 197.436 150.354 1.00 107.99 ? 222 ILE A CB    1 
ATOM   1652  C CG1   . ILE A 1 222 ? 174.217 198.189 149.945 1.00 107.99 ? 222 ILE A CG1   1 
ATOM   1653  C CG2   . ILE A 1 222 ? 176.660 198.393 150.403 1.00 107.99 ? 222 ILE A CG2   1 
ATOM   1654  C CD1   . ILE A 1 222 ? 173.723 199.163 150.988 1.00 107.99 ? 222 ILE A CD1   1 
ATOM   1655  N N     . ILE A 1 223 ? 178.117 195.875 148.999 1.00 105.21 ? 223 ILE A N     1 
ATOM   1656  C CA    . ILE A 1 223 ? 179.421 195.256 149.194 1.00 105.21 ? 223 ILE A CA    1 
ATOM   1657  C C     . ILE A 1 223 ? 180.405 196.331 149.630 1.00 105.21 ? 223 ILE A C     1 
ATOM   1658  O O     . ILE A 1 223 ? 180.414 197.436 149.077 1.00 105.21 ? 223 ILE A O     1 
ATOM   1659  C CB    . ILE A 1 223 ? 179.902 194.554 147.910 1.00 105.21 ? 223 ILE A CB    1 
ATOM   1660  C CG1   . ILE A 1 223 ? 178.924 193.447 147.525 1.00 105.21 ? 223 ILE A CG1   1 
ATOM   1661  C CG2   . ILE A 1 223 ? 181.290 193.982 148.100 1.00 105.21 ? 223 ILE A CG2   1 
ATOM   1662  C CD1   . ILE A 1 223 ? 179.168 192.876 146.153 1.00 105.21 ? 223 ILE A CD1   1 
ATOM   1663  N N     . ASN A 1 224 ? 181.238 196.004 150.618 1.00 108.45 ? 224 ASN A N     1 
ATOM   1664  C CA    . ASN A 1 224 ? 182.129 196.978 151.239 1.00 108.45 ? 224 ASN A CA    1 
ATOM   1665  C C     . ASN A 1 224 ? 183.571 196.875 150.755 1.00 108.45 ? 224 ASN A C     1 
ATOM   1666  O O     . ASN A 1 224 ? 184.135 197.864 150.278 1.00 108.45 ? 224 ASN A O     1 
ATOM   1667  C CB    . ASN A 1 224 ? 182.089 196.820 152.763 1.00 108.45 ? 224 ASN A CB    1 
ATOM   1668  C CG    . ASN A 1 224 ? 180.779 197.279 153.361 1.00 108.45 ? 224 ASN A CG    1 
ATOM   1669  O OD1   . ASN A 1 224 ? 180.235 198.311 152.972 1.00 108.45 ? 224 ASN A OD1   1 
ATOM   1670  N ND2   . ASN A 1 224 ? 180.263 196.514 154.312 1.00 108.45 ? 224 ASN A ND2   1 
ATOM   1671  N N     . GLY A 1 225 ? 184.180 195.698 150.863 1.00 111.55 ? 225 GLY A N     1 
ATOM   1672  C CA    . GLY A 1 225 ? 185.607 195.567 150.637 1.00 111.55 ? 225 GLY A CA    1 
ATOM   1673  C C     . GLY A 1 225 ? 186.021 195.326 149.201 1.00 111.55 ? 225 GLY A C     1 
ATOM   1674  O O     . GLY A 1 225 ? 185.500 194.426 148.537 1.00 111.55 ? 225 GLY A O     1 
ATOM   1675  N N     . ARG A 1 226 ? 186.966 196.129 148.710 1.00 110.20 ? 226 ARG A N     1 
ATOM   1676  C CA    . ARG A 1 226 ? 187.490 195.915 147.366 1.00 110.20 ? 226 ARG A CA    1 
ATOM   1677  C C     . ARG A 1 226 ? 188.685 194.972 147.381 1.00 110.20 ? 226 ARG A C     1 
ATOM   1678  O O     . ARG A 1 226 ? 188.956 194.291 146.386 1.00 110.20 ? 226 ARG A O     1 
ATOM   1679  C CB    . ARG A 1 226 ? 187.875 197.250 146.734 1.00 110.20 ? 226 ARG A CB    1 
ATOM   1680  C CG    . ARG A 1 226 ? 186.704 198.177 146.518 1.00 110.20 ? 226 ARG A CG    1 
ATOM   1681  C CD    . ARG A 1 226 ? 185.776 197.626 145.459 1.00 110.20 ? 226 ARG A CD    1 
ATOM   1682  N NE    . ARG A 1 226 ? 186.452 197.480 144.175 1.00 110.20 ? 226 ARG A NE    1 
ATOM   1683  C CZ    . ARG A 1 226 ? 186.563 198.453 143.277 1.00 110.20 ? 226 ARG A CZ    1 
ATOM   1684  N NH1   . ARG A 1 226 ? 187.196 198.233 142.134 1.00 110.20 ? 226 ARG A NH1   1 
ATOM   1685  N NH2   . ARG A 1 226 ? 186.039 199.646 143.523 1.00 110.20 ? 226 ARG A NH2   1 
ATOM   1686  N N     . ARG A 1 227 ? 189.416 194.928 148.497 1.00 120.62 ? 227 ARG A N     1 
ATOM   1687  C CA    . ARG A 1 227 ? 190.599 194.078 148.577 1.00 120.62 ? 227 ARG A CA    1 
ATOM   1688  C C     . ARG A 1 227 ? 190.244 192.612 148.369 1.00 120.62 ? 227 ARG A C     1 
ATOM   1689  O O     . ARG A 1 227 ? 190.981 191.874 147.703 1.00 120.62 ? 227 ARG A O     1 
ATOM   1690  C CB    . ARG A 1 227 ? 191.293 194.273 149.926 1.00 120.62 ? 227 ARG A CB    1 
ATOM   1691  C CG    . ARG A 1 227 ? 192.150 195.525 150.015 1.00 120.62 ? 227 ARG A CG    1 
ATOM   1692  C CD    . ARG A 1 227 ? 191.320 196.760 150.326 1.00 120.62 ? 227 ARG A CD    1 
ATOM   1693  N NE    . ARG A 1 227 ? 190.584 196.631 151.579 1.00 120.62 ? 227 ARG A NE    1 
ATOM   1694  C CZ    . ARG A 1 227 ? 191.091 196.915 152.774 1.00 120.62 ? 227 ARG A CZ    1 
ATOM   1695  N NH1   . ARG A 1 227 ? 192.340 197.345 152.881 1.00 120.62 ? 227 ARG A NH1   1 
ATOM   1696  N NH2   . ARG A 1 227 ? 190.349 196.770 153.863 1.00 120.62 ? 227 ARG A NH2   1 
ATOM   1697  N N     . GLY A 1 228 ? 189.111 192.177 148.921 1.00 111.90 ? 228 GLY A N     1 
ATOM   1698  C CA    . GLY A 1 228 ? 188.757 190.770 148.846 1.00 111.90 ? 228 GLY A CA    1 
ATOM   1699  C C     . GLY A 1 228 ? 188.555 190.291 147.423 1.00 111.90 ? 228 GLY A C     1 
ATOM   1700  O O     . GLY A 1 228 ? 189.157 189.303 146.996 1.00 111.90 ? 228 GLY A O     1 
ATOM   1701  N N     . ILE A 1 229 ? 187.703 190.986 146.668 1.00 109.81 ? 229 ILE A N     1 
ATOM   1702  C CA    . ILE A 1 229 ? 187.407 190.544 145.311 1.00 109.81 ? 229 ILE A CA    1 
ATOM   1703  C C     . ILE A 1 229 ? 188.633 190.670 144.422 1.00 109.81 ? 229 ILE A C     1 
ATOM   1704  O O     . ILE A 1 229 ? 188.840 189.849 143.520 1.00 109.81 ? 229 ILE A O     1 
ATOM   1705  C CB    . ILE A 1 229 ? 186.210 191.324 144.741 1.00 109.81 ? 229 ILE A CB    1 
ATOM   1706  C CG1   . ILE A 1 229 ? 186.525 192.817 144.670 1.00 109.81 ? 229 ILE A CG1   1 
ATOM   1707  C CG2   . ILE A 1 229 ? 184.978 191.089 145.589 1.00 109.81 ? 229 ILE A CG2   1 
ATOM   1708  C CD1   . ILE A 1 229 ? 185.494 193.614 143.913 1.00 109.81 ? 229 ILE A CD1   1 
ATOM   1709  N N     . GLU A 1 230 ? 189.473 191.676 144.663 1.00 118.92 ? 230 GLU A N     1 
ATOM   1710  C CA    . GLU A 1 230 ? 190.695 191.814 143.880 1.00 118.92 ? 230 GLU A CA    1 
ATOM   1711  C C     . GLU A 1 230 ? 191.625 190.635 144.122 1.00 118.92 ? 230 GLU A C     1 
ATOM   1712  O O     . GLU A 1 230 ? 192.129 190.018 143.175 1.00 118.92 ? 230 GLU A O     1 
ATOM   1713  C CB    . GLU A 1 230 ? 191.385 193.134 144.222 1.00 118.92 ? 230 GLU A CB    1 
ATOM   1714  C CG    . GLU A 1 230 ? 192.532 193.502 143.298 1.00 118.92 ? 230 GLU A CG    1 
ATOM   1715  C CD    . GLU A 1 230 ? 193.843 192.860 143.707 1.00 118.92 ? 230 GLU A CD    1 
ATOM   1716  O OE1   . GLU A 1 230 ? 194.019 192.586 144.912 1.00 118.92 ? 230 GLU A OE1   1 
ATOM   1717  O OE2   . GLU A 1 230 ? 194.696 192.632 142.824 1.00 118.92 ? 230 GLU A OE2   1 
ATOM   1718  N N     . GLU A 1 231 ? 191.864 190.306 145.394 1.00 124.88 ? 231 GLU A N     1 
ATOM   1719  C CA    . GLU A 1 231 ? 192.718 189.168 145.710 1.00 124.88 ? 231 GLU A CA    1 
ATOM   1720  C C     . GLU A 1 231 ? 192.127 187.873 145.172 1.00 124.88 ? 231 GLU A C     1 
ATOM   1721  O O     . GLU A 1 231 ? 192.863 186.980 144.735 1.00 124.88 ? 231 GLU A O     1 
ATOM   1722  C CB    . GLU A 1 231 ? 192.931 189.075 147.219 1.00 124.88 ? 231 GLU A CB    1 
ATOM   1723  C CG    . GLU A 1 231 ? 193.871 187.959 147.644 1.00 124.88 ? 231 GLU A CG    1 
ATOM   1724  C CD    . GLU A 1 231 ? 194.112 187.936 149.141 1.00 124.88 ? 231 GLU A CD    1 
ATOM   1725  O OE1   . GLU A 1 231 ? 193.534 188.786 149.851 1.00 124.88 ? 231 GLU A OE1   1 
ATOM   1726  O OE2   . GLU A 1 231 ? 194.879 187.068 149.608 1.00 124.88 ? 231 GLU A OE2   1 
ATOM   1727  N N     . ALA A 1 232 ? 190.799 187.758 145.178 1.00 115.92 ? 232 ALA A N     1 
ATOM   1728  C CA    . ALA A 1 232 ? 190.163 186.542 144.683 1.00 115.92 ? 232 ALA A CA    1 
ATOM   1729  C C     . ALA A 1 232 ? 190.349 186.399 143.179 1.00 115.92 ? 232 ALA A C     1 
ATOM   1730  O O     . ALA A 1 232 ? 190.724 185.328 142.689 1.00 115.92 ? 232 ALA A O     1 
ATOM   1731  C CB    . ALA A 1 232 ? 188.679 186.541 145.048 1.00 115.92 ? 232 ALA A CB    1 
ATOM   1732  N N     . TYR A 1 233 ? 190.093 187.471 142.426 1.00 111.85 ? 233 TYR A N     1 
ATOM   1733  C CA    . TYR A 1 233 ? 190.273 187.409 140.981 1.00 111.85 ? 233 TYR A CA    1 
ATOM   1734  C C     . TYR A 1 233 ? 191.732 187.208 140.601 1.00 111.85 ? 233 TYR A C     1 
ATOM   1735  O O     . TYR A 1 233 ? 192.022 186.562 139.588 1.00 111.85 ? 233 TYR A O     1 
ATOM   1736  C CB    . TYR A 1 233 ? 189.733 188.675 140.318 1.00 111.85 ? 233 TYR A CB    1 
ATOM   1737  C CG    . TYR A 1 233 ? 188.228 188.774 140.314 1.00 111.85 ? 233 TYR A CG    1 
ATOM   1738  C CD1   . TYR A 1 233 ? 187.440 187.675 140.617 1.00 111.85 ? 233 TYR A CD1   1 
ATOM   1739  C CD2   . TYR A 1 233 ? 187.594 189.965 139.994 1.00 111.85 ? 233 TYR A CD2   1 
ATOM   1740  C CE1   . TYR A 1 233 ? 186.064 187.761 140.611 1.00 111.85 ? 233 TYR A CE1   1 
ATOM   1741  C CE2   . TYR A 1 233 ? 186.218 190.060 139.985 1.00 111.85 ? 233 TYR A CE2   1 
ATOM   1742  C CZ    . TYR A 1 233 ? 185.458 188.956 140.294 1.00 111.85 ? 233 TYR A CZ    1 
ATOM   1743  O OH    . TYR A 1 233 ? 184.086 189.046 140.286 1.00 111.85 ? 233 TYR A OH    1 
ATOM   1744  N N     . ARG A 1 234 ? 192.664 187.743 141.390 1.00 113.80 ? 234 ARG A N     1 
ATOM   1745  C CA    . ARG A 1 234 ? 194.066 187.638 141.011 1.00 113.80 ? 234 ARG A CA    1 
ATOM   1746  C C     . ARG A 1 234 ? 194.655 186.280 141.379 1.00 113.80 ? 234 ARG A C     1 
ATOM   1747  O O     . ARG A 1 234 ? 195.410 185.698 140.593 1.00 113.80 ? 234 ARG A O     1 
ATOM   1748  C CB    . ARG A 1 234 ? 194.866 188.766 141.659 1.00 113.80 ? 234 ARG A CB    1 
ATOM   1749  C CG    . ARG A 1 234 ? 196.326 188.800 141.260 1.00 113.80 ? 234 ARG A CG    1 
ATOM   1750  C CD    . ARG A 1 234 ? 197.031 189.972 141.911 1.00 113.80 ? 234 ARG A CD    1 
ATOM   1751  N NE    . ARG A 1 234 ? 196.992 189.881 143.366 1.00 113.80 ? 234 ARG A NE    1 
ATOM   1752  C CZ    . ARG A 1 234 ? 197.835 189.155 144.090 1.00 113.80 ? 234 ARG A CZ    1 
ATOM   1753  N NH1   . ARG A 1 234 ? 198.789 188.454 143.493 1.00 113.80 ? 234 ARG A NH1   1 
ATOM   1754  N NH2   . ARG A 1 234 ? 197.725 189.129 145.410 1.00 113.80 ? 234 ARG A NH2   1 
ATOM   1755  N N     . THR A 1 235 ? 194.323 185.757 142.558 1.00 113.91 ? 235 THR A N     1 
ATOM   1756  C CA    . THR A 1 235 ? 194.909 184.518 143.051 1.00 113.91 ? 235 THR A CA    1 
ATOM   1757  C C     . THR A 1 235 ? 193.937 183.348 142.974 1.00 113.91 ? 235 THR A C     1 
ATOM   1758  O O     . THR A 1 235 ? 194.256 182.315 142.382 1.00 113.91 ? 235 THR A O     1 
ATOM   1759  C CB    . THR A 1 235 ? 195.391 184.706 144.494 1.00 113.91 ? 235 THR A CB    1 
ATOM   1760  O OG1   . THR A 1 235 ? 194.271 185.014 145.333 1.00 113.91 ? 235 THR A OG1   1 
ATOM   1761  C CG2   . THR A 1 235 ? 196.396 185.841 144.571 1.00 113.91 ? 235 THR A CG2   1 
ATOM   1762  N N     . GLY A 1 236 ? 192.756 183.481 143.567 1.00 109.62 ? 236 GLY A N     1 
ATOM   1763  C CA    . GLY A 1 236 ? 191.796 182.397 143.567 1.00 109.62 ? 236 GLY A CA    1 
ATOM   1764  C C     . GLY A 1 236 ? 191.113 182.212 144.905 1.00 109.62 ? 236 GLY A C     1 
ATOM   1765  O O     . GLY A 1 236 ? 190.167 181.428 145.023 1.00 109.62 ? 236 GLY A O     1 
ATOM   1766  N N     . ARG A 1 237 ? 191.584 182.926 145.922 1.00 108.37 ? 237 ARG A N     1 
ATOM   1767  C CA    . ARG A 1 237 ? 191.004 182.864 147.254 1.00 108.37 ? 237 ARG A CA    1 
ATOM   1768  C C     . ARG A 1 237 ? 190.812 184.273 147.793 1.00 108.37 ? 237 ARG A C     1 
ATOM   1769  O O     . ARG A 1 237 ? 191.558 185.194 147.450 1.00 108.37 ? 237 ARG A O     1 
ATOM   1770  C CB    . ARG A 1 237 ? 191.881 182.055 148.212 1.00 108.37 ? 237 ARG A CB    1 
ATOM   1771  C CG    . ARG A 1 237 ? 191.976 180.584 147.863 1.00 108.37 ? 237 ARG A CG    1 
ATOM   1772  C CD    . ARG A 1 237 ? 192.911 179.856 148.810 1.00 108.37 ? 237 ARG A CD    1 
ATOM   1773  N NE    . ARG A 1 237 ? 192.400 179.839 150.176 1.00 108.37 ? 237 ARG A NE    1 
ATOM   1774  C CZ    . ARG A 1 237 ? 191.590 178.903 150.657 1.00 108.37 ? 237 ARG A CZ    1 
ATOM   1775  N NH1   . ARG A 1 237 ? 191.198 177.903 149.881 1.00 108.37 ? 237 ARG A NH1   1 
ATOM   1776  N NH2   . ARG A 1 237 ? 191.173 178.964 151.914 1.00 108.37 ? 237 ARG A NH2   1 
ATOM   1777  N N     . GLY A 1 238 ? 189.802 184.432 148.637 1.00 103.47 ? 238 GLY A N     1 
ATOM   1778  C CA    . GLY A 1 238 ? 189.521 185.725 149.232 1.00 103.47 ? 238 GLY A CA    1 
ATOM   1779  C C     . GLY A 1 238 ? 188.188 185.689 149.942 1.00 103.47 ? 238 GLY A C     1 
ATOM   1780  O O     . GLY A 1 238 ? 187.418 184.730 149.825 1.00 103.47 ? 238 GLY A O     1 
ATOM   1781  N N     . LYS A 1 239 ? 187.925 186.760 150.685 1.00 104.12 ? 239 LYS A N     1 
ATOM   1782  C CA    . LYS A 1 239 ? 186.684 186.910 151.427 1.00 104.12 ? 239 LYS A CA    1 
ATOM   1783  C C     . LYS A 1 239 ? 186.029 188.233 151.063 1.00 104.12 ? 239 LYS A C     1 
ATOM   1784  O O     . LYS A 1 239 ? 186.704 189.200 150.705 1.00 104.12 ? 239 LYS A O     1 
ATOM   1785  C CB    . LYS A 1 239 ? 186.916 186.851 152.936 1.00 104.12 ? 239 LYS A CB    1 
ATOM   1786  C CG    . LYS A 1 239 ? 187.286 185.478 153.454 1.00 104.12 ? 239 LYS A CG    1 
ATOM   1787  C CD    . LYS A 1 239 ? 187.644 185.542 154.926 1.00 104.12 ? 239 LYS A CD    1 
ATOM   1788  C CE    . LYS A 1 239 ? 186.422 185.850 155.769 1.00 104.12 ? 239 LYS A CE    1 
ATOM   1789  N NZ    . LYS A 1 239 ? 186.730 185.806 157.222 1.00 104.12 ? 239 LYS A NZ    1 
ATOM   1790  N N     . VAL A 1 240 ? 184.704 188.265 151.162 1.00 97.49  ? 240 VAL A N     1 
ATOM   1791  C CA    . VAL A 1 240 ? 183.927 189.450 150.828 1.00 97.49  ? 240 VAL A CA    1 
ATOM   1792  C C     . VAL A 1 240 ? 182.754 189.546 151.793 1.00 97.49  ? 240 VAL A C     1 
ATOM   1793  O O     . VAL A 1 240 ? 182.214 188.534 152.248 1.00 97.49  ? 240 VAL A O     1 
ATOM   1794  C CB    . VAL A 1 240 ? 183.451 189.417 149.358 1.00 97.49  ? 240 VAL A CB    1 
ATOM   1795  C CG1   . VAL A 1 240 ? 182.488 188.266 149.130 1.00 97.49  ? 240 VAL A CG1   1 
ATOM   1796  C CG2   . VAL A 1 240 ? 182.817 190.737 148.965 1.00 97.49  ? 240 VAL A CG2   1 
ATOM   1797  N N     . TYR A 1 241 ? 182.374 190.776 152.121 1.00 96.93  ? 241 TYR A N     1 
ATOM   1798  C CA    . TYR A 1 241 ? 181.280 191.033 153.042 1.00 96.93  ? 241 TYR A CA    1 
ATOM   1799  C C     . TYR A 1 241 ? 180.026 191.441 152.280 1.00 96.93  ? 241 TYR A C     1 
ATOM   1800  O O     . TYR A 1 241 ? 180.096 192.084 151.230 1.00 96.93  ? 241 TYR A O     1 
ATOM   1801  C CB    . TYR A 1 241 ? 181.658 192.128 154.039 1.00 96.93  ? 241 TYR A CB    1 
ATOM   1802  C CG    . TYR A 1 241 ? 182.757 191.726 154.989 1.00 96.93  ? 241 TYR A CG    1 
ATOM   1803  C CD1   . TYR A 1 241 ? 182.481 190.979 156.123 1.00 96.93  ? 241 TYR A CD1   1 
ATOM   1804  C CD2   . TYR A 1 241 ? 184.074 192.085 154.745 1.00 96.93  ? 241 TYR A CD2   1 
ATOM   1805  C CE1   . TYR A 1 241 ? 183.484 190.608 156.993 1.00 96.93  ? 241 TYR A CE1   1 
ATOM   1806  C CE2   . TYR A 1 241 ? 185.084 191.719 155.608 1.00 96.93  ? 241 TYR A CE2   1 
ATOM   1807  C CZ    . TYR A 1 241 ? 184.784 190.981 156.730 1.00 96.93  ? 241 TYR A CZ    1 
ATOM   1808  O OH    . TYR A 1 241 ? 185.788 190.612 157.594 1.00 96.93  ? 241 TYR A OH    1 
ATOM   1809  N N     . ILE A 1 242 ? 178.875 191.059 152.823 1.00 94.16  ? 242 ILE A N     1 
ATOM   1810  C CA    . ILE A 1 242 ? 177.577 191.398 152.255 1.00 94.16  ? 242 ILE A CA    1 
ATOM   1811  C C     . ILE A 1 242 ? 176.779 192.142 153.314 1.00 94.16  ? 242 ILE A C     1 
ATOM   1812  O O     . ILE A 1 242 ? 176.647 191.664 154.446 1.00 94.16  ? 242 ILE A O     1 
ATOM   1813  C CB    . ILE A 1 242 ? 176.818 190.147 151.783 1.00 94.16  ? 242 ILE A CB    1 
ATOM   1814  C CG1   . ILE A 1 242 ? 177.647 189.383 150.753 1.00 94.16  ? 242 ILE A CG1   1 
ATOM   1815  C CG2   . ILE A 1 242 ? 175.479 190.536 151.196 1.00 94.16  ? 242 ILE A CG2   1 
ATOM   1816  C CD1   . ILE A 1 242 ? 177.955 190.182 149.516 1.00 94.16  ? 242 ILE A CD1   1 
ATOM   1817  N N     . ARG A 1 243 ? 176.248 193.304 152.948 1.00 105.68 ? 243 ARG A N     1 
ATOM   1818  C CA    . ARG A 1 243 ? 175.513 194.157 153.870 1.00 105.68 ? 243 ARG A CA    1 
ATOM   1819  C C     . ARG A 1 243 ? 174.135 194.452 153.301 1.00 105.68 ? 243 ARG A C     1 
ATOM   1820  O O     . ARG A 1 243 ? 174.008 194.810 152.125 1.00 105.68 ? 243 ARG A O     1 
ATOM   1821  C CB    . ARG A 1 243 ? 176.264 195.462 154.129 1.00 105.68 ? 243 ARG A CB    1 
ATOM   1822  C CG    . ARG A 1 243 ? 175.644 196.327 155.206 1.00 105.68 ? 243 ARG A CG    1 
ATOM   1823  C CD    . ARG A 1 243 ? 176.456 197.591 155.411 1.00 105.68 ? 243 ARG A CD    1 
ATOM   1824  N NE    . ARG A 1 243 ? 177.816 197.282 155.834 1.00 105.68 ? 243 ARG A NE    1 
ATOM   1825  C CZ    . ARG A 1 243 ? 178.165 197.015 157.087 1.00 105.68 ? 243 ARG A CZ    1 
ATOM   1826  N NH1   . ARG A 1 243 ? 179.427 196.742 157.382 1.00 105.68 ? 243 ARG A NH1   1 
ATOM   1827  N NH2   . ARG A 1 243 ? 177.252 197.013 158.046 1.00 105.68 ? 243 ARG A NH2   1 
ATOM   1828  N N     . ALA A 1 244 ? 173.111 194.308 154.135 1.00 99.19  ? 244 ALA A N     1 
ATOM   1829  C CA    . ALA A 1 244 ? 171.753 194.581 153.702 1.00 99.19  ? 244 ALA A CA    1 
ATOM   1830  C C     . ALA A 1 244 ? 171.537 196.084 153.550 1.00 99.19  ? 244 ALA A C     1 
ATOM   1831  O O     . ALA A 1 244 ? 172.356 196.907 153.967 1.00 99.19  ? 244 ALA A O     1 
ATOM   1832  C CB    . ALA A 1 244 ? 170.749 193.994 154.690 1.00 99.19  ? 244 ALA A CB    1 
ATOM   1833  N N     . ARG A 1 245 ? 170.412 196.440 152.939 1.00 113.39 ? 245 ARG A N     1 
ATOM   1834  C CA    . ARG A 1 245 ? 170.046 197.830 152.711 1.00 113.39 ? 245 ARG A CA    1 
ATOM   1835  C C     . ARG A 1 245 ? 168.963 198.239 153.697 1.00 113.39 ? 245 ARG A C     1 
ATOM   1836  O O     . ARG A 1 245 ? 167.903 197.607 153.758 1.00 113.39 ? 245 ARG A O     1 
ATOM   1837  C CB    . ARG A 1 245 ? 169.558 198.046 151.279 1.00 113.39 ? 245 ARG A CB    1 
ATOM   1838  C CG    . ARG A 1 245 ? 169.274 199.499 150.951 1.00 113.39 ? 245 ARG A CG    1 
ATOM   1839  C CD    . ARG A 1 245 ? 168.809 199.661 149.518 1.00 113.39 ? 245 ARG A CD    1 
ATOM   1840  N NE    . ARG A 1 245 ? 169.847 199.282 148.565 1.00 113.39 ? 245 ARG A NE    1 
ATOM   1841  C CZ    . ARG A 1 245 ? 170.828 200.086 148.171 1.00 113.39 ? 245 ARG A CZ    1 
ATOM   1842  N NH1   . ARG A 1 245 ? 170.911 201.319 148.651 1.00 113.39 ? 245 ARG A NH1   1 
ATOM   1843  N NH2   . ARG A 1 245 ? 171.729 199.657 147.299 1.00 113.39 ? 245 ARG A NH2   1 
ATOM   1844  N N     . ALA A 1 246 ? 169.229 199.295 154.457 1.00 122.65 ? 246 ALA A N     1 
ATOM   1845  C CA    . ALA A 1 246 ? 168.273 199.803 155.430 1.00 122.65 ? 246 ALA A CA    1 
ATOM   1846  C C     . ALA A 1 246 ? 168.563 201.276 155.664 1.00 122.65 ? 246 ALA A C     1 
ATOM   1847  O O     . ALA A 1 246 ? 169.595 201.801 155.241 1.00 122.65 ? 246 ALA A O     1 
ATOM   1848  C CB    . ALA A 1 246 ? 168.333 199.014 156.740 1.00 122.65 ? 246 ALA A CB    1 
ATOM   1849  N N     . GLU A 1 247 ? 167.636 201.939 156.349 1.00 142.03 ? 247 GLU A N     1 
ATOM   1850  C CA    . GLU A 1 247 ? 167.779 203.358 156.636 1.00 142.03 ? 247 GLU A CA    1 
ATOM   1851  C C     . GLU A 1 247 ? 166.854 203.722 157.787 1.00 142.03 ? 247 GLU A C     1 
ATOM   1852  O O     . GLU A 1 247 ? 165.996 202.936 158.197 1.00 142.03 ? 247 GLU A O     1 
ATOM   1853  C CB    . GLU A 1 247 ? 167.473 204.211 155.404 1.00 142.03 ? 247 GLU A CB    1 
ATOM   1854  C CG    . GLU A 1 247 ? 166.026 204.140 154.952 1.00 142.03 ? 247 GLU A CG    1 
ATOM   1855  C CD    . GLU A 1 247 ? 165.769 204.949 153.698 1.00 142.03 ? 247 GLU A CD    1 
ATOM   1856  O OE1   . GLU A 1 247 ? 166.730 205.541 153.164 1.00 142.03 ? 247 GLU A OE1   1 
ATOM   1857  O OE2   . GLU A 1 247 ? 164.606 204.997 153.248 1.00 142.03 ? 247 GLU A OE2   1 
ATOM   1858  N N     . VAL A 1 248 ? 167.043 204.930 158.303 1.00 149.46 ? 248 VAL A N     1 
ATOM   1859  C CA    . VAL A 1 248 ? 166.211 205.447 159.376 1.00 149.46 ? 248 VAL A CA    1 
ATOM   1860  C C     . VAL A 1 248 ? 165.054 206.230 158.772 1.00 149.46 ? 248 VAL A C     1 
ATOM   1861  O O     . VAL A 1 248 ? 165.102 206.677 157.624 1.00 149.46 ? 248 VAL A O     1 
ATOM   1862  C CB    . VAL A 1 248 ? 167.023 206.325 160.346 1.00 149.46 ? 248 VAL A CB    1 
ATOM   1863  C CG1   . VAL A 1 248 ? 168.158 205.525 160.962 1.00 149.46 ? 248 VAL A CG1   1 
ATOM   1864  C CG2   . VAL A 1 248 ? 167.552 207.553 159.627 1.00 149.46 ? 248 VAL A CG2   1 
ATOM   1865  N N     . GLU A 1 249 ? 163.997 206.406 159.562 1.00 155.77 ? 249 GLU A N     1 
ATOM   1866  C CA    . GLU A 1 249 ? 162.846 207.185 159.115 1.00 155.77 ? 249 GLU A CA    1 
ATOM   1867  C C     . GLU A 1 249 ? 162.307 207.960 160.307 1.00 155.77 ? 249 GLU A C     1 
ATOM   1868  O O     . GLU A 1 249 ? 162.175 207.400 161.400 1.00 155.77 ? 249 GLU A O     1 
ATOM   1869  C CB    . GLU A 1 249 ? 161.768 206.290 158.524 1.00 155.77 ? 249 GLU A CB    1 
ATOM   1870  C CG    . GLU A 1 249 ? 160.598 207.076 157.954 1.00 155.77 ? 249 GLU A CG    1 
ATOM   1871  C CD    . GLU A 1 249 ? 159.479 206.188 157.460 1.00 155.77 ? 249 GLU A CD    1 
ATOM   1872  O OE1   . GLU A 1 249 ? 159.576 204.958 157.635 1.00 155.77 ? 249 GLU A OE1   1 
ATOM   1873  O OE2   . GLU A 1 249 ? 158.501 206.718 156.893 1.00 155.77 ? 249 GLU A OE2   1 
ATOM   1874  N N     . VAL A 1 250 ? 162.003 209.237 160.097 1.00 168.00 ? 250 VAL A N     1 
ATOM   1875  C CA    . VAL A 1 250 ? 161.347 210.074 161.091 1.00 168.00 ? 250 VAL A CA    1 
ATOM   1876  C C     . VAL A 1 250 ? 160.202 210.800 160.404 1.00 168.00 ? 250 VAL A C     1 
ATOM   1877  O O     . VAL A 1 250 ? 160.395 211.406 159.344 1.00 168.00 ? 250 VAL A O     1 
ATOM   1878  C CB    . VAL A 1 250 ? 162.322 211.079 161.730 1.00 168.00 ? 250 VAL A CB    1 
ATOM   1879  C CG1   . VAL A 1 250 ? 161.589 211.968 162.722 1.00 168.00 ? 250 VAL A CG1   1 
ATOM   1880  C CG2   . VAL A 1 250 ? 163.475 210.355 162.401 1.00 168.00 ? 250 VAL A CG2   1 
ATOM   1881  N N     . ASP A 1 251 ? 159.016 210.731 160.999 1.00 180.19 ? 251 ASP A N     1 
ATOM   1882  C CA    . ASP A 1 251 ? 157.873 211.442 160.447 1.00 180.19 ? 251 ASP A CA    1 
ATOM   1883  C C     . ASP A 1 251 ? 158.096 212.947 160.536 1.00 180.19 ? 251 ASP A C     1 
ATOM   1884  O O     . ASP A 1 251 ? 158.851 213.438 161.380 1.00 180.19 ? 251 ASP A O     1 
ATOM   1885  C CB    . ASP A 1 251 ? 156.594 211.053 161.187 1.00 180.19 ? 251 ASP A CB    1 
ATOM   1886  C CG    . ASP A 1 251 ? 156.179 209.622 160.915 1.00 180.19 ? 251 ASP A CG    1 
ATOM   1887  O OD1   . ASP A 1 251 ? 156.475 209.115 159.812 1.00 180.19 ? 251 ASP A OD1   1 
ATOM   1888  O OD2   . ASP A 1 251 ? 155.559 209.002 161.804 1.00 180.19 ? 251 ASP A OD2   1 
ATOM   1889  N N     . ALA A 1 252 ? 157.437 213.683 159.638 1.00 183.83 ? 252 ALA A N     1 
ATOM   1890  C CA    . ALA A 1 252 ? 157.563 215.136 159.641 1.00 183.83 ? 252 ALA A CA    1 
ATOM   1891  C C     . ALA A 1 252 ? 157.109 215.726 160.969 1.00 183.83 ? 252 ALA A C     1 
ATOM   1892  O O     . ALA A 1 252 ? 157.642 216.747 161.420 1.00 183.83 ? 252 ALA A O     1 
ATOM   1893  C CB    . ALA A 1 252 ? 156.759 215.734 158.488 1.00 183.83 ? 252 ALA A CB    1 
ATOM   1894  N N     . LYS A 1 253 ? 156.130 215.099 161.608 1.00 186.47 ? 253 LYS A N     1 
ATOM   1895  C CA    . LYS A 1 253 ? 155.631 215.522 162.908 1.00 186.47 ? 253 LYS A CA    1 
ATOM   1896  C C     . LYS A 1 253 ? 156.217 214.613 163.978 1.00 186.47 ? 253 LYS A C     1 
ATOM   1897  O O     . LYS A 1 253 ? 157.100 213.801 163.682 1.00 186.47 ? 253 LYS A O     1 
ATOM   1898  C CB    . LYS A 1 253 ? 154.105 215.515 162.934 1.00 186.47 ? 253 LYS A CB    1 
ATOM   1899  C CG    . LYS A 1 253 ? 153.527 216.490 161.928 1.00 186.47 ? 253 LYS A CG    1 
ATOM   1900  C CD    . LYS A 1 253 ? 153.927 217.914 162.296 1.00 186.47 ? 253 LYS A CD    1 
ATOM   1901  C CE    . LYS A 1 253 ? 153.371 218.932 161.319 1.00 186.47 ? 253 LYS A CE    1 
ATOM   1902  N NZ    . LYS A 1 253 ? 154.054 218.833 159.997 1.00 186.47 ? 253 LYS A NZ    1 
ATOM   1903  N N     . THR A 1 254 ? 155.729 214.765 165.211 1.00 182.97 ? 254 THR A N     1 
ATOM   1904  C CA    . THR A 1 254 ? 156.332 214.199 166.430 1.00 182.97 ? 254 THR A CA    1 
ATOM   1905  C C     . THR A 1 254 ? 156.736 212.745 166.178 1.00 182.97 ? 254 THR A C     1 
ATOM   1906  O O     . THR A 1 254 ? 157.942 212.463 166.177 1.00 182.97 ? 254 THR A O     1 
ATOM   1907  C CB    . THR A 1 254 ? 155.371 214.434 167.594 1.00 182.97 ? 254 THR A CB    1 
ATOM   1908  O OG1   . THR A 1 254 ? 155.890 213.821 168.782 1.00 182.97 ? 254 THR A OG1   1 
ATOM   1909  C CG2   . THR A 1 254 ? 153.966 213.916 167.283 1.00 182.97 ? 254 THR A CG2   1 
ATOM   1910  N N     . GLY A 1 255 ? 155.797 211.827 165.931 1.00 173.26 ? 255 GLY A N     1 
ATOM   1911  C CA    . GLY A 1 255 ? 156.095 210.444 165.596 1.00 173.26 ? 255 GLY A CA    1 
ATOM   1912  C C     . GLY A 1 255 ? 157.189 209.825 166.458 1.00 173.26 ? 255 GLY A C     1 
ATOM   1913  O O     . GLY A 1 255 ? 157.334 210.111 167.650 1.00 173.26 ? 255 GLY A O     1 
ATOM   1914  N N     . ARG A 1 256 ? 157.969 208.958 165.816 1.00 151.39 ? 256 ARG A N     1 
ATOM   1915  C CA    . ARG A 1 256 ? 159.173 208.392 166.405 1.00 151.39 ? 256 ARG A CA    1 
ATOM   1916  C C     . ARG A 1 256 ? 160.022 207.790 165.294 1.00 151.39 ? 256 ARG A C     1 
ATOM   1917  O O     . ARG A 1 256 ? 159.582 207.659 164.150 1.00 151.39 ? 256 ARG A O     1 
ATOM   1918  C CB    . ARG A 1 256 ? 158.854 207.337 167.473 1.00 151.39 ? 256 ARG A CB    1 
ATOM   1919  C CG    . ARG A 1 256 ? 158.187 206.086 166.940 1.00 151.39 ? 256 ARG A CG    1 
ATOM   1920  C CD    . ARG A 1 256 ? 157.961 205.080 168.056 1.00 151.39 ? 256 ARG A CD    1 
ATOM   1921  N NE    . ARG A 1 256 ? 157.012 205.571 169.049 1.00 151.39 ? 256 ARG A NE    1 
ATOM   1922  C CZ    . ARG A 1 256 ? 155.700 205.380 168.982 1.00 151.39 ? 256 ARG A CZ    1 
ATOM   1923  N NH1   . ARG A 1 256 ? 155.177 204.701 167.971 1.00 151.39 ? 256 ARG A NH1   1 
ATOM   1924  N NH2   . ARG A 1 256 ? 154.909 205.864 169.930 1.00 151.39 ? 256 ARG A NH2   1 
ATOM   1925  N N     . GLU A 1 257 ? 161.253 207.427 165.643 1.00 150.34 ? 257 GLU A N     1 
ATOM   1926  C CA    . GLU A 1 257 ? 162.186 206.901 164.657 1.00 150.34 ? 257 GLU A CA    1 
ATOM   1927  C C     . GLU A 1 257 ? 161.872 205.443 164.341 1.00 150.34 ? 257 GLU A C     1 
ATOM   1928  O O     . GLU A 1 257 ? 161.478 204.670 165.219 1.00 150.34 ? 257 GLU A O     1 
ATOM   1929  C CB    . GLU A 1 257 ? 163.617 207.037 165.166 1.00 150.34 ? 257 GLU A CB    1 
ATOM   1930  C CG    . GLU A 1 257 ? 164.041 208.477 165.384 1.00 150.34 ? 257 GLU A CG    1 
ATOM   1931  C CD    . GLU A 1 257 ? 165.455 208.598 165.902 1.00 150.34 ? 257 GLU A CD    1 
ATOM   1932  O OE1   . GLU A 1 257 ? 166.071 207.553 166.194 1.00 150.34 ? 257 GLU A OE1   1 
ATOM   1933  O OE2   . GLU A 1 257 ? 165.949 209.738 166.021 1.00 150.34 ? 257 GLU A OE2   1 
ATOM   1934  N N     . THR A 1 258 ? 162.052 205.068 163.077 1.00 143.24 ? 258 THR A N     1 
ATOM   1935  C CA    . THR A 1 258 ? 161.680 203.743 162.606 1.00 143.24 ? 258 THR A CA    1 
ATOM   1936  C C     . THR A 1 258 ? 162.658 203.306 161.523 1.00 143.24 ? 258 THR A C     1 
ATOM   1937  O O     . THR A 1 258 ? 163.185 204.124 160.766 1.00 143.24 ? 258 THR A O     1 
ATOM   1938  C CB    . THR A 1 258 ? 160.237 203.736 162.078 1.00 143.24 ? 258 THR A CB    1 
ATOM   1939  O OG1   . THR A 1 258 ? 159.359 204.246 163.088 1.00 143.24 ? 258 THR A OG1   1 
ATOM   1940  C CG2   . THR A 1 258 ? 159.792 202.329 161.731 1.00 143.24 ? 258 THR A CG2   1 
ATOM   1941  N N     . ILE A 1 259 ? 162.898 201.998 161.458 1.00 132.75 ? 259 ILE A N     1 
ATOM   1942  C CA    . ILE A 1 259 ? 163.846 201.401 160.524 1.00 132.75 ? 259 ILE A CA    1 
ATOM   1943  C C     . ILE A 1 259 ? 163.070 200.616 159.478 1.00 132.75 ? 259 ILE A C     1 
ATOM   1944  O O     . ILE A 1 259 ? 162.098 199.925 159.805 1.00 132.75 ? 259 ILE A O     1 
ATOM   1945  C CB    . ILE A 1 259 ? 164.851 200.494 161.254 1.00 132.75 ? 259 ILE A CB    1 
ATOM   1946  C CG1   . ILE A 1 259 ? 165.582 201.287 162.333 1.00 132.75 ? 259 ILE A CG1   1 
ATOM   1947  C CG2   . ILE A 1 259 ? 165.848 199.902 160.278 1.00 132.75 ? 259 ILE A CG2   1 
ATOM   1948  C CD1   . ILE A 1 259 ? 166.356 202.456 161.789 1.00 132.75 ? 259 ILE A CD1   1 
ATOM   1949  N N     . ILE A 1 260 ? 163.499 200.722 158.223 1.00 125.48 ? 260 ILE A N     1 
ATOM   1950  C CA    . ILE A 1 260 ? 162.919 199.974 157.114 1.00 125.48 ? 260 ILE A CA    1 
ATOM   1951  C C     . ILE A 1 260 ? 164.012 199.130 156.480 1.00 125.48 ? 260 ILE A C     1 
ATOM   1952  O O     . ILE A 1 260 ? 165.112 199.627 156.216 1.00 125.48 ? 260 ILE A O     1 
ATOM   1953  C CB    . ILE A 1 260 ? 162.283 200.903 156.065 1.00 125.48 ? 260 ILE A CB    1 
ATOM   1954  C CG1   . ILE A 1 260 ? 161.070 201.621 156.642 1.00 125.48 ? 260 ILE A CG1   1 
ATOM   1955  C CG2   . ILE A 1 260 ? 161.888 200.126 154.821 1.00 125.48 ? 260 ILE A CG2   1 
ATOM   1956  C CD1   . ILE A 1 260 ? 160.530 202.671 155.720 1.00 125.48 ? 260 ILE A CD1   1 
ATOM   1957  N N     . VAL A 1 261 ? 163.708 197.860 156.235 1.00 120.77 ? 261 VAL A N     1 
ATOM   1958  C CA    . VAL A 1 261 ? 164.603 196.949 155.537 1.00 120.77 ? 261 VAL A CA    1 
ATOM   1959  C C     . VAL A 1 261 ? 163.943 196.555 154.225 1.00 120.77 ? 261 VAL A C     1 
ATOM   1960  O O     . VAL A 1 261 ? 162.795 196.097 154.216 1.00 120.77 ? 261 VAL A O     1 
ATOM   1961  C CB    . VAL A 1 261 ? 164.923 195.705 156.383 1.00 120.77 ? 261 VAL A CB    1 
ATOM   1962  C CG1   . VAL A 1 261 ? 165.753 194.724 155.580 1.00 120.77 ? 261 VAL A CG1   1 
ATOM   1963  C CG2   . VAL A 1 261 ? 165.651 196.109 157.650 1.00 120.77 ? 261 VAL A CG2   1 
ATOM   1964  N N     . HIS A 1 262 ? 164.667 196.730 153.123 1.00 118.12 ? 262 HIS A N     1 
ATOM   1965  C CA    . HIS A 1 262 ? 164.137 196.451 151.795 1.00 118.12 ? 262 HIS A CA    1 
ATOM   1966  C C     . HIS A 1 262 ? 164.583 195.108 151.237 1.00 118.12 ? 262 HIS A C     1 
ATOM   1967  O O     . HIS A 1 262 ? 163.815 194.460 150.521 1.00 118.12 ? 262 HIS A O     1 
ATOM   1968  C CB    . HIS A 1 262 ? 164.544 197.559 150.822 1.00 118.12 ? 262 HIS A CB    1 
ATOM   1969  C CG    . HIS A 1 262 ? 163.920 198.884 151.125 1.00 118.12 ? 262 HIS A CG    1 
ATOM   1970  N ND1   . HIS A 1 262 ? 162.602 199.167 150.839 1.00 118.12 ? 262 HIS A ND1   1 
ATOM   1971  C CD2   . HIS A 1 262 ? 164.430 200.002 151.693 1.00 118.12 ? 262 HIS A CD2   1 
ATOM   1972  C CE1   . HIS A 1 262 ? 162.328 200.403 151.214 1.00 118.12 ? 262 HIS A CE1   1 
ATOM   1973  N NE2   . HIS A 1 262 ? 163.421 200.932 151.736 1.00 118.12 ? 262 HIS A NE2   1 
ATOM   1974  N N     . GLU A 1 263 ? 165.802 194.670 151.540 1.00 120.11 ? 263 GLU A N     1 
ATOM   1975  C CA    . GLU A 1 263 ? 166.321 193.440 150.960 1.00 120.11 ? 263 GLU A CA    1 
ATOM   1976  C C     . GLU A 1 263 ? 167.388 192.845 151.867 1.00 120.11 ? 263 GLU A C     1 
ATOM   1977  O O     . GLU A 1 263 ? 168.193 193.571 152.456 1.00 120.11 ? 263 GLU A O     1 
ATOM   1978  C CB    . GLU A 1 263 ? 166.874 193.699 149.556 1.00 120.11 ? 263 GLU A CB    1 
ATOM   1979  C CG    . GLU A 1 263 ? 168.022 194.684 149.510 1.00 120.11 ? 263 GLU A CG    1 
ATOM   1980  C CD    . GLU A 1 263 ? 168.423 195.030 148.093 1.00 120.11 ? 263 GLU A CD    1 
ATOM   1981  O OE1   . GLU A 1 263 ? 167.772 194.522 147.157 1.00 120.11 ? 263 GLU A OE1   1 
ATOM   1982  O OE2   . GLU A 1 263 ? 169.386 195.806 147.916 1.00 120.11 ? 263 GLU A OE2   1 
ATOM   1983  N N     . ILE A 1 264 ? 167.383 191.520 151.971 1.00 98.80  ? 264 ILE A N     1 
ATOM   1984  C CA    . ILE A 1 264 ? 168.272 190.788 152.869 1.00 98.80  ? 264 ILE A CA    1 
ATOM   1985  C C     . ILE A 1 264 ? 169.445 190.227 152.074 1.00 98.80  ? 264 ILE A C     1 
ATOM   1986  O O     . ILE A 1 264 ? 169.381 190.170 150.839 1.00 98.80  ? 264 ILE A O     1 
ATOM   1987  C CB    . ILE A 1 264 ? 167.514 189.672 153.601 1.00 98.80  ? 264 ILE A CB    1 
ATOM   1988  C CG1   . ILE A 1 264 ? 166.912 188.693 152.595 1.00 98.80  ? 264 ILE A CG1   1 
ATOM   1989  C CG2   . ILE A 1 264 ? 166.451 190.257 154.508 1.00 98.80  ? 264 ILE A CG2   1 
ATOM   1990  C CD1   . ILE A 1 264 ? 166.343 187.448 153.228 1.00 98.80  ? 264 ILE A CD1   1 
ATOM   1991  N N     . PRO A 1 265 ? 170.528 189.810 152.726 1.00 93.71  ? 265 PRO A N     1 
ATOM   1992  C CA    . PRO A 1 265 ? 171.667 189.255 151.989 1.00 93.71  ? 265 PRO A CA    1 
ATOM   1993  C C     . PRO A 1 265 ? 171.330 187.942 151.301 1.00 93.71  ? 265 PRO A C     1 
ATOM   1994  O O     . PRO A 1 265 ? 170.214 187.425 151.372 1.00 93.71  ? 265 PRO A O     1 
ATOM   1995  C CB    . PRO A 1 265 ? 172.724 189.046 153.076 1.00 93.71  ? 265 PRO A CB    1 
ATOM   1996  C CG    . PRO A 1 265 ? 172.359 190.005 154.138 1.00 93.71  ? 265 PRO A CG    1 
ATOM   1997  C CD    . PRO A 1 265 ? 170.865 190.048 154.139 1.00 93.71  ? 265 PRO A CD    1 
ATOM   1998  N N     . TYR A 1 266 ? 172.343 187.404 150.629 1.00 91.43  ? 266 TYR A N     1 
ATOM   1999  C CA    . TYR A 1 266 ? 172.175 186.213 149.810 1.00 91.43  ? 266 TYR A CA    1 
ATOM   2000  C C     . TYR A 1 266 ? 172.043 184.966 150.677 1.00 91.43  ? 266 TYR A C     1 
ATOM   2001  O O     . TYR A 1 266 ? 172.846 184.733 151.583 1.00 91.43  ? 266 TYR A O     1 
ATOM   2002  C CB    . TYR A 1 266 ? 173.370 186.091 148.863 1.00 91.43  ? 266 TYR A CB    1 
ATOM   2003  C CG    . TYR A 1 266 ? 173.329 184.939 147.891 1.00 91.43  ? 266 TYR A CG    1 
ATOM   2004  C CD1   . TYR A 1 266 ? 172.461 184.947 146.811 1.00 91.43  ? 266 TYR A CD1   1 
ATOM   2005  C CD2   . TYR A 1 266 ? 174.198 183.868 148.024 1.00 91.43  ? 266 TYR A CD2   1 
ATOM   2006  C CE1   . TYR A 1 266 ? 172.436 183.902 145.910 1.00 91.43  ? 266 TYR A CE1   1 
ATOM   2007  C CE2   . TYR A 1 266 ? 174.184 182.823 147.126 1.00 91.43  ? 266 TYR A CE2   1 
ATOM   2008  C CZ    . TYR A 1 266 ? 173.300 182.843 146.073 1.00 91.43  ? 266 TYR A CZ    1 
ATOM   2009  O OH    . TYR A 1 266 ? 173.283 181.800 145.178 1.00 91.43  ? 266 TYR A OH    1 
ATOM   2010  N N     . GLN A 1 267 ? 171.014 184.164 150.390 1.00 96.89  ? 267 GLN A N     1 
ATOM   2011  C CA    . GLN A 1 267 ? 170.774 182.887 151.072 1.00 96.89  ? 267 GLN A CA    1 
ATOM   2012  C C     . GLN A 1 267 ? 170.584 183.063 152.577 1.00 96.89  ? 267 GLN A C     1 
ATOM   2013  O O     . GLN A 1 267 ? 171.389 182.588 153.381 1.00 96.89  ? 267 GLN A O     1 
ATOM   2014  C CB    . GLN A 1 267 ? 171.899 181.889 150.793 1.00 96.89  ? 267 GLN A CB    1 
ATOM   2015  C CG    . GLN A 1 267 ? 171.940 181.380 149.371 1.00 96.89  ? 267 GLN A CG    1 
ATOM   2016  C CD    . GLN A 1 267 ? 173.074 180.405 149.143 1.00 96.89  ? 267 GLN A CD    1 
ATOM   2017  O OE1   . GLN A 1 267 ? 173.882 180.155 150.037 1.00 96.89  ? 267 GLN A OE1   1 
ATOM   2018  N NE2   . GLN A 1 267 ? 173.143 179.847 147.941 1.00 96.89  ? 267 GLN A NE2   1 
ATOM   2019  N N     . VAL A 1 268 ? 169.511 183.745 152.967 1.00 102.99 ? 268 VAL A N     1 
ATOM   2020  C CA    . VAL A 1 268 ? 169.162 183.931 154.370 1.00 102.99 ? 268 VAL A CA    1 
ATOM   2021  C C     . VAL A 1 268 ? 167.677 183.650 154.543 1.00 102.99 ? 268 VAL A C     1 
ATOM   2022  O O     . VAL A 1 268 ? 166.844 184.239 153.845 1.00 102.99 ? 268 VAL A O     1 
ATOM   2023  C CB    . VAL A 1 268 ? 169.502 185.350 154.859 1.00 102.99 ? 268 VAL A CB    1 
ATOM   2024  C CG1   . VAL A 1 268 ? 169.031 185.535 156.289 1.00 102.99 ? 268 VAL A CG1   1 
ATOM   2025  C CG2   . VAL A 1 268 ? 170.993 185.609 154.750 1.00 102.99 ? 268 VAL A CG2   1 
ATOM   2026  N N     . ASN A 1 269 ? 167.347 182.759 155.475 1.00 116.71 ? 269 ASN A N     1 
ATOM   2027  C CA    . ASN A 1 269 ? 165.952 182.492 155.800 1.00 116.71 ? 269 ASN A CA    1 
ATOM   2028  C C     . ASN A 1 269 ? 165.363 183.668 156.565 1.00 116.71 ? 269 ASN A C     1 
ATOM   2029  O O     . ASN A 1 269 ? 165.914 184.100 157.581 1.00 116.71 ? 269 ASN A O     1 
ATOM   2030  C CB    . ASN A 1 269 ? 165.825 181.213 156.626 1.00 116.71 ? 269 ASN A CB    1 
ATOM   2031  C CG    . ASN A 1 269 ? 166.222 179.978 155.851 1.00 116.71 ? 269 ASN A CG    1 
ATOM   2032  O OD1   . ASN A 1 269 ? 167.211 179.320 156.172 1.00 116.71 ? 269 ASN A OD1   1 
ATOM   2033  N ND2   . ASN A 1 269 ? 165.449 179.652 154.823 1.00 116.71 ? 269 ASN A ND2   1 
ATOM   2034  N N     . LYS A 1 270 ? 164.235 184.184 156.076 1.00 123.59 ? 270 LYS A N     1 
ATOM   2035  C CA    . LYS A 1 270 ? 163.633 185.353 156.705 1.00 123.59 ? 270 LYS A CA    1 
ATOM   2036  C C     . LYS A 1 270 ? 162.992 184.996 158.040 1.00 123.59 ? 270 LYS A C     1 
ATOM   2037  O O     . LYS A 1 270 ? 163.107 185.751 159.014 1.00 123.59 ? 270 LYS A O     1 
ATOM   2038  C CB    . LYS A 1 270 ? 162.611 185.981 155.759 1.00 123.59 ? 270 LYS A CB    1 
ATOM   2039  C CG    . LYS A 1 270 ? 161.989 187.260 156.279 1.00 123.59 ? 270 LYS A CG    1 
ATOM   2040  C CD    . LYS A 1 270 ? 161.124 187.922 155.221 1.00 123.59 ? 270 LYS A CD    1 
ATOM   2041  C CE    . LYS A 1 270 ? 159.826 187.165 155.019 1.00 123.59 ? 270 LYS A CE    1 
ATOM   2042  N NZ    . LYS A 1 270 ? 158.919 187.866 154.072 1.00 123.59 ? 270 LYS A NZ    1 
ATOM   2043  N N     . ALA A 1 271 ? 162.318 183.846 158.108 1.00 124.01 ? 271 ALA A N     1 
ATOM   2044  C CA    . ALA A 1 271 ? 161.664 183.446 159.350 1.00 124.01 ? 271 ALA A CA    1 
ATOM   2045  C C     . ALA A 1 271 ? 162.680 183.197 160.456 1.00 124.01 ? 271 ALA A C     1 
ATOM   2046  O O     . ALA A 1 271 ? 162.479 183.627 161.600 1.00 124.01 ? 271 ALA A O     1 
ATOM   2047  C CB    . ALA A 1 271 ? 160.810 182.202 159.115 1.00 124.01 ? 271 ALA A CB    1 
ATOM   2048  N N     . ARG A 1 272 ? 163.769 182.491 160.140 1.00 127.75 ? 272 ARG A N     1 
ATOM   2049  C CA    . ARG A 1 272 ? 164.826 182.289 161.123 1.00 127.75 ? 272 ARG A CA    1 
ATOM   2050  C C     . ARG A 1 272 ? 165.390 183.619 161.599 1.00 127.75 ? 272 ARG A C     1 
ATOM   2051  O O     . ARG A 1 272 ? 165.679 183.791 162.788 1.00 127.75 ? 272 ARG A O     1 
ATOM   2052  C CB    . ARG A 1 272 ? 165.939 181.423 160.536 1.00 127.75 ? 272 ARG A CB    1 
ATOM   2053  C CG    . ARG A 1 272 ? 165.550 179.982 160.278 1.00 127.75 ? 272 ARG A CG    1 
ATOM   2054  C CD    . ARG A 1 272 ? 166.733 179.205 159.727 1.00 127.75 ? 272 ARG A CD    1 
ATOM   2055  N NE    . ARG A 1 272 ? 166.403 177.808 159.462 1.00 127.75 ? 272 ARG A NE    1 
ATOM   2056  C CZ    . ARG A 1 272 ? 167.253 176.930 158.941 1.00 127.75 ? 272 ARG A CZ    1 
ATOM   2057  N NH1   . ARG A 1 272 ? 168.487 177.302 158.631 1.00 127.75 ? 272 ARG A NH1   1 
ATOM   2058  N NH2   . ARG A 1 272 ? 166.871 175.678 158.733 1.00 127.75 ? 272 ARG A NH2   1 
ATOM   2059  N N     . LEU A 1 273 ? 165.543 184.575 160.682 1.00 120.75 ? 273 LEU A N     1 
ATOM   2060  C CA    . LEU A 1 273 ? 166.057 185.889 161.050 1.00 120.75 ? 273 LEU A CA    1 
ATOM   2061  C C     . LEU A 1 273 ? 165.124 186.587 162.030 1.00 120.75 ? 273 LEU A C     1 
ATOM   2062  O O     . LEU A 1 273 ? 165.564 187.115 163.059 1.00 120.75 ? 273 LEU A O     1 
ATOM   2063  C CB    . LEU A 1 273 ? 166.252 186.737 159.795 1.00 120.75 ? 273 LEU A CB    1 
ATOM   2064  C CG    . LEU A 1 273 ? 166.857 188.121 160.012 1.00 120.75 ? 273 LEU A CG    1 
ATOM   2065  C CD1   . LEU A 1 273 ? 168.269 187.994 160.555 1.00 120.75 ? 273 LEU A CD1   1 
ATOM   2066  C CD2   . LEU A 1 273 ? 166.842 188.922 158.722 1.00 120.75 ? 273 LEU A CD2   1 
ATOM   2067  N N     . ILE A 1 274 ? 163.826 186.606 161.718 1.00 119.75 ? 274 ILE A N     1 
ATOM   2068  C CA    . ILE A 1 274 ? 162.860 187.256 162.598 1.00 119.75 ? 274 ILE A CA    1 
ATOM   2069  C C     . ILE A 1 274 ? 162.856 186.595 163.968 1.00 119.75 ? 274 ILE A C     1 
ATOM   2070  O O     . ILE A 1 274 ? 162.827 187.274 165.004 1.00 119.75 ? 274 ILE A O     1 
ATOM   2071  C CB    . ILE A 1 274 ? 161.460 187.239 161.960 1.00 119.75 ? 274 ILE A CB    1 
ATOM   2072  C CG1   . ILE A 1 274 ? 161.474 188.001 160.637 1.00 119.75 ? 274 ILE A CG1   1 
ATOM   2073  C CG2   . ILE A 1 274 ? 160.436 187.831 162.907 1.00 119.75 ? 274 ILE A CG2   1 
ATOM   2074  C CD1   . ILE A 1 274 ? 161.858 189.452 160.783 1.00 119.75 ? 274 ILE A CD1   1 
ATOM   2075  N N     . GLU A 1 275 ? 162.891 185.262 164.000 1.00 133.24 ? 275 GLU A N     1 
ATOM   2076  C CA    . GLU A 1 275 ? 162.872 184.565 165.280 1.00 133.24 ? 275 GLU A CA    1 
ATOM   2077  C C     . GLU A 1 275 ? 164.127 184.862 166.090 1.00 133.24 ? 275 GLU A C     1 
ATOM   2078  O O     . GLU A 1 275 ? 164.053 185.080 167.305 1.00 133.24 ? 275 GLU A O     1 
ATOM   2079  C CB    . GLU A 1 275 ? 162.718 183.063 165.062 1.00 133.24 ? 275 GLU A CB    1 
ATOM   2080  C CG    . GLU A 1 275 ? 162.632 182.275 166.352 1.00 133.24 ? 275 GLU A CG    1 
ATOM   2081  C CD    . GLU A 1 275 ? 162.413 180.800 166.116 1.00 133.24 ? 275 GLU A CD    1 
ATOM   2082  O OE1   . GLU A 1 275 ? 162.324 180.393 164.938 1.00 133.24 ? 275 GLU A OE1   1 
ATOM   2083  O OE2   . GLU A 1 275 ? 162.336 180.045 167.107 1.00 133.24 ? 275 GLU A OE2   1 
ATOM   2084  N N     . LYS A 1 276 ? 165.289 184.881 165.436 1.00 128.11 ? 276 LYS A N     1 
ATOM   2085  C CA    . LYS A 1 276 ? 166.526 185.154 166.157 1.00 128.11 ? 276 LYS A CA    1 
ATOM   2086  C C     . LYS A 1 276 ? 166.546 186.578 166.693 1.00 128.11 ? 276 LYS A C     1 
ATOM   2087  O O     . LYS A 1 276 ? 167.046 186.826 167.795 1.00 128.11 ? 276 LYS A O     1 
ATOM   2088  C CB    . LYS A 1 276 ? 167.729 184.898 165.251 1.00 128.11 ? 276 LYS A CB    1 
ATOM   2089  C CG    . LYS A 1 276 ? 169.066 185.011 165.960 1.00 128.11 ? 276 LYS A CG    1 
ATOM   2090  C CD    . LYS A 1 276 ? 170.213 184.658 165.031 1.00 128.11 ? 276 LYS A CD    1 
ATOM   2091  C CE    . LYS A 1 276 ? 171.552 184.776 165.738 1.00 128.11 ? 276 LYS A CE    1 
ATOM   2092  N NZ    . LYS A 1 276 ? 172.687 184.447 164.832 1.00 128.11 ? 276 LYS A NZ    1 
ATOM   2093  N N     . ILE A 1 277 ? 165.996 187.528 165.935 1.00 123.24 ? 277 ILE A N     1 
ATOM   2094  C CA    . ILE A 1 277 ? 165.934 188.903 166.423 1.00 123.24 ? 277 ILE A CA    1 
ATOM   2095  C C     . ILE A 1 277 ? 164.993 189.009 167.613 1.00 123.24 ? 277 ILE A C     1 
ATOM   2096  O O     . ILE A 1 277 ? 165.291 189.695 168.601 1.00 123.24 ? 277 ILE A O     1 
ATOM   2097  C CB    . ILE A 1 277 ? 165.527 189.859 165.289 1.00 123.24 ? 277 ILE A CB    1 
ATOM   2098  C CG1   . ILE A 1 277 ? 166.624 189.891 164.232 1.00 123.24 ? 277 ILE A CG1   1 
ATOM   2099  C CG2   . ILE A 1 277 ? 165.268 191.252 165.830 1.00 123.24 ? 277 ILE A CG2   1 
ATOM   2100  C CD1   . ILE A 1 277 ? 167.941 190.367 164.782 1.00 123.24 ? 277 ILE A CD1   1 
ATOM   2101  N N     . ALA A 1 278 ? 163.837 188.346 167.539 1.00 129.31 ? 278 ALA A N     1 
ATOM   2102  C CA    . ALA A 1 278 ? 162.936 188.328 168.685 1.00 129.31 ? 278 ALA A CA    1 
ATOM   2103  C C     . ALA A 1 278 ? 163.627 187.742 169.908 1.00 129.31 ? 278 ALA A C     1 
ATOM   2104  O O     . ALA A 1 278 ? 163.484 188.258 171.023 1.00 129.31 ? 278 ALA A O     1 
ATOM   2105  C CB    . ALA A 1 278 ? 161.673 187.537 168.350 1.00 129.31 ? 278 ALA A CB    1 
ATOM   2106  N N     . GLU A 1 279 ? 164.404 186.675 169.712 1.00 135.48 ? 279 GLU A N     1 
ATOM   2107  C CA    . GLU A 1 279 ? 165.114 186.065 170.830 1.00 135.48 ? 279 GLU A CA    1 
ATOM   2108  C C     . GLU A 1 279 ? 166.159 187.009 171.406 1.00 135.48 ? 279 GLU A C     1 
ATOM   2109  O O     . GLU A 1 279 ? 166.302 187.115 172.628 1.00 135.48 ? 279 GLU A O     1 
ATOM   2110  C CB    . GLU A 1 279 ? 165.766 184.759 170.387 1.00 135.48 ? 279 GLU A CB    1 
ATOM   2111  C CG    . GLU A 1 279 ? 166.463 184.019 171.511 1.00 135.48 ? 279 GLU A CG    1 
ATOM   2112  C CD    . GLU A 1 279 ? 167.060 182.706 171.058 1.00 135.48 ? 279 GLU A CD    1 
ATOM   2113  O OE1   . GLU A 1 279 ? 166.962 182.392 169.854 1.00 135.48 ? 279 GLU A OE1   1 
ATOM   2114  O OE2   . GLU A 1 279 ? 167.623 181.984 171.907 1.00 135.48 ? 279 GLU A OE2   1 
ATOM   2115  N N     . LEU A 1 280 ? 166.908 187.697 170.543 1.00 131.23 ? 280 LEU A N     1 
ATOM   2116  C CA    . LEU A 1 280 ? 167.916 188.632 171.030 1.00 131.23 ? 280 LEU A CA    1 
ATOM   2117  C C     . LEU A 1 280 ? 167.278 189.765 171.820 1.00 131.23 ? 280 LEU A C     1 
ATOM   2118  O O     . LEU A 1 280 ? 167.808 190.186 172.854 1.00 131.23 ? 280 LEU A O     1 
ATOM   2119  C CB    . LEU A 1 280 ? 168.733 189.190 169.866 1.00 131.23 ? 280 LEU A CB    1 
ATOM   2120  C CG    . LEU A 1 280 ? 169.657 188.203 169.155 1.00 131.23 ? 280 LEU A CG    1 
ATOM   2121  C CD1   . LEU A 1 280 ? 170.292 188.852 167.940 1.00 131.23 ? 280 LEU A CD1   1 
ATOM   2122  C CD2   . LEU A 1 280 ? 170.722 187.693 170.110 1.00 131.23 ? 280 LEU A CD2   1 
ATOM   2123  N N     . VAL A 1 281 ? 166.140 190.273 171.348 1.00 130.82 ? 281 VAL A N     1 
ATOM   2124  C CA    . VAL A 1 281 ? 165.447 191.324 172.086 1.00 130.82 ? 281 VAL A CA    1 
ATOM   2125  C C     . VAL A 1 281 ? 164.961 190.796 173.427 1.00 130.82 ? 281 VAL A C     1 
ATOM   2126  O O     . VAL A 1 281 ? 165.044 191.484 174.451 1.00 130.82 ? 281 VAL A O     1 
ATOM   2127  C CB    . VAL A 1 281 ? 164.290 191.896 171.247 1.00 130.82 ? 281 VAL A CB    1 
ATOM   2128  C CG1   . VAL A 1 281 ? 163.491 192.899 172.060 1.00 130.82 ? 281 VAL A CG1   1 
ATOM   2129  C CG2   . VAL A 1 281 ? 164.831 192.546 169.992 1.00 130.82 ? 281 VAL A CG2   1 
ATOM   2130  N N     . LYS A 1 282 ? 164.457 189.561 173.445 1.00 131.66 ? 282 LYS A N     1 
ATOM   2131  C CA    . LYS A 1 282 ? 163.985 188.974 174.693 1.00 131.66 ? 282 LYS A CA    1 
ATOM   2132  C C     . LYS A 1 282 ? 165.130 188.773 175.678 1.00 131.66 ? 282 LYS A C     1 
ATOM   2133  O O     . LYS A 1 282 ? 164.944 188.899 176.894 1.00 131.66 ? 282 LYS A O     1 
ATOM   2134  C CB    . LYS A 1 282 ? 163.281 187.649 174.405 1.00 131.66 ? 282 LYS A CB    1 
ATOM   2135  C CG    . LYS A 1 282 ? 162.695 186.976 175.626 1.00 131.66 ? 282 LYS A CG    1 
ATOM   2136  C CD    . LYS A 1 282 ? 161.543 187.780 176.192 1.00 131.66 ? 282 LYS A CD    1 
ATOM   2137  C CE    . LYS A 1 282 ? 160.952 187.097 177.412 1.00 131.66 ? 282 LYS A CE    1 
ATOM   2138  N NZ    . LYS A 1 282 ? 160.310 185.800 177.055 1.00 131.66 ? 282 LYS A NZ    1 
ATOM   2139  N N     . GLU A 1 283 ? 166.326 188.467 175.172 1.00 136.37 ? 283 GLU A N     1 
ATOM   2140  C CA    . GLU A 1 283 ? 167.451 188.189 176.058 1.00 136.37 ? 283 GLU A CA    1 
ATOM   2141  C C     . GLU A 1 283 ? 168.105 189.474 176.545 1.00 136.37 ? 283 GLU A C     1 
ATOM   2142  O O     . GLU A 1 283 ? 169.044 189.432 177.349 1.00 136.37 ? 283 GLU A O     1 
ATOM   2143  C CB    . GLU A 1 283 ? 168.474 187.308 175.344 1.00 136.37 ? 283 GLU A CB    1 
ATOM   2144  C CG    . GLU A 1 283 ? 167.972 185.912 175.030 1.00 136.37 ? 283 GLU A CG    1 
ATOM   2145  C CD    . GLU A 1 283 ? 169.003 185.078 174.299 1.00 136.37 ? 283 GLU A CD    1 
ATOM   2146  O OE1   . GLU A 1 283 ? 170.069 185.624 173.949 1.00 136.37 ? 283 GLU A OE1   1 
ATOM   2147  O OE2   . GLU A 1 283 ? 168.745 183.878 174.068 1.00 136.37 ? 283 GLU A OE2   1 
ATOM   2148  N N     . LYS A 1 284 ? 167.647 190.622 176.041 1.00 143.20 ? 284 LYS A N     1 
ATOM   2149  C CA    . LYS A 1 284 ? 168.129 191.937 176.454 1.00 143.20 ? 284 LYS A CA    1 
ATOM   2150  C C     . LYS A 1 284 ? 169.576 192.152 176.010 1.00 143.20 ? 284 LYS A C     1 
ATOM   2151  O O     . LYS A 1 284 ? 170.195 193.164 176.351 1.00 143.20 ? 284 LYS A O     1 
ATOM   2152  C CB    . LYS A 1 284 ? 167.972 192.106 177.972 1.00 143.20 ? 284 LYS A CB    1 
ATOM   2153  C CG    . LYS A 1 284 ? 168.180 193.516 178.504 1.00 143.20 ? 284 LYS A CG    1 
ATOM   2154  C CD    . LYS A 1 284 ? 167.945 193.579 180.002 1.00 143.20 ? 284 LYS A CD    1 
ATOM   2155  C CE    . LYS A 1 284 ? 168.183 194.981 180.537 1.00 143.20 ? 284 LYS A CE    1 
ATOM   2156  N NZ    . LYS A 1 284 ? 167.954 195.058 182.005 1.00 143.20 ? 284 LYS A NZ    1 
ATOM   2157  N N     . ARG A 1 285 ? 170.120 191.215 175.227 1.00 139.24 ? 285 ARG A N     1 
ATOM   2158  C CA    . ARG A 1 285 ? 171.469 191.387 174.697 1.00 139.24 ? 285 ARG A CA    1 
ATOM   2159  C C     . ARG A 1 285 ? 171.580 192.609 173.799 1.00 139.24 ? 285 ARG A C     1 
ATOM   2160  O O     . ARG A 1 285 ? 172.659 193.205 173.711 1.00 139.24 ? 285 ARG A O     1 
ATOM   2161  C CB    . ARG A 1 285 ? 171.896 190.143 173.921 1.00 139.24 ? 285 ARG A CB    1 
ATOM   2162  C CG    . ARG A 1 285 ? 172.085 188.907 174.776 1.00 139.24 ? 285 ARG A CG    1 
ATOM   2163  C CD    . ARG A 1 285 ? 172.526 187.733 173.922 1.00 139.24 ? 285 ARG A CD    1 
ATOM   2164  N NE    . ARG A 1 285 ? 172.636 186.498 174.689 1.00 139.24 ? 285 ARG A NE    1 
ATOM   2165  C CZ    . ARG A 1 285 ? 173.743 186.096 175.304 1.00 139.24 ? 285 ARG A CZ    1 
ATOM   2166  N NH1   . ARG A 1 285 ? 174.844 186.833 175.242 1.00 139.24 ? 285 ARG A NH1   1 
ATOM   2167  N NH2   . ARG A 1 285 ? 173.751 184.955 175.978 1.00 139.24 ? 285 ARG A NH2   1 
ATOM   2168  N N     . VAL A 1 286 ? 170.496 192.993 173.131 1.00 136.43 ? 286 VAL A N     1 
ATOM   2169  C CA    . VAL A 1 286 ? 170.464 194.188 172.304 1.00 136.43 ? 286 VAL A CA    1 
ATOM   2170  C C     . VAL A 1 286 ? 169.502 195.176 172.954 1.00 136.43 ? 286 VAL A C     1 
ATOM   2171  O O     . VAL A 1 286 ? 168.606 194.800 173.712 1.00 136.43 ? 286 VAL A O     1 
ATOM   2172  C CB    . VAL A 1 286 ? 170.050 193.873 170.851 1.00 136.43 ? 286 VAL A CB    1 
ATOM   2173  C CG1   . VAL A 1 286 ? 168.588 193.452 170.789 1.00 136.43 ? 286 VAL A CG1   1 
ATOM   2174  C CG2   . VAL A 1 286 ? 170.337 195.051 169.930 1.00 136.43 ? 286 VAL A CG2   1 
ATOM   2175  N N     . GLU A 1 287 ? 169.704 196.456 172.658 1.00 142.95 ? 287 GLU A N     1 
ATOM   2176  C CA    . GLU A 1 287 ? 168.971 197.527 173.312 1.00 142.95 ? 287 GLU A CA    1 
ATOM   2177  C C     . GLU A 1 287 ? 168.197 198.353 172.294 1.00 142.95 ? 287 GLU A C     1 
ATOM   2178  O O     . GLU A 1 287 ? 168.494 198.345 171.097 1.00 142.95 ? 287 GLU A O     1 
ATOM   2179  C CB    . GLU A 1 287 ? 169.921 198.440 174.095 1.00 142.95 ? 287 GLU A CB    1 
ATOM   2180  C CG    . GLU A 1 287 ? 170.648 197.742 175.225 1.00 142.95 ? 287 GLU A CG    1 
ATOM   2181  C CD    . GLU A 1 287 ? 169.715 197.306 176.331 1.00 142.95 ? 287 GLU A CD    1 
ATOM   2182  O OE1   . GLU A 1 287 ? 168.704 198.001 176.564 1.00 142.95 ? 287 GLU A OE1   1 
ATOM   2183  O OE2   . GLU A 1 287 ? 169.989 196.267 176.966 1.00 142.95 ? 287 GLU A OE2   1 
ATOM   2184  N N     . GLY A 1 288 ? 167.192 199.068 172.792 1.00 138.83 ? 288 GLY A N     1 
ATOM   2185  C CA    . GLY A 1 288 ? 166.493 200.057 171.998 1.00 138.83 ? 288 GLY A CA    1 
ATOM   2186  C C     . GLY A 1 288 ? 165.446 199.530 171.044 1.00 138.83 ? 288 GLY A C     1 
ATOM   2187  O O     . GLY A 1 288 ? 164.966 200.295 170.200 1.00 138.83 ? 288 GLY A O     1 
ATOM   2188  N N     . ILE A 1 289 ? 165.068 198.260 171.144 1.00 136.86 ? 289 ILE A N     1 
ATOM   2189  C CA    . ILE A 1 289 ? 164.058 197.673 170.272 1.00 136.86 ? 289 ILE A CA    1 
ATOM   2190  C C     . ILE A 1 289 ? 162.801 197.439 171.095 1.00 136.86 ? 289 ILE A C     1 
ATOM   2191  O O     . ILE A 1 289 ? 162.845 196.771 172.136 1.00 136.86 ? 289 ILE A O     1 
ATOM   2192  C CB    . ILE A 1 289 ? 164.547 196.370 169.628 1.00 136.86 ? 289 ILE A CB    1 
ATOM   2193  C CG1   . ILE A 1 289 ? 165.744 196.650 168.718 1.00 136.86 ? 289 ILE A CG1   1 
ATOM   2194  C CG2   . ILE A 1 289 ? 163.423 195.718 168.844 1.00 136.86 ? 289 ILE A CG2   1 
ATOM   2195  C CD1   . ILE A 1 289 ? 166.446 195.406 168.234 1.00 136.86 ? 289 ILE A CD1   1 
ATOM   2196  N N     . SER A 1 290 ? 161.680 197.984 170.627 1.00 143.74 ? 290 SER A N     1 
ATOM   2197  C CA    . SER A 1 290 ? 160.416 197.882 171.349 1.00 143.74 ? 290 SER A CA    1 
ATOM   2198  C C     . SER A 1 290 ? 159.585 196.693 170.872 1.00 143.74 ? 290 SER A C     1 
ATOM   2199  O O     . SER A 1 290 ? 159.243 195.809 171.663 1.00 143.74 ? 290 SER A O     1 
ATOM   2200  C CB    . SER A 1 290 ? 159.624 199.185 171.199 1.00 143.74 ? 290 SER A CB    1 
ATOM   2201  O OG    . SER A 1 290 ? 159.239 199.388 169.851 1.00 143.74 ? 290 SER A OG    1 
ATOM   2202  N N     . ALA A 1 291 ? 159.254 196.660 169.583 1.00 136.85 ? 291 ALA A N     1 
ATOM   2203  C CA    . ALA A 1 291 ? 158.399 195.619 169.029 1.00 136.85 ? 291 ALA A CA    1 
ATOM   2204  C C     . ALA A 1 291 ? 158.946 195.221 167.664 1.00 136.85 ? 291 ALA A C     1 
ATOM   2205  O O     . ALA A 1 291 ? 160.068 195.577 167.292 1.00 136.85 ? 291 ALA A O     1 
ATOM   2206  C CB    . ALA A 1 291 ? 156.943 196.096 168.953 1.00 136.85 ? 291 ALA A CB    1 
ATOM   2207  N N     . LEU A 1 292 ? 158.144 194.471 166.911 1.00 132.52 ? 292 LEU A N     1 
ATOM   2208  C CA    . LEU A 1 292 ? 158.550 194.004 165.592 1.00 132.52 ? 292 LEU A CA    1 
ATOM   2209  C C     . LEU A 1 292 ? 157.300 193.694 164.784 1.00 132.52 ? 292 LEU A C     1 
ATOM   2210  O O     . LEU A 1 292 ? 156.374 193.057 165.295 1.00 132.52 ? 292 LEU A O     1 
ATOM   2211  C CB    . LEU A 1 292 ? 159.448 192.767 165.702 1.00 132.52 ? 292 LEU A CB    1 
ATOM   2212  C CG    . LEU A 1 292 ? 160.155 192.271 164.441 1.00 132.52 ? 292 LEU A CG    1 
ATOM   2213  C CD1   . LEU A 1 292 ? 161.453 191.587 164.823 1.00 132.52 ? 292 LEU A CD1   1 
ATOM   2214  C CD2   . LEU A 1 292 ? 159.275 191.322 163.642 1.00 132.52 ? 292 LEU A CD2   1 
ATOM   2215  N N     . ARG A 1 293 ? 157.278 194.137 163.530 1.00 137.49 ? 293 ARG A N     1 
ATOM   2216  C CA    . ARG A 1 293 ? 156.131 193.934 162.660 1.00 137.49 ? 293 ARG A CA    1 
ATOM   2217  C C     . ARG A 1 293 ? 156.612 193.525 161.275 1.00 137.49 ? 293 ARG A C     1 
ATOM   2218  O O     . ARG A 1 293 ? 157.809 193.367 161.027 1.00 137.49 ? 293 ARG A O     1 
ATOM   2219  C CB    . ARG A 1 293 ? 155.259 195.193 162.577 1.00 137.49 ? 293 ARG A CB    1 
ATOM   2220  C CG    . ARG A 1 293 ? 154.540 195.529 163.872 1.00 137.49 ? 293 ARG A CG    1 
ATOM   2221  C CD    . ARG A 1 293 ? 153.709 196.791 163.732 1.00 137.49 ? 293 ARG A CD    1 
ATOM   2222  N NE    . ARG A 1 293 ? 154.544 197.975 163.565 1.00 137.49 ? 293 ARG A NE    1 
ATOM   2223  C CZ    . ARG A 1 293 ? 154.073 199.189 163.299 1.00 137.49 ? 293 ARG A CZ    1 
ATOM   2224  N NH1   . ARG A 1 293 ? 152.768 199.381 163.170 1.00 137.49 ? 293 ARG A NH1   1 
ATOM   2225  N NH2   . ARG A 1 293 ? 154.907 200.210 163.164 1.00 137.49 ? 293 ARG A NH2   1 
ATOM   2226  N N     . ASP A 1 294 ? 155.652 193.345 160.372 1.00 144.86 ? 294 ASP A N     1 
ATOM   2227  C CA    . ASP A 1 294 ? 155.930 192.963 158.996 1.00 144.86 ? 294 ASP A CA    1 
ATOM   2228  C C     . ASP A 1 294 ? 154.892 193.590 158.080 1.00 144.86 ? 294 ASP A C     1 
ATOM   2229  O O     . ASP A 1 294 ? 153.718 193.705 158.443 1.00 144.86 ? 294 ASP A O     1 
ATOM   2230  C CB    . ASP A 1 294 ? 155.926 191.441 158.827 1.00 144.86 ? 294 ASP A CB    1 
ATOM   2231  C CG    . ASP A 1 294 ? 156.408 191.003 157.458 1.00 144.86 ? 294 ASP A CG    1 
ATOM   2232  O OD1   . ASP A 1 294 ? 156.738 191.875 156.626 1.00 144.86 ? 294 ASP A OD1   1 
ATOM   2233  O OD2   . ASP A 1 294 ? 156.454 189.781 157.212 1.00 144.86 ? 294 ASP A OD2   1 
ATOM   2234  N N     . GLU A 1 295 ? 155.332 193.993 156.887 1.00 144.81 ? 295 GLU A N     1 
ATOM   2235  C CA    . GLU A 1 295 ? 154.444 194.566 155.885 1.00 144.81 ? 295 GLU A CA    1 
ATOM   2236  C C     . GLU A 1 295 ? 154.730 194.030 154.489 1.00 144.81 ? 295 GLU A C     1 
ATOM   2237  O O     . GLU A 1 295 ? 154.243 194.604 153.508 1.00 144.81 ? 295 GLU A O     1 
ATOM   2238  C CB    . GLU A 1 295 ? 154.547 196.095 155.877 1.00 144.81 ? 295 GLU A CB    1 
ATOM   2239  C CG    . GLU A 1 295 ? 154.036 196.768 157.136 1.00 144.81 ? 295 GLU A CG    1 
ATOM   2240  C CD    . GLU A 1 295 ? 154.180 198.277 157.086 1.00 144.81 ? 295 GLU A CD    1 
ATOM   2241  O OE1   . GLU A 1 295 ? 154.775 198.788 156.114 1.00 144.81 ? 295 GLU A OE1   1 
ATOM   2242  O OE2   . GLU A 1 295 ? 153.703 198.951 158.022 1.00 144.81 ? 295 GLU A OE2   1 
ATOM   2243  N N     . SER A 1 296 ? 155.506 192.955 154.372 1.00 147.09 ? 296 SER A N     1 
ATOM   2244  C CA    . SER A 1 296 ? 155.871 192.438 153.062 1.00 147.09 ? 296 SER A CA    1 
ATOM   2245  C C     . SER A 1 296 ? 154.641 191.933 152.320 1.00 147.09 ? 296 SER A C     1 
ATOM   2246  O O     . SER A 1 296 ? 153.758 191.298 152.903 1.00 147.09 ? 296 SER A O     1 
ATOM   2247  C CB    . SER A 1 296 ? 156.899 191.318 153.205 1.00 147.09 ? 296 SER A CB    1 
ATOM   2248  O OG    . SER A 1 296 ? 158.101 191.810 153.768 1.00 147.09 ? 296 SER A OG    1 
ATOM   2249  N N     . ASP A 1 297 ? 154.591 192.218 151.024 1.00 162.20 ? 297 ASP A N     1 
ATOM   2250  C CA    . ASP A 1 297 ? 153.445 191.875 150.196 1.00 162.20 ? 297 ASP A CA    1 
ATOM   2251  C C     . ASP A 1 297 ? 153.942 191.554 148.791 1.00 162.20 ? 297 ASP A C     1 
ATOM   2252  O O     . ASP A 1 297 ? 155.138 191.344 148.569 1.00 162.20 ? 297 ASP A O     1 
ATOM   2253  C CB    . ASP A 1 297 ? 152.416 193.013 150.205 1.00 162.20 ? 297 ASP A CB    1 
ATOM   2254  C CG    . ASP A 1 297 ? 152.989 194.327 149.700 1.00 162.20 ? 297 ASP A CG    1 
ATOM   2255  O OD1   . ASP A 1 297 ? 154.204 194.388 149.416 1.00 162.20 ? 297 ASP A OD1   1 
ATOM   2256  O OD2   . ASP A 1 297 ? 152.220 195.303 149.586 1.00 162.20 ? 297 ASP A OD2   1 
ATOM   2257  N N     . LYS A 1 298 ? 153.017 191.523 147.836 1.00 164.30 ? 298 LYS A N     1 
ATOM   2258  C CA    . LYS A 1 298 ? 153.345 191.223 146.450 1.00 164.30 ? 298 LYS A CA    1 
ATOM   2259  C C     . LYS A 1 298 ? 153.956 192.408 145.713 1.00 164.30 ? 298 LYS A C     1 
ATOM   2260  O O     . LYS A 1 298 ? 154.049 192.369 144.482 1.00 164.30 ? 298 LYS A O     1 
ATOM   2261  C CB    . LYS A 1 298 ? 152.097 190.739 145.708 1.00 164.30 ? 298 LYS A CB    1 
ATOM   2262  C CG    . LYS A 1 298 ? 151.001 191.784 145.585 1.00 164.30 ? 298 LYS A CG    1 
ATOM   2263  C CD    . LYS A 1 298 ? 149.777 191.217 144.883 1.00 164.30 ? 298 LYS A CD    1 
ATOM   2264  C CE    . LYS A 1 298 ? 148.689 192.267 144.736 1.00 164.30 ? 298 LYS A CE    1 
ATOM   2265  N NZ    . LYS A 1 298 ? 148.124 192.661 146.056 1.00 164.30 ? 298 LYS A NZ    1 
ATOM   2266  N N     . ASP A 1 299 ? 154.367 193.454 146.427 1.00 170.98 ? 299 ASP A N     1 
ATOM   2267  C CA    . ASP A 1 299 ? 154.979 194.623 145.815 1.00 170.98 ? 299 ASP A CA    1 
ATOM   2268  C C     . ASP A 1 299 ? 156.406 194.863 146.282 1.00 170.98 ? 299 ASP A C     1 
ATOM   2269  O O     . ASP A 1 299 ? 156.983 195.905 145.955 1.00 170.98 ? 299 ASP A O     1 
ATOM   2270  C CB    . ASP A 1 299 ? 154.129 195.867 146.094 1.00 170.98 ? 299 ASP A CB    1 
ATOM   2271  C CG    . ASP A 1 299 ? 152.792 195.822 145.389 1.00 170.98 ? 299 ASP A CG    1 
ATOM   2272  O OD1   . ASP A 1 299 ? 152.706 195.177 144.324 1.00 170.98 ? 299 ASP A OD1   1 
ATOM   2273  O OD2   . ASP A 1 299 ? 151.828 196.430 145.898 1.00 170.98 ? 299 ASP A OD2   1 
ATOM   2274  N N     . GLY A 1 300 ? 156.983 193.942 147.033 1.00 159.80 ? 300 GLY A N     1 
ATOM   2275  C CA    . GLY A 1 300 ? 158.335 194.079 147.542 1.00 159.80 ? 300 GLY A CA    1 
ATOM   2276  C C     . GLY A 1 300 ? 158.377 193.788 149.029 1.00 159.80 ? 300 GLY A C     1 
ATOM   2277  O O     . GLY A 1 300 ? 157.446 194.079 149.779 1.00 159.80 ? 300 GLY A O     1 
ATOM   2278  N N     . MET A 1 301 ? 159.488 193.202 149.464 1.00 140.83 ? 301 MET A N     1 
ATOM   2279  C CA    . MET A 1 301 ? 159.651 192.845 150.865 1.00 140.83 ? 301 MET A CA    1 
ATOM   2280  C C     . MET A 1 301 ? 159.853 194.097 151.706 1.00 140.83 ? 301 MET A C     1 
ATOM   2281  O O     . MET A 1 301 ? 160.553 195.029 151.302 1.00 140.83 ? 301 MET A O     1 
ATOM   2282  C CB    . MET A 1 301 ? 160.832 191.893 151.040 1.00 140.83 ? 301 MET A CB    1 
ATOM   2283  C CG    . MET A 1 301 ? 161.007 191.392 152.459 1.00 140.83 ? 301 MET A CG    1 
ATOM   2284  S SD    . MET A 1 301 ? 162.367 190.227 152.605 1.00 140.83 ? 301 MET A SD    1 
ATOM   2285  C CE    . MET A 1 301 ? 163.748 191.338 152.381 1.00 140.83 ? 301 MET A CE    1 
ATOM   2286  N N     . ARG A 1 302 ? 159.232 194.113 152.884 1.00 136.55 ? 302 ARG A N     1 
ATOM   2287  C CA    . ARG A 1 302 ? 159.246 195.298 153.737 1.00 136.55 ? 302 ARG A CA    1 
ATOM   2288  C C     . ARG A 1 302 ? 159.149 194.850 155.187 1.00 136.55 ? 302 ARG A C     1 
ATOM   2289  O O     . ARG A 1 302 ? 158.123 194.305 155.601 1.00 136.55 ? 302 ARG A O     1 
ATOM   2290  C CB    . ARG A 1 302 ? 158.099 196.235 153.375 1.00 136.55 ? 302 ARG A CB    1 
ATOM   2291  C CG    . ARG A 1 302 ? 158.073 197.526 154.164 1.00 136.55 ? 302 ARG A CG    1 
ATOM   2292  C CD    . ARG A 1 302 ? 156.953 198.425 153.677 1.00 136.55 ? 302 ARG A CD    1 
ATOM   2293  N NE    . ARG A 1 302 ? 156.844 199.642 154.473 1.00 136.55 ? 302 ARG A NE    1 
ATOM   2294  C CZ    . ARG A 1 302 ? 157.545 200.745 154.241 1.00 136.55 ? 302 ARG A CZ    1 
ATOM   2295  N NH1   . ARG A 1 302 ? 158.408 200.783 153.234 1.00 136.55 ? 302 ARG A NH1   1 
ATOM   2296  N NH2   . ARG A 1 302 ? 157.385 201.810 155.013 1.00 136.55 ? 302 ARG A NH2   1 
ATOM   2297  N N     . ILE A 1 303 ? 160.213 195.079 155.951 1.00 122.12 ? 303 ILE A N     1 
ATOM   2298  C CA    . ILE A 1 303 ? 160.253 194.771 157.375 1.00 122.12 ? 303 ILE A CA    1 
ATOM   2299  C C     . ILE A 1 303 ? 160.376 196.080 158.138 1.00 122.12 ? 303 ILE A C     1 
ATOM   2300  O O     . ILE A 1 303 ? 161.219 196.921 157.806 1.00 122.12 ? 303 ILE A O     1 
ATOM   2301  C CB    . ILE A 1 303 ? 161.413 193.823 157.724 1.00 122.12 ? 303 ILE A CB    1 
ATOM   2302  C CG1   . ILE A 1 303 ? 161.213 192.469 157.048 1.00 122.12 ? 303 ILE A CG1   1 
ATOM   2303  C CG2   . ILE A 1 303 ? 161.527 193.648 159.227 1.00 122.12 ? 303 ILE A CG2   1 
ATOM   2304  C CD1   . ILE A 1 303 ? 162.411 191.562 157.153 1.00 122.12 ? 303 ILE A CD1   1 
ATOM   2305  N N     . VAL A 1 304 ? 159.539 196.249 159.156 1.00 128.44 ? 304 VAL A N     1 
ATOM   2306  C CA    . VAL A 1 304 ? 159.487 197.470 159.949 1.00 128.44 ? 304 VAL A CA    1 
ATOM   2307  C C     . VAL A 1 304 ? 159.872 197.131 161.381 1.00 128.44 ? 304 VAL A C     1 
ATOM   2308  O O     . VAL A 1 304 ? 159.343 196.177 161.961 1.00 128.44 ? 304 VAL A O     1 
ATOM   2309  C CB    . VAL A 1 304 ? 158.091 198.115 159.896 1.00 128.44 ? 304 VAL A CB    1 
ATOM   2310  C CG1   . VAL A 1 304 ? 158.024 199.316 160.818 1.00 128.44 ? 304 VAL A CG1   1 
ATOM   2311  C CG2   . VAL A 1 304 ? 157.750 198.510 158.471 1.00 128.44 ? 304 VAL A CG2   1 
ATOM   2312  N N     . ILE A 1 305 ? 160.790 197.911 161.946 1.00 129.00 ? 305 ILE A N     1 
ATOM   2313  C CA    . ILE A 1 305 ? 161.232 197.748 163.325 1.00 129.00 ? 305 ILE A CA    1 
ATOM   2314  C C     . ILE A 1 305 ? 161.011 199.063 164.055 1.00 129.00 ? 305 ILE A C     1 
ATOM   2315  O O     . ILE A 1 305 ? 161.458 200.119 163.593 1.00 129.00 ? 305 ILE A O     1 
ATOM   2316  C CB    . ILE A 1 305 ? 162.707 197.320 163.403 1.00 129.00 ? 305 ILE A CB    1 
ATOM   2317  C CG1   . ILE A 1 305 ? 162.888 195.940 162.774 1.00 129.00 ? 305 ILE A CG1   1 
ATOM   2318  C CG2   . ILE A 1 305 ? 163.184 197.318 164.842 1.00 129.00 ? 305 ILE A CG2   1 
ATOM   2319  C CD1   . ILE A 1 305 ? 164.330 195.544 162.586 1.00 129.00 ? 305 ILE A CD1   1 
ATOM   2320  N N     . GLU A 1 306 ? 160.328 198.998 165.194 1.00 145.69 ? 306 GLU A N     1 
ATOM   2321  C CA    . GLU A 1 306 ? 159.989 200.187 165.964 1.00 145.69 ? 306 GLU A CA    1 
ATOM   2322  C C     . GLU A 1 306 ? 161.089 200.466 166.980 1.00 145.69 ? 306 GLU A C     1 
ATOM   2323  O O     . GLU A 1 306 ? 161.358 199.639 167.858 1.00 145.69 ? 306 GLU A O     1 
ATOM   2324  C CB    . GLU A 1 306 ? 158.644 200.012 166.664 1.00 145.69 ? 306 GLU A CB    1 
ATOM   2325  C CG    . GLU A 1 306 ? 158.172 201.255 167.392 1.00 145.69 ? 306 GLU A CG    1 
ATOM   2326  C CD    . GLU A 1 306 ? 156.808 201.074 168.021 1.00 145.69 ? 306 GLU A CD    1 
ATOM   2327  O OE1   . GLU A 1 306 ? 156.251 199.961 167.920 1.00 145.69 ? 306 GLU A OE1   1 
ATOM   2328  O OE2   . GLU A 1 306 ? 156.290 202.046 168.611 1.00 145.69 ? 306 GLU A OE2   1 
ATOM   2329  N N     . VAL A 1 307 ? 161.712 201.630 166.864 1.00 140.60 ? 307 VAL A N     1 
ATOM   2330  C CA    . VAL A 1 307 ? 162.802 202.010 167.753 1.00 140.60 ? 307 VAL A CA    1 
ATOM   2331  C C     . VAL A 1 307 ? 162.236 202.425 169.103 1.00 140.60 ? 307 VAL A C     1 
ATOM   2332  O O     . VAL A 1 307 ? 161.189 203.075 169.190 1.00 140.60 ? 307 VAL A O     1 
ATOM   2333  C CB    . VAL A 1 307 ? 163.636 203.143 167.122 1.00 140.60 ? 307 VAL A CB    1 
ATOM   2334  C CG1   . VAL A 1 307 ? 164.765 203.565 168.050 1.00 140.60 ? 307 VAL A CG1   1 
ATOM   2335  C CG2   . VAL A 1 307 ? 164.169 202.716 165.765 1.00 140.60 ? 307 VAL A CG2   1 
ATOM   2336  N N     . LYS A 1 308 ? 162.929 202.037 170.170 1.00 141.39 ? 308 LYS A N     1 
ATOM   2337  C CA    . LYS A 1 308 ? 162.559 202.500 171.498 1.00 141.39 ? 308 LYS A CA    1 
ATOM   2338  C C     . LYS A 1 308 ? 162.688 204.016 171.579 1.00 141.39 ? 308 LYS A C     1 
ATOM   2339  O O     . LYS A 1 308 ? 163.587 204.618 170.986 1.00 141.39 ? 308 LYS A O     1 
ATOM   2340  C CB    . LYS A 1 308 ? 163.438 201.836 172.557 1.00 141.39 ? 308 LYS A CB    1 
ATOM   2341  C CG    . LYS A 1 308 ? 163.063 202.166 173.990 1.00 141.39 ? 308 LYS A CG    1 
ATOM   2342  C CD    . LYS A 1 308 ? 163.935 201.398 174.969 1.00 141.39 ? 308 LYS A CD    1 
ATOM   2343  C CE    . LYS A 1 308 ? 163.580 201.730 176.407 1.00 141.39 ? 308 LYS A CE    1 
ATOM   2344  N NZ    . LYS A 1 308 ? 164.429 200.981 177.372 1.00 141.39 ? 308 LYS A NZ    1 
ATOM   2345  N N     . ARG A 1 309 ? 161.768 204.633 172.316 1.00 148.90 ? 309 ARG A N     1 
ATOM   2346  C CA    . ARG A 1 309 ? 161.748 206.083 172.434 1.00 148.90 ? 309 ARG A CA    1 
ATOM   2347  C C     . ARG A 1 309 ? 163.041 206.590 173.065 1.00 148.90 ? 309 ARG A C     1 
ATOM   2348  O O     . ARG A 1 309 ? 163.649 205.929 173.912 1.00 148.90 ? 309 ARG A O     1 
ATOM   2349  C CB    . ARG A 1 309 ? 160.544 206.528 173.263 1.00 148.90 ? 309 ARG A CB    1 
ATOM   2350  C CG    . ARG A 1 309 ? 160.372 208.031 173.360 1.00 148.90 ? 309 ARG A CG    1 
ATOM   2351  C CD    . ARG A 1 309 ? 159.134 208.388 174.159 1.00 148.90 ? 309 ARG A CD    1 
ATOM   2352  N NE    . ARG A 1 309 ? 158.945 209.831 174.258 1.00 148.90 ? 309 ARG A NE    1 
ATOM   2353  C CZ    . ARG A 1 309 ? 159.467 210.585 175.221 1.00 148.90 ? 309 ARG A CZ    1 
ATOM   2354  N NH1   . ARG A 1 309 ? 160.215 210.033 176.166 1.00 148.90 ? 309 ARG A NH1   1 
ATOM   2355  N NH2   . ARG A 1 309 ? 159.243 211.891 175.237 1.00 148.90 ? 309 ARG A NH2   1 
ATOM   2356  N N     . ASP A 1 310 ? 163.463 207.776 172.626 1.00 153.54 ? 310 ASP A N     1 
ATOM   2357  C CA    . ASP A 1 310 ? 164.683 208.423 173.106 1.00 153.54 ? 310 ASP A CA    1 
ATOM   2358  C C     . ASP A 1 310 ? 165.917 207.572 172.819 1.00 153.54 ? 310 ASP A C     1 
ATOM   2359  O O     . ASP A 1 310 ? 166.726 207.305 173.710 1.00 153.54 ? 310 ASP A O     1 
ATOM   2360  C CB    . ASP A 1 310 ? 164.593 208.756 174.598 1.00 153.54 ? 310 ASP A CB    1 
ATOM   2361  C CG    . ASP A 1 310 ? 165.678 209.716 175.048 1.00 153.54 ? 310 ASP A CG    1 
ATOM   2362  O OD1   . ASP A 1 310 ? 166.498 210.133 174.204 1.00 153.54 ? 310 ASP A OD1   1 
ATOM   2363  O OD2   . ASP A 1 310 ? 165.714 210.053 176.249 1.00 153.54 ? 310 ASP A OD2   1 
ATOM   2364  N N     . ALA A 1 311 ? 166.054 207.126 171.575 1.00 144.53 ? 311 ALA A N     1 
ATOM   2365  C CA    . ALA A 1 311 ? 167.230 206.401 171.118 1.00 144.53 ? 311 ALA A CA    1 
ATOM   2366  C C     . ALA A 1 311 ? 167.558 206.857 169.705 1.00 144.53 ? 311 ALA A C     1 
ATOM   2367  O O     . ALA A 1 311 ? 166.673 206.898 168.845 1.00 144.53 ? 311 ALA A O     1 
ATOM   2368  C CB    . ALA A 1 311 ? 167.003 204.887 171.156 1.00 144.53 ? 311 ALA A CB    1 
ATOM   2369  N N     . VAL A 1 312 ? 168.822 207.213 169.473 1.00 140.26 ? 312 VAL A N     1 
ATOM   2370  C CA    . VAL A 1 312 ? 169.242 207.630 168.138 1.00 140.26 ? 312 VAL A CA    1 
ATOM   2371  C C     . VAL A 1 312 ? 169.032 206.500 167.140 1.00 140.26 ? 312 VAL A C     1 
ATOM   2372  O O     . VAL A 1 312 ? 168.726 206.734 165.964 1.00 140.26 ? 312 VAL A O     1 
ATOM   2373  C CB    . VAL A 1 312 ? 170.706 208.104 168.164 1.00 140.26 ? 312 VAL A CB    1 
ATOM   2374  C CG1   . VAL A 1 312 ? 171.189 208.447 166.763 1.00 140.26 ? 312 VAL A CG1   1 
ATOM   2375  C CG2   . VAL A 1 312 ? 170.855 209.300 169.089 1.00 140.26 ? 312 VAL A CG2   1 
ATOM   2376  N N     . GLY A 1 313 ? 169.183 205.257 167.592 1.00 128.75 ? 313 GLY A N     1 
ATOM   2377  C CA    . GLY A 1 313 ? 168.935 204.104 166.760 1.00 128.75 ? 313 GLY A CA    1 
ATOM   2378  C C     . GLY A 1 313 ? 170.057 203.736 165.817 1.00 128.75 ? 313 GLY A C     1 
ATOM   2379  O O     . GLY A 1 313 ? 170.096 202.595 165.347 1.00 128.75 ? 313 GLY A O     1 
ATOM   2380  N N     . GLU A 1 314 ? 170.970 204.661 165.522 1.00 128.16 ? 314 GLU A N     1 
ATOM   2381  C CA    . GLU A 1 314 ? 172.078 204.331 164.634 1.00 128.16 ? 314 GLU A CA    1 
ATOM   2382  C C     . GLU A 1 314 ? 173.092 203.439 165.335 1.00 128.16 ? 314 GLU A C     1 
ATOM   2383  O O     . GLU A 1 314 ? 173.681 202.547 164.713 1.00 128.16 ? 314 GLU A O     1 
ATOM   2384  C CB    . GLU A 1 314 ? 172.732 205.611 164.124 1.00 128.16 ? 314 GLU A CB    1 
ATOM   2385  C CG    . GLU A 1 314 ? 171.806 206.445 163.261 1.00 128.16 ? 314 GLU A CG    1 
ATOM   2386  C CD    . GLU A 1 314 ? 172.449 207.725 162.781 1.00 128.16 ? 314 GLU A CD    1 
ATOM   2387  O OE1   . GLU A 1 314 ? 173.586 208.016 163.205 1.00 128.16 ? 314 GLU A OE1   1 
ATOM   2388  O OE2   . GLU A 1 314 ? 171.812 208.444 161.983 1.00 128.16 ? 314 GLU A OE2   1 
ATOM   2389  N N     . VAL A 1 315 ? 173.305 203.660 166.633 1.00 121.65 ? 315 VAL A N     1 
ATOM   2390  C CA    . VAL A 1 315 ? 174.127 202.738 167.408 1.00 121.65 ? 315 VAL A CA    1 
ATOM   2391  C C     . VAL A 1 315 ? 173.475 201.363 167.442 1.00 121.65 ? 315 VAL A C     1 
ATOM   2392  O O     . VAL A 1 315 ? 174.154 200.332 167.360 1.00 121.65 ? 315 VAL A O     1 
ATOM   2393  C CB    . VAL A 1 315 ? 174.361 203.293 168.824 1.00 121.65 ? 315 VAL A CB    1 
ATOM   2394  C CG1   . VAL A 1 315 ? 175.154 202.303 169.661 1.00 121.65 ? 315 VAL A CG1   1 
ATOM   2395  C CG2   . VAL A 1 315 ? 175.073 204.634 168.751 1.00 121.65 ? 315 VAL A CG2   1 
ATOM   2396  N N     . VAL A 1 316 ? 172.145 201.328 167.549 1.00 118.34 ? 316 VAL A N     1 
ATOM   2397  C CA    . VAL A 1 316 ? 171.420 200.064 167.479 1.00 118.34 ? 316 VAL A CA    1 
ATOM   2398  C C     . VAL A 1 316 ? 171.646 199.395 166.130 1.00 118.34 ? 316 VAL A C     1 
ATOM   2399  O O     . VAL A 1 316 ? 171.864 198.181 166.051 1.00 118.34 ? 316 VAL A O     1 
ATOM   2400  C CB    . VAL A 1 316 ? 169.923 200.300 167.747 1.00 118.34 ? 316 VAL A CB    1 
ATOM   2401  C CG1   . VAL A 1 316 ? 169.138 199.013 167.567 1.00 118.34 ? 316 VAL A CG1   1 
ATOM   2402  C CG2   . VAL A 1 316 ? 169.720 200.866 169.140 1.00 118.34 ? 316 VAL A CG2   1 
ATOM   2403  N N     . LEU A 1 317 ? 171.599 200.177 165.052 1.00 115.02 ? 317 LEU A N     1 
ATOM   2404  C CA    . LEU A 1 317 ? 171.803 199.628 163.718 1.00 115.02 ? 317 LEU A CA    1 
ATOM   2405  C C     . LEU A 1 317 ? 173.206 199.058 163.569 1.00 115.02 ? 317 LEU A C     1 
ATOM   2406  O O     . LEU A 1 317 ? 173.394 197.990 162.975 1.00 115.02 ? 317 LEU A O     1 
ATOM   2407  C CB    . LEU A 1 317 ? 171.551 200.714 162.675 1.00 115.02 ? 317 LEU A CB    1 
ATOM   2408  C CG    . LEU A 1 317 ? 171.606 200.298 161.209 1.00 115.02 ? 317 LEU A CG    1 
ATOM   2409  C CD1   . LEU A 1 317 ? 170.490 199.317 160.903 1.00 115.02 ? 317 LEU A CD1   1 
ATOM   2410  C CD2   . LEU A 1 317 ? 171.514 201.518 160.314 1.00 115.02 ? 317 LEU A CD2   1 
ATOM   2411  N N     . ASN A 1 318 ? 174.205 199.762 164.102 1.00 112.89 ? 318 ASN A N     1 
ATOM   2412  C CA    . ASN A 1 318 ? 175.575 199.265 164.040 1.00 112.89 ? 318 ASN A CA    1 
ATOM   2413  C C     . ASN A 1 318 ? 175.732 197.990 164.858 1.00 112.89 ? 318 ASN A C     1 
ATOM   2414  O O     . ASN A 1 318 ? 176.399 197.042 164.427 1.00 112.89 ? 318 ASN A O     1 
ATOM   2415  C CB    . ASN A 1 318 ? 176.541 200.342 164.525 1.00 112.89 ? 318 ASN A CB    1 
ATOM   2416  C CG    . ASN A 1 318 ? 176.624 201.514 163.573 1.00 112.89 ? 318 ASN A CG    1 
ATOM   2417  O OD1   . ASN A 1 318 ? 176.665 201.337 162.357 1.00 112.89 ? 318 ASN A OD1   1 
ATOM   2418  N ND2   . ASN A 1 318 ? 176.643 202.722 164.121 1.00 112.89 ? 318 ASN A ND2   1 
ATOM   2419  N N     . ASN A 1 319 ? 175.113 197.945 166.038 1.00 114.04 ? 319 ASN A N     1 
ATOM   2420  C CA    . ASN A 1 319 ? 175.171 196.738 166.853 1.00 114.04 ? 319 ASN A CA    1 
ATOM   2421  C C     . ASN A 1 319 ? 174.519 195.565 166.136 1.00 114.04 ? 319 ASN A C     1 
ATOM   2422  O O     . ASN A 1 319 ? 175.013 194.432 166.202 1.00 114.04 ? 319 ASN A O     1 
ATOM   2423  C CB    . ASN A 1 319 ? 174.499 196.993 168.198 1.00 114.04 ? 319 ASN A CB    1 
ATOM   2424  C CG    . ASN A 1 319 ? 175.264 197.984 169.046 1.00 114.04 ? 319 ASN A CG    1 
ATOM   2425  O OD1   . ASN A 1 319 ? 176.490 197.930 169.127 1.00 114.04 ? 319 ASN A OD1   1 
ATOM   2426  N ND2   . ASN A 1 319 ? 174.545 198.908 169.671 1.00 114.04 ? 319 ASN A ND2   1 
ATOM   2427  N N     . LEU A 1 320 ? 173.412 195.819 165.437 1.00 109.99 ? 320 LEU A N     1 
ATOM   2428  C CA    . LEU A 1 320 ? 172.783 194.771 164.642 1.00 109.99 ? 320 LEU A CA    1 
ATOM   2429  C C     . LEU A 1 320 ? 173.721 194.289 163.545 1.00 109.99 ? 320 LEU A C     1 
ATOM   2430  O O     . LEU A 1 320 ? 174.009 193.092 163.441 1.00 109.99 ? 320 LEU A O     1 
ATOM   2431  C CB    . LEU A 1 320 ? 171.473 195.279 164.045 1.00 109.99 ? 320 LEU A CB    1 
ATOM   2432  C CG    . LEU A 1 320 ? 170.368 195.579 165.053 1.00 109.99 ? 320 LEU A CG    1 
ATOM   2433  C CD1   . LEU A 1 320 ? 169.171 196.196 164.357 1.00 109.99 ? 320 LEU A CD1   1 
ATOM   2434  C CD2   . LEU A 1 320 ? 169.973 194.316 165.795 1.00 109.99 ? 320 LEU A CD2   1 
ATOM   2435  N N     . TYR A 1 321 ? 174.218 195.218 162.723 1.00 105.18 ? 321 TYR A N     1 
ATOM   2436  C CA    . TYR A 1 321 ? 175.188 194.873 161.689 1.00 105.18 ? 321 TYR A CA    1 
ATOM   2437  C C     . TYR A 1 321 ? 176.338 194.047 162.244 1.00 105.18 ? 321 TYR A C     1 
ATOM   2438  O O     . TYR A 1 321 ? 176.884 193.187 161.544 1.00 105.18 ? 321 TYR A O     1 
ATOM   2439  C CB    . TYR A 1 321 ? 175.729 196.143 161.033 1.00 105.18 ? 321 TYR A CB    1 
ATOM   2440  C CG    . TYR A 1 321 ? 174.738 196.852 160.143 1.00 105.18 ? 321 TYR A CG    1 
ATOM   2441  C CD1   . TYR A 1 321 ? 173.604 196.205 159.682 1.00 105.18 ? 321 TYR A CD1   1 
ATOM   2442  C CD2   . TYR A 1 321 ? 174.936 198.172 159.767 1.00 105.18 ? 321 TYR A CD2   1 
ATOM   2443  C CE1   . TYR A 1 321 ? 172.699 196.849 158.867 1.00 105.18 ? 321 TYR A CE1   1 
ATOM   2444  C CE2   . TYR A 1 321 ? 174.038 198.824 158.953 1.00 105.18 ? 321 TYR A CE2   1 
ATOM   2445  C CZ    . TYR A 1 321 ? 172.920 198.159 158.507 1.00 105.18 ? 321 TYR A CZ    1 
ATOM   2446  O OH    . TYR A 1 321 ? 172.019 198.807 157.696 1.00 105.18 ? 321 TYR A OH    1 
ATOM   2447  N N     . SER A 1 322 ? 176.718 194.291 163.498 1.00 106.99 ? 322 SER A N     1 
ATOM   2448  C CA    . SER A 1 322 ? 177.785 193.504 164.104 1.00 106.99 ? 322 SER A CA    1 
ATOM   2449  C C     . SER A 1 322 ? 177.304 192.109 164.487 1.00 106.99 ? 322 SER A C     1 
ATOM   2450  O O     . SER A 1 322 ? 178.026 191.125 164.296 1.00 106.99 ? 322 SER A O     1 
ATOM   2451  C CB    . SER A 1 322 ? 178.341 194.232 165.326 1.00 106.99 ? 322 SER A CB    1 
ATOM   2452  O OG    . SER A 1 322 ? 178.950 195.456 164.954 1.00 106.99 ? 322 SER A OG    1 
ATOM   2453  N N     . GLN A 1 323 ? 176.087 191.999 165.019 1.00 103.68 ? 323 GLN A N     1 
ATOM   2454  C CA    . GLN A 1 323 ? 175.609 190.741 165.579 1.00 103.68 ? 323 GLN A CA    1 
ATOM   2455  C C     . GLN A 1 323 ? 174.572 190.028 164.726 1.00 103.68 ? 323 GLN A C     1 
ATOM   2456  O O     . GLN A 1 323 ? 174.496 188.799 164.775 1.00 103.68 ? 323 GLN A O     1 
ATOM   2457  C CB    . GLN A 1 323 ? 175.014 190.978 166.971 1.00 103.68 ? 323 GLN A CB    1 
ATOM   2458  C CG    . GLN A 1 323 ? 176.025 191.450 167.995 1.00 103.68 ? 323 GLN A CG    1 
ATOM   2459  C CD    . GLN A 1 323 ? 175.398 191.704 169.347 1.00 103.68 ? 323 GLN A CD    1 
ATOM   2460  O OE1   . GLN A 1 323 ? 174.186 191.582 169.513 1.00 103.68 ? 323 GLN A OE1   1 
ATOM   2461  N NE2   . GLN A 1 323 ? 176.222 192.064 170.324 1.00 103.68 ? 323 GLN A NE2   1 
ATOM   2462  N N     . THR A 1 324 ? 173.775 190.756 163.955 1.00 109.35 ? 324 THR A N     1 
ATOM   2463  C CA    . THR A 1 324 ? 172.691 190.150 163.199 1.00 109.35 ? 324 THR A CA    1 
ATOM   2464  C C     . THR A 1 324 ? 173.223 189.526 161.909 1.00 109.35 ? 324 THR A C     1 
ATOM   2465  O O     . THR A 1 324 ? 174.279 189.902 161.394 1.00 109.35 ? 324 THR A O     1 
ATOM   2466  C CB    . THR A 1 324 ? 171.623 191.203 162.888 1.00 109.35 ? 324 THR A CB    1 
ATOM   2467  O OG1   . THR A 1 324 ? 171.209 191.828 164.108 1.00 109.35 ? 324 THR A OG1   1 
ATOM   2468  C CG2   . THR A 1 324 ? 170.403 190.585 162.225 1.00 109.35 ? 324 THR A CG2   1 
ATOM   2469  N N     . GLN A 1 325 ? 172.471 188.553 161.389 1.00 107.34 ? 325 GLN A N     1 
ATOM   2470  C CA    . GLN A 1 325 ? 172.776 187.954 160.096 1.00 107.34 ? 325 GLN A CA    1 
ATOM   2471  C C     . GLN A 1 325 ? 172.768 188.963 158.954 1.00 107.34 ? 325 GLN A C     1 
ATOM   2472  O O     . GLN A 1 325 ? 173.131 188.599 157.831 1.00 107.34 ? 325 GLN A O     1 
ATOM   2473  C CB    . GLN A 1 325 ? 171.781 186.835 159.789 1.00 107.34 ? 325 GLN A CB    1 
ATOM   2474  C CG    . GLN A 1 325 ? 171.872 185.640 160.718 1.00 107.34 ? 325 GLN A CG    1 
ATOM   2475  C CD    . GLN A 1 325 ? 173.157 184.861 160.535 1.00 107.34 ? 325 GLN A CD    1 
ATOM   2476  O OE1   . GLN A 1 325 ? 173.633 184.686 159.415 1.00 107.34 ? 325 GLN A OE1   1 
ATOM   2477  N NE2   . GLN A 1 325 ? 173.726 184.388 161.637 1.00 107.34 ? 325 GLN A NE2   1 
ATOM   2478  N N     . LEU A 1 326 ? 172.362 190.211 159.205 1.00 99.92  ? 326 LEU A N     1 
ATOM   2479  C CA    . LEU A 1 326 ? 172.312 191.215 158.149 1.00 99.92  ? 326 LEU A CA    1 
ATOM   2480  C C     . LEU A 1 326 ? 173.669 191.463 157.506 1.00 99.92  ? 326 LEU A C     1 
ATOM   2481  O O     . LEU A 1 326 ? 173.729 192.021 156.405 1.00 99.92  ? 326 LEU A O     1 
ATOM   2482  C CB    . LEU A 1 326 ? 171.757 192.526 158.702 1.00 99.92  ? 326 LEU A CB    1 
ATOM   2483  C CG    . LEU A 1 326 ? 170.299 192.467 159.150 1.00 99.92  ? 326 LEU A CG    1 
ATOM   2484  C CD1   . LEU A 1 326 ? 169.885 193.772 159.803 1.00 99.92  ? 326 LEU A CD1   1 
ATOM   2485  C CD2   . LEU A 1 326 ? 169.397 192.139 157.977 1.00 99.92  ? 326 LEU A CD2   1 
ATOM   2486  N N     . GLN A 1 327 ? 174.758 191.076 158.164 1.00 98.84  ? 327 GLN A N     1 
ATOM   2487  C CA    . GLN A 1 327 ? 176.096 191.171 157.591 1.00 98.84  ? 327 GLN A CA    1 
ATOM   2488  C C     . GLN A 1 327 ? 176.759 189.807 157.713 1.00 98.84  ? 327 GLN A C     1 
ATOM   2489  O O     . GLN A 1 327 ? 177.051 189.354 158.824 1.00 98.84  ? 327 GLN A O     1 
ATOM   2490  C CB    . GLN A 1 327 ? 176.926 192.248 158.286 1.00 98.84  ? 327 GLN A CB    1 
ATOM   2491  C CG    . GLN A 1 327 ? 178.298 192.444 157.674 1.00 98.84  ? 327 GLN A CG    1 
ATOM   2492  C CD    . GLN A 1 327 ? 179.066 193.576 158.319 1.00 98.84  ? 327 GLN A CD    1 
ATOM   2493  O OE1   . GLN A 1 327 ? 178.586 194.212 159.256 1.00 98.84  ? 327 GLN A OE1   1 
ATOM   2494  N NE2   . GLN A 1 327 ? 180.269 193.835 157.820 1.00 98.84  ? 327 GLN A NE2   1 
ATOM   2495  N N     . VAL A 1 328 ? 176.996 189.158 156.577 1.00 97.06  ? 328 VAL A N     1 
ATOM   2496  C CA    . VAL A 1 328 ? 177.578 187.825 156.543 1.00 97.06  ? 328 VAL A CA    1 
ATOM   2497  C C     . VAL A 1 328 ? 178.709 187.813 155.525 1.00 97.06  ? 328 VAL A C     1 
ATOM   2498  O O     . VAL A 1 328 ? 178.701 188.571 154.550 1.00 97.06  ? 328 VAL A O     1 
ATOM   2499  C CB    . VAL A 1 328 ? 176.516 186.753 156.209 1.00 97.06  ? 328 VAL A CB    1 
ATOM   2500  C CG1   . VAL A 1 328 ? 176.017 186.923 154.787 1.00 97.06  ? 328 VAL A CG1   1 
ATOM   2501  C CG2   . VAL A 1 328 ? 177.062 185.355 156.433 1.00 97.06  ? 328 VAL A CG2   1 
ATOM   2502  N N     . SER A 1 329 ? 179.696 186.954 155.765 1.00 101.92 ? 329 SER A N     1 
ATOM   2503  C CA    . SER A 1 329 ? 180.844 186.832 154.885 1.00 101.92 ? 329 SER A CA    1 
ATOM   2504  C C     . SER A 1 329 ? 180.560 185.813 153.783 1.00 101.92 ? 329 SER A C     1 
ATOM   2505  O O     . SER A 1 329 ? 179.459 185.271 153.668 1.00 101.92 ? 329 SER A O     1 
ATOM   2506  C CB    . SER A 1 329 ? 182.085 186.448 155.685 1.00 101.92 ? 329 SER A CB    1 
ATOM   2507  O OG    . SER A 1 329 ? 181.945 185.156 156.248 1.00 101.92 ? 329 SER A OG    1 
ATOM   2508  N N     . PHE A 1 330 ? 181.572 185.544 152.960 1.00 98.00  ? 330 PHE A N     1 
ATOM   2509  C CA    . PHE A 1 330 ? 181.408 184.638 151.832 1.00 98.00  ? 330 PHE A CA    1 
ATOM   2510  C C     . PHE A 1 330 ? 182.775 184.130 151.402 1.00 98.00  ? 330 PHE A C     1 
ATOM   2511  O O     . PHE A 1 330 ? 183.682 184.927 151.148 1.00 98.00  ? 330 PHE A O     1 
ATOM   2512  C CB    . PHE A 1 330 ? 180.707 185.344 150.671 1.00 98.00  ? 330 PHE A CB    1 
ATOM   2513  C CG    . PHE A 1 330 ? 180.382 184.442 149.524 1.00 98.00  ? 330 PHE A CG    1 
ATOM   2514  C CD1   . PHE A 1 330 ? 179.298 183.586 149.589 1.00 98.00  ? 330 PHE A CD1   1 
ATOM   2515  C CD2   . PHE A 1 330 ? 181.158 184.444 148.383 1.00 98.00  ? 330 PHE A CD2   1 
ATOM   2516  C CE1   . PHE A 1 330 ? 178.994 182.754 148.534 1.00 98.00  ? 330 PHE A CE1   1 
ATOM   2517  C CE2   . PHE A 1 330 ? 180.859 183.613 147.326 1.00 98.00  ? 330 PHE A CE2   1 
ATOM   2518  C CZ    . PHE A 1 330 ? 179.775 182.768 147.401 1.00 98.00  ? 330 PHE A CZ    1 
ATOM   2519  N N     . GLY A 1 331 ? 182.918 182.809 151.327 1.00 100.21 ? 331 GLY A N     1 
ATOM   2520  C CA    . GLY A 1 331 ? 184.187 182.176 151.019 1.00 100.21 ? 331 GLY A CA    1 
ATOM   2521  C C     . GLY A 1 331 ? 184.465 181.918 149.551 1.00 100.21 ? 331 GLY A C     1 
ATOM   2522  O O     . GLY A 1 331 ? 184.348 180.776 149.096 1.00 100.21 ? 331 GLY A O     1 
ATOM   2523  N N     . ILE A 1 332 ? 184.819 182.958 148.793 1.00 97.48  ? 332 ILE A N     1 
ATOM   2524  C CA    . ILE A 1 332 ? 185.164 182.765 147.389 1.00 97.48  ? 332 ILE A CA    1 
ATOM   2525  C C     . ILE A 1 332 ? 186.344 181.813 147.271 1.00 97.48  ? 332 ILE A C     1 
ATOM   2526  O O     . ILE A 1 332 ? 187.379 181.993 147.924 1.00 97.48  ? 332 ILE A O     1 
ATOM   2527  C CB    . ILE A 1 332 ? 185.471 184.112 146.719 1.00 97.48  ? 332 ILE A CB    1 
ATOM   2528  C CG1   . ILE A 1 332 ? 184.219 184.983 146.674 1.00 97.48  ? 332 ILE A CG1   1 
ATOM   2529  C CG2   . ILE A 1 332 ? 186.015 183.900 145.321 1.00 97.48  ? 332 ILE A CG2   1 
ATOM   2530  C CD1   . ILE A 1 332 ? 184.487 186.398 146.232 1.00 97.48  ? 332 ILE A CD1   1 
ATOM   2531  N N     . ASN A 1 333 ? 186.189 180.789 146.433 1.00 101.08 ? 333 ASN A N     1 
ATOM   2532  C CA    . ASN A 1 333 ? 187.258 179.822 146.191 1.00 101.08 ? 333 ASN A CA    1 
ATOM   2533  C C     . ASN A 1 333 ? 186.978 179.150 144.854 1.00 101.08 ? 333 ASN A C     1 
ATOM   2534  O O     . ASN A 1 333 ? 186.017 178.385 144.740 1.00 101.08 ? 333 ASN A O     1 
ATOM   2535  C CB    . ASN A 1 333 ? 187.331 178.799 147.317 1.00 101.08 ? 333 ASN A CB    1 
ATOM   2536  C CG    . ASN A 1 333 ? 188.543 177.899 147.206 1.00 101.08 ? 333 ASN A CG    1 
ATOM   2537  O OD1   . ASN A 1 333 ? 189.337 178.021 146.275 1.00 101.08 ? 333 ASN A OD1   1 
ATOM   2538  N ND2   . ASN A 1 333 ? 188.688 176.985 148.156 1.00 101.08 ? 333 ASN A ND2   1 
ATOM   2539  N N     . MET A 1 334 ? 187.819 179.419 143.860 1.00 102.88 ? 334 MET A N     1 
ATOM   2540  C CA    . MET A 1 334 ? 187.592 178.962 142.493 1.00 102.88 ? 334 MET A CA    1 
ATOM   2541  C C     . MET A 1 334 ? 188.361 177.668 142.255 1.00 102.88 ? 334 MET A C     1 
ATOM   2542  O O     . MET A 1 334 ? 189.594 177.672 142.200 1.00 102.88 ? 334 MET A O     1 
ATOM   2543  C CB    . MET A 1 334 ? 188.012 180.035 141.493 1.00 102.88 ? 334 MET A CB    1 
ATOM   2544  C CG    . MET A 1 334 ? 187.152 181.280 141.532 1.00 102.88 ? 334 MET A CG    1 
ATOM   2545  S SD    . MET A 1 334 ? 187.684 182.519 140.340 1.00 102.88 ? 334 MET A SD    1 
ATOM   2546  C CE    . MET A 1 334 ? 186.547 183.848 140.713 1.00 102.88 ? 334 MET A CE    1 
ATOM   2547  N N     . VAL A 1 335 ? 187.630 176.566 142.108 1.00 99.64  ? 335 VAL A N     1 
ATOM   2548  C CA    . VAL A 1 335 ? 188.205 175.261 141.801 1.00 99.64  ? 335 VAL A CA    1 
ATOM   2549  C C     . VAL A 1 335 ? 187.285 174.556 140.815 1.00 99.64  ? 335 VAL A C     1 
ATOM   2550  O O     . VAL A 1 335 ? 186.074 174.475 141.042 1.00 99.64  ? 335 VAL A O     1 
ATOM   2551  C CB    . VAL A 1 335 ? 188.395 174.396 143.062 1.00 99.64  ? 335 VAL A CB    1 
ATOM   2552  C CG1   . VAL A 1 335 ? 188.839 172.999 142.678 1.00 99.64  ? 335 VAL A CG1   1 
ATOM   2553  C CG2   . VAL A 1 335 ? 189.407 175.026 144.001 1.00 99.64  ? 335 VAL A CG2   1 
ATOM   2554  N N     . ALA A 1 336 ? 187.853 174.045 139.726 1.00 99.57  ? 336 ALA A N     1 
ATOM   2555  C CA    . ALA A 1 336 ? 187.079 173.332 138.722 1.00 99.57  ? 336 ALA A CA    1 
ATOM   2556  C C     . ALA A 1 336 ? 187.998 172.373 137.976 1.00 99.57  ? 336 ALA A C     1 
ATOM   2557  O O     . ALA A 1 336 ? 189.201 172.303 138.238 1.00 99.57  ? 336 ALA A O     1 
ATOM   2558  C CB    . ALA A 1 336 ? 186.389 174.306 137.765 1.00 99.57  ? 336 ALA A CB    1 
ATOM   2559  N N     . LEU A 1 337 ? 187.418 171.632 137.037 1.00 103.49 ? 337 LEU A N     1 
ATOM   2560  C CA    . LEU A 1 337 ? 188.145 170.639 136.260 1.00 103.49 ? 337 LEU A CA    1 
ATOM   2561  C C     . LEU A 1 337 ? 188.589 171.230 134.930 1.00 103.49 ? 337 LEU A C     1 
ATOM   2562  O O     . LEU A 1 337 ? 187.807 171.884 134.237 1.00 103.49 ? 337 LEU A O     1 
ATOM   2563  C CB    . LEU A 1 337 ? 187.282 169.402 136.011 1.00 103.49 ? 337 LEU A CB    1 
ATOM   2564  C CG    . LEU A 1 337 ? 186.943 168.573 137.247 1.00 103.49 ? 337 LEU A CG    1 
ATOM   2565  C CD1   . LEU A 1 337 ? 185.973 167.459 136.895 1.00 103.49 ? 337 LEU A CD1   1 
ATOM   2566  C CD2   . LEU A 1 337 ? 188.210 168.011 137.864 1.00 103.49 ? 337 LEU A CD2   1 
ATOM   2567  N N     . HIS A 1 338 ? 189.847 170.982 134.574 1.00 103.85 ? 338 HIS A N     1 
ATOM   2568  C CA    . HIS A 1 338 ? 190.437 171.515 133.354 1.00 103.85 ? 338 HIS A CA    1 
ATOM   2569  C C     . HIS A 1 338 ? 190.690 170.437 132.311 1.00 103.85 ? 338 HIS A C     1 
ATOM   2570  O O     . HIS A 1 338 ? 190.374 170.628 131.134 1.00 103.85 ? 338 HIS A O     1 
ATOM   2571  C CB    . HIS A 1 338 ? 191.741 172.251 133.691 1.00 103.85 ? 338 HIS A CB    1 
ATOM   2572  C CG    . HIS A 1 338 ? 192.353 172.964 132.527 1.00 103.85 ? 338 HIS A CG    1 
ATOM   2573  N ND1   . HIS A 1 338 ? 191.802 174.104 131.982 1.00 103.85 ? 338 HIS A ND1   1 
ATOM   2574  C CD2   . HIS A 1 338 ? 193.479 172.715 131.819 1.00 103.85 ? 338 HIS A CD2   1 
ATOM   2575  C CE1   . HIS A 1 338 ? 192.555 174.518 130.979 1.00 103.85 ? 338 HIS A CE1   1 
ATOM   2576  N NE2   . HIS A 1 338 ? 193.578 173.691 130.858 1.00 103.85 ? 338 HIS A NE2   1 
ATOM   2577  N N     . HIS A 1 339 ? 191.265 169.307 132.714 1.00 111.21 ? 339 HIS A N     1 
ATOM   2578  C CA    . HIS A 1 339 ? 191.348 168.118 131.871 1.00 111.21 ? 339 HIS A CA    1 
ATOM   2579  C C     . HIS A 1 339 ? 191.046 166.876 132.694 1.00 111.21 ? 339 HIS A C     1 
ATOM   2580  O O     . HIS A 1 339 ? 191.724 165.850 132.579 1.00 111.21 ? 339 HIS A O     1 
ATOM   2581  C CB    . HIS A 1 339 ? 192.714 167.994 131.196 1.00 111.21 ? 339 HIS A CB    1 
ATOM   2582  C CG    . HIS A 1 339 ? 192.989 169.063 130.185 1.00 111.21 ? 339 HIS A CG    1 
ATOM   2583  N ND1   . HIS A 1 339 ? 192.355 169.112 128.961 1.00 111.21 ? 339 HIS A ND1   1 
ATOM   2584  C CD2   . HIS A 1 339 ? 193.849 170.107 130.204 1.00 111.21 ? 339 HIS A CD2   1 
ATOM   2585  C CE1   . HIS A 1 339 ? 192.799 170.153 128.279 1.00 111.21 ? 339 HIS A CE1   1 
ATOM   2586  N NE2   . HIS A 1 339 ? 193.706 170.774 129.012 1.00 111.21 ? 339 HIS A NE2   1 
ATOM   2587  N N     . GLY A 1 340 ? 190.019 166.953 133.534 1.00 109.87 ? 340 GLY A N     1 
ATOM   2588  C CA    . GLY A 1 340 ? 189.730 165.874 134.453 1.00 109.87 ? 340 GLY A CA    1 
ATOM   2589  C C     . GLY A 1 340 ? 190.538 165.909 135.725 1.00 109.87 ? 340 GLY A C     1 
ATOM   2590  O O     . GLY A 1 340 ? 190.679 164.875 136.384 1.00 109.87 ? 340 GLY A O     1 
ATOM   2591  N N     . GLN A 1 341 ? 191.082 167.070 136.089 1.00 112.42 ? 341 GLN A N     1 
ATOM   2592  C CA    . GLN A 1 341 ? 191.903 167.218 137.278 1.00 112.42 ? 341 GLN A CA    1 
ATOM   2593  C C     . GLN A 1 341 ? 191.623 168.576 137.908 1.00 112.42 ? 341 GLN A C     1 
ATOM   2594  O O     . GLN A 1 341 ? 191.526 169.584 137.191 1.00 112.42 ? 341 GLN A O     1 
ATOM   2595  C CB    . GLN A 1 341 ? 193.393 167.094 136.949 1.00 112.42 ? 341 GLN A CB    1 
ATOM   2596  C CG    . GLN A 1 341 ? 193.808 165.716 136.470 1.00 112.42 ? 341 GLN A CG    1 
ATOM   2597  C CD    . GLN A 1 341 ? 195.270 165.647 136.100 1.00 112.42 ? 341 GLN A CD    1 
ATOM   2598  O OE1   . GLN A 1 341 ? 195.980 166.651 136.138 1.00 112.42 ? 341 GLN A OE1   1 
ATOM   2599  N NE2   . GLN A 1 341 ? 195.729 164.458 135.733 1.00 112.42 ? 341 GLN A NE2   1 
ATOM   2600  N N     . PRO A 1 342 ? 191.478 168.634 139.230 1.00 99.96  ? 342 PRO A N     1 
ATOM   2601  C CA    . PRO A 1 342 ? 191.199 169.915 139.889 1.00 99.96  ? 342 PRO A CA    1 
ATOM   2602  C C     . PRO A 1 342 ? 192.404 170.841 139.821 1.00 99.96  ? 342 PRO A C     1 
ATOM   2603  O O     . PRO A 1 342 ? 193.528 170.443 140.132 1.00 99.96  ? 342 PRO A O     1 
ATOM   2604  C CB    . PRO A 1 342 ? 190.885 169.509 141.331 1.00 99.96  ? 342 PRO A CB    1 
ATOM   2605  C CG    . PRO A 1 342 ? 190.505 168.067 141.247 1.00 99.96  ? 342 PRO A CG    1 
ATOM   2606  C CD    . PRO A 1 342 ? 191.356 167.502 140.156 1.00 99.96  ? 342 PRO A CD    1 
ATOM   2607  N N     . LYS A 1 343 ? 192.159 172.087 139.419 1.00 98.59  ? 343 LYS A N     1 
ATOM   2608  C CA    . LYS A 1 343 ? 193.202 173.101 139.353 1.00 98.59  ? 343 LYS A CA    1 
ATOM   2609  C C     . LYS A 1 343 ? 192.611 174.451 139.721 1.00 98.59  ? 343 LYS A C     1 
ATOM   2610  O O     . LYS A 1 343 ? 191.567 174.839 139.190 1.00 98.59  ? 343 LYS A O     1 
ATOM   2611  C CB    . LYS A 1 343 ? 193.827 173.167 137.955 1.00 98.59  ? 343 LYS A CB    1 
ATOM   2612  C CG    . LYS A 1 343 ? 194.720 171.987 137.607 1.00 98.59  ? 343 LYS A CG    1 
ATOM   2613  C CD    . LYS A 1 343 ? 195.208 172.056 136.170 1.00 98.59  ? 343 LYS A CD    1 
ATOM   2614  C CE    . LYS A 1 343 ? 196.541 172.779 136.064 1.00 98.59  ? 343 LYS A CE    1 
ATOM   2615  N NZ    . LYS A 1 343 ? 196.417 174.242 136.307 1.00 98.59  ? 343 LYS A NZ    1 
ATOM   2616  N N     . ILE A 1 344 ? 193.280 175.162 140.626 1.00 99.45  ? 344 ILE A N     1 
ATOM   2617  C CA    . ILE A 1 344 ? 192.856 176.511 140.986 1.00 99.45  ? 344 ILE A CA    1 
ATOM   2618  C C     . ILE A 1 344 ? 193.138 177.437 139.813 1.00 99.45  ? 344 ILE A C     1 
ATOM   2619  O O     . ILE A 1 344 ? 194.293 177.624 139.414 1.00 99.45  ? 344 ILE A O     1 
ATOM   2620  C CB    . ILE A 1 344 ? 193.564 176.995 142.257 1.00 99.45  ? 344 ILE A CB    1 
ATOM   2621  C CG1   . ILE A 1 344 ? 193.138 176.159 143.464 1.00 99.45  ? 344 ILE A CG1   1 
ATOM   2622  C CG2   . ILE A 1 344 ? 193.272 178.462 142.494 1.00 99.45  ? 344 ILE A CG2   1 
ATOM   2623  C CD1   . ILE A 1 344 ? 194.022 174.961 143.727 1.00 99.45  ? 344 ILE A CD1   1 
ATOM   2624  N N     . MET A 1 345 ? 192.084 178.025 139.258 1.00 110.00 ? 345 MET A N     1 
ATOM   2625  C CA    . MET A 1 345 ? 192.174 178.793 138.027 1.00 110.00 ? 345 MET A CA    1 
ATOM   2626  C C     . MET A 1 345 ? 191.605 180.188 138.240 1.00 110.00 ? 345 MET A C     1 
ATOM   2627  O O     . MET A 1 345 ? 190.577 180.355 138.903 1.00 110.00 ? 345 MET A O     1 
ATOM   2628  C CB    . MET A 1 345 ? 191.430 178.080 136.897 1.00 110.00 ? 345 MET A CB    1 
ATOM   2629  C CG    . MET A 1 345 ? 192.018 176.719 136.559 1.00 110.00 ? 345 MET A CG    1 
ATOM   2630  S SD    . MET A 1 345 ? 191.094 175.819 135.302 1.00 110.00 ? 345 MET A SD    1 
ATOM   2631  C CE    . MET A 1 345 ? 191.508 176.765 133.842 1.00 110.00 ? 345 MET A CE    1 
ATOM   2632  N N     . ASN A 1 346 ? 192.279 181.185 137.676 1.00 106.14 ? 346 ASN A N     1 
ATOM   2633  C CA    . ASN A 1 346 ? 191.844 182.568 137.779 1.00 106.14 ? 346 ASN A CA    1 
ATOM   2634  C C     . ASN A 1 346 ? 190.952 182.927 136.590 1.00 106.14 ? 346 ASN A C     1 
ATOM   2635  O O     . ASN A 1 346 ? 190.512 182.062 135.828 1.00 106.14 ? 346 ASN A O     1 
ATOM   2636  C CB    . ASN A 1 346 ? 193.053 183.493 137.899 1.00 106.14 ? 346 ASN A CB    1 
ATOM   2637  C CG    . ASN A 1 346 ? 193.987 183.393 136.711 1.00 106.14 ? 346 ASN A CG    1 
ATOM   2638  O OD1   . ASN A 1 346 ? 193.704 182.703 135.733 1.00 106.14 ? 346 ASN A OD1   1 
ATOM   2639  N ND2   . ASN A 1 346 ? 195.115 184.087 136.793 1.00 106.14 ? 346 ASN A ND2   1 
ATOM   2640  N N     . LEU A 1 347 ? 190.685 184.222 136.420 1.00 106.31 ? 347 LEU A N     1 
ATOM   2641  C CA    . LEU A 1 347 ? 189.722 184.667 135.417 1.00 106.31 ? 347 LEU A CA    1 
ATOM   2642  C C     . LEU A 1 347 ? 190.250 184.461 134.001 1.00 106.31 ? 347 LEU A C     1 
ATOM   2643  O O     . LEU A 1 347 ? 189.544 183.925 133.131 1.00 106.31 ? 347 LEU A O     1 
ATOM   2644  C CB    . LEU A 1 347 ? 189.384 186.137 135.658 1.00 106.31 ? 347 LEU A CB    1 
ATOM   2645  C CG    . LEU A 1 347 ? 188.330 186.764 134.753 1.00 106.31 ? 347 LEU A CG    1 
ATOM   2646  C CD1   . LEU A 1 347 ? 186.994 186.082 134.958 1.00 106.31 ? 347 LEU A CD1   1 
ATOM   2647  C CD2   . LEU A 1 347 ? 188.222 188.251 135.024 1.00 106.31 ? 347 LEU A CD2   1 
ATOM   2648  N N     . LYS A 1 348 ? 191.489 184.891 133.751 1.00 102.34 ? 348 LYS A N     1 
ATOM   2649  C CA    . LYS A 1 348 ? 192.048 184.822 132.405 1.00 102.34 ? 348 LYS A CA    1 
ATOM   2650  C C     . LYS A 1 348 ? 192.032 183.398 131.869 1.00 102.34 ? 348 LYS A C     1 
ATOM   2651  O O     . LYS A 1 348 ? 191.749 183.173 130.685 1.00 102.34 ? 348 LYS A O     1 
ATOM   2652  C CB    . LYS A 1 348 ? 193.469 185.381 132.406 1.00 102.34 ? 348 LYS A CB    1 
ATOM   2653  C CG    . LYS A 1 348 ? 194.107 185.453 131.034 1.00 102.34 ? 348 LYS A CG    1 
ATOM   2654  C CD    . LYS A 1 348 ? 195.481 186.091 131.102 1.00 102.34 ? 348 LYS A CD    1 
ATOM   2655  C CE    . LYS A 1 348 ? 196.125 186.151 129.729 1.00 102.34 ? 348 LYS A CE    1 
ATOM   2656  N NZ    . LYS A 1 348 ? 197.476 186.769 129.777 1.00 102.34 ? 348 LYS A NZ    1 
ATOM   2657  N N     . ASP A 1 349 ? 192.323 182.421 132.729 1.00 104.29 ? 349 ASP A N     1 
ATOM   2658  C CA    . ASP A 1 349 ? 192.315 181.030 132.294 1.00 104.29 ? 349 ASP A CA    1 
ATOM   2659  C C     . ASP A 1 349 ? 190.922 180.600 131.858 1.00 104.29 ? 349 ASP A C     1 
ATOM   2660  O O     . ASP A 1 349 ? 190.762 179.926 130.831 1.00 104.29 ? 349 ASP A O     1 
ATOM   2661  C CB    . ASP A 1 349 ? 192.829 180.136 133.419 1.00 104.29 ? 349 ASP A CB    1 
ATOM   2662  C CG    . ASP A 1 349 ? 194.284 180.392 133.741 1.00 104.29 ? 349 ASP A CG    1 
ATOM   2663  O OD1   . ASP A 1 349 ? 195.027 180.814 132.832 1.00 104.29 ? 349 ASP A OD1   1 
ATOM   2664  O OD2   . ASP A 1 349 ? 194.685 180.173 134.903 1.00 104.29 ? 349 ASP A OD2   1 
ATOM   2665  N N     . ILE A 1 350 ? 189.901 180.985 132.625 1.00 93.23  ? 350 ILE A N     1 
ATOM   2666  C CA    . ILE A 1 350 ? 188.529 180.639 132.272 1.00 93.23  ? 350 ILE A CA    1 
ATOM   2667  C C     . ILE A 1 350 ? 188.166 181.233 130.918 1.00 93.23  ? 350 ILE A C     1 
ATOM   2668  O O     . ILE A 1 350 ? 187.584 180.560 130.055 1.00 93.23  ? 350 ILE A O     1 
ATOM   2669  C CB    . ILE A 1 350 ? 187.560 181.109 133.371 1.00 93.23  ? 350 ILE A CB    1 
ATOM   2670  C CG1   . ILE A 1 350 ? 187.846 180.374 134.678 1.00 93.23  ? 350 ILE A CG1   1 
ATOM   2671  C CG2   . ILE A 1 350 ? 186.122 180.896 132.945 1.00 93.23  ? 350 ILE A CG2   1 
ATOM   2672  C CD1   . ILE A 1 350 ? 187.106 180.940 135.860 1.00 93.23  ? 350 ILE A CD1   1 
ATOM   2673  N N     . ILE A 1 351 ? 188.511 182.505 130.709 1.00 94.74  ? 351 ILE A N     1 
ATOM   2674  C CA    . ILE A 1 351 ? 188.165 183.155 129.448 1.00 94.74  ? 351 ILE A CA    1 
ATOM   2675  C C     . ILE A 1 351 ? 188.873 182.477 128.280 1.00 94.74  ? 351 ILE A C     1 
ATOM   2676  O O     . ILE A 1 351 ? 188.272 182.237 127.221 1.00 94.74  ? 351 ILE A O     1 
ATOM   2677  C CB    . ILE A 1 351 ? 188.482 184.657 129.519 1.00 94.74  ? 351 ILE A CB    1 
ATOM   2678  C CG1   . ILE A 1 351 ? 187.580 185.329 130.552 1.00 94.74  ? 351 ILE A CG1   1 
ATOM   2679  C CG2   . ILE A 1 351 ? 188.307 185.304 128.163 1.00 94.74  ? 351 ILE A CG2   1 
ATOM   2680  C CD1   . ILE A 1 351 ? 187.969 186.749 130.862 1.00 94.74  ? 351 ILE A CD1   1 
ATOM   2681  N N     . ALA A 1 352 ? 190.156 182.151 128.453 1.00 99.29  ? 352 ALA A N     1 
ATOM   2682  C CA    . ALA A 1 352 ? 190.890 181.481 127.385 1.00 99.29  ? 352 ALA A CA    1 
ATOM   2683  C C     . ALA A 1 352 ? 190.270 180.130 127.053 1.00 99.29  ? 352 ALA A C     1 
ATOM   2684  O O     . ALA A 1 352 ? 190.123 179.776 125.875 1.00 99.29  ? 352 ALA A O     1 
ATOM   2685  C CB    . ALA A 1 352 ? 192.357 181.317 127.778 1.00 99.29  ? 352 ALA A CB    1 
ATOM   2686  N N     . ALA A 1 353 ? 189.901 179.361 128.081 1.00 92.76  ? 353 ALA A N     1 
ATOM   2687  C CA    . ALA A 1 353 ? 189.280 178.063 127.840 1.00 92.76  ? 353 ALA A CA    1 
ATOM   2688  C C     . ALA A 1 353 ? 187.969 178.214 127.083 1.00 92.76  ? 353 ALA A C     1 
ATOM   2689  O O     . ALA A 1 353 ? 187.685 177.448 126.151 1.00 92.76  ? 353 ALA A O     1 
ATOM   2690  C CB    . ALA A 1 353 ? 189.053 177.337 129.165 1.00 92.76  ? 353 ALA A CB    1 
ATOM   2691  N N     . PHE A 1 354 ? 187.156 179.198 127.472 1.00 85.15  ? 354 PHE A N     1 
ATOM   2692  C CA    . PHE A 1 354 ? 185.899 179.442 126.773 1.00 85.15  ? 354 PHE A CA    1 
ATOM   2693  C C     . PHE A 1 354 ? 186.142 179.742 125.300 1.00 85.15  ? 354 PHE A C     1 
ATOM   2694  O O     . PHE A 1 354 ? 185.475 179.184 124.417 1.00 85.15  ? 354 PHE A O     1 
ATOM   2695  C CB    . PHE A 1 354 ? 185.155 180.595 127.443 1.00 85.15  ? 354 PHE A CB    1 
ATOM   2696  C CG    . PHE A 1 354 ? 183.840 180.919 126.807 1.00 85.15  ? 354 PHE A CG    1 
ATOM   2697  C CD1   . PHE A 1 354 ? 182.736 180.118 127.024 1.00 85.15  ? 354 PHE A CD1   1 
ATOM   2698  C CD2   . PHE A 1 354 ? 183.706 182.030 125.996 1.00 85.15  ? 354 PHE A CD2   1 
ATOM   2699  C CE1   . PHE A 1 354 ? 181.523 180.418 126.441 1.00 85.15  ? 354 PHE A CE1   1 
ATOM   2700  C CE2   . PHE A 1 354 ? 182.496 182.334 125.411 1.00 85.15  ? 354 PHE A CE2   1 
ATOM   2701  C CZ    . PHE A 1 354 ? 181.403 181.527 125.633 1.00 85.15  ? 354 PHE A CZ    1 
ATOM   2702  N N     . VAL A 1 355 ? 187.106 180.620 125.017 1.00 89.86  ? 355 VAL A N     1 
ATOM   2703  C CA    . VAL A 1 355 ? 187.378 180.995 123.632 1.00 89.86  ? 355 VAL A CA    1 
ATOM   2704  C C     . VAL A 1 355 ? 187.840 179.787 122.825 1.00 89.86  ? 355 VAL A C     1 
ATOM   2705  O O     . VAL A 1 355 ? 187.412 179.586 121.680 1.00 89.86  ? 355 VAL A O     1 
ATOM   2706  C CB    . VAL A 1 355 ? 188.406 182.138 123.585 1.00 89.86  ? 355 VAL A CB    1 
ATOM   2707  C CG1   . VAL A 1 355 ? 188.818 182.416 122.155 1.00 89.86  ? 355 VAL A CG1   1 
ATOM   2708  C CG2   . VAL A 1 355 ? 187.821 183.384 124.214 1.00 89.86  ? 355 VAL A CG2   1 
ATOM   2709  N N     . ARG A 1 356 ? 188.721 178.967 123.403 1.00 96.77  ? 356 ARG A N     1 
ATOM   2710  C CA    . ARG A 1 356 ? 189.205 177.792 122.683 1.00 96.77  ? 356 ARG A CA    1 
ATOM   2711  C C     . ARG A 1 356 ? 188.068 176.823 122.379 1.00 96.77  ? 356 ARG A C     1 
ATOM   2712  O O     . ARG A 1 356 ? 187.963 176.301 121.257 1.00 96.77  ? 356 ARG A O     1 
ATOM   2713  C CB    . ARG A 1 356 ? 190.296 177.097 123.493 1.00 96.77  ? 356 ARG A CB    1 
ATOM   2714  C CG    . ARG A 1 356 ? 191.534 177.943 123.702 1.00 96.77  ? 356 ARG A CG    1 
ATOM   2715  C CD    . ARG A 1 356 ? 192.276 178.154 122.400 1.00 96.77  ? 356 ARG A CD    1 
ATOM   2716  N NE    . ARG A 1 356 ? 192.728 176.889 121.830 1.00 96.77  ? 356 ARG A NE    1 
ATOM   2717  C CZ    . ARG A 1 356 ? 193.864 176.287 122.162 1.00 96.77  ? 356 ARG A CZ    1 
ATOM   2718  N NH1   . ARG A 1 356 ? 194.199 175.137 121.594 1.00 96.77  ? 356 ARG A NH1   1 
ATOM   2719  N NH2   . ARG A 1 356 ? 194.665 176.833 123.066 1.00 96.77  ? 356 ARG A NH2   1 
ATOM   2720  N N     . HIS A 1 357 ? 187.217 176.562 123.374 1.00 90.26  ? 357 HIS A N     1 
ATOM   2721  C CA    . HIS A 1 357 ? 186.067 175.692 123.157 1.00 90.26  ? 357 HIS A CA    1 
ATOM   2722  C C     . HIS A 1 357 ? 185.195 176.210 122.023 1.00 90.26  ? 357 HIS A C     1 
ATOM   2723  O O     . HIS A 1 357 ? 184.765 175.440 121.150 1.00 90.26  ? 357 HIS A O     1 
ATOM   2724  C CB    . HIS A 1 357 ? 185.260 175.581 124.449 1.00 90.26  ? 357 HIS A CB    1 
ATOM   2725  C CG    . HIS A 1 357 ? 184.131 174.604 124.375 1.00 90.26  ? 357 HIS A CG    1 
ATOM   2726  N ND1   . HIS A 1 357 ? 182.882 174.946 123.904 1.00 90.26  ? 357 HIS A ND1   1 
ATOM   2727  C CD2   . HIS A 1 357 ? 184.058 173.298 124.721 1.00 90.26  ? 357 HIS A CD2   1 
ATOM   2728  C CE1   . HIS A 1 357 ? 182.090 173.890 123.958 1.00 90.26  ? 357 HIS A CE1   1 
ATOM   2729  N NE2   . HIS A 1 357 ? 182.779 172.877 124.450 1.00 90.26  ? 357 HIS A NE2   1 
ATOM   2730  N N     . ARG A 1 358 ? 184.934 177.519 122.013 1.00 89.62  ? 358 ARG A N     1 
ATOM   2731  C CA    . ARG A 1 358 ? 184.079 178.083 120.976 1.00 89.62  ? 358 ARG A CA    1 
ATOM   2732  C C     . ARG A 1 358 ? 184.709 177.926 119.596 1.00 89.62  ? 358 ARG A C     1 
ATOM   2733  O O     . ARG A 1 358 ? 184.023 177.565 118.628 1.00 89.62  ? 358 ARG A O     1 
ATOM   2734  C CB    . ARG A 1 358 ? 183.793 179.550 121.281 1.00 89.62  ? 358 ARG A CB    1 
ATOM   2735  C CG    . ARG A 1 358 ? 182.802 180.176 120.337 1.00 89.62  ? 358 ARG A CG    1 
ATOM   2736  C CD    . ARG A 1 358 ? 181.453 179.505 120.491 1.00 89.62  ? 358 ARG A CD    1 
ATOM   2737  N NE    . ARG A 1 358 ? 180.449 180.085 119.609 1.00 89.62  ? 358 ARG A NE    1 
ATOM   2738  C CZ    . ARG A 1 358 ? 179.250 179.554 119.398 1.00 89.62  ? 358 ARG A CZ    1 
ATOM   2739  N NH1   . ARG A 1 358 ? 178.910 178.426 120.004 1.00 89.62  ? 358 ARG A NH1   1 
ATOM   2740  N NH2   . ARG A 1 358 ? 178.396 180.148 118.576 1.00 89.62  ? 358 ARG A NH2   1 
ATOM   2741  N N     . ARG A 1 359 ? 186.013 178.196 119.487 1.00 92.10  ? 359 ARG A N     1 
ATOM   2742  C CA    . ARG A 1 359 ? 186.706 178.004 118.216 1.00 92.10  ? 359 ARG A CA    1 
ATOM   2743  C C     . ARG A 1 359 ? 186.538 176.580 117.708 1.00 92.10  ? 359 ARG A C     1 
ATOM   2744  O O     . ARG A 1 359 ? 186.196 176.355 116.537 1.00 92.10  ? 359 ARG A O     1 
ATOM   2745  C CB    . ARG A 1 359 ? 188.191 178.329 118.364 1.00 92.10  ? 359 ARG A CB    1 
ATOM   2746  C CG    . ARG A 1 359 ? 188.516 179.791 118.557 1.00 92.10  ? 359 ARG A CG    1 
ATOM   2747  C CD    . ARG A 1 359 ? 190.017 179.983 118.657 1.00 92.10  ? 359 ARG A CD    1 
ATOM   2748  N NE    . ARG A 1 359 ? 190.381 181.382 118.843 1.00 92.10  ? 359 ARG A NE    1 
ATOM   2749  C CZ    . ARG A 1 359 ? 191.625 181.808 119.020 1.00 92.10  ? 359 ARG A CZ    1 
ATOM   2750  N NH1   . ARG A 1 359 ? 192.626 180.940 119.038 1.00 92.10  ? 359 ARG A NH1   1 
ATOM   2751  N NH2   . ARG A 1 359 ? 191.869 183.100 119.182 1.00 92.10  ? 359 ARG A NH2   1 
ATOM   2752  N N     . GLU A 1 360 ? 186.795 175.602 118.579 1.00 100.06 ? 360 GLU A N     1 
ATOM   2753  C CA    . GLU A 1 360 ? 186.719 174.208 118.155 1.00 100.06 ? 360 GLU A CA    1 
ATOM   2754  C C     . GLU A 1 360 ? 185.315 173.848 117.684 1.00 100.06 ? 360 GLU A C     1 
ATOM   2755  O O     . GLU A 1 360 ? 185.144 173.184 116.647 1.00 100.06 ? 360 GLU A O     1 
ATOM   2756  C CB    . GLU A 1 360 ? 187.155 173.294 119.297 1.00 100.06 ? 360 GLU A CB    1 
ATOM   2757  C CG    . GLU A 1 360 ? 187.188 171.827 118.937 1.00 100.06 ? 360 GLU A CG    1 
ATOM   2758  C CD    . GLU A 1 360 ? 187.673 170.966 120.082 1.00 100.06 ? 360 GLU A CD    1 
ATOM   2759  O OE1   . GLU A 1 360 ? 187.976 171.524 121.157 1.00 100.06 ? 360 GLU A OE1   1 
ATOM   2760  O OE2   . GLU A 1 360 ? 187.746 169.732 119.911 1.00 100.06 ? 360 GLU A OE2   1 
ATOM   2761  N N     . VAL A 1 361 ? 184.297 174.282 118.430 1.00 89.99  ? 361 VAL A N     1 
ATOM   2762  C CA    . VAL A 1 361 ? 182.922 173.969 118.051 1.00 89.99  ? 361 VAL A CA    1 
ATOM   2763  C C     . VAL A 1 361 ? 182.602 174.551 116.681 1.00 89.99  ? 361 VAL A C     1 
ATOM   2764  O O     . VAL A 1 361 ? 182.014 173.879 115.821 1.00 89.99  ? 361 VAL A O     1 
ATOM   2765  C CB    . VAL A 1 361 ? 181.940 174.477 119.120 1.00 89.99  ? 361 VAL A CB    1 
ATOM   2766  C CG1   . VAL A 1 361 ? 180.514 174.319 118.639 1.00 89.99  ? 361 VAL A CG1   1 
ATOM   2767  C CG2   . VAL A 1 361 ? 182.142 173.716 120.413 1.00 89.99  ? 361 VAL A CG2   1 
ATOM   2768  N N     . VAL A 1 362 ? 182.983 175.811 116.458 1.00 90.78  ? 362 VAL A N     1 
ATOM   2769  C CA    . VAL A 1 362 ? 182.689 176.448 115.176 1.00 90.78  ? 362 VAL A CA    1 
ATOM   2770  C C     . VAL A 1 362 ? 183.359 175.693 114.037 1.00 90.78  ? 362 VAL A C     1 
ATOM   2771  O O     . VAL A 1 362 ? 182.740 175.433 112.994 1.00 90.78  ? 362 VAL A O     1 
ATOM   2772  C CB    . VAL A 1 362 ? 183.112 177.926 115.201 1.00 90.78  ? 362 VAL A CB    1 
ATOM   2773  C CG1   . VAL A 1 362 ? 182.998 178.524 113.817 1.00 90.78  ? 362 VAL A CG1   1 
ATOM   2774  C CG2   . VAL A 1 362 ? 182.243 178.696 116.168 1.00 90.78  ? 362 VAL A CG2   1 
ATOM   2775  N N     . THR A 1 363 ? 184.628 175.323 114.217 1.00 90.50  ? 363 THR A N     1 
ATOM   2776  C CA    . THR A 1 363 ? 185.343 174.628 113.151 1.00 90.50  ? 363 THR A CA    1 
ATOM   2777  C C     . THR A 1 363 ? 184.671 173.303 112.808 1.00 90.50  ? 363 THR A C     1 
ATOM   2778  O O     . THR A 1 363 ? 184.468 172.976 111.628 1.00 90.50  ? 363 THR A O     1 
ATOM   2779  C CB    . THR A 1 363 ? 186.797 174.406 113.556 1.00 90.50  ? 363 THR A CB    1 
ATOM   2780  O OG1   . THR A 1 363 ? 187.421 175.672 113.800 1.00 90.50  ? 363 THR A OG1   1 
ATOM   2781  C CG2   . THR A 1 363 ? 187.548 173.687 112.454 1.00 90.50  ? 363 THR A CG2   1 
ATOM   2782  N N     . ARG A 1 364 ? 184.311 172.525 113.832 1.00 93.69  ? 364 ARG A N     1 
ATOM   2783  C CA    . ARG A 1 364 ? 183.701 171.225 113.566 1.00 93.69  ? 364 ARG A CA    1 
ATOM   2784  C C     . ARG A 1 364 ? 182.349 171.376 112.876 1.00 93.69  ? 364 ARG A C     1 
ATOM   2785  O O     . ARG A 1 364 ? 182.040 170.634 111.931 1.00 93.69  ? 364 ARG A O     1 
ATOM   2786  C CB    . ARG A 1 364 ? 183.570 170.433 114.864 1.00 93.69  ? 364 ARG A CB    1 
ATOM   2787  C CG    . ARG A 1 364 ? 184.911 170.047 115.460 1.00 93.69  ? 364 ARG A CG    1 
ATOM   2788  C CD    . ARG A 1 364 ? 184.757 169.289 116.763 1.00 93.69  ? 364 ARG A CD    1 
ATOM   2789  N NE    . ARG A 1 364 ? 184.158 167.974 116.565 1.00 93.69  ? 364 ARG A NE    1 
ATOM   2790  C CZ    . ARG A 1 364 ? 183.786 167.169 117.553 1.00 93.69  ? 364 ARG A CZ    1 
ATOM   2791  N NH1   . ARG A 1 364 ? 183.951 167.545 118.814 1.00 93.69  ? 364 ARG A NH1   1 
ATOM   2792  N NH2   . ARG A 1 364 ? 183.248 165.988 117.283 1.00 93.69  ? 364 ARG A NH2   1 
ATOM   2793  N N     . ARG A 1 365 ? 181.533 172.332 113.329 1.00 95.37  ? 365 ARG A N     1 
ATOM   2794  C CA    . ARG A 1 365 ? 180.248 172.561 112.676 1.00 95.37  ? 365 ARG A CA    1 
ATOM   2795  C C     . ARG A 1 365 ? 180.434 172.928 111.210 1.00 95.37  ? 365 ARG A C     1 
ATOM   2796  O O     . ARG A 1 365 ? 179.691 172.450 110.338 1.00 95.37  ? 365 ARG A O     1 
ATOM   2797  C CB    . ARG A 1 365 ? 179.476 173.662 113.397 1.00 95.37  ? 365 ARG A CB    1 
ATOM   2798  C CG    . ARG A 1 365 ? 178.096 173.902 112.825 1.00 95.37  ? 365 ARG A CG    1 
ATOM   2799  C CD    . ARG A 1 365 ? 177.394 175.034 113.540 1.00 95.37  ? 365 ARG A CD    1 
ATOM   2800  N NE    . ARG A 1 365 ? 178.036 176.316 113.276 1.00 95.37  ? 365 ARG A NE    1 
ATOM   2801  C CZ    . ARG A 1 365 ? 177.728 177.447 113.899 1.00 95.37  ? 365 ARG A CZ    1 
ATOM   2802  N NH1   . ARG A 1 365 ? 176.782 177.457 114.828 1.00 95.37  ? 365 ARG A NH1   1 
ATOM   2803  N NH2   . ARG A 1 365 ? 178.364 178.569 113.594 1.00 95.37  ? 365 ARG A NH2   1 
ATOM   2804  N N     . THR A 1 366 ? 181.416 173.785 110.922 1.00 100.41 ? 366 THR A N     1 
ATOM   2805  C CA    . THR A 1 366 ? 181.659 174.181 109.541 1.00 100.41 ? 366 THR A CA    1 
ATOM   2806  C C     . THR A 1 366 ? 182.035 172.981 108.684 1.00 100.41 ? 366 THR A C     1 
ATOM   2807  O O     . THR A 1 366 ? 181.524 172.818 107.568 1.00 100.41 ? 366 THR A O     1 
ATOM   2808  C CB    . THR A 1 366 ? 182.751 175.244 109.485 1.00 100.41 ? 366 THR A CB    1 
ATOM   2809  O OG1   . THR A 1 366 ? 182.333 176.393 110.230 1.00 100.41 ? 366 THR A OG1   1 
ATOM   2810  C CG2   . THR A 1 366 ? 183.012 175.650 108.050 1.00 100.41 ? 366 THR A CG2   1 
ATOM   2811  N N     . ILE A 1 367 ? 182.929 172.128 109.191 1.00 93.18  ? 367 ILE A N     1 
ATOM   2812  C CA    . ILE A 1 367 ? 183.316 170.941 108.430 1.00 93.18  ? 367 ILE A CA    1 
ATOM   2813  C C     . ILE A 1 367 ? 182.101 170.070 108.136 1.00 93.18  ? 367 ILE A C     1 
ATOM   2814  O O     . ILE A 1 367 ? 181.919 169.580 107.009 1.00 93.18  ? 367 ILE A O     1 
ATOM   2815  C CB    . ILE A 1 367 ? 184.403 170.152 109.180 1.00 93.18  ? 367 ILE A CB    1 
ATOM   2816  C CG1   . ILE A 1 367 ? 185.692 170.965 109.258 1.00 93.18  ? 367 ILE A CG1   1 
ATOM   2817  C CG2   . ILE A 1 367 ? 184.648 168.816 108.509 1.00 93.18  ? 367 ILE A CG2   1 
ATOM   2818  C CD1   . ILE A 1 367 ? 186.730 170.360 110.171 1.00 93.18  ? 367 ILE A CD1   1 
ATOM   2819  N N     . PHE A 1 368 ? 181.253 169.861 109.145 1.00 102.48 ? 368 PHE A N     1 
ATOM   2820  C CA    . PHE A 1 368 ? 180.082 169.009 108.954 1.00 102.48 ? 368 PHE A CA    1 
ATOM   2821  C C     . PHE A 1 368 ? 179.164 169.563 107.871 1.00 102.48 ? 368 PHE A C     1 
ATOM   2822  O O     . PHE A 1 368 ? 178.733 168.830 106.967 1.00 102.48 ? 368 PHE A O     1 
ATOM   2823  C CB    . PHE A 1 368 ? 179.324 168.859 110.270 1.00 102.48 ? 368 PHE A CB    1 
ATOM   2824  C CG    . PHE A 1 368 ? 178.103 167.998 110.167 1.00 102.48 ? 368 PHE A CG    1 
ATOM   2825  C CD1   . PHE A 1 368 ? 178.214 166.622 110.102 1.00 102.48 ? 368 PHE A CD1   1 
ATOM   2826  C CD2   . PHE A 1 368 ? 176.843 168.567 110.134 1.00 102.48 ? 368 PHE A CD2   1 
ATOM   2827  C CE1   . PHE A 1 368 ? 177.092 165.829 110.008 1.00 102.48 ? 368 PHE A CE1   1 
ATOM   2828  C CE2   . PHE A 1 368 ? 175.717 167.779 110.039 1.00 102.48 ? 368 PHE A CE2   1 
ATOM   2829  C CZ    . PHE A 1 368 ? 175.842 166.408 109.976 1.00 102.48 ? 368 PHE A CZ    1 
ATOM   2830  N N     . GLU A 1 369 ? 178.843 170.857 107.953 1.00 109.71 ? 369 GLU A N     1 
ATOM   2831  C CA    . GLU A 1 369 ? 177.945 171.444 106.963 1.00 109.71 ? 369 GLU A CA    1 
ATOM   2832  C C     . GLU A 1 369 ? 178.552 171.395 105.567 1.00 109.71 ? 369 GLU A C     1 
ATOM   2833  O O     . GLU A 1 369 ? 177.840 171.171 104.577 1.00 109.71 ? 369 GLU A O     1 
ATOM   2834  C CB    . GLU A 1 369 ? 177.593 172.878 107.349 1.00 109.71 ? 369 GLU A CB    1 
ATOM   2835  C CG    . GLU A 1 369 ? 176.716 172.977 108.580 1.00 109.71 ? 369 GLU A CG    1 
ATOM   2836  C CD    . GLU A 1 369 ? 176.358 174.406 108.925 1.00 109.71 ? 369 GLU A CD    1 
ATOM   2837  O OE1   . GLU A 1 369 ? 176.889 175.326 108.269 1.00 109.71 ? 369 GLU A OE1   1 
ATOM   2838  O OE2   . GLU A 1 369 ? 175.545 174.610 109.851 1.00 109.71 ? 369 GLU A OE2   1 
ATOM   2839  N N     . LEU A 1 370 ? 179.868 171.597 105.468 1.00 104.46 ? 370 LEU A N     1 
ATOM   2840  C CA    . LEU A 1 370 ? 180.531 171.496 104.173 1.00 104.46 ? 370 LEU A CA    1 
ATOM   2841  C C     . LEU A 1 370 ? 180.341 170.114 103.568 1.00 104.46 ? 370 LEU A C     1 
ATOM   2842  O O     . LEU A 1 370 ? 179.969 169.983 102.396 1.00 104.46 ? 370 LEU A O     1 
ATOM   2843  C CB    . LEU A 1 370 ? 182.018 171.809 104.314 1.00 104.46 ? 370 LEU A CB    1 
ATOM   2844  C CG    . LEU A 1 370 ? 182.786 171.703 102.999 1.00 104.46 ? 370 LEU A CG    1 
ATOM   2845  C CD1   . LEU A 1 370 ? 182.262 172.718 102.000 1.00 104.46 ? 370 LEU A CD1   1 
ATOM   2846  C CD2   . LEU A 1 370 ? 184.275 171.884 103.226 1.00 104.46 ? 370 LEU A CD2   1 
ATOM   2847  N N     . ARG A 1 371 ? 180.600 169.067 104.355 1.00 109.87 ? 371 ARG A N     1 
ATOM   2848  C CA    . ARG A 1 371 ? 180.465 167.712 103.823 1.00 109.87 ? 371 ARG A CA    1 
ATOM   2849  C C     . ARG A 1 371 ? 179.027 167.423 103.405 1.00 109.87 ? 371 ARG A C     1 
ATOM   2850  O O     . ARG A 1 371 ? 178.783 166.799 102.358 1.00 109.87 ? 371 ARG A O     1 
ATOM   2851  C CB    . ARG A 1 371 ? 180.942 166.693 104.855 1.00 109.87 ? 371 ARG A CB    1 
ATOM   2852  C CG    . ARG A 1 371 ? 180.922 165.263 104.352 1.00 109.87 ? 371 ARG A CG    1 
ATOM   2853  C CD    . ARG A 1 371 ? 181.466 164.303 105.393 1.00 109.87 ? 371 ARG A CD    1 
ATOM   2854  N NE    . ARG A 1 371 ? 180.647 164.279 106.599 1.00 109.87 ? 371 ARG A NE    1 
ATOM   2855  C CZ    . ARG A 1 371 ? 179.542 163.554 106.734 1.00 109.87 ? 371 ARG A CZ    1 
ATOM   2856  N NH1   . ARG A 1 371 ? 179.120 162.792 105.735 1.00 109.87 ? 371 ARG A NH1   1 
ATOM   2857  N NH2   . ARG A 1 371 ? 178.857 163.592 107.868 1.00 109.87 ? 371 ARG A NH2   1 
ATOM   2858  N N     . LYS A 1 372 ? 178.061 167.880 104.205 1.00 113.53 ? 372 LYS A N     1 
ATOM   2859  C CA    . LYS A 1 372 ? 176.661 167.644 103.865 1.00 113.53 ? 372 LYS A CA    1 
ATOM   2860  C C     . LYS A 1 372 ? 176.292 168.304 102.542 1.00 113.53 ? 372 LYS A C     1 
ATOM   2861  O O     . LYS A 1 372 ? 175.695 167.663 101.662 1.00 113.53 ? 372 LYS A O     1 
ATOM   2862  C CB    . LYS A 1 372 ? 175.757 168.153 104.983 1.00 113.53 ? 372 LYS A CB    1 
ATOM   2863  C CG    . LYS A 1 372 ? 174.288 167.886 104.740 1.00 113.53 ? 372 LYS A CG    1 
ATOM   2864  C CD    . LYS A 1 372 ? 174.025 166.394 104.686 1.00 113.53 ? 372 LYS A CD    1 
ATOM   2865  C CE    . LYS A 1 372 ? 174.235 165.756 106.049 1.00 113.53 ? 372 LYS A CE    1 
ATOM   2866  N NZ    . LYS A 1 372 ? 173.927 164.301 106.035 1.00 113.53 ? 372 LYS A NZ    1 
ATOM   2867  N N     . ALA A 1 373 ? 176.633 169.585 102.384 1.00 112.20 ? 373 ALA A N     1 
ATOM   2868  C CA    . ALA A 1 373 ? 176.330 170.270 101.133 1.00 112.20 ? 373 ALA A CA    1 
ATOM   2869  C C     . ALA A 1 373 ? 177.051 169.626 99.958  1.00 112.20 ? 373 ALA A C     1 
ATOM   2870  O O     . ALA A 1 373 ? 176.500 169.564 98.852  1.00 112.20 ? 373 ALA A O     1 
ATOM   2871  C CB    . ALA A 1 373 ? 176.699 171.747 101.238 1.00 112.20 ? 373 ALA A CB    1 
ATOM   2872  N N     . ARG A 1 374 ? 178.276 169.143 100.180 1.00 117.65 ? 374 ARG A N     1 
ATOM   2873  C CA    . ARG A 1 374 ? 179.001 168.445 99.126  1.00 117.65 ? 374 ARG A CA    1 
ATOM   2874  C C     . ARG A 1 374 ? 178.217 167.243 98.624  1.00 117.65 ? 374 ARG A C     1 
ATOM   2875  O O     . ARG A 1 374 ? 178.010 167.086 97.413  1.00 117.65 ? 374 ARG A O     1 
ATOM   2876  C CB    . ARG A 1 374 ? 180.367 168.003 99.643  1.00 117.65 ? 374 ARG A CB    1 
ATOM   2877  C CG    . ARG A 1 374 ? 181.236 167.338 98.598  1.00 117.65 ? 374 ARG A CG    1 
ATOM   2878  C CD    . ARG A 1 374 ? 181.727 168.344 97.579  1.00 117.65 ? 374 ARG A CD    1 
ATOM   2879  N NE    . ARG A 1 374 ? 182.527 169.386 98.213  1.00 117.65 ? 374 ARG A NE    1 
ATOM   2880  C CZ    . ARG A 1 374 ? 183.816 169.261 98.511  1.00 117.65 ? 374 ARG A CZ    1 
ATOM   2881  N NH1   . ARG A 1 374 ? 184.458 168.135 98.231  1.00 117.65 ? 374 ARG A NH1   1 
ATOM   2882  N NH2   . ARG A 1 374 ? 184.464 170.263 99.086  1.00 117.65 ? 374 ARG A NH2   1 
ATOM   2883  N N     . ASP A 1 375 ? 177.777 166.380 99.541  1.00 117.16 ? 375 ASP A N     1 
ATOM   2884  C CA    . ASP A 1 375 ? 177.036 165.192 99.121  1.00 117.16 ? 375 ASP A CA    1 
ATOM   2885  C C     . ASP A 1 375 ? 175.731 165.566 98.428  1.00 117.16 ? 375 ASP A C     1 
ATOM   2886  O O     . ASP A 1 375 ? 175.345 164.942 97.426  1.00 117.16 ? 375 ASP A O     1 
ATOM   2887  C CB    . ASP A 1 375 ? 176.766 164.287 100.321 1.00 117.16 ? 375 ASP A CB    1 
ATOM   2888  C CG    . ASP A 1 375 ? 178.022 163.625 100.842 1.00 117.16 ? 375 ASP A CG    1 
ATOM   2889  O OD1   . ASP A 1 375 ? 178.953 163.403 100.040 1.00 117.16 ? 375 ASP A OD1   1 
ATOM   2890  O OD2   . ASP A 1 375 ? 178.080 163.324 102.051 1.00 117.16 ? 375 ASP A OD2   1 
ATOM   2891  N N     . ARG A 1 376 ? 175.040 166.586 98.943  1.00 117.19 ? 376 ARG A N     1 
ATOM   2892  C CA    . ARG A 1 376 ? 173.789 167.005 98.320  1.00 117.19 ? 376 ARG A CA    1 
ATOM   2893  C C     . ARG A 1 376 ? 174.016 167.449 96.881  1.00 117.19 ? 376 ARG A C     1 
ATOM   2894  O O     . ARG A 1 376 ? 173.281 167.048 95.967  1.00 117.19 ? 376 ARG A O     1 
ATOM   2895  C CB    . ARG A 1 376 ? 173.146 168.126 99.133  1.00 117.19 ? 376 ARG A CB    1 
ATOM   2896  C CG    . ARG A 1 376 ? 171.841 168.622 98.543  1.00 117.19 ? 376 ARG A CG    1 
ATOM   2897  C CD    . ARG A 1 376 ? 170.785 167.536 98.573  1.00 117.19 ? 376 ARG A CD    1 
ATOM   2898  N NE    . ARG A 1 376 ? 169.514 167.997 98.026  1.00 117.19 ? 376 ARG A NE    1 
ATOM   2899  C CZ    . ARG A 1 376 ? 168.480 167.202 97.776  1.00 117.19 ? 376 ARG A CZ    1 
ATOM   2900  N NH1   . ARG A 1 376 ? 168.566 165.903 98.024  1.00 117.19 ? 376 ARG A NH1   1 
ATOM   2901  N NH2   . ARG A 1 376 ? 167.361 167.706 97.277  1.00 117.19 ? 376 ARG A NH2   1 
ATOM   2902  N N     . ALA A 1 377 ? 175.036 168.280 96.659  1.00 118.78 ? 377 ALA A N     1 
ATOM   2903  C CA    . ALA A 1 377 ? 175.328 168.736 95.306  1.00 118.78 ? 377 ALA A CA    1 
ATOM   2904  C C     . ALA A 1 377 ? 175.727 167.573 94.409  1.00 118.78 ? 377 ALA A C     1 
ATOM   2905  O O     . ALA A 1 377 ? 175.367 167.540 93.225  1.00 118.78 ? 377 ALA A O     1 
ATOM   2906  C CB    . ALA A 1 377 ? 176.429 169.794 95.334  1.00 118.78 ? 377 ALA A CB    1 
ATOM   2907  N N     . HIS A 1 378 ? 176.472 166.610 94.954  1.00 117.69 ? 378 HIS A N     1 
ATOM   2908  C CA    . HIS A 1 378 ? 176.873 165.458 94.155  1.00 117.69 ? 378 HIS A CA    1 
ATOM   2909  C C     . HIS A 1 378 ? 175.665 164.671 93.670  1.00 117.69 ? 378 HIS A C     1 
ATOM   2910  O O     . HIS A 1 378 ? 175.638 164.205 92.526  1.00 117.69 ? 378 HIS A O     1 
ATOM   2911  C CB    . HIS A 1 378 ? 177.809 164.557 94.956  1.00 117.69 ? 378 HIS A CB    1 
ATOM   2912  C CG    . HIS A 1 378 ? 178.318 163.383 94.183  1.00 117.69 ? 378 HIS A CG    1 
ATOM   2913  N ND1   . HIS A 1 378 ? 177.655 162.176 94.145  1.00 117.69 ? 378 HIS A ND1   1 
ATOM   2914  C CD2   . HIS A 1 378 ? 179.415 163.235 93.404  1.00 117.69 ? 378 HIS A CD2   1 
ATOM   2915  C CE1   . HIS A 1 378 ? 178.330 161.330 93.389  1.00 117.69 ? 378 HIS A CE1   1 
ATOM   2916  N NE2   . HIS A 1 378 ? 179.400 161.949 92.924  1.00 117.69 ? 378 HIS A NE2   1 
ATOM   2917  N N     . ILE A 1 379 ? 174.656 164.505 94.525  1.00 112.36 ? 379 ILE A N     1 
ATOM   2918  C CA    . ILE A 1 379 ? 173.451 163.806 94.082  1.00 112.36 ? 379 ILE A CA    1 
ATOM   2919  C C     . ILE A 1 379 ? 172.689 164.643 93.059  1.00 112.36 ? 379 ILE A C     1 
ATOM   2920  O O     . ILE A 1 379 ? 172.196 164.123 92.044  1.00 112.36 ? 379 ILE A O     1 
ATOM   2921  C CB    . ILE A 1 379 ? 172.563 163.442 95.283  1.00 112.36 ? 379 ILE A CB    1 
ATOM   2922  C CG1   . ILE A 1 379 ? 173.309 162.498 96.224  1.00 112.36 ? 379 ILE A CG1   1 
ATOM   2923  C CG2   . ILE A 1 379 ? 171.266 162.809 94.811  1.00 112.36 ? 379 ILE A CG2   1 
ATOM   2924  C CD1   . ILE A 1 379 ? 173.694 161.188 95.582  1.00 112.36 ? 379 ILE A CD1   1 
ATOM   2925  N N     . LEU A 1 380 ? 172.581 165.949 93.308  1.00 119.93 ? 380 LEU A N     1 
ATOM   2926  C CA    . LEU A 1 380 ? 171.774 166.797 92.439  1.00 119.93 ? 380 LEU A CA    1 
ATOM   2927  C C     . LEU A 1 380 ? 172.365 166.881 91.037  1.00 119.93 ? 380 LEU A C     1 
ATOM   2928  O O     . LEU A 1 380 ? 171.627 166.997 90.052  1.00 119.93 ? 380 LEU A O     1 
ATOM   2929  C CB    . LEU A 1 380 ? 171.630 168.184 93.062  1.00 119.93 ? 380 LEU A CB    1 
ATOM   2930  C CG    . LEU A 1 380 ? 170.642 169.154 92.416  1.00 119.93 ? 380 LEU A CG    1 
ATOM   2931  C CD1   . LEU A 1 380 ? 170.029 170.035 93.480  1.00 119.93 ? 380 LEU A CD1   1 
ATOM   2932  C CD2   . LEU A 1 380 ? 171.328 170.016 91.369  1.00 119.93 ? 380 LEU A CD2   1 
ATOM   2933  N N     . GLU A 1 381 ? 173.694 166.831 90.925  1.00 128.20 ? 381 GLU A N     1 
ATOM   2934  C CA    . GLU A 1 381 ? 174.320 166.851 89.605  1.00 128.20 ? 381 GLU A CA    1 
ATOM   2935  C C     . GLU A 1 381 ? 173.843 165.680 88.756  1.00 128.20 ? 381 GLU A C     1 
ATOM   2936  O O     . GLU A 1 381 ? 173.408 165.859 87.610  1.00 128.20 ? 381 GLU A O     1 
ATOM   2937  C CB    . GLU A 1 381 ? 175.842 166.823 89.739  1.00 128.20 ? 381 GLU A CB    1 
ATOM   2938  C CG    . GLU A 1 381 ? 176.453 168.091 90.303  1.00 128.20 ? 381 GLU A CG    1 
ATOM   2939  C CD    . GLU A 1 381 ? 177.963 168.007 90.415  1.00 128.20 ? 381 GLU A CD    1 
ATOM   2940  O OE1   . GLU A 1 381 ? 178.520 166.915 90.173  1.00 128.20 ? 381 GLU A OE1   1 
ATOM   2941  O OE2   . GLU A 1 381 ? 178.594 169.035 90.741  1.00 128.20 ? 381 GLU A OE2   1 
ATOM   2942  N N     . ALA A 1 382 ? 173.927 164.467 89.304  1.00 123.36 ? 382 ALA A N     1 
ATOM   2943  C CA    . ALA A 1 382 ? 173.492 163.291 88.564  1.00 123.36 ? 382 ALA A CA    1 
ATOM   2944  C C     . ALA A 1 382 ? 172.001 163.351 88.273  1.00 123.36 ? 382 ALA A C     1 
ATOM   2945  O O     . ALA A 1 382 ? 171.552 162.919 87.204  1.00 123.36 ? 382 ALA A O     1 
ATOM   2946  C CB    . ALA A 1 382 ? 173.837 162.024 89.342  1.00 123.36 ? 382 ALA A CB    1 
ATOM   2947  N N     . LEU A 1 383 ? 171.216 163.889 89.208  1.00 116.03 ? 383 LEU A N     1 
ATOM   2948  C CA    . LEU A 1 383 ? 169.783 163.998 88.955  1.00 116.03 ? 383 LEU A CA    1 
ATOM   2949  C C     . LEU A 1 383 ? 169.511 164.916 87.767  1.00 116.03 ? 383 LEU A C     1 
ATOM   2950  O O     . LEU A 1 383 ? 168.668 164.610 86.914  1.00 116.03 ? 383 LEU A O     1 
ATOM   2951  C CB    . LEU A 1 383 ? 169.065 164.491 90.211  1.00 116.03 ? 383 LEU A CB    1 
ATOM   2952  C CG    . LEU A 1 383 ? 167.544 164.330 90.253  1.00 116.03 ? 383 LEU A CG    1 
ATOM   2953  C CD1   . LEU A 1 383 ? 167.089 164.151 91.691  1.00 116.03 ? 383 LEU A CD1   1 
ATOM   2954  C CD2   . LEU A 1 383 ? 166.824 165.505 89.614  1.00 116.03 ? 383 LEU A CD2   1 
ATOM   2955  N N     . ALA A 1 384 ? 170.229 166.037 87.684  1.00 117.99 ? 384 ALA A N     1 
ATOM   2956  C CA    . ALA A 1 384 ? 170.058 166.940 86.550  1.00 117.99 ? 384 ALA A CA    1 
ATOM   2957  C C     . ALA A 1 384 ? 170.495 166.283 85.248  1.00 117.99 ? 384 ALA A C     1 
ATOM   2958  O O     . ALA A 1 384 ? 169.816 166.413 84.220  1.00 117.99 ? 384 ALA A O     1 
ATOM   2959  C CB    . ALA A 1 384 ? 170.840 168.232 86.782  1.00 117.99 ? 384 ALA A CB    1 
ATOM   2960  N N     . VAL A 1 385 ? 171.628 165.579 85.270  1.00 118.01 ? 385 VAL A N     1 
ATOM   2961  C CA    . VAL A 1 385 ? 172.099 164.906 84.061  1.00 118.01 ? 385 VAL A CA    1 
ATOM   2962  C C     . VAL A 1 385 ? 171.072 163.887 83.587  1.00 118.01 ? 385 VAL A C     1 
ATOM   2963  O O     . VAL A 1 385 ? 170.830 163.740 82.383  1.00 118.01 ? 385 VAL A O     1 
ATOM   2964  C CB    . VAL A 1 385 ? 173.472 164.256 84.305  1.00 118.01 ? 385 VAL A CB    1 
ATOM   2965  C CG1   . VAL A 1 385 ? 173.882 163.430 83.104  1.00 118.01 ? 385 VAL A CG1   1 
ATOM   2966  C CG2   . VAL A 1 385 ? 174.512 165.322 84.582  1.00 118.01 ? 385 VAL A CG2   1 
ATOM   2967  N N     . ALA A 1 386 ? 170.444 163.176 84.525  1.00 128.18 ? 386 ALA A N     1 
ATOM   2968  C CA    . ALA A 1 386 ? 169.394 162.234 84.154  1.00 128.18 ? 386 ALA A CA    1 
ATOM   2969  C C     . ALA A 1 386 ? 168.183 162.956 83.583  1.00 128.18 ? 386 ALA A C     1 
ATOM   2970  O O     . ALA A 1 386 ? 167.555 162.476 82.633  1.00 128.18 ? 386 ALA A O     1 
ATOM   2971  C CB    . ALA A 1 386 ? 168.990 161.392 85.362  1.00 128.18 ? 386 ALA A CB    1 
ATOM   2972  N N     . LEU A 1 387 ? 167.831 164.107 84.157  1.00 120.44 ? 387 LEU A N     1 
ATOM   2973  C CA    . LEU A 1 387 ? 166.711 164.875 83.626  1.00 120.44 ? 387 LEU A CA    1 
ATOM   2974  C C     . LEU A 1 387 ? 166.999 165.353 82.209  1.00 120.44 ? 387 LEU A C     1 
ATOM   2975  O O     . LEU A 1 387 ? 166.074 165.549 81.412  1.00 120.44 ? 387 LEU A O     1 
ATOM   2976  C CB    . LEU A 1 387 ? 166.402 166.056 84.547  1.00 120.44 ? 387 LEU A CB    1 
ATOM   2977  C CG    . LEU A 1 387 ? 165.128 166.867 84.294  1.00 120.44 ? 387 LEU A CG    1 
ATOM   2978  C CD1   . LEU A 1 387 ? 164.594 167.408 85.605  1.00 120.44 ? 387 LEU A CD1   1 
ATOM   2979  C CD2   . LEU A 1 387 ? 165.376 168.016 83.332  1.00 120.44 ? 387 LEU A CD2   1 
ATOM   2980  N N     . ALA A 1 388 ? 168.277 165.548 81.879  1.00 124.94 ? 388 ALA A N     1 
ATOM   2981  C CA    . ALA A 1 388 ? 168.628 166.003 80.536  1.00 124.94 ? 388 ALA A CA    1 
ATOM   2982  C C     . ALA A 1 388 ? 168.182 165.004 79.476  1.00 124.94 ? 388 ALA A C     1 
ATOM   2983  O O     . ALA A 1 388 ? 167.386 165.339 78.592  1.00 124.94 ? 388 ALA A O     1 
ATOM   2984  C CB    . ALA A 1 388 ? 170.132 166.248 80.437  1.00 124.94 ? 388 ALA A CB    1 
ATOM   2985  N N     . ASN A 1 389 ? 168.675 163.777 79.547  1.00 124.30 ? 389 ASN A N     1 
ATOM   2986  C CA    . ASN A 1 389 ? 168.315 162.730 78.599  1.00 124.30 ? 389 ASN A CA    1 
ATOM   2987  C C     . ASN A 1 389 ? 167.242 161.868 79.257  1.00 124.30 ? 389 ASN A C     1 
ATOM   2988  O O     . ASN A 1 389 ? 167.523 161.120 80.196  1.00 124.30 ? 389 ASN A O     1 
ATOM   2989  C CB    . ASN A 1 389 ? 169.539 161.913 78.200  1.00 124.30 ? 389 ASN A CB    1 
ATOM   2990  C CG    . ASN A 1 389 ? 170.586 162.746 77.481  1.00 124.30 ? 389 ASN A CG    1 
ATOM   2991  O OD1   . ASN A 1 389 ? 171.711 162.903 77.955  1.00 124.30 ? 389 ASN A OD1   1 
ATOM   2992  N ND2   . ASN A 1 389 ? 170.213 163.294 76.331  1.00 124.30 ? 389 ASN A ND2   1 
ATOM   2993  N N     . ILE A 1 390 ? 166.010 161.978 78.768  1.00 125.89 ? 390 ILE A N     1 
ATOM   2994  C CA    . ILE A 1 390 ? 164.875 161.273 79.356  1.00 125.89 ? 390 ILE A CA    1 
ATOM   2995  C C     . ILE A 1 390 ? 164.417 160.098 78.495  1.00 125.89 ? 390 ILE A C     1 
ATOM   2996  O O     . ILE A 1 390 ? 164.175 159.007 79.013  1.00 125.89 ? 390 ILE A O     1 
ATOM   2997  C CB    . ILE A 1 390 ? 163.712 162.254 79.642  1.00 125.89 ? 390 ILE A CB    1 
ATOM   2998  C CG1   . ILE A 1 390 ? 162.564 161.532 80.352  1.00 125.89 ? 390 ILE A CG1   1 
ATOM   2999  C CG2   . ILE A 1 390 ? 163.251 162.972 78.382  1.00 125.89 ? 390 ILE A CG2   1 
ATOM   3000  C CD1   . ILE A 1 390 ? 161.501 162.450 80.907  1.00 125.89 ? 390 ILE A CD1   1 
ATOM   3001  N N     . ASP A 1 391 ? 164.329 160.287 77.174  1.00 138.57 ? 391 ASP A N     1 
ATOM   3002  C CA    . ASP A 1 391 ? 163.697 159.274 76.326  1.00 138.57 ? 391 ASP A CA    1 
ATOM   3003  C C     . ASP A 1 391 ? 164.519 157.992 76.219  1.00 138.57 ? 391 ASP A C     1 
ATOM   3004  O O     . ASP A 1 391 ? 163.933 156.896 76.331  1.00 138.57 ? 391 ASP A O     1 
ATOM   3005  C CB    . ASP A 1 391 ? 163.389 159.889 74.955  1.00 138.57 ? 391 ASP A CB    1 
ATOM   3006  C CG    . ASP A 1 391 ? 162.507 159.022 74.097  1.00 138.57 ? 391 ASP A CG    1 
ATOM   3007  O OD1   . ASP A 1 391 ? 162.163 157.909 74.531  1.00 138.57 ? 391 ASP A OD1   1 
ATOM   3008  O OD2   . ASP A 1 391 ? 162.159 159.462 72.983  1.00 138.57 ? 391 ASP A OD2   1 
ATOM   3009  N N     . PRO A 1 392 ? 165.839 158.032 75.990  1.00 131.72 ? 392 PRO A N     1 
ATOM   3010  C CA    . PRO A 1 392 ? 166.600 156.773 75.999  1.00 131.72 ? 392 PRO A CA    1 
ATOM   3011  C C     . PRO A 1 392 ? 166.525 156.041 77.326  1.00 131.72 ? 392 PRO A C     1 
ATOM   3012  O O     . PRO A 1 392 ? 166.500 154.806 77.343  1.00 131.72 ? 392 PRO A O     1 
ATOM   3013  C CB    . PRO A 1 392 ? 168.026 157.227 75.668  1.00 131.72 ? 392 PRO A CB    1 
ATOM   3014  C CG    . PRO A 1 392 ? 167.842 158.489 74.913  1.00 131.72 ? 392 PRO A CG    1 
ATOM   3015  C CD    . PRO A 1 392 ? 166.677 159.163 75.560  1.00 131.72 ? 392 PRO A CD    1 
ATOM   3016  N N     . ILE A 1 393 ? 166.485 156.765 78.445  1.00 134.34 ? 393 ILE A N     1 
ATOM   3017  C CA    . ILE A 1 393 ? 166.331 156.100 79.733  1.00 134.34 ? 393 ILE A CA    1 
ATOM   3018  C C     . ILE A 1 393 ? 164.951 155.467 79.836  1.00 134.34 ? 393 ILE A C     1 
ATOM   3019  O O     . ILE A 1 393 ? 164.798 154.369 80.386  1.00 134.34 ? 393 ILE A O     1 
ATOM   3020  C CB    . ILE A 1 393 ? 166.605 157.088 80.881  1.00 134.34 ? 393 ILE A CB    1 
ATOM   3021  C CG1   . ILE A 1 393 ? 168.079 157.498 80.887  1.00 134.34 ? 393 ILE A CG1   1 
ATOM   3022  C CG2   . ILE A 1 393 ? 166.216 156.490 82.218  1.00 134.34 ? 393 ILE A CG2   1 
ATOM   3023  C CD1   . ILE A 1 393 ? 168.404 158.600 81.885  1.00 134.34 ? 393 ILE A CD1   1 
ATOM   3024  N N     . ILE A 1 394 ? 163.933 156.124 79.279  1.00 134.18 ? 394 ILE A N     1 
ATOM   3025  C CA    . ILE A 1 394 ? 162.601 155.528 79.256  1.00 134.18 ? 394 ILE A CA    1 
ATOM   3026  C C     . ILE A 1 394 ? 162.629 154.198 78.519  1.00 134.18 ? 394 ILE A C     1 
ATOM   3027  O O     . ILE A 1 394 ? 162.136 153.181 79.020  1.00 134.18 ? 394 ILE A O     1 
ATOM   3028  C CB    . ILE A 1 394 ? 161.583 156.495 78.632  1.00 134.18 ? 394 ILE A CB    1 
ATOM   3029  C CG1   . ILE A 1 394 ? 161.337 157.675 79.572  1.00 134.18 ? 394 ILE A CG1   1 
ATOM   3030  C CG2   . ILE A 1 394 ? 160.290 155.770 78.330  1.00 134.18 ? 394 ILE A CG2   1 
ATOM   3031  C CD1   . ILE A 1 394 ? 160.586 158.827 78.944  1.00 134.18 ? 394 ILE A CD1   1 
ATOM   3032  N N     . GLU A 1 395 ? 163.206 154.182 77.316  1.00 140.90 ? 395 GLU A N     1 
ATOM   3033  C CA    . GLU A 1 395 ? 163.251 152.922 76.575  1.00 140.90 ? 395 GLU A CA    1 
ATOM   3034  C C     . GLU A 1 395 ? 164.108 151.876 77.279  1.00 140.90 ? 395 GLU A C     1 
ATOM   3035  O O     . GLU A 1 395 ? 163.777 150.684 77.266  1.00 140.90 ? 395 GLU A O     1 
ATOM   3036  C CB    . GLU A 1 395 ? 163.743 153.122 75.140  1.00 140.90 ? 395 GLU A CB    1 
ATOM   3037  C CG    . GLU A 1 395 ? 162.671 153.608 74.156  1.00 140.90 ? 395 GLU A CG    1 
ATOM   3038  C CD    . GLU A 1 395 ? 162.746 155.073 73.784  1.00 140.90 ? 395 GLU A CD    1 
ATOM   3039  O OE1   . GLU A 1 395 ? 163.773 155.709 74.095  1.00 140.90 ? 395 GLU A OE1   1 
ATOM   3040  O OE2   . GLU A 1 395 ? 161.774 155.575 73.182  1.00 140.90 ? 395 GLU A OE2   1 
ATOM   3041  N N     . LEU A 1 396 ? 165.216 152.295 77.887  1.00 134.06 ? 396 LEU A N     1 
ATOM   3042  C CA    . LEU A 1 396 ? 166.092 151.335 78.546  1.00 134.06 ? 396 LEU A CA    1 
ATOM   3043  C C     . LEU A 1 396 ? 165.404 150.701 79.745  1.00 134.06 ? 396 LEU A C     1 
ATOM   3044  O O     . LEU A 1 396 ? 165.602 149.515 80.024  1.00 134.06 ? 396 LEU A O     1 
ATOM   3045  C CB    . LEU A 1 396 ? 167.398 152.010 78.957  1.00 134.06 ? 396 LEU A CB    1 
ATOM   3046  C CG    . LEU A 1 396 ? 168.522 151.100 79.459  1.00 134.06 ? 396 LEU A CG    1 
ATOM   3047  C CD1   . LEU A 1 396 ? 169.874 151.691 79.112  1.00 134.06 ? 396 LEU A CD1   1 
ATOM   3048  C CD2   . LEU A 1 396 ? 168.427 150.873 80.961  1.00 134.06 ? 396 LEU A CD2   1 
ATOM   3049  N N     . ILE A 1 397 ? 164.579 151.467 80.459  1.00 132.22 ? 397 ILE A N     1 
ATOM   3050  C CA    . ILE A 1 397 ? 163.812 150.881 81.554  1.00 132.22 ? 397 ILE A CA    1 
ATOM   3051  C C     . ILE A 1 397 ? 162.706 149.979 81.016  1.00 132.22 ? 397 ILE A C     1 
ATOM   3052  O O     . ILE A 1 397 ? 162.455 148.894 81.555  1.00 132.22 ? 397 ILE A O     1 
ATOM   3053  C CB    . ILE A 1 397 ? 163.249 151.985 82.463  1.00 132.22 ? 397 ILE A CB    1 
ATOM   3054  C CG1   . ILE A 1 397 ? 164.387 152.761 83.118  1.00 132.22 ? 397 ILE A CG1   1 
ATOM   3055  C CG2   . ILE A 1 397 ? 162.334 151.395 83.513  1.00 132.22 ? 397 ILE A CG2   1 
ATOM   3056  C CD1   . ILE A 1 397 ? 163.925 153.983 83.859  1.00 132.22 ? 397 ILE A CD1   1 
ATOM   3057  N N     . ARG A 1 398 ? 162.029 150.405 79.946  1.00 137.23 ? 398 ARG A N     1 
ATOM   3058  C CA    . ARG A 1 398 ? 160.930 149.605 79.413  1.00 137.23 ? 398 ARG A CA    1 
ATOM   3059  C C     . ARG A 1 398 ? 161.410 148.265 78.877  1.00 137.23 ? 398 ARG A C     1 
ATOM   3060  O O     . ARG A 1 398 ? 160.685 147.268 78.969  1.00 137.23 ? 398 ARG A O     1 
ATOM   3061  C CB    . ARG A 1 398 ? 160.191 150.380 78.324  1.00 137.23 ? 398 ARG A CB    1 
ATOM   3062  C CG    . ARG A 1 398 ? 159.409 151.564 78.859  1.00 137.23 ? 398 ARG A CG    1 
ATOM   3063  C CD    . ARG A 1 398 ? 158.691 152.318 77.755  1.00 137.23 ? 398 ARG A CD    1 
ATOM   3064  N NE    . ARG A 1 398 ? 157.623 151.525 77.153  1.00 137.23 ? 398 ARG A NE    1 
ATOM   3065  C CZ    . ARG A 1 398 ? 156.941 151.889 76.073  1.00 137.23 ? 398 ARG A CZ    1 
ATOM   3066  N NH1   . ARG A 1 398 ? 157.212 153.039 75.470  1.00 137.23 ? 398 ARG A NH1   1 
ATOM   3067  N NH2   . ARG A 1 398 ? 155.987 151.103 75.595  1.00 137.23 ? 398 ARG A NH2   1 
ATOM   3068  N N     . HIS A 1 399 ? 162.619 148.214 78.318  1.00 143.18 ? 399 HIS A N     1 
ATOM   3069  C CA    . HIS A 1 399 ? 163.138 146.940 77.832  1.00 143.18 ? 399 HIS A CA    1 
ATOM   3070  C C     . HIS A 1 399 ? 163.721 146.083 78.950  1.00 143.18 ? 399 HIS A C     1 
ATOM   3071  O O     . HIS A 1 399 ? 163.628 144.853 78.888  1.00 143.18 ? 399 HIS A O     1 
ATOM   3072  C CB    . HIS A 1 399 ? 164.189 147.170 76.744  1.00 143.18 ? 399 HIS A CB    1 
ATOM   3073  C CG    . HIS A 1 399 ? 163.625 147.718 75.471  1.00 143.18 ? 399 HIS A CG    1 
ATOM   3074  N ND1   . HIS A 1 399 ? 162.844 146.963 74.622  1.00 143.18 ? 399 HIS A ND1   1 
ATOM   3075  C CD2   . HIS A 1 399 ? 163.737 148.937 74.893  1.00 143.18 ? 399 HIS A CD2   1 
ATOM   3076  C CE1   . HIS A 1 399 ? 162.489 147.697 73.583  1.00 143.18 ? 399 HIS A CE1   1 
ATOM   3077  N NE2   . HIS A 1 399 ? 163.018 148.899 73.723  1.00 143.18 ? 399 HIS A NE2   1 
ATOM   3078  N N     . ALA A 1 400 ? 164.303 146.697 79.971  1.00 144.66 ? 400 ALA A N     1 
ATOM   3079  C CA    . ALA A 1 400 ? 164.973 145.937 81.022  1.00 144.66 ? 400 ALA A CA    1 
ATOM   3080  C C     . ALA A 1 400 ? 163.966 145.146 81.847  1.00 144.66 ? 400 ALA A C     1 
ATOM   3081  O O     . ALA A 1 400 ? 163.031 145.739 82.400  1.00 144.66 ? 400 ALA A O     1 
ATOM   3082  C CB    . ALA A 1 400 ? 165.774 146.868 81.920  1.00 144.66 ? 400 ALA A CB    1 
ATOM   3083  N N     . PRO A 1 401 ? 164.105 143.822 81.952  1.00 143.61 ? 401 PRO A N     1 
ATOM   3084  C CA    . PRO A 1 401 ? 163.167 143.062 82.795  1.00 143.61 ? 401 PRO A CA    1 
ATOM   3085  C C     . PRO A 1 401 ? 163.393 143.274 84.280  1.00 143.61 ? 401 PRO A C     1 
ATOM   3086  O O     . PRO A 1 401 ? 162.425 143.398 85.041  1.00 143.61 ? 401 PRO A O     1 
ATOM   3087  C CB    . PRO A 1 401 ? 163.437 141.608 82.388  1.00 143.61 ? 401 PRO A CB    1 
ATOM   3088  C CG    . PRO A 1 401 ? 164.114 141.698 81.057  1.00 143.61 ? 401 PRO A CG    1 
ATOM   3089  C CD    . PRO A 1 401 ? 164.936 142.940 81.120  1.00 143.61 ? 401 PRO A CD    1 
ATOM   3090  N N     . THR A 1 402 ? 164.645 143.309 84.717  1.00 141.56 ? 402 THR A N     1 
ATOM   3091  C CA    . THR A 1 402 ? 165.008 143.373 86.120  1.00 141.56 ? 402 THR A CA    1 
ATOM   3092  C C     . THR A 1 402 ? 165.466 144.775 86.497  1.00 141.56 ? 402 THR A C     1 
ATOM   3093  O O     . THR A 1 402 ? 166.262 145.380 85.771  1.00 141.56 ? 402 THR A O     1 
ATOM   3094  C CB    . THR A 1 402 ? 166.129 142.374 86.428  1.00 141.56 ? 402 THR A CB    1 
ATOM   3095  O OG1   . THR A 1 402 ? 165.687 141.048 86.117  1.00 141.56 ? 402 THR A OG1   1 
ATOM   3096  C CG2   . THR A 1 402 ? 166.535 142.436 87.892  1.00 141.56 ? 402 THR A CG2   1 
ATOM   3097  N N     . PRO A 1 403 ? 164.987 145.318 87.620  1.00 135.44 ? 403 PRO A N     1 
ATOM   3098  C CA    . PRO A 1 403 ? 165.470 146.643 88.045  1.00 135.44 ? 403 PRO A CA    1 
ATOM   3099  C C     . PRO A 1 403 ? 166.966 146.679 88.311  1.00 135.44 ? 403 PRO A C     1 
ATOM   3100  O O     . PRO A 1 403 ? 167.627 147.669 87.970  1.00 135.44 ? 403 PRO A O     1 
ATOM   3101  C CB    . PRO A 1 403 ? 164.649 146.921 89.312  1.00 135.44 ? 403 PRO A CB    1 
ATOM   3102  C CG    . PRO A 1 403 ? 164.224 145.579 89.801  1.00 135.44 ? 403 PRO A CG    1 
ATOM   3103  C CD    . PRO A 1 403 ? 164.011 144.753 88.568  1.00 135.44 ? 403 PRO A CD    1 
ATOM   3104  N N     . ALA A 1 404 ? 167.524 145.622 88.906  1.00 140.64 ? 404 ALA A N     1 
ATOM   3105  C CA    . ALA A 1 404 ? 168.968 145.578 89.113  1.00 140.64 ? 404 ALA A CA    1 
ATOM   3106  C C     . ALA A 1 404 ? 169.709 145.571 87.782  1.00 140.64 ? 404 ALA A C     1 
ATOM   3107  O O     . ALA A 1 404 ? 170.736 146.245 87.628  1.00 140.64 ? 404 ALA A O     1 
ATOM   3108  C CB    . ALA A 1 404 ? 169.345 144.357 89.948  1.00 140.64 ? 404 ALA A CB    1 
ATOM   3109  N N     . GLU A 1 405 ? 169.202 144.815 86.807  1.00 147.76 ? 405 GLU A N     1 
ATOM   3110  C CA    . GLU A 1 405 ? 169.816 144.816 85.484  1.00 147.76 ? 405 GLU A CA    1 
ATOM   3111  C C     . GLU A 1 405 ? 169.718 146.189 84.836  1.00 147.76 ? 405 GLU A C     1 
ATOM   3112  O O     . GLU A 1 405 ? 170.642 146.620 84.137  1.00 147.76 ? 405 GLU A O     1 
ATOM   3113  C CB    . GLU A 1 405 ? 169.161 143.755 84.601  1.00 147.76 ? 405 GLU A CB    1 
ATOM   3114  C CG    . GLU A 1 405 ? 169.431 142.332 85.051  1.00 147.76 ? 405 GLU A CG    1 
ATOM   3115  C CD    . GLU A 1 405 ? 170.889 141.946 84.911  1.00 147.76 ? 405 GLU A CD    1 
ATOM   3116  O OE1   . GLU A 1 405 ? 171.553 142.448 83.980  1.00 147.76 ? 405 GLU A OE1   1 
ATOM   3117  O OE2   . GLU A 1 405 ? 171.372 141.140 85.734  1.00 147.76 ? 405 GLU A OE2   1 
ATOM   3118  N N     . ALA A 1 406 ? 168.605 146.892 85.054  1.00 137.10 ? 406 ALA A N     1 
ATOM   3119  C CA    . ALA A 1 406 ? 168.478 148.247 84.531  1.00 137.10 ? 406 ALA A CA    1 
ATOM   3120  C C     . ALA A 1 406 ? 169.507 149.175 85.160  1.00 137.10 ? 406 ALA A C     1 
ATOM   3121  O O     . ALA A 1 406 ? 170.121 149.996 84.468  1.00 137.10 ? 406 ALA A O     1 
ATOM   3122  C CB    . ALA A 1 406 ? 167.064 148.772 84.770  1.00 137.10 ? 406 ALA A CB    1 
ATOM   3123  N N     . LYS A 1 407 ? 169.702 149.064 86.475  1.00 132.11 ? 407 LYS A N     1 
ATOM   3124  C CA    . LYS A 1 407 ? 170.739 149.847 87.137  1.00 132.11 ? 407 LYS A CA    1 
ATOM   3125  C C     . LYS A 1 407 ? 172.111 149.549 86.547  1.00 132.11 ? 407 LYS A C     1 
ATOM   3126  O O     . LYS A 1 407 ? 172.892 150.468 86.265  1.00 132.11 ? 407 LYS A O     1 
ATOM   3127  C CB    . LYS A 1 407 ? 170.728 149.559 88.637  1.00 132.11 ? 407 LYS A CB    1 
ATOM   3128  C CG    . LYS A 1 407 ? 171.714 150.385 89.435  1.00 132.11 ? 407 LYS A CG    1 
ATOM   3129  C CD    . LYS A 1 407 ? 171.720 149.974 90.898  1.00 132.11 ? 407 LYS A CD    1 
ATOM   3130  C CE    . LYS A 1 407 ? 170.473 150.459 91.613  1.00 132.11 ? 407 LYS A CE    1 
ATOM   3131  N NZ    . LYS A 1 407 ? 170.531 150.177 93.073  1.00 132.11 ? 407 LYS A NZ    1 
ATOM   3132  N N     . THR A 1 408 ? 172.417 148.266 86.347  1.00 139.91 ? 408 THR A N     1 
ATOM   3133  C CA    . THR A 1 408 ? 173.715 147.893 85.795  1.00 139.91 ? 408 THR A CA    1 
ATOM   3134  C C     . THR A 1 408 ? 173.893 148.443 84.385  1.00 139.91 ? 408 THR A C     1 
ATOM   3135  O O     . THR A 1 408 ? 174.976 148.923 84.029  1.00 139.91 ? 408 THR A O     1 
ATOM   3136  C CB    . THR A 1 408 ? 173.869 146.372 85.805  1.00 139.91 ? 408 THR A CB    1 
ATOM   3137  O OG1   . THR A 1 408 ? 173.762 145.892 87.151  1.00 139.91 ? 408 THR A OG1   1 
ATOM   3138  C CG2   . THR A 1 408 ? 175.221 145.969 85.242  1.00 139.91 ? 408 THR A CG2   1 
ATOM   3139  N N     . ALA A 1 409 ? 172.838 148.391 83.571  1.00 135.29 ? 409 ALA A N     1 
ATOM   3140  C CA    . ALA A 1 409 ? 172.919 148.928 82.218  1.00 135.29 ? 409 ALA A CA    1 
ATOM   3141  C C     . ALA A 1 409 ? 173.129 150.435 82.238  1.00 135.29 ? 409 ALA A C     1 
ATOM   3142  O O     . ALA A 1 409 ? 173.897 150.973 81.432  1.00 135.29 ? 409 ALA A O     1 
ATOM   3143  C CB    . ALA A 1 409 ? 171.658 148.572 81.434  1.00 135.29 ? 409 ALA A CB    1 
ATOM   3144  N N     . LEU A 1 410 ? 172.447 151.136 83.147  1.00 132.29 ? 410 LEU A N     1 
ATOM   3145  C CA    . LEU A 1 410 ? 172.665 152.573 83.285  1.00 132.29 ? 410 LEU A CA    1 
ATOM   3146  C C     . LEU A 1 410 ? 174.104 152.873 83.678  1.00 132.29 ? 410 LEU A C     1 
ATOM   3147  O O     . LEU A 1 410 ? 174.694 153.852 83.209  1.00 132.29 ? 410 LEU A O     1 
ATOM   3148  C CB    . LEU A 1 410 ? 171.700 153.157 84.314  1.00 132.29 ? 410 LEU A CB    1 
ATOM   3149  C CG    . LEU A 1 410 ? 170.223 153.190 83.930  1.00 132.29 ? 410 LEU A CG    1 
ATOM   3150  C CD1   . LEU A 1 410 ? 169.383 153.644 85.107  1.00 132.29 ? 410 LEU A CD1   1 
ATOM   3151  C CD2   . LEU A 1 410 ? 170.012 154.103 82.737  1.00 132.29 ? 410 LEU A CD2   1 
ATOM   3152  N N     . VAL A 1 411 ? 174.682 152.042 84.544  1.00 134.77 ? 411 VAL A N     1 
ATOM   3153  C CA    . VAL A 1 411 ? 176.069 152.253 84.949  1.00 134.77 ? 411 VAL A CA    1 
ATOM   3154  C C     . VAL A 1 411 ? 177.015 151.973 83.787  1.00 134.77 ? 411 VAL A C     1 
ATOM   3155  O O     . VAL A 1 411 ? 178.049 152.635 83.634  1.00 134.77 ? 411 VAL A O     1 
ATOM   3156  C CB    . VAL A 1 411 ? 176.402 151.385 86.177  1.00 134.77 ? 411 VAL A CB    1 
ATOM   3157  C CG1   . VAL A 1 411 ? 177.876 151.489 86.525  1.00 134.77 ? 411 VAL A CG1   1 
ATOM   3158  C CG2   . VAL A 1 411 ? 175.555 151.805 87.360  1.00 134.77 ? 411 VAL A CG2   1 
ATOM   3159  N N     . ALA A 1 412 ? 176.667 151.005 82.936  1.00 136.38 ? 412 ALA A N     1 
ATOM   3160  C CA    . ALA A 1 412 ? 177.618 150.511 81.944  1.00 136.38 ? 412 ALA A CA    1 
ATOM   3161  C C     . ALA A 1 412 ? 177.874 151.526 80.835  1.00 136.38 ? 412 ALA A C     1 
ATOM   3162  O O     . ALA A 1 412 ? 179.012 151.675 80.375  1.00 136.38 ? 412 ALA A O     1 
ATOM   3163  C CB    . ALA A 1 412 ? 177.119 149.192 81.355  1.00 136.38 ? 412 ALA A CB    1 
ATOM   3164  N N     . ASN A 1 413 ? 176.839 152.227 80.390  1.00 133.49 ? 413 ASN A N     1 
ATOM   3165  C CA    . ASN A 1 413 ? 177.020 153.053 79.199  1.00 133.49 ? 413 ASN A CA    1 
ATOM   3166  C C     . ASN A 1 413 ? 177.347 154.488 79.578  1.00 133.49 ? 413 ASN A C     1 
ATOM   3167  O O     . ASN A 1 413 ? 176.849 154.982 80.599  1.00 133.49 ? 413 ASN A O     1 
ATOM   3168  C CB    . ASN A 1 413 ? 175.768 153.031 78.332  1.00 133.49 ? 413 ASN A CB    1 
ATOM   3169  C CG    . ASN A 1 413 ? 175.550 151.694 77.661  1.00 133.49 ? 413 ASN A CG    1 
ATOM   3170  O OD1   . ASN A 1 413 ? 176.493 151.065 77.183  1.00 133.49 ? 413 ASN A OD1   1 
ATOM   3171  N ND2   . ASN A 1 413 ? 174.299 151.253 77.614  1.00 133.49 ? 413 ASN A ND2   1 
ATOM   3172  N N     . PRO A 1 414 ? 178.171 155.183 78.791  1.00 121.18 ? 414 PRO A N     1 
ATOM   3173  C CA    . PRO A 1 414 ? 178.375 156.621 79.011  1.00 121.18 ? 414 PRO A CA    1 
ATOM   3174  C C     . PRO A 1 414 ? 177.131 157.419 78.650  1.00 121.18 ? 414 PRO A C     1 
ATOM   3175  O O     . PRO A 1 414 ? 176.105 156.836 78.286  1.00 121.18 ? 414 PRO A O     1 
ATOM   3176  C CB    . PRO A 1 414 ? 179.547 156.957 78.079  1.00 121.18 ? 414 PRO A CB    1 
ATOM   3177  C CG    . PRO A 1 414 ? 180.216 155.646 77.817  1.00 121.18 ? 414 PRO A CG    1 
ATOM   3178  C CD    . PRO A 1 414 ? 179.110 154.640 77.799  1.00 121.18 ? 414 PRO A CD    1 
ATOM   3179  N N     . TRP A 1 415 ? 177.200 158.744 78.745  1.00 108.30 ? 415 TRP A N     1 
ATOM   3180  C CA    . TRP A 1 415 ? 176.046 159.579 78.459  1.00 108.30 ? 415 TRP A CA    1 
ATOM   3181  C C     . TRP A 1 415 ? 176.462 160.797 77.654  1.00 108.30 ? 415 TRP A C     1 
ATOM   3182  O O     . TRP A 1 415 ? 177.632 161.186 77.636  1.00 108.30 ? 415 TRP A O     1 
ATOM   3183  C CB    . TRP A 1 415 ? 175.329 159.994 79.743  1.00 108.30 ? 415 TRP A CB    1 
ATOM   3184  C CG    . TRP A 1 415 ? 174.695 158.823 80.392  1.00 108.30 ? 415 TRP A CG    1 
ATOM   3185  C CD1   . TRP A 1 415 ? 175.179 158.108 81.443  1.00 108.30 ? 415 TRP A CD1   1 
ATOM   3186  C CD2   . TRP A 1 415 ? 173.480 158.184 79.995  1.00 108.30 ? 415 TRP A CD2   1 
ATOM   3187  N NE1   . TRP A 1 415 ? 174.327 157.076 81.744  1.00 108.30 ? 415 TRP A NE1   1 
ATOM   3188  C CE2   . TRP A 1 415 ? 173.275 157.101 80.868  1.00 108.30 ? 415 TRP A CE2   1 
ATOM   3189  C CE3   . TRP A 1 415 ? 172.538 158.432 78.994  1.00 108.30 ? 415 TRP A CE3   1 
ATOM   3190  C CZ2   . TRP A 1 415 ? 172.169 156.266 80.771  1.00 108.30 ? 415 TRP A CZ2   1 
ATOM   3191  C CZ3   . TRP A 1 415 ? 171.441 157.602 78.900  1.00 108.30 ? 415 TRP A CZ3   1 
ATOM   3192  C CH2   . TRP A 1 415 ? 171.266 156.532 79.782  1.00 108.30 ? 415 TRP A CH2   1 
ATOM   3193  N N     . GLN A 1 416 ? 175.477 161.400 76.990  1.00 118.20 ? 416 GLN A N     1 
ATOM   3194  C CA    . GLN A 1 416 ? 175.728 162.407 75.968  1.00 118.20 ? 416 GLN A CA    1 
ATOM   3195  C C     . GLN A 1 416 ? 175.945 163.797 76.549  1.00 118.20 ? 416 GLN A C     1 
ATOM   3196  O O     . GLN A 1 416 ? 176.737 164.570 76.003  1.00 118.20 ? 416 GLN A O     1 
ATOM   3197  C CB    . GLN A 1 416 ? 174.568 162.416 74.970  1.00 118.20 ? 416 GLN A CB    1 
ATOM   3198  C CG    . GLN A 1 416 ? 174.807 163.247 73.728  1.00 118.20 ? 416 GLN A CG    1 
ATOM   3199  C CD    . GLN A 1 416 ? 174.325 164.669 73.882  1.00 118.20 ? 416 GLN A CD    1 
ATOM   3200  O OE1   . GLN A 1 416 ? 173.376 164.935 74.618  1.00 118.20 ? 416 GLN A OE1   1 
ATOM   3201  N NE2   . GLN A 1 416 ? 174.973 165.593 73.186  1.00 118.20 ? 416 GLN A NE2   1 
ATOM   3202  N N     . LEU A 1 417 ? 175.264 164.131 77.647  1.00 118.02 ? 417 LEU A N     1 
ATOM   3203  C CA    . LEU A 1 417 ? 175.446 165.411 78.332  1.00 118.02 ? 417 LEU A CA    1 
ATOM   3204  C C     . LEU A 1 417 ? 175.149 166.572 77.376  1.00 118.02 ? 417 LEU A C     1 
ATOM   3205  O O     . LEU A 1 417 ? 176.036 167.296 76.924  1.00 118.02 ? 417 LEU A O     1 
ATOM   3206  C CB    . LEU A 1 417 ? 176.856 165.503 78.934  1.00 118.02 ? 417 LEU A CB    1 
ATOM   3207  C CG    . LEU A 1 417 ? 177.148 166.558 80.007  1.00 118.02 ? 417 LEU A CG    1 
ATOM   3208  C CD1   . LEU A 1 417 ? 178.198 166.032 80.975  1.00 118.02 ? 417 LEU A CD1   1 
ATOM   3209  C CD2   . LEU A 1 417 ? 177.610 167.880 79.421  1.00 118.02 ? 417 LEU A CD2   1 
ATOM   3210  N N     . GLY A 1 418 ? 173.869 166.680 77.025  1.00 122.24 ? 418 GLY A N     1 
ATOM   3211  C CA    . GLY A 1 418 ? 173.406 167.717 76.120  1.00 122.24 ? 418 GLY A CA    1 
ATOM   3212  C C     . GLY A 1 418 ? 173.872 169.115 76.474  1.00 122.24 ? 418 GLY A C     1 
ATOM   3213  O O     . GLY A 1 418 ? 174.249 169.381 77.619  1.00 122.24 ? 418 GLY A O     1 
ATOM   3214  N N     . ASN A 1 419 ? 173.840 170.022 75.494  1.00 134.37 ? 419 ASN A N     1 
ATOM   3215  C CA    . ASN A 1 419 ? 174.447 171.338 75.677  1.00 134.37 ? 419 ASN A CA    1 
ATOM   3216  C C     . ASN A 1 419 ? 173.729 172.149 76.749  1.00 134.37 ? 419 ASN A C     1 
ATOM   3217  O O     . ASN A 1 419 ? 174.369 172.870 77.522  1.00 134.37 ? 419 ASN A O     1 
ATOM   3218  C CB    . ASN A 1 419 ? 174.461 172.095 74.351  1.00 134.37 ? 419 ASN A CB    1 
ATOM   3219  C CG    . ASN A 1 419 ? 175.433 171.500 73.356  1.00 134.37 ? 419 ASN A CG    1 
ATOM   3220  O OD1   . ASN A 1 419 ? 176.539 171.101 73.717  1.00 134.37 ? 419 ASN A OD1   1 
ATOM   3221  N ND2   . ASN A 1 419 ? 175.028 171.441 72.093  1.00 134.37 ? 419 ASN A ND2   1 
ATOM   3222  N N     . VAL A 1 420 ? 172.399 172.050 76.810  1.00 127.60 ? 420 VAL A N     1 
ATOM   3223  C CA    . VAL A 1 420 ? 171.656 172.811 77.810  1.00 127.60 ? 420 VAL A CA    1 
ATOM   3224  C C     . VAL A 1 420 ? 171.953 172.301 79.212  1.00 127.60 ? 420 VAL A C     1 
ATOM   3225  O O     . VAL A 1 420 ? 171.731 173.012 80.199  1.00 127.60 ? 420 VAL A O     1 
ATOM   3226  C CB    . VAL A 1 420 ? 170.148 172.772 77.504  1.00 127.60 ? 420 VAL A CB    1 
ATOM   3227  C CG1   . VAL A 1 420 ? 169.864 173.455 76.179  1.00 127.60 ? 420 VAL A CG1   1 
ATOM   3228  C CG2   . VAL A 1 420 ? 169.649 171.338 77.486  1.00 127.60 ? 420 VAL A CG2   1 
ATOM   3229  N N     . ALA A 1 421 ? 172.458 171.072 79.328  1.00 122.00 ? 421 ALA A N     1 
ATOM   3230  C CA    . ALA A 1 421 ? 172.795 170.538 80.643  1.00 122.00 ? 421 ALA A CA    1 
ATOM   3231  C C     . ALA A 1 421 ? 174.001 171.254 81.237  1.00 122.00 ? 421 ALA A C     1 
ATOM   3232  O O     . ALA A 1 421 ? 174.104 171.402 82.460  1.00 122.00 ? 421 ALA A O     1 
ATOM   3233  C CB    . ALA A 1 421 ? 173.053 169.035 80.550  1.00 122.00 ? 421 ALA A CB    1 
ATOM   3234  N N     . ALA A 1 422 ? 174.924 171.701 80.392  1.00 116.40 ? 422 ALA A N     1 
ATOM   3235  C CA    . ALA A 1 422 ? 176.110 172.400 80.869  1.00 116.40 ? 422 ALA A CA    1 
ATOM   3236  C C     . ALA A 1 422 ? 176.011 173.894 80.593  1.00 116.40 ? 422 ALA A C     1 
ATOM   3237  O O     . ALA A 1 422 ? 176.953 174.503 80.089  1.00 116.40 ? 422 ALA A O     1 
ATOM   3238  C CB    . ALA A 1 422 ? 177.358 171.825 80.225  1.00 116.40 ? 422 ALA A CB    1 
ATOM   3239  N N     . ALA A 1 427 ? 181.071 175.390 86.767  1.00 185.48 ? 427 ALA A N     1 
ATOM   3240  C CA    . ALA A 1 427 ? 181.128 175.674 88.195  1.00 185.48 ? 427 ALA A CA    1 
ATOM   3241  C C     . ALA A 1 427 ? 182.566 175.891 88.649  1.00 185.48 ? 427 ALA A C     1 
ATOM   3242  O O     . ALA A 1 427 ? 183.420 176.296 87.861  1.00 185.48 ? 427 ALA A O     1 
ATOM   3243  C CB    . ALA A 1 427 ? 180.486 174.548 88.986  1.00 185.48 ? 427 ALA A CB    1 
ATOM   3244  N N     . GLY A 1 428 ? 182.825 175.621 89.926  1.00 193.69 ? 428 GLY A N     1 
ATOM   3245  C CA    . GLY A 1 428 ? 184.156 175.772 90.477  1.00 193.69 ? 428 GLY A CA    1 
ATOM   3246  C C     . GLY A 1 428 ? 185.163 174.831 89.851  1.00 193.69 ? 428 GLY A C     1 
ATOM   3247  O O     . GLY A 1 428 ? 184.789 173.801 89.283  1.00 193.69 ? 428 GLY A O     1 
ATOM   3248  N N     . ASP A 1 429 ? 186.449 175.184 89.938  1.00 193.20 ? 429 ASP A N     1 
ATOM   3249  C CA    . ASP A 1 429 ? 187.496 174.325 89.395  1.00 193.20 ? 429 ASP A CA    1 
ATOM   3250  C C     . ASP A 1 429 ? 187.489 172.956 90.062  1.00 193.20 ? 429 ASP A C     1 
ATOM   3251  O O     . ASP A 1 429 ? 187.681 171.929 89.401  1.00 193.20 ? 429 ASP A O     1 
ATOM   3252  C CB    . ASP A 1 429 ? 188.858 175.000 89.563  1.00 193.20 ? 429 ASP A CB    1 
ATOM   3253  C CG    . ASP A 1 429 ? 189.973 174.235 88.888  1.00 193.20 ? 429 ASP A CG    1 
ATOM   3254  O OD1   . ASP A 1 429 ? 190.056 174.281 87.643  1.00 193.20 ? 429 ASP A OD1   1 
ATOM   3255  O OD2   . ASP A 1 429 ? 190.766 173.588 89.601  1.00 193.20 ? 429 ASP A OD2   1 
ATOM   3256  N N     . ASP A 1 430 ? 187.270 172.925 91.370  1.00 171.83 ? 430 ASP A N     1 
ATOM   3257  C CA    . ASP A 1 430 ? 187.150 171.687 92.127  1.00 171.83 ? 430 ASP A CA    1 
ATOM   3258  C C     . ASP A 1 430 ? 186.225 171.953 93.310  1.00 171.83 ? 430 ASP A C     1 
ATOM   3259  O O     . ASP A 1 430 ? 185.464 172.926 93.309  1.00 171.83 ? 430 ASP A O     1 
ATOM   3260  C CB    . ASP A 1 430 ? 188.539 171.165 92.539  1.00 171.83 ? 430 ASP A CB    1 
ATOM   3261  C CG    . ASP A 1 430 ? 189.321 172.164 93.372  1.00 171.83 ? 430 ASP A CG    1 
ATOM   3262  O OD1   . ASP A 1 430 ? 188.842 173.303 93.559  1.00 171.83 ? 430 ASP A OD1   1 
ATOM   3263  O OD2   . ASP A 1 430 ? 190.421 171.807 93.845  1.00 171.83 ? 430 ASP A OD2   1 
ATOM   3264  N N     . ALA A 1 431 ? 186.271 171.071 94.308  1.00 143.33 ? 431 ALA A N     1 
ATOM   3265  C CA    . ALA A 1 431 ? 185.524 171.155 95.559  1.00 143.33 ? 431 ALA A CA    1 
ATOM   3266  C C     . ALA A 1 431 ? 184.027 170.968 95.368  1.00 143.33 ? 431 ALA A C     1 
ATOM   3267  O O     . ALA A 1 431 ? 183.268 171.161 96.323  1.00 143.33 ? 431 ALA A O     1 
ATOM   3268  C CB    . ALA A 1 431 ? 185.769 172.475 96.306  1.00 143.33 ? 431 ALA A CB    1 
ATOM   3269  N N     . ALA A 1 432 ? 183.571 170.618 94.170  1.00 128.80 ? 432 ALA A N     1 
ATOM   3270  C CA    . ALA A 1 432 ? 182.176 170.266 93.962  1.00 128.80 ? 432 ALA A CA    1 
ATOM   3271  C C     . ALA A 1 432 ? 181.933 168.767 94.046  1.00 128.80 ? 432 ALA A C     1 
ATOM   3272  O O     . ALA A 1 432 ? 180.795 168.328 93.852  1.00 128.80 ? 432 ALA A O     1 
ATOM   3273  C CB    . ALA A 1 432 ? 181.694 170.791 92.606  1.00 128.80 ? 432 ALA A CB    1 
ATOM   3274  N N     . ARG A 1 433 ? 182.967 167.980 94.329  1.00 123.10 ? 433 ARG A N     1 
ATOM   3275  C CA    . ARG A 1 433 ? 182.882 166.534 94.407  1.00 123.10 ? 433 ARG A CA    1 
ATOM   3276  C C     . ARG A 1 433 ? 183.437 166.038 95.737  1.00 123.10 ? 433 ARG A C     1 
ATOM   3277  O O     . ARG A 1 433 ? 184.343 166.655 96.304  1.00 123.10 ? 433 ARG A O     1 
ATOM   3278  C CB    . ARG A 1 433 ? 183.648 165.887 93.246  1.00 123.10 ? 433 ARG A CB    1 
ATOM   3279  C CG    . ARG A 1 433 ? 185.122 166.236 93.214  1.00 123.10 ? 433 ARG A CG    1 
ATOM   3280  C CD    . ARG A 1 433 ? 185.801 165.644 91.993  1.00 123.10 ? 433 ARG A CD    1 
ATOM   3281  N NE    . ARG A 1 433 ? 185.848 164.187 92.041  1.00 123.10 ? 433 ARG A NE    1 
ATOM   3282  C CZ    . ARG A 1 433 ? 186.134 163.419 90.996  1.00 123.10 ? 433 ARG A CZ    1 
ATOM   3283  N NH1   . ARG A 1 433 ? 186.158 162.100 91.126  1.00 123.10 ? 433 ARG A NH1   1 
ATOM   3284  N NH2   . ARG A 1 433 ? 186.399 163.970 89.820  1.00 123.10 ? 433 ARG A NH2   1 
ATOM   3285  N N     . PRO A 1 434 ? 182.903 164.938 96.266  1.00 125.32 ? 434 PRO A N     1 
ATOM   3286  C CA    . PRO A 1 434 ? 183.353 164.449 97.574  1.00 125.32 ? 434 PRO A CA    1 
ATOM   3287  C C     . PRO A 1 434 ? 184.805 163.998 97.545  1.00 125.32 ? 434 PRO A C     1 
ATOM   3288  O O     . PRO A 1 434 ? 185.443 163.883 96.497  1.00 125.32 ? 434 PRO A O     1 
ATOM   3289  C CB    . PRO A 1 434 ? 182.413 163.273 97.858  1.00 125.32 ? 434 PRO A CB    1 
ATOM   3290  C CG    . PRO A 1 434 ? 181.211 163.546 97.027  1.00 125.32 ? 434 PRO A CG    1 
ATOM   3291  C CD    . PRO A 1 434 ? 181.732 164.194 95.780  1.00 125.32 ? 434 PRO A CD    1 
ATOM   3292  N N     . GLU A 1 435 ? 185.330 163.734 98.742  1.00 140.11 ? 435 GLU A N     1 
ATOM   3293  C CA    . GLU A 1 435 ? 186.715 163.296 98.868  1.00 140.11 ? 435 GLU A CA    1 
ATOM   3294  C C     . GLU A 1 435 ? 186.871 161.841 98.450  1.00 140.11 ? 435 GLU A C     1 
ATOM   3295  O O     . GLU A 1 435 ? 187.746 161.505 97.644  1.00 140.11 ? 435 GLU A O     1 
ATOM   3296  C CB    . GLU A 1 435 ? 187.196 163.490 100.304 1.00 140.11 ? 435 GLU A CB    1 
ATOM   3297  C CG    . GLU A 1 435 ? 187.296 164.938 100.739 1.00 140.11 ? 435 GLU A CG    1 
ATOM   3298  C CD    . GLU A 1 435 ? 187.749 165.075 102.178 1.00 140.11 ? 435 GLU A CD    1 
ATOM   3299  O OE1   . GLU A 1 435 ? 187.866 164.038 102.864 1.00 140.11 ? 435 GLU A OE1   1 
ATOM   3300  O OE2   . GLU A 1 435 ? 187.985 166.217 102.625 1.00 140.11 ? 435 GLU A OE2   1 
ATOM   3301  N N     . TRP A 1 436 ? 186.024 160.962 98.988  1.00 133.64 ? 436 TRP A N     1 
ATOM   3302  C CA    . TRP A 1 436 ? 186.150 159.536 98.714  1.00 133.64 ? 436 TRP A CA    1 
ATOM   3303  C C     . TRP A 1 436 ? 185.811 159.187 97.272  1.00 133.64 ? 436 TRP A C     1 
ATOM   3304  O O     . TRP A 1 436 ? 186.007 158.038 96.861  1.00 133.64 ? 436 TRP A O     1 
ATOM   3305  C CB    . TRP A 1 436 ? 185.257 158.746 99.668  1.00 133.64 ? 436 TRP A CB    1 
ATOM   3306  C CG    . TRP A 1 436 ? 183.809 159.074 99.526  1.00 133.64 ? 436 TRP A CG    1 
ATOM   3307  C CD1   . TRP A 1 436 ? 183.124 160.055 100.178 1.00 133.64 ? 436 TRP A CD1   1 
ATOM   3308  C CD2   . TRP A 1 436 ? 182.863 158.417 98.679  1.00 133.64 ? 436 TRP A CD2   1 
ATOM   3309  N NE1   . TRP A 1 436 ? 181.808 160.051 99.789  1.00 133.64 ? 436 TRP A NE1   1 
ATOM   3310  C CE2   . TRP A 1 436 ? 181.621 159.054 98.869  1.00 133.64 ? 436 TRP A CE2   1 
ATOM   3311  C CE3   . TRP A 1 436 ? 182.944 157.352 97.778  1.00 133.64 ? 436 TRP A CE3   1 
ATOM   3312  C CZ2   . TRP A 1 436 ? 180.471 158.661 98.191  1.00 133.64 ? 436 TRP A CZ2   1 
ATOM   3313  C CZ3   . TRP A 1 436 ? 181.802 156.964 97.107  1.00 133.64 ? 436 TRP A CZ3   1 
ATOM   3314  C CH2   . TRP A 1 436 ? 180.581 157.617 97.316  1.00 133.64 ? 436 TRP A CH2   1 
ATOM   3315  N N     . LEU A 1 437 ? 185.302 160.140 96.498  1.00 130.14 ? 437 LEU A N     1 
ATOM   3316  C CA    . LEU A 1 437 ? 185.026 159.886 95.093  1.00 130.14 ? 437 LEU A CA    1 
ATOM   3317  C C     . LEU A 1 437 ? 186.330 159.738 94.321  1.00 130.14 ? 437 LEU A C     1 
ATOM   3318  O O     . LEU A 1 437 ? 187.264 160.526 94.497  1.00 130.14 ? 437 LEU A O     1 
ATOM   3319  C CB    . LEU A 1 437 ? 184.188 161.020 94.508  1.00 130.14 ? 437 LEU A CB    1 
ATOM   3320  C CG    . LEU A 1 437 ? 183.752 160.841 93.054  1.00 130.14 ? 437 LEU A CG    1 
ATOM   3321  C CD1   . LEU A 1 437 ? 182.847 159.627 92.916  1.00 130.14 ? 437 LEU A CD1   1 
ATOM   3322  C CD2   . LEU A 1 437 ? 183.064 162.096 92.537  1.00 130.14 ? 437 LEU A CD2   1 
ATOM   3323  N N     . GLU A 1 438 ? 186.392 158.734 93.474  1.00 136.26 ? 438 GLU A N     1 
ATOM   3324  C CA    . GLU A 1 438 ? 187.587 158.454 92.697  1.00 136.26 ? 438 GLU A CA    1 
ATOM   3325  C C     . GLU A 1 438 ? 187.597 159.275 91.413  1.00 136.26 ? 438 GLU A C     1 
ATOM   3326  O O     . GLU A 1 438 ? 186.539 159.641 90.891  1.00 136.26 ? 438 GLU A O     1 
ATOM   3327  C CB    . GLU A 1 438 ? 187.660 156.966 92.367  1.00 136.26 ? 438 GLU A CB    1 
ATOM   3328  C CG    . GLU A 1 438 ? 187.900 156.080 93.577  1.00 136.26 ? 438 GLU A CG    1 
ATOM   3329  C CD    . GLU A 1 438 ? 186.633 155.819 94.370  1.00 136.26 ? 438 GLU A CD    1 
ATOM   3330  O OE1   . GLU A 1 438 ? 185.556 156.290 93.949  1.00 136.26 ? 438 GLU A OE1   1 
ATOM   3331  O OE2   . GLU A 1 438 ? 186.713 155.146 95.418  1.00 136.26 ? 438 GLU A OE2   1 
ATOM   3332  N N     . PRO A 1 439 ? 188.783 159.585 90.880  1.00 135.04 ? 439 PRO A N     1 
ATOM   3333  C CA    . PRO A 1 439 ? 188.862 160.443 89.687  1.00 135.04 ? 439 PRO A CA    1 
ATOM   3334  C C     . PRO A 1 439 ? 188.303 159.817 88.419  1.00 135.04 ? 439 PRO A C     1 
ATOM   3335  O O     . PRO A 1 439 ? 188.343 160.466 87.368  1.00 135.04 ? 439 PRO A O     1 
ATOM   3336  C CB    . PRO A 1 439 ? 190.372 160.693 89.542  1.00 135.04 ? 439 PRO A CB    1 
ATOM   3337  C CG    . PRO A 1 439 ? 190.937 160.439 90.899  1.00 135.04 ? 439 PRO A CG    1 
ATOM   3338  C CD    . PRO A 1 439 ? 190.109 159.328 91.462  1.00 135.04 ? 439 PRO A CD    1 
ATOM   3339  N N     . GLU A 1 440 ? 187.787 158.593 88.469  1.00 134.26 ? 440 GLU A N     1 
ATOM   3340  C CA    . GLU A 1 440 ? 187.320 157.906 87.273  1.00 134.26 ? 440 GLU A CA    1 
ATOM   3341  C C     . GLU A 1 440 ? 185.875 158.224 86.918  1.00 134.26 ? 440 GLU A C     1 
ATOM   3342  O O     . GLU A 1 440 ? 185.315 157.570 86.033  1.00 134.26 ? 440 GLU A O     1 
ATOM   3343  C CB    . GLU A 1 440 ? 187.479 156.395 87.443  1.00 134.26 ? 440 GLU A CB    1 
ATOM   3344  C CG    . GLU A 1 440 ? 188.920 155.938 87.501  1.00 134.26 ? 440 GLU A CG    1 
ATOM   3345  C CD    . GLU A 1 440 ? 189.040 154.444 87.689  1.00 134.26 ? 440 GLU A CD    1 
ATOM   3346  O OE1   . GLU A 1 440 ? 187.999 153.790 87.908  1.00 134.26 ? 440 GLU A OE1   1 
ATOM   3347  O OE2   . GLU A 1 440 ? 190.172 153.924 87.615  1.00 134.26 ? 440 GLU A OE2   1 
ATOM   3348  N N     . PHE A 1 441 ? 185.258 159.200 87.576  1.00 123.60 ? 441 PHE A N     1 
ATOM   3349  C CA    . PHE A 1 441 ? 183.865 159.546 87.339  1.00 123.60 ? 441 PHE A CA    1 
ATOM   3350  C C     . PHE A 1 441 ? 183.751 161.044 87.101  1.00 123.60 ? 441 PHE A C     1 
ATOM   3351  O O     . PHE A 1 441 ? 184.353 161.838 87.830  1.00 123.60 ? 441 PHE A O     1 
ATOM   3352  C CB    . PHE A 1 441 ? 182.995 159.121 88.521  1.00 123.60 ? 441 PHE A CB    1 
ATOM   3353  C CG    . PHE A 1 441 ? 183.015 157.644 88.782  1.00 123.60 ? 441 PHE A CG    1 
ATOM   3354  C CD1   . PHE A 1 441 ? 182.256 156.780 88.017  1.00 123.60 ? 441 PHE A CD1   1 
ATOM   3355  C CD2   . PHE A 1 441 ? 183.800 157.120 89.792  1.00 123.60 ? 441 PHE A CD2   1 
ATOM   3356  C CE1   . PHE A 1 441 ? 182.279 155.418 88.258  1.00 123.60 ? 441 PHE A CE1   1 
ATOM   3357  C CE2   . PHE A 1 441 ? 183.826 155.763 90.036  1.00 123.60 ? 441 PHE A CE2   1 
ATOM   3358  C CZ    . PHE A 1 441 ? 183.065 154.911 89.270  1.00 123.60 ? 441 PHE A CZ    1 
ATOM   3359  N N     . GLY A 1 442 ? 182.985 161.425 86.080  1.00 121.73 ? 442 GLY A N     1 
ATOM   3360  C CA    . GLY A 1 442 ? 182.801 162.823 85.749  1.00 121.73 ? 442 GLY A CA    1 
ATOM   3361  C C     . GLY A 1 442 ? 183.887 163.435 84.895  1.00 121.73 ? 442 GLY A C     1 
ATOM   3362  O O     . GLY A 1 442 ? 184.169 164.629 85.044  1.00 121.73 ? 442 GLY A O     1 
ATOM   3363  N N     . VAL A 1 443 ? 184.504 162.662 84.006  1.00 120.03 ? 443 VAL A N     1 
ATOM   3364  C CA    . VAL A 1 443 ? 185.611 163.148 83.188  1.00 120.03 ? 443 VAL A CA    1 
ATOM   3365  C C     . VAL A 1 443 ? 185.140 164.197 82.187  1.00 120.03 ? 443 VAL A C     1 
ATOM   3366  O O     . VAL A 1 443 ? 183.958 164.529 82.126  1.00 120.03 ? 443 VAL A O     1 
ATOM   3367  C CB    . VAL A 1 443 ? 186.309 161.987 82.456  1.00 120.03 ? 443 VAL A CB    1 
ATOM   3368  C CG1   . VAL A 1 443 ? 186.873 160.990 83.455  1.00 120.03 ? 443 VAL A CG1   1 
ATOM   3369  C CG2   . VAL A 1 443 ? 185.346 161.307 81.499  1.00 120.03 ? 443 VAL A CG2   1 
ATOM   3370  N N     . GLY A 1 446 ? 179.461 166.317 75.984  1.00 126.97 ? 446 GLY A N     1 
ATOM   3371  C CA    . GLY A 1 446 ? 180.479 166.006 76.969  1.00 126.97 ? 446 GLY A CA    1 
ATOM   3372  C C     . GLY A 1 446 ? 180.468 164.554 77.405  1.00 126.97 ? 446 GLY A C     1 
ATOM   3373  O O     . GLY A 1 446 ? 179.566 163.795 77.050  1.00 126.97 ? 446 GLY A O     1 
ATOM   3374  N N     . LEU A 1 447 ? 181.477 164.168 78.181  1.00 126.09 ? 447 LEU A N     1 
ATOM   3375  C CA    . LEU A 1 447 ? 181.614 162.810 78.686  1.00 126.09 ? 447 LEU A CA    1 
ATOM   3376  C C     . LEU A 1 447 ? 181.237 162.796 80.158  1.00 126.09 ? 447 LEU A C     1 
ATOM   3377  O O     . LEU A 1 447 ? 181.585 163.722 80.897  1.00 126.09 ? 447 LEU A O     1 
ATOM   3378  C CB    . LEU A 1 447 ? 183.043 162.290 78.508  1.00 126.09 ? 447 LEU A CB    1 
ATOM   3379  C CG    . LEU A 1 447 ? 183.483 161.836 77.114  1.00 126.09 ? 447 LEU A CG    1 
ATOM   3380  C CD1   . LEU A 1 447 ? 183.721 163.025 76.192  1.00 126.09 ? 447 LEU A CD1   1 
ATOM   3381  C CD2   . LEU A 1 447 ? 184.727 160.970 77.210  1.00 126.09 ? 447 LEU A CD2   1 
ATOM   3382  N N     . TYR A 1 448 ? 180.527 161.754 80.580  1.00 119.14 ? 448 TYR A N     1 
ATOM   3383  C CA    . TYR A 1 448 ? 180.135 161.646 81.977  1.00 119.14 ? 448 TYR A CA    1 
ATOM   3384  C C     . TYR A 1 448 ? 179.759 160.207 82.287  1.00 119.14 ? 448 TYR A C     1 
ATOM   3385  O O     . TYR A 1 448 ? 179.208 159.505 81.437  1.00 119.14 ? 448 TYR A O     1 
ATOM   3386  C CB    . TYR A 1 448 ? 178.967 162.580 82.305  1.00 119.14 ? 448 TYR A CB    1 
ATOM   3387  C CG    . TYR A 1 448 ? 178.562 162.547 83.757  1.00 119.14 ? 448 TYR A CG    1 
ATOM   3388  C CD1   . TYR A 1 448 ? 179.365 163.122 84.732  1.00 119.14 ? 448 TYR A CD1   1 
ATOM   3389  C CD2   . TYR A 1 448 ? 177.375 161.954 84.154  1.00 119.14 ? 448 TYR A CD2   1 
ATOM   3390  C CE1   . TYR A 1 448 ? 179.001 163.097 86.061  1.00 119.14 ? 448 TYR A CE1   1 
ATOM   3391  C CE2   . TYR A 1 448 ? 177.000 161.930 85.480  1.00 119.14 ? 448 TYR A CE2   1 
ATOM   3392  C CZ    . TYR A 1 448 ? 177.817 162.501 86.430  1.00 119.14 ? 448 TYR A CZ    1 
ATOM   3393  O OH    . TYR A 1 448 ? 177.447 162.475 87.753  1.00 119.14 ? 448 TYR A OH    1 
ATOM   3394  N N     . TYR A 1 449 ? 180.059 159.783 83.508  1.00 113.79 ? 449 TYR A N     1 
ATOM   3395  C CA    . TYR A 1 449 ? 179.746 158.447 83.983  1.00 113.79 ? 449 TYR A CA    1 
ATOM   3396  C C     . TYR A 1 449 ? 178.967 158.539 85.287  1.00 113.79 ? 449 TYR A C     1 
ATOM   3397  O O     . TYR A 1 449 ? 178.872 159.599 85.909  1.00 113.79 ? 449 TYR A O     1 
ATOM   3398  C CB    . TYR A 1 449 ? 181.022 157.621 84.165  1.00 113.79 ? 449 TYR A CB    1 
ATOM   3399  C CG    . TYR A 1 449 ? 181.717 157.322 82.859  1.00 113.79 ? 449 TYR A CG    1 
ATOM   3400  C CD1   . TYR A 1 449 ? 181.291 156.280 82.049  1.00 113.79 ? 449 TYR A CD1   1 
ATOM   3401  C CD2   . TYR A 1 449 ? 182.786 158.091 82.426  1.00 113.79 ? 449 TYR A CD2   1 
ATOM   3402  C CE1   . TYR A 1 449 ? 181.916 156.004 80.853  1.00 113.79 ? 449 TYR A CE1   1 
ATOM   3403  C CE2   . TYR A 1 449 ? 183.419 157.822 81.229  1.00 113.79 ? 449 TYR A CE2   1 
ATOM   3404  C CZ    . TYR A 1 449 ? 182.978 156.777 80.448  1.00 113.79 ? 449 TYR A CZ    1 
ATOM   3405  O OH    . TYR A 1 449 ? 183.602 156.503 79.255  1.00 113.79 ? 449 TYR A OH    1 
ATOM   3406  N N     . LEU A 1 450 ? 178.411 157.410 85.703  1.00 112.89 ? 450 LEU A N     1 
ATOM   3407  C CA    . LEU A 1 450 ? 177.500 157.367 86.837  1.00 112.89 ? 450 LEU A CA    1 
ATOM   3408  C C     . LEU A 1 450 ? 178.073 156.500 87.956  1.00 112.89 ? 450 LEU A C     1 
ATOM   3409  O O     . LEU A 1 450 ? 179.205 156.017 87.889  1.00 112.89 ? 450 LEU A O     1 
ATOM   3410  C CB    . LEU A 1 450 ? 176.128 156.856 86.399  1.00 112.89 ? 450 LEU A CB    1 
ATOM   3411  C CG    . LEU A 1 450 ? 175.324 157.752 85.465  1.00 112.89 ? 450 LEU A CG    1 
ATOM   3412  C CD1   . LEU A 1 450 ? 174.060 157.040 85.033  1.00 112.89 ? 450 LEU A CD1   1 
ATOM   3413  C CD2   . LEU A 1 450 ? 174.990 159.057 86.155  1.00 112.89 ? 450 LEU A CD2   1 
ATOM   3414  N N     . THR A 1 451 ? 177.262 156.307 88.992  1.00 117.05 ? 451 THR A N     1 
ATOM   3415  C CA    . THR A 1 451 ? 177.607 155.491 90.142  1.00 117.05 ? 451 THR A CA    1 
ATOM   3416  C C     . THR A 1 451 ? 176.357 154.717 90.535  1.00 117.05 ? 451 THR A C     1 
ATOM   3417  O O     . THR A 1 451 ? 175.254 155.055 90.105  1.00 117.05 ? 451 THR A O     1 
ATOM   3418  C CB    . THR A 1 451 ? 178.110 156.367 91.303  1.00 117.05 ? 451 THR A CB    1 
ATOM   3419  O OG1   . THR A 1 451 ? 179.132 157.245 90.819  1.00 117.05 ? 451 THR A OG1   1 
ATOM   3420  C CG2   . THR A 1 451 ? 178.710 155.519 92.415  1.00 117.05 ? 451 THR A CG2   1 
ATOM   3421  N N     . GLU A 1 452 ? 176.532 153.657 91.325  1.00 127.30 ? 452 GLU A N     1 
ATOM   3422  C CA    . GLU A 1 452 ? 175.377 152.895 91.790  1.00 127.30 ? 452 GLU A CA    1 
ATOM   3423  C C     . GLU A 1 452 ? 174.434 153.768 92.608  1.00 127.30 ? 452 GLU A C     1 
ATOM   3424  O O     . GLU A 1 452 ? 173.207 153.692 92.458  1.00 127.30 ? 452 GLU A O     1 
ATOM   3425  C CB    . GLU A 1 452 ? 175.839 151.696 92.614  1.00 127.30 ? 452 GLU A CB    1 
ATOM   3426  C CG    . GLU A 1 452 ? 176.606 150.660 91.821  1.00 127.30 ? 452 GLU A CG    1 
ATOM   3427  C CD    . GLU A 1 452 ? 177.035 149.487 92.675  1.00 127.30 ? 452 GLU A CD    1 
ATOM   3428  O OE1   . GLU A 1 452 ? 176.833 149.543 93.907  1.00 127.30 ? 452 GLU A OE1   1 
ATOM   3429  O OE2   . GLU A 1 452 ? 177.572 148.509 92.117  1.00 127.30 ? 452 GLU A OE2   1 
ATOM   3430  N N     . GLN A 1 453 ? 174.994 154.599 93.487  1.00 126.15 ? 453 GLN A N     1 
ATOM   3431  C CA    . GLN A 1 453 ? 174.178 155.507 94.284  1.00 126.15 ? 453 GLN A CA    1 
ATOM   3432  C C     . GLN A 1 453 ? 173.414 156.475 93.391  1.00 126.15 ? 453 GLN A C     1 
ATOM   3433  O O     . GLN A 1 453 ? 172.214 156.711 93.586  1.00 126.15 ? 453 GLN A O     1 
ATOM   3434  C CB    . GLN A 1 453 ? 175.071 156.259 95.269  1.00 126.15 ? 453 GLN A CB    1 
ATOM   3435  C CG    . GLN A 1 453 ? 174.343 157.176 96.228  1.00 126.15 ? 453 GLN A CG    1 
ATOM   3436  C CD    . GLN A 1 453 ? 175.291 157.843 97.207  1.00 126.15 ? 453 GLN A CD    1 
ATOM   3437  O OE1   . GLN A 1 453 ? 176.505 157.646 97.142  1.00 126.15 ? 453 GLN A OE1   1 
ATOM   3438  N NE2   . GLN A 1 453 ? 174.742 158.635 98.119  1.00 126.15 ? 453 GLN A NE2   1 
ATOM   3439  N N     . GLN A 1 454 ? 174.098 157.041 92.395  1.00 120.60 ? 454 GLN A N     1 
ATOM   3440  C CA    . GLN A 1 454 ? 173.439 157.951 91.465  1.00 120.60 ? 454 GLN A CA    1 
ATOM   3441  C C     . GLN A 1 454 ? 172.329 157.246 90.699  1.00 120.60 ? 454 GLN A C     1 
ATOM   3442  O O     . GLN A 1 454 ? 171.259 157.819 90.472  1.00 120.60 ? 454 GLN A O     1 
ATOM   3443  C CB    . GLN A 1 454 ? 174.464 158.532 90.495  1.00 120.60 ? 454 GLN A CB    1 
ATOM   3444  C CG    . GLN A 1 454 ? 175.511 159.412 91.141  1.00 120.60 ? 454 GLN A CG    1 
ATOM   3445  C CD    . GLN A 1 454 ? 176.509 159.935 90.133  1.00 120.60 ? 454 GLN A CD    1 
ATOM   3446  O OE1   . GLN A 1 454 ? 176.475 159.562 88.962  1.00 120.60 ? 454 GLN A OE1   1 
ATOM   3447  N NE2   . GLN A 1 454 ? 177.396 160.814 90.577  1.00 120.60 ? 454 GLN A NE2   1 
ATOM   3448  N N     . ALA A 1 455 ? 172.565 156.000 90.294  1.00 121.66 ? 455 ALA A N     1 
ATOM   3449  C CA    . ALA A 1 455 ? 171.565 155.270 89.525  1.00 121.66 ? 455 ALA A CA    1 
ATOM   3450  C C     . ALA A 1 455 ? 170.341 154.968 90.375  1.00 121.66 ? 455 ALA A C     1 
ATOM   3451  O O     . ALA A 1 455 ? 169.204 155.044 89.896  1.00 121.66 ? 455 ALA A O     1 
ATOM   3452  C CB    . ALA A 1 455 ? 172.170 153.982 88.970  1.00 121.66 ? 455 ALA A CB    1 
ATOM   3453  N N     . GLN A 1 456 ? 170.553 154.620 91.645  1.00 124.10 ? 456 GLN A N     1 
ATOM   3454  C CA    . GLN A 1 456 ? 169.415 154.398 92.528  1.00 124.10 ? 456 GLN A CA    1 
ATOM   3455  C C     . GLN A 1 456 ? 168.641 155.689 92.747  1.00 124.10 ? 456 GLN A C     1 
ATOM   3456  O O     . GLN A 1 456 ? 167.404 155.688 92.763  1.00 124.10 ? 456 GLN A O     1 
ATOM   3457  C CB    . GLN A 1 456 ? 169.882 153.814 93.859  1.00 124.10 ? 456 GLN A CB    1 
ATOM   3458  C CG    . GLN A 1 456 ? 168.742 153.409 94.772  1.00 124.10 ? 456 GLN A CG    1 
ATOM   3459  C CD    . GLN A 1 456 ? 169.224 152.749 96.044  1.00 124.10 ? 456 GLN A CD    1 
ATOM   3460  O OE1   . GLN A 1 456 ? 170.426 152.634 96.280  1.00 124.10 ? 456 GLN A OE1   1 
ATOM   3461  N NE2   . GLN A 1 456 ? 168.287 152.303 96.870  1.00 124.10 ? 456 GLN A NE2   1 
ATOM   3462  N N     . ALA A 1 457 ? 169.353 156.808 92.896  1.00 121.59 ? 457 ALA A N     1 
ATOM   3463  C CA    . ALA A 1 457 ? 168.675 158.094 93.006  1.00 121.59 ? 457 ALA A CA    1 
ATOM   3464  C C     . ALA A 1 457 ? 167.841 158.383 91.765  1.00 121.59 ? 457 ALA A C     1 
ATOM   3465  O O     . ALA A 1 457 ? 166.706 158.862 91.866  1.00 121.59 ? 457 ALA A O     1 
ATOM   3466  C CB    . ALA A 1 457 ? 169.697 159.206 93.239  1.00 121.59 ? 457 ALA A CB    1 
ATOM   3467  N N     . ILE A 1 458 ? 168.390 158.094 90.585  1.00 114.98 ? 458 ILE A N     1 
ATOM   3468  C CA    . ILE A 1 458 ? 167.660 158.320 89.340  1.00 114.98 ? 458 ILE A CA    1 
ATOM   3469  C C     . ILE A 1 458 ? 166.413 157.450 89.288  1.00 114.98 ? 458 ILE A C     1 
ATOM   3470  O O     . ILE A 1 458 ? 165.324 157.918 88.934  1.00 114.98 ? 458 ILE A O     1 
ATOM   3471  C CB    . ILE A 1 458 ? 168.574 158.063 88.129  1.00 114.98 ? 458 ILE A CB    1 
ATOM   3472  C CG1   . ILE A 1 458 ? 169.703 159.089 88.085  1.00 114.98 ? 458 ILE A CG1   1 
ATOM   3473  C CG2   . ILE A 1 458 ? 167.776 158.101 86.843  1.00 114.98 ? 458 ILE A CG2   1 
ATOM   3474  C CD1   . ILE A 1 458 ? 170.793 158.738 87.104  1.00 114.98 ? 458 ILE A CD1   1 
ATOM   3475  N N     . LEU A 1 459 ? 166.549 156.172 89.635  1.00 116.81 ? 459 LEU A N     1 
ATOM   3476  C CA    . LEU A 1 459 ? 165.397 155.283 89.674  1.00 116.81 ? 459 LEU A CA    1 
ATOM   3477  C C     . LEU A 1 459 ? 164.377 155.692 90.726  1.00 116.81 ? 459 LEU A C     1 
ATOM   3478  O O     . LEU A 1 459 ? 163.211 155.300 90.619  1.00 116.81 ? 459 LEU A O     1 
ATOM   3479  C CB    . LEU A 1 459 ? 165.848 153.846 89.925  1.00 116.81 ? 459 LEU A CB    1 
ATOM   3480  C CG    . LEU A 1 459 ? 166.632 153.202 88.785  1.00 116.81 ? 459 LEU A CG    1 
ATOM   3481  C CD1   . LEU A 1 459 ? 167.147 151.838 89.199  1.00 116.81 ? 459 LEU A CD1   1 
ATOM   3482  C CD2   . LEU A 1 459 ? 165.759 153.094 87.549  1.00 116.81 ? 459 LEU A CD2   1 
ATOM   3483  N N     . ASP A 1 460 ? 164.784 156.463 91.733  1.00 129.07 ? 460 ASP A N     1 
ATOM   3484  C CA    . ASP A 1 460 ? 163.878 156.924 92.777  1.00 129.07 ? 460 ASP A CA    1 
ATOM   3485  C C     . ASP A 1 460 ? 163.246 158.276 92.456  1.00 129.07 ? 460 ASP A C     1 
ATOM   3486  O O     . ASP A 1 460 ? 162.917 159.037 93.371  1.00 129.07 ? 460 ASP A O     1 
ATOM   3487  C CB    . ASP A 1 460 ? 164.607 156.988 94.117  1.00 129.07 ? 460 ASP A CB    1 
ATOM   3488  C CG    . ASP A 1 460 ? 164.940 155.616 94.661  1.00 129.07 ? 460 ASP A CG    1 
ATOM   3489  O OD1   . ASP A 1 460 ? 164.189 154.663 94.367  1.00 129.07 ? 460 ASP A OD1   1 
ATOM   3490  O OD2   . ASP A 1 460 ? 165.953 155.488 95.381  1.00 129.07 ? 460 ASP A OD2   1 
ATOM   3491  N N     . LEU A 1 461 ? 163.071 158.592 91.178  1.00 115.91 ? 461 LEU A N     1 
ATOM   3492  C CA    . LEU A 1 461 ? 162.395 159.820 90.791  1.00 115.91 ? 461 LEU A CA    1 
ATOM   3493  C C     . LEU A 1 461 ? 160.887 159.617 90.734  1.00 115.91 ? 461 LEU A C     1 
ATOM   3494  O O     . LEU A 1 461 ? 160.378 158.495 90.777  1.00 115.91 ? 461 LEU A O     1 
ATOM   3495  C CB    . LEU A 1 461 ? 162.890 160.317 89.435  1.00 115.91 ? 461 LEU A CB    1 
ATOM   3496  C CG    . LEU A 1 461 ? 164.300 160.895 89.394  1.00 115.91 ? 461 LEU A CG    1 
ATOM   3497  C CD1   . LEU A 1 461 ? 164.689 161.218 87.965  1.00 115.91 ? 461 LEU A CD1   1 
ATOM   3498  C CD2   . LEU A 1 461 ? 164.379 162.133 90.267  1.00 115.91 ? 461 LEU A CD2   1 
ATOM   3499  N N     . ARG A 1 462 ? 160.174 160.730 90.638  1.00 112.19 ? 462 ARG A N     1 
ATOM   3500  C CA    . ARG A 1 462 ? 158.730 160.745 90.479  1.00 112.19 ? 462 ARG A CA    1 
ATOM   3501  C C     . ARG A 1 462 ? 158.373 161.420 89.160  1.00 112.19 ? 462 ARG A C     1 
ATOM   3502  O O     . ARG A 1 462 ? 159.239 161.882 88.414  1.00 112.19 ? 462 ARG A O     1 
ATOM   3503  C CB    . ARG A 1 462 ? 158.067 161.454 91.659  1.00 112.19 ? 462 ARG A CB    1 
ATOM   3504  C CG    . ARG A 1 462 ? 158.196 160.710 92.969  1.00 112.19 ? 462 ARG A CG    1 
ATOM   3505  C CD    . ARG A 1 462 ? 157.510 161.461 94.087  1.00 112.19 ? 462 ARG A CD    1 
ATOM   3506  N NE    . ARG A 1 462 ? 157.614 160.751 95.356  1.00 112.19 ? 462 ARG A NE    1 
ATOM   3507  C CZ    . ARG A 1 462 ? 157.137 161.212 96.506  1.00 112.19 ? 462 ARG A CZ    1 
ATOM   3508  N NH1   . ARG A 1 462 ? 156.522 162.385 96.547  1.00 112.19 ? 462 ARG A NH1   1 
ATOM   3509  N NH2   . ARG A 1 462 ? 157.274 160.500 97.615  1.00 112.19 ? 462 ARG A NH2   1 
ATOM   3510  N N     . LEU A 1 463 ? 157.075 161.476 88.875  1.00 112.66 ? 463 LEU A N     1 
ATOM   3511  C CA    . LEU A 1 463 ? 156.607 162.121 87.658  1.00 112.66 ? 463 LEU A CA    1 
ATOM   3512  C C     . LEU A 1 463 ? 156.398 163.617 87.822  1.00 112.66 ? 463 LEU A C     1 
ATOM   3513  O O     . LEU A 1 463 ? 156.376 164.338 86.818  1.00 112.66 ? 463 LEU A O     1 
ATOM   3514  C CB    . LEU A 1 463 ? 155.303 161.474 87.185  1.00 112.66 ? 463 LEU A CB    1 
ATOM   3515  C CG    . LEU A 1 463 ? 155.433 160.025 86.720  1.00 112.66 ? 463 LEU A CG    1 
ATOM   3516  C CD1   . LEU A 1 463 ? 154.072 159.445 86.381  1.00 112.66 ? 463 LEU A CD1   1 
ATOM   3517  C CD2   . LEU A 1 463 ? 156.370 159.930 85.530  1.00 112.66 ? 463 LEU A CD2   1 
ATOM   3518  N N     . GLN A 1 464 ? 156.255 164.104 89.056  1.00 123.26 ? 464 GLN A N     1 
ATOM   3519  C CA    . GLN A 1 464 ? 156.080 165.534 89.273  1.00 123.26 ? 464 GLN A CA    1 
ATOM   3520  C C     . GLN A 1 464 ? 157.320 166.331 88.901  1.00 123.26 ? 464 GLN A C     1 
ATOM   3521  O O     . GLN A 1 464 ? 157.235 167.556 88.767  1.00 123.26 ? 464 GLN A O     1 
ATOM   3522  C CB    . GLN A 1 464 ? 155.710 165.807 90.728  1.00 123.26 ? 464 GLN A CB    1 
ATOM   3523  C CG    . GLN A 1 464 ? 154.347 165.283 91.125  1.00 123.26 ? 464 GLN A CG    1 
ATOM   3524  C CD    . GLN A 1 464 ? 154.019 165.575 92.571  1.00 123.26 ? 464 GLN A CD    1 
ATOM   3525  O OE1   . GLN A 1 464 ? 154.842 166.120 93.307  1.00 123.26 ? 464 GLN A OE1   1 
ATOM   3526  N NE2   . GLN A 1 464 ? 152.812 165.216 92.988  1.00 123.26 ? 464 GLN A NE2   1 
ATOM   3527  N N     . LYS A 1 465 ? 158.462 165.672 88.729  1.00 119.13 ? 465 LYS A N     1 
ATOM   3528  C CA    . LYS A 1 465 ? 159.694 166.337 88.335  1.00 119.13 ? 465 LYS A CA    1 
ATOM   3529  C C     . LYS A 1 465 ? 159.753 166.637 86.845  1.00 119.13 ? 465 LYS A C     1 
ATOM   3530  O O     . LYS A 1 465 ? 160.838 166.928 86.331  1.00 119.13 ? 465 LYS A O     1 
ATOM   3531  C CB    . LYS A 1 465 ? 160.902 165.487 88.735  1.00 119.13 ? 465 LYS A CB    1 
ATOM   3532  C CG    . LYS A 1 465 ? 161.008 165.213 90.221  1.00 119.13 ? 465 LYS A CG    1 
ATOM   3533  C CD    . LYS A 1 465 ? 161.267 166.487 91.000  1.00 119.13 ? 465 LYS A CD    1 
ATOM   3534  C CE    . LYS A 1 465 ? 161.559 166.184 92.457  1.00 119.13 ? 465 LYS A CE    1 
ATOM   3535  N NZ    . LYS A 1 465 ? 160.357 165.669 93.165  1.00 119.13 ? 465 LYS A NZ    1 
ATOM   3536  N N     . LEU A 1 466 ? 158.627 166.572 86.141  1.00 119.51 ? 466 LEU A N     1 
ATOM   3537  C CA    . LEU A 1 466 ? 158.588 166.746 84.695  1.00 119.51 ? 466 LEU A CA    1 
ATOM   3538  C C     . LEU A 1 466 ? 157.687 167.909 84.290  1.00 119.51 ? 466 LEU A C     1 
ATOM   3539  O O     . LEU A 1 466 ? 156.849 167.787 83.395  1.00 119.51 ? 466 LEU A O     1 
ATOM   3540  C CB    . LEU A 1 466 ? 158.145 165.456 84.014  1.00 119.51 ? 466 LEU A CB    1 
ATOM   3541  C CG    . LEU A 1 466 ? 159.110 164.288 84.220  1.00 119.51 ? 466 LEU A CG    1 
ATOM   3542  C CD1   . LEU A 1 466 ? 158.564 163.014 83.608  1.00 119.51 ? 466 LEU A CD1   1 
ATOM   3543  C CD2   . LEU A 1 466 ? 160.469 164.622 83.645  1.00 119.51 ? 466 LEU A CD2   1 
ATOM   3544  N N     . THR A 1 467 ? 157.843 169.048 84.958  1.00 134.67 ? 467 THR A N     1 
ATOM   3545  C CA    . THR A 1 467 ? 157.152 170.273 84.591  1.00 134.67 ? 467 THR A CA    1 
ATOM   3546  C C     . THR A 1 467 ? 158.174 171.387 84.420  1.00 134.67 ? 467 THR A C     1 
ATOM   3547  O O     . THR A 1 467 ? 159.366 171.211 84.685  1.00 134.67 ? 467 THR A O     1 
ATOM   3548  C CB    . THR A 1 467 ? 156.107 170.678 85.639  1.00 134.67 ? 467 THR A CB    1 
ATOM   3549  O OG1   . THR A 1 467 ? 156.755 170.921 86.894  1.00 134.67 ? 467 THR A OG1   1 
ATOM   3550  C CG2   . THR A 1 467 ? 155.071 169.581 85.812  1.00 134.67 ? 467 THR A CG2   1 
ATOM   3551  N N     . GLY A 1 468 ? 157.693 172.544 83.975  1.00 139.33 ? 468 GLY A N     1 
ATOM   3552  C CA    . GLY A 1 468 ? 158.568 173.675 83.736  1.00 139.33 ? 468 GLY A CA    1 
ATOM   3553  C C     . GLY A 1 468 ? 158.881 174.483 84.978  1.00 139.33 ? 468 GLY A C     1 
ATOM   3554  O O     . GLY A 1 468 ? 159.078 175.699 84.901  1.00 139.33 ? 468 GLY A O     1 
ATOM   3555  N N     . LEU A 1 469 ? 158.928 173.820 86.131  1.00 142.84 ? 469 LEU A N     1 
ATOM   3556  C CA    . LEU A 1 469 ? 159.243 174.489 87.387  1.00 142.84 ? 469 LEU A CA    1 
ATOM   3557  C C     . LEU A 1 469 ? 160.442 173.828 88.051  1.00 142.84 ? 469 LEU A C     1 
ATOM   3558  O O     . LEU A 1 469 ? 161.319 174.506 88.604  1.00 142.84 ? 469 LEU A O     1 
ATOM   3559  C CB    . LEU A 1 469 ? 158.040 174.456 88.335  1.00 142.84 ? 469 LEU A CB    1 
ATOM   3560  C CG    . LEU A 1 469 ? 156.940 175.513 88.206  1.00 142.84 ? 469 LEU A CG    1 
ATOM   3561  C CD1   . LEU A 1 469 ? 157.500 176.907 88.450  1.00 142.84 ? 469 LEU A CD1   1 
ATOM   3562  C CD2   . LEU A 1 469 ? 156.220 175.436 86.866  1.00 142.84 ? 469 LEU A CD2   1 
ATOM   3563  N N     . GLU A 1 470 ? 160.483 172.496 87.984  1.00 146.40 ? 470 GLU A N     1 
ATOM   3564  C CA    . GLU A 1 470 ? 161.501 171.746 88.707  1.00 146.40 ? 470 GLU A CA    1 
ATOM   3565  C C     . GLU A 1 470 ? 162.882 171.978 88.116  1.00 146.40 ? 470 GLU A C     1 
ATOM   3566  O O     . GLU A 1 470 ? 163.880 171.973 88.841  1.00 146.40 ? 470 GLU A O     1 
ATOM   3567  C CB    . GLU A 1 470 ? 161.150 170.261 88.703  1.00 146.40 ? 470 GLU A CB    1 
ATOM   3568  C CG    . GLU A 1 470 ? 159.848 169.947 89.420  1.00 146.40 ? 470 GLU A CG    1 
ATOM   3569  C CD    . GLU A 1 470 ? 159.907 170.262 90.901  1.00 146.40 ? 470 GLU A CD    1 
ATOM   3570  O OE1   . GLU A 1 470 ? 160.999 170.136 91.495  1.00 146.40 ? 470 GLU A OE1   1 
ATOM   3571  O OE2   . GLU A 1 470 ? 158.862 170.639 91.471  1.00 146.40 ? 470 GLU A OE2   1 
ATOM   3572  N N     . HIS A 1 471 ? 162.960 172.189 86.802  1.00 141.50 ? 471 HIS A N     1 
ATOM   3573  C CA    . HIS A 1 471 ? 164.242 172.483 86.172  1.00 141.50 ? 471 HIS A CA    1 
ATOM   3574  C C     . HIS A 1 471 ? 164.868 173.740 86.767  1.00 141.50 ? 471 HIS A C     1 
ATOM   3575  O O     . HIS A 1 471 ? 166.035 173.731 87.190  1.00 141.50 ? 471 HIS A O     1 
ATOM   3576  C CB    . HIS A 1 471 ? 164.042 172.632 84.664  1.00 141.50 ? 471 HIS A CB    1 
ATOM   3577  C CG    . HIS A 1 471 ? 165.312 172.809 83.895  1.00 141.50 ? 471 HIS A CG    1 
ATOM   3578  N ND1   . HIS A 1 471 ? 166.185 171.771 83.653  1.00 141.50 ? 471 HIS A ND1   1 
ATOM   3579  C CD2   . HIS A 1 471 ? 165.851 173.900 83.301  1.00 141.50 ? 471 HIS A CD2   1 
ATOM   3580  C CE1   . HIS A 1 471 ? 167.210 172.215 82.948  1.00 141.50 ? 471 HIS A CE1   1 
ATOM   3581  N NE2   . HIS A 1 471 ? 167.032 173.504 82.721  1.00 141.50 ? 471 HIS A NE2   1 
ATOM   3582  N N     . GLU A 1 472 ? 164.097 174.828 86.826  1.00 146.06 ? 472 GLU A N     1 
ATOM   3583  C CA    . GLU A 1 472 ? 164.609 176.067 87.398  1.00 146.06 ? 472 GLU A CA    1 
ATOM   3584  C C     . GLU A 1 472 ? 164.877 175.918 88.888  1.00 146.06 ? 472 GLU A C     1 
ATOM   3585  O O     . GLU A 1 472 ? 165.852 176.475 89.404  1.00 146.06 ? 472 GLU A O     1 
ATOM   3586  C CB    . GLU A 1 472 ? 163.627 177.208 87.141  1.00 146.06 ? 472 GLU A CB    1 
ATOM   3587  C CG    . GLU A 1 472 ? 163.480 177.575 85.678  1.00 146.06 ? 472 GLU A CG    1 
ATOM   3588  C CD    . GLU A 1 472 ? 162.509 178.716 85.462  1.00 146.06 ? 472 GLU A CD    1 
ATOM   3589  O OE1   . GLU A 1 472 ? 161.871 179.147 86.445  1.00 146.06 ? 472 GLU A OE1   1 
ATOM   3590  O OE2   . GLU A 1 472 ? 162.383 179.181 84.310  1.00 146.06 ? 472 GLU A OE2   1 
ATOM   3591  N N     . LYS A 1 473 ? 164.026 175.171 89.598  1.00 146.43 ? 473 LYS A N     1 
ATOM   3592  C CA    . LYS A 1 473 ? 164.263 174.965 91.023  1.00 146.43 ? 473 LYS A CA    1 
ATOM   3593  C C     . LYS A 1 473 ? 165.584 174.246 91.263  1.00 146.43 ? 473 LYS A C     1 
ATOM   3594  O O     . LYS A 1 473 ? 166.351 174.620 92.159  1.00 146.43 ? 473 LYS A O     1 
ATOM   3595  C CB    . LYS A 1 473 ? 163.104 174.190 91.644  1.00 146.43 ? 473 LYS A CB    1 
ATOM   3596  C CG    . LYS A 1 473 ? 161.817 174.987 91.737  1.00 146.43 ? 473 LYS A CG    1 
ATOM   3597  C CD    . LYS A 1 473 ? 160.724 174.189 92.421  1.00 146.43 ? 473 LYS A CD    1 
ATOM   3598  C CE    . LYS A 1 473 ? 159.436 174.988 92.512  1.00 146.43 ? 473 LYS A CE    1 
ATOM   3599  N NZ    . LYS A 1 473 ? 158.357 174.218 93.185  1.00 146.43 ? 473 LYS A NZ    1 
ATOM   3600  N N     . LEU A 1 474 ? 165.873 173.219 90.464  1.00 139.21 ? 474 LEU A N     1 
ATOM   3601  C CA    . LEU A 1 474 ? 167.125 172.490 90.614  1.00 139.21 ? 474 LEU A CA    1 
ATOM   3602  C C     . LEU A 1 474 ? 168.318 173.363 90.260  1.00 139.21 ? 474 LEU A C     1 
ATOM   3603  O O     . LEU A 1 474 ? 169.346 173.324 90.945  1.00 139.21 ? 474 LEU A O     1 
ATOM   3604  C CB    . LEU A 1 474 ? 167.108 171.231 89.751  1.00 139.21 ? 474 LEU A CB    1 
ATOM   3605  C CG    . LEU A 1 474 ? 166.119 170.157 90.197  1.00 139.21 ? 474 LEU A CG    1 
ATOM   3606  C CD1   . LEU A 1 474 ? 166.071 169.031 89.186  1.00 139.21 ? 474 LEU A CD1   1 
ATOM   3607  C CD2   . LEU A 1 474 ? 166.496 169.633 91.568  1.00 139.21 ? 474 LEU A CD2   1 
ATOM   3608  N N     . LEU A 1 475 ? 168.202 174.157 89.193  1.00 143.12 ? 475 LEU A N     1 
ATOM   3609  C CA    . LEU A 1 475 ? 169.297 175.056 88.839  1.00 143.12 ? 475 LEU A CA    1 
ATOM   3610  C C     . LEU A 1 475 ? 169.570 176.054 89.961  1.00 143.12 ? 475 LEU A C     1 
ATOM   3611  O O     . LEU A 1 475 ? 170.732 176.329 90.299  1.00 143.12 ? 475 LEU A O     1 
ATOM   3612  C CB    . LEU A 1 475 ? 168.973 175.773 87.528  1.00 143.12 ? 475 LEU A CB    1 
ATOM   3613  C CG    . LEU A 1 475 ? 170.076 176.578 86.839  1.00 143.12 ? 475 LEU A CG    1 
ATOM   3614  C CD1   . LEU A 1 475 ? 169.866 176.547 85.337  1.00 143.12 ? 475 LEU A CD1   1 
ATOM   3615  C CD2   . LEU A 1 475 ? 170.111 178.018 87.333  1.00 143.12 ? 475 LEU A CD2   1 
ATOM   3616  N N     . ASP A 1 476 ? 168.508 176.592 90.564  1.00 146.73 ? 476 ASP A N     1 
ATOM   3617  C CA    . ASP A 1 476 ? 168.671 177.539 91.660  1.00 146.73 ? 476 ASP A CA    1 
ATOM   3618  C C     . ASP A 1 476 ? 169.315 176.877 92.869  1.00 146.73 ? 476 ASP A C     1 
ATOM   3619  O O     . ASP A 1 476 ? 170.215 177.452 93.496  1.00 146.73 ? 476 ASP A O     1 
ATOM   3620  C CB    . ASP A 1 476 ? 167.315 178.132 92.036  1.00 146.73 ? 476 ASP A CB    1 
ATOM   3621  C CG    . ASP A 1 476 ? 166.723 178.970 90.927  1.00 146.73 ? 476 ASP A CG    1 
ATOM   3622  O OD1   . ASP A 1 476 ? 167.500 179.541 90.135  1.00 146.73 ? 476 ASP A OD1   1 
ATOM   3623  O OD2   . ASP A 1 476 ? 165.480 179.053 90.842  1.00 146.73 ? 476 ASP A OD2   1 
ATOM   3624  N N     . GLU A 1 477 ? 168.851 175.677 93.224  1.00 134.88 ? 477 GLU A N     1 
ATOM   3625  C CA    . GLU A 1 477 ? 169.444 174.958 94.343  1.00 134.88 ? 477 GLU A CA    1 
ATOM   3626  C C     . GLU A 1 477 ? 170.920 174.688 94.095  1.00 134.88 ? 477 GLU A C     1 
ATOM   3627  O O     . GLU A 1 477 ? 171.746 174.820 95.006  1.00 134.88 ? 477 GLU A O     1 
ATOM   3628  C CB    . GLU A 1 477 ? 168.690 173.652 94.586  1.00 134.88 ? 477 GLU A CB    1 
ATOM   3629  C CG    . GLU A 1 477 ? 169.203 172.852 95.772  1.00 134.88 ? 477 GLU A CG    1 
ATOM   3630  C CD    . GLU A 1 477 ? 168.387 171.600 96.031  1.00 134.88 ? 477 GLU A CD    1 
ATOM   3631  O OE1   . GLU A 1 477 ? 167.419 171.354 95.282  1.00 134.88 ? 477 GLU A OE1   1 
ATOM   3632  O OE2   . GLU A 1 477 ? 168.719 170.855 96.978  1.00 134.88 ? 477 GLU A OE2   1 
ATOM   3633  N N     . TYR A 1 478 ? 171.272 174.327 92.861  1.00 122.44 ? 478 TYR A N     1 
ATOM   3634  C CA    . TYR A 1 478 ? 172.664 174.038 92.543  1.00 122.44 ? 478 TYR A CA    1 
ATOM   3635  C C     . TYR A 1 478 ? 173.530 175.284 92.680  1.00 122.44 ? 478 TYR A C     1 
ATOM   3636  O O     . TYR A 1 478 ? 174.626 175.231 93.257  1.00 122.44 ? 478 TYR A O     1 
ATOM   3637  C CB    . TYR A 1 478 ? 172.753 173.459 91.132  1.00 122.44 ? 478 TYR A CB    1 
ATOM   3638  C CG    . TYR A 1 478 ? 174.136 173.026 90.727  1.00 122.44 ? 478 TYR A CG    1 
ATOM   3639  C CD1   . TYR A 1 478 ? 174.707 171.883 91.264  1.00 122.44 ? 478 TYR A CD1   1 
ATOM   3640  C CD2   . TYR A 1 478 ? 174.864 173.745 89.795  1.00 122.44 ? 478 TYR A CD2   1 
ATOM   3641  C CE1   . TYR A 1 478 ? 175.969 171.479 90.896  1.00 122.44 ? 478 TYR A CE1   1 
ATOM   3642  C CE2   . TYR A 1 478 ? 176.127 173.346 89.417  1.00 122.44 ? 478 TYR A CE2   1 
ATOM   3643  C CZ    . TYR A 1 478 ? 176.675 172.212 89.971  1.00 122.44 ? 478 TYR A CZ    1 
ATOM   3644  O OH    . TYR A 1 478 ? 177.936 171.811 89.598  1.00 122.44 ? 478 TYR A OH    1 
ATOM   3645  N N     . LYS A 1 479 ? 173.052 176.419 92.164  1.00 125.25 ? 479 LYS A N     1 
ATOM   3646  C CA    . LYS A 1 479 ? 173.809 177.661 92.304  1.00 125.25 ? 479 LYS A CA    1 
ATOM   3647  C C     . LYS A 1 479 ? 173.976 178.045 93.770  1.00 125.25 ? 479 LYS A C     1 
ATOM   3648  O O     . LYS A 1 479 ? 175.061 178.475 94.195  1.00 125.25 ? 479 LYS A O     1 
ATOM   3649  C CB    . LYS A 1 479 ? 173.122 178.786 91.535  1.00 125.25 ? 479 LYS A CB    1 
ATOM   3650  C CG    . LYS A 1 479 ? 173.889 180.094 91.561  1.00 125.25 ? 479 LYS A CG    1 
ATOM   3651  C CD    . LYS A 1 479 ? 173.210 181.155 90.718  1.00 125.25 ? 479 LYS A CD    1 
ATOM   3652  C CE    . LYS A 1 479 ? 173.993 182.454 90.749  1.00 125.25 ? 479 LYS A CE    1 
ATOM   3653  N NZ    . LYS A 1 479 ? 173.351 183.513 89.928  1.00 125.25 ? 479 LYS A NZ    1 
ATOM   3654  N N     . GLU A 1 480 ? 172.910 177.900 94.559  1.00 131.56 ? 480 GLU A N     1 
ATOM   3655  C CA    . GLU A 1 480 ? 172.987 178.251 95.971  1.00 131.56 ? 480 GLU A CA    1 
ATOM   3656  C C     . GLU A 1 480 ? 173.978 177.358 96.705  1.00 131.56 ? 480 GLU A C     1 
ATOM   3657  O O     . GLU A 1 480 ? 174.746 177.833 97.550  1.00 131.56 ? 480 GLU A O     1 
ATOM   3658  C CB    . GLU A 1 480 ? 171.601 178.159 96.605  1.00 131.56 ? 480 GLU A CB    1 
ATOM   3659  C CG    . GLU A 1 480 ? 171.550 178.601 98.054  1.00 131.56 ? 480 GLU A CG    1 
ATOM   3660  C CD    . GLU A 1 480 ? 170.142 178.589 98.612  1.00 131.56 ? 480 GLU A CD    1 
ATOM   3661  O OE1   . GLU A 1 480 ? 169.210 178.223 97.864  1.00 131.56 ? 480 GLU A OE1   1 
ATOM   3662  O OE2   . GLU A 1 480 ? 169.966 178.945 99.796  1.00 131.56 ? 480 GLU A OE2   1 
ATOM   3663  N N     . LEU A 1 481 ? 173.981 176.061 96.391  1.00 125.56 ? 481 LEU A N     1 
ATOM   3664  C CA    . LEU A 1 481 ? 174.922 175.155 97.040  1.00 125.56 ? 481 LEU A CA    1 
ATOM   3665  C C     . LEU A 1 481 ? 176.357 175.482 96.653  1.00 125.56 ? 481 LEU A C     1 
ATOM   3666  O O     . LEU A 1 481 ? 177.265 175.398 97.488  1.00 125.56 ? 481 LEU A O     1 
ATOM   3667  C CB    . LEU A 1 481 ? 174.586 173.707 96.694  1.00 125.56 ? 481 LEU A CB    1 
ATOM   3668  C CG    . LEU A 1 481 ? 173.262 173.192 97.258  1.00 125.56 ? 481 LEU A CG    1 
ATOM   3669  C CD1   . LEU A 1 481 ? 172.986 171.777 96.777  1.00 125.56 ? 481 LEU A CD1   1 
ATOM   3670  C CD2   . LEU A 1 481 ? 173.262 173.260 98.774  1.00 125.56 ? 481 LEU A CD2   1 
ATOM   3671  N N     . LEU A 1 482 ? 176.584 175.847 95.389  1.00 126.03 ? 482 LEU A N     1 
ATOM   3672  C CA    . LEU A 1 482 ? 177.920 176.278 94.987  1.00 126.03 ? 482 LEU A CA    1 
ATOM   3673  C C     . LEU A 1 482 ? 178.375 177.480 95.803  1.00 126.03 ? 482 LEU A C     1 
ATOM   3674  O O     . LEU A 1 482 ? 179.499 177.503 96.329  1.00 126.03 ? 482 LEU A O     1 
ATOM   3675  C CB    . LEU A 1 482 ? 177.945 176.615 93.499  1.00 126.03 ? 482 LEU A CB    1 
ATOM   3676  C CG    . LEU A 1 482 ? 177.762 175.461 92.519  1.00 126.03 ? 482 LEU A CG    1 
ATOM   3677  C CD1   . LEU A 1 482 ? 177.693 175.994 91.101  1.00 126.03 ? 482 LEU A CD1   1 
ATOM   3678  C CD2   . LEU A 1 482 ? 178.893 174.462 92.665  1.00 126.03 ? 482 LEU A CD2   1 
ATOM   3679  N N     . ASP A 1 483 ? 177.516 178.494 95.908  1.00 129.16 ? 483 ASP A N     1 
ATOM   3680  C CA    . ASP A 1 483 ? 177.872 179.678 96.685  1.00 129.16 ? 483 ASP A CA    1 
ATOM   3681  C C     . ASP A 1 483 ? 178.172 179.311 98.134  1.00 129.16 ? 483 ASP A C     1 
ATOM   3682  O O     . ASP A 1 483 ? 179.147 179.799 98.725  1.00 129.16 ? 483 ASP A O     1 
ATOM   3683  C CB    . ASP A 1 483 ? 176.746 180.707 96.612  1.00 129.16 ? 483 ASP A CB    1 
ATOM   3684  C CG    . ASP A 1 483 ? 177.161 182.066 97.140  1.00 129.16 ? 483 ASP A CG    1 
ATOM   3685  O OD1   . ASP A 1 483 ? 178.329 182.218 97.554  1.00 129.16 ? 483 ASP A OD1   1 
ATOM   3686  O OD2   . ASP A 1 483 ? 176.317 182.985 97.144  1.00 129.16 ? 483 ASP A OD2   1 
ATOM   3687  N N     . GLN A 1 484 ? 177.349 178.437 98.717  1.00 121.08 ? 484 GLN A N     1 
ATOM   3688  C CA    . GLN A 1 484 ? 177.520 178.078 100.119 1.00 121.08 ? 484 GLN A CA    1 
ATOM   3689  C C     . GLN A 1 484 ? 178.826 177.329 100.348 1.00 121.08 ? 484 GLN A C     1 
ATOM   3690  O O     . GLN A 1 484 ? 179.534 177.591 101.328 1.00 121.08 ? 484 GLN A O     1 
ATOM   3691  C CB    . GLN A 1 484 ? 176.331 177.243 100.591 1.00 121.08 ? 484 GLN A CB    1 
ATOM   3692  C CG    . GLN A 1 484 ? 176.362 176.905 102.068 1.00 121.08 ? 484 GLN A CG    1 
ATOM   3693  C CD    . GLN A 1 484 ? 175.131 176.143 102.511 1.00 121.08 ? 484 GLN A CD    1 
ATOM   3694  O OE1   . GLN A 1 484 ? 174.259 175.827 101.703 1.00 121.08 ? 484 GLN A OE1   1 
ATOM   3695  N NE2   . GLN A 1 484 ? 175.053 175.845 103.802 1.00 121.08 ? 484 GLN A NE2   1 
ATOM   3696  N N     . ILE A 1 485 ? 179.167 176.394 99.459  1.00 120.95 ? 485 ILE A N     1 
ATOM   3697  C CA    . ILE A 1 485 ? 180.395 175.630 99.660  1.00 120.95 ? 485 ILE A CA    1 
ATOM   3698  C C     . ILE A 1 485 ? 181.613 176.519 99.448  1.00 120.95 ? 485 ILE A C     1 
ATOM   3699  O O     . ILE A 1 485 ? 182.634 176.367 100.131 1.00 120.95 ? 485 ILE A O     1 
ATOM   3700  C CB    . ILE A 1 485 ? 180.429 174.382 98.758  1.00 120.95 ? 485 ILE A CB    1 
ATOM   3701  C CG1   . ILE A 1 485 ? 180.433 174.764 97.281  1.00 120.95 ? 485 ILE A CG1   1 
ATOM   3702  C CG2   . ILE A 1 485 ? 179.260 173.468 99.073  1.00 120.95 ? 485 ILE A CG2   1 
ATOM   3703  C CD1   . ILE A 1 485 ? 180.706 173.601 96.357  1.00 120.95 ? 485 ILE A CD1   1 
ATOM   3704  N N     . ALA A 1 486 ? 181.520 177.485 98.529  1.00 122.16 ? 486 ALA A N     1 
ATOM   3705  C CA    . ALA A 1 486 ? 182.620 178.433 98.375  1.00 122.16 ? 486 ALA A CA    1 
ATOM   3706  C C     . ALA A 1 486 ? 182.814 179.254 99.644  1.00 122.16 ? 486 ALA A C     1 
ATOM   3707  O O     . ALA A 1 486 ? 183.947 179.438 100.116 1.00 122.16 ? 486 ALA A O     1 
ATOM   3708  C CB    . ALA A 1 486 ? 182.364 179.345 97.177  1.00 122.16 ? 486 ALA A CB    1 
ATOM   3709  N N     . GLU A 1 487 ? 181.714 179.751 100.215 1.00 123.93 ? 487 GLU A N     1 
ATOM   3710  C CA    . GLU A 1 487 ? 181.808 180.521 101.451 1.00 123.93 ? 487 GLU A CA    1 
ATOM   3711  C C     . GLU A 1 487 ? 182.392 179.685 102.583 1.00 123.93 ? 487 GLU A C     1 
ATOM   3712  O O     . GLU A 1 487 ? 183.198 180.178 103.383 1.00 123.93 ? 487 GLU A O     1 
ATOM   3713  C CB    . GLU A 1 487 ? 180.432 181.059 101.836 1.00 123.93 ? 487 GLU A CB    1 
ATOM   3714  C CG    . GLU A 1 487 ? 180.432 181.897 103.098 1.00 123.93 ? 487 GLU A CG    1 
ATOM   3715  C CD    . GLU A 1 487 ? 181.234 183.173 102.948 1.00 123.93 ? 487 GLU A CD    1 
ATOM   3716  O OE1   . GLU A 1 487 ? 181.360 183.668 101.808 1.00 123.93 ? 487 GLU A OE1   1 
ATOM   3717  O OE2   . GLU A 1 487 ? 181.741 183.681 103.970 1.00 123.93 ? 487 GLU A OE2   1 
ATOM   3718  N N     . LEU A 1 488 ? 181.996 178.414 102.669 1.00 118.72 ? 488 LEU A N     1 
ATOM   3719  C CA    . LEU A 1 488 ? 182.506 177.562 103.737 1.00 118.72 ? 488 LEU A CA    1 
ATOM   3720  C C     . LEU A 1 488 ? 183.994 177.289 103.564 1.00 118.72 ? 488 LEU A C     1 
ATOM   3721  O O     . LEU A 1 488 ? 184.751 177.280 104.542 1.00 118.72 ? 488 LEU A O     1 
ATOM   3722  C CB    . LEU A 1 488 ? 181.721 176.255 103.793 1.00 118.72 ? 488 LEU A CB    1 
ATOM   3723  C CG    . LEU A 1 488 ? 180.268 176.403 104.239 1.00 118.72 ? 488 LEU A CG    1 
ATOM   3724  C CD1   . LEU A 1 488 ? 179.546 175.069 104.173 1.00 118.72 ? 488 LEU A CD1   1 
ATOM   3725  C CD2   . LEU A 1 488 ? 180.203 176.987 105.638 1.00 118.72 ? 488 LEU A CD2   1 
ATOM   3726  N N     . LEU A 1 489 ? 184.437 177.063 102.327 1.00 123.43 ? 489 LEU A N     1 
ATOM   3727  C CA    . LEU A 1 489 ? 185.864 176.873 102.104 1.00 123.43 ? 489 LEU A CA    1 
ATOM   3728  C C     . LEU A 1 489 ? 186.639 178.128 102.487 1.00 123.43 ? 489 LEU A C     1 
ATOM   3729  O O     . LEU A 1 489 ? 187.718 178.044 103.087 1.00 123.43 ? 489 LEU A O     1 
ATOM   3730  C CB    . LEU A 1 489 ? 186.122 176.486 100.648 1.00 123.43 ? 489 LEU A CB    1 
ATOM   3731  C CG    . LEU A 1 489 ? 187.522 175.976 100.299 1.00 123.43 ? 489 LEU A CG    1 
ATOM   3732  C CD1   . LEU A 1 489 ? 187.438 174.963 99.171  1.00 123.43 ? 489 LEU A CD1   1 
ATOM   3733  C CD2   . LEU A 1 489 ? 188.456 177.114 99.911  1.00 123.43 ? 489 LEU A CD2   1 
ATOM   3734  N N     . ARG A 1 490 ? 186.086 179.303 102.181 1.00 131.58 ? 490 ARG A N     1 
ATOM   3735  C CA    . ARG A 1 490 ? 186.773 180.541 102.542 1.00 131.58 ? 490 ARG A CA    1 
ATOM   3736  C C     . ARG A 1 490 ? 186.849 180.719 104.055 1.00 131.58 ? 490 ARG A C     1 
ATOM   3737  O O     . ARG A 1 490 ? 187.872 181.174 104.585 1.00 131.58 ? 490 ARG A O     1 
ATOM   3738  C CB    . ARG A 1 490 ? 186.078 181.740 101.900 1.00 131.58 ? 490 ARG A CB    1 
ATOM   3739  C CG    . ARG A 1 490 ? 186.779 183.053 102.181 1.00 131.58 ? 490 ARG A CG    1 
ATOM   3740  C CD    . ARG A 1 490 ? 186.157 184.201 101.414 1.00 131.58 ? 490 ARG A CD    1 
ATOM   3741  N NE    . ARG A 1 490 ? 186.802 185.464 101.756 1.00 131.58 ? 490 ARG A NE    1 
ATOM   3742  C CZ    . ARG A 1 490 ? 187.922 185.901 101.191 1.00 131.58 ? 490 ARG A CZ    1 
ATOM   3743  N NH1   . ARG A 1 490 ? 188.447 187.061 101.562 1.00 131.58 ? 490 ARG A NH1   1 
ATOM   3744  N NH2   . ARG A 1 490 ? 188.523 185.175 100.259 1.00 131.58 ? 490 ARG A NH2   1 
ATOM   3745  N N     . ILE A 1 491 ? 185.770 180.384 104.767 1.00 124.22 ? 491 ILE A N     1 
ATOM   3746  C CA    . ILE A 1 491 ? 185.767 180.577 106.217 1.00 124.22 ? 491 ILE A CA    1 
ATOM   3747  C C     . ILE A 1 491 ? 186.680 179.561 106.893 1.00 124.22 ? 491 ILE A C     1 
ATOM   3748  O O     . ILE A 1 491 ? 187.242 179.828 107.963 1.00 124.22 ? 491 ILE A O     1 
ATOM   3749  C CB    . ILE A 1 491 ? 184.333 180.525 106.778 1.00 124.22 ? 491 ILE A CB    1 
ATOM   3750  C CG1   . ILE A 1 491 ? 184.311 181.019 108.224 1.00 124.22 ? 491 ILE A CG1   1 
ATOM   3751  C CG2   . ILE A 1 491 ? 183.772 179.125 106.741 1.00 124.22 ? 491 ILE A CG2   1 
ATOM   3752  C CD1   . ILE A 1 491 ? 182.922 181.266 108.755 1.00 124.22 ? 491 ILE A CD1   1 
ATOM   3753  N N     . LEU A 1 492 ? 186.850 178.383 106.287 1.00 116.74 ? 492 LEU A N     1 
ATOM   3754  C CA    . LEU A 1 492 ? 187.848 177.452 106.803 1.00 116.74 ? 492 LEU A CA    1 
ATOM   3755  C C     . LEU A 1 492 ? 189.258 177.945 106.516 1.00 116.74 ? 492 LEU A C     1 
ATOM   3756  O O     . LEU A 1 492 ? 190.170 177.742 107.326 1.00 116.74 ? 492 LEU A O     1 
ATOM   3757  C CB    . LEU A 1 492 ? 187.648 176.060 106.210 1.00 116.74 ? 492 LEU A CB    1 
ATOM   3758  C CG    . LEU A 1 492 ? 186.449 175.270 106.719 1.00 116.74 ? 492 LEU A CG    1 
ATOM   3759  C CD1   . LEU A 1 492 ? 186.316 173.970 105.951 1.00 116.74 ? 492 LEU A CD1   1 
ATOM   3760  C CD2   . LEU A 1 492 ? 186.610 175.002 108.202 1.00 116.74 ? 492 LEU A CD2   1 
ATOM   3761  N N     . GLY A 1 493 ? 189.458 178.591 105.367 1.00 127.19 ? 493 GLY A N     1 
ATOM   3762  C CA    . GLY A 1 493 ? 190.789 179.060 105.024 1.00 127.19 ? 493 GLY A CA    1 
ATOM   3763  C C     . GLY A 1 493 ? 191.258 180.206 105.900 1.00 127.19 ? 493 GLY A C     1 
ATOM   3764  O O     . GLY A 1 493 ? 192.378 180.187 106.415 1.00 127.19 ? 493 GLY A O     1 
ATOM   3765  N N     . SER A 1 494 ? 190.412 181.214 106.088 1.00 135.25 ? 494 SER A N     1 
ATOM   3766  C CA    . SER A 1 494 ? 190.810 182.445 106.762 1.00 135.25 ? 494 SER A CA    1 
ATOM   3767  C C     . SER A 1 494 ? 190.377 182.415 108.221 1.00 135.25 ? 494 SER A C     1 
ATOM   3768  O O     . SER A 1 494 ? 189.199 182.191 108.520 1.00 135.25 ? 494 SER A O     1 
ATOM   3769  C CB    . SER A 1 494 ? 190.220 183.671 106.064 1.00 135.25 ? 494 SER A CB    1 
ATOM   3770  O OG    . SER A 1 494 ? 190.747 183.809 104.757 1.00 135.25 ? 494 SER A OG    1 
ATOM   3771  N N     . ALA A 1 495 ? 191.331 182.654 109.124 1.00 129.53 ? 495 ALA A N     1 
ATOM   3772  C CA    . ALA A 1 495 ? 191.029 182.693 110.550 1.00 129.53 ? 495 ALA A CA    1 
ATOM   3773  C C     . ALA A 1 495 ? 190.431 184.025 110.978 1.00 129.53 ? 495 ALA A C     1 
ATOM   3774  O O     . ALA A 1 495 ? 189.683 184.072 111.964 1.00 129.53 ? 495 ALA A O     1 
ATOM   3775  C CB    . ALA A 1 495 ? 192.292 182.407 111.363 1.00 129.53 ? 495 ALA A CB    1 
ATOM   3776  N N     . ASP A 1 496 ? 190.753 185.109 110.271 1.00 126.97 ? 496 ASP A N     1 
ATOM   3777  C CA    . ASP A 1 496 ? 190.141 186.394 110.585 1.00 126.97 ? 496 ASP A CA    1 
ATOM   3778  C C     . ASP A 1 496 ? 188.636 186.340 110.372 1.00 126.97 ? 496 ASP A C     1 
ATOM   3779  O O     . ASP A 1 496 ? 187.870 186.946 111.129 1.00 126.97 ? 496 ASP A O     1 
ATOM   3780  C CB    . ASP A 1 496 ? 190.772 187.494 109.734 1.00 126.97 ? 496 ASP A CB    1 
ATOM   3781  C CG    . ASP A 1 496 ? 192.222 187.743 110.094 1.00 126.97 ? 496 ASP A CG    1 
ATOM   3782  O OD1   . ASP A 1 496 ? 192.590 187.513 111.264 1.00 126.97 ? 496 ASP A OD1   1 
ATOM   3783  O OD2   . ASP A 1 496 ? 192.993 188.165 109.208 1.00 126.97 ? 496 ASP A OD2   1 
ATOM   3784  N N     . ARG A 1 497 ? 188.194 185.605 109.351 1.00 126.96 ? 497 ARG A N     1 
ATOM   3785  C CA    . ARG A 1 497 ? 186.764 185.424 109.136 1.00 126.96 ? 497 ARG A CA    1 
ATOM   3786  C C     . ARG A 1 497 ? 186.124 184.691 110.308 1.00 126.96 ? 497 ARG A C     1 
ATOM   3787  O O     . ARG A 1 497 ? 185.028 185.050 110.755 1.00 126.96 ? 497 ARG A O     1 
ATOM   3788  C CB    . ARG A 1 497 ? 186.532 184.668 107.829 1.00 126.96 ? 497 ARG A CB    1 
ATOM   3789  C CG    . ARG A 1 497 ? 185.075 184.461 107.483 1.00 126.96 ? 497 ARG A CG    1 
ATOM   3790  C CD    . ARG A 1 497 ? 184.389 185.779 107.199 1.00 126.96 ? 497 ARG A CD    1 
ATOM   3791  N NE    . ARG A 1 497 ? 182.991 185.585 106.835 1.00 126.96 ? 497 ARG A NE    1 
ATOM   3792  C CZ    . ARG A 1 497 ? 182.113 186.572 106.707 1.00 126.96 ? 497 ARG A CZ    1 
ATOM   3793  N NH1   . ARG A 1 497 ? 182.491 187.825 106.917 1.00 126.96 ? 497 ARG A NH1   1 
ATOM   3794  N NH2   . ARG A 1 497 ? 180.858 186.308 106.373 1.00 126.96 ? 497 ARG A NH2   1 
ATOM   3795  N N     . LEU A 1 498 ? 186.800 183.663 110.823 1.00 124.89 ? 498 LEU A N     1 
ATOM   3796  C CA    . LEU A 1 498 ? 186.304 182.949 111.994 1.00 124.89 ? 498 LEU A CA    1 
ATOM   3797  C C     . LEU A 1 498 ? 186.191 183.876 113.198 1.00 124.89 ? 498 LEU A C     1 
ATOM   3798  O O     . LEU A 1 498 ? 185.202 183.833 113.945 1.00 124.89 ? 498 LEU A O     1 
ATOM   3799  C CB    . LEU A 1 498 ? 187.233 181.773 112.292 1.00 124.89 ? 498 LEU A CB    1 
ATOM   3800  C CG    . LEU A 1 498 ? 186.928 180.787 113.414 1.00 124.89 ? 498 LEU A CG    1 
ATOM   3801  C CD1   . LEU A 1 498 ? 187.445 179.417 113.028 1.00 124.89 ? 498 LEU A CD1   1 
ATOM   3802  C CD2   . LEU A 1 498 ? 187.594 181.243 114.695 1.00 124.89 ? 498 LEU A CD2   1 
ATOM   3803  N N     . MET A 1 499 ? 187.206 184.714 113.406 1.00 124.19 ? 499 MET A N     1 
ATOM   3804  C CA    . MET A 1 499 ? 187.166 185.650 114.524 1.00 124.19 ? 499 MET A CA    1 
ATOM   3805  C C     . MET A 1 499 ? 186.012 186.632 114.370 1.00 124.19 ? 499 MET A C     1 
ATOM   3806  O O     . MET A 1 499 ? 185.313 186.944 115.343 1.00 124.19 ? 499 MET A O     1 
ATOM   3807  C CB    . MET A 1 499 ? 188.495 186.393 114.630 1.00 124.19 ? 499 MET A CB    1 
ATOM   3808  C CG    . MET A 1 499 ? 189.680 185.476 114.868 1.00 124.19 ? 499 MET A CG    1 
ATOM   3809  S SD    . MET A 1 499 ? 189.534 184.487 116.367 1.00 124.19 ? 499 MET A SD    1 
ATOM   3810  C CE    . MET A 1 499 ? 189.745 185.749 117.611 1.00 124.19 ? 499 MET A CE    1 
ATOM   3811  N N     . GLU A 1 500 ? 185.796 187.125 113.149 1.00 130.74 ? 500 GLU A N     1 
ATOM   3812  C CA    . GLU A 1 500 ? 184.679 188.029 112.895 1.00 130.74 ? 500 GLU A CA    1 
ATOM   3813  C C     . GLU A 1 500 ? 183.346 187.350 113.180 1.00 130.74 ? 500 GLU A C     1 
ATOM   3814  O O     . GLU A 1 500 ? 182.433 187.966 113.742 1.00 130.74 ? 500 GLU A O     1 
ATOM   3815  C CB    . GLU A 1 500 ? 184.724 188.522 111.450 1.00 130.74 ? 500 GLU A CB    1 
ATOM   3816  C CG    . GLU A 1 500 ? 185.902 189.422 111.126 1.00 130.74 ? 500 GLU A CG    1 
ATOM   3817  C CD    . GLU A 1 500 ? 185.943 189.815 109.661 1.00 130.74 ? 500 GLU A CD    1 
ATOM   3818  O OE1   . GLU A 1 500 ? 185.132 189.278 108.876 1.00 130.74 ? 500 GLU A OE1   1 
ATOM   3819  O OE2   . GLU A 1 500 ? 186.786 190.660 109.292 1.00 130.74 ? 500 GLU A OE2   1 
ATOM   3820  N N     . VAL A 1 501 ? 183.214 186.083 112.784 1.00 125.01 ? 501 VAL A N     1 
ATOM   3821  C CA    . VAL A 1 501 ? 181.972 185.352 113.025 1.00 125.01 ? 501 VAL A CA    1 
ATOM   3822  C C     . VAL A 1 501 ? 181.717 185.219 114.520 1.00 125.01 ? 501 VAL A C     1 
ATOM   3823  O O     . VAL A 1 501 ? 180.592 185.420 115.000 1.00 125.01 ? 501 VAL A O     1 
ATOM   3824  C CB    . VAL A 1 501 ? 182.016 183.976 112.338 1.00 125.01 ? 501 VAL A CB    1 
ATOM   3825  C CG1   . VAL A 1 501 ? 180.825 183.140 112.761 1.00 125.01 ? 501 VAL A CG1   1 
ATOM   3826  C CG2   . VAL A 1 501 ? 182.020 184.144 110.833 1.00 125.01 ? 501 VAL A CG2   1 
ATOM   3827  N N     . ILE A 1 502 ? 182.757 184.866 115.277 1.00 118.69 ? 502 ILE A N     1 
ATOM   3828  C CA    . ILE A 1 502 ? 182.594 184.735 116.723 1.00 118.69 ? 502 ILE A CA    1 
ATOM   3829  C C     . ILE A 1 502 ? 182.201 186.073 117.338 1.00 118.69 ? 502 ILE A C     1 
ATOM   3830  O O     . ILE A 1 502 ? 181.330 186.141 118.218 1.00 118.69 ? 502 ILE A O     1 
ATOM   3831  C CB    . ILE A 1 502 ? 183.873 184.169 117.364 1.00 118.69 ? 502 ILE A CB    1 
ATOM   3832  C CG1   . ILE A 1 502 ? 184.098 182.731 116.911 1.00 118.69 ? 502 ILE A CG1   1 
ATOM   3833  C CG2   . ILE A 1 502 ? 183.788 184.232 118.874 1.00 118.69 ? 502 ILE A CG2   1 
ATOM   3834  C CD1   . ILE A 1 502 ? 185.415 182.172 117.351 1.00 118.69 ? 502 ILE A CD1   1 
ATOM   3835  N N     . ARG A 1 503 ? 182.832 187.156 116.881 1.00 121.48 ? 503 ARG A N     1 
ATOM   3836  C CA    . ARG A 1 503 ? 182.498 188.479 117.396 1.00 121.48 ? 503 ARG A CA    1 
ATOM   3837  C C     . ARG A 1 503 ? 181.043 188.828 117.117 1.00 121.48 ? 503 ARG A C     1 
ATOM   3838  O O     . ARG A 1 503 ? 180.339 189.346 117.994 1.00 121.48 ? 503 ARG A O     1 
ATOM   3839  C CB    . ARG A 1 503 ? 183.422 189.526 116.777 1.00 121.48 ? 503 ARG A CB    1 
ATOM   3840  C CG    . ARG A 1 503 ? 183.246 190.923 117.339 1.00 121.48 ? 503 ARG A CG    1 
ATOM   3841  C CD    . ARG A 1 503 ? 184.180 191.902 116.653 1.00 121.48 ? 503 ARG A CD    1 
ATOM   3842  N NE    . ARG A 1 503 ? 185.579 191.558 116.880 1.00 121.48 ? 503 ARG A NE    1 
ATOM   3843  C CZ    . ARG A 1 503 ? 186.265 191.909 117.961 1.00 121.48 ? 503 ARG A CZ    1 
ATOM   3844  N NH1   . ARG A 1 503 ? 185.680 192.615 118.917 1.00 121.48 ? 503 ARG A NH1   1 
ATOM   3845  N NH2   . ARG A 1 503 ? 187.535 191.552 118.087 1.00 121.48 ? 503 ARG A NH2   1 
ATOM   3846  N N     . GLU A 1 504 ? 180.579 188.557 115.897 1.00 132.47 ? 504 GLU A N     1 
ATOM   3847  C CA    . GLU A 1 504 ? 179.200 188.872 115.542 1.00 132.47 ? 504 GLU A CA    1 
ATOM   3848  C C     . GLU A 1 504 ? 178.221 188.063 116.379 1.00 132.47 ? 504 GLU A C     1 
ATOM   3849  O O     . GLU A 1 504 ? 177.203 188.592 116.844 1.00 132.47 ? 504 GLU A O     1 
ATOM   3850  C CB    . GLU A 1 504 ? 178.975 188.618 114.054 1.00 132.47 ? 504 GLU A CB    1 
ATOM   3851  C CG    . GLU A 1 504 ? 179.762 189.549 113.151 1.00 132.47 ? 504 GLU A CG    1 
ATOM   3852  C CD    . GLU A 1 504 ? 179.576 189.237 111.681 1.00 132.47 ? 504 GLU A CD    1 
ATOM   3853  O OE1   . GLU A 1 504 ? 178.925 188.218 111.365 1.00 132.47 ? 504 GLU A OE1   1 
ATOM   3854  O OE2   . GLU A 1 504 ? 180.084 190.007 110.839 1.00 132.47 ? 504 GLU A OE2   1 
ATOM   3855  N N     . GLU A 1 505 ? 178.514 186.778 116.588 1.00 129.50 ? 505 GLU A N     1 
ATOM   3856  C CA    . GLU A 1 505 ? 177.629 185.949 117.400 1.00 129.50 ? 505 GLU A CA    1 
ATOM   3857  C C     . GLU A 1 505 ? 177.560 186.455 118.835 1.00 129.50 ? 505 GLU A C     1 
ATOM   3858  O O     . GLU A 1 505 ? 176.477 186.510 119.432 1.00 129.50 ? 505 GLU A O     1 
ATOM   3859  C CB    . GLU A 1 505 ? 178.089 184.494 117.368 1.00 129.50 ? 505 GLU A CB    1 
ATOM   3860  C CG    . GLU A 1 505 ? 177.924 183.831 116.018 1.00 129.50 ? 505 GLU A CG    1 
ATOM   3861  C CD    . GLU A 1 505 ? 178.386 182.390 116.024 1.00 129.50 ? 505 GLU A CD    1 
ATOM   3862  O OE1   . GLU A 1 505 ? 178.945 181.950 117.051 1.00 129.50 ? 505 GLU A OE1   1 
ATOM   3863  O OE2   . GLU A 1 505 ? 178.190 181.697 115.003 1.00 129.50 ? 505 GLU A OE2   1 
ATOM   3864  N N     . LEU A 1 506 ? 178.705 186.831 119.406 1.00 115.82 ? 506 LEU A N     1 
ATOM   3865  C CA    . LEU A 1 506 ? 178.694 187.339 120.774 1.00 115.82 ? 506 LEU A CA    1 
ATOM   3866  C C     . LEU A 1 506 ? 177.930 188.653 120.871 1.00 115.82 ? 506 LEU A C     1 
ATOM   3867  O O     . LEU A 1 506 ? 177.179 188.871 121.830 1.00 115.82 ? 506 LEU A O     1 
ATOM   3868  C CB    . LEU A 1 506 ? 180.122 187.503 121.286 1.00 115.82 ? 506 LEU A CB    1 
ATOM   3869  C CG    . LEU A 1 506 ? 180.870 186.185 121.471 1.00 115.82 ? 506 LEU A CG    1 
ATOM   3870  C CD1   . LEU A 1 506 ? 182.310 186.437 121.874 1.00 115.82 ? 506 LEU A CD1   1 
ATOM   3871  C CD2   . LEU A 1 506 ? 180.165 185.319 122.498 1.00 115.82 ? 506 LEU A CD2   1 
ATOM   3872  N N     . GLU A 1 507 ? 178.106 189.541 119.889 1.00 123.96 ? 507 GLU A N     1 
ATOM   3873  C CA    . GLU A 1 507 ? 177.365 190.798 119.901 1.00 123.96 ? 507 GLU A CA    1 
ATOM   3874  C C     . GLU A 1 507 ? 175.867 190.549 119.807 1.00 123.96 ? 507 GLU A C     1 
ATOM   3875  O O     . GLU A 1 507 ? 175.073 191.215 120.485 1.00 123.96 ? 507 GLU A O     1 
ATOM   3876  C CB    . GLU A 1 507 ? 177.831 191.693 118.756 1.00 123.96 ? 507 GLU A CB    1 
ATOM   3877  C CG    . GLU A 1 507 ? 179.250 192.203 118.912 1.00 123.96 ? 507 GLU A CG    1 
ATOM   3878  C CD    . GLU A 1 507 ? 179.702 193.034 117.729 1.00 123.96 ? 507 GLU A CD    1 
ATOM   3879  O OE1   . GLU A 1 507 ? 178.952 193.107 116.733 1.00 123.96 ? 507 GLU A OE1   1 
ATOM   3880  O OE2   . GLU A 1 507 ? 180.809 193.610 117.793 1.00 123.96 ? 507 GLU A OE2   1 
ATOM   3881  N N     . LEU A 1 508 ? 175.462 189.589 118.974 1.00 117.24 ? 508 LEU A N     1 
ATOM   3882  C CA    . LEU A 1 508 ? 174.044 189.266 118.860 1.00 117.24 ? 508 LEU A CA    1 
ATOM   3883  C C     . LEU A 1 508 ? 173.495 188.724 120.172 1.00 117.24 ? 508 LEU A C     1 
ATOM   3884  O O     . LEU A 1 508 ? 172.404 189.113 120.606 1.00 117.24 ? 508 LEU A O     1 
ATOM   3885  C CB    . LEU A 1 508 ? 173.827 188.260 117.732 1.00 117.24 ? 508 LEU A CB    1 
ATOM   3886  C CG    . LEU A 1 508 ? 172.370 187.890 117.465 1.00 117.24 ? 508 LEU A CG    1 
ATOM   3887  C CD1   . LEU A 1 508 ? 171.593 189.115 117.021 1.00 117.24 ? 508 LEU A CD1   1 
ATOM   3888  C CD2   . LEU A 1 508 ? 172.281 186.787 116.425 1.00 117.24 ? 508 LEU A CD2   1 
ATOM   3889  N N     . VAL A 1 509 ? 174.241 187.827 120.821 1.00 110.62 ? 509 VAL A N     1 
ATOM   3890  C CA    . VAL A 1 509 ? 173.792 187.274 122.098 1.00 110.62 ? 509 VAL A CA    1 
ATOM   3891  C C     . VAL A 1 509 ? 173.639 188.383 123.130 1.00 110.62 ? 509 VAL A C     1 
ATOM   3892  O O     . VAL A 1 509 ? 172.662 188.421 123.892 1.00 110.62 ? 509 VAL A O     1 
ATOM   3893  C CB    . VAL A 1 509 ? 174.761 186.183 122.584 1.00 110.62 ? 509 VAL A CB    1 
ATOM   3894  C CG1   . VAL A 1 509 ? 174.391 185.740 123.986 1.00 110.62 ? 509 VAL A CG1   1 
ATOM   3895  C CG2   . VAL A 1 509 ? 174.733 185.001 121.640 1.00 110.62 ? 509 VAL A CG2   1 
ATOM   3896  N N     . ARG A 1 510 ? 174.608 189.300 123.175 1.00 108.30 ? 510 ARG A N     1 
ATOM   3897  C CA    . ARG A 1 510 ? 174.519 190.415 124.111 1.00 108.30 ? 510 ARG A CA    1 
ATOM   3898  C C     . ARG A 1 510 ? 173.284 191.260 123.843 1.00 108.30 ? 510 ARG A C     1 
ATOM   3899  O O     . ARG A 1 510 ? 172.520 191.569 124.765 1.00 108.30 ? 510 ARG A O     1 
ATOM   3900  C CB    . ARG A 1 510 ? 175.773 191.282 124.031 1.00 108.30 ? 510 ARG A CB    1 
ATOM   3901  C CG    . ARG A 1 510 ? 175.762 192.438 125.016 1.00 108.30 ? 510 ARG A CG    1 
ATOM   3902  C CD    . ARG A 1 510 ? 177.017 193.285 124.912 1.00 108.30 ? 510 ARG A CD    1 
ATOM   3903  N NE    . ARG A 1 510 ? 177.096 194.006 123.645 1.00 108.30 ? 510 ARG A NE    1 
ATOM   3904  C CZ    . ARG A 1 510 ? 178.159 194.698 123.248 1.00 108.30 ? 510 ARG A CZ    1 
ATOM   3905  N NH1   . ARG A 1 510 ? 179.232 194.767 124.022 1.00 108.30 ? 510 ARG A NH1   1 
ATOM   3906  N NH2   . ARG A 1 510 ? 178.147 195.324 122.080 1.00 108.30 ? 510 ARG A NH2   1 
ATOM   3907  N N     . GLU A 1 511 ? 173.071 191.643 122.584 1.00 122.25 ? 511 GLU A N     1 
ATOM   3908  C CA    . GLU A 1 511 ? 171.929 192.490 122.263 1.00 122.25 ? 511 GLU A CA    1 
ATOM   3909  C C     . GLU A 1 511 ? 170.615 191.783 122.566 1.00 122.25 ? 511 GLU A C     1 
ATOM   3910  O O     . GLU A 1 511 ? 169.614 192.432 122.890 1.00 122.25 ? 511 GLU A O     1 
ATOM   3911  C CB    . GLU A 1 511 ? 171.985 192.917 120.798 1.00 122.25 ? 511 GLU A CB    1 
ATOM   3912  C CG    . GLU A 1 511 ? 170.895 193.893 120.401 1.00 122.25 ? 511 GLU A CG    1 
ATOM   3913  C CD    . GLU A 1 511 ? 171.028 194.358 118.967 1.00 122.25 ? 511 GLU A CD    1 
ATOM   3914  O OE1   . GLU A 1 511 ? 171.968 193.906 118.281 1.00 122.25 ? 511 GLU A OE1   1 
ATOM   3915  O OE2   . GLU A 1 511 ? 170.194 195.175 118.525 1.00 122.25 ? 511 GLU A OE2   1 
ATOM   3916  N N     . GLN A 1 512 ? 170.599 190.453 122.478 1.00 116.41 ? 512 GLN A N     1 
ATOM   3917  C CA    . GLN A 1 512 ? 169.368 189.725 122.761 1.00 116.41 ? 512 GLN A CA    1 
ATOM   3918  C C     . GLN A 1 512 ? 169.092 189.649 124.257 1.00 116.41 ? 512 GLN A C     1 
ATOM   3919  O O     . GLN A 1 512 ? 167.957 189.865 124.697 1.00 116.41 ? 512 GLN A O     1 
ATOM   3920  C CB    . GLN A 1 512 ? 169.425 188.324 122.154 1.00 116.41 ? 512 GLN A CB    1 
ATOM   3921  C CG    . GLN A 1 512 ? 169.335 188.293 120.639 1.00 116.41 ? 512 GLN A CG    1 
ATOM   3922  C CD    . GLN A 1 512 ? 169.366 186.882 120.086 1.00 116.41 ? 512 GLN A CD    1 
ATOM   3923  O OE1   . GLN A 1 512 ? 169.521 185.915 120.831 1.00 116.41 ? 512 GLN A OE1   1 
ATOM   3924  N NE2   . GLN A 1 512 ? 169.214 186.757 118.773 1.00 116.41 ? 512 GLN A NE2   1 
ATOM   3925  N N     . PHE A 1 513 ? 170.109 189.341 125.061 1.00 108.05 ? 513 PHE A N     1 
ATOM   3926  C CA    . PHE A 1 513 ? 169.886 188.986 126.460 1.00 108.05 ? 513 PHE A CA    1 
ATOM   3927  C C     . PHE A 1 513 ? 170.580 189.919 127.452 1.00 108.05 ? 513 PHE A C     1 
ATOM   3928  O O     . PHE A 1 513 ? 170.911 189.515 128.567 1.00 108.05 ? 513 PHE A O     1 
ATOM   3929  C CB    . PHE A 1 513 ? 170.313 187.544 126.712 1.00 108.05 ? 513 PHE A CB    1 
ATOM   3930  C CG    . PHE A 1 513 ? 169.457 186.536 126.012 1.00 108.05 ? 513 PHE A CG    1 
ATOM   3931  C CD1   . PHE A 1 513 ? 168.236 186.164 126.540 1.00 108.05 ? 513 PHE A CD1   1 
ATOM   3932  C CD2   . PHE A 1 513 ? 169.868 185.968 124.822 1.00 108.05 ? 513 PHE A CD2   1 
ATOM   3933  C CE1   . PHE A 1 513 ? 167.443 185.238 125.897 1.00 108.05 ? 513 PHE A CE1   1 
ATOM   3934  C CE2   . PHE A 1 513 ? 169.080 185.042 124.173 1.00 108.05 ? 513 PHE A CE2   1 
ATOM   3935  C CZ    . PHE A 1 513 ? 167.866 184.676 124.711 1.00 108.05 ? 513 PHE A CZ    1 
ATOM   3936  N N     . GLY A 1 514 ? 170.799 191.176 127.076 1.00 112.75 ? 514 GLY A N     1 
ATOM   3937  C CA    . GLY A 1 514 ? 171.272 192.143 128.043 1.00 112.75 ? 514 GLY A CA    1 
ATOM   3938  C C     . GLY A 1 514 ? 170.220 192.514 129.074 1.00 112.75 ? 514 GLY A C     1 
ATOM   3939  O O     . GLY A 1 514 ? 169.030 192.246 128.916 1.00 112.75 ? 514 GLY A O     1 
ATOM   3940  N N     . ASP A 1 515 ? 170.683 193.140 130.153 1.00 118.34 ? 515 ASP A N     1 
ATOM   3941  C CA    . ASP A 1 515 ? 169.816 193.643 131.215 1.00 118.34 ? 515 ASP A CA    1 
ATOM   3942  C C     . ASP A 1 515 ? 170.602 194.668 132.029 1.00 118.34 ? 515 ASP A C     1 
ATOM   3943  O O     . ASP A 1 515 ? 171.692 195.095 131.634 1.00 118.34 ? 515 ASP A O     1 
ATOM   3944  C CB    . ASP A 1 515 ? 169.278 192.499 132.082 1.00 118.34 ? 515 ASP A CB    1 
ATOM   3945  C CG    . ASP A 1 515 ? 170.379 191.696 132.745 1.00 118.34 ? 515 ASP A CG    1 
ATOM   3946  O OD1   . ASP A 1 515 ? 171.567 191.961 132.471 1.00 118.34 ? 515 ASP A OD1   1 
ATOM   3947  O OD2   . ASP A 1 515 ? 170.054 190.794 133.546 1.00 118.34 ? 515 ASP A OD2   1 
ATOM   3948  N N     . LYS A 1 516 ? 170.049 195.063 133.171 1.00 120.28 ? 516 LYS A N     1 
ATOM   3949  C CA    . LYS A 1 516 ? 170.647 196.085 134.014 1.00 120.28 ? 516 LYS A CA    1 
ATOM   3950  C C     . LYS A 1 516 ? 171.203 195.449 135.291 1.00 120.28 ? 516 LYS A C     1 
ATOM   3951  O O     . LYS A 1 516 ? 170.942 194.286 135.604 1.00 120.28 ? 516 LYS A O     1 
ATOM   3952  C CB    . LYS A 1 516 ? 169.614 197.176 134.318 1.00 120.28 ? 516 LYS A CB    1 
ATOM   3953  C CG    . LYS A 1 516 ? 170.177 198.440 134.959 1.00 120.28 ? 516 LYS A CG    1 
ATOM   3954  C CD    . LYS A 1 516 ? 169.080 199.419 135.344 1.00 120.28 ? 516 LYS A CD    1 
ATOM   3955  C CE    . LYS A 1 516 ? 168.491 200.114 134.129 1.00 120.28 ? 516 LYS A CE    1 
ATOM   3956  N NZ    . LYS A 1 516 ? 167.498 201.154 134.523 1.00 120.28 ? 516 LYS A NZ    1 
ATOM   3957  N N     . ARG A 1 517 ? 171.986 196.231 136.034 1.00 107.82 ? 517 ARG A N     1 
ATOM   3958  C CA    . ARG A 1 517 ? 172.605 195.792 137.278 1.00 107.82 ? 517 ARG A CA    1 
ATOM   3959  C C     . ARG A 1 517 ? 171.572 195.734 138.397 1.00 107.82 ? 517 ARG A C     1 
ATOM   3960  O O     . ARG A 1 517 ? 170.610 196.508 138.402 1.00 107.82 ? 517 ARG A O     1 
ATOM   3961  C CB    . ARG A 1 517 ? 173.742 196.744 137.657 1.00 107.82 ? 517 ARG A CB    1 
ATOM   3962  C CG    . ARG A 1 517 ? 174.420 196.448 138.986 1.00 107.82 ? 517 ARG A CG    1 
ATOM   3963  C CD    . ARG A 1 517 ? 175.206 195.151 138.955 1.00 107.82 ? 517 ARG A CD    1 
ATOM   3964  N NE    . ARG A 1 517 ? 176.324 195.222 138.026 1.00 107.82 ? 517 ARG A NE    1 
ATOM   3965  C CZ    . ARG A 1 517 ? 177.508 195.738 138.335 1.00 107.82 ? 517 ARG A CZ    1 
ATOM   3966  N NH1   . ARG A 1 517 ? 178.477 195.768 137.435 1.00 107.82 ? 517 ARG A NH1   1 
ATOM   3967  N NH2   . ARG A 1 517 ? 177.726 196.230 139.545 1.00 107.82 ? 517 ARG A NH2   1 
ATOM   3968  N N     . ARG A 1 518 ? 171.771 194.810 139.339 1.00 106.67 ? 518 ARG A N     1 
ATOM   3969  C CA    . ARG A 1 518 ? 170.940 194.713 140.533 1.00 106.67 ? 518 ARG A CA    1 
ATOM   3970  C C     . ARG A 1 518 ? 171.658 195.197 141.787 1.00 106.67 ? 518 ARG A C     1 
ATOM   3971  O O     . ARG A 1 518 ? 171.167 196.098 142.471 1.00 106.67 ? 518 ARG A O     1 
ATOM   3972  C CB    . ARG A 1 518 ? 170.467 193.270 140.734 1.00 106.67 ? 518 ARG A CB    1 
ATOM   3973  C CG    . ARG A 1 518 ? 169.495 192.790 139.675 1.00 106.67 ? 518 ARG A CG    1 
ATOM   3974  C CD    . ARG A 1 518 ? 169.036 191.372 139.953 1.00 106.67 ? 518 ARG A CD    1 
ATOM   3975  N NE    . ARG A 1 518 ? 168.123 190.887 138.924 1.00 106.67 ? 518 ARG A NE    1 
ATOM   3976  C CZ    . ARG A 1 518 ? 167.598 189.667 138.906 1.00 106.67 ? 518 ARG A CZ    1 
ATOM   3977  N NH1   . ARG A 1 518 ? 167.891 188.801 139.866 1.00 106.67 ? 518 ARG A NH1   1 
ATOM   3978  N NH2   . ARG A 1 518 ? 166.777 189.312 137.928 1.00 106.67 ? 518 ARG A NH2   1 
ATOM   3979  N N     . THR A 1 519 ? 172.822 194.629 142.095 1.00 107.01 ? 519 THR A N     1 
ATOM   3980  C CA    . THR A 1 519 ? 173.544 194.971 143.313 1.00 107.01 ? 519 THR A CA    1 
ATOM   3981  C C     . THR A 1 519 ? 174.264 196.306 143.131 1.00 107.01 ? 519 THR A C     1 
ATOM   3982  O O     . THR A 1 519 ? 174.067 197.020 142.145 1.00 107.01 ? 519 THR A O     1 
ATOM   3983  C CB    . THR A 1 519 ? 174.519 193.859 143.686 1.00 107.01 ? 519 THR A CB    1 
ATOM   3984  O OG1   . THR A 1 519 ? 175.510 193.732 142.661 1.00 107.01 ? 519 THR A OG1   1 
ATOM   3985  C CG2   . THR A 1 519 ? 173.787 192.538 143.832 1.00 107.01 ? 519 THR A CG2   1 
ATOM   3986  N N     . GLU A 1 520 ? 175.116 196.659 144.092 1.00 115.96 ? 520 GLU A N     1 
ATOM   3987  C CA    . GLU A 1 520 ? 175.864 197.907 144.040 1.00 115.96 ? 520 GLU A CA    1 
ATOM   3988  C C     . GLU A 1 520 ? 177.083 197.790 144.942 1.00 115.96 ? 520 GLU A C     1 
ATOM   3989  O O     . GLU A 1 520 ? 177.003 197.211 146.028 1.00 115.96 ? 520 GLU A O     1 
ATOM   3990  C CB    . GLU A 1 520 ? 174.996 199.095 144.466 1.00 115.96 ? 520 GLU A CB    1 
ATOM   3991  C CG    . GLU A 1 520 ? 175.680 200.443 144.336 1.00 115.96 ? 520 GLU A CG    1 
ATOM   3992  C CD    . GLU A 1 520 ? 174.767 201.591 144.710 1.00 115.96 ? 520 GLU A CD    1 
ATOM   3993  O OE1   . GLU A 1 520 ? 173.604 201.327 145.081 1.00 115.96 ? 520 GLU A OE1   1 
ATOM   3994  O OE2   . GLU A 1 520 ? 175.211 202.756 144.637 1.00 115.96 ? 520 GLU A OE2   1 
ATOM   3995  N N     . ILE A 1 521 ? 178.203 198.346 144.491 1.00 110.62 ? 521 ILE A N     1 
ATOM   3996  C CA    . ILE A 1 521 ? 179.485 198.217 145.176 1.00 110.62 ? 521 ILE A CA    1 
ATOM   3997  C C     . ILE A 1 521 ? 179.905 199.604 145.643 1.00 110.62 ? 521 ILE A C     1 
ATOM   3998  O O     . ILE A 1 521 ? 180.272 200.459 144.828 1.00 110.62 ? 521 ILE A O     1 
ATOM   3999  C CB    . ILE A 1 521 ? 180.556 197.589 144.282 1.00 110.62 ? 521 ILE A CB    1 
ATOM   4000  C CG1   . ILE A 1 521 ? 180.159 196.162 143.910 1.00 110.62 ? 521 ILE A CG1   1 
ATOM   4001  C CG2   . ILE A 1 521 ? 181.900 197.608 144.981 1.00 110.62 ? 521 ILE A CG2   1 
ATOM   4002  C CD1   . ILE A 1 521 ? 181.020 195.554 142.831 1.00 110.62 ? 521 ILE A CD1   1 
ATOM   4003  N N     . THR A 1 522 ? 179.864 199.831 146.953 1.00 119.70 ? 522 THR A N     1 
ATOM   4004  C CA    . THR A 1 522 ? 180.324 201.076 147.567 1.00 119.70 ? 522 THR A CA    1 
ATOM   4005  C C     . THR A 1 522 ? 181.617 200.757 148.310 1.00 119.70 ? 522 THR A C     1 
ATOM   4006  O O     . THR A 1 522 ? 181.608 200.065 149.331 1.00 119.70 ? 522 THR A O     1 
ATOM   4007  C CB    . THR A 1 522 ? 179.270 201.667 148.500 1.00 119.70 ? 522 THR A CB    1 
ATOM   4008  O OG1   . THR A 1 522 ? 179.000 200.748 149.565 1.00 119.70 ? 522 THR A OG1   1 
ATOM   4009  C CG2   . THR A 1 522 ? 177.985 201.943 147.737 1.00 119.70 ? 522 THR A CG2   1 
ATOM   4010  N N     . ALA A 1 523 ? 182.731 201.266 147.792 1.00 123.18 ? 523 ALA A N     1 
ATOM   4011  C CA    . ALA A 1 523 ? 184.051 200.929 148.313 1.00 123.18 ? 523 ALA A CA    1 
ATOM   4012  C C     . ALA A 1 523 ? 184.279 201.645 149.638 1.00 123.18 ? 523 ALA A C     1 
ATOM   4013  O O     . ALA A 1 523 ? 184.579 202.843 149.658 1.00 123.18 ? 523 ALA A O     1 
ATOM   4014  C CB    . ALA A 1 523 ? 185.129 201.301 147.301 1.00 123.18 ? 523 ALA A CB    1 
ATOM   4015  N N     . ASN A 1 524 ? 184.146 200.907 150.737 1.00 123.57 ? 524 ASN A N     1 
ATOM   4016  C CA    . ASN A 1 524 ? 184.474 201.392 152.078 1.00 123.57 ? 524 ASN A CA    1 
ATOM   4017  C C     . ASN A 1 524 ? 183.818 202.734 152.394 1.00 123.57 ? 524 ASN A C     1 
ATOM   4018  O O     . ASN A 1 524 ? 184.477 203.774 152.382 1.00 123.57 ? 524 ASN A O     1 
ATOM   4019  C CB    . ASN A 1 524 ? 185.992 201.502 152.238 1.00 123.57 ? 524 ASN A CB    1 
ATOM   4020  C CG    . ASN A 1 524 ? 186.416 201.705 153.678 1.00 123.57 ? 524 ASN A CG    1 
ATOM   4021  O OD1   . ASN A 1 524 ? 185.584 201.773 154.581 1.00 123.57 ? 524 ASN A OD1   1 
ATOM   4022  N ND2   . ASN A 1 524 ? 187.720 201.802 153.899 1.00 123.57 ? 524 ASN A ND2   1 
ATOM   4023  N N     . GLY B 2 402 ? 166.217 145.468 168.824 1.00 164.06 ? 402 GLY B N     1 
ATOM   4024  C CA    . GLY B 2 402 ? 167.482 144.999 168.291 1.00 164.06 ? 402 GLY B CA    1 
ATOM   4025  C C     . GLY B 2 402 ? 167.448 143.544 167.866 1.00 164.06 ? 402 GLY B C     1 
ATOM   4026  O O     . GLY B 2 402 ? 167.641 143.222 166.692 1.00 164.06 ? 402 GLY B O     1 
ATOM   4027  N N     . LEU B 2 403 ? 167.197 142.655 168.831 1.00 166.09 ? 403 LEU B N     1 
ATOM   4028  C CA    . LEU B 2 403 ? 167.123 141.232 168.501 1.00 166.09 ? 403 LEU B CA    1 
ATOM   4029  C C     . LEU B 2 403 ? 165.924 140.918 167.615 1.00 166.09 ? 403 LEU B C     1 
ATOM   4030  O O     . LEU B 2 403 ? 166.102 140.221 166.600 1.00 166.09 ? 403 LEU B O     1 
ATOM   4031  C CB    . LEU B 2 403 ? 167.141 140.397 169.787 1.00 166.09 ? 403 LEU B CB    1 
ATOM   4032  C CG    . LEU B 2 403 ? 167.138 138.872 169.664 1.00 166.09 ? 403 LEU B CG    1 
ATOM   4033  C CD1   . LEU B 2 403 ? 168.386 138.383 168.950 1.00 166.09 ? 403 LEU B CD1   1 
ATOM   4034  C CD2   . LEU B 2 403 ? 167.023 138.233 171.039 1.00 166.09 ? 403 LEU B CD2   1 
ATOM   4035  N N     . PRO B 2 404 ? 164.708 141.382 167.905 1.00 167.84 ? 404 PRO B N     1 
ATOM   4036  C CA    . PRO B 2 404 ? 163.610 141.240 166.945 1.00 167.84 ? 404 PRO B CA    1 
ATOM   4037  C C     . PRO B 2 404 ? 163.732 142.274 165.828 1.00 167.84 ? 404 PRO B C     1 
ATOM   4038  O O     . PRO B 2 404 ? 164.707 143.017 165.727 1.00 167.84 ? 404 PRO B O     1 
ATOM   4039  C CB    . PRO B 2 404 ? 162.359 141.495 167.792 1.00 167.84 ? 404 PRO B CB    1 
ATOM   4040  C CG    . PRO B 2 404 ? 162.794 141.307 169.200 1.00 167.84 ? 404 PRO B CG    1 
ATOM   4041  C CD    . PRO B 2 404 ? 164.197 141.808 169.219 1.00 167.84 ? 404 PRO B CD    1 
ATOM   4042  N N     . GLY B 2 405 ? 162.711 142.304 164.975 1.00 156.37 ? 405 GLY B N     1 
ATOM   4043  C CA    . GLY B 2 405 ? 162.605 143.325 163.953 1.00 156.37 ? 405 GLY B CA    1 
ATOM   4044  C C     . GLY B 2 405 ? 163.330 143.001 162.665 1.00 156.37 ? 405 GLY B C     1 
ATOM   4045  O O     . GLY B 2 405 ? 162.704 142.879 161.608 1.00 156.37 ? 405 GLY B O     1 
ATOM   4046  N N     . LYS B 2 406 ? 164.649 142.863 162.734 1.00 142.52 ? 406 LYS B N     1 
ATOM   4047  C CA    . LYS B 2 406 ? 165.460 142.652 161.543 1.00 142.52 ? 406 LYS B CA    1 
ATOM   4048  C C     . LYS B 2 406 ? 166.217 141.335 161.554 1.00 142.52 ? 406 LYS B C     1 
ATOM   4049  O O     . LYS B 2 406 ? 166.231 140.629 160.542 1.00 142.52 ? 406 LYS B O     1 
ATOM   4050  C CB    . LYS B 2 406 ? 166.450 143.812 161.373 1.00 142.52 ? 406 LYS B CB    1 
ATOM   4051  C CG    . LYS B 2 406 ? 165.779 145.159 161.201 1.00 142.52 ? 406 LYS B CG    1 
ATOM   4052  C CD    . LYS B 2 406 ? 164.991 145.210 159.906 1.00 142.52 ? 406 LYS B CD    1 
ATOM   4053  C CE    . LYS B 2 406 ? 164.364 146.574 159.692 1.00 142.52 ? 406 LYS B CE    1 
ATOM   4054  N NZ    . LYS B 2 406 ? 163.550 146.606 158.448 1.00 142.52 ? 406 LYS B NZ    1 
ATOM   4055  N N     . LEU B 2 407 ? 166.848 140.985 162.671 1.00 137.69 ? 407 LEU B N     1 
ATOM   4056  C CA    . LEU B 2 407 ? 167.670 139.785 162.719 1.00 137.69 ? 407 LEU B CA    1 
ATOM   4057  C C     . LEU B 2 407 ? 166.820 138.539 162.511 1.00 137.69 ? 407 LEU B C     1 
ATOM   4058  O O     . LEU B 2 407 ? 165.768 138.379 163.137 1.00 137.69 ? 407 LEU B O     1 
ATOM   4059  C CB    . LEU B 2 407 ? 168.407 139.700 164.051 1.00 137.69 ? 407 LEU B CB    1 
ATOM   4060  C CG    . LEU B 2 407 ? 169.313 138.478 164.179 1.00 137.69 ? 407 LEU B CG    1 
ATOM   4061  C CD1   . LEU B 2 407 ? 170.387 138.511 163.108 1.00 137.69 ? 407 LEU B CD1   1 
ATOM   4062  C CD2   . LEU B 2 407 ? 169.935 138.408 165.562 1.00 137.69 ? 407 LEU B CD2   1 
ATOM   4063  N N     . ALA B 2 408 ? 167.276 137.662 161.623 1.00 137.85 ? 408 ALA B N     1 
ATOM   4064  C CA    . ALA B 2 408 ? 166.637 136.375 161.365 1.00 137.85 ? 408 ALA B CA    1 
ATOM   4065  C C     . ALA B 2 408 ? 167.711 135.301 161.492 1.00 137.85 ? 408 ALA B C     1 
ATOM   4066  O O     . ALA B 2 408 ? 168.446 135.031 160.537 1.00 137.85 ? 408 ALA B O     1 
ATOM   4067  C CB    . ALA B 2 408 ? 165.978 136.351 159.990 1.00 137.85 ? 408 ALA B CB    1 
ATOM   4068  N N     . ASP B 2 409 ? 167.798 134.686 162.668 1.00 155.28 ? 409 ASP B N     1 
ATOM   4069  C CA    . ASP B 2 409 ? 168.835 133.702 162.944 1.00 155.28 ? 409 ASP B CA    1 
ATOM   4070  C C     . ASP B 2 409 ? 168.486 132.372 162.277 1.00 155.28 ? 409 ASP B C     1 
ATOM   4071  O O     . ASP B 2 409 ? 167.524 132.260 161.512 1.00 155.28 ? 409 ASP B O     1 
ATOM   4072  C CB    . ASP B 2 409 ? 169.030 133.553 164.449 1.00 155.28 ? 409 ASP B CB    1 
ATOM   4073  C CG    . ASP B 2 409 ? 167.764 133.119 165.160 1.00 155.28 ? 409 ASP B CG    1 
ATOM   4074  O OD1   . ASP B 2 409 ? 166.707 133.029 164.502 1.00 155.28 ? 409 ASP B OD1   1 
ATOM   4075  O OD2   . ASP B 2 409 ? 167.828 132.861 166.380 1.00 155.28 ? 409 ASP B OD2   1 
ATOM   4076  N N     . CYS B 2 410 ? 169.271 131.342 162.571 1.00 154.51 ? 410 CYS B N     1 
ATOM   4077  C CA    . CYS B 2 410 ? 169.105 130.019 161.992 1.00 154.51 ? 410 CYS B CA    1 
ATOM   4078  C C     . CYS B 2 410 ? 168.611 129.045 163.054 1.00 154.51 ? 410 CYS B C     1 
ATOM   4079  O O     . CYS B 2 410 ? 168.346 129.414 164.201 1.00 154.51 ? 410 CYS B O     1 
ATOM   4080  C CB    . CYS B 2 410 ? 170.418 129.536 161.377 1.00 154.51 ? 410 CYS B CB    1 
ATOM   4081  S SG    . CYS B 2 410 ? 171.742 129.291 162.578 1.00 154.51 ? 410 CYS B SG    1 
ATOM   4082  N N     . GLN B 2 411 ? 168.489 127.778 162.656 1.00 157.38 ? 411 GLN B N     1 
ATOM   4083  C CA    . GLN B 2 411 ? 168.028 126.756 163.589 1.00 157.38 ? 411 GLN B CA    1 
ATOM   4084  C C     . GLN B 2 411 ? 169.104 126.410 164.608 1.00 157.38 ? 411 GLN B C     1 
ATOM   4085  O O     . GLN B 2 411 ? 168.807 126.220 165.793 1.00 157.38 ? 411 GLN B O     1 
ATOM   4086  C CB    . GLN B 2 411 ? 167.594 125.506 162.826 1.00 157.38 ? 411 GLN B CB    1 
ATOM   4087  C CG    . GLN B 2 411 ? 166.357 125.704 161.970 1.00 157.38 ? 411 GLN B CG    1 
ATOM   4088  C CD    . GLN B 2 411 ? 165.974 124.453 161.207 1.00 157.38 ? 411 GLN B CD    1 
ATOM   4089  O OE1   . GLN B 2 411 ? 166.671 123.441 161.262 1.00 157.38 ? 411 GLN B OE1   1 
ATOM   4090  N NE2   . GLN B 2 411 ? 164.860 124.518 160.488 1.00 157.38 ? 411 GLN B NE2   1 
ATOM   4091  N N     . GLU B 2 412 ? 170.356 126.325 164.171 1.00 159.40 ? 412 GLU B N     1 
ATOM   4092  C CA    . GLU B 2 412 ? 171.434 125.956 165.075 1.00 159.40 ? 412 GLU B CA    1 
ATOM   4093  C C     . GLU B 2 412 ? 171.749 127.100 166.029 1.00 159.40 ? 412 GLU B C     1 
ATOM   4094  O O     . GLU B 2 412 ? 171.722 128.274 165.650 1.00 159.40 ? 412 GLU B O     1 
ATOM   4095  C CB    . GLU B 2 412 ? 172.682 125.569 164.286 1.00 159.40 ? 412 GLU B CB    1 
ATOM   4096  C CG    . GLU B 2 412 ? 173.839 125.113 165.156 1.00 159.40 ? 412 GLU B CG    1 
ATOM   4097  C CD    . GLU B 2 412 ? 173.521 123.844 165.919 1.00 159.40 ? 412 GLU B CD    1 
ATOM   4098  O OE1   . GLU B 2 412 ? 172.690 123.050 165.431 1.00 159.40 ? 412 GLU B OE1   1 
ATOM   4099  O OE2   . GLU B 2 412 ? 174.092 123.641 167.010 1.00 159.40 ? 412 GLU B OE2   1 
ATOM   4100  N N     . ARG B 2 413 ? 172.047 126.748 167.280 1.00 162.26 ? 413 ARG B N     1 
ATOM   4101  C CA    . ARG B 2 413 ? 172.397 127.727 168.296 1.00 162.26 ? 413 ARG B CA    1 
ATOM   4102  C C     . ARG B 2 413 ? 173.856 127.665 168.721 1.00 162.26 ? 413 ARG B C     1 
ATOM   4103  O O     . ARG B 2 413 ? 174.337 128.608 169.354 1.00 162.26 ? 413 ARG B O     1 
ATOM   4104  C CB    . ARG B 2 413 ? 171.509 127.545 169.534 1.00 162.26 ? 413 ARG B CB    1 
ATOM   4105  C CG    . ARG B 2 413 ? 170.039 127.819 169.273 1.00 162.26 ? 413 ARG B CG    1 
ATOM   4106  C CD    . ARG B 2 413 ? 169.210 127.598 170.523 1.00 162.26 ? 413 ARG B CD    1 
ATOM   4107  N NE    . ARG B 2 413 ? 169.530 128.570 171.564 1.00 162.26 ? 413 ARG B NE    1 
ATOM   4108  C CZ    . ARG B 2 413 ? 169.074 128.506 172.810 1.00 162.26 ? 413 ARG B CZ    1 
ATOM   4109  N NH1   . ARG B 2 413 ? 168.274 127.513 173.175 1.00 162.26 ? 413 ARG B NH1   1 
ATOM   4110  N NH2   . ARG B 2 413 ? 169.417 129.435 173.692 1.00 162.26 ? 413 ARG B NH2   1 
ATOM   4111  N N     . ASP B 2 414 ? 174.561 126.589 168.394 1.00 161.31 ? 414 ASP B N     1 
ATOM   4112  C CA    . ASP B 2 414 ? 175.974 126.487 168.735 1.00 161.31 ? 414 ASP B CA    1 
ATOM   4113  C C     . ASP B 2 414 ? 176.784 127.442 167.868 1.00 161.31 ? 414 ASP B C     1 
ATOM   4114  O O     . ASP B 2 414 ? 176.699 127.376 166.636 1.00 161.31 ? 414 ASP B O     1 
ATOM   4115  C CB    . ASP B 2 414 ? 176.468 125.056 168.537 1.00 161.31 ? 414 ASP B CB    1 
ATOM   4116  C CG    . ASP B 2 414 ? 177.892 124.847 169.027 1.00 161.31 ? 414 ASP B CG    1 
ATOM   4117  O OD1   . ASP B 2 414 ? 178.515 125.806 169.529 1.00 161.31 ? 414 ASP B OD1   1 
ATOM   4118  O OD2   . ASP B 2 414 ? 178.396 123.712 168.897 1.00 161.31 ? 414 ASP B OD2   1 
ATOM   4119  N N     . PRO B 2 415 ? 177.575 128.331 168.460 1.00 147.79 ? 415 PRO B N     1 
ATOM   4120  C CA    . PRO B 2 415 ? 178.483 129.152 167.658 1.00 147.79 ? 415 PRO B CA    1 
ATOM   4121  C C     . PRO B 2 415 ? 179.539 128.300 166.970 1.00 147.79 ? 415 PRO B C     1 
ATOM   4122  O O     . PRO B 2 415 ? 179.569 127.072 167.093 1.00 147.79 ? 415 PRO B O     1 
ATOM   4123  C CB    . PRO B 2 415 ? 179.112 130.097 168.687 1.00 147.79 ? 415 PRO B CB    1 
ATOM   4124  C CG    . PRO B 2 415 ? 178.128 130.144 169.799 1.00 147.79 ? 415 PRO B CG    1 
ATOM   4125  C CD    . PRO B 2 415 ? 177.538 128.768 169.866 1.00 147.79 ? 415 PRO B CD    1 
ATOM   4126  N N     . ALA B 2 416 ? 180.399 128.979 166.215 1.00 138.19 ? 416 ALA B N     1 
ATOM   4127  C CA    . ALA B 2 416 ? 181.499 128.413 165.442 1.00 138.19 ? 416 ALA B CA    1 
ATOM   4128  C C     . ALA B 2 416 ? 180.995 127.527 164.313 1.00 138.19 ? 416 ALA B C     1 
ATOM   4129  O O     . ALA B 2 416 ? 181.787 126.775 163.738 1.00 138.19 ? 416 ALA B O     1 
ATOM   4130  C CB    . ALA B 2 416 ? 182.490 127.616 166.303 1.00 138.19 ? 416 ALA B CB    1 
ATOM   4131  N N     . LEU B 2 417 ? 179.707 127.579 163.981 1.00 133.96 ? 417 LEU B N     1 
ATOM   4132  C CA    . LEU B 2 417 ? 179.182 126.867 162.829 1.00 133.96 ? 417 LEU B CA    1 
ATOM   4133  C C     . LEU B 2 417 ? 178.214 127.707 162.008 1.00 133.96 ? 417 LEU B C     1 
ATOM   4134  O O     . LEU B 2 417 ? 177.961 127.377 160.845 1.00 133.96 ? 417 LEU B O     1 
ATOM   4135  C CB    . LEU B 2 417 ? 178.505 125.566 163.285 1.00 133.96 ? 417 LEU B CB    1 
ATOM   4136  C CG    . LEU B 2 417 ? 178.105 124.496 162.267 1.00 133.96 ? 417 LEU B CG    1 
ATOM   4137  C CD1   . LEU B 2 417 ? 178.260 123.122 162.892 1.00 133.96 ? 417 LEU B CD1   1 
ATOM   4138  C CD2   . LEU B 2 417 ? 176.672 124.684 161.800 1.00 133.96 ? 417 LEU B CD2   1 
ATOM   4139  N N     . SER B 2 418 ? 177.698 128.800 162.561 1.00 128.91 ? 418 SER B N     1 
ATOM   4140  C CA    . SER B 2 418 ? 176.730 129.627 161.863 1.00 128.91 ? 418 SER B CA    1 
ATOM   4141  C C     . SER B 2 418 ? 177.434 130.726 161.077 1.00 128.91 ? 418 SER B C     1 
ATOM   4142  O O     . SER B 2 418 ? 178.591 131.067 161.336 1.00 128.91 ? 418 SER B O     1 
ATOM   4143  C CB    . SER B 2 418 ? 175.735 130.247 162.842 1.00 128.91 ? 418 SER B CB    1 
ATOM   4144  O OG    . SER B 2 418 ? 176.383 131.178 163.688 1.00 128.91 ? 418 SER B OG    1 
ATOM   4145  N N     . GLU B 2 419 ? 176.715 131.280 160.107 1.00 127.24 ? 419 GLU B N     1 
ATOM   4146  C CA    . GLU B 2 419 ? 177.213 132.359 159.267 1.00 127.24 ? 419 GLU B CA    1 
ATOM   4147  C C     . GLU B 2 419 ? 176.314 133.576 159.419 1.00 127.24 ? 419 GLU B C     1 
ATOM   4148  O O     . GLU B 2 419 ? 175.098 133.441 159.588 1.00 127.24 ? 419 GLU B O     1 
ATOM   4149  C CB    . GLU B 2 419 ? 177.272 131.935 157.797 1.00 127.24 ? 419 GLU B CB    1 
ATOM   4150  C CG    . GLU B 2 419 ? 178.316 130.878 157.489 1.00 127.24 ? 419 GLU B CG    1 
ATOM   4151  C CD    . GLU B 2 419 ? 178.323 130.476 156.025 1.00 127.24 ? 419 GLU B CD    1 
ATOM   4152  O OE1   . GLU B 2 419 ? 177.419 130.913 155.281 1.00 127.24 ? 419 GLU B OE1   1 
ATOM   4153  O OE2   . GLU B 2 419 ? 179.235 129.727 155.616 1.00 127.24 ? 419 GLU B OE2   1 
ATOM   4154  N N     . LEU B 2 420 ? 176.916 134.759 159.354 1.00 120.41 ? 420 LEU B N     1 
ATOM   4155  C CA    . LEU B 2 420 ? 176.201 136.021 159.468 1.00 120.41 ? 420 LEU B CA    1 
ATOM   4156  C C     . LEU B 2 420 ? 176.571 136.919 158.295 1.00 120.41 ? 420 LEU B C     1 
ATOM   4157  O O     . LEU B 2 420 ? 177.707 136.888 157.814 1.00 120.41 ? 420 LEU B O     1 
ATOM   4158  C CB    . LEU B 2 420 ? 176.528 136.714 160.791 1.00 120.41 ? 420 LEU B CB    1 
ATOM   4159  C CG    . LEU B 2 420 ? 175.800 138.023 161.083 1.00 120.41 ? 420 LEU B CG    1 
ATOM   4160  C CD1   . LEU B 2 420 ? 174.308 137.784 161.160 1.00 120.41 ? 420 LEU B CD1   1 
ATOM   4161  C CD2   . LEU B 2 420 ? 176.311 138.636 162.371 1.00 120.41 ? 420 LEU B CD2   1 
ATOM   4162  N N     . TYR B 2 421 ? 175.610 137.716 157.836 1.00 112.13 ? 421 TYR B N     1 
ATOM   4163  C CA    . TYR B 2 421 ? 175.824 138.613 156.712 1.00 112.13 ? 421 TYR B CA    1 
ATOM   4164  C C     . TYR B 2 421 ? 175.338 140.016 157.049 1.00 112.13 ? 421 TYR B C     1 
ATOM   4165  O O     . TYR B 2 421 ? 174.563 140.224 157.985 1.00 112.13 ? 421 TYR B O     1 
ATOM   4166  C CB    . TYR B 2 421 ? 175.112 138.107 155.457 1.00 112.13 ? 421 TYR B CB    1 
ATOM   4167  C CG    . TYR B 2 421 ? 175.676 136.822 154.903 1.00 112.13 ? 421 TYR B CG    1 
ATOM   4168  C CD1   . TYR B 2 421 ? 176.856 136.818 154.176 1.00 112.13 ? 421 TYR B CD1   1 
ATOM   4169  C CD2   . TYR B 2 421 ? 175.018 135.618 155.086 1.00 112.13 ? 421 TYR B CD2   1 
ATOM   4170  C CE1   . TYR B 2 421 ? 177.370 135.649 153.659 1.00 112.13 ? 421 TYR B CE1   1 
ATOM   4171  C CE2   . TYR B 2 421 ? 175.525 134.446 154.572 1.00 112.13 ? 421 TYR B CE2   1 
ATOM   4172  C CZ    . TYR B 2 421 ? 176.700 134.466 153.860 1.00 112.13 ? 421 TYR B CZ    1 
ATOM   4173  O OH    . TYR B 2 421 ? 177.207 133.296 153.348 1.00 112.13 ? 421 TYR B OH    1 
ATOM   4174  N N     . LEU B 2 422 ? 175.805 140.982 156.260 1.00 106.62 ? 422 LEU B N     1 
ATOM   4175  C CA    . LEU B 2 422 ? 175.450 142.386 156.431 1.00 106.62 ? 422 LEU B CA    1 
ATOM   4176  C C     . LEU B 2 422 ? 175.283 143.007 155.054 1.00 106.62 ? 422 LEU B C     1 
ATOM   4177  O O     . LEU B 2 422 ? 176.215 142.970 154.247 1.00 106.62 ? 422 LEU B O     1 
ATOM   4178  C CB    . LEU B 2 422 ? 176.526 143.131 157.224 1.00 106.62 ? 422 LEU B CB    1 
ATOM   4179  C CG    . LEU B 2 422 ? 176.734 142.711 158.678 1.00 106.62 ? 422 LEU B CG    1 
ATOM   4180  C CD1   . LEU B 2 422 ? 177.947 143.405 159.263 1.00 106.62 ? 422 LEU B CD1   1 
ATOM   4181  C CD2   . LEU B 2 422 ? 175.498 143.028 159.493 1.00 106.62 ? 422 LEU B CD2   1 
ATOM   4182  N N     . VAL B 2 423 ? 174.107 143.574 154.782 1.00 115.37 ? 423 VAL B N     1 
ATOM   4183  C CA    . VAL B 2 423 ? 173.776 144.137 153.479 1.00 115.37 ? 423 VAL B CA    1 
ATOM   4184  C C     . VAL B 2 423 ? 172.939 145.396 153.679 1.00 115.37 ? 423 VAL B C     1 
ATOM   4185  O O     . VAL B 2 423 ? 172.603 145.775 154.803 1.00 115.37 ? 423 VAL B O     1 
ATOM   4186  C CB    . VAL B 2 423 ? 173.019 143.135 152.583 1.00 115.37 ? 423 VAL B CB    1 
ATOM   4187  C CG1   . VAL B 2 423 ? 173.888 141.937 152.253 1.00 115.37 ? 423 VAL B CG1   1 
ATOM   4188  C CG2   . VAL B 2 423 ? 171.739 142.689 153.264 1.00 115.37 ? 423 VAL B CG2   1 
ATOM   4189  N N     . GLU B 2 424 ? 172.606 146.049 152.566 1.00 131.45 ? 424 GLU B N     1 
ATOM   4190  C CA    . GLU B 2 424 ? 171.640 147.140 152.589 1.00 131.45 ? 424 GLU B CA    1 
ATOM   4191  C C     . GLU B 2 424 ? 170.244 146.573 152.811 1.00 131.45 ? 424 GLU B C     1 
ATOM   4192  O O     . GLU B 2 424 ? 169.879 145.549 152.227 1.00 131.45 ? 424 GLU B O     1 
ATOM   4193  C CB    . GLU B 2 424 ? 171.697 147.931 151.284 1.00 131.45 ? 424 GLU B CB    1 
ATOM   4194  C CG    . GLU B 2 424 ? 170.769 149.131 151.249 1.00 131.45 ? 424 GLU B CG    1 
ATOM   4195  C CD    . GLU B 2 424 ? 170.890 149.923 149.962 1.00 131.45 ? 424 GLU B CD    1 
ATOM   4196  O OE1   . GLU B 2 424 ? 171.687 149.522 149.090 1.00 131.45 ? 424 GLU B OE1   1 
ATOM   4197  O OE2   . GLU B 2 424 ? 170.187 150.947 149.823 1.00 131.45 ? 424 GLU B OE2   1 
ATOM   4198  N N     . GLY B 2 425 ? 169.458 147.245 153.648 1.00 133.11 ? 425 GLY B N     1 
ATOM   4199  C CA    . GLY B 2 425 ? 168.315 146.596 154.258 1.00 133.11 ? 425 GLY B CA    1 
ATOM   4200  C C     . GLY B 2 425 ? 167.166 146.150 153.378 1.00 133.11 ? 425 GLY B C     1 
ATOM   4201  O O     . GLY B 2 425 ? 167.020 144.954 153.115 1.00 133.11 ? 425 GLY B O     1 
ATOM   4202  N N     . ASP B 2 426 ? 166.372 147.090 152.871 1.00 139.97 ? 426 ASP B N     1 
ATOM   4203  C CA    . ASP B 2 426 ? 165.070 146.717 152.326 1.00 139.97 ? 426 ASP B CA    1 
ATOM   4204  C C     . ASP B 2 426 ? 165.204 146.043 150.967 1.00 139.97 ? 426 ASP B C     1 
ATOM   4205  O O     . ASP B 2 426 ? 164.552 145.027 150.701 1.00 139.97 ? 426 ASP B O     1 
ATOM   4206  C CB    . ASP B 2 426 ? 164.167 147.945 152.233 1.00 139.97 ? 426 ASP B CB    1 
ATOM   4207  C CG    . ASP B 2 426 ? 162.751 147.596 151.830 1.00 139.97 ? 426 ASP B CG    1 
ATOM   4208  O OD1   . ASP B 2 426 ? 162.007 147.059 152.677 1.00 139.97 ? 426 ASP B OD1   1 
ATOM   4209  O OD2   . ASP B 2 426 ? 162.381 147.857 150.667 1.00 139.97 ? 426 ASP B OD2   1 
ATOM   4210  N N     . SER B 2 427 ? 166.044 146.593 150.093 1.00 133.13 ? 427 SER B N     1 
ATOM   4211  C CA    . SER B 2 427 ? 166.151 146.061 148.739 1.00 133.13 ? 427 SER B CA    1 
ATOM   4212  C C     . SER B 2 427 ? 166.787 144.677 148.741 1.00 133.13 ? 427 SER B C     1 
ATOM   4213  O O     . SER B 2 427 ? 166.243 143.728 148.166 1.00 133.13 ? 427 SER B O     1 
ATOM   4214  C CB    . SER B 2 427 ? 166.949 147.026 147.862 1.00 133.13 ? 427 SER B CB    1 
ATOM   4215  O OG    . SER B 2 427 ? 167.091 146.519 146.547 1.00 133.13 ? 427 SER B OG    1 
ATOM   4216  N N     . ALA B 2 428 ? 167.942 144.540 149.391 1.00 133.63 ? 428 ALA B N     1 
ATOM   4217  C CA    . ALA B 2 428 ? 168.694 143.295 149.300 1.00 133.63 ? 428 ALA B CA    1 
ATOM   4218  C C     . ALA B 2 428 ? 168.233 142.251 150.308 1.00 133.63 ? 428 ALA B C     1 
ATOM   4219  O O     . ALA B 2 428 ? 168.298 141.050 150.014 1.00 133.63 ? 428 ALA B O     1 
ATOM   4220  C CB    . ALA B 2 428 ? 170.186 143.570 149.485 1.00 133.63 ? 428 ALA B CB    1 
ATOM   4221  N N     . GLY B 2 429 ? 167.776 142.678 151.489 1.00 133.43 ? 429 GLY B N     1 
ATOM   4222  C CA    . GLY B 2 429 ? 167.449 141.724 152.534 1.00 133.43 ? 429 GLY B CA    1 
ATOM   4223  C C     . GLY B 2 429 ? 166.317 140.793 152.154 1.00 133.43 ? 429 GLY B C     1 
ATOM   4224  O O     . GLY B 2 429 ? 166.305 139.627 152.550 1.00 133.43 ? 429 GLY B O     1 
ATOM   4225  N N     . GLY B 2 430 ? 165.351 141.291 151.383 1.00 136.29 ? 430 GLY B N     1 
ATOM   4226  C CA    . GLY B 2 430 ? 164.257 140.436 150.953 1.00 136.29 ? 430 GLY B CA    1 
ATOM   4227  C C     . GLY B 2 430 ? 164.738 139.261 150.126 1.00 136.29 ? 430 GLY B C     1 
ATOM   4228  O O     . GLY B 2 430 ? 164.433 138.103 150.426 1.00 136.29 ? 430 GLY B O     1 
ATOM   4229  N N     . SER B 2 431 ? 165.508 139.546 149.075 1.00 135.20 ? 431 SER B N     1 
ATOM   4230  C CA    . SER B 2 431 ? 166.052 138.479 148.245 1.00 135.20 ? 431 SER B CA    1 
ATOM   4231  C C     . SER B 2 431 ? 166.980 137.580 149.048 1.00 135.20 ? 431 SER B C     1 
ATOM   4232  O O     . SER B 2 431 ? 166.983 136.356 148.866 1.00 135.20 ? 431 SER B O     1 
ATOM   4233  C CB    . SER B 2 431 ? 166.788 139.075 147.047 1.00 135.20 ? 431 SER B CB    1 
ATOM   4234  O OG    . SER B 2 431 ? 167.924 139.807 147.471 1.00 135.20 ? 431 SER B OG    1 
ATOM   4235  N N     . ALA B 2 432 ? 167.767 138.167 149.951 1.00 134.61 ? 432 ALA B N     1 
ATOM   4236  C CA    . ALA B 2 432 ? 168.691 137.371 150.749 1.00 134.61 ? 432 ALA B CA    1 
ATOM   4237  C C     . ALA B 2 432 ? 167.939 136.371 151.618 1.00 134.61 ? 432 ALA B C     1 
ATOM   4238  O O     . ALA B 2 432 ? 168.290 135.187 151.669 1.00 134.61 ? 432 ALA B O     1 
ATOM   4239  C CB    . ALA B 2 432 ? 169.563 138.288 151.603 1.00 134.61 ? 432 ALA B CB    1 
ATOM   4240  N N     . LYS B 2 433 ? 166.892 136.831 152.305 1.00 130.13 ? 433 LYS B N     1 
ATOM   4241  C CA    . LYS B 2 433 ? 166.085 135.930 153.120 1.00 130.13 ? 433 LYS B CA    1 
ATOM   4242  C C     . LYS B 2 433 ? 165.408 134.872 152.263 1.00 130.13 ? 433 LYS B C     1 
ATOM   4243  O O     . LYS B 2 433 ? 165.404 133.687 152.614 1.00 130.13 ? 433 LYS B O     1 
ATOM   4244  C CB    . LYS B 2 433 ? 165.038 136.721 153.901 1.00 130.13 ? 433 LYS B CB    1 
ATOM   4245  C CG    . LYS B 2 433 ? 165.596 137.629 154.979 1.00 130.13 ? 433 LYS B CG    1 
ATOM   4246  C CD    . LYS B 2 433 ? 164.471 138.358 155.695 1.00 130.13 ? 433 LYS B CD    1 
ATOM   4247  C CE    . LYS B 2 433 ? 165.002 139.303 156.757 1.00 130.13 ? 433 LYS B CE    1 
ATOM   4248  N NZ    . LYS B 2 433 ? 163.901 140.032 157.444 1.00 130.13 ? 433 LYS B NZ    1 
ATOM   4249  N N     . GLN B 2 434 ? 164.830 135.280 151.131 1.00 134.92 ? 434 GLN B N     1 
ATOM   4250  C CA    . GLN B 2 434 ? 164.078 134.338 150.314 1.00 134.92 ? 434 GLN B CA    1 
ATOM   4251  C C     . GLN B 2 434 ? 164.974 133.335 149.602 1.00 134.92 ? 434 GLN B C     1 
ATOM   4252  O O     . GLN B 2 434 ? 164.475 132.311 149.125 1.00 134.92 ? 434 GLN B O     1 
ATOM   4253  C CB    . GLN B 2 434 ? 163.225 135.094 149.295 1.00 134.92 ? 434 GLN B CB    1 
ATOM   4254  C CG    . GLN B 2 434 ? 162.123 135.929 149.926 1.00 134.92 ? 434 GLN B CG    1 
ATOM   4255  C CD    . GLN B 2 434 ? 161.301 136.686 148.902 1.00 134.92 ? 434 GLN B CD    1 
ATOM   4256  O OE1   . GLN B 2 434 ? 161.576 136.632 147.704 1.00 134.92 ? 434 GLN B OE1   1 
ATOM   4257  N NE2   . GLN B 2 434 ? 160.287 137.403 149.372 1.00 134.92 ? 434 GLN B NE2   1 
ATOM   4258  N N     . GLY B 2 435 ? 166.276 133.597 149.520 1.00 135.80 ? 435 GLY B N     1 
ATOM   4259  C CA    . GLY B 2 435 ? 167.162 132.685 148.826 1.00 135.80 ? 435 GLY B CA    1 
ATOM   4260  C C     . GLY B 2 435 ? 168.148 131.947 149.709 1.00 135.80 ? 435 GLY B C     1 
ATOM   4261  O O     . GLY B 2 435 ? 168.820 131.020 149.249 1.00 135.80 ? 435 GLY B O     1 
ATOM   4262  N N     . ARG B 2 436 ? 168.238 132.335 150.978 1.00 131.40 ? 436 ARG B N     1 
ATOM   4263  C CA    . ARG B 2 436 ? 169.239 131.763 151.865 1.00 131.40 ? 436 ARG B CA    1 
ATOM   4264  C C     . ARG B 2 436 ? 168.864 130.336 152.252 1.00 131.40 ? 436 ARG B C     1 
ATOM   4265  O O     . ARG B 2 436 ? 167.885 129.760 151.771 1.00 131.40 ? 436 ARG B O     1 
ATOM   4266  C CB    . ARG B 2 436 ? 169.393 132.610 153.124 1.00 131.40 ? 436 ARG B CB    1 
ATOM   4267  C CG    . ARG B 2 436 ? 168.171 132.584 154.028 1.00 131.40 ? 436 ARG B CG    1 
ATOM   4268  C CD    . ARG B 2 436 ? 168.431 133.333 155.318 1.00 131.40 ? 436 ARG B CD    1 
ATOM   4269  N NE    . ARG B 2 436 ? 167.244 133.418 156.161 1.00 131.40 ? 436 ARG B NE    1 
ATOM   4270  C CZ    . ARG B 2 436 ? 166.888 132.493 157.045 1.00 131.40 ? 436 ARG B CZ    1 
ATOM   4271  N NH1   . ARG B 2 436 ? 167.626 131.404 157.201 1.00 131.40 ? 436 ARG B NH1   1 
ATOM   4272  N NH2   . ARG B 2 436 ? 165.792 132.658 157.771 1.00 131.40 ? 436 ARG B NH2   1 
ATOM   4273  N N     . ASN B 2 437 ? 169.668 129.766 153.138 1.00 134.31 ? 437 ASN B N     1 
ATOM   4274  C CA    . ASN B 2 437 ? 169.367 128.502 153.788 1.00 134.31 ? 437 ASN B CA    1 
ATOM   4275  C C     . ASN B 2 437 ? 168.737 128.771 155.149 1.00 134.31 ? 437 ASN B C     1 
ATOM   4276  O O     . ASN B 2 437 ? 168.898 129.844 155.733 1.00 134.31 ? 437 ASN B O     1 
ATOM   4277  C CB    . ASN B 2 437 ? 170.633 127.657 153.942 1.00 134.31 ? 437 ASN B CB    1 
ATOM   4278  C CG    . ASN B 2 437 ? 170.342 126.249 154.415 1.00 134.31 ? 437 ASN B CG    1 
ATOM   4279  O OD1   . ASN B 2 437 ? 169.191 125.887 154.655 1.00 134.31 ? 437 ASN B OD1   1 
ATOM   4280  N ND2   . ASN B 2 437 ? 171.388 125.445 154.553 1.00 134.31 ? 437 ASN B ND2   1 
ATOM   4281  N N     . ARG B 2 438 ? 168.003 127.778 155.647 1.00 141.20 ? 438 ARG B N     1 
ATOM   4282  C CA    . ARG B 2 438 ? 167.326 127.884 156.931 1.00 141.20 ? 438 ARG B CA    1 
ATOM   4283  C C     . ARG B 2 438 ? 167.937 126.971 157.985 1.00 141.20 ? 438 ARG B C     1 
ATOM   4284  O O     . ARG B 2 438 ? 167.241 126.546 158.911 1.00 141.20 ? 438 ARG B O     1 
ATOM   4285  C CB    . ARG B 2 438 ? 165.837 127.584 156.768 1.00 141.20 ? 438 ARG B CB    1 
ATOM   4286  C CG    . ARG B 2 438 ? 165.093 128.639 155.981 1.00 141.20 ? 438 ARG B CG    1 
ATOM   4287  C CD    . ARG B 2 438 ? 163.627 128.290 155.842 1.00 141.20 ? 438 ARG B CD    1 
ATOM   4288  N NE    . ARG B 2 438 ? 162.913 129.292 155.060 1.00 141.20 ? 438 ARG B NE    1 
ATOM   4289  C CZ    . ARG B 2 438 ? 161.633 129.198 154.717 1.00 141.20 ? 438 ARG B CZ    1 
ATOM   4290  N NH1   . ARG B 2 438 ? 161.065 130.159 154.002 1.00 141.20 ? 438 ARG B NH1   1 
ATOM   4291  N NH2   . ARG B 2 438 ? 160.923 128.140 155.085 1.00 141.20 ? 438 ARG B NH2   1 
ATOM   4292  N N     . LYS B 2 439 ? 169.222 126.658 157.862 1.00 141.01 ? 439 LYS B N     1 
ATOM   4293  C CA    . LYS B 2 439 ? 169.899 125.787 158.810 1.00 141.01 ? 439 LYS B CA    1 
ATOM   4294  C C     . LYS B 2 439 ? 170.991 126.498 159.592 1.00 141.01 ? 439 LYS B C     1 
ATOM   4295  O O     . LYS B 2 439 ? 170.988 126.470 160.826 1.00 141.01 ? 439 LYS B O     1 
ATOM   4296  C CB    . LYS B 2 439 ? 170.490 124.577 158.076 1.00 141.01 ? 439 LYS B CB    1 
ATOM   4297  C CG    . LYS B 2 439 ? 171.164 123.576 158.989 1.00 141.01 ? 439 LYS B CG    1 
ATOM   4298  C CD    . LYS B 2 439 ? 171.619 122.352 158.218 1.00 141.01 ? 439 LYS B CD    1 
ATOM   4299  C CE    . LYS B 2 439 ? 172.416 121.415 159.107 1.00 141.01 ? 439 LYS B CE    1 
ATOM   4300  N NZ    . LYS B 2 439 ? 171.570 120.845 160.189 1.00 141.01 ? 439 LYS B NZ    1 
ATOM   4301  N N     . ASN B 2 440 ? 171.936 127.131 158.903 1.00 130.61 ? 440 ASN B N     1 
ATOM   4302  C CA    . ASN B 2 440 ? 173.071 127.780 159.547 1.00 130.61 ? 440 ASN B CA    1 
ATOM   4303  C C     . ASN B 2 440 ? 173.377 129.117 158.885 1.00 130.61 ? 440 ASN B C     1 
ATOM   4304  O O     . ASN B 2 440 ? 174.537 129.451 158.624 1.00 130.61 ? 440 ASN B O     1 
ATOM   4305  C CB    . ASN B 2 440 ? 174.296 126.867 159.536 1.00 130.61 ? 440 ASN B CB    1 
ATOM   4306  C CG    . ASN B 2 440 ? 174.674 126.415 158.142 1.00 130.61 ? 440 ASN B CG    1 
ATOM   4307  O OD1   . ASN B 2 440 ? 174.075 126.836 157.155 1.00 130.61 ? 440 ASN B OD1   1 
ATOM   4308  N ND2   . ASN B 2 440 ? 175.676 125.551 158.054 1.00 130.61 ? 440 ASN B ND2   1 
ATOM   4309  N N     . GLN B 2 441 ? 172.341 129.904 158.606 1.00 133.12 ? 441 GLN B N     1 
ATOM   4310  C CA    . GLN B 2 441 ? 172.502 131.191 157.947 1.00 133.12 ? 441 GLN B CA    1 
ATOM   4311  C C     . GLN B 2 441 ? 171.790 132.270 158.748 1.00 133.12 ? 441 GLN B C     1 
ATOM   4312  O O     . GLN B 2 441 ? 170.784 132.010 159.412 1.00 133.12 ? 441 GLN B O     1 
ATOM   4313  C CB    . GLN B 2 441 ? 171.952 131.156 156.520 1.00 133.12 ? 441 GLN B CB    1 
ATOM   4314  C CG    . GLN B 2 441 ? 172.636 130.145 155.619 1.00 133.12 ? 441 GLN B CG    1 
ATOM   4315  C CD    . GLN B 2 441 ? 174.089 130.479 155.358 1.00 133.12 ? 441 GLN B CD    1 
ATOM   4316  O OE1   . GLN B 2 441 ? 174.450 131.643 155.200 1.00 133.12 ? 441 GLN B OE1   1 
ATOM   4317  N NE2   . GLN B 2 441 ? 174.931 129.456 155.306 1.00 133.12 ? 441 GLN B NE2   1 
ATOM   4318  N N     . ALA B 2 442 ? 172.320 133.488 158.679 1.00 125.55 ? 442 ALA B N     1 
ATOM   4319  C CA    . ALA B 2 442 ? 171.728 134.612 159.387 1.00 125.55 ? 442 ALA B CA    1 
ATOM   4320  C C     . ALA B 2 442 ? 171.956 135.884 158.587 1.00 125.55 ? 442 ALA B C     1 
ATOM   4321  O O     . ALA B 2 442 ? 172.956 136.016 157.876 1.00 125.55 ? 442 ALA B O     1 
ATOM   4322  C CB    . ALA B 2 442 ? 172.307 134.757 160.798 1.00 125.55 ? 442 ALA B CB    1 
ATOM   4323  N N     . ILE B 2 443 ? 171.019 136.821 158.712 1.00 120.11 ? 443 ILE B N     1 
ATOM   4324  C CA    . ILE B 2 443 ? 171.033 138.065 157.953 1.00 120.11 ? 443 ILE B CA    1 
ATOM   4325  C C     . ILE B 2 443 ? 170.719 139.218 158.894 1.00 120.11 ? 443 ILE B C     1 
ATOM   4326  O O     . ILE B 2 443 ? 169.783 139.132 159.696 1.00 120.11 ? 443 ILE B O     1 
ATOM   4327  C CB    . ILE B 2 443 ? 170.020 138.035 156.795 1.00 120.11 ? 443 ILE B CB    1 
ATOM   4328  C CG1   . ILE B 2 443 ? 170.408 136.969 155.775 1.00 120.11 ? 443 ILE B CG1   1 
ATOM   4329  C CG2   . ILE B 2 443 ? 169.917 139.396 156.135 1.00 120.11 ? 443 ILE B CG2   1 
ATOM   4330  C CD1   . ILE B 2 443 ? 169.337 136.710 154.763 1.00 120.11 ? 443 ILE B CD1   1 
ATOM   4331  N N     . LEU B 2 444 ? 171.494 140.291 158.792 1.00 111.49 ? 444 LEU B N     1 
ATOM   4332  C CA    . LEU B 2 444 ? 171.229 141.525 159.529 1.00 111.49 ? 444 LEU B CA    1 
ATOM   4333  C C     . LEU B 2 444 ? 171.218 142.692 158.555 1.00 111.49 ? 444 LEU B C     1 
ATOM   4334  O O     . LEU B 2 444 ? 172.300 143.168 158.152 1.00 111.49 ? 444 LEU B O     1 
ATOM   4335  C CB    . LEU B 2 444 ? 172.260 141.753 160.628 1.00 111.49 ? 444 LEU B CB    1 
ATOM   4336  C CG    . LEU B 2 444 ? 172.034 143.040 161.420 1.00 111.49 ? 444 LEU B CG    1 
ATOM   4337  C CD1   . LEU B 2 444 ? 170.681 143.010 162.103 1.00 111.49 ? 444 LEU B CD1   1 
ATOM   4338  C CD2   . LEU B 2 444 ? 173.142 143.246 162.434 1.00 111.49 ? 444 LEU B CD2   1 
ATOM   4339  N N     . PRO B 2 445 ? 170.050 143.173 158.148 1.00 107.90 ? 445 PRO B N     1 
ATOM   4340  C CA    . PRO B 2 445 ? 169.992 144.338 157.260 1.00 107.90 ? 445 PRO B CA    1 
ATOM   4341  C C     . PRO B 2 445 ? 170.540 145.586 157.937 1.00 107.90 ? 445 PRO B C     1 
ATOM   4342  O O     . PRO B 2 445 ? 170.747 145.640 159.150 1.00 107.90 ? 445 PRO B O     1 
ATOM   4343  C CB    . PRO B 2 445 ? 168.498 144.473 156.963 1.00 107.90 ? 445 PRO B CB    1 
ATOM   4344  C CG    . PRO B 2 445 ? 167.945 143.108 157.183 1.00 107.90 ? 445 PRO B CG    1 
ATOM   4345  C CD    . PRO B 2 445 ? 168.731 142.548 158.325 1.00 107.90 ? 445 PRO B CD    1 
ATOM   4346  N N     . LEU B 2 446 ? 170.773 146.611 157.118 1.00 110.74 ? 446 LEU B N     1 
ATOM   4347  C CA    . LEU B 2 446 ? 171.293 147.886 157.591 1.00 110.74 ? 446 LEU B CA    1 
ATOM   4348  C C     . LEU B 2 446 ? 170.515 149.021 156.945 1.00 110.74 ? 446 LEU B C     1 
ATOM   4349  O O     . LEU B 2 446 ? 169.765 148.822 155.988 1.00 110.74 ? 446 LEU B O     1 
ATOM   4350  C CB    . LEU B 2 446 ? 172.787 148.042 157.291 1.00 110.74 ? 446 LEU B CB    1 
ATOM   4351  C CG    . LEU B 2 446 ? 173.725 147.113 158.056 1.00 110.74 ? 446 LEU B CG    1 
ATOM   4352  C CD1   . LEU B 2 446 ? 175.152 147.292 157.575 1.00 110.74 ? 446 LEU B CD1   1 
ATOM   4353  C CD2   . LEU B 2 446 ? 173.620 147.376 159.547 1.00 110.74 ? 446 LEU B CD2   1 
ATOM   4354  N N     . LYS B 2 447 ? 170.704 150.224 157.481 1.00 109.87 ? 447 LYS B N     1 
ATOM   4355  C CA    . LYS B 2 447 ? 169.998 151.414 157.020 1.00 109.87 ? 447 LYS B CA    1 
ATOM   4356  C C     . LYS B 2 447 ? 171.011 152.475 156.608 1.00 109.87 ? 447 LYS B C     1 
ATOM   4357  O O     . LYS B 2 447 ? 171.681 153.065 157.462 1.00 109.87 ? 447 LYS B O     1 
ATOM   4358  C CB    . LYS B 2 447 ? 169.070 151.949 158.107 1.00 109.87 ? 447 LYS B CB    1 
ATOM   4359  C CG    . LYS B 2 447 ? 167.860 151.081 158.385 1.00 109.87 ? 447 LYS B CG    1 
ATOM   4360  C CD    . LYS B 2 447 ? 167.068 151.635 159.554 1.00 109.87 ? 447 LYS B CD    1 
ATOM   4361  C CE    . LYS B 2 447 ? 166.397 152.945 159.180 1.00 109.87 ? 447 LYS B CE    1 
ATOM   4362  N NZ    . LYS B 2 447 ? 165.533 153.463 160.275 1.00 109.87 ? 447 LYS B NZ    1 
ATOM   4363  N N     . GLY B 2 448 ? 171.115 152.718 155.306 1.00 106.29 ? 448 GLY B N     1 
ATOM   4364  C CA    . GLY B 2 448 ? 171.909 153.841 154.828 1.00 106.29 ? 448 GLY B CA    1 
ATOM   4365  C C     . GLY B 2 448 ? 173.378 153.683 155.160 1.00 106.29 ? 448 GLY B C     1 
ATOM   4366  O O     . GLY B 2 448 ? 173.995 152.649 154.883 1.00 106.29 ? 448 GLY B O     1 
ATOM   4367  N N     . LYS B 2 449 ? 173.951 154.720 155.759 1.00 93.40  ? 449 LYS B N     1 
ATOM   4368  C CA    . LYS B 2 449 ? 175.359 154.763 156.113 1.00 93.40  ? 449 LYS B CA    1 
ATOM   4369  C C     . LYS B 2 449 ? 175.512 154.782 157.631 1.00 93.40  ? 449 LYS B C     1 
ATOM   4370  O O     . LYS B 2 449 ? 174.533 154.752 158.381 1.00 93.40  ? 449 LYS B O     1 
ATOM   4371  C CB    . LYS B 2 449 ? 176.029 155.978 155.471 1.00 93.40  ? 449 LYS B CB    1 
ATOM   4372  C CG    . LYS B 2 449 ? 176.080 155.911 153.959 1.00 93.40  ? 449 LYS B CG    1 
ATOM   4373  C CD    . LYS B 2 449 ? 176.774 157.125 153.373 1.00 93.40  ? 449 LYS B CD    1 
ATOM   4374  C CE    . LYS B 2 449 ? 176.804 157.058 151.858 1.00 93.40  ? 449 LYS B CE    1 
ATOM   4375  N NZ    . LYS B 2 449 ? 177.474 158.244 151.264 1.00 93.40  ? 449 LYS B NZ    1 
ATOM   4376  N N     . ILE B 2 450 ? 176.762 154.830 158.084 1.00 95.31  ? 450 ILE B N     1 
ATOM   4377  C CA    . ILE B 2 450 ? 177.091 154.783 159.502 1.00 95.31  ? 450 ILE B CA    1 
ATOM   4378  C C     . ILE B 2 450 ? 178.149 155.837 159.795 1.00 95.31  ? 450 ILE B C     1 
ATOM   4379  O O     . ILE B 2 450 ? 179.049 156.068 158.982 1.00 95.31  ? 450 ILE B O     1 
ATOM   4380  C CB    . ILE B 2 450 ? 177.582 153.380 159.916 1.00 95.31  ? 450 ILE B CB    1 
ATOM   4381  C CG1   . ILE B 2 450 ? 176.472 152.352 159.713 1.00 95.31  ? 450 ILE B CG1   1 
ATOM   4382  C CG2   . ILE B 2 450 ? 178.041 153.363 161.363 1.00 95.31  ? 450 ILE B CG2   1 
ATOM   4383  C CD1   . ILE B 2 450 ? 176.937 150.927 159.843 1.00 95.31  ? 450 ILE B CD1   1 
ATOM   4384  N N     . LEU B 2 451 ? 178.036 156.479 160.955 1.00 104.29 ? 451 LEU B N     1 
ATOM   4385  C CA    . LEU B 2 451 ? 178.981 157.516 161.340 1.00 104.29 ? 451 LEU B CA    1 
ATOM   4386  C C     . LEU B 2 451 ? 180.372 156.937 161.583 1.00 104.29 ? 451 LEU B C     1 
ATOM   4387  O O     . LEU B 2 451 ? 180.529 155.790 162.012 1.00 104.29 ? 451 LEU B O     1 
ATOM   4388  C CB    . LEU B 2 451 ? 178.473 158.244 162.586 1.00 104.29 ? 451 LEU B CB    1 
ATOM   4389  C CG    . LEU B 2 451 ? 178.137 157.405 163.823 1.00 104.29 ? 451 LEU B CG    1 
ATOM   4390  C CD1   . LEU B 2 451 ? 179.345 157.185 164.720 1.00 104.29 ? 451 LEU B CD1   1 
ATOM   4391  C CD2   . LEU B 2 451 ? 176.997 158.046 164.599 1.00 104.29 ? 451 LEU B CD2   1 
ATOM   4392  N N     . ASN B 2 452 ? 181.389 157.750 161.305 1.00 110.83 ? 452 ASN B N     1 
ATOM   4393  C CA    . ASN B 2 452 ? 182.769 157.332 161.508 1.00 110.83 ? 452 ASN B CA    1 
ATOM   4394  C C     . ASN B 2 452 ? 183.072 157.152 162.987 1.00 110.83 ? 452 ASN B C     1 
ATOM   4395  O O     . ASN B 2 452 ? 182.375 157.675 163.859 1.00 110.83 ? 452 ASN B O     1 
ATOM   4396  C CB    . ASN B 2 452 ? 183.740 158.355 160.924 1.00 110.83 ? 452 ASN B CB    1 
ATOM   4397  C CG    . ASN B 2 452 ? 183.649 158.450 159.426 1.00 110.83 ? 452 ASN B CG    1 
ATOM   4398  O OD1   . ASN B 2 452 ? 183.250 159.476 158.884 1.00 110.83 ? 452 ASN B OD1   1 
ATOM   4399  N ND2   . ASN B 2 452 ? 184.023 157.377 158.742 1.00 110.83 ? 452 ASN B ND2   1 
ATOM   4400  N N     . VAL B 2 453 ? 184.137 156.404 163.264 1.00 117.23 ? 453 VAL B N     1 
ATOM   4401  C CA    . VAL B 2 453 ? 184.586 156.244 164.640 1.00 117.23 ? 453 VAL B CA    1 
ATOM   4402  C C     . VAL B 2 453 ? 185.516 157.382 165.034 1.00 117.23 ? 453 VAL B C     1 
ATOM   4403  O O     . VAL B 2 453 ? 185.463 157.881 166.163 1.00 117.23 ? 453 VAL B O     1 
ATOM   4404  C CB    . VAL B 2 453 ? 185.258 154.873 164.813 1.00 117.23 ? 453 VAL B CB    1 
ATOM   4405  C CG1   . VAL B 2 453 ? 185.780 154.709 166.230 1.00 117.23 ? 453 VAL B CG1   1 
ATOM   4406  C CG2   . VAL B 2 453 ? 184.285 153.766 164.460 1.00 117.23 ? 453 VAL B CG2   1 
ATOM   4407  N N     . GLU B 2 454 ? 186.364 157.823 164.109 1.00 124.82 ? 454 GLU B N     1 
ATOM   4408  C CA    . GLU B 2 454 ? 187.367 158.833 164.413 1.00 124.82 ? 454 GLU B CA    1 
ATOM   4409  C C     . GLU B 2 454 ? 186.846 160.249 164.232 1.00 124.82 ? 454 GLU B C     1 
ATOM   4410  O O     . GLU B 2 454 ? 187.045 161.097 165.107 1.00 124.82 ? 454 GLU B O     1 
ATOM   4411  C CB    . GLU B 2 454 ? 188.592 158.630 163.527 1.00 124.82 ? 454 GLU B CB    1 
ATOM   4412  C CG    . GLU B 2 454 ? 189.338 157.349 163.784 1.00 124.82 ? 454 GLU B CG    1 
ATOM   4413  C CD    . GLU B 2 454 ? 190.491 157.183 162.827 1.00 124.82 ? 454 GLU B CD    1 
ATOM   4414  O OE1   . GLU B 2 454 ? 190.604 158.018 161.907 1.00 124.82 ? 454 GLU B OE1   1 
ATOM   4415  O OE2   . GLU B 2 454 ? 191.276 156.226 162.984 1.00 124.82 ? 454 GLU B OE2   1 
ATOM   4416  N N     . LYS B 2 455 ? 186.186 160.519 163.104 1.00 131.10 ? 455 LYS B N     1 
ATOM   4417  C CA    . LYS B 2 455 ? 185.753 161.878 162.806 1.00 131.10 ? 455 LYS B CA    1 
ATOM   4418  C C     . LYS B 2 455 ? 184.781 162.390 163.861 1.00 131.10 ? 455 LYS B C     1 
ATOM   4419  O O     . LYS B 2 455 ? 184.756 163.588 164.166 1.00 131.10 ? 455 LYS B O     1 
ATOM   4420  C CB    . LYS B 2 455 ? 185.127 161.926 161.413 1.00 131.10 ? 455 LYS B CB    1 
ATOM   4421  C CG    . LYS B 2 455 ? 184.778 163.320 160.925 1.00 131.10 ? 455 LYS B CG    1 
ATOM   4422  C CD    . LYS B 2 455 ? 184.258 163.276 159.499 1.00 131.10 ? 455 LYS B CD    1 
ATOM   4423  C CE    . LYS B 2 455 ? 183.892 164.661 158.998 1.00 131.10 ? 455 LYS B CE    1 
ATOM   4424  N NZ    . LYS B 2 455 ? 183.381 164.617 157.601 1.00 131.10 ? 455 LYS B NZ    1 
ATOM   4425  N N     . ALA B 2 456 ? 183.982 161.496 164.435 1.00 138.97 ? 456 ALA B N     1 
ATOM   4426  C CA    . ALA B 2 456 ? 183.089 161.829 165.540 1.00 138.97 ? 456 ALA B CA    1 
ATOM   4427  C C     . ALA B 2 456 ? 183.197 160.720 166.574 1.00 138.97 ? 456 ALA B C     1 
ATOM   4428  O O     . ALA B 2 456 ? 182.591 159.655 166.411 1.00 138.97 ? 456 ALA B O     1 
ATOM   4429  C CB    . ALA B 2 456 ? 181.648 161.996 165.061 1.00 138.97 ? 456 ALA B CB    1 
ATOM   4430  N N     . ARG B 2 457 ? 183.961 160.964 167.633 1.00 153.91 ? 457 ARG B N     1 
ATOM   4431  C CA    . ARG B 2 457 ? 184.209 159.964 168.663 1.00 153.91 ? 457 ARG B CA    1 
ATOM   4432  C C     . ARG B 2 457 ? 183.513 160.391 169.948 1.00 153.91 ? 457 ARG B C     1 
ATOM   4433  O O     . ARG B 2 457 ? 183.846 161.428 170.532 1.00 153.91 ? 457 ARG B O     1 
ATOM   4434  C CB    . ARG B 2 457 ? 185.715 159.749 168.873 1.00 153.91 ? 457 ARG B CB    1 
ATOM   4435  C CG    . ARG B 2 457 ? 186.481 160.912 169.497 1.00 153.91 ? 457 ARG B CG    1 
ATOM   4436  C CD    . ARG B 2 457 ? 187.012 161.874 168.453 1.00 153.91 ? 457 ARG B CD    1 
ATOM   4437  N NE    . ARG B 2 457 ? 187.797 162.940 169.067 1.00 153.91 ? 457 ARG B NE    1 
ATOM   4438  C CZ    . ARG B 2 457 ? 189.121 162.928 169.171 1.00 153.91 ? 457 ARG B CZ    1 
ATOM   4439  N NH1   . ARG B 2 457 ? 189.817 161.901 168.703 1.00 153.91 ? 457 ARG B NH1   1 
ATOM   4440  N NH2   . ARG B 2 457 ? 189.751 163.944 169.745 1.00 153.91 ? 457 ARG B NH2   1 
ATOM   4441  N N     . PHE B 2 458 ? 182.520 159.610 170.362 1.00 153.43 ? 458 PHE B N     1 
ATOM   4442  C CA    . PHE B 2 458 ? 181.830 159.822 171.626 1.00 153.43 ? 458 PHE B CA    1 
ATOM   4443  C C     . PHE B 2 458 ? 181.263 158.487 172.072 1.00 153.43 ? 458 PHE B C     1 
ATOM   4444  O O     . PHE B 2 458 ? 180.419 157.912 171.379 1.00 153.43 ? 458 PHE B O     1 
ATOM   4445  C CB    . PHE B 2 458 ? 180.705 160.856 171.502 1.00 153.43 ? 458 PHE B CB    1 
ATOM   4446  C CG    . PHE B 2 458 ? 181.183 162.248 171.211 1.00 153.43 ? 458 PHE B CG    1 
ATOM   4447  C CD1   . PHE B 2 458 ? 181.690 163.044 172.223 1.00 153.43 ? 458 PHE B CD1   1 
ATOM   4448  C CD2   . PHE B 2 458 ? 181.126 162.760 169.926 1.00 153.43 ? 458 PHE B CD2   1 
ATOM   4449  C CE1   . PHE B 2 458 ? 182.135 164.326 171.959 1.00 153.43 ? 458 PHE B CE1   1 
ATOM   4450  C CE2   . PHE B 2 458 ? 181.569 164.041 169.656 1.00 153.43 ? 458 PHE B CE2   1 
ATOM   4451  C CZ    . PHE B 2 458 ? 182.074 164.824 170.674 1.00 153.43 ? 458 PHE B CZ    1 
ATOM   4452  N N     . ASP B 2 459 ? 181.727 157.998 173.223 1.00 157.72 ? 459 ASP B N     1 
ATOM   4453  C CA    . ASP B 2 459 ? 181.195 156.750 173.754 1.00 157.72 ? 459 ASP B CA    1 
ATOM   4454  C C     . ASP B 2 459 ? 179.706 156.846 174.050 1.00 157.72 ? 459 ASP B C     1 
ATOM   4455  O O     . ASP B 2 459 ? 179.035 155.813 174.139 1.00 157.72 ? 459 ASP B O     1 
ATOM   4456  C CB    . ASP B 2 459 ? 181.961 156.345 175.011 1.00 157.72 ? 459 ASP B CB    1 
ATOM   4457  C CG    . ASP B 2 459 ? 183.385 155.929 174.710 1.00 157.72 ? 459 ASP B CG    1 
ATOM   4458  O OD1   . ASP B 2 459 ? 183.631 155.420 173.597 1.00 157.72 ? 459 ASP B OD1   1 
ATOM   4459  O OD2   . ASP B 2 459 ? 184.258 156.116 175.582 1.00 157.72 ? 459 ASP B OD2   1 
ATOM   4460  N N     . LYS B 2 460 ? 179.179 158.060 174.199 1.00 158.64 ? 460 LYS B N     1 
ATOM   4461  C CA    . LYS B 2 460 ? 177.743 158.266 174.298 1.00 158.64 ? 460 LYS B CA    1 
ATOM   4462  C C     . LYS B 2 460 ? 177.060 158.302 172.940 1.00 158.64 ? 460 LYS B C     1 
ATOM   4463  O O     . LYS B 2 460 ? 175.867 157.989 172.852 1.00 158.64 ? 460 LYS B O     1 
ATOM   4464  C CB    . LYS B 2 460 ? 177.444 159.570 175.044 1.00 158.64 ? 460 LYS B CB    1 
ATOM   4465  C CG    . LYS B 2 460 ? 177.825 159.550 176.513 1.00 158.64 ? 460 LYS B CG    1 
ATOM   4466  C CD    . LYS B 2 460 ? 177.463 160.861 177.191 1.00 158.64 ? 460 LYS B CD    1 
ATOM   4467  C CE    . LYS B 2 460 ? 177.853 160.847 178.661 1.00 158.64 ? 460 LYS B CE    1 
ATOM   4468  N NZ    . LYS B 2 460 ? 177.510 162.125 179.343 1.00 158.64 ? 460 LYS B NZ    1 
ATOM   4469  N N     . MET B 2 461 ? 177.783 158.672 171.884 1.00 145.00 ? 461 MET B N     1 
ATOM   4470  C CA    . MET B 2 461 ? 177.197 158.753 170.552 1.00 145.00 ? 461 MET B CA    1 
ATOM   4471  C C     . MET B 2 461 ? 176.829 157.354 170.079 1.00 145.00 ? 461 MET B C     1 
ATOM   4472  O O     . MET B 2 461 ? 177.707 156.537 169.785 1.00 145.00 ? 461 MET B O     1 
ATOM   4473  C CB    . MET B 2 461 ? 178.170 159.416 169.584 1.00 145.00 ? 461 MET B CB    1 
ATOM   4474  C CG    . MET B 2 461 ? 177.567 159.737 168.233 1.00 145.00 ? 461 MET B CG    1 
ATOM   4475  S SD    . MET B 2 461 ? 176.288 160.999 168.357 1.00 145.00 ? 461 MET B SD    1 
ATOM   4476  C CE    . MET B 2 461 ? 175.322 160.639 166.896 1.00 145.00 ? 461 MET B CE    1 
ATOM   4477  N N     . LEU B 2 462 ? 175.530 157.075 170.010 1.00 139.11 ? 462 LEU B N     1 
ATOM   4478  C CA    . LEU B 2 462 ? 175.051 155.775 169.562 1.00 139.11 ? 462 LEU B CA    1 
ATOM   4479  C C     . LEU B 2 462 ? 173.633 155.932 169.034 1.00 139.11 ? 462 LEU B C     1 
ATOM   4480  O O     . LEU B 2 462 ? 172.783 156.529 169.701 1.00 139.11 ? 462 LEU B O     1 
ATOM   4481  C CB    . LEU B 2 462 ? 175.128 154.744 170.700 1.00 139.11 ? 462 LEU B CB    1 
ATOM   4482  C CG    . LEU B 2 462 ? 174.408 154.983 172.031 1.00 139.11 ? 462 LEU B CG    1 
ATOM   4483  C CD1   . LEU B 2 462 ? 172.987 154.433 172.019 1.00 139.11 ? 462 LEU B CD1   1 
ATOM   4484  C CD2   . LEU B 2 462 ? 175.214 154.386 173.176 1.00 139.11 ? 462 LEU B CD2   1 
ATOM   4485  N N     . SER B 2 463 ? 173.397 155.432 167.823 1.00 142.30 ? 463 SER B N     1 
ATOM   4486  C CA    . SER B 2 463 ? 172.085 155.512 167.191 1.00 142.30 ? 463 SER B CA    1 
ATOM   4487  C C     . SER B 2 463 ? 171.480 154.135 166.965 1.00 142.30 ? 463 SER B C     1 
ATOM   4488  O O     . SER B 2 463 ? 170.357 153.879 167.412 1.00 142.30 ? 463 SER B O     1 
ATOM   4489  C CB    . SER B 2 463 ? 172.191 156.276 165.867 1.00 142.30 ? 463 SER B CB    1 
ATOM   4490  O OG    . SER B 2 463 ? 172.972 155.552 164.933 1.00 142.30 ? 463 SER B OG    1 
ATOM   4491  N N     . SER B 2 464 ? 172.191 153.238 166.282 1.00 143.09 ? 464 SER B N     1 
ATOM   4492  C CA    . SER B 2 464 ? 171.677 151.900 166.012 1.00 143.09 ? 464 SER B CA    1 
ATOM   4493  C C     . SER B 2 464 ? 172.133 150.899 167.072 1.00 143.09 ? 464 SER B C     1 
ATOM   4494  O O     . SER B 2 464 ? 171.305 150.313 167.776 1.00 143.09 ? 464 SER B O     1 
ATOM   4495  C CB    . SER B 2 464 ? 172.116 151.442 164.617 1.00 143.09 ? 464 SER B CB    1 
ATOM   4496  O OG    . SER B 2 464 ? 173.523 151.284 164.554 1.00 143.09 ? 464 SER B OG    1 
ATOM   4497  N N     . GLN B 2 465 ? 173.444 150.684 167.181 1.00 154.46 ? 465 GLN B N     1 
ATOM   4498  C CA    . GLN B 2 465 ? 174.062 149.804 168.170 1.00 154.46 ? 465 GLN B CA    1 
ATOM   4499  C C     . GLN B 2 465 ? 173.608 148.352 168.023 1.00 154.46 ? 465 GLN B C     1 
ATOM   4500  O O     . GLN B 2 465 ? 174.060 147.477 168.778 1.00 154.46 ? 465 GLN B O     1 
ATOM   4501  C CB    . GLN B 2 465 ? 173.794 150.316 169.595 1.00 154.46 ? 465 GLN B CB    1 
ATOM   4502  C CG    . GLN B 2 465 ? 174.610 149.666 170.702 1.00 154.46 ? 465 GLN B CG    1 
ATOM   4503  C CD    . GLN B 2 465 ? 174.318 150.263 172.065 1.00 154.46 ? 465 GLN B CD    1 
ATOM   4504  O OE1   . GLN B 2 465 ? 173.467 151.142 172.200 1.00 154.46 ? 465 GLN B OE1   1 
ATOM   4505  N NE2   . GLN B 2 465 ? 175.025 149.787 173.084 1.00 154.46 ? 465 GLN B NE2   1 
ATOM   4506  N N     . GLU B 2 466 ? 172.749 148.066 167.042 1.00 147.45 ? 466 GLU B N     1 
ATOM   4507  C CA    . GLU B 2 466 ? 172.229 146.715 166.877 1.00 147.45 ? 466 GLU B CA    1 
ATOM   4508  C C     . GLU B 2 466 ? 173.342 145.741 166.531 1.00 147.45 ? 466 GLU B C     1 
ATOM   4509  O O     . GLU B 2 466 ? 173.309 144.578 166.947 1.00 147.45 ? 466 GLU B O     1 
ATOM   4510  C CB    . GLU B 2 466 ? 171.147 146.701 165.800 1.00 147.45 ? 466 GLU B CB    1 
ATOM   4511  C CG    . GLU B 2 466 ? 169.907 147.490 166.173 1.00 147.45 ? 466 GLU B CG    1 
ATOM   4512  C CD    . GLU B 2 466 ? 168.871 147.500 165.070 1.00 147.45 ? 466 GLU B CD    1 
ATOM   4513  O OE1   . GLU B 2 466 ? 169.174 147.010 163.962 1.00 147.45 ? 466 GLU B OE1   1 
ATOM   4514  O OE2   . GLU B 2 466 ? 167.751 147.997 165.311 1.00 147.45 ? 466 GLU B OE2   1 
ATOM   4515  N N     . VAL B 2 467 ? 174.342 146.203 165.778 1.00 148.75 ? 467 VAL B N     1 
ATOM   4516  C CA    . VAL B 2 467 ? 175.476 145.350 165.438 1.00 148.75 ? 467 VAL B CA    1 
ATOM   4517  C C     . VAL B 2 467 ? 176.123 144.798 166.699 1.00 148.75 ? 467 VAL B C     1 
ATOM   4518  O O     . VAL B 2 467 ? 176.233 143.578 166.873 1.00 148.75 ? 467 VAL B O     1 
ATOM   4519  C CB    . VAL B 2 467 ? 176.489 146.128 164.580 1.00 148.75 ? 467 VAL B CB    1 
ATOM   4520  C CG1   . VAL B 2 467 ? 177.728 145.289 164.339 1.00 148.75 ? 467 VAL B CG1   1 
ATOM   4521  C CG2   . VAL B 2 467 ? 175.858 146.542 163.265 1.00 148.75 ? 467 VAL B CG2   1 
ATOM   4522  N N     . ALA B 2 468 ? 176.551 145.686 167.599 1.00 155.36 ? 468 ALA B N     1 
ATOM   4523  C CA    . ALA B 2 468 ? 177.184 145.244 168.837 1.00 155.36 ? 468 ALA B CA    1 
ATOM   4524  C C     . ALA B 2 468 ? 176.227 144.415 169.679 1.00 155.36 ? 468 ALA B C     1 
ATOM   4525  O O     . ALA B 2 468 ? 176.595 143.341 170.174 1.00 155.36 ? 468 ALA B O     1 
ATOM   4526  C CB    . ALA B 2 468 ? 177.687 146.451 169.628 1.00 155.36 ? 468 ALA B CB    1 
ATOM   4527  N N     . THR B 2 469 ? 174.989 144.893 169.836 1.00 156.44 ? 469 THR B N     1 
ATOM   4528  C CA    . THR B 2 469 ? 174.016 144.202 170.678 1.00 156.44 ? 469 THR B CA    1 
ATOM   4529  C C     . THR B 2 469 ? 173.806 142.765 170.218 1.00 156.44 ? 469 THR B C     1 
ATOM   4530  O O     . THR B 2 469 ? 173.612 141.861 171.039 1.00 156.44 ? 469 THR B O     1 
ATOM   4531  C CB    . THR B 2 469 ? 172.692 144.966 170.676 1.00 156.44 ? 469 THR B CB    1 
ATOM   4532  O OG1   . THR B 2 469 ? 172.907 146.293 171.169 1.00 156.44 ? 469 THR B OG1   1 
ATOM   4533  C CG2   . THR B 2 469 ? 171.665 144.269 171.556 1.00 156.44 ? 469 THR B CG2   1 
ATOM   4534  N N     . LEU B 2 470 ? 173.854 142.529 168.908 1.00 151.07 ? 470 LEU B N     1 
ATOM   4535  C CA    . LEU B 2 470 ? 173.586 141.188 168.407 1.00 151.07 ? 470 LEU B CA    1 
ATOM   4536  C C     . LEU B 2 470 ? 174.852 140.346 168.348 1.00 151.07 ? 470 LEU B C     1 
ATOM   4537  O O     . LEU B 2 470 ? 174.787 139.117 168.462 1.00 151.07 ? 470 LEU B O     1 
ATOM   4538  C CB    . LEU B 2 470 ? 172.927 141.265 167.034 1.00 151.07 ? 470 LEU B CB    1 
ATOM   4539  C CG    . LEU B 2 470 ? 171.542 141.905 167.073 1.00 151.07 ? 470 LEU B CG    1 
ATOM   4540  C CD1   . LEU B 2 470 ? 170.942 142.010 165.680 1.00 151.07 ? 470 LEU B CD1   1 
ATOM   4541  C CD2   . LEU B 2 470 ? 170.642 141.121 168.004 1.00 151.07 ? 470 LEU B CD2   1 
ATOM   4542  N N     . ILE B 2 471 ? 176.015 140.976 168.172 1.00 155.20 ? 471 ILE B N     1 
ATOM   4543  C CA    . ILE B 2 471 ? 177.226 140.182 168.001 1.00 155.20 ? 471 ILE B CA    1 
ATOM   4544  C C     . ILE B 2 471 ? 177.761 139.712 169.352 1.00 155.20 ? 471 ILE B C     1 
ATOM   4545  O O     . ILE B 2 471 ? 177.986 138.513 169.556 1.00 155.20 ? 471 ILE B O     1 
ATOM   4546  C CB    . ILE B 2 471 ? 178.277 140.955 167.175 1.00 155.20 ? 471 ILE B CB    1 
ATOM   4547  C CG1   . ILE B 2 471 ? 179.425 140.032 166.769 1.00 155.20 ? 471 ILE B CG1   1 
ATOM   4548  C CG2   . ILE B 2 471 ? 178.814 142.182 167.900 1.00 155.20 ? 471 ILE B CG2   1 
ATOM   4549  C CD1   . ILE B 2 471 ? 180.316 140.617 165.699 1.00 155.20 ? 471 ILE B CD1   1 
ATOM   4550  N N     . THR B 2 472 ? 177.944 140.626 170.300 1.00 164.62 ? 472 THR B N     1 
ATOM   4551  C CA    . THR B 2 472 ? 178.550 140.302 171.595 1.00 164.62 ? 472 THR B CA    1 
ATOM   4552  C C     . THR B 2 472 ? 177.934 141.217 172.646 1.00 164.62 ? 472 THR B C     1 
ATOM   4553  O O     . THR B 2 472 ? 176.873 141.814 172.431 1.00 164.62 ? 472 THR B O     1 
ATOM   4554  C CB    . THR B 2 472 ? 180.077 140.449 171.580 1.00 164.62 ? 472 THR B CB    1 
ATOM   4555  O OG1   . THR B 2 472 ? 180.434 141.775 171.167 1.00 164.62 ? 472 THR B OG1   1 
ATOM   4556  C CG2   . THR B 2 472 ? 180.748 139.419 170.676 1.00 164.62 ? 472 THR B CG2   1 
ATOM   4557  N N     . ALA B 2 473 ? 178.596 141.310 173.799 1.00 172.98 ? 473 ALA B N     1 
ATOM   4558  C CA    . ALA B 2 473 ? 178.209 142.258 174.833 1.00 172.98 ? 473 ALA B CA    1 
ATOM   4559  C C     . ALA B 2 473 ? 179.035 143.537 174.798 1.00 172.98 ? 473 ALA B C     1 
ATOM   4560  O O     . ALA B 2 473 ? 178.738 144.462 175.561 1.00 172.98 ? 473 ALA B O     1 
ATOM   4561  C CB    . ALA B 2 473 ? 178.325 141.609 176.214 1.00 172.98 ? 473 ALA B CB    1 
ATOM   4562  N N     . LEU B 2 474 ? 180.051 143.603 173.940 1.00 167.69 ? 474 LEU B N     1 
ATOM   4563  C CA    . LEU B 2 474 ? 180.910 144.780 173.796 1.00 167.69 ? 474 LEU B CA    1 
ATOM   4564  C C     . LEU B 2 474 ? 181.552 145.191 175.119 1.00 167.69 ? 474 LEU B C     1 
ATOM   4565  O O     . LEU B 2 474 ? 181.028 146.035 175.848 1.00 167.69 ? 474 LEU B O     1 
ATOM   4566  C CB    . LEU B 2 474 ? 180.121 145.952 173.208 1.00 167.69 ? 474 LEU B CB    1 
ATOM   4567  C CG    . LEU B 2 474 ? 180.910 147.234 172.939 1.00 167.69 ? 474 LEU B CG    1 
ATOM   4568  C CD1   . LEU B 2 474 ? 182.012 146.982 171.926 1.00 167.69 ? 474 LEU B CD1   1 
ATOM   4569  C CD2   . LEU B 2 474 ? 179.983 148.340 172.463 1.00 167.69 ? 474 LEU B CD2   1 
ATOM   4570  N N     . TYR B 2 483 ? 186.144 142.404 177.241 1.00 161.90 ? 483 TYR B N     1 
ATOM   4571  C CA    . TYR B 2 483 ? 184.707 142.225 177.078 1.00 161.90 ? 483 TYR B CA    1 
ATOM   4572  C C     . TYR B 2 483 ? 184.359 141.108 176.104 1.00 161.90 ? 483 TYR B C     1 
ATOM   4573  O O     . TYR B 2 483 ? 183.570 140.220 176.421 1.00 161.90 ? 483 TYR B O     1 
ATOM   4574  C CB    . TYR B 2 483 ? 184.064 143.523 176.605 1.00 161.90 ? 483 TYR B CB    1 
ATOM   4575  C CG    . TYR B 2 483 ? 184.049 144.612 177.645 1.00 161.90 ? 483 TYR B CG    1 
ATOM   4576  C CD1   . TYR B 2 483 ? 183.086 144.631 178.646 1.00 161.90 ? 483 TYR B CD1   1 
ATOM   4577  C CD2   . TYR B 2 483 ? 184.996 145.626 177.627 1.00 161.90 ? 483 TYR B CD2   1 
ATOM   4578  C CE1   . TYR B 2 483 ? 183.068 145.629 179.599 1.00 161.90 ? 483 TYR B CE1   1 
ATOM   4579  C CE2   . TYR B 2 483 ? 184.985 146.626 178.576 1.00 161.90 ? 483 TYR B CE2   1 
ATOM   4580  C CZ    . TYR B 2 483 ? 184.020 146.624 179.559 1.00 161.90 ? 483 TYR B CZ    1 
ATOM   4581  O OH    . TYR B 2 483 ? 184.012 147.623 180.505 1.00 161.90 ? 483 TYR B OH    1 
ATOM   4582  N N     . ASN B 2 484 ? 184.947 141.156 174.913 1.00 160.64 ? 484 ASN B N     1 
ATOM   4583  C CA    . ASN B 2 484 ? 184.609 140.208 173.858 1.00 160.64 ? 484 ASN B CA    1 
ATOM   4584  C C     . ASN B 2 484 ? 184.984 138.737 174.086 1.00 160.64 ? 484 ASN B C     1 
ATOM   4585  O O     . ASN B 2 484 ? 184.321 137.876 173.497 1.00 160.64 ? 484 ASN B O     1 
ATOM   4586  C CB    . ASN B 2 484 ? 185.170 140.698 172.517 1.00 160.64 ? 484 ASN B CB    1 
ATOM   4587  C CG    . ASN B 2 484 ? 186.629 141.110 172.585 1.00 160.64 ? 484 ASN B CG    1 
ATOM   4588  O OD1   . ASN B 2 484 ? 187.268 141.027 173.626 1.00 160.64 ? 484 ASN B OD1   1 
ATOM   4589  N ND2   . ASN B 2 484 ? 187.162 141.561 171.458 1.00 160.64 ? 484 ASN B ND2   1 
ATOM   4590  N N     . PRO B 2 485 ? 186.002 138.366 174.881 1.00 156.34 ? 485 PRO B N     1 
ATOM   4591  C CA    . PRO B 2 485 ? 186.315 136.929 174.968 1.00 156.34 ? 485 PRO B CA    1 
ATOM   4592  C C     . PRO B 2 485 ? 185.188 136.113 175.567 1.00 156.34 ? 485 PRO B C     1 
ATOM   4593  O O     . PRO B 2 485 ? 185.070 134.923 175.255 1.00 156.34 ? 485 PRO B O     1 
ATOM   4594  C CB    . PRO B 2 485 ? 187.564 136.886 175.865 1.00 156.34 ? 485 PRO B CB    1 
ATOM   4595  C CG    . PRO B 2 485 ? 188.093 138.253 175.865 1.00 156.34 ? 485 PRO B CG    1 
ATOM   4596  C CD    . PRO B 2 485 ? 186.888 139.121 175.786 1.00 156.34 ? 485 PRO B CD    1 
ATOM   4597  N N     . ASP B 2 486 ? 184.360 136.715 176.424 1.00 165.68 ? 486 ASP B N     1 
ATOM   4598  C CA    . ASP B 2 486 ? 183.316 135.963 177.110 1.00 165.68 ? 486 ASP B CA    1 
ATOM   4599  C C     . ASP B 2 486 ? 182.312 135.392 176.117 1.00 165.68 ? 486 ASP B C     1 
ATOM   4600  O O     . ASP B 2 486 ? 182.198 134.172 175.954 1.00 165.68 ? 486 ASP B O     1 
ATOM   4601  C CB    . ASP B 2 486 ? 182.614 136.862 178.128 1.00 165.68 ? 486 ASP B CB    1 
ATOM   4602  C CG    . ASP B 2 486 ? 183.531 137.287 179.255 1.00 165.68 ? 486 ASP B CG    1 
ATOM   4603  O OD1   . ASP B 2 486 ? 184.455 136.516 179.594 1.00 165.68 ? 486 ASP B OD1   1 
ATOM   4604  O OD2   . ASP B 2 486 ? 183.336 138.396 179.797 1.00 165.68 ? 486 ASP B OD2   1 
ATOM   4605  N N     . LYS B 2 487 ? 181.585 136.266 175.432 1.00 160.65 ? 487 LYS B N     1 
ATOM   4606  C CA    . LYS B 2 487 ? 180.588 135.862 174.454 1.00 160.65 ? 487 LYS B CA    1 
ATOM   4607  C C     . LYS B 2 487 ? 181.182 135.951 173.057 1.00 160.65 ? 487 LYS B C     1 
ATOM   4608  O O     . LYS B 2 487 ? 181.764 136.971 172.679 1.00 160.65 ? 487 LYS B O     1 
ATOM   4609  C CB    . LYS B 2 487 ? 179.339 136.735 174.557 1.00 160.65 ? 487 LYS B CB    1 
ATOM   4610  C CG    . LYS B 2 487 ? 178.563 136.529 175.845 1.00 160.65 ? 487 LYS B CG    1 
ATOM   4611  C CD    . LYS B 2 487 ? 177.298 137.369 175.876 1.00 160.65 ? 487 LYS B CD    1 
ATOM   4612  C CE    . LYS B 2 487 ? 176.530 137.155 177.170 1.00 160.65 ? 487 LYS B CE    1 
ATOM   4613  N NZ    . LYS B 2 487 ? 175.286 137.971 177.226 1.00 160.65 ? 487 LYS B NZ    1 
ATOM   4614  N N     . LEU B 2 488 ? 181.021 134.875 172.288 1.00 152.19 ? 488 LEU B N     1 
ATOM   4615  C CA    . LEU B 2 488 ? 181.723 134.724 171.020 1.00 152.19 ? 488 LEU B CA    1 
ATOM   4616  C C     . LEU B 2 488 ? 180.808 134.209 169.917 1.00 152.19 ? 488 LEU B C     1 
ATOM   4617  O O     . LEU B 2 488 ? 181.287 133.556 168.985 1.00 152.19 ? 488 LEU B O     1 
ATOM   4618  C CB    . LEU B 2 488 ? 182.921 133.785 171.191 1.00 152.19 ? 488 LEU B CB    1 
ATOM   4619  C CG    . LEU B 2 488 ? 184.045 134.249 172.121 1.00 152.19 ? 488 LEU B CG    1 
ATOM   4620  C CD1   . LEU B 2 488 ? 185.054 133.136 172.348 1.00 152.19 ? 488 LEU B CD1   1 
ATOM   4621  C CD2   . LEU B 2 488 ? 184.728 135.470 171.542 1.00 152.19 ? 488 LEU B CD2   1 
ATOM   4622  N N     . ARG B 2 489 ? 179.507 134.481 170.006 1.00 147.15 ? 489 ARG B N     1 
ATOM   4623  C CA    . ARG B 2 489 ? 178.568 133.953 169.026 1.00 147.15 ? 489 ARG B CA    1 
ATOM   4624  C C     . ARG B 2 489 ? 178.933 134.411 167.621 1.00 147.15 ? 489 ARG B C     1 
ATOM   4625  O O     . ARG B 2 489 ? 179.548 135.464 167.433 1.00 147.15 ? 489 ARG B O     1 
ATOM   4626  C CB    . ARG B 2 489 ? 177.144 134.390 169.361 1.00 147.15 ? 489 ARG B CB    1 
ATOM   4627  C CG    . ARG B 2 489 ? 176.584 133.750 170.613 1.00 147.15 ? 489 ARG B CG    1 
ATOM   4628  C CD    . ARG B 2 489 ? 175.178 134.240 170.886 1.00 147.15 ? 489 ARG B CD    1 
ATOM   4629  N NE    . ARG B 2 489 ? 175.161 135.653 171.246 1.00 147.15 ? 489 ARG B NE    1 
ATOM   4630  C CZ    . ARG B 2 489 ? 174.054 136.371 171.392 1.00 147.15 ? 489 ARG B CZ    1 
ATOM   4631  N NH1   . ARG B 2 489 ? 174.131 137.652 171.723 1.00 147.15 ? 489 ARG B NH1   1 
ATOM   4632  N NH2   . ARG B 2 489 ? 172.869 135.807 171.204 1.00 147.15 ? 489 ARG B NH2   1 
ATOM   4633  N N     . TYR B 2 490 ? 178.553 133.597 166.635 1.00 132.76 ? 490 TYR B N     1 
ATOM   4634  C CA    . TYR B 2 490 ? 178.827 133.878 165.233 1.00 132.76 ? 490 TYR B CA    1 
ATOM   4635  C C     . TYR B 2 490 ? 180.323 134.026 164.985 1.00 132.76 ? 490 TYR B C     1 
ATOM   4636  O O     . TYR B 2 490 ? 180.795 135.115 164.643 1.00 132.76 ? 490 TYR B O     1 
ATOM   4637  C CB    . TYR B 2 490 ? 178.080 135.135 164.786 1.00 132.76 ? 490 TYR B CB    1 
ATOM   4638  C CG    . TYR B 2 490 ? 176.583 134.973 164.803 1.00 132.76 ? 490 TYR B CG    1 
ATOM   4639  C CD1   . TYR B 2 490 ? 175.921 134.376 163.744 1.00 132.76 ? 490 TYR B CD1   1 
ATOM   4640  C CD2   . TYR B 2 490 ? 175.834 135.402 165.888 1.00 132.76 ? 490 TYR B CD2   1 
ATOM   4641  C CE1   . TYR B 2 490 ? 174.554 134.224 163.758 1.00 132.76 ? 490 TYR B CE1   1 
ATOM   4642  C CE2   . TYR B 2 490 ? 174.467 135.253 165.911 1.00 132.76 ? 490 TYR B CE2   1 
ATOM   4643  C CZ    . TYR B 2 490 ? 173.832 134.663 164.844 1.00 132.76 ? 490 TYR B CZ    1 
ATOM   4644  O OH    . TYR B 2 490 ? 172.467 134.510 164.860 1.00 132.76 ? 490 TYR B OH    1 
ATOM   4645  N N     . HIS B 2 491 ? 181.078 132.939 165.166 1.00 129.15 ? 491 HIS B N     1 
ATOM   4646  C CA    . HIS B 2 491 ? 182.520 132.986 164.948 1.00 129.15 ? 491 HIS B CA    1 
ATOM   4647  C C     . HIS B 2 491 ? 182.892 133.321 163.509 1.00 129.15 ? 491 HIS B C     1 
ATOM   4648  O O     . HIS B 2 491 ? 184.075 133.538 163.226 1.00 129.15 ? 491 HIS B O     1 
ATOM   4649  C CB    . HIS B 2 491 ? 183.164 131.656 165.343 1.00 129.15 ? 491 HIS B CB    1 
ATOM   4650  C CG    . HIS B 2 491 ? 183.247 131.437 166.822 1.00 129.15 ? 491 HIS B CG    1 
ATOM   4651  N ND1   . HIS B 2 491 ? 182.233 130.852 167.549 1.00 129.15 ? 491 HIS B ND1   1 
ATOM   4652  C CD2   . HIS B 2 491 ? 184.232 131.719 167.709 1.00 129.15 ? 491 HIS B CD2   1 
ATOM   4653  C CE1   . HIS B 2 491 ? 182.588 130.784 168.820 1.00 129.15 ? 491 HIS B CE1   1 
ATOM   4654  N NE2   . HIS B 2 491 ? 183.796 131.305 168.944 1.00 129.15 ? 491 HIS B NE2   1 
ATOM   4655  N N     . SER B 2 492 ? 181.927 133.361 162.595 1.00 122.08 ? 492 SER B N     1 
ATOM   4656  C CA    . SER B 2 492 ? 182.179 133.706 161.204 1.00 122.08 ? 492 SER B CA    1 
ATOM   4657  C C     . SER B 2 492 ? 181.197 134.780 160.759 1.00 122.08 ? 492 SER B C     1 
ATOM   4658  O O     . SER B 2 492 ? 179.982 134.606 160.893 1.00 122.08 ? 492 SER B O     1 
ATOM   4659  C CB    . SER B 2 492 ? 182.059 132.476 160.305 1.00 122.08 ? 492 SER B CB    1 
ATOM   4660  O OG    . SER B 2 492 ? 180.726 131.999 160.279 1.00 122.08 ? 492 SER B OG    1 
ATOM   4661  N N     . ILE B 2 493 ? 181.725 135.882 160.231 1.00 113.95 ? 493 ILE B N     1 
ATOM   4662  C CA    . ILE B 2 493 ? 180.921 136.985 159.723 1.00 113.95 ? 493 ILE B CA    1 
ATOM   4663  C C     . ILE B 2 493 ? 181.415 137.351 158.331 1.00 113.95 ? 493 ILE B C     1 
ATOM   4664  O O     . ILE B 2 493 ? 182.617 137.289 158.051 1.00 113.95 ? 493 ILE B O     1 
ATOM   4665  C CB    . ILE B 2 493 ? 180.969 138.211 160.657 1.00 113.95 ? 493 ILE B CB    1 
ATOM   4666  C CG1   . ILE B 2 493 ? 182.405 138.702 160.825 1.00 113.95 ? 493 ILE B CG1   1 
ATOM   4667  C CG2   . ILE B 2 493 ? 180.361 137.880 162.003 1.00 113.95 ? 493 ILE B CG2   1 
ATOM   4668  C CD1   . ILE B 2 493 ? 182.508 140.024 161.539 1.00 113.95 ? 493 ILE B CD1   1 
ATOM   4669  N N     . ILE B 2 494 ? 180.483 137.722 157.457 1.00 113.86 ? 494 ILE B N     1 
ATOM   4670  C CA    . ILE B 2 494 ? 180.784 138.038 156.068 1.00 113.86 ? 494 ILE B CA    1 
ATOM   4671  C C     . ILE B 2 494 ? 180.080 139.338 155.708 1.00 113.86 ? 494 ILE B C     1 
ATOM   4672  O O     . ILE B 2 494 ? 178.972 139.616 156.178 1.00 113.86 ? 494 ILE B O     1 
ATOM   4673  C CB    . ILE B 2 494 ? 180.361 136.898 155.111 1.00 113.86 ? 494 ILE B CB    1 
ATOM   4674  C CG1   . ILE B 2 494 ? 181.110 135.605 155.435 1.00 113.86 ? 494 ILE B CG1   1 
ATOM   4675  C CG2   . ILE B 2 494 ? 180.613 137.274 153.663 1.00 113.86 ? 494 ILE B CG2   1 
ATOM   4676  C CD1   . ILE B 2 494 ? 180.381 134.692 156.393 1.00 113.86 ? 494 ILE B CD1   1 
ATOM   4677  N N     . ILE B 2 495 ? 180.732 140.139 154.872 1.00 106.08 ? 495 ILE B N     1 
ATOM   4678  C CA    . ILE B 2 495 ? 180.209 141.427 154.437 1.00 106.08 ? 495 ILE B CA    1 
ATOM   4679  C C     . ILE B 2 495 ? 179.903 141.337 152.949 1.00 106.08 ? 495 ILE B C     1 
ATOM   4680  O O     . ILE B 2 495 ? 180.821 141.318 152.120 1.00 106.08 ? 495 ILE B O     1 
ATOM   4681  C CB    . ILE B 2 495 ? 181.196 142.564 154.722 1.00 106.08 ? 495 ILE B CB    1 
ATOM   4682  C CG1   . ILE B 2 495 ? 181.444 142.688 156.221 1.00 106.08 ? 495 ILE B CG1   1 
ATOM   4683  C CG2   . ILE B 2 495 ? 180.673 143.870 154.161 1.00 106.08 ? 495 ILE B CG2   1 
ATOM   4684  C CD1   . ILE B 2 495 ? 182.587 143.605 156.560 1.00 106.08 ? 495 ILE B CD1   1 
ATOM   4685  N N     . MET B 2 496 ? 178.619 141.281 152.605 1.00 118.65 ? 496 MET B N     1 
ATOM   4686  C CA    . MET B 2 496 ? 178.192 141.411 151.219 1.00 118.65 ? 496 MET B CA    1 
ATOM   4687  C C     . MET B 2 496 ? 177.850 142.864 150.930 1.00 118.65 ? 496 MET B C     1 
ATOM   4688  O O     . MET B 2 496 ? 177.158 143.519 151.713 1.00 118.65 ? 496 MET B O     1 
ATOM   4689  C CB    . MET B 2 496 ? 176.979 140.529 150.921 1.00 118.65 ? 496 MET B CB    1 
ATOM   4690  C CG    . MET B 2 496 ? 177.255 139.043 150.945 1.00 118.65 ? 496 MET B CG    1 
ATOM   4691  S SD    . MET B 2 496 ? 175.824 138.092 150.401 1.00 118.65 ? 496 MET B SD    1 
ATOM   4692  C CE    . MET B 2 496 ? 174.734 138.277 151.806 1.00 118.65 ? 496 MET B CE    1 
ATOM   4693  N N     . THR B 2 497 ? 178.338 143.367 149.802 1.00 126.30 ? 497 THR B N     1 
ATOM   4694  C CA    . THR B 2 497 ? 178.146 144.774 149.489 1.00 126.30 ? 497 THR B CA    1 
ATOM   4695  C C     . THR B 2 497 ? 178.134 144.937 147.976 1.00 126.30 ? 497 THR B C     1 
ATOM   4696  O O     . THR B 2 497 ? 178.744 144.149 147.250 1.00 126.30 ? 497 THR B O     1 
ATOM   4697  C CB    . THR B 2 497 ? 179.247 145.633 150.124 1.00 126.30 ? 497 THR B CB    1 
ATOM   4698  O OG1   . THR B 2 497 ? 179.349 145.320 151.518 1.00 126.30 ? 497 THR B OG1   1 
ATOM   4699  C CG2   . THR B 2 497 ? 178.903 147.093 150.012 1.00 126.30 ? 497 THR B CG2   1 
ATOM   4700  N N     . ASP B 2 498 ? 177.422 145.962 147.512 1.00 136.13 ? 498 ASP B N     1 
ATOM   4701  C CA    . ASP B 2 498 ? 177.289 146.224 146.089 1.00 136.13 ? 498 ASP B CA    1 
ATOM   4702  C C     . ASP B 2 498 ? 178.652 146.492 145.452 1.00 136.13 ? 498 ASP B C     1 
ATOM   4703  O O     . ASP B 2 498 ? 179.661 146.705 146.128 1.00 136.13 ? 498 ASP B O     1 
ATOM   4704  C CB    . ASP B 2 498 ? 176.357 147.411 145.853 1.00 136.13 ? 498 ASP B CB    1 
ATOM   4705  C CG    . ASP B 2 498 ? 174.916 147.093 146.188 1.00 136.13 ? 498 ASP B CG    1 
ATOM   4706  O OD1   . ASP B 2 498 ? 174.518 145.919 146.041 1.00 136.13 ? 498 ASP B OD1   1 
ATOM   4707  O OD2   . ASP B 2 498 ? 174.182 148.015 146.600 1.00 136.13 ? 498 ASP B OD2   1 
ATOM   4708  N N     . ALA B 2 499 ? 178.666 146.485 144.121 1.00 134.58 ? 499 ALA B N     1 
ATOM   4709  C CA    . ALA B 2 499 ? 179.886 146.662 143.347 1.00 134.58 ? 499 ALA B CA    1 
ATOM   4710  C C     . ALA B 2 499 ? 180.109 148.098 142.894 1.00 134.58 ? 499 ALA B C     1 
ATOM   4711  O O     . ALA B 2 499 ? 181.079 148.360 142.177 1.00 134.58 ? 499 ALA B O     1 
ATOM   4712  C CB    . ALA B 2 499 ? 179.870 145.739 142.126 1.00 134.58 ? 499 ALA B CB    1 
ATOM   4713  N N     . ASP B 2 500 ? 179.247 149.029 143.288 1.00 132.93 ? 500 ASP B N     1 
ATOM   4714  C CA    . ASP B 2 500 ? 179.418 150.428 142.922 1.00 132.93 ? 500 ASP B CA    1 
ATOM   4715  C C     . ASP B 2 500 ? 180.488 151.062 143.811 1.00 132.93 ? 500 ASP B C     1 
ATOM   4716  O O     . ASP B 2 500 ? 181.192 150.383 144.563 1.00 132.93 ? 500 ASP B O     1 
ATOM   4717  C CB    . ASP B 2 500 ? 178.082 151.162 143.004 1.00 132.93 ? 500 ASP B CB    1 
ATOM   4718  C CG    . ASP B 2 500 ? 177.480 151.133 144.398 1.00 132.93 ? 500 ASP B CG    1 
ATOM   4719  O OD1   . ASP B 2 500 ? 178.058 150.484 145.295 1.00 132.93 ? 500 ASP B OD1   1 
ATOM   4720  O OD2   . ASP B 2 500 ? 176.421 151.766 144.596 1.00 132.93 ? 500 ASP B OD2   1 
ATOM   4721  N N     . VAL B 2 501 ? 180.623 152.386 143.735 1.00 123.14 ? 501 VAL B N     1 
ATOM   4722  C CA    . VAL B 2 501 ? 181.612 153.066 144.563 1.00 123.14 ? 501 VAL B CA    1 
ATOM   4723  C C     . VAL B 2 501 ? 181.098 153.264 145.987 1.00 123.14 ? 501 VAL B C     1 
ATOM   4724  O O     . VAL B 2 501 ? 181.874 153.188 146.951 1.00 123.14 ? 501 VAL B O     1 
ATOM   4725  C CB    . VAL B 2 501 ? 182.016 154.398 143.909 1.00 123.14 ? 501 VAL B CB    1 
ATOM   4726  C CG1   . VAL B 2 501 ? 182.716 154.135 142.588 1.00 123.14 ? 501 VAL B CG1   1 
ATOM   4727  C CG2   . VAL B 2 501 ? 180.794 155.274 143.682 1.00 123.14 ? 501 VAL B CG2   1 
ATOM   4728  N N     . ASP B 2 502 ? 179.797 153.509 146.147 1.00 120.62 ? 502 ASP B N     1 
ATOM   4729  C CA    . ASP B 2 502 ? 179.229 153.626 147.483 1.00 120.62 ? 502 ASP B CA    1 
ATOM   4730  C C     . ASP B 2 502 ? 179.371 152.322 148.252 1.00 120.62 ? 502 ASP B C     1 
ATOM   4731  O O     . ASP B 2 502 ? 179.512 152.332 149.482 1.00 120.62 ? 502 ASP B O     1 
ATOM   4732  C CB    . ASP B 2 502 ? 177.766 154.045 147.382 1.00 120.62 ? 502 ASP B CB    1 
ATOM   4733  C CG    . ASP B 2 502 ? 177.605 155.445 146.829 1.00 120.62 ? 502 ASP B CG    1 
ATOM   4734  O OD1   . ASP B 2 502 ? 178.495 156.285 147.073 1.00 120.62 ? 502 ASP B OD1   1 
ATOM   4735  O OD2   . ASP B 2 502 ? 176.604 155.703 146.132 1.00 120.62 ? 502 ASP B OD2   1 
ATOM   4736  N N     . GLY B 2 503 ? 179.344 151.195 147.541 1.00 122.59 ? 503 GLY B N     1 
ATOM   4737  C CA    . GLY B 2 503 ? 179.618 149.924 148.185 1.00 122.59 ? 503 GLY B CA    1 
ATOM   4738  C C     . GLY B 2 503 ? 180.984 149.896 148.841 1.00 122.59 ? 503 GLY B C     1 
ATOM   4739  O O     . GLY B 2 503 ? 181.116 149.555 150.018 1.00 122.59 ? 503 GLY B O     1 
ATOM   4740  N N     . SER B 2 504 ? 182.020 150.269 148.089 1.00 113.55 ? 504 SER B N     1 
ATOM   4741  C CA    . SER B 2 504 ? 183.360 150.307 148.661 1.00 113.55 ? 504 SER B CA    1 
ATOM   4742  C C     . SER B 2 504 ? 183.456 151.327 149.785 1.00 113.55 ? 504 SER B C     1 
ATOM   4743  O O     . SER B 2 504 ? 184.197 151.121 150.754 1.00 113.55 ? 504 SER B O     1 
ATOM   4744  C CB    . SER B 2 504 ? 184.382 150.620 147.572 1.00 113.55 ? 504 SER B CB    1 
ATOM   4745  O OG    . SER B 2 504 ? 184.185 151.923 147.054 1.00 113.55 ? 504 SER B OG    1 
ATOM   4746  N N     . HIS B 2 505 ? 182.710 152.426 149.678 1.00 103.85 ? 505 HIS B N     1 
ATOM   4747  C CA    . HIS B 2 505 ? 182.732 153.438 150.729 1.00 103.85 ? 505 HIS B CA    1 
ATOM   4748  C C     . HIS B 2 505 ? 182.208 152.873 152.046 1.00 103.85 ? 505 HIS B C     1 
ATOM   4749  O O     . HIS B 2 505 ? 182.867 152.967 153.092 1.00 103.85 ? 505 HIS B O     1 
ATOM   4750  C CB    . HIS B 2 505 ? 181.905 154.647 150.295 1.00 103.85 ? 505 HIS B CB    1 
ATOM   4751  C CG    . HIS B 2 505 ? 181.905 155.763 151.288 1.00 103.85 ? 505 HIS B CG    1 
ATOM   4752  N ND1   . HIS B 2 505 ? 182.990 156.591 151.474 1.00 103.85 ? 505 HIS B ND1   1 
ATOM   4753  C CD2   . HIS B 2 505 ? 180.956 156.186 152.156 1.00 103.85 ? 505 HIS B CD2   1 
ATOM   4754  C CE1   . HIS B 2 505 ? 182.709 157.477 152.412 1.00 103.85 ? 505 HIS B CE1   1 
ATOM   4755  N NE2   . HIS B 2 505 ? 181.481 157.253 152.843 1.00 103.85 ? 505 HIS B NE2   1 
ATOM   4756  N N     . ILE B 2 506 ? 181.013 152.284 152.012 1.00 104.09 ? 506 ILE B N     1 
ATOM   4757  C CA    . ILE B 2 506 ? 180.446 151.717 153.230 1.00 104.09 ? 506 ILE B CA    1 
ATOM   4758  C C     . ILE B 2 506 ? 181.289 150.543 153.711 1.00 104.09 ? 506 ILE B C     1 
ATOM   4759  O O     . ILE B 2 506 ? 181.382 150.288 154.920 1.00 104.09 ? 506 ILE B O     1 
ATOM   4760  C CB    . ILE B 2 506 ? 178.976 151.325 152.998 1.00 104.09 ? 506 ILE B CB    1 
ATOM   4761  C CG1   . ILE B 2 506 ? 178.282 151.066 154.331 1.00 104.09 ? 506 ILE B CG1   1 
ATOM   4762  C CG2   . ILE B 2 506 ? 178.875 150.110 152.109 1.00 104.09 ? 506 ILE B CG2   1 
ATOM   4763  C CD1   . ILE B 2 506 ? 178.180 152.293 155.200 1.00 104.09 ? 506 ILE B CD1   1 
ATOM   4764  N N     . ARG B 2 507 ? 181.944 149.836 152.787 1.00 101.47 ? 507 ARG B N     1 
ATOM   4765  C CA    . ARG B 2 507 ? 182.854 148.766 153.171 1.00 101.47 ? 507 ARG B CA    1 
ATOM   4766  C C     . ARG B 2 507 ? 184.011 149.304 153.999 1.00 101.47 ? 507 ARG B C     1 
ATOM   4767  O O     . ARG B 2 507 ? 184.351 148.741 155.046 1.00 101.47 ? 507 ARG B O     1 
ATOM   4768  C CB    . ARG B 2 507 ? 183.371 148.072 151.915 1.00 101.47 ? 507 ARG B CB    1 
ATOM   4769  C CG    . ARG B 2 507 ? 184.278 146.898 152.163 1.00 101.47 ? 507 ARG B CG    1 
ATOM   4770  C CD    . ARG B 2 507 ? 184.665 146.280 150.840 1.00 101.47 ? 507 ARG B CD    1 
ATOM   4771  N NE    . ARG B 2 507 ? 183.506 145.708 150.165 1.00 101.47 ? 507 ARG B NE    1 
ATOM   4772  C CZ    . ARG B 2 507 ? 183.513 145.285 148.907 1.00 101.47 ? 507 ARG B CZ    1 
ATOM   4773  N NH1   . ARG B 2 507 ? 184.621 145.376 148.187 1.00 101.47 ? 507 ARG B NH1   1 
ATOM   4774  N NH2   . ARG B 2 507 ? 182.415 144.774 148.366 1.00 101.47 ? 507 ARG B NH2   1 
ATOM   4775  N N     . THR B 2 508 ? 184.632 150.388 153.534 1.00 104.49 ? 508 THR B N     1 
ATOM   4776  C CA    . THR B 2 508 ? 185.733 151.000 154.272 1.00 104.49 ? 508 THR B CA    1 
ATOM   4777  C C     . THR B 2 508 ? 185.276 151.484 155.641 1.00 104.49 ? 508 THR B C     1 
ATOM   4778  O O     . THR B 2 508 ? 185.990 151.326 156.641 1.00 104.49 ? 508 THR B O     1 
ATOM   4779  C CB    . THR B 2 508 ? 186.314 152.158 153.462 1.00 104.49 ? 508 THR B CB    1 
ATOM   4780  O OG1   . THR B 2 508 ? 186.807 151.669 152.209 1.00 104.49 ? 508 THR B OG1   1 
ATOM   4781  C CG2   . THR B 2 508 ? 187.444 152.824 154.220 1.00 104.49 ? 508 THR B CG2   1 
ATOM   4782  N N     . LEU B 2 509 ? 184.088 152.086 155.701 1.00 99.87  ? 509 LEU B N     1 
ATOM   4783  C CA    . LEU B 2 509 ? 183.554 152.529 156.988 1.00 99.87  ? 509 LEU B CA    1 
ATOM   4784  C C     . LEU B 2 509 ? 183.393 151.361 157.955 1.00 99.87  ? 509 LEU B C     1 
ATOM   4785  O O     . LEU B 2 509 ? 183.819 151.434 159.115 1.00 99.87  ? 509 LEU B O     1 
ATOM   4786  C CB    . LEU B 2 509 ? 182.228 153.261 156.786 1.00 99.87  ? 509 LEU B CB    1 
ATOM   4787  C CG    . LEU B 2 509 ? 182.323 154.776 156.583 1.00 99.87  ? 509 LEU B CG    1 
ATOM   4788  C CD1   . LEU B 2 509 ? 183.017 155.159 155.302 1.00 99.87  ? 509 LEU B CD1   1 
ATOM   4789  C CD2   . LEU B 2 509 ? 180.943 155.387 156.595 1.00 99.87  ? 509 LEU B CD2   1 
ATOM   4790  N N     . LEU B 2 510 ? 182.777 150.271 157.497 1.00 98.62  ? 510 LEU B N     1 
ATOM   4791  C CA    . LEU B 2 510 ? 182.595 149.115 158.369 1.00 98.62  ? 510 LEU B CA    1 
ATOM   4792  C C     . LEU B 2 510 ? 183.931 148.527 158.804 1.00 98.62  ? 510 LEU B C     1 
ATOM   4793  O O     . LEU B 2 510 ? 184.095 148.126 159.965 1.00 98.62  ? 510 LEU B O     1 
ATOM   4794  C CB    . LEU B 2 510 ? 181.745 148.054 157.674 1.00 98.62  ? 510 LEU B CB    1 
ATOM   4795  C CG    . LEU B 2 510 ? 180.273 148.404 157.495 1.00 98.62  ? 510 LEU B CG    1 
ATOM   4796  C CD1   . LEU B 2 510 ? 179.579 147.324 156.693 1.00 98.62  ? 510 LEU B CD1   1 
ATOM   4797  C CD2   . LEU B 2 510 ? 179.618 148.568 158.852 1.00 98.62  ? 510 LEU B CD2   1 
ATOM   4798  N N     . LEU B 2 511 ? 184.899 148.462 157.888 1.00 103.40 ? 511 LEU B N     1 
ATOM   4799  C CA    . LEU B 2 511 ? 186.188 147.880 158.239 1.00 103.40 ? 511 LEU B CA    1 
ATOM   4800  C C     . LEU B 2 511 ? 186.904 148.712 159.292 1.00 103.40 ? 511 LEU B C     1 
ATOM   4801  O O     . LEU B 2 511 ? 187.458 148.160 160.252 1.00 103.40 ? 511 LEU B O     1 
ATOM   4802  C CB    . LEU B 2 511 ? 187.060 147.720 156.998 1.00 103.40 ? 511 LEU B CB    1 
ATOM   4803  C CG    . LEU B 2 511 ? 186.601 146.640 156.022 1.00 103.40 ? 511 LEU B CG    1 
ATOM   4804  C CD1   . LEU B 2 511 ? 187.490 146.629 154.792 1.00 103.40 ? 511 LEU B CD1   1 
ATOM   4805  C CD2   . LEU B 2 511 ? 186.592 145.281 156.702 1.00 103.40 ? 511 LEU B CD2   1 
ATOM   4806  N N     . THR B 2 512 ? 186.904 150.040 159.140 1.00 110.20 ? 512 THR B N     1 
ATOM   4807  C CA    . THR B 2 512 ? 187.561 150.862 160.149 1.00 110.20 ? 512 THR B CA    1 
ATOM   4808  C C     . THR B 2 512 ? 186.815 150.806 161.477 1.00 110.20 ? 512 THR B C     1 
ATOM   4809  O O     . THR B 2 512 ? 187.450 150.831 162.540 1.00 110.20 ? 512 THR B O     1 
ATOM   4810  C CB    . THR B 2 512 ? 187.720 152.307 159.663 1.00 110.20 ? 512 THR B CB    1 
ATOM   4811  O OG1   . THR B 2 512 ? 188.544 153.028 160.586 1.00 110.20 ? 512 THR B OG1   1 
ATOM   4812  C CG2   . THR B 2 512 ? 186.387 153.011 159.555 1.00 110.20 ? 512 THR B CG2   1 
ATOM   4813  N N     . PHE B 2 513 ? 185.483 150.679 161.443 1.00 111.40 ? 513 PHE B N     1 
ATOM   4814  C CA    . PHE B 2 513 ? 184.738 150.467 162.679 1.00 111.40 ? 513 PHE B CA    1 
ATOM   4815  C C     . PHE B 2 513 ? 185.221 149.220 163.402 1.00 111.40 ? 513 PHE B C     1 
ATOM   4816  O O     . PHE B 2 513 ? 185.555 149.268 164.593 1.00 111.40 ? 513 PHE B O     1 
ATOM   4817  C CB    . PHE B 2 513 ? 183.243 150.353 162.392 1.00 111.40 ? 513 PHE B CB    1 
ATOM   4818  C CG    . PHE B 2 513 ? 182.419 150.066 163.615 1.00 111.40 ? 513 PHE B CG    1 
ATOM   4819  C CD1   . PHE B 2 513 ? 182.068 151.080 164.487 1.00 111.40 ? 513 PHE B CD1   1 
ATOM   4820  C CD2   . PHE B 2 513 ? 182.025 148.773 163.909 1.00 111.40 ? 513 PHE B CD2   1 
ATOM   4821  C CE1   . PHE B 2 513 ? 181.318 150.814 165.614 1.00 111.40 ? 513 PHE B CE1   1 
ATOM   4822  C CE2   . PHE B 2 513 ? 181.280 148.501 165.035 1.00 111.40 ? 513 PHE B CE2   1 
ATOM   4823  C CZ    . PHE B 2 513 ? 180.925 149.523 165.889 1.00 111.40 ? 513 PHE B CZ    1 
ATOM   4824  N N     . PHE B 2 514 ? 185.227 148.081 162.705 1.00 109.39 ? 514 PHE B N     1 
ATOM   4825  C CA    . PHE B 2 514 ? 185.681 146.842 163.334 1.00 109.39 ? 514 PHE B CA    1 
ATOM   4826  C C     . PHE B 2 514 ? 187.095 146.989 163.877 1.00 109.39 ? 514 PHE B C     1 
ATOM   4827  O O     . PHE B 2 514 ? 187.382 146.592 165.014 1.00 109.39 ? 514 PHE B O     1 
ATOM   4828  C CB    . PHE B 2 514 ? 185.617 145.664 162.361 1.00 109.39 ? 514 PHE B CB    1 
ATOM   4829  C CG    . PHE B 2 514 ? 184.235 145.137 162.127 1.00 109.39 ? 514 PHE B CG    1 
ATOM   4830  C CD1   . PHE B 2 514 ? 183.582 144.415 163.108 1.00 109.39 ? 514 PHE B CD1   1 
ATOM   4831  C CD2   . PHE B 2 514 ? 183.615 145.307 160.907 1.00 109.39 ? 514 PHE B CD2   1 
ATOM   4832  C CE1   . PHE B 2 514 ? 182.314 143.914 162.888 1.00 109.39 ? 514 PHE B CE1   1 
ATOM   4833  C CE2   . PHE B 2 514 ? 182.352 144.805 160.678 1.00 109.39 ? 514 PHE B CE2   1 
ATOM   4834  C CZ    . PHE B 2 514 ? 181.701 144.108 161.667 1.00 109.39 ? 514 PHE B CZ    1 
ATOM   4835  N N     . TYR B 2 515 ? 187.993 147.573 163.081 1.00 105.35 ? 515 TYR B N     1 
ATOM   4836  C CA    . TYR B 2 515 ? 189.391 147.652 163.487 1.00 105.35 ? 515 TYR B CA    1 
ATOM   4837  C C     . TYR B 2 515 ? 189.558 148.492 164.745 1.00 105.35 ? 515 TYR B C     1 
ATOM   4838  O O     . TYR B 2 515 ? 190.331 148.136 165.641 1.00 105.35 ? 515 TYR B O     1 
ATOM   4839  C CB    . TYR B 2 515 ? 190.243 148.223 162.358 1.00 105.35 ? 515 TYR B CB    1 
ATOM   4840  C CG    . TYR B 2 515 ? 191.708 148.296 162.715 1.00 105.35 ? 515 TYR B CG    1 
ATOM   4841  C CD1   . TYR B 2 515 ? 192.503 147.160 162.694 1.00 105.35 ? 515 TYR B CD1   1 
ATOM   4842  C CD2   . TYR B 2 515 ? 192.290 149.495 163.096 1.00 105.35 ? 515 TYR B CD2   1 
ATOM   4843  C CE1   . TYR B 2 515 ? 193.839 147.219 163.026 1.00 105.35 ? 515 TYR B CE1   1 
ATOM   4844  C CE2   . TYR B 2 515 ? 193.625 149.563 163.431 1.00 105.35 ? 515 TYR B CE2   1 
ATOM   4845  C CZ    . TYR B 2 515 ? 194.395 148.423 163.394 1.00 105.35 ? 515 TYR B CZ    1 
ATOM   4846  O OH    . TYR B 2 515 ? 195.727 148.488 163.727 1.00 105.35 ? 515 TYR B OH    1 
ATOM   4847  N N     . ARG B 2 516 ? 188.846 149.616 164.832 1.00 114.61 ? 516 ARG B N     1 
ATOM   4848  C CA    . ARG B 2 516 ? 189.066 150.514 165.959 1.00 114.61 ? 516 ARG B CA    1 
ATOM   4849  C C     . ARG B 2 516 ? 188.186 150.153 167.148 1.00 114.61 ? 516 ARG B C     1 
ATOM   4850  O O     . ARG B 2 516 ? 188.315 150.743 168.226 1.00 114.61 ? 516 ARG B O     1 
ATOM   4851  C CB    . ARG B 2 516 ? 188.841 151.961 165.528 1.00 114.61 ? 516 ARG B CB    1 
ATOM   4852  C CG    . ARG B 2 516 ? 189.848 152.439 164.504 1.00 114.61 ? 516 ARG B CG    1 
ATOM   4853  C CD    . ARG B 2 516 ? 191.240 152.486 165.105 1.00 114.61 ? 516 ARG B CD    1 
ATOM   4854  N NE    . ARG B 2 516 ? 191.299 153.386 166.251 1.00 114.61 ? 516 ARG B NE    1 
ATOM   4855  C CZ    . ARG B 2 516 ? 191.522 154.692 166.160 1.00 114.61 ? 516 ARG B CZ    1 
ATOM   4856  N NH1   . ARG B 2 516 ? 191.557 155.441 167.253 1.00 114.61 ? 516 ARG B NH1   1 
ATOM   4857  N NH2   . ARG B 2 516 ? 191.713 155.249 164.974 1.00 114.61 ? 516 ARG B NH2   1 
ATOM   4858  N N     . GLN B 2 517 ? 187.277 149.191 166.977 1.00 115.09 ? 517 GLN B N     1 
ATOM   4859  C CA    . GLN B 2 517 ? 186.496 148.757 168.131 1.00 115.09 ? 517 GLN B CA    1 
ATOM   4860  C C     . GLN B 2 517 ? 187.032 147.458 168.723 1.00 115.09 ? 517 GLN B C     1 
ATOM   4861  O O     . GLN B 2 517 ? 187.351 147.405 169.917 1.00 115.09 ? 517 GLN B O     1 
ATOM   4862  C CB    . GLN B 2 517 ? 185.024 148.620 167.753 1.00 115.09 ? 517 GLN B CB    1 
ATOM   4863  C CG    . GLN B 2 517 ? 184.369 149.954 167.480 1.00 115.09 ? 517 GLN B CG    1 
ATOM   4864  C CD    . GLN B 2 517 ? 184.461 150.883 168.674 1.00 115.09 ? 517 GLN B CD    1 
ATOM   4865  O OE1   . GLN B 2 517 ? 185.206 151.862 168.653 1.00 115.09 ? 517 GLN B OE1   1 
ATOM   4866  N NE2   . GLN B 2 517 ? 183.712 150.576 169.725 1.00 115.09 ? 517 GLN B NE2   1 
ATOM   4867  N N     . MET B 2 518 ? 187.133 146.401 167.924 1.00 122.16 ? 518 MET B N     1 
ATOM   4868  C CA    . MET B 2 518 ? 187.505 145.083 168.438 1.00 122.16 ? 518 MET B CA    1 
ATOM   4869  C C     . MET B 2 518 ? 188.672 144.529 167.632 1.00 122.16 ? 518 MET B C     1 
ATOM   4870  O O     . MET B 2 518 ? 188.469 143.888 166.589 1.00 122.16 ? 518 MET B O     1 
ATOM   4871  C CB    . MET B 2 518 ? 186.317 144.127 168.405 1.00 122.16 ? 518 MET B CB    1 
ATOM   4872  C CG    . MET B 2 518 ? 185.200 144.515 169.355 1.00 122.16 ? 518 MET B CG    1 
ATOM   4873  S SD    . MET B 2 518 ? 183.819 143.359 169.320 1.00 122.16 ? 518 MET B SD    1 
ATOM   4874  C CE    . MET B 2 518 ? 183.051 143.802 167.765 1.00 122.16 ? 518 MET B CE    1 
ATOM   4875  N N     . PRO B 2 519 ? 189.908 144.752 168.083 1.00 123.81 ? 519 PRO B N     1 
ATOM   4876  C CA    . PRO B 2 519 ? 191.054 144.223 167.329 1.00 123.81 ? 519 PRO B CA    1 
ATOM   4877  C C     . PRO B 2 519 ? 191.156 142.711 167.375 1.00 123.81 ? 519 PRO B C     1 
ATOM   4878  O O     . PRO B 2 519 ? 191.707 142.107 166.446 1.00 123.81 ? 519 PRO B O     1 
ATOM   4879  C CB    . PRO B 2 519 ? 192.255 144.893 168.010 1.00 123.81 ? 519 PRO B CB    1 
ATOM   4880  C CG    . PRO B 2 519 ? 191.686 146.099 168.687 1.00 123.81 ? 519 PRO B CG    1 
ATOM   4881  C CD    . PRO B 2 519 ? 190.322 145.688 169.138 1.00 123.81 ? 519 PRO B CD    1 
ATOM   4882  N N     . GLU B 2 520 ? 190.642 142.076 168.430 1.00 132.77 ? 520 GLU B N     1 
ATOM   4883  C CA    . GLU B 2 520 ? 190.814 140.633 168.575 1.00 132.77 ? 520 GLU B CA    1 
ATOM   4884  C C     . GLU B 2 520 ? 190.004 139.865 167.541 1.00 132.77 ? 520 GLU B C     1 
ATOM   4885  O O     . GLU B 2 520 ? 190.465 138.841 167.021 1.00 132.77 ? 520 GLU B O     1 
ATOM   4886  C CB    . GLU B 2 520 ? 190.423 140.192 169.983 1.00 132.77 ? 520 GLU B CB    1 
ATOM   4887  C CG    . GLU B 2 520 ? 191.363 140.669 171.067 1.00 132.77 ? 520 GLU B CG    1 
ATOM   4888  C CD    . GLU B 2 520 ? 190.944 140.189 172.439 1.00 132.77 ? 520 GLU B CD    1 
ATOM   4889  O OE1   . GLU B 2 520 ? 189.853 139.590 172.549 1.00 132.77 ? 520 GLU B OE1   1 
ATOM   4890  O OE2   . GLU B 2 520 ? 191.703 140.408 173.406 1.00 132.77 ? 520 GLU B OE2   1 
ATOM   4891  N N     . ILE B 2 521 ? 188.788 140.325 167.245 1.00 119.94 ? 521 ILE B N     1 
ATOM   4892  C CA    . ILE B 2 521 ? 187.964 139.610 166.279 1.00 119.94 ? 521 ILE B CA    1 
ATOM   4893  C C     . ILE B 2 521 ? 188.568 139.713 164.887 1.00 119.94 ? 521 ILE B C     1 
ATOM   4894  O O     . ILE B 2 521 ? 188.361 138.832 164.044 1.00 119.94 ? 521 ILE B O     1 
ATOM   4895  C CB    . ILE B 2 521 ? 186.516 140.132 166.319 1.00 119.94 ? 521 ILE B CB    1 
ATOM   4896  C CG1   . ILE B 2 521 ? 185.590 139.191 165.550 1.00 119.94 ? 521 ILE B CG1   1 
ATOM   4897  C CG2   . ILE B 2 521 ? 186.433 141.536 165.753 1.00 119.94 ? 521 ILE B CG2   1 
ATOM   4898  C CD1   . ILE B 2 521 ? 184.126 139.435 165.816 1.00 119.94 ? 521 ILE B CD1   1 
ATOM   4899  N N     . VAL B 2 522 ? 189.334 140.771 164.623 1.00 121.53 ? 522 VAL B N     1 
ATOM   4900  C CA    . VAL B 2 522 ? 190.040 140.873 163.354 1.00 121.53 ? 522 VAL B CA    1 
ATOM   4901  C C     . VAL B 2 522 ? 191.293 140.011 163.374 1.00 121.53 ? 522 VAL B C     1 
ATOM   4902  O O     . VAL B 2 522 ? 191.630 139.360 162.379 1.00 121.53 ? 522 VAL B O     1 
ATOM   4903  C CB    . VAL B 2 522 ? 190.369 142.345 163.050 1.00 121.53 ? 522 VAL B CB    1 
ATOM   4904  C CG1   . VAL B 2 522 ? 191.173 142.457 161.768 1.00 121.53 ? 522 VAL B CG1   1 
ATOM   4905  C CG2   . VAL B 2 522 ? 189.095 143.160 162.957 1.00 121.53 ? 522 VAL B CG2   1 
ATOM   4906  N N     . GLU B 2 523 ? 191.992 139.983 164.509 1.00 125.22 ? 523 GLU B N     1 
ATOM   4907  C CA    . GLU B 2 523 ? 193.226 139.212 164.601 1.00 125.22 ? 523 GLU B CA    1 
ATOM   4908  C C     . GLU B 2 523 ? 192.962 137.722 164.453 1.00 125.22 ? 523 GLU B C     1 
ATOM   4909  O O     . GLU B 2 523 ? 193.712 137.015 163.772 1.00 125.22 ? 523 GLU B O     1 
ATOM   4910  C CB    . GLU B 2 523 ? 193.921 139.499 165.928 1.00 125.22 ? 523 GLU B CB    1 
ATOM   4911  C CG    . GLU B 2 523 ? 195.237 138.772 166.098 1.00 125.22 ? 523 GLU B CG    1 
ATOM   4912  C CD    . GLU B 2 523 ? 195.901 139.083 167.420 1.00 125.22 ? 523 GLU B CD    1 
ATOM   4913  O OE1   . GLU B 2 523 ? 195.319 139.858 168.207 1.00 125.22 ? 523 GLU B OE1   1 
ATOM   4914  O OE2   . GLU B 2 523 ? 197.001 138.549 167.675 1.00 125.22 ? 523 GLU B OE2   1 
ATOM   4915  N N     . ARG B 2 524 ? 191.896 137.226 165.075 1.00 121.05 ? 524 ARG B N     1 
ATOM   4916  C CA    . ARG B 2 524 ? 191.610 135.798 165.073 1.00 121.05 ? 524 ARG B CA    1 
ATOM   4917  C C     . ARG B 2 524 ? 190.938 135.324 163.793 1.00 121.05 ? 524 ARG B C     1 
ATOM   4918  O O     . ARG B 2 524 ? 190.386 134.218 163.778 1.00 121.05 ? 524 ARG B O     1 
ATOM   4919  C CB    . ARG B 2 524 ? 190.753 135.431 166.284 1.00 121.05 ? 524 ARG B CB    1 
ATOM   4920  C CG    . ARG B 2 524 ? 191.494 135.538 167.600 1.00 121.05 ? 524 ARG B CG    1 
ATOM   4921  C CD    . ARG B 2 524 ? 190.610 135.151 168.767 1.00 121.05 ? 524 ARG B CD    1 
ATOM   4922  N NE    . ARG B 2 524 ? 191.318 135.262 170.037 1.00 121.05 ? 524 ARG B NE    1 
ATOM   4923  C CZ    . ARG B 2 524 ? 190.763 135.042 171.223 1.00 121.05 ? 524 ARG B CZ    1 
ATOM   4924  N NH1   . ARG B 2 524 ? 189.485 134.699 171.307 1.00 121.05 ? 524 ARG B NH1   1 
ATOM   4925  N NH2   . ARG B 2 524 ? 191.486 135.166 172.327 1.00 121.05 ? 524 ARG B NH2   1 
ATOM   4926  N N     . GLY B 2 525 ? 190.970 136.124 162.731 1.00 116.90 ? 525 GLY B N     1 
ATOM   4927  C CA    . GLY B 2 525 ? 190.462 135.701 161.441 1.00 116.90 ? 525 GLY B CA    1 
ATOM   4928  C C     . GLY B 2 525 ? 189.003 135.299 161.444 1.00 116.90 ? 525 GLY B C     1 
ATOM   4929  O O     . GLY B 2 525 ? 188.672 134.134 161.206 1.00 116.90 ? 525 GLY B O     1 
ATOM   4930  N N     . HIS B 2 526 ? 188.118 136.256 161.717 1.00 116.85 ? 526 HIS B N     1 
ATOM   4931  C CA    . HIS B 2 526 ? 186.686 136.014 161.682 1.00 116.85 ? 526 HIS B CA    1 
ATOM   4932  C C     . HIS B 2 526 ? 185.948 136.872 160.669 1.00 116.85 ? 526 HIS B C     1 
ATOM   4933  O O     . HIS B 2 526 ? 184.802 136.552 160.338 1.00 116.85 ? 526 HIS B O     1 
ATOM   4934  C CB    . HIS B 2 526 ? 186.068 136.242 163.070 1.00 116.85 ? 526 HIS B CB    1 
ATOM   4935  C CG    . HIS B 2 526 ? 186.559 135.285 164.111 1.00 116.85 ? 526 HIS B CG    1 
ATOM   4936  N ND1   . HIS B 2 526 ? 186.143 133.972 164.171 1.00 116.85 ? 526 HIS B ND1   1 
ATOM   4937  C CD2   . HIS B 2 526 ? 187.434 135.449 165.131 1.00 116.85 ? 526 HIS B CD2   1 
ATOM   4938  C CE1   . HIS B 2 526 ? 186.739 133.369 165.184 1.00 116.85 ? 526 HIS B CE1   1 
ATOM   4939  N NE2   . HIS B 2 526 ? 187.528 134.243 165.783 1.00 116.85 ? 526 HIS B NE2   1 
ATOM   4940  N N     . VAL B 2 527 ? 186.560 137.936 160.172 1.00 109.22 ? 527 VAL B N     1 
ATOM   4941  C CA    . VAL B 2 527 ? 185.928 138.797 159.182 1.00 109.22 ? 527 VAL B CA    1 
ATOM   4942  C C     . VAL B 2 527 ? 186.212 138.249 157.792 1.00 109.22 ? 527 VAL B C     1 
ATOM   4943  O O     . VAL B 2 527 ? 187.312 137.760 157.512 1.00 109.22 ? 527 VAL B O     1 
ATOM   4944  C CB    . VAL B 2 527 ? 186.434 140.241 159.333 1.00 109.22 ? 527 VAL B CB    1 
ATOM   4945  C CG1   . VAL B 2 527 ? 185.821 141.140 158.276 1.00 109.22 ? 527 VAL B CG1   1 
ATOM   4946  C CG2   . VAL B 2 527 ? 186.131 140.760 160.725 1.00 109.22 ? 527 VAL B CG2   1 
ATOM   4947  N N     . TYR B 2 528 ? 185.215 138.319 156.914 1.00 113.29 ? 528 TYR B N     1 
ATOM   4948  C CA    . TYR B 2 528 ? 185.365 137.842 155.550 1.00 113.29 ? 528 TYR B CA    1 
ATOM   4949  C C     . TYR B 2 528 ? 184.726 138.837 154.594 1.00 113.29 ? 528 TYR B C     1 
ATOM   4950  O O     . TYR B 2 528 ? 183.831 139.600 154.965 1.00 113.29 ? 528 TYR B O     1 
ATOM   4951  C CB    . TYR B 2 528 ? 184.744 136.454 155.370 1.00 113.29 ? 528 TYR B CB    1 
ATOM   4952  C CG    . TYR B 2 528 ? 185.460 135.368 156.133 1.00 113.29 ? 528 TYR B CG    1 
ATOM   4953  C CD1   . TYR B 2 528 ? 186.605 134.776 155.624 1.00 113.29 ? 528 TYR B CD1   1 
ATOM   4954  C CD2   . TYR B 2 528 ? 184.995 134.940 157.367 1.00 113.29 ? 528 TYR B CD2   1 
ATOM   4955  C CE1   . TYR B 2 528 ? 187.262 133.783 156.319 1.00 113.29 ? 528 TYR B CE1   1 
ATOM   4956  C CE2   . TYR B 2 528 ? 185.645 133.948 158.069 1.00 113.29 ? 528 TYR B CE2   1 
ATOM   4957  C CZ    . TYR B 2 528 ? 186.779 133.374 157.541 1.00 113.29 ? 528 TYR B CZ    1 
ATOM   4958  O OH    . TYR B 2 528 ? 187.432 132.385 158.238 1.00 113.29 ? 528 TYR B OH    1 
ATOM   4959  N N     . ILE B 2 529 ? 185.199 138.820 153.352 1.00 115.13 ? 529 ILE B N     1 
ATOM   4960  C CA    . ILE B 2 529 ? 184.711 139.707 152.304 1.00 115.13 ? 529 ILE B CA    1 
ATOM   4961  C C     . ILE B 2 529 ? 184.185 138.856 151.159 1.00 115.13 ? 529 ILE B C     1 
ATOM   4962  O O     . ILE B 2 529 ? 184.861 137.921 150.714 1.00 115.13 ? 529 ILE B O     1 
ATOM   4963  C CB    . ILE B 2 529 ? 185.812 140.661 151.812 1.00 115.13 ? 529 ILE B CB    1 
ATOM   4964  C CG1   . ILE B 2 529 ? 186.336 141.500 152.974 1.00 115.13 ? 529 ILE B CG1   1 
ATOM   4965  C CG2   . ILE B 2 529 ? 185.283 141.557 150.710 1.00 115.13 ? 529 ILE B CG2   1 
ATOM   4966  C CD1   . ILE B 2 529 ? 185.274 142.349 153.624 1.00 115.13 ? 529 ILE B CD1   1 
ATOM   4967  N N     . ALA B 2 530 ? 182.986 139.178 150.688 1.00 121.44 ? 530 ALA B N     1 
ATOM   4968  C CA    . ALA B 2 530 ? 182.374 138.465 149.578 1.00 121.44 ? 530 ALA B CA    1 
ATOM   4969  C C     . ALA B 2 530 ? 182.804 139.075 148.247 1.00 121.44 ? 530 ALA B C     1 
ATOM   4970  O O     . ALA B 2 530 ? 183.300 140.201 148.181 1.00 121.44 ? 530 ALA B O     1 
ATOM   4971  C CB    . ALA B 2 530 ? 180.851 138.486 149.696 1.00 121.44 ? 530 ALA B CB    1 
ATOM   4972  N N     . GLN B 2 531 ? 182.606 138.308 147.177 1.00 128.16 ? 531 GLN B N     1 
ATOM   4973  C CA    . GLN B 2 531 ? 182.971 138.716 145.820 1.00 128.16 ? 531 GLN B CA    1 
ATOM   4974  C C     . GLN B 2 531 ? 181.804 138.428 144.888 1.00 128.16 ? 531 GLN B C     1 
ATOM   4975  O O     . GLN B 2 531 ? 181.762 137.377 144.233 1.00 128.16 ? 531 GLN B O     1 
ATOM   4976  C CB    . GLN B 2 531 ? 184.239 138.001 145.350 1.00 128.16 ? 531 GLN B CB    1 
ATOM   4977  C CG    . GLN B 2 531 ? 185.476 138.333 146.158 1.00 128.16 ? 531 GLN B CG    1 
ATOM   4978  C CD    . GLN B 2 531 ? 185.879 139.786 146.029 1.00 128.16 ? 531 GLN B CD    1 
ATOM   4979  O OE1   . GLN B 2 531 ? 185.777 140.378 144.956 1.00 128.16 ? 531 GLN B OE1   1 
ATOM   4980  N NE2   . GLN B 2 531 ? 186.342 140.369 147.127 1.00 128.16 ? 531 GLN B NE2   1 
ATOM   4981  N N     . PRO B 2 532 ? 180.833 139.339 144.810 1.00 129.85 ? 532 PRO B N     1 
ATOM   4982  C CA    . PRO B 2 532 ? 179.705 139.115 143.912 1.00 129.85 ? 532 PRO B CA    1 
ATOM   4983  C C     . PRO B 2 532 ? 180.146 139.166 142.465 1.00 129.85 ? 532 PRO B C     1 
ATOM   4984  O O     . PRO B 2 532 ? 181.117 139.861 142.119 1.00 129.85 ? 532 PRO B O     1 
ATOM   4985  C CB    . PRO B 2 532 ? 178.754 140.281 144.245 1.00 129.85 ? 532 PRO B CB    1 
ATOM   4986  C CG    . PRO B 2 532 ? 179.160 140.719 145.612 1.00 129.85 ? 532 PRO B CG    1 
ATOM   4987  C CD    . PRO B 2 532 ? 180.640 140.519 145.661 1.00 129.85 ? 532 PRO B CD    1 
ATOM   4988  N N     . PRO B 2 533 ? 179.470 138.438 141.576 1.00 142.36 ? 533 PRO B N     1 
ATOM   4989  C CA    . PRO B 2 533 ? 179.782 138.545 140.147 1.00 142.36 ? 533 PRO B CA    1 
ATOM   4990  C C     . PRO B 2 533 ? 179.476 139.941 139.624 1.00 142.36 ? 533 PRO B C     1 
ATOM   4991  O O     . PRO B 2 533 ? 178.780 140.734 140.260 1.00 142.36 ? 533 PRO B O     1 
ATOM   4992  C CB    . PRO B 2 533 ? 178.872 137.496 139.502 1.00 142.36 ? 533 PRO B CB    1 
ATOM   4993  C CG    . PRO B 2 533 ? 178.567 136.537 140.605 1.00 142.36 ? 533 PRO B CG    1 
ATOM   4994  C CD    . PRO B 2 533 ? 178.494 137.374 141.845 1.00 142.36 ? 533 PRO B CD    1 
ATOM   4995  N N     . LEU B 2 534 ? 180.006 140.235 138.442 1.00 170.05 ? 534 LEU B N     1 
ATOM   4996  C CA    . LEU B 2 534 ? 179.875 141.561 137.862 1.00 170.05 ? 534 LEU B CA    1 
ATOM   4997  C C     . LEU B 2 534 ? 179.227 141.579 136.487 1.00 170.05 ? 534 LEU B C     1 
ATOM   4998  O O     . LEU B 2 534 ? 178.509 142.532 136.177 1.00 170.05 ? 534 LEU B O     1 
ATOM   4999  C CB    . LEU B 2 534 ? 181.251 142.239 137.775 1.00 170.05 ? 534 LEU B CB    1 
ATOM   5000  C CG    . LEU B 2 534 ? 181.282 143.681 137.274 1.00 170.05 ? 534 LEU B CG    1 
ATOM   5001  C CD1   . LEU B 2 534 ? 180.456 144.572 138.183 1.00 170.05 ? 534 LEU B CD1   1 
ATOM   5002  C CD2   . LEU B 2 534 ? 182.717 144.178 137.199 1.00 170.05 ? 534 LEU B CD2   1 
ATOM   5003  N N     . TYR B 2 535 ? 179.447 140.562 135.659 1.00 178.37 ? 535 TYR B N     1 
ATOM   5004  C CA    . TYR B 2 535 ? 178.874 140.517 134.323 1.00 178.37 ? 535 TYR B CA    1 
ATOM   5005  C C     . TYR B 2 535 ? 178.230 139.166 134.070 1.00 178.37 ? 535 TYR B C     1 
ATOM   5006  O O     . TYR B 2 535 ? 178.735 138.132 134.515 1.00 178.37 ? 535 TYR B O     1 
ATOM   5007  C CB    . TYR B 2 535 ? 179.930 140.787 133.249 1.00 178.37 ? 535 TYR B CB    1 
ATOM   5008  C CG    . TYR B 2 535 ? 180.448 142.202 133.244 1.00 178.37 ? 535 TYR B CG    1 
ATOM   5009  C CD1   . TYR B 2 535 ? 179.708 143.227 132.674 1.00 178.37 ? 535 TYR B CD1   1 
ATOM   5010  C CD2   . TYR B 2 535 ? 181.681 142.511 133.796 1.00 178.37 ? 535 TYR B CD2   1 
ATOM   5011  C CE1   . TYR B 2 535 ? 180.177 144.524 132.663 1.00 178.37 ? 535 TYR B CE1   1 
ATOM   5012  C CE2   . TYR B 2 535 ? 182.160 143.804 133.787 1.00 178.37 ? 535 TYR B CE2   1 
ATOM   5013  C CZ    . TYR B 2 535 ? 181.405 144.807 133.222 1.00 178.37 ? 535 TYR B CZ    1 
ATOM   5014  O OH    . TYR B 2 535 ? 181.884 146.096 133.215 1.00 178.37 ? 535 TYR B OH    1 
ATOM   5015  N N     . LYS B 2 536 ? 177.113 139.186 133.347 1.00 180.89 ? 536 LYS B N     1 
ATOM   5016  C CA    . LYS B 2 536 ? 176.430 137.979 132.900 1.00 180.89 ? 536 LYS B CA    1 
ATOM   5017  C C     . LYS B 2 536 ? 176.358 138.013 131.381 1.00 180.89 ? 536 LYS B C     1 
ATOM   5018  O O     . LYS B 2 536 ? 175.619 138.822 130.810 1.00 180.89 ? 536 LYS B O     1 
ATOM   5019  C CB    . LYS B 2 536 ? 175.032 137.875 133.513 1.00 180.89 ? 536 LYS B CB    1 
ATOM   5020  C CG    . LYS B 2 536 ? 174.292 136.594 133.162 1.00 180.89 ? 536 LYS B CG    1 
ATOM   5021  C CD    . LYS B 2 536 ? 173.289 136.816 132.041 1.00 180.89 ? 536 LYS B CD    1 
ATOM   5022  C CE    . LYS B 2 536 ? 172.543 135.536 131.711 1.00 180.89 ? 536 LYS B CE    1 
ATOM   5023  N NZ    . LYS B 2 536 ? 171.700 135.079 132.849 1.00 180.89 ? 536 LYS B NZ    1 
ATOM   5024  N N     . VAL B 2 537 ? 177.124 137.142 130.733 1.00 202.79 ? 537 VAL B N     1 
ATOM   5025  C CA    . VAL B 2 537 ? 177.209 137.086 129.279 1.00 202.79 ? 537 VAL B CA    1 
ATOM   5026  C C     . VAL B 2 537 ? 176.494 135.827 128.815 1.00 202.79 ? 537 VAL B C     1 
ATOM   5027  O O     . VAL B 2 537 ? 176.770 134.729 129.313 1.00 202.79 ? 537 VAL B O     1 
ATOM   5028  C CB    . VAL B 2 537 ? 178.665 137.102 128.792 1.00 202.79 ? 537 VAL B CB    1 
ATOM   5029  C CG1   . VAL B 2 537 ? 178.719 136.917 127.285 1.00 202.79 ? 537 VAL B CG1   1 
ATOM   5030  C CG2   . VAL B 2 537 ? 179.340 138.400 129.197 1.00 202.79 ? 537 VAL B CG2   1 
ATOM   5031  N N     . LYS B 2 538 ? 175.577 135.986 127.864 1.00 222.02 ? 538 LYS B N     1 
ATOM   5032  C CA    . LYS B 2 538 ? 174.789 134.881 127.328 1.00 222.02 ? 538 LYS B CA    1 
ATOM   5033  C C     . LYS B 2 538 ? 174.838 134.937 125.807 1.00 222.02 ? 538 LYS B C     1 
ATOM   5034  O O     . LYS B 2 538 ? 174.273 135.851 125.196 1.00 222.02 ? 538 LYS B O     1 
ATOM   5035  C CB    . LYS B 2 538 ? 173.349 134.944 127.833 1.00 222.02 ? 538 LYS B CB    1 
ATOM   5036  C CG    . LYS B 2 538 ? 172.474 133.801 127.356 1.00 222.02 ? 538 LYS B CG    1 
ATOM   5037  C CD    . LYS B 2 538 ? 171.094 133.870 127.985 1.00 222.02 ? 538 LYS B CD    1 
ATOM   5038  C CE    . LYS B 2 538 ? 170.165 132.823 127.394 1.00 222.02 ? 538 LYS B CE    1 
ATOM   5039  N NZ    . LYS B 2 538 ? 170.609 131.441 127.723 1.00 222.02 ? 538 LYS B NZ    1 
ATOM   5040  N N     . LYS B 2 539 ? 175.508 133.964 125.199 1.00 236.75 ? 539 LYS B N     1 
ATOM   5041  C CA    . LYS B 2 539 ? 175.560 133.818 123.747 1.00 236.75 ? 539 LYS B CA    1 
ATOM   5042  C C     . LYS B 2 539 ? 174.723 132.598 123.382 1.00 236.75 ? 539 LYS B C     1 
ATOM   5043  O O     . LYS B 2 539 ? 175.247 131.487 123.268 1.00 236.75 ? 539 LYS B O     1 
ATOM   5044  C CB    . LYS B 2 539 ? 176.997 133.674 123.257 1.00 236.75 ? 539 LYS B CB    1 
ATOM   5045  C CG    . LYS B 2 539 ? 177.850 134.914 123.447 1.00 236.75 ? 539 LYS B CG    1 
ATOM   5046  C CD    . LYS B 2 539 ? 179.254 134.694 122.911 1.00 236.75 ? 539 LYS B CD    1 
ATOM   5047  C CE    . LYS B 2 539 ? 180.087 135.959 123.009 1.00 236.75 ? 539 LYS B CE    1 
ATOM   5048  N NZ    . LYS B 2 539 ? 180.351 136.335 124.423 1.00 236.75 ? 539 LYS B NZ    1 
ATOM   5049  N N     . GLY B 2 540 ? 173.422 132.810 123.195 1.00 241.40 ? 540 GLY B N     1 
ATOM   5050  C CA    . GLY B 2 540 ? 172.515 131.710 122.936 1.00 241.40 ? 540 GLY B CA    1 
ATOM   5051  C C     . GLY B 2 540 ? 172.478 130.729 124.089 1.00 241.40 ? 540 GLY B C     1 
ATOM   5052  O O     . GLY B 2 540 ? 171.935 131.030 125.155 1.00 241.40 ? 540 GLY B O     1 
ATOM   5053  N N     . LYS B 2 541 ? 173.057 129.546 123.883 1.00 246.56 ? 541 LYS B N     1 
ATOM   5054  C CA    . LYS B 2 541 ? 173.160 128.571 124.961 1.00 246.56 ? 541 LYS B CA    1 
ATOM   5055  C C     . LYS B 2 541 ? 174.313 128.886 125.904 1.00 246.56 ? 541 LYS B C     1 
ATOM   5056  O O     . LYS B 2 541 ? 174.224 128.603 127.104 1.00 246.56 ? 541 LYS B O     1 
ATOM   5057  C CB    . LYS B 2 541 ? 173.328 127.166 124.380 1.00 246.56 ? 541 LYS B CB    1 
ATOM   5058  C CG    . LYS B 2 541 ? 173.399 126.063 125.421 1.00 246.56 ? 541 LYS B CG    1 
ATOM   5059  C CD    . LYS B 2 541 ? 173.467 124.695 124.769 1.00 246.56 ? 541 LYS B CD    1 
ATOM   5060  C CE    . LYS B 2 541 ? 173.686 123.608 125.806 1.00 246.56 ? 541 LYS B CE    1 
ATOM   5061  N NZ    . LYS B 2 541 ? 172.523 123.482 126.725 1.00 246.56 ? 541 LYS B NZ    1 
ATOM   5062  N N     . GLN B 2 542 ? 175.387 129.477 125.388 1.00 239.94 ? 542 GLN B N     1 
ATOM   5063  C CA    . GLN B 2 542 ? 176.595 129.715 126.171 1.00 239.94 ? 542 GLN B CA    1 
ATOM   5064  C C     . GLN B 2 542 ? 176.343 130.839 127.170 1.00 239.94 ? 542 GLN B C     1 
ATOM   5065  O O     . GLN B 2 542 ? 176.187 132.002 126.784 1.00 239.94 ? 542 GLN B O     1 
ATOM   5066  C CB    . GLN B 2 542 ? 177.763 130.053 125.250 1.00 239.94 ? 542 GLN B CB    1 
ATOM   5067  C CG    . GLN B 2 542 ? 179.091 130.222 125.966 1.00 239.94 ? 542 GLN B CG    1 
ATOM   5068  C CD    . GLN B 2 542 ? 180.230 130.517 125.011 1.00 239.94 ? 542 GLN B CD    1 
ATOM   5069  O OE1   . GLN B 2 542 ? 180.027 130.638 123.803 1.00 239.94 ? 542 GLN B OE1   1 
ATOM   5070  N NE2   . GLN B 2 542 ? 181.438 130.636 125.550 1.00 239.94 ? 542 GLN B NE2   1 
ATOM   5071  N N     . GLU B 2 543 ? 176.301 130.492 128.451 1.00 220.14 ? 543 GLU B N     1 
ATOM   5072  C CA    . GLU B 2 543 ? 176.232 131.462 129.533 1.00 220.14 ? 543 GLU B CA    1 
ATOM   5073  C C     . GLU B 2 543 ? 177.604 131.607 130.180 1.00 220.14 ? 543 GLU B C     1 
ATOM   5074  O O     . GLU B 2 543 ? 178.493 130.771 129.998 1.00 220.14 ? 543 GLU B O     1 
ATOM   5075  C CB    . GLU B 2 543 ? 175.204 131.039 130.583 1.00 220.14 ? 543 GLU B CB    1 
ATOM   5076  C CG    . GLU B 2 543 ? 175.586 129.778 131.336 1.00 220.14 ? 543 GLU B CG    1 
ATOM   5077  C CD    . GLU B 2 543 ? 174.542 129.367 132.351 1.00 220.14 ? 543 GLU B CD    1 
ATOM   5078  O OE1   . GLU B 2 543 ? 173.508 130.059 132.455 1.00 220.14 ? 543 GLU B OE1   1 
ATOM   5079  O OE2   . GLU B 2 543 ? 174.756 128.353 133.046 1.00 220.14 ? 543 GLU B OE2   1 
ATOM   5080  N N     . GLN B 2 544 ? 177.769 132.683 130.946 1.00 198.04 ? 544 GLN B N     1 
ATOM   5081  C CA    . GLN B 2 544 ? 179.054 132.947 131.579 1.00 198.04 ? 544 GLN B CA    1 
ATOM   5082  C C     . GLN B 2 544 ? 178.870 133.950 132.706 1.00 198.04 ? 544 GLN B C     1 
ATOM   5083  O O     . GLN B 2 544 ? 178.190 134.965 132.530 1.00 198.04 ? 544 GLN B O     1 
ATOM   5084  C CB    . GLN B 2 544 ? 180.067 133.475 130.558 1.00 198.04 ? 544 GLN B CB    1 
ATOM   5085  C CG    . GLN B 2 544 ? 181.465 133.653 131.115 1.00 198.04 ? 544 GLN B CG    1 
ATOM   5086  C CD    . GLN B 2 544 ? 182.098 132.336 131.508 1.00 198.04 ? 544 GLN B CD    1 
ATOM   5087  O OE1   . GLN B 2 544 ? 181.964 131.335 130.805 1.00 198.04 ? 544 GLN B OE1   1 
ATOM   5088  N NE2   . GLN B 2 544 ? 182.792 132.328 132.640 1.00 198.04 ? 544 GLN B NE2   1 
ATOM   5089  N N     . TYR B 2 545 ? 179.471 133.659 133.856 1.00 181.46 ? 545 TYR B N     1 
ATOM   5090  C CA    . TYR B 2 545 ? 179.526 134.589 134.975 1.00 181.46 ? 545 TYR B CA    1 
ATOM   5091  C C     . TYR B 2 545 ? 180.907 135.229 135.010 1.00 181.46 ? 545 TYR B C     1 
ATOM   5092  O O     . TYR B 2 545 ? 181.916 134.529 135.152 1.00 181.46 ? 545 TYR B O     1 
ATOM   5093  C CB    . TYR B 2 545 ? 179.227 133.884 136.296 1.00 181.46 ? 545 TYR B CB    1 
ATOM   5094  C CG    . TYR B 2 545 ? 177.794 133.446 136.431 1.00 181.46 ? 545 TYR B CG    1 
ATOM   5095  C CD1   . TYR B 2 545 ? 176.805 134.350 136.794 1.00 181.46 ? 545 TYR B CD1   1 
ATOM   5096  C CD2   . TYR B 2 545 ? 177.426 132.130 136.197 1.00 181.46 ? 545 TYR B CD2   1 
ATOM   5097  C CE1   . TYR B 2 545 ? 175.490 133.956 136.919 1.00 181.46 ? 545 TYR B CE1   1 
ATOM   5098  C CE2   . TYR B 2 545 ? 176.113 131.726 136.321 1.00 181.46 ? 545 TYR B CE2   1 
ATOM   5099  C CZ    . TYR B 2 545 ? 175.149 132.642 136.682 1.00 181.46 ? 545 TYR B CZ    1 
ATOM   5100  O OH    . TYR B 2 545 ? 173.839 132.240 136.805 1.00 181.46 ? 545 TYR B OH    1 
ATOM   5101  N N     . ILE B 2 546 ? 180.949 136.550 134.881 1.00 186.99 ? 546 ILE B N     1 
ATOM   5102  C CA    . ILE B 2 546 ? 182.195 137.302 134.836 1.00 186.99 ? 546 ILE B CA    1 
ATOM   5103  C C     . ILE B 2 546 ? 182.173 138.328 135.958 1.00 186.99 ? 546 ILE B C     1 
ATOM   5104  O O     . ILE B 2 546 ? 181.183 139.049 136.127 1.00 186.99 ? 546 ILE B O     1 
ATOM   5105  C CB    . ILE B 2 546 ? 182.395 137.972 133.467 1.00 186.99 ? 546 ILE B CB    1 
ATOM   5106  C CG1   . ILE B 2 546 ? 182.501 136.895 132.386 1.00 186.99 ? 546 ILE B CG1   1 
ATOM   5107  C CG2   . ILE B 2 546 ? 183.635 138.847 133.479 1.00 186.99 ? 546 ILE B CG2   1 
ATOM   5108  C CD1   . ILE B 2 546 ? 182.414 137.415 130.979 1.00 186.99 ? 546 ILE B CD1   1 
ATOM   5109  N N     . LYS B 2 547 ? 183.264 138.390 136.722 1.00 183.80 ? 547 LYS B N     1 
ATOM   5110  C CA    . LYS B 2 547 ? 183.311 139.184 137.939 1.00 183.80 ? 547 LYS B CA    1 
ATOM   5111  C C     . LYS B 2 547 ? 184.267 140.365 137.882 1.00 183.80 ? 547 LYS B C     1 
ATOM   5112  O O     . LYS B 2 547 ? 184.150 141.267 138.717 1.00 183.80 ? 547 LYS B O     1 
ATOM   5113  C CB    . LYS B 2 547 ? 183.713 138.301 139.128 1.00 183.80 ? 547 LYS B CB    1 
ATOM   5114  C CG    . LYS B 2 547 ? 185.132 137.770 139.027 1.00 183.80 ? 547 LYS B CG    1 
ATOM   5115  C CD    . LYS B 2 547 ? 185.484 136.876 140.200 1.00 183.80 ? 547 LYS B CD    1 
ATOM   5116  C CE    . LYS B 2 547 ? 186.916 136.381 140.091 1.00 183.80 ? 547 LYS B CE    1 
ATOM   5117  N NZ    . LYS B 2 547 ? 187.294 135.502 141.229 1.00 183.80 ? 547 LYS B NZ    1 
ATOM   5118  N N     . ASP B 2 548 ? 185.203 140.387 136.938 1.00 200.93 ? 548 ASP B N     1 
ATOM   5119  C CA    . ASP B 2 548 ? 186.269 141.376 136.946 1.00 200.93 ? 548 ASP B CA    1 
ATOM   5120  C C     . ASP B 2 548 ? 186.433 141.995 135.566 1.00 200.93 ? 548 ASP B C     1 
ATOM   5121  O O     . ASP B 2 548 ? 186.092 141.396 134.543 1.00 200.93 ? 548 ASP B O     1 
ATOM   5122  C CB    . ASP B 2 548 ? 187.593 140.754 137.402 1.00 200.93 ? 548 ASP B CB    1 
ATOM   5123  C CG    . ASP B 2 548 ? 187.555 140.304 138.848 1.00 200.93 ? 548 ASP B CG    1 
ATOM   5124  O OD1   . ASP B 2 548 ? 186.804 140.910 139.641 1.00 200.93 ? 548 ASP B OD1   1 
ATOM   5125  O OD2   . ASP B 2 548 ? 188.273 139.342 139.192 1.00 200.93 ? 548 ASP B OD2   1 
ATOM   5126  N N     . ASP B 2 549 ? 186.984 143.209 135.554 1.00 219.16 ? 549 ASP B N     1 
ATOM   5127  C CA    . ASP B 2 549 ? 187.187 143.920 134.297 1.00 219.16 ? 549 ASP B CA    1 
ATOM   5128  C C     . ASP B 2 549 ? 188.223 143.220 133.426 1.00 219.16 ? 549 ASP B C     1 
ATOM   5129  O O     . ASP B 2 549 ? 188.018 143.056 132.217 1.00 219.16 ? 549 ASP B O     1 
ATOM   5130  C CB    . ASP B 2 549 ? 187.605 145.362 134.582 1.00 219.16 ? 549 ASP B CB    1 
ATOM   5131  C CG    . ASP B 2 549 ? 187.539 146.244 133.353 1.00 219.16 ? 549 ASP B CG    1 
ATOM   5132  O OD1   . ASP B 2 549 ? 187.169 145.744 132.271 1.00 219.16 ? 549 ASP B OD1   1 
ATOM   5133  O OD2   . ASP B 2 549 ? 187.858 147.446 133.472 1.00 219.16 ? 549 ASP B OD2   1 
ATOM   5134  N N     . GLU B 2 550 ? 189.343 142.802 134.018 1.00 224.45 ? 550 GLU B N     1 
ATOM   5135  C CA    . GLU B 2 550 ? 190.358 142.091 133.248 1.00 224.45 ? 550 GLU B CA    1 
ATOM   5136  C C     . GLU B 2 550 ? 189.842 140.740 132.772 1.00 224.45 ? 550 GLU B C     1 
ATOM   5137  O O     . GLU B 2 550 ? 190.180 140.295 131.668 1.00 224.45 ? 550 GLU B O     1 
ATOM   5138  C CB    . GLU B 2 550 ? 191.626 141.920 134.085 1.00 224.45 ? 550 GLU B CB    1 
ATOM   5139  C CG    . GLU B 2 550 ? 192.790 141.294 133.334 1.00 224.45 ? 550 GLU B CG    1 
ATOM   5140  C CD    . GLU B 2 550 ? 194.045 141.193 134.180 1.00 224.45 ? 550 GLU B CD    1 
ATOM   5141  O OE1   . GLU B 2 550 ? 193.996 141.577 135.367 1.00 224.45 ? 550 GLU B OE1   1 
ATOM   5142  O OE2   . GLU B 2 550 ? 195.081 140.733 133.656 1.00 224.45 ? 550 GLU B OE2   1 
ATOM   5143  N N     . ALA B 2 551 ? 189.019 140.076 133.586 1.00 221.77 ? 551 ALA B N     1 
ATOM   5144  C CA    . ALA B 2 551 ? 188.403 138.830 133.149 1.00 221.77 ? 551 ALA B CA    1 
ATOM   5145  C C     . ALA B 2 551 ? 187.488 139.064 131.956 1.00 221.77 ? 551 ALA B C     1 
ATOM   5146  O O     . ALA B 2 551 ? 187.506 138.293 130.991 1.00 221.77 ? 551 ALA B O     1 
ATOM   5147  C CB    . ALA B 2 551 ? 187.630 138.192 134.302 1.00 221.77 ? 551 ALA B CB    1 
ATOM   5148  N N     . MET B 2 552 ? 186.681 140.126 132.005 1.00 225.68 ? 552 MET B N     1 
ATOM   5149  C CA    . MET B 2 552 ? 185.830 140.470 130.870 1.00 225.68 ? 552 MET B CA    1 
ATOM   5150  C C     . MET B 2 552 ? 186.662 140.761 129.630 1.00 225.68 ? 552 MET B C     1 
ATOM   5151  O O     . MET B 2 552 ? 186.298 140.364 128.516 1.00 225.68 ? 552 MET B O     1 
ATOM   5152  C CB    . MET B 2 552 ? 184.959 141.677 131.219 1.00 225.68 ? 552 MET B CB    1 
ATOM   5153  C CG    . MET B 2 552 ? 183.936 142.025 130.156 1.00 225.68 ? 552 MET B CG    1 
ATOM   5154  S SD    . MET B 2 552 ? 182.675 140.751 130.000 1.00 225.68 ? 552 MET B SD    1 
ATOM   5155  C CE    . MET B 2 552 ? 182.166 140.980 128.301 1.00 225.68 ? 552 MET B CE    1 
ATOM   5156  N N     . ASP B 2 553 ? 187.783 141.459 129.807 1.00 233.81 ? 553 ASP B N     1 
ATOM   5157  C CA    . ASP B 2 553 ? 188.647 141.783 128.678 1.00 233.81 ? 553 ASP B CA    1 
ATOM   5158  C C     . ASP B 2 553 ? 189.217 140.518 128.050 1.00 233.81 ? 553 ASP B C     1 
ATOM   5159  O O     . ASP B 2 553 ? 189.205 140.355 126.823 1.00 233.81 ? 553 ASP B O     1 
ATOM   5160  C CB    . ASP B 2 553 ? 189.768 142.711 129.142 1.00 233.81 ? 553 ASP B CB    1 
ATOM   5161  C CG    . ASP B 2 553 ? 189.250 144.052 129.620 1.00 233.81 ? 553 ASP B CG    1 
ATOM   5162  O OD1   . ASP B 2 553 ? 188.196 144.495 129.118 1.00 233.81 ? 553 ASP B OD1   1 
ATOM   5163  O OD2   . ASP B 2 553 ? 189.890 144.657 130.506 1.00 233.81 ? 553 ASP B OD2   1 
ATOM   5164  N N     . GLN B 2 554 ? 189.721 139.606 128.884 1.00 237.40 ? 554 GLN B N     1 
ATOM   5165  C CA    . GLN B 2 554 ? 190.267 138.355 128.368 1.00 237.40 ? 554 GLN B CA    1 
ATOM   5166  C C     . GLN B 2 554 ? 189.183 137.512 127.709 1.00 237.40 ? 554 GLN B C     1 
ATOM   5167  O O     . GLN B 2 554 ? 189.436 136.839 126.704 1.00 237.40 ? 554 GLN B O     1 
ATOM   5168  C CB    . GLN B 2 554 ? 190.947 137.573 129.491 1.00 237.40 ? 554 GLN B CB    1 
ATOM   5169  C CG    . GLN B 2 554 ? 192.196 138.237 130.040 1.00 237.40 ? 554 GLN B CG    1 
ATOM   5170  C CD    . GLN B 2 554 ? 192.838 137.430 131.149 1.00 237.40 ? 554 GLN B CD    1 
ATOM   5171  O OE1   . GLN B 2 554 ? 192.317 136.393 131.560 1.00 237.40 ? 554 GLN B OE1   1 
ATOM   5172  N NE2   . GLN B 2 554 ? 193.977 137.902 131.642 1.00 237.40 ? 554 GLN B NE2   1 
ATOM   5173  N N     . TYR B 2 555 ? 187.963 137.550 128.249 1.00 238.60 ? 555 TYR B N     1 
ATOM   5174  C CA    . TYR B 2 555 ? 186.860 136.813 127.644 1.00 238.60 ? 555 TYR B CA    1 
ATOM   5175  C C     . TYR B 2 555 ? 186.523 137.363 126.265 1.00 238.60 ? 555 TYR B C     1 
ATOM   5176  O O     . TYR B 2 555 ? 186.316 136.599 125.315 1.00 238.60 ? 555 TYR B O     1 
ATOM   5177  C CB    . TYR B 2 555 ? 185.639 136.868 128.561 1.00 238.60 ? 555 TYR B CB    1 
ATOM   5178  C CG    . TYR B 2 555 ? 184.440 136.107 128.049 1.00 238.60 ? 555 TYR B CG    1 
ATOM   5179  C CD1   . TYR B 2 555 ? 184.391 134.722 128.117 1.00 238.60 ? 555 TYR B CD1   1 
ATOM   5180  C CD2   . TYR B 2 555 ? 183.352 136.774 127.505 1.00 238.60 ? 555 TYR B CD2   1 
ATOM   5181  C CE1   . TYR B 2 555 ? 183.294 134.022 127.652 1.00 238.60 ? 555 TYR B CE1   1 
ATOM   5182  C CE2   . TYR B 2 555 ? 182.251 136.084 127.038 1.00 238.60 ? 555 TYR B CE2   1 
ATOM   5183  C CZ    . TYR B 2 555 ? 182.227 134.708 127.114 1.00 238.60 ? 555 TYR B CZ    1 
ATOM   5184  O OH    . TYR B 2 555 ? 181.131 134.018 126.649 1.00 238.60 ? 555 TYR B OH    1 
ATOM   5185  N N     . GLN B 2 556 ? 186.457 138.690 126.140 1.00 245.22 ? 556 GLN B N     1 
ATOM   5186  C CA    . GLN B 2 556 ? 186.216 139.298 124.835 1.00 245.22 ? 556 GLN B CA    1 
ATOM   5187  C C     . GLN B 2 556 ? 187.326 138.948 123.855 1.00 245.22 ? 556 GLN B C     1 
ATOM   5188  O O     . GLN B 2 556 ? 187.061 138.660 122.681 1.00 245.22 ? 556 GLN B O     1 
ATOM   5189  C CB    . GLN B 2 556 ? 186.085 140.813 124.975 1.00 245.22 ? 556 GLN B CB    1 
ATOM   5190  C CG    . GLN B 2 556 ? 184.839 141.266 125.713 1.00 245.22 ? 556 GLN B CG    1 
ATOM   5191  C CD    . GLN B 2 556 ? 184.766 142.773 125.849 1.00 245.22 ? 556 GLN B CD    1 
ATOM   5192  O OE1   . GLN B 2 556 ? 185.689 143.487 125.459 1.00 245.22 ? 556 GLN B OE1   1 
ATOM   5193  N NE2   . GLN B 2 556 ? 183.663 143.266 126.399 1.00 245.22 ? 556 GLN B NE2   1 
ATOM   5194  N N     . ILE B 2 557 ? 188.577 138.963 124.319 1.00 250.51 ? 557 ILE B N     1 
ATOM   5195  C CA    . ILE B 2 557 ? 189.695 138.608 123.449 1.00 250.51 ? 557 ILE B CA    1 
ATOM   5196  C C     . ILE B 2 557 ? 189.570 137.165 122.978 1.00 250.51 ? 557 ILE B C     1 
ATOM   5197  O O     . ILE B 2 557 ? 189.759 136.863 121.793 1.00 250.51 ? 557 ILE B O     1 
ATOM   5198  C CB    . ILE B 2 557 ? 191.034 138.856 124.168 1.00 250.51 ? 557 ILE B CB    1 
ATOM   5199  C CG1   . ILE B 2 557 ? 191.252 140.354 124.389 1.00 250.51 ? 557 ILE B CG1   1 
ATOM   5200  C CG2   . ILE B 2 557 ? 192.187 138.253 123.384 1.00 250.51 ? 557 ILE B CG2   1 
ATOM   5201  C CD1   . ILE B 2 557 ? 192.412 140.668 125.304 1.00 250.51 ? 557 ILE B CD1   1 
ATOM   5202  N N     . SER B 2 558 ? 189.240 136.253 123.895 1.00 256.50 ? 558 SER B N     1 
ATOM   5203  C CA    . SER B 2 558 ? 189.119 134.846 123.529 1.00 256.50 ? 558 SER B CA    1 
ATOM   5204  C C     . SER B 2 558 ? 187.967 134.625 122.556 1.00 256.50 ? 558 SER B C     1 
ATOM   5205  O O     . SER B 2 558 ? 188.073 133.803 121.638 1.00 256.50 ? 558 SER B O     1 
ATOM   5206  C CB    . SER B 2 558 ? 188.937 133.993 124.784 1.00 256.50 ? 558 SER B CB    1 
ATOM   5207  O OG    . SER B 2 558 ? 188.804 132.622 124.450 1.00 256.50 ? 558 SER B OG    1 
ATOM   5208  N N     . ILE B 2 559 ? 186.861 135.349 122.736 1.00 256.27 ? 559 ILE B N     1 
ATOM   5209  C CA    . ILE B 2 559 ? 185.739 135.222 121.811 1.00 256.27 ? 559 ILE B CA    1 
ATOM   5210  C C     . ILE B 2 559 ? 186.112 135.761 120.436 1.00 256.27 ? 559 ILE B C     1 
ATOM   5211  O O     . ILE B 2 559 ? 185.754 135.177 119.407 1.00 256.27 ? 559 ILE B O     1 
ATOM   5212  C CB    . ILE B 2 559 ? 184.492 135.923 122.379 1.00 256.27 ? 559 ILE B CB    1 
ATOM   5213  C CG1   . ILE B 2 559 ? 184.035 135.232 123.663 1.00 256.27 ? 559 ILE B CG1   1 
ATOM   5214  C CG2   . ILE B 2 559 ? 183.373 135.944 121.348 1.00 256.27 ? 559 ILE B CG2   1 
ATOM   5215  C CD1   . ILE B 2 559 ? 183.650 133.782 123.469 1.00 256.27 ? 559 ILE B CD1   1 
ATOM   5216  N N     . ALA B 2 560 ? 186.838 136.879 120.391 1.00 261.84 ? 560 ALA B N     1 
ATOM   5217  C CA    . ALA B 2 560 ? 187.247 137.428 119.103 1.00 261.84 ? 560 ALA B CA    1 
ATOM   5218  C C     . ALA B 2 560 ? 188.274 136.540 118.413 1.00 261.84 ? 560 ALA B C     1 
ATOM   5219  O O     . ALA B 2 560 ? 188.365 136.541 117.180 1.00 261.84 ? 560 ALA B O     1 
ATOM   5220  C CB    . ALA B 2 560 ? 187.802 138.839 119.284 1.00 261.84 ? 560 ALA B CB    1 
ATOM   5221  N N     . LEU B 2 561 ? 189.049 135.779 119.183 1.00 257.45 ? 561 LEU B N     1 
ATOM   5222  C CA    . LEU B 2 561 ? 190.097 134.916 118.643 1.00 257.45 ? 561 LEU B CA    1 
ATOM   5223  C C     . LEU B 2 561 ? 189.685 133.450 118.622 1.00 257.45 ? 561 LEU B C     1 
ATOM   5224  O O     . LEU B 2 561 ? 190.486 132.570 118.947 1.00 257.45 ? 561 LEU B O     1 
ATOM   5225  C CB    . LEU B 2 561 ? 191.389 135.094 119.435 1.00 257.45 ? 561 LEU B CB    1 
ATOM   5226  C CG    . LEU B 2 561 ? 192.067 136.459 119.315 1.00 257.45 ? 561 LEU B CG    1 
ATOM   5227  C CD1   . LEU B 2 561 ? 193.269 136.535 120.240 1.00 257.45 ? 561 LEU B CD1   1 
ATOM   5228  C CD2   . LEU B 2 561 ? 192.474 136.730 117.876 1.00 257.45 ? 561 LEU B CD2   1 
ATOM   5229  N N     . ASP B 2 562 ? 188.442 133.154 118.247 1.00 267.60 ? 562 ASP B N     1 
ATOM   5230  C CA    . ASP B 2 562 ? 187.977 131.773 118.228 1.00 267.60 ? 562 ASP B CA    1 
ATOM   5231  C C     . ASP B 2 562 ? 188.602 130.990 117.081 1.00 267.60 ? 562 ASP B C     1 
ATOM   5232  O O     . ASP B 2 562 ? 187.919 130.646 116.110 1.00 267.60 ? 562 ASP B O     1 
ATOM   5233  C CB    . ASP B 2 562 ? 186.452 131.718 118.120 1.00 267.60 ? 562 ASP B CB    1 
ATOM   5234  C CG    . ASP B 2 562 ? 185.761 132.153 119.394 1.00 267.60 ? 562 ASP B CG    1 
ATOM   5235  O OD1   . ASP B 2 562 ? 186.351 131.985 120.480 1.00 267.60 ? 562 ASP B OD1   1 
ATOM   5236  O OD2   . ASP B 2 562 ? 184.620 132.653 119.310 1.00 267.60 ? 562 ASP B OD2   1 
ATOM   5237  N N     . GLY B 2 563 ? 189.896 130.704 117.188 1.00 278.36 ? 563 GLY B N     1 
ATOM   5238  C CA    . GLY B 2 563 ? 190.568 129.861 116.211 1.00 278.36 ? 563 GLY B CA    1 
ATOM   5239  C C     . GLY B 2 563 ? 190.609 130.424 114.807 1.00 278.36 ? 563 GLY B C     1 
ATOM   5240  O O     . GLY B 2 563 ? 190.370 129.689 113.841 1.00 278.36 ? 563 GLY B O     1 
ATOM   5241  N N     . ALA B 2 564 ? 190.907 131.713 114.668 1.00 284.45 ? 564 ALA B N     1 
ATOM   5242  C CA    . ALA B 2 564 ? 191.033 132.303 113.346 1.00 284.45 ? 564 ALA B CA    1 
ATOM   5243  C C     . ALA B 2 564 ? 192.346 131.867 112.695 1.00 284.45 ? 564 ALA B C     1 
ATOM   5244  O O     . ALA B 2 564 ? 193.249 131.334 113.345 1.00 284.45 ? 564 ALA B O     1 
ATOM   5245  C CB    . ALA B 2 564 ? 190.954 133.827 113.427 1.00 284.45 ? 564 ALA B CB    1 
ATOM   5246  N N     . THR B 2 565 ? 192.445 132.100 111.388 1.00 290.60 ? 565 THR B N     1 
ATOM   5247  C CA    . THR B 2 565 ? 193.618 131.700 110.615 1.00 290.60 ? 565 THR B CA    1 
ATOM   5248  C C     . THR B 2 565 ? 193.920 132.783 109.589 1.00 290.60 ? 565 THR B C     1 
ATOM   5249  O O     . THR B 2 565 ? 193.146 132.981 108.648 1.00 290.60 ? 565 THR B O     1 
ATOM   5250  C CB    . THR B 2 565 ? 193.397 130.351 109.929 1.00 290.60 ? 565 THR B CB    1 
ATOM   5251  O OG1   . THR B 2 565 ? 193.112 129.353 110.917 1.00 290.60 ? 565 THR B OG1   1 
ATOM   5252  C CG2   . THR B 2 565 ? 194.637 129.942 109.156 1.00 290.60 ? 565 THR B CG2   1 
ATOM   5253  N N     . LEU B 2 566 ? 195.045 133.471 109.764 1.00 290.66 ? 566 LEU B N     1 
ATOM   5254  C CA    . LEU B 2 566 ? 195.456 134.539 108.863 1.00 290.66 ? 566 LEU B CA    1 
ATOM   5255  C C     . LEU B 2 566 ? 196.326 133.992 107.739 1.00 290.66 ? 566 LEU B C     1 
ATOM   5256  O O     . LEU B 2 566 ? 197.111 133.062 107.941 1.00 290.66 ? 566 LEU B O     1 
ATOM   5257  C CB    . LEU B 2 566 ? 196.211 135.625 109.632 1.00 290.66 ? 566 LEU B CB    1 
ATOM   5258  C CG    . LEU B 2 566 ? 196.787 136.800 108.841 1.00 290.66 ? 566 LEU B CG    1 
ATOM   5259  C CD1   . LEU B 2 566 ? 195.699 137.553 108.108 1.00 290.66 ? 566 LEU B CD1   1 
ATOM   5260  C CD2   . LEU B 2 566 ? 197.551 137.732 109.769 1.00 290.66 ? 566 LEU B CD2   1 
ATOM   5261  N N     . HIS B 2 567 ? 196.180 134.580 106.551 1.00 297.27 ? 567 HIS B N     1 
ATOM   5262  C CA    . HIS B 2 567 ? 196.956 134.198 105.370 1.00 297.27 ? 567 HIS B CA    1 
ATOM   5263  C C     . HIS B 2 567 ? 197.570 135.458 104.768 1.00 297.27 ? 567 HIS B C     1 
ATOM   5264  O O     . HIS B 2 567 ? 196.947 136.128 103.940 1.00 297.27 ? 567 HIS B O     1 
ATOM   5265  C CB    . HIS B 2 567 ? 196.090 133.463 104.357 1.00 297.27 ? 567 HIS B CB    1 
ATOM   5266  C CG    . HIS B 2 567 ? 195.591 132.138 104.838 1.00 297.27 ? 567 HIS B CG    1 
ATOM   5267  N ND1   . HIS B 2 567 ? 194.406 131.995 105.526 1.00 297.27 ? 567 HIS B ND1   1 
ATOM   5268  C CD2   . HIS B 2 567 ? 196.120 130.896 104.735 1.00 297.27 ? 567 HIS B CD2   1 
ATOM   5269  C CE1   . HIS B 2 567 ? 194.224 130.721 105.822 1.00 297.27 ? 567 HIS B CE1   1 
ATOM   5270  N NE2   . HIS B 2 567 ? 195.250 130.033 105.355 1.00 297.27 ? 567 HIS B NE2   1 
ATOM   5271  N N     . THR B 2 568 ? 198.788 135.778 105.188 1.00 302.38 ? 568 THR B N     1 
ATOM   5272  C CA    . THR B 2 568 ? 199.563 136.839 104.566 1.00 302.38 ? 568 THR B CA    1 
ATOM   5273  C C     . THR B 2 568 ? 200.517 136.225 103.544 1.00 302.38 ? 568 THR B C     1 
ATOM   5274  O O     . THR B 2 568 ? 200.448 135.033 103.235 1.00 302.38 ? 568 THR B O     1 
ATOM   5275  C CB    . THR B 2 568 ? 200.314 137.647 105.622 1.00 302.38 ? 568 THR B CB    1 
ATOM   5276  O OG1   . THR B 2 568 ? 201.211 136.787 106.335 1.00 302.38 ? 568 THR B OG1   1 
ATOM   5277  C CG2   . THR B 2 568 ? 199.342 138.279 106.600 1.00 302.38 ? 568 THR B CG2   1 
ATOM   5278  N N     . ASN B 2 569 ? 201.422 137.037 103.002 1.00 305.06 ? 569 ASN B N     1 
ATOM   5279  C CA    . ASN B 2 569 ? 202.468 136.557 102.108 1.00 305.06 ? 569 ASN B CA    1 
ATOM   5280  C C     . ASN B 2 569 ? 203.829 136.524 102.798 1.00 305.06 ? 569 ASN B C     1 
ATOM   5281  O O     . ASN B 2 569 ? 204.866 136.702 102.155 1.00 305.06 ? 569 ASN B O     1 
ATOM   5282  C CB    . ASN B 2 569 ? 202.525 137.408 100.842 1.00 305.06 ? 569 ASN B CB    1 
ATOM   5283  C CG    . ASN B 2 569 ? 201.270 137.280 100.002 1.00 305.06 ? 569 ASN B CG    1 
ATOM   5284  O OD1   . ASN B 2 569 ? 200.522 138.239 99.837  1.00 305.06 ? 569 ASN B OD1   1 
ATOM   5285  N ND2   . ASN B 2 569 ? 201.034 136.088 99.466  1.00 305.06 ? 569 ASN B ND2   1 
ATOM   5286  N N     . ALA B 2 570 ? 203.833 136.293 104.108 1.00 313.48 ? 570 ALA B N     1 
ATOM   5287  C CA    . ALA B 2 570 ? 205.055 136.216 104.892 1.00 313.48 ? 570 ALA B CA    1 
ATOM   5288  C C     . ALA B 2 570 ? 205.600 134.789 104.853 1.00 313.48 ? 570 ALA B C     1 
ATOM   5289  O O     . ALA B 2 570 ? 205.178 133.960 104.042 1.00 313.48 ? 570 ALA B O     1 
ATOM   5290  C CB    . ALA B 2 570 ? 204.798 136.687 106.322 1.00 313.48 ? 570 ALA B CB    1 
ATOM   5291  N N     . SER B 2 571 ? 206.558 134.492 105.734 1.00 321.62 ? 571 SER B N     1 
ATOM   5292  C CA    . SER B 2 571 ? 207.138 133.155 105.787 1.00 321.62 ? 571 SER B CA    1 
ATOM   5293  C C     . SER B 2 571 ? 206.124 132.098 106.206 1.00 321.62 ? 571 SER B C     1 
ATOM   5294  O O     . SER B 2 571 ? 206.300 130.921 105.872 1.00 321.62 ? 571 SER B O     1 
ATOM   5295  C CB    . SER B 2 571 ? 208.331 133.140 106.744 1.00 321.62 ? 571 SER B CB    1 
ATOM   5296  O OG    . SER B 2 571 ? 207.918 133.386 108.077 1.00 321.62 ? 571 SER B OG    1 
ATOM   5297  N N     . ALA B 2 572 ? 205.070 132.485 106.925 1.00 316.44 ? 572 ALA B N     1 
ATOM   5298  C CA    . ALA B 2 572 ? 204.051 131.539 107.355 1.00 316.44 ? 572 ALA B CA    1 
ATOM   5299  C C     . ALA B 2 572 ? 202.910 131.533 106.353 1.00 316.44 ? 572 ALA B C     1 
ATOM   5300  O O     . ALA B 2 572 ? 202.271 132.578 106.155 1.00 316.44 ? 572 ALA B O     1 
ATOM   5301  C CB    . ALA B 2 572 ? 203.532 131.901 108.742 1.00 316.44 ? 572 ALA B CB    1 
ATOM   5302  N N     . PRO B 2 573 ? 202.626 130.406 105.694 1.00 311.86 ? 573 PRO B N     1 
ATOM   5303  C CA    . PRO B 2 573 ? 201.485 130.381 104.760 1.00 311.86 ? 573 PRO B CA    1 
ATOM   5304  C C     . PRO B 2 573 ? 200.155 130.669 105.436 1.00 311.86 ? 573 PRO B C     1 
ATOM   5305  O O     . PRO B 2 573 ? 199.320 131.394 104.879 1.00 311.86 ? 573 PRO B O     1 
ATOM   5306  C CB    . PRO B 2 573 ? 201.546 128.959 104.182 1.00 311.86 ? 573 PRO B CB    1 
ATOM   5307  C CG    . PRO B 2 573 ? 202.968 128.535 104.362 1.00 311.86 ? 573 PRO B CG    1 
ATOM   5308  C CD    . PRO B 2 573 ? 203.404 129.156 105.654 1.00 311.86 ? 573 PRO B CD    1 
ATOM   5309  N N     . ALA B 2 574 ? 199.933 130.117 106.625 1.00 296.46 ? 574 ALA B N     1 
ATOM   5310  C CA    . ALA B 2 574 ? 198.708 130.332 107.391 1.00 296.46 ? 574 ALA B CA    1 
ATOM   5311  C C     . ALA B 2 574 ? 199.103 130.704 108.817 1.00 296.46 ? 574 ALA B C     1 
ATOM   5312  O O     . ALA B 2 574 ? 199.220 129.838 109.688 1.00 296.46 ? 574 ALA B O     1 
ATOM   5313  C CB    . ALA B 2 574 ? 197.816 129.095 107.359 1.00 296.46 ? 574 ALA B CB    1 
ATOM   5314  N N     . LEU B 2 575 ? 199.308 131.997 109.053 1.00 280.89 ? 575 LEU B N     1 
ATOM   5315  C CA    . LEU B 2 575 ? 199.650 132.476 110.387 1.00 280.89 ? 575 LEU B CA    1 
ATOM   5316  C C     . LEU B 2 575 ? 198.423 132.410 111.286 1.00 280.89 ? 575 LEU B C     1 
ATOM   5317  O O     . LEU B 2 575 ? 197.389 133.011 110.978 1.00 280.89 ? 575 LEU B O     1 
ATOM   5318  C CB    . LEU B 2 575 ? 200.186 133.902 110.317 1.00 280.89 ? 575 LEU B CB    1 
ATOM   5319  C CG    . LEU B 2 575 ? 200.611 134.515 111.652 1.00 280.89 ? 575 LEU B CG    1 
ATOM   5320  C CD1   . LEU B 2 575 ? 201.764 133.733 112.260 1.00 280.89 ? 575 LEU B CD1   1 
ATOM   5321  C CD2   . LEU B 2 575 ? 200.983 135.978 111.481 1.00 280.89 ? 575 LEU B CD2   1 
ATOM   5322  N N     . ALA B 2 576 ? 198.536 131.688 112.397 1.00 264.39 ? 576 ALA B N     1 
ATOM   5323  C CA    . ALA B 2 576 ? 197.411 131.520 113.305 1.00 264.39 ? 576 ALA B CA    1 
ATOM   5324  C C     . ALA B 2 576 ? 197.910 130.937 114.617 1.00 264.39 ? 576 ALA B C     1 
ATOM   5325  O O     . ALA B 2 576 ? 199.049 130.471 114.718 1.00 264.39 ? 576 ALA B O     1 
ATOM   5326  C CB    . ALA B 2 576 ? 196.332 130.614 112.704 1.00 264.39 ? 576 ALA B CB    1 
ATOM   5327  N N     . GLY B 2 577 ? 197.039 130.975 115.621 1.00 239.40 ? 577 GLY B N     1 
ATOM   5328  C CA    . GLY B 2 577 ? 197.277 130.262 116.858 1.00 239.40 ? 577 GLY B CA    1 
ATOM   5329  C C     . GLY B 2 577 ? 197.771 131.096 118.021 1.00 239.40 ? 577 GLY B C     1 
ATOM   5330  O O     . GLY B 2 577 ? 197.454 132.285 118.143 1.00 239.40 ? 577 GLY B O     1 
ATOM   5331  N N     . GLU B 2 578 ? 198.552 130.456 118.892 1.00 229.89 ? 578 GLU B N     1 
ATOM   5332  C CA    . GLU B 2 578 ? 199.030 131.129 120.092 1.00 229.89 ? 578 GLU B CA    1 
ATOM   5333  C C     . GLU B 2 578 ? 199.984 132.264 119.755 1.00 229.89 ? 578 GLU B C     1 
ATOM   5334  O O     . GLU B 2 578 ? 200.051 133.250 120.493 1.00 229.89 ? 578 GLU B O     1 
ATOM   5335  C CB    . GLU B 2 578 ? 199.700 130.121 121.024 1.00 229.89 ? 578 GLU B CB    1 
ATOM   5336  C CG    . GLU B 2 578 ? 198.738 129.092 121.592 1.00 229.89 ? 578 GLU B CG    1 
ATOM   5337  C CD    . GLU B 2 578 ? 199.417 128.115 122.528 1.00 229.89 ? 578 GLU B CD    1 
ATOM   5338  O OE1   . GLU B 2 578 ? 200.660 128.167 122.644 1.00 229.89 ? 578 GLU B OE1   1 
ATOM   5339  O OE2   . GLU B 2 578 ? 198.707 127.297 123.150 1.00 229.89 ? 578 GLU B OE2   1 
ATOM   5340  N N     . ALA B 2 579 ? 200.714 132.155 118.645 1.00 229.21 ? 579 ALA B N     1 
ATOM   5341  C CA    . ALA B 2 579 ? 201.558 133.263 118.213 1.00 229.21 ? 579 ALA B CA    1 
ATOM   5342  C C     . ALA B 2 579 ? 200.720 134.505 117.940 1.00 229.21 ? 579 ALA B C     1 
ATOM   5343  O O     . ALA B 2 579 ? 201.032 135.599 118.426 1.00 229.21 ? 579 ALA B O     1 
ATOM   5344  C CB    . ALA B 2 579 ? 202.356 132.863 116.972 1.00 229.21 ? 579 ALA B CB    1 
ATOM   5345  N N     . LEU B 2 580 ? 199.641 134.350 117.168 1.00 232.35 ? 580 LEU B N     1 
ATOM   5346  C CA    . LEU B 2 580 ? 198.752 135.475 116.892 1.00 232.35 ? 580 LEU B CA    1 
ATOM   5347  C C     . LEU B 2 580 ? 198.093 135.981 118.166 1.00 232.35 ? 580 LEU B C     1 
ATOM   5348  O O     . LEU B 2 580 ? 197.917 137.192 118.346 1.00 232.35 ? 580 LEU B O     1 
ATOM   5349  C CB    . LEU B 2 580 ? 197.693 135.067 115.868 1.00 232.35 ? 580 LEU B CB    1 
ATOM   5350  C CG    . LEU B 2 580 ? 196.688 136.150 115.476 1.00 232.35 ? 580 LEU B CG    1 
ATOM   5351  C CD1   . LEU B 2 580 ? 197.394 137.331 114.835 1.00 232.35 ? 580 LEU B CD1   1 
ATOM   5352  C CD2   . LEU B 2 580 ? 195.632 135.583 114.542 1.00 232.35 ? 580 LEU B CD2   1 
ATOM   5353  N N     . GLU B 2 581 ? 197.715 135.067 119.060 1.00 234.54 ? 581 GLU B N     1 
ATOM   5354  C CA    . GLU B 2 581 ? 197.107 135.476 120.322 1.00 234.54 ? 581 GLU B CA    1 
ATOM   5355  C C     . GLU B 2 581 ? 198.061 136.355 121.125 1.00 234.54 ? 581 GLU B C     1 
ATOM   5356  O O     . GLU B 2 581 ? 197.684 137.431 121.608 1.00 234.54 ? 581 GLU B O     1 
ATOM   5357  C CB    . GLU B 2 581 ? 196.700 134.241 121.126 1.00 234.54 ? 581 GLU B CB    1 
ATOM   5358  C CG    . GLU B 2 581 ? 195.594 133.418 120.482 1.00 234.54 ? 581 GLU B CG    1 
ATOM   5359  C CD    . GLU B 2 581 ? 195.255 132.168 121.273 1.00 234.54 ? 581 GLU B CD    1 
ATOM   5360  O OE1   . GLU B 2 581 ? 195.958 131.883 122.264 1.00 234.54 ? 581 GLU B OE1   1 
ATOM   5361  O OE2   . GLU B 2 581 ? 194.291 131.468 120.899 1.00 234.54 ? 581 GLU B OE2   1 
ATOM   5362  N N     . LYS B 2 582 ? 199.312 135.909 121.267 1.00 225.37 ? 582 LYS B N     1 
ATOM   5363  C CA    . LYS B 2 582 ? 200.306 136.671 122.013 1.00 225.37 ? 582 LYS B CA    1 
ATOM   5364  C C     . LYS B 2 582 ? 200.606 137.999 121.333 1.00 225.37 ? 582 LYS B C     1 
ATOM   5365  O O     . LYS B 2 582 ? 200.807 139.019 122.004 1.00 225.37 ? 582 LYS B O     1 
ATOM   5366  C CB    . LYS B 2 582 ? 201.580 135.840 122.164 1.00 225.37 ? 582 LYS B CB    1 
ATOM   5367  C CG    . LYS B 2 582 ? 202.657 136.473 123.024 1.00 225.37 ? 582 LYS B CG    1 
ATOM   5368  C CD    . LYS B 2 582 ? 203.840 135.530 123.178 1.00 225.37 ? 582 LYS B CD    1 
ATOM   5369  C CE    . LYS B 2 582 ? 204.933 136.144 124.032 1.00 225.37 ? 582 LYS B CE    1 
ATOM   5370  N NZ    . LYS B 2 582 ? 206.091 135.221 124.179 1.00 225.37 ? 582 LYS B NZ    1 
ATOM   5371  N N     . LEU B 2 583 ? 200.635 138.007 119.998 1.00 227.92 ? 583 LEU B N     1 
ATOM   5372  C CA    . LEU B 2 583 ? 200.873 139.250 119.273 1.00 227.92 ? 583 LEU B CA    1 
ATOM   5373  C C     . LEU B 2 583 ? 199.762 140.257 119.533 1.00 227.92 ? 583 LEU B C     1 
ATOM   5374  O O     . LEU B 2 583 ? 200.029 141.436 119.793 1.00 227.92 ? 583 LEU B O     1 
ATOM   5375  C CB    . LEU B 2 583 ? 201.001 138.962 117.779 1.00 227.92 ? 583 LEU B CB    1 
ATOM   5376  C CG    . LEU B 2 583 ? 201.326 140.154 116.882 1.00 227.92 ? 583 LEU B CG    1 
ATOM   5377  C CD1   . LEU B 2 583 ? 202.681 140.735 117.245 1.00 227.92 ? 583 LEU B CD1   1 
ATOM   5378  C CD2   . LEU B 2 583 ? 201.286 139.741 115.421 1.00 227.92 ? 583 LEU B CD2   1 
ATOM   5379  N N     . VAL B 2 584 ? 198.507 139.806 119.477 1.00 228.17 ? 584 VAL B N     1 
ATOM   5380  C CA    . VAL B 2 584 ? 197.382 140.700 119.729 1.00 228.17 ? 584 VAL B CA    1 
ATOM   5381  C C     . VAL B 2 584 ? 197.404 141.190 121.171 1.00 228.17 ? 584 VAL B C     1 
ATOM   5382  O O     . VAL B 2 584 ? 197.097 142.355 121.451 1.00 228.17 ? 584 VAL B O     1 
ATOM   5383  C CB    . VAL B 2 584 ? 196.055 140.000 119.385 1.00 228.17 ? 584 VAL B CB    1 
ATOM   5384  C CG1   . VAL B 2 584 ? 194.876 140.868 119.782 1.00 228.17 ? 584 VAL B CG1   1 
ATOM   5385  C CG2   . VAL B 2 584 ? 195.998 139.682 117.902 1.00 228.17 ? 584 VAL B CG2   1 
ATOM   5386  N N     . SER B 2 585 ? 197.783 140.318 122.107 1.00 226.23 ? 585 SER B N     1 
ATOM   5387  C CA    . SER B 2 585 ? 197.854 140.730 123.507 1.00 226.23 ? 585 SER B CA    1 
ATOM   5388  C C     . SER B 2 585 ? 198.914 141.805 123.714 1.00 226.23 ? 585 SER B C     1 
ATOM   5389  O O     . SER B 2 585 ? 198.676 142.805 124.407 1.00 226.23 ? 585 SER B O     1 
ATOM   5390  C CB    . SER B 2 585 ? 198.142 139.519 124.392 1.00 226.23 ? 585 SER B CB    1 
ATOM   5391  O OG    . SER B 2 585 ? 199.434 139.001 124.133 1.00 226.23 ? 585 SER B OG    1 
ATOM   5392  N N     . GLU B 2 586 ? 200.094 141.614 123.123 1.00 222.35 ? 586 GLU B N     1 
ATOM   5393  C CA    . GLU B 2 586 ? 201.153 142.609 123.246 1.00 222.35 ? 586 GLU B CA    1 
ATOM   5394  C C     . GLU B 2 586 ? 200.752 143.918 122.578 1.00 222.35 ? 586 GLU B C     1 
ATOM   5395  O O     . GLU B 2 586 ? 201.042 145.006 123.094 1.00 222.35 ? 586 GLU B O     1 
ATOM   5396  C CB    . GLU B 2 586 ? 202.447 142.063 122.647 1.00 222.35 ? 586 GLU B CB    1 
ATOM   5397  C CG    . GLU B 2 586 ? 203.651 142.964 122.823 1.00 222.35 ? 586 GLU B CG    1 
ATOM   5398  C CD    . GLU B 2 586 ? 204.921 142.329 122.298 1.00 222.35 ? 586 GLU B CD    1 
ATOM   5399  O OE1   . GLU B 2 586 ? 204.848 141.195 121.780 1.00 222.35 ? 586 GLU B OE1   1 
ATOM   5400  O OE2   . GLU B 2 586 ? 205.992 142.961 122.405 1.00 222.35 ? 586 GLU B OE2   1 
ATOM   5401  N N     . TYR B 2 587 ? 200.067 143.833 121.435 1.00 225.32 ? 587 TYR B N     1 
ATOM   5402  C CA    . TYR B 2 587 ? 199.592 145.038 120.767 1.00 225.32 ? 587 TYR B CA    1 
ATOM   5403  C C     . TYR B 2 587 ? 198.585 145.786 121.628 1.00 225.32 ? 587 TYR B C     1 
ATOM   5404  O O     . TYR B 2 587 ? 198.624 147.017 121.711 1.00 225.32 ? 587 TYR B O     1 
ATOM   5405  C CB    . TYR B 2 587 ? 198.979 144.677 119.415 1.00 225.32 ? 587 TYR B CB    1 
ATOM   5406  C CG    . TYR B 2 587 ? 198.487 145.867 118.628 1.00 225.32 ? 587 TYR B CG    1 
ATOM   5407  C CD1   . TYR B 2 587 ? 199.376 146.702 117.968 1.00 225.32 ? 587 TYR B CD1   1 
ATOM   5408  C CD2   . TYR B 2 587 ? 197.132 146.155 118.545 1.00 225.32 ? 587 TYR B CD2   1 
ATOM   5409  C CE1   . TYR B 2 587 ? 198.929 147.790 117.245 1.00 225.32 ? 587 TYR B CE1   1 
ATOM   5410  C CE2   . TYR B 2 587 ? 196.675 147.242 117.825 1.00 225.32 ? 587 TYR B CE2   1 
ATOM   5411  C CZ    . TYR B 2 587 ? 197.578 148.056 117.177 1.00 225.32 ? 587 TYR B CZ    1 
ATOM   5412  O OH    . TYR B 2 587 ? 197.131 149.139 116.458 1.00 225.32 ? 587 TYR B OH    1 
ATOM   5413  N N     . ASN B 2 588 ? 197.675 145.058 122.280 1.00 223.52 ? 588 ASN B N     1 
ATOM   5414  C CA    . ASN B 2 588 ? 196.696 145.702 123.150 1.00 223.52 ? 588 ASN B CA    1 
ATOM   5415  C C     . ASN B 2 588 ? 197.369 146.358 124.347 1.00 223.52 ? 588 ASN B C     1 
ATOM   5416  O O     . ASN B 2 588 ? 196.992 147.465 124.750 1.00 223.52 ? 588 ASN B O     1 
ATOM   5417  C CB    . ASN B 2 588 ? 195.656 144.685 123.615 1.00 223.52 ? 588 ASN B CB    1 
ATOM   5418  C CG    . ASN B 2 588 ? 194.731 144.251 122.501 1.00 223.52 ? 588 ASN B CG    1 
ATOM   5419  O OD1   . ASN B 2 588 ? 194.279 145.069 121.700 1.00 223.52 ? 588 ASN B OD1   1 
ATOM   5420  N ND2   . ASN B 2 588 ? 194.445 142.956 122.440 1.00 223.52 ? 588 ASN B ND2   1 
ATOM   5421  N N     . ALA B 2 589 ? 198.363 145.686 124.932 1.00 222.29 ? 589 ALA B N     1 
ATOM   5422  C CA    . ALA B 2 589 ? 199.102 146.285 126.040 1.00 222.29 ? 589 ALA B CA    1 
ATOM   5423  C C     . ALA B 2 589 ? 199.801 147.567 125.604 1.00 222.29 ? 589 ALA B C     1 
ATOM   5424  O O     . ALA B 2 589 ? 199.769 148.581 126.316 1.00 222.29 ? 589 ALA B O     1 
ATOM   5425  C CB    . ALA B 2 589 ? 200.112 145.284 126.600 1.00 222.29 ? 589 ALA B CB    1 
ATOM   5426  N N     . THR B 2 590 ? 200.423 147.547 124.424 1.00 219.07 ? 590 THR B N     1 
ATOM   5427  C CA    . THR B 2 590 ? 201.104 148.742 123.937 1.00 219.07 ? 590 THR B CA    1 
ATOM   5428  C C     . THR B 2 590 ? 200.112 149.859 123.635 1.00 219.07 ? 590 THR B C     1 
ATOM   5429  O O     . THR B 2 590 ? 200.394 151.032 123.900 1.00 219.07 ? 590 THR B O     1 
ATOM   5430  C CB    . THR B 2 590 ? 201.934 148.409 122.700 1.00 219.07 ? 590 THR B CB    1 
ATOM   5431  O OG1   . THR B 2 590 ? 202.870 147.373 123.020 1.00 219.07 ? 590 THR B OG1   1 
ATOM   5432  C CG2   . THR B 2 590 ? 202.699 149.636 122.234 1.00 219.07 ? 590 THR B CG2   1 
ATOM   5433  N N     . GLN B 2 591 ? 198.944 149.517 123.089 1.00 217.61 ? 591 GLN B N     1 
ATOM   5434  C CA    . GLN B 2 591 ? 197.930 150.534 122.826 1.00 217.61 ? 591 GLN B CA    1 
ATOM   5435  C C     . GLN B 2 591 ? 197.413 151.146 124.120 1.00 217.61 ? 591 GLN B C     1 
ATOM   5436  O O     . GLN B 2 591 ? 197.168 152.355 124.184 1.00 217.61 ? 591 GLN B O     1 
ATOM   5437  C CB    . GLN B 2 591 ? 196.781 149.938 122.015 1.00 217.61 ? 591 GLN B CB    1 
ATOM   5438  C CG    . GLN B 2 591 ? 197.159 149.553 120.597 1.00 217.61 ? 591 GLN B CG    1 
ATOM   5439  C CD    . GLN B 2 591 ? 197.521 150.756 119.752 1.00 217.61 ? 591 GLN B CD    1 
ATOM   5440  O OE1   . GLN B 2 591 ? 196.903 151.813 119.860 1.00 217.61 ? 591 GLN B OE1   1 
ATOM   5441  N NE2   . GLN B 2 591 ? 198.531 150.601 118.904 1.00 217.61 ? 591 GLN B NE2   1 
ATOM   5442  N N     . LYS B 2 592 ? 197.239 150.330 125.160 1.00 212.56 ? 592 LYS B N     1 
ATOM   5443  C CA    . LYS B 2 592 ? 196.838 150.869 126.455 1.00 212.56 ? 592 LYS B CA    1 
ATOM   5444  C C     . LYS B 2 592 ? 197.900 151.810 127.006 1.00 212.56 ? 592 LYS B C     1 
ATOM   5445  O O     . LYS B 2 592 ? 197.582 152.883 127.534 1.00 212.56 ? 592 LYS B O     1 
ATOM   5446  C CB    . LYS B 2 592 ? 196.569 149.730 127.436 1.00 212.56 ? 592 LYS B CB    1 
ATOM   5447  C CG    . LYS B 2 592 ? 196.054 150.187 128.788 1.00 212.56 ? 592 LYS B CG    1 
ATOM   5448  C CD    . LYS B 2 592 ? 195.731 148.998 129.675 1.00 212.56 ? 592 LYS B CD    1 
ATOM   5449  C CE    . LYS B 2 592 ? 195.230 149.444 131.036 1.00 212.56 ? 592 LYS B CE    1 
ATOM   5450  N NZ    . LYS B 2 592 ? 194.916 148.284 131.913 1.00 212.56 ? 592 LYS B NZ    1 
ATOM   5451  N N     . MET B 2 593 ? 199.171 151.425 126.882 1.00 214.11 ? 593 MET B N     1 
ATOM   5452  C CA    . MET B 2 593 ? 200.253 152.293 127.340 1.00 214.11 ? 593 MET B CA    1 
ATOM   5453  C C     . MET B 2 593 ? 200.274 153.609 126.568 1.00 214.11 ? 593 MET B C     1 
ATOM   5454  O O     . MET B 2 593 ? 200.500 154.680 127.147 1.00 214.11 ? 593 MET B O     1 
ATOM   5455  C CB    . MET B 2 593 ? 201.590 151.567 127.205 1.00 214.11 ? 593 MET B CB    1 
ATOM   5456  C CG    . MET B 2 593 ? 202.777 152.356 127.715 1.00 214.11 ? 593 MET B CG    1 
ATOM   5457  S SD    . MET B 2 593 ? 204.322 151.445 127.564 1.00 214.11 ? 593 MET B SD    1 
ATOM   5458  C CE    . MET B 2 593 ? 204.555 151.478 125.788 1.00 214.11 ? 593 MET B CE    1 
ATOM   5459  N N     . ILE B 2 594 ? 200.040 153.546 125.256 1.00 208.54 ? 594 ILE B N     1 
ATOM   5460  C CA    . ILE B 2 594 ? 200.015 154.758 124.443 1.00 208.54 ? 594 ILE B CA    1 
ATOM   5461  C C     . ILE B 2 594 ? 198.841 155.643 124.836 1.00 208.54 ? 594 ILE B C     1 
ATOM   5462  O O     . ILE B 2 594 ? 198.976 156.867 124.933 1.00 208.54 ? 594 ILE B O     1 
ATOM   5463  C CB    . ILE B 2 594 ? 199.978 154.400 122.948 1.00 208.54 ? 594 ILE B CB    1 
ATOM   5464  C CG1   . ILE B 2 594 ? 201.284 153.726 122.531 1.00 208.54 ? 594 ILE B CG1   1 
ATOM   5465  C CG2   . ILE B 2 594 ? 199.724 155.639 122.107 1.00 208.54 ? 594 ILE B CG2   1 
ATOM   5466  C CD1   . ILE B 2 594 ? 201.234 153.112 121.151 1.00 208.54 ? 594 ILE B CD1   1 
ATOM   5467  N N     . ASN B 2 595 ? 197.670 155.046 125.058 1.00 205.92 ? 595 ASN B N     1 
ATOM   5468  C CA    . ASN B 2 595 ? 196.519 155.827 125.496 1.00 205.92 ? 595 ASN B CA    1 
ATOM   5469  C C     . ASN B 2 595 ? 196.777 156.480 126.845 1.00 205.92 ? 595 ASN B C     1 
ATOM   5470  O O     . ASN B 2 595 ? 196.317 157.601 127.092 1.00 205.92 ? 595 ASN B O     1 
ATOM   5471  C CB    . ASN B 2 595 ? 195.277 154.940 125.564 1.00 205.92 ? 595 ASN B CB    1 
ATOM   5472  C CG    . ASN B 2 595 ? 194.804 154.499 124.197 1.00 205.92 ? 595 ASN B CG    1 
ATOM   5473  O OD1   . ASN B 2 595 ? 194.797 155.283 123.249 1.00 205.92 ? 595 ASN B OD1   1 
ATOM   5474  N ND2   . ASN B 2 595 ? 194.407 153.238 124.086 1.00 205.92 ? 595 ASN B ND2   1 
ATOM   5475  N N     . ARG B 2 596 ? 197.512 155.798 127.725 1.00 208.34 ? 596 ARG B N     1 
ATOM   5476  C CA    . ARG B 2 596 ? 197.856 156.397 129.011 1.00 208.34 ? 596 ARG B CA    1 
ATOM   5477  C C     . ARG B 2 596 ? 198.817 157.567 128.837 1.00 208.34 ? 596 ARG B C     1 
ATOM   5478  O O     . ARG B 2 596 ? 198.626 158.628 129.443 1.00 208.34 ? 596 ARG B O     1 
ATOM   5479  C CB    . ARG B 2 596 ? 198.452 155.344 129.944 1.00 208.34 ? 596 ARG B CB    1 
ATOM   5480  C CG    . ARG B 2 596 ? 197.443 154.313 130.424 1.00 208.34 ? 596 ARG B CG    1 
ATOM   5481  C CD    . ARG B 2 596 ? 198.045 153.354 131.439 1.00 208.34 ? 596 ARG B CD    1 
ATOM   5482  N NE    . ARG B 2 596 ? 199.034 152.461 130.843 1.00 208.34 ? 596 ARG B NE    1 
ATOM   5483  C CZ    . ARG B 2 596 ? 200.326 152.466 131.155 1.00 208.34 ? 596 ARG B CZ    1 
ATOM   5484  N NH1   . ARG B 2 596 ? 200.787 153.315 132.062 1.00 208.34 ? 596 ARG B NH1   1 
ATOM   5485  N NH2   . ARG B 2 596 ? 201.155 151.617 130.565 1.00 208.34 ? 596 ARG B NH2   1 
ATOM   5486  N N     . MET B 2 597 ? 199.850 157.402 128.010 1.00 206.91 ? 597 MET B N     1 
ATOM   5487  C CA    . MET B 2 597 ? 200.806 158.487 127.814 1.00 206.91 ? 597 MET B CA    1 
ATOM   5488  C C     . MET B 2 597 ? 200.273 159.593 126.914 1.00 206.91 ? 597 MET B C     1 
ATOM   5489  O O     . MET B 2 597 ? 200.938 160.625 126.774 1.00 206.91 ? 597 MET B O     1 
ATOM   5490  C CB    . MET B 2 597 ? 202.118 157.961 127.225 1.00 206.91 ? 597 MET B CB    1 
ATOM   5491  C CG    . MET B 2 597 ? 202.009 157.484 125.788 1.00 206.91 ? 597 MET B CG    1 
ATOM   5492  S SD    . MET B 2 597 ? 203.577 156.891 125.121 1.00 206.91 ? 597 MET B SD    1 
ATOM   5493  C CE    . MET B 2 597 ? 203.742 155.322 125.963 1.00 206.91 ? 597 MET B CE    1 
ATOM   5494  N N     . GLU B 2 598 ? 199.105 159.396 126.296 1.00 200.38 ? 598 GLU B N     1 
ATOM   5495  C CA    . GLU B 2 598 ? 198.549 160.399 125.392 1.00 200.38 ? 598 GLU B CA    1 
ATOM   5496  C C     . GLU B 2 598 ? 198.374 161.750 126.072 1.00 200.38 ? 598 GLU B C     1 
ATOM   5497  O O     . GLU B 2 598 ? 198.379 162.787 125.398 1.00 200.38 ? 598 GLU B O     1 
ATOM   5498  C CB    . GLU B 2 598 ? 197.213 159.903 124.832 1.00 200.38 ? 598 GLU B CB    1 
ATOM   5499  C CG    . GLU B 2 598 ? 196.642 160.730 123.685 1.00 200.38 ? 598 GLU B CG    1 
ATOM   5500  C CD    . GLU B 2 598 ? 195.827 161.918 124.166 1.00 200.38 ? 598 GLU B CD    1 
ATOM   5501  O OE1   . GLU B 2 598 ? 195.252 161.835 125.272 1.00 200.38 ? 598 GLU B OE1   1 
ATOM   5502  O OE2   . GLU B 2 598 ? 195.768 162.935 123.444 1.00 200.38 ? 598 GLU B OE2   1 
ATOM   5503  N N     . ARG B 2 599 ? 198.230 161.762 127.399 1.00 192.45 ? 599 ARG B N     1 
ATOM   5504  C CA    . ARG B 2 599 ? 198.035 163.017 128.119 1.00 192.45 ? 599 ARG B CA    1 
ATOM   5505  C C     . ARG B 2 599 ? 199.171 164.002 127.864 1.00 192.45 ? 599 ARG B C     1 
ATOM   5506  O O     . ARG B 2 599 ? 198.979 165.218 127.983 1.00 192.45 ? 599 ARG B O     1 
ATOM   5507  C CB    . ARG B 2 599 ? 197.893 162.731 129.615 1.00 192.45 ? 599 ARG B CB    1 
ATOM   5508  C CG    . ARG B 2 599 ? 197.575 163.943 130.471 1.00 192.45 ? 599 ARG B CG    1 
ATOM   5509  C CD    . ARG B 2 599 ? 197.395 163.549 131.927 1.00 192.45 ? 599 ARG B CD    1 
ATOM   5510  N NE    . ARG B 2 599 ? 197.075 164.700 132.765 1.00 192.45 ? 599 ARG B NE    1 
ATOM   5511  C CZ    . ARG B 2 599 ? 197.988 165.467 133.352 1.00 192.45 ? 599 ARG B CZ    1 
ATOM   5512  N NH1   . ARG B 2 599 ? 199.277 165.205 133.190 1.00 192.45 ? 599 ARG B NH1   1 
ATOM   5513  N NH2   . ARG B 2 599 ? 197.613 166.497 134.098 1.00 192.45 ? 599 ARG B NH2   1 
ATOM   5514  N N     . ARG B 2 600 ? 200.348 163.503 127.491 1.00 189.10 ? 600 ARG B N     1 
ATOM   5515  C CA    . ARG B 2 600 ? 201.518 164.346 127.279 1.00 189.10 ? 600 ARG B CA    1 
ATOM   5516  C C     . ARG B 2 600 ? 201.623 164.845 125.841 1.00 189.10 ? 600 ARG B C     1 
ATOM   5517  O O     . ARG B 2 600 ? 201.711 166.054 125.606 1.00 189.10 ? 600 ARG B O     1 
ATOM   5518  C CB    . ARG B 2 600 ? 202.785 163.574 127.658 1.00 189.10 ? 600 ARG B CB    1 
ATOM   5519  C CG    . ARG B 2 600 ? 202.878 163.230 129.135 1.00 189.10 ? 600 ARG B CG    1 
ATOM   5520  C CD    . ARG B 2 600 ? 204.094 162.368 129.426 1.00 189.10 ? 600 ARG B CD    1 
ATOM   5521  N NE    . ARG B 2 600 ? 205.340 163.073 129.152 1.00 189.10 ? 600 ARG B NE    1 
ATOM   5522  C CZ    . ARG B 2 600 ? 205.964 163.850 130.029 1.00 189.10 ? 600 ARG B CZ    1 
ATOM   5523  N NH1   . ARG B 2 600 ? 205.454 164.024 131.240 1.00 189.10 ? 600 ARG B NH1   1 
ATOM   5524  N NH2   . ARG B 2 600 ? 207.096 164.454 129.696 1.00 189.10 ? 600 ARG B NH2   1 
ATOM   5525  N N     . TYR B 2 601 ? 201.615 163.936 124.875 1.00 191.28 ? 601 TYR B N     1 
ATOM   5526  C CA    . TYR B 2 601 ? 201.894 164.244 123.483 1.00 191.28 ? 601 TYR B CA    1 
ATOM   5527  C C     . TYR B 2 601 ? 200.690 163.931 122.605 1.00 191.28 ? 601 TYR B C     1 
ATOM   5528  O O     . TYR B 2 601 ? 199.796 163.177 123.007 1.00 191.28 ? 601 TYR B O     1 
ATOM   5529  C CB    . TYR B 2 601 ? 203.112 163.446 122.993 1.00 191.28 ? 601 TYR B CB    1 
ATOM   5530  C CG    . TYR B 2 601 ? 204.419 163.884 123.607 1.00 191.28 ? 601 TYR B CG    1 
ATOM   5531  C CD1   . TYR B 2 601 ? 204.520 165.090 124.287 1.00 191.28 ? 601 TYR B CD1   1 
ATOM   5532  C CD2   . TYR B 2 601 ? 205.555 163.094 123.502 1.00 191.28 ? 601 TYR B CD2   1 
ATOM   5533  C CE1   . TYR B 2 601 ? 205.712 165.494 124.849 1.00 191.28 ? 601 TYR B CE1   1 
ATOM   5534  C CE2   . TYR B 2 601 ? 206.752 163.491 124.059 1.00 191.28 ? 601 TYR B CE2   1 
ATOM   5535  C CZ    . TYR B 2 601 ? 206.825 164.692 124.732 1.00 191.28 ? 601 TYR B CZ    1 
ATOM   5536  O OH    . TYR B 2 601 ? 208.017 165.094 125.290 1.00 191.28 ? 601 TYR B OH    1 
ATOM   5537  N N     . PRO B 2 602 ? 200.629 164.498 121.399 1.00 190.07 ? 602 PRO B N     1 
ATOM   5538  C CA    . PRO B 2 602 ? 199.539 164.163 120.476 1.00 190.07 ? 602 PRO B CA    1 
ATOM   5539  C C     . PRO B 2 602 ? 199.560 162.689 120.100 1.00 190.07 ? 602 PRO B C     1 
ATOM   5540  O O     . PRO B 2 602 ? 200.515 161.954 120.360 1.00 190.07 ? 602 PRO B O     1 
ATOM   5541  C CB    . PRO B 2 602 ? 199.813 165.055 119.261 1.00 190.07 ? 602 PRO B CB    1 
ATOM   5542  C CG    . PRO B 2 602 ? 200.605 166.186 119.802 1.00 190.07 ? 602 PRO B CG    1 
ATOM   5543  C CD    . PRO B 2 602 ? 201.463 165.595 120.879 1.00 190.07 ? 602 PRO B CD    1 
ATOM   5544  N N     . LYS B 2 603 ? 198.473 162.259 119.462 1.00 194.84 ? 603 LYS B N     1 
ATOM   5545  C CA    . LYS B 2 603 ? 198.277 160.854 119.138 1.00 194.84 ? 603 LYS B CA    1 
ATOM   5546  C C     . LYS B 2 603 ? 198.669 160.500 117.709 1.00 194.84 ? 603 LYS B C     1 
ATOM   5547  O O     . LYS B 2 603 ? 198.987 159.335 117.442 1.00 194.84 ? 603 LYS B O     1 
ATOM   5548  C CB    . LYS B 2 603 ? 196.811 160.466 119.375 1.00 194.84 ? 603 LYS B CB    1 
ATOM   5549  C CG    . LYS B 2 603 ? 196.529 158.980 119.291 1.00 194.84 ? 603 LYS B CG    1 
ATOM   5550  C CD    . LYS B 2 603 ? 195.055 158.696 119.500 1.00 194.84 ? 603 LYS B CD    1 
ATOM   5551  C CE    . LYS B 2 603 ? 194.661 158.890 120.954 1.00 194.84 ? 603 LYS B CE    1 
ATOM   5552  N NZ    . LYS B 2 603 ? 193.243 158.505 121.195 1.00 194.84 ? 603 LYS B NZ    1 
ATOM   5553  N N     . ALA B 2 604 ? 198.673 161.473 116.797 1.00 201.73 ? 604 ALA B N     1 
ATOM   5554  C CA    . ALA B 2 604 ? 198.994 161.185 115.402 1.00 201.73 ? 604 ALA B CA    1 
ATOM   5555  C C     . ALA B 2 604 ? 200.415 160.655 115.258 1.00 201.73 ? 604 ALA B C     1 
ATOM   5556  O O     . ALA B 2 604 ? 200.646 159.636 114.597 1.00 201.73 ? 604 ALA B O     1 
ATOM   5557  C CB    . ALA B 2 604 ? 198.798 162.440 114.551 1.00 201.73 ? 604 ALA B CB    1 
ATOM   5558  N N     . MET B 2 605 ? 201.385 161.338 115.871 1.00 208.70 ? 605 MET B N     1 
ATOM   5559  C CA    . MET B 2 605 ? 202.772 160.896 115.778 1.00 208.70 ? 605 MET B CA    1 
ATOM   5560  C C     . MET B 2 605 ? 202.974 159.553 116.470 1.00 208.70 ? 605 MET B C     1 
ATOM   5561  O O     . MET B 2 605 ? 203.702 158.688 115.964 1.00 208.70 ? 605 MET B O     1 
ATOM   5562  C CB    . MET B 2 605 ? 203.697 161.954 116.377 1.00 208.70 ? 605 MET B CB    1 
ATOM   5563  C CG    . MET B 2 605 ? 205.172 161.601 116.309 1.00 208.70 ? 605 MET B CG    1 
ATOM   5564  S SD    . MET B 2 605 ? 206.232 162.906 116.962 1.00 208.70 ? 605 MET B SD    1 
ATOM   5565  C CE    . MET B 2 605 ? 205.886 162.788 118.715 1.00 208.70 ? 605 MET B CE    1 
ATOM   5566  N N     . LEU B 2 606 ? 202.340 159.365 117.630 1.00 204.87 ? 606 LEU B N     1 
ATOM   5567  C CA    . LEU B 2 606 ? 202.482 158.108 118.354 1.00 204.87 ? 606 LEU B CA    1 
ATOM   5568  C C     . LEU B 2 606 ? 201.894 156.942 117.572 1.00 204.87 ? 606 LEU B C     1 
ATOM   5569  O O     . LEU B 2 606 ? 202.391 155.815 117.672 1.00 204.87 ? 606 LEU B O     1 
ATOM   5570  C CB    . LEU B 2 606 ? 201.819 158.218 119.726 1.00 204.87 ? 606 LEU B CB    1 
ATOM   5571  C CG    . LEU B 2 606 ? 202.448 159.223 120.690 1.00 204.87 ? 606 LEU B CG    1 
ATOM   5572  C CD1   . LEU B 2 606 ? 201.636 159.320 121.973 1.00 204.87 ? 606 LEU B CD1   1 
ATOM   5573  C CD2   . LEU B 2 606 ? 203.889 158.847 120.989 1.00 204.87 ? 606 LEU B CD2   1 
ATOM   5574  N N     . LYS B 2 607 ? 200.842 157.188 116.789 1.00 204.02 ? 607 LYS B N     1 
ATOM   5575  C CA    . LYS B 2 607 ? 200.279 156.124 115.968 1.00 204.02 ? 607 LYS B CA    1 
ATOM   5576  C C     . LYS B 2 607 ? 201.073 155.904 114.688 1.00 204.02 ? 607 LYS B C     1 
ATOM   5577  O O     . LYS B 2 607 ? 201.150 154.772 114.200 1.00 204.02 ? 607 LYS B O     1 
ATOM   5578  C CB    . LYS B 2 607 ? 198.821 156.433 115.628 1.00 204.02 ? 607 LYS B CB    1 
ATOM   5579  C CG    . LYS B 2 607 ? 197.871 156.319 116.806 1.00 204.02 ? 607 LYS B CG    1 
ATOM   5580  C CD    . LYS B 2 607 ? 196.468 156.756 116.423 1.00 204.02 ? 607 LYS B CD    1 
ATOM   5581  C CE    . LYS B 2 607 ? 195.810 155.755 115.488 1.00 204.02 ? 607 LYS B CE    1 
ATOM   5582  N NZ    . LYS B 2 607 ? 194.396 156.121 115.202 1.00 204.02 ? 607 LYS B NZ    1 
ATOM   5583  N N     . GLU B 2 608 ? 201.667 156.961 114.130 1.00 210.22 ? 608 GLU B N     1 
ATOM   5584  C CA    . GLU B 2 608 ? 202.401 156.812 112.880 1.00 210.22 ? 608 GLU B CA    1 
ATOM   5585  C C     . GLU B 2 608 ? 203.773 156.181 113.086 1.00 210.22 ? 608 GLU B C     1 
ATOM   5586  O O     . GLU B 2 608 ? 204.275 155.491 112.187 1.00 210.22 ? 608 GLU B O     1 
ATOM   5587  C CB    . GLU B 2 608 ? 202.535 158.169 112.187 1.00 210.22 ? 608 GLU B CB    1 
ATOM   5588  C CG    . GLU B 2 608 ? 203.232 158.097 110.845 1.00 210.22 ? 608 GLU B CG    1 
ATOM   5589  C CD    . GLU B 2 608 ? 202.473 157.249 109.845 1.00 210.22 ? 608 GLU B CD    1 
ATOM   5590  O OE1   . GLU B 2 608 ? 201.228 157.198 109.925 1.00 210.22 ? 608 GLU B OE1   1 
ATOM   5591  O OE2   . GLU B 2 608 ? 203.128 156.612 108.993 1.00 210.22 ? 608 GLU B OE2   1 
ATOM   5592  N N     . LEU B 2 609 ? 204.386 156.384 114.254 1.00 199.16 ? 609 LEU B N     1 
ATOM   5593  C CA    . LEU B 2 609 ? 205.656 155.721 114.534 1.00 199.16 ? 609 LEU B CA    1 
ATOM   5594  C C     . LEU B 2 609 ? 205.534 154.204 114.560 1.00 199.16 ? 609 LEU B C     1 
ATOM   5595  O O     . LEU B 2 609 ? 206.559 153.519 114.641 1.00 199.16 ? 609 LEU B O     1 
ATOM   5596  C CB    . LEU B 2 609 ? 206.234 156.220 115.857 1.00 199.16 ? 609 LEU B CB    1 
ATOM   5597  C CG    . LEU B 2 609 ? 206.739 157.662 115.833 1.00 199.16 ? 609 LEU B CG    1 
ATOM   5598  C CD1   . LEU B 2 609 ? 207.154 158.106 117.220 1.00 199.16 ? 609 LEU B CD1   1 
ATOM   5599  C CD2   . LEU B 2 609 ? 207.896 157.795 114.859 1.00 199.16 ? 609 LEU B CD2   1 
ATOM   5600  N N     . ILE B 2 610 ? 204.315 153.665 114.499 1.00 197.81 ? 610 ILE B N     1 
ATOM   5601  C CA    . ILE B 2 610 ? 204.144 152.225 114.336 1.00 197.81 ? 610 ILE B CA    1 
ATOM   5602  C C     . ILE B 2 610 ? 204.734 151.773 113.008 1.00 197.81 ? 610 ILE B C     1 
ATOM   5603  O O     . ILE B 2 610 ? 205.494 150.801 112.941 1.00 197.81 ? 610 ILE B O     1 
ATOM   5604  C CB    . ILE B 2 610 ? 202.657 151.846 114.444 1.00 197.81 ? 610 ILE B CB    1 
ATOM   5605  C CG1   . ILE B 2 610 ? 202.125 152.151 115.843 1.00 197.81 ? 610 ILE B CG1   1 
ATOM   5606  C CG2   . ILE B 2 610 ? 202.453 150.384 114.089 1.00 197.81 ? 610 ILE B CG2   1 
ATOM   5607  C CD1   . ILE B 2 610 ? 200.620 152.047 115.956 1.00 197.81 ? 610 ILE B CD1   1 
ATOM   5608  N N     . TYR B 2 611 ? 204.392 152.476 111.931 1.00 198.98 ? 611 TYR B N     1 
ATOM   5609  C CA    . TYR B 2 611 ? 204.826 152.104 110.594 1.00 198.98 ? 611 TYR B CA    1 
ATOM   5610  C C     . TYR B 2 611 ? 206.054 152.871 110.125 1.00 198.98 ? 611 TYR B C     1 
ATOM   5611  O O     . TYR B 2 611 ? 206.707 152.432 109.172 1.00 198.98 ? 611 TYR B O     1 
ATOM   5612  C CB    . TYR B 2 611 ? 203.682 152.311 109.599 1.00 198.98 ? 611 TYR B CB    1 
ATOM   5613  C CG    . TYR B 2 611 ? 202.517 151.379 109.827 1.00 198.98 ? 611 TYR B CG    1 
ATOM   5614  C CD1   . TYR B 2 611 ? 202.542 150.078 109.345 1.00 198.98 ? 611 TYR B CD1   1 
ATOM   5615  C CD2   . TYR B 2 611 ? 201.398 151.795 110.533 1.00 198.98 ? 611 TYR B CD2   1 
ATOM   5616  C CE1   . TYR B 2 611 ? 201.482 149.222 109.553 1.00 198.98 ? 611 TYR B CE1   1 
ATOM   5617  C CE2   . TYR B 2 611 ? 200.333 150.946 110.746 1.00 198.98 ? 611 TYR B CE2   1 
ATOM   5618  C CZ    . TYR B 2 611 ? 200.381 149.660 110.254 1.00 198.98 ? 611 TYR B CZ    1 
ATOM   5619  O OH    . TYR B 2 611 ? 199.322 148.808 110.462 1.00 198.98 ? 611 TYR B OH    1 
ATOM   5620  N N     . GLN B 2 612 ? 206.381 153.997 110.755 1.00 204.26 ? 612 GLN B N     1 
ATOM   5621  C CA    . GLN B 2 612 ? 207.578 154.727 110.373 1.00 204.26 ? 612 GLN B CA    1 
ATOM   5622  C C     . GLN B 2 612 ? 208.830 153.902 110.665 1.00 204.26 ? 612 GLN B C     1 
ATOM   5623  O O     . GLN B 2 612 ? 208.829 153.041 111.548 1.00 204.26 ? 612 GLN B O     1 
ATOM   5624  C CB    . GLN B 2 612 ? 207.646 156.065 111.102 1.00 204.26 ? 612 GLN B CB    1 
ATOM   5625  C CG    . GLN B 2 612 ? 206.598 157.057 110.645 1.00 204.26 ? 612 GLN B CG    1 
ATOM   5626  C CD    . GLN B 2 612 ? 206.794 157.480 109.203 1.00 204.26 ? 612 GLN B CD    1 
ATOM   5627  O OE1   . GLN B 2 612 ? 207.921 157.671 108.747 1.00 204.26 ? 612 GLN B OE1   1 
ATOM   5628  N NE2   . GLN B 2 612 ? 205.694 157.624 108.473 1.00 204.26 ? 612 GLN B NE2   1 
ATOM   5629  N N     . PRO B 2 613 ? 209.915 154.142 109.920 1.00 194.43 ? 613 PRO B N     1 
ATOM   5630  C CA    . PRO B 2 613 ? 211.150 153.375 110.140 1.00 194.43 ? 613 PRO B CA    1 
ATOM   5631  C C     . PRO B 2 613 ? 211.760 153.607 111.513 1.00 194.43 ? 613 PRO B C     1 
ATOM   5632  O O     . PRO B 2 613 ? 211.280 154.442 112.286 1.00 194.43 ? 613 PRO B O     1 
ATOM   5633  C CB    . PRO B 2 613 ? 212.078 153.881 109.028 1.00 194.43 ? 613 PRO B CB    1 
ATOM   5634  C CG    . PRO B 2 613 ? 211.159 154.403 107.979 1.00 194.43 ? 613 PRO B CG    1 
ATOM   5635  C CD    . PRO B 2 613 ? 210.006 154.997 108.725 1.00 194.43 ? 613 PRO B CD    1 
ATOM   5636  N N     . THR B 2 614 ? 212.827 152.874 111.817 1.00 192.47 ? 614 THR B N     1 
ATOM   5637  C CA    . THR B 2 614 ? 213.467 152.962 113.119 1.00 192.47 ? 614 THR B CA    1 
ATOM   5638  C C     . THR B 2 614 ? 214.242 154.272 113.254 1.00 192.47 ? 614 THR B C     1 
ATOM   5639  O O     . THR B 2 614 ? 214.253 155.125 112.362 1.00 192.47 ? 614 THR B O     1 
ATOM   5640  C CB    . THR B 2 614 ? 214.397 151.773 113.335 1.00 192.47 ? 614 THR B CB    1 
ATOM   5641  O OG1   . THR B 2 614 ? 214.916 151.811 114.670 1.00 192.47 ? 614 THR B OG1   1 
ATOM   5642  C CG2   . THR B 2 614 ? 215.552 151.822 112.347 1.00 192.47 ? 614 THR B CG2   1 
ATOM   5643  N N     . LEU B 2 615 ? 214.903 154.425 114.399 1.00 199.15 ? 615 LEU B N     1 
ATOM   5644  C CA    . LEU B 2 615 ? 215.714 155.601 114.671 1.00 199.15 ? 615 LEU B CA    1 
ATOM   5645  C C     . LEU B 2 615 ? 216.764 155.226 115.708 1.00 199.15 ? 615 LEU B C     1 
ATOM   5646  O O     . LEU B 2 615 ? 216.568 154.301 116.500 1.00 199.15 ? 615 LEU B O     1 
ATOM   5647  C CB    . LEU B 2 615 ? 214.852 156.771 115.157 1.00 199.15 ? 615 LEU B CB    1 
ATOM   5648  C CG    . LEU B 2 615 ? 215.527 158.132 115.329 1.00 199.15 ? 615 LEU B CG    1 
ATOM   5649  C CD1   . LEU B 2 615 ? 216.039 158.644 113.993 1.00 199.15 ? 615 LEU B CD1   1 
ATOM   5650  C CD2   . LEU B 2 615 ? 214.567 159.128 115.953 1.00 199.15 ? 615 LEU B CD2   1 
ATOM   5651  N N     . THR B 2 616 ? 217.884 155.946 115.685 1.00 210.29 ? 616 THR B N     1 
ATOM   5652  C CA    . THR B 2 616 ? 219.017 155.637 116.543 1.00 210.29 ? 616 THR B CA    1 
ATOM   5653  C C     . THR B 2 616 ? 219.777 156.924 116.830 1.00 210.29 ? 616 THR B C     1 
ATOM   5654  O O     . THR B 2 616 ? 219.816 157.834 115.998 1.00 210.29 ? 616 THR B O     1 
ATOM   5655  C CB    . THR B 2 616 ? 219.937 154.596 115.886 1.00 210.29 ? 616 THR B CB    1 
ATOM   5656  O OG1   . THR B 2 616 ? 219.186 153.409 115.599 1.00 210.29 ? 616 THR B OG1   1 
ATOM   5657  C CG2   . THR B 2 616 ? 221.103 154.232 116.797 1.00 210.29 ? 616 THR B CG2   1 
ATOM   5658  N N     . GLU B 2 617 ? 220.377 156.997 118.022 1.00 217.22 ? 617 GLU B N     1 
ATOM   5659  C CA    . GLU B 2 617 ? 221.183 158.159 118.378 1.00 217.22 ? 617 GLU B CA    1 
ATOM   5660  C C     . GLU B 2 617 ? 222.345 158.379 117.418 1.00 217.22 ? 617 GLU B C     1 
ATOM   5661  O O     . GLU B 2 617 ? 222.863 159.498 117.337 1.00 217.22 ? 617 GLU B O     1 
ATOM   5662  C CB    . GLU B 2 617 ? 221.717 158.022 119.804 1.00 217.22 ? 617 GLU B CB    1 
ATOM   5663  C CG    . GLU B 2 617 ? 220.655 158.131 120.880 1.00 217.22 ? 617 GLU B CG    1 
ATOM   5664  C CD    . GLU B 2 617 ? 221.234 158.024 122.277 1.00 217.22 ? 617 GLU B CD    1 
ATOM   5665  O OE1   . GLU B 2 617 ? 222.444 157.737 122.396 1.00 217.22 ? 617 GLU B OE1   1 
ATOM   5666  O OE2   . GLU B 2 617 ? 220.481 158.230 123.253 1.00 217.22 ? 617 GLU B OE2   1 
ATOM   5667  N N     . ALA B 2 618 ? 222.769 157.344 116.692 1.00 223.55 ? 618 ALA B N     1 
ATOM   5668  C CA    . ALA B 2 618 ? 223.859 157.499 115.738 1.00 223.55 ? 618 ALA B CA    1 
ATOM   5669  C C     . ALA B 2 618 ? 223.461 158.309 114.512 1.00 223.55 ? 618 ALA B C     1 
ATOM   5670  O O     . ALA B 2 618 ? 224.346 158.734 113.762 1.00 223.55 ? 618 ALA B O     1 
ATOM   5671  C CB    . ALA B 2 618 ? 224.373 156.126 115.303 1.00 223.55 ? 618 ALA B CB    1 
ATOM   5672  N N     . ASP B 2 619 ? 222.167 158.537 114.295 1.00 228.78 ? 619 ASP B N     1 
ATOM   5673  C CA    . ASP B 2 619 ? 221.690 159.256 113.119 1.00 228.78 ? 619 ASP B CA    1 
ATOM   5674  C C     . ASP B 2 619 ? 221.899 160.762 113.211 1.00 228.78 ? 619 ASP B C     1 
ATOM   5675  O O     . ASP B 2 619 ? 221.598 161.471 112.245 1.00 228.78 ? 619 ASP B O     1 
ATOM   5676  C CB    . ASP B 2 619 ? 220.205 158.959 112.888 1.00 228.78 ? 619 ASP B CB    1 
ATOM   5677  C CG    . ASP B 2 619 ? 219.959 157.535 112.424 1.00 228.78 ? 619 ASP B CG    1 
ATOM   5678  O OD1   . ASP B 2 619 ? 220.846 156.963 111.756 1.00 228.78 ? 619 ASP B OD1   1 
ATOM   5679  O OD2   . ASP B 2 619 ? 218.879 156.988 112.727 1.00 228.78 ? 619 ASP B OD2   1 
ATOM   5680  N N     . LEU B 2 620 ? 222.406 161.267 114.334 1.00 225.17 ? 620 LEU B N     1 
ATOM   5681  C CA    . LEU B 2 620 ? 222.638 162.699 114.487 1.00 225.17 ? 620 LEU B CA    1 
ATOM   5682  C C     . LEU B 2 620 ? 223.835 163.199 113.691 1.00 225.17 ? 620 LEU B C     1 
ATOM   5683  O O     . LEU B 2 620 ? 224.146 164.392 113.767 1.00 225.17 ? 620 LEU B O     1 
ATOM   5684  C CB    . LEU B 2 620 ? 222.818 163.045 115.966 1.00 225.17 ? 620 LEU B CB    1 
ATOM   5685  C CG    . LEU B 2 620 ? 221.551 163.237 116.803 1.00 225.17 ? 620 LEU B CG    1 
ATOM   5686  C CD1   . LEU B 2 620 ? 220.812 161.929 117.038 1.00 225.17 ? 620 LEU B CD1   1 
ATOM   5687  C CD2   . LEU B 2 620 ? 221.895 163.897 118.128 1.00 225.17 ? 620 LEU B CD2   1 
ATOM   5688  N N     . SER B 2 621 ? 224.513 162.330 112.939 1.00 232.12 ? 621 SER B N     1 
ATOM   5689  C CA    . SER B 2 621 ? 225.650 162.765 112.135 1.00 232.12 ? 621 SER B CA    1 
ATOM   5690  C C     . SER B 2 621 ? 225.188 163.434 110.847 1.00 232.12 ? 621 SER B C     1 
ATOM   5691  O O     . SER B 2 621 ? 225.470 164.613 110.609 1.00 232.12 ? 621 SER B O     1 
ATOM   5692  C CB    . SER B 2 621 ? 226.558 161.573 111.822 1.00 232.12 ? 621 SER B CB    1 
ATOM   5693  O OG    . SER B 2 621 ? 227.123 161.037 113.004 1.00 232.12 ? 621 SER B OG    1 
ATOM   5694  N N     . ASP B 2 622 ? 224.474 162.693 110.005 1.00 223.81 ? 622 ASP B N     1 
ATOM   5695  C CA    . ASP B 2 622 ? 224.012 163.226 108.732 1.00 223.81 ? 622 ASP B CA    1 
ATOM   5696  C C     . ASP B 2 622 ? 222.760 164.065 108.937 1.00 223.81 ? 622 ASP B C     1 
ATOM   5697  O O     . ASP B 2 622 ? 221.788 163.613 109.549 1.00 223.81 ? 622 ASP B O     1 
ATOM   5698  C CB    . ASP B 2 622 ? 223.727 162.096 107.743 1.00 223.81 ? 622 ASP B CB    1 
ATOM   5699  C CG    . ASP B 2 622 ? 223.429 162.602 106.339 1.00 223.81 ? 622 ASP B CG    1 
ATOM   5700  O OD1   . ASP B 2 622 ? 223.446 163.832 106.121 1.00 223.81 ? 622 ASP B OD1   1 
ATOM   5701  O OD2   . ASP B 2 622 ? 223.169 161.764 105.452 1.00 223.81 ? 622 ASP B OD2   1 
ATOM   5702  N N     . GLU B 2 623 ? 222.791 165.292 108.420 1.00 215.61 ? 623 GLU B N     1 
ATOM   5703  C CA    . GLU B 2 623 ? 221.586 166.107 108.405 1.00 215.61 ? 623 GLU B CA    1 
ATOM   5704  C C     . GLU B 2 623 ? 220.567 165.561 107.416 1.00 215.61 ? 623 GLU B C     1 
ATOM   5705  O O     . GLU B 2 623 ? 219.357 165.683 107.643 1.00 215.61 ? 623 GLU B O     1 
ATOM   5706  C CB    . GLU B 2 623 ? 221.946 167.552 108.070 1.00 215.61 ? 623 GLU B CB    1 
ATOM   5707  C CG    . GLU B 2 623 ? 220.785 168.520 108.126 1.00 215.61 ? 623 GLU B CG    1 
ATOM   5708  C CD    . GLU B 2 623 ? 221.220 169.947 107.867 1.00 215.61 ? 623 GLU B CD    1 
ATOM   5709  O OE1   . GLU B 2 623 ? 222.427 170.166 107.630 1.00 215.61 ? 623 GLU B OE1   1 
ATOM   5710  O OE2   . GLU B 2 623 ? 220.357 170.849 107.901 1.00 215.61 ? 623 GLU B OE2   1 
ATOM   5711  N N     . GLN B 2 624 ? 221.034 164.936 106.330 1.00 214.58 ? 624 GLN B N     1 
ATOM   5712  C CA    . GLN B 2 624 ? 220.115 164.449 105.308 1.00 214.58 ? 624 GLN B CA    1 
ATOM   5713  C C     . GLN B 2 624 ? 219.283 163.274 105.805 1.00 214.58 ? 624 GLN B C     1 
ATOM   5714  O O     . GLN B 2 624 ? 218.116 163.150 105.426 1.00 214.58 ? 624 GLN B O     1 
ATOM   5715  C CB    . GLN B 2 624 ? 220.876 164.055 104.042 1.00 214.58 ? 624 GLN B CB    1 
ATOM   5716  C CG    . GLN B 2 624 ? 219.962 163.649 102.890 1.00 214.58 ? 624 GLN B CG    1 
ATOM   5717  C CD    . GLN B 2 624 ? 220.716 163.347 101.612 1.00 214.58 ? 624 GLN B CD    1 
ATOM   5718  O OE1   . GLN B 2 624 ? 221.944 163.397 101.575 1.00 214.58 ? 624 GLN B OE1   1 
ATOM   5719  N NE2   . GLN B 2 624 ? 219.981 163.036 100.552 1.00 214.58 ? 624 GLN B NE2   1 
ATOM   5720  N N     . THR B 2 625 ? 219.854 162.406 106.641 1.00 209.26 ? 625 THR B N     1 
ATOM   5721  C CA    . THR B 2 625 ? 219.069 161.306 107.195 1.00 209.26 ? 625 THR B CA    1 
ATOM   5722  C C     . THR B 2 625 ? 217.910 161.833 108.030 1.00 209.26 ? 625 THR B C     1 
ATOM   5723  O O     . THR B 2 625 ? 216.759 161.411 107.858 1.00 209.26 ? 625 THR B O     1 
ATOM   5724  C CB    . THR B 2 625 ? 219.960 160.390 108.032 1.00 209.26 ? 625 THR B CB    1 
ATOM   5725  O OG1   . THR B 2 625 ? 220.552 161.142 109.099 1.00 209.26 ? 625 THR B OG1   1 
ATOM   5726  C CG2   . THR B 2 625 ? 221.051 159.782 107.172 1.00 209.26 ? 625 THR B CG2   1 
ATOM   5727  N N     . VAL B 2 626 ? 218.201 162.763 108.942 1.00 206.37 ? 626 VAL B N     1 
ATOM   5728  C CA    . VAL B 2 626 ? 217.157 163.360 109.767 1.00 206.37 ? 626 VAL B CA    1 
ATOM   5729  C C     . VAL B 2 626 ? 216.136 164.078 108.895 1.00 206.37 ? 626 VAL B C     1 
ATOM   5730  O O     . VAL B 2 626 ? 214.925 164.007 109.142 1.00 206.37 ? 626 VAL B O     1 
ATOM   5731  C CB    . VAL B 2 626 ? 217.783 164.309 110.805 1.00 206.37 ? 626 VAL B CB    1 
ATOM   5732  C CG1   . VAL B 2 626 ? 216.705 165.010 111.605 1.00 206.37 ? 626 VAL B CG1   1 
ATOM   5733  C CG2   . VAL B 2 626 ? 218.723 163.544 111.722 1.00 206.37 ? 626 VAL B CG2   1 
ATOM   5734  N N     . THR B 2 627 ? 216.608 164.775 107.859 1.00 204.09 ? 627 THR B N     1 
ATOM   5735  C CA    . THR B 2 627 ? 215.701 165.515 106.990 1.00 204.09 ? 627 THR B CA    1 
ATOM   5736  C C     . THR B 2 627 ? 214.760 164.572 106.254 1.00 204.09 ? 627 THR B C     1 
ATOM   5737  O O     . THR B 2 627 ? 213.550 164.809 106.197 1.00 204.09 ? 627 THR B O     1 
ATOM   5738  C CB    . THR B 2 627 ? 216.501 166.358 105.999 1.00 204.09 ? 627 THR B CB    1 
ATOM   5739  O OG1   . THR B 2 627 ? 217.345 167.267 106.718 1.00 204.09 ? 627 THR B OG1   1 
ATOM   5740  C CG2   . THR B 2 627 ? 215.566 167.150 105.103 1.00 204.09 ? 627 THR B CG2   1 
ATOM   5741  N N     . ARG B 2 628 ? 215.302 163.496 105.682 1.00 203.77 ? 628 ARG B N     1 
ATOM   5742  C CA    . ARG B 2 628 ? 214.474 162.517 104.989 1.00 203.77 ? 628 ARG B CA    1 
ATOM   5743  C C     . ARG B 2 628 ? 213.469 161.881 105.938 1.00 203.77 ? 628 ARG B C     1 
ATOM   5744  O O     . ARG B 2 628 ? 212.296 161.699 105.585 1.00 203.77 ? 628 ARG B O     1 
ATOM   5745  C CB    . ARG B 2 628 ? 215.363 161.448 104.354 1.00 203.77 ? 628 ARG B CB    1 
ATOM   5746  C CG    . ARG B 2 628 ? 214.610 160.362 103.608 1.00 203.77 ? 628 ARG B CG    1 
ATOM   5747  C CD    . ARG B 2 628 ? 213.958 160.909 102.350 1.00 203.77 ? 628 ARG B CD    1 
ATOM   5748  N NE    . ARG B 2 628 ? 213.253 159.869 101.605 1.00 203.77 ? 628 ARG B NE    1 
ATOM   5749  C CZ    . ARG B 2 628 ? 211.990 159.521 101.825 1.00 203.77 ? 628 ARG B CZ    1 
ATOM   5750  N NH1   . ARG B 2 628 ? 211.286 160.136 102.765 1.00 203.77 ? 628 ARG B NH1   1 
ATOM   5751  N NH2   . ARG B 2 628 ? 211.427 158.563 101.102 1.00 203.77 ? 628 ARG B NH2   1 
ATOM   5752  N N     . TRP B 2 629 ? 213.911 161.542 107.151 1.00 197.49 ? 629 TRP B N     1 
ATOM   5753  C CA    . TRP B 2 629 ? 213.018 160.929 108.128 1.00 197.49 ? 629 TRP B CA    1 
ATOM   5754  C C     . TRP B 2 629 ? 211.852 161.853 108.456 1.00 197.49 ? 629 TRP B C     1 
ATOM   5755  O O     . TRP B 2 629 ? 210.681 161.450 108.391 1.00 197.49 ? 629 TRP B O     1 
ATOM   5756  C CB    . TRP B 2 629 ? 213.813 160.581 109.386 1.00 197.49 ? 629 TRP B CB    1 
ATOM   5757  C CG    . TRP B 2 629 ? 213.031 159.886 110.447 1.00 197.49 ? 629 TRP B CG    1 
ATOM   5758  C CD1   . TRP B 2 629 ? 212.475 158.645 110.375 1.00 197.49 ? 629 TRP B CD1   1 
ATOM   5759  C CD2   . TRP B 2 629 ? 212.728 160.387 111.753 1.00 197.49 ? 629 TRP B CD2   1 
ATOM   5760  N NE1   . TRP B 2 629 ? 211.839 158.343 111.553 1.00 197.49 ? 629 TRP B NE1   1 
ATOM   5761  C CE2   . TRP B 2 629 ? 211.980 159.397 112.416 1.00 197.49 ? 629 TRP B CE2   1 
ATOM   5762  C CE3   . TRP B 2 629 ? 213.014 161.579 112.423 1.00 197.49 ? 629 TRP B CE3   1 
ATOM   5763  C CZ2   . TRP B 2 629 ? 211.513 159.562 113.717 1.00 197.49 ? 629 TRP B CZ2   1 
ATOM   5764  C CZ3   . TRP B 2 629 ? 212.550 161.740 113.715 1.00 197.49 ? 629 TRP B CZ3   1 
ATOM   5765  C CH2   . TRP B 2 629 ? 211.808 160.738 114.348 1.00 197.49 ? 629 TRP B CH2   1 
ATOM   5766  N N     . VAL B 2 630 ? 212.155 163.109 108.792 1.00 203.45 ? 630 VAL B N     1 
ATOM   5767  C CA    . VAL B 2 630 ? 211.097 164.030 109.185 1.00 203.45 ? 630 VAL B CA    1 
ATOM   5768  C C     . VAL B 2 630 ? 210.216 164.379 107.992 1.00 203.45 ? 630 VAL B C     1 
ATOM   5769  O O     . VAL B 2 630 ? 209.009 164.593 108.151 1.00 203.45 ? 630 VAL B O     1 
ATOM   5770  C CB    . VAL B 2 630 ? 211.690 165.288 109.849 1.00 203.45 ? 630 VAL B CB    1 
ATOM   5771  C CG1   . VAL B 2 630 ? 212.457 166.132 108.844 1.00 203.45 ? 630 VAL B CG1   1 
ATOM   5772  C CG2   . VAL B 2 630 ? 210.595 166.102 110.520 1.00 203.45 ? 630 VAL B CG2   1 
ATOM   5773  N N     . ASN B 2 631 ? 210.775 164.404 106.780 1.00 204.54 ? 631 ASN B N     1 
ATOM   5774  C CA    . ASN B 2 631 ? 209.962 164.696 105.608 1.00 204.54 ? 631 ASN B CA    1 
ATOM   5775  C C     . ASN B 2 631 ? 208.971 163.572 105.346 1.00 204.54 ? 631 ASN B C     1 
ATOM   5776  O O     . ASN B 2 631 ? 207.792 163.825 105.079 1.00 204.54 ? 631 ASN B O     1 
ATOM   5777  C CB    . ASN B 2 631 ? 210.860 164.925 104.392 1.00 204.54 ? 631 ASN B CB    1 
ATOM   5778  C CG    . ASN B 2 631 ? 210.103 165.478 103.200 1.00 204.54 ? 631 ASN B CG    1 
ATOM   5779  O OD1   . ASN B 2 631 ? 208.891 165.688 103.258 1.00 204.54 ? 631 ASN B OD1   1 
ATOM   5780  N ND2   . ASN B 2 631 ? 210.817 165.717 102.107 1.00 204.54 ? 631 ASN B ND2   1 
ATOM   5781  N N     . ALA B 2 632 ? 209.434 162.321 105.415 1.00 196.25 ? 632 ALA B N     1 
ATOM   5782  C CA    . ALA B 2 632 ? 208.522 161.192 105.267 1.00 196.25 ? 632 ALA B CA    1 
ATOM   5783  C C     . ALA B 2 632 ? 207.437 161.228 106.332 1.00 196.25 ? 632 ALA B C     1 
ATOM   5784  O O     . ALA B 2 632 ? 206.255 161.003 106.036 1.00 196.25 ? 632 ALA B O     1 
ATOM   5785  C CB    . ALA B 2 632 ? 209.295 159.877 105.338 1.00 196.25 ? 632 ALA B CB    1 
ATOM   5786  N N     . LEU B 2 633 ? 207.821 161.520 107.577 1.00 194.35 ? 633 LEU B N     1 
ATOM   5787  C CA    . LEU B 2 633 ? 206.844 161.589 108.658 1.00 194.35 ? 633 LEU B CA    1 
ATOM   5788  C C     . LEU B 2 633 ? 205.779 162.643 108.376 1.00 194.35 ? 633 LEU B C     1 
ATOM   5789  O O     . LEU B 2 633 ? 204.576 162.363 108.448 1.00 194.35 ? 633 LEU B O     1 
ATOM   5790  C CB    . LEU B 2 633 ? 207.552 161.879 109.980 1.00 194.35 ? 633 LEU B CB    1 
ATOM   5791  C CG    . LEU B 2 633 ? 206.647 161.951 111.208 1.00 194.35 ? 633 LEU B CG    1 
ATOM   5792  C CD1   . LEU B 2 633 ? 205.964 160.614 111.438 1.00 194.35 ? 633 LEU B CD1   1 
ATOM   5793  C CD2   . LEU B 2 633 ? 207.439 162.377 112.434 1.00 194.35 ? 633 LEU B CD2   1 
ATOM   5794  N N     . VAL B 2 634 ? 206.206 163.865 108.051 1.00 196.05 ? 634 VAL B N     1 
ATOM   5795  C CA    . VAL B 2 634 ? 205.260 164.954 107.836 1.00 196.05 ? 634 VAL B CA    1 
ATOM   5796  C C     . VAL B 2 634 ? 204.391 164.681 106.616 1.00 196.05 ? 634 VAL B C     1 
ATOM   5797  O O     . VAL B 2 634 ? 203.194 164.993 106.610 1.00 196.05 ? 634 VAL B O     1 
ATOM   5798  C CB    . VAL B 2 634 ? 206.008 166.294 107.716 1.00 196.05 ? 634 VAL B CB    1 
ATOM   5799  C CG1   . VAL B 2 634 ? 205.049 167.411 107.343 1.00 196.05 ? 634 VAL B CG1   1 
ATOM   5800  C CG2   . VAL B 2 634 ? 206.705 166.623 109.022 1.00 196.05 ? 634 VAL B CG2   1 
ATOM   5801  N N     . SER B 2 635 ? 204.965 164.085 105.568 1.00 197.22 ? 635 SER B N     1 
ATOM   5802  C CA    . SER B 2 635 ? 204.185 163.796 104.373 1.00 197.22 ? 635 SER B CA    1 
ATOM   5803  C C     . SER B 2 635 ? 203.107 162.765 104.665 1.00 197.22 ? 635 SER B C     1 
ATOM   5804  O O     . SER B 2 635 ? 201.947 162.936 104.272 1.00 197.22 ? 635 SER B O     1 
ATOM   5805  C CB    . SER B 2 635 ? 205.104 163.316 103.251 1.00 197.22 ? 635 SER B CB    1 
ATOM   5806  O OG    . SER B 2 635 ? 204.363 163.012 102.083 1.00 197.22 ? 635 SER B OG    1 
ATOM   5807  N N     . GLU B 2 636 ? 203.464 161.690 105.370 1.00 196.80 ? 636 GLU B N     1 
ATOM   5808  C CA    . GLU B 2 636 ? 202.455 160.695 105.708 1.00 196.80 ? 636 GLU B CA    1 
ATOM   5809  C C     . GLU B 2 636 ? 201.404 161.264 106.652 1.00 196.80 ? 636 GLU B C     1 
ATOM   5810  O O     . GLU B 2 636 ? 200.225 160.904 106.552 1.00 196.80 ? 636 GLU B O     1 
ATOM   5811  C CB    . GLU B 2 636 ? 203.111 159.460 106.317 1.00 196.80 ? 636 GLU B CB    1 
ATOM   5812  C CG    . GLU B 2 636 ? 202.126 158.356 106.636 1.00 196.80 ? 636 GLU B CG    1 
ATOM   5813  C CD    . GLU B 2 636 ? 201.465 157.783 105.400 1.00 196.80 ? 636 GLU B CD    1 
ATOM   5814  O OE1   . GLU B 2 636 ? 202.072 157.849 104.311 1.00 196.80 ? 636 GLU B OE1   1 
ATOM   5815  O OE2   . GLU B 2 636 ? 200.335 157.265 105.519 1.00 196.80 ? 636 GLU B OE2   1 
ATOM   5816  N N     . LEU B 2 637 ? 201.798 162.165 107.554 1.00 193.57 ? 637 LEU B N     1 
ATOM   5817  C CA    . LEU B 2 637 ? 200.819 162.775 108.448 1.00 193.57 ? 637 LEU B CA    1 
ATOM   5818  C C     . LEU B 2 637 ? 199.841 163.654 107.679 1.00 193.57 ? 637 LEU B C     1 
ATOM   5819  O O     . LEU B 2 637 ? 198.628 163.593 107.908 1.00 193.57 ? 637 LEU B O     1 
ATOM   5820  C CB    . LEU B 2 637 ? 201.526 163.577 109.539 1.00 193.57 ? 637 LEU B CB    1 
ATOM   5821  C CG    . LEU B 2 637 ? 202.275 162.746 110.579 1.00 193.57 ? 637 LEU B CG    1 
ATOM   5822  C CD1   . LEU B 2 637 ? 203.051 163.648 111.524 1.00 193.57 ? 637 LEU B CD1   1 
ATOM   5823  C CD2   . LEU B 2 637 ? 201.305 161.863 111.347 1.00 193.57 ? 637 LEU B CD2   1 
ATOM   5824  N N     . ASN B 2 638 ? 200.349 164.484 106.765 1.00 190.52 ? 638 ASN B N     1 
ATOM   5825  C CA    . ASN B 2 638 ? 199.461 165.310 105.955 1.00 190.52 ? 638 ASN B CA    1 
ATOM   5826  C C     . ASN B 2 638 ? 198.589 164.461 105.042 1.00 190.52 ? 638 ASN B C     1 
ATOM   5827  O O     . ASN B 2 638 ? 197.464 164.857 104.715 1.00 190.52 ? 638 ASN B O     1 
ATOM   5828  C CB    . ASN B 2 638 ? 200.267 166.317 105.135 1.00 190.52 ? 638 ASN B CB    1 
ATOM   5829  C CG    . ASN B 2 638 ? 200.820 167.444 105.980 1.00 190.52 ? 638 ASN B CG    1 
ATOM   5830  O OD1   . ASN B 2 638 ? 200.136 167.968 106.859 1.00 190.52 ? 638 ASN B OD1   1 
ATOM   5831  N ND2   . ASN B 2 638 ? 202.063 167.827 105.717 1.00 190.52 ? 638 ASN B ND2   1 
ATOM   5832  N N     . ASP B 2 639 ? 199.084 163.297 104.621 1.00 195.30 ? 639 ASP B N     1 
ATOM   5833  C CA    . ASP B 2 639 ? 198.258 162.387 103.837 1.00 195.30 ? 639 ASP B CA    1 
ATOM   5834  C C     . ASP B 2 639 ? 197.113 161.835 104.676 1.00 195.30 ? 639 ASP B C     1 
ATOM   5835  O O     . ASP B 2 639 ? 195.947 161.887 104.268 1.00 195.30 ? 639 ASP B O     1 
ATOM   5836  C CB    . ASP B 2 639 ? 199.116 161.250 103.284 1.00 195.30 ? 639 ASP B CB    1 
ATOM   5837  C CG    . ASP B 2 639 ? 198.378 160.399 102.268 1.00 195.30 ? 639 ASP B CG    1 
ATOM   5838  O OD1   . ASP B 2 639 ? 197.201 160.694 101.973 1.00 195.30 ? 639 ASP B OD1   1 
ATOM   5839  O OD2   . ASP B 2 639 ? 198.977 159.424 101.767 1.00 195.30 ? 639 ASP B OD2   1 
ATOM   5840  N N     . LYS B 2 640 ? 197.430 161.304 105.858 1.00 195.19 ? 640 LYS B N     1 
ATOM   5841  C CA    . LYS B 2 640 ? 196.412 160.682 106.695 1.00 195.19 ? 640 LYS B CA    1 
ATOM   5842  C C     . LYS B 2 640 ? 195.488 161.701 107.349 1.00 195.19 ? 640 LYS B C     1 
ATOM   5843  O O     . LYS B 2 640 ? 194.419 161.320 107.837 1.00 195.19 ? 640 LYS B O     1 
ATOM   5844  C CB    . LYS B 2 640 ? 197.072 159.818 107.770 1.00 195.19 ? 640 LYS B CB    1 
ATOM   5845  C CG    . LYS B 2 640 ? 197.878 158.657 107.215 1.00 195.19 ? 640 LYS B CG    1 
ATOM   5846  C CD    . LYS B 2 640 ? 196.987 157.687 106.461 1.00 195.19 ? 640 LYS B CD    1 
ATOM   5847  C CE    . LYS B 2 640 ? 196.073 156.933 107.410 1.00 195.19 ? 640 LYS B CE    1 
ATOM   5848  N NZ    . LYS B 2 640 ? 195.244 155.926 106.697 1.00 195.19 ? 640 LYS B NZ    1 
ATOM   5849  N N     . GLU B 2 641 ? 195.868 162.977 107.370 1.00 188.85 ? 641 GLU B N     1 
ATOM   5850  C CA    . GLU B 2 641 ? 195.041 164.002 107.996 1.00 188.85 ? 641 GLU B CA    1 
ATOM   5851  C C     . GLU B 2 641 ? 193.753 164.185 107.205 1.00 188.85 ? 641 GLU B C     1 
ATOM   5852  O O     . GLU B 2 641 ? 193.757 164.775 106.120 1.00 188.85 ? 641 GLU B O     1 
ATOM   5853  C CB    . GLU B 2 641 ? 195.808 165.317 108.091 1.00 188.85 ? 641 GLU B CB    1 
ATOM   5854  C CG    . GLU B 2 641 ? 195.007 166.451 108.713 1.00 188.85 ? 641 GLU B CG    1 
ATOM   5855  C CD    . GLU B 2 641 ? 194.681 166.214 110.174 1.00 188.85 ? 641 GLU B CD    1 
ATOM   5856  O OE1   . GLU B 2 641 ? 195.453 165.506 110.854 1.00 188.85 ? 641 GLU B OE1   1 
ATOM   5857  O OE2   . GLU B 2 641 ? 193.647 166.733 110.643 1.00 188.85 ? 641 GLU B OE2   1 
ATOM   5858  N N     . GLN B 2 642 ? 192.649 163.681 107.751 1.00 176.39 ? 642 GLN B N     1 
ATOM   5859  C CA    . GLN B 2 642 ? 191.330 163.890 107.176 1.00 176.39 ? 642 GLN B CA    1 
ATOM   5860  C C     . GLN B 2 642 ? 190.540 164.971 107.899 1.00 176.39 ? 642 GLN B C     1 
ATOM   5861  O O     . GLN B 2 642 ? 189.510 165.414 107.380 1.00 176.39 ? 642 GLN B O     1 
ATOM   5862  C CB    . GLN B 2 642 ? 190.537 162.579 107.185 1.00 176.39 ? 642 GLN B CB    1 
ATOM   5863  C CG    . GLN B 2 642 ? 190.234 162.047 108.574 1.00 176.39 ? 642 GLN B CG    1 
ATOM   5864  C CD    . GLN B 2 642 ? 189.528 160.707 108.538 1.00 176.39 ? 642 GLN B CD    1 
ATOM   5865  O OE1   . GLN B 2 642 ? 189.219 160.185 107.467 1.00 176.39 ? 642 GLN B OE1   1 
ATOM   5866  N NE2   . GLN B 2 642 ? 189.267 160.143 109.711 1.00 176.39 ? 642 GLN B NE2   1 
ATOM   5867  N N     . HIS B 2 643 ? 190.992 165.400 109.072 1.00 175.77 ? 643 HIS B N     1 
ATOM   5868  C CA    . HIS B 2 643 ? 190.346 166.473 109.809 1.00 175.77 ? 643 HIS B CA    1 
ATOM   5869  C C     . HIS B 2 643 ? 190.952 167.812 109.393 1.00 175.77 ? 643 HIS B C     1 
ATOM   5870  O O     . HIS B 2 643 ? 191.737 167.897 108.445 1.00 175.77 ? 643 HIS B O     1 
ATOM   5871  C CB    . HIS B 2 643 ? 190.476 166.230 111.310 1.00 175.77 ? 643 HIS B CB    1 
ATOM   5872  C CG    . HIS B 2 643 ? 189.764 165.003 111.785 1.00 175.77 ? 643 HIS B CG    1 
ATOM   5873  N ND1   . HIS B 2 643 ? 188.397 164.952 111.947 1.00 175.77 ? 643 HIS B ND1   1 
ATOM   5874  C CD2   . HIS B 2 643 ? 190.230 163.779 112.126 1.00 175.77 ? 643 HIS B CD2   1 
ATOM   5875  C CE1   . HIS B 2 643 ? 188.051 163.751 112.374 1.00 175.77 ? 643 HIS B CE1   1 
ATOM   5876  N NE2   . HIS B 2 643 ? 189.145 163.020 112.490 1.00 175.77 ? 643 HIS B NE2   1 
ATOM   5877  N N     . GLY B 2 644 ? 190.597 168.876 110.107 1.00 175.57 ? 644 GLY B N     1 
ATOM   5878  C CA    . GLY B 2 644 ? 191.092 170.198 109.785 1.00 175.57 ? 644 GLY B CA    1 
ATOM   5879  C C     . GLY B 2 644 ? 192.404 170.547 110.458 1.00 175.57 ? 644 GLY B C     1 
ATOM   5880  O O     . GLY B 2 644 ? 192.430 171.355 111.391 1.00 175.57 ? 644 GLY B O     1 
ATOM   5881  N N     . SER B 2 645 ? 193.500 169.947 110.000 1.00 175.12 ? 645 SER B N     1 
ATOM   5882  C CA    . SER B 2 645 ? 194.811 170.234 110.561 1.00 175.12 ? 645 SER B CA    1 
ATOM   5883  C C     . SER B 2 645 ? 195.866 170.073 109.477 1.00 175.12 ? 645 SER B C     1 
ATOM   5884  O O     . SER B 2 645 ? 195.592 169.587 108.378 1.00 175.12 ? 645 SER B O     1 
ATOM   5885  C CB    . SER B 2 645 ? 195.120 169.329 111.757 1.00 175.12 ? 645 SER B CB    1 
ATOM   5886  O OG    . SER B 2 645 ? 196.415 169.589 112.266 1.00 175.12 ? 645 SER B OG    1 
ATOM   5887  N N     . GLN B 2 646 ? 197.086 170.496 109.804 1.00 178.88 ? 646 GLN B N     1 
ATOM   5888  C CA    . GLN B 2 646 ? 198.223 170.396 108.901 1.00 178.88 ? 646 GLN B CA    1 
ATOM   5889  C C     . GLN B 2 646 ? 199.431 169.913 109.690 1.00 178.88 ? 646 GLN B C     1 
ATOM   5890  O O     . GLN B 2 646 ? 199.343 169.622 110.886 1.00 178.88 ? 646 GLN B O     1 
ATOM   5891  C CB    . GLN B 2 646 ? 198.517 171.737 108.219 1.00 178.88 ? 646 GLN B CB    1 
ATOM   5892  C CG    . GLN B 2 646 ? 197.445 172.189 107.251 1.00 178.88 ? 646 GLN B CG    1 
ATOM   5893  C CD    . GLN B 2 646 ? 197.768 173.525 106.620 1.00 178.88 ? 646 GLN B CD    1 
ATOM   5894  O OE1   . GLN B 2 646 ? 198.772 174.153 106.953 1.00 178.88 ? 646 GLN B OE1   1 
ATOM   5895  N NE2   . GLN B 2 646 ? 196.915 173.970 105.705 1.00 178.88 ? 646 GLN B NE2   1 
ATOM   5896  N N     . TRP B 2 647 ? 200.572 169.831 109.009 1.00 177.92 ? 647 TRP B N     1 
ATOM   5897  C CA    . TRP B 2 647 ? 201.801 169.361 109.629 1.00 177.92 ? 647 TRP B CA    1 
ATOM   5898  C C     . TRP B 2 647 ? 202.988 170.011 108.938 1.00 177.92 ? 647 TRP B C     1 
ATOM   5899  O O     . TRP B 2 647 ? 203.028 170.098 107.708 1.00 177.92 ? 647 TRP B O     1 
ATOM   5900  C CB    . TRP B 2 647 ? 201.913 167.836 109.551 1.00 177.92 ? 647 TRP B CB    1 
ATOM   5901  C CG    . TRP B 2 647 ? 200.889 167.134 110.370 1.00 177.92 ? 647 TRP B CG    1 
ATOM   5902  C CD1   . TRP B 2 647 ? 199.692 166.647 109.941 1.00 177.92 ? 647 TRP B CD1   1 
ATOM   5903  C CD2   . TRP B 2 647 ? 200.965 166.842 111.768 1.00 177.92 ? 647 TRP B CD2   1 
ATOM   5904  N NE1   . TRP B 2 647 ? 199.016 166.068 110.985 1.00 177.92 ? 647 TRP B NE1   1 
ATOM   5905  C CE2   . TRP B 2 647 ? 199.778 166.173 112.118 1.00 177.92 ? 647 TRP B CE2   1 
ATOM   5906  C CE3   . TRP B 2 647 ? 201.923 167.078 112.756 1.00 177.92 ? 647 TRP B CE3   1 
ATOM   5907  C CZ2   . TRP B 2 647 ? 199.522 165.739 113.414 1.00 177.92 ? 647 TRP B CZ2   1 
ATOM   5908  C CZ3   . TRP B 2 647 ? 201.669 166.644 114.042 1.00 177.92 ? 647 TRP B CZ3   1 
ATOM   5909  C CH2   . TRP B 2 647 ? 200.478 165.983 114.360 1.00 177.92 ? 647 TRP B CH2   1 
ATOM   5910  N N     . LYS B 2 648 ? 203.951 170.466 109.737 1.00 179.07 ? 648 LYS B N     1 
ATOM   5911  C CA    . LYS B 2 648 ? 205.157 171.092 109.220 1.00 179.07 ? 648 LYS B CA    1 
ATOM   5912  C C     . LYS B 2 648 ? 206.351 170.612 110.031 1.00 179.07 ? 648 LYS B C     1 
ATOM   5913  O O     . LYS B 2 648 ? 206.220 170.202 111.186 1.00 179.07 ? 648 LYS B O     1 
ATOM   5914  C CB    . LYS B 2 648 ? 205.058 172.623 109.258 1.00 179.07 ? 648 LYS B CB    1 
ATOM   5915  C CG    . LYS B 2 648 ? 204.024 173.193 108.301 1.00 179.07 ? 648 LYS B CG    1 
ATOM   5916  C CD    . LYS B 2 648 ? 203.967 174.707 108.379 1.00 179.07 ? 648 LYS B CD    1 
ATOM   5917  C CE    . LYS B 2 648 ? 202.902 175.264 107.449 1.00 179.07 ? 648 LYS B CE    1 
ATOM   5918  N NZ    . LYS B 2 648 ? 202.814 176.748 107.529 1.00 179.07 ? 648 LYS B NZ    1 
ATOM   5919  N N     . PHE B 2 649 ? 207.524 170.672 109.411 1.00 181.25 ? 649 PHE B N     1 
ATOM   5920  C CA    . PHE B 2 649 ? 208.751 170.153 109.993 1.00 181.25 ? 649 PHE B CA    1 
ATOM   5921  C C     . PHE B 2 649 ? 209.644 171.294 110.459 1.00 181.25 ? 649 PHE B C     1 
ATOM   5922  O O     . PHE B 2 649 ? 209.391 172.471 110.189 1.00 181.25 ? 649 PHE B O     1 
ATOM   5923  C CB    . PHE B 2 649 ? 209.494 169.268 108.986 1.00 181.25 ? 649 PHE B CB    1 
ATOM   5924  C CG    . PHE B 2 649 ? 209.968 170.006 107.768 1.00 181.25 ? 649 PHE B CG    1 
ATOM   5925  C CD1   . PHE B 2 649 ? 209.134 170.170 106.675 1.00 181.25 ? 649 PHE B CD1   1 
ATOM   5926  C CD2   . PHE B 2 649 ? 211.250 170.523 107.708 1.00 181.25 ? 649 PHE B CD2   1 
ATOM   5927  C CE1   . PHE B 2 649 ? 209.566 170.847 105.552 1.00 181.25 ? 649 PHE B CE1   1 
ATOM   5928  C CE2   . PHE B 2 649 ? 211.688 171.200 106.586 1.00 181.25 ? 649 PHE B CE2   1 
ATOM   5929  C CZ    . PHE B 2 649 ? 210.845 171.361 105.507 1.00 181.25 ? 649 PHE B CZ    1 
ATOM   5930  N N     . ASP B 2 650 ? 210.707 170.923 111.169 1.00 188.27 ? 650 ASP B N     1 
ATOM   5931  C CA    . ASP B 2 650 ? 211.674 171.890 111.671 1.00 188.27 ? 650 ASP B CA    1 
ATOM   5932  C C     . ASP B 2 650 ? 212.967 171.164 112.003 1.00 188.27 ? 650 ASP B C     1 
ATOM   5933  O O     . ASP B 2 650 ? 212.939 170.103 112.633 1.00 188.27 ? 650 ASP B O     1 
ATOM   5934  C CB    . ASP B 2 650 ? 211.140 172.615 112.909 1.00 188.27 ? 650 ASP B CB    1 
ATOM   5935  C CG    . ASP B 2 650 ? 212.076 173.701 113.392 1.00 188.27 ? 650 ASP B CG    1 
ATOM   5936  O OD1   . ASP B 2 650 ? 212.131 174.768 112.745 1.00 188.27 ? 650 ASP B OD1   1 
ATOM   5937  O OD2   . ASP B 2 650 ? 212.762 173.487 114.413 1.00 188.27 ? 650 ASP B OD2   1 
ATOM   5938  N N     . VAL B 2 651 ? 214.090 171.736 111.581 1.00 192.23 ? 651 VAL B N     1 
ATOM   5939  C CA    . VAL B 2 651 ? 215.414 171.193 111.857 1.00 192.23 ? 651 VAL B CA    1 
ATOM   5940  C C     . VAL B 2 651 ? 216.170 172.215 112.692 1.00 192.23 ? 651 VAL B C     1 
ATOM   5941  O O     . VAL B 2 651 ? 216.297 173.379 112.292 1.00 192.23 ? 651 VAL B O     1 
ATOM   5942  C CB    . VAL B 2 651 ? 216.180 170.864 110.568 1.00 192.23 ? 651 VAL B CB    1 
ATOM   5943  C CG1   . VAL B 2 651 ? 217.597 170.430 110.895 1.00 192.23 ? 651 VAL B CG1   1 
ATOM   5944  C CG2   . VAL B 2 651 ? 215.454 169.781 109.791 1.00 192.23 ? 651 VAL B CG2   1 
ATOM   5945  N N     . HIS B 2 652 ? 216.670 171.782 113.845 1.00 214.60 ? 652 HIS B N     1 
ATOM   5946  C CA    . HIS B 2 652 ? 217.364 172.662 114.770 1.00 214.60 ? 652 HIS B CA    1 
ATOM   5947  C C     . HIS B 2 652 ? 218.676 172.024 115.199 1.00 214.60 ? 652 HIS B C     1 
ATOM   5948  O O     . HIS B 2 652 ? 218.810 170.798 115.229 1.00 214.60 ? 652 HIS B O     1 
ATOM   5949  C CB    . HIS B 2 652 ? 216.503 172.966 116.002 1.00 214.60 ? 652 HIS B CB    1 
ATOM   5950  C CG    . HIS B 2 652 ? 217.093 173.995 116.914 1.00 214.60 ? 652 HIS B CG    1 
ATOM   5951  N ND1   . HIS B 2 652 ? 218.002 173.681 117.902 1.00 214.60 ? 652 HIS B ND1   1 
ATOM   5952  C CD2   . HIS B 2 652 ? 216.898 175.333 116.995 1.00 214.60 ? 652 HIS B CD2   1 
ATOM   5953  C CE1   . HIS B 2 652 ? 218.345 174.782 118.548 1.00 214.60 ? 652 HIS B CE1   1 
ATOM   5954  N NE2   . HIS B 2 652 ? 217.689 175.797 118.017 1.00 214.60 ? 652 HIS B NE2   1 
ATOM   5955  N N     . THR B 2 653 ? 219.646 172.874 115.529 1.00 226.67 ? 653 THR B N     1 
ATOM   5956  C CA    . THR B 2 653 ? 220.954 172.445 116.011 1.00 226.67 ? 653 THR B CA    1 
ATOM   5957  C C     . THR B 2 653 ? 221.214 173.127 117.347 1.00 226.67 ? 653 THR B C     1 
ATOM   5958  O O     . THR B 2 653 ? 221.439 174.341 117.396 1.00 226.67 ? 653 THR B O     1 
ATOM   5959  C CB    . THR B 2 653 ? 222.052 172.782 115.004 1.00 226.67 ? 653 THR B CB    1 
ATOM   5960  O OG1   . THR B 2 653 ? 222.117 174.202 114.826 1.00 226.67 ? 653 THR B OG1   1 
ATOM   5961  C CG2   . THR B 2 653 ? 221.761 172.127 113.665 1.00 226.67 ? 653 THR B CG2   1 
ATOM   5962  N N     . ASN B 2 654 ? 221.186 172.347 118.426 1.00 232.77 ? 654 ASN B N     1 
ATOM   5963  C CA    . ASN B 2 654 ? 221.405 172.845 119.784 1.00 232.77 ? 654 ASN B CA    1 
ATOM   5964  C C     . ASN B 2 654 ? 222.584 172.071 120.362 1.00 232.77 ? 654 ASN B C     1 
ATOM   5965  O O     . ASN B 2 654 ? 222.397 171.053 121.033 1.00 232.77 ? 654 ASN B O     1 
ATOM   5966  C CB    . ASN B 2 654 ? 220.149 172.683 120.633 1.00 232.77 ? 654 ASN B CB    1 
ATOM   5967  C CG    . ASN B 2 654 ? 220.262 173.369 121.978 1.00 232.77 ? 654 ASN B CG    1 
ATOM   5968  O OD1   . ASN B 2 654 ? 221.287 173.972 122.298 1.00 232.77 ? 654 ASN B OD1   1 
ATOM   5969  N ND2   . ASN B 2 654 ? 219.208 173.274 122.780 1.00 232.77 ? 654 ASN B ND2   1 
ATOM   5970  N N     . ALA B 2 655 ? 223.792 172.554 120.106 1.00 246.01 ? 655 ALA B N     1 
ATOM   5971  C CA    . ALA B 2 655 ? 225.006 171.834 120.478 1.00 246.01 ? 655 ALA B CA    1 
ATOM   5972  C C     . ALA B 2 655 ? 226.196 172.771 120.338 1.00 246.01 ? 655 ALA B C     1 
ATOM   5973  O O     . ALA B 2 655 ? 226.042 173.984 120.153 1.00 246.01 ? 655 ALA B O     1 
ATOM   5974  C CB    . ALA B 2 655 ? 225.206 170.597 119.608 1.00 246.01 ? 655 ALA B CB    1 
ATOM   5975  N N     . GLU B 2 656 ? 227.393 172.192 120.438 1.00 262.38 ? 656 GLU B N     1 
ATOM   5976  C CA    . GLU B 2 656 ? 228.592 172.874 119.977 1.00 262.38 ? 656 GLU B CA    1 
ATOM   5977  C C     . GLU B 2 656 ? 228.797 172.660 118.483 1.00 262.38 ? 656 GLU B C     1 
ATOM   5978  O O     . GLU B 2 656 ? 229.140 173.605 117.762 1.00 262.38 ? 656 GLU B O     1 
ATOM   5979  C CB    . GLU B 2 656 ? 229.811 172.392 120.764 1.00 262.38 ? 656 GLU B CB    1 
ATOM   5980  C CG    . GLU B 2 656 ? 231.092 173.140 120.438 1.00 262.38 ? 656 GLU B CG    1 
ATOM   5981  C CD    . GLU B 2 656 ? 232.266 172.672 121.271 1.00 262.38 ? 656 GLU B CD    1 
ATOM   5982  O OE1   . GLU B 2 656 ? 232.086 171.741 122.084 1.00 262.38 ? 656 GLU B OE1   1 
ATOM   5983  O OE2   . GLU B 2 656 ? 233.368 173.236 121.116 1.00 262.38 ? 656 GLU B OE2   1 
ATOM   5984  N N     . GLN B 2 657 ? 228.594 171.435 117.991 1.00 264.36 ? 657 GLN B N     1 
ATOM   5985  C CA    . GLN B 2 657 ? 228.664 171.188 116.557 1.00 264.36 ? 657 GLN B CA    1 
ATOM   5986  C C     . GLN B 2 657 ? 227.329 170.762 115.959 1.00 264.36 ? 657 GLN B C     1 
ATOM   5987  O O     . GLN B 2 657 ? 226.774 171.492 115.133 1.00 264.36 ? 657 GLN B O     1 
ATOM   5988  C CB    . GLN B 2 657 ? 229.728 170.122 116.259 1.00 264.36 ? 657 GLN B CB    1 
ATOM   5989  C CG    . GLN B 2 657 ? 231.159 170.542 116.546 1.00 264.36 ? 657 GLN B CG    1 
ATOM   5990  C CD    . GLN B 2 657 ? 232.154 169.440 116.228 1.00 264.36 ? 657 GLN B CD    1 
ATOM   5991  O OE1   . GLN B 2 657 ? 231.770 168.333 115.850 1.00 264.36 ? 657 GLN B OE1   1 
ATOM   5992  N NE2   . GLN B 2 657 ? 233.440 169.738 116.378 1.00 264.36 ? 657 GLN B NE2   1 
ATOM   5993  N N     . ASN B 2 658 ? 226.787 169.600 116.338 1.00 245.34 ? 658 ASN B N     1 
ATOM   5994  C CA    . ASN B 2 658 ? 225.503 169.216 115.760 1.00 245.34 ? 658 ASN B CA    1 
ATOM   5995  C C     . ASN B 2 658 ? 224.390 168.889 116.756 1.00 245.34 ? 658 ASN B C     1 
ATOM   5996  O O     . ASN B 2 658 ? 223.431 169.658 116.880 1.00 245.34 ? 658 ASN B O     1 
ATOM   5997  C CB    . ASN B 2 658 ? 225.722 168.034 114.808 1.00 245.34 ? 658 ASN B CB    1 
ATOM   5998  C CG    . ASN B 2 658 ? 226.413 166.856 115.476 1.00 245.34 ? 658 ASN B CG    1 
ATOM   5999  O OD1   . ASN B 2 658 ? 226.649 166.863 116.684 1.00 245.34 ? 658 ASN B OD1   1 
ATOM   6000  N ND2   . ASN B 2 658 ? 226.740 165.838 114.690 1.00 245.34 ? 658 ASN B ND2   1 
ATOM   6001  N N     . LEU B 2 659 ? 224.542 167.789 117.504 1.00 235.66 ? 659 LEU B N     1 
ATOM   6002  C CA    . LEU B 2 659 ? 223.465 167.189 118.297 1.00 235.66 ? 659 LEU B CA    1 
ATOM   6003  C C     . LEU B 2 659 ? 222.106 167.389 117.634 1.00 235.66 ? 659 LEU B C     1 
ATOM   6004  O O     . LEU B 2 659 ? 221.204 167.982 118.234 1.00 235.66 ? 659 LEU B O     1 
ATOM   6005  C CB    . LEU B 2 659 ? 223.445 167.728 119.728 1.00 235.66 ? 659 LEU B CB    1 
ATOM   6006  C CG    . LEU B 2 659 ? 224.598 167.260 120.624 1.00 235.66 ? 659 LEU B CG    1 
ATOM   6007  C CD1   . LEU B 2 659 ? 224.546 167.945 121.982 1.00 235.66 ? 659 LEU B CD1   1 
ATOM   6008  C CD2   . LEU B 2 659 ? 224.576 165.748 120.782 1.00 235.66 ? 659 LEU B CD2   1 
ATOM   6009  N N     . PHE B 2 660 ? 221.962 166.919 116.395 1.00 224.58 ? 660 PHE B N     1 
ATOM   6010  C CA    . PHE B 2 660 ? 220.762 167.199 115.612 1.00 224.58 ? 660 PHE B CA    1 
ATOM   6011  C C     . PHE B 2 660 ? 219.506 166.730 116.335 1.00 224.58 ? 660 PHE B C     1 
ATOM   6012  O O     . PHE B 2 660 ? 219.447 165.606 116.841 1.00 224.58 ? 660 PHE B O     1 
ATOM   6013  C CB    . PHE B 2 660 ? 220.867 166.529 114.245 1.00 224.58 ? 660 PHE B CB    1 
ATOM   6014  C CG    . PHE B 2 660 ? 221.834 167.202 113.318 1.00 224.58 ? 660 PHE B CG    1 
ATOM   6015  C CD1   . PHE B 2 660 ? 222.253 168.499 113.558 1.00 224.58 ? 660 PHE B CD1   1 
ATOM   6016  C CD2   . PHE B 2 660 ? 222.329 166.536 112.210 1.00 224.58 ? 660 PHE B CD2   1 
ATOM   6017  C CE1   . PHE B 2 660 ? 223.140 169.122 112.705 1.00 224.58 ? 660 PHE B CE1   1 
ATOM   6018  C CE2   . PHE B 2 660 ? 223.220 167.156 111.356 1.00 224.58 ? 660 PHE B CE2   1 
ATOM   6019  C CZ    . PHE B 2 660 ? 223.625 168.450 111.604 1.00 224.58 ? 660 PHE B CZ    1 
ATOM   6020  N N     . GLU B 2 661 ? 218.502 167.600 116.386 1.00 217.21 ? 661 GLU B N     1 
ATOM   6021  C CA    . GLU B 2 661 ? 217.257 167.287 117.070 1.00 217.21 ? 661 GLU B CA    1 
ATOM   6022  C C     . GLU B 2 661 ? 216.060 167.689 116.219 1.00 217.21 ? 661 GLU B C     1 
ATOM   6023  O O     . GLU B 2 661 ? 215.870 168.879 115.938 1.00 217.21 ? 661 GLU B O     1 
ATOM   6024  C CB    . GLU B 2 661 ? 217.206 167.979 118.431 1.00 217.21 ? 661 GLU B CB    1 
ATOM   6025  C CG    . GLU B 2 661 ? 218.202 167.427 119.435 1.00 217.21 ? 661 GLU B CG    1 
ATOM   6026  C CD    . GLU B 2 661 ? 218.136 168.125 120.777 1.00 217.21 ? 661 GLU B CD    1 
ATOM   6027  O OE1   . GLU B 2 661 ? 217.416 169.140 120.892 1.00 217.21 ? 661 GLU B OE1   1 
ATOM   6028  O OE2   . GLU B 2 661 ? 218.800 167.652 121.723 1.00 217.21 ? 661 GLU B OE2   1 
ATOM   6029  N N     . PRO B 2 662 ? 215.242 166.732 115.787 1.00 203.71 ? 662 PRO B N     1 
ATOM   6030  C CA    . PRO B 2 662 ? 214.065 167.074 114.983 1.00 203.71 ? 662 PRO B CA    1 
ATOM   6031  C C     . PRO B 2 662 ? 213.000 167.774 115.813 1.00 203.71 ? 662 PRO B C     1 
ATOM   6032  O O     . PRO B 2 662 ? 212.868 167.552 117.019 1.00 203.71 ? 662 PRO B O     1 
ATOM   6033  C CB    . PRO B 2 662 ? 213.568 165.713 114.488 1.00 203.71 ? 662 PRO B CB    1 
ATOM   6034  C CG    . PRO B 2 662 ? 214.747 164.806 114.612 1.00 203.71 ? 662 PRO B CG    1 
ATOM   6035  C CD    . PRO B 2 662 ? 215.484 165.283 115.820 1.00 203.71 ? 662 PRO B CD    1 
ATOM   6036  N N     . ILE B 2 663 ? 212.232 168.631 115.142 1.00 195.30 ? 663 ILE B N     1 
ATOM   6037  C CA    . ILE B 2 663 ? 211.127 169.358 115.758 1.00 195.30 ? 663 ILE B CA    1 
ATOM   6038  C C     . ILE B 2 663 ? 209.959 169.363 114.783 1.00 195.30 ? 663 ILE B C     1 
ATOM   6039  O O     . ILE B 2 663 ? 210.138 169.639 113.592 1.00 195.30 ? 663 ILE B O     1 
ATOM   6040  C CB    . ILE B 2 663 ? 211.520 170.800 116.141 1.00 195.30 ? 663 ILE B CB    1 
ATOM   6041  C CG1   . ILE B 2 663 ? 212.598 170.796 117.228 1.00 195.30 ? 663 ILE B CG1   1 
ATOM   6042  C CG2   . ILE B 2 663 ? 210.303 171.580 116.609 1.00 195.30 ? 663 ILE B CG2   1 
ATOM   6043  C CD1   . ILE B 2 663 ? 213.209 172.158 117.490 1.00 195.30 ? 663 ILE B CD1   1 
ATOM   6044  N N     . VAL B 2 664 ? 208.766 169.059 115.286 1.00 188.63 ? 664 VAL B N     1 
ATOM   6045  C CA    . VAL B 2 664 ? 207.554 168.990 114.480 1.00 188.63 ? 664 VAL B CA    1 
ATOM   6046  C C     . VAL B 2 664 ? 206.696 170.208 114.789 1.00 188.63 ? 664 VAL B C     1 
ATOM   6047  O O     . VAL B 2 664 ? 206.476 170.541 115.959 1.00 188.63 ? 664 VAL B O     1 
ATOM   6048  C CB    . VAL B 2 664 ? 206.775 167.692 114.749 1.00 188.63 ? 664 VAL B CB    1 
ATOM   6049  C CG1   . VAL B 2 664 ? 205.454 167.697 113.997 1.00 188.63 ? 664 VAL B CG1   1 
ATOM   6050  C CG2   . VAL B 2 664 ? 207.609 166.487 114.355 1.00 188.63 ? 664 VAL B CG2   1 
ATOM   6051  N N     . ARG B 2 665 ? 206.211 170.867 113.742 1.00 181.22 ? 665 ARG B N     1 
ATOM   6052  C CA    . ARG B 2 665 ? 205.320 172.012 113.871 1.00 181.22 ? 665 ARG B CA    1 
ATOM   6053  C C     . ARG B 2 665 ? 203.951 171.630 113.330 1.00 181.22 ? 665 ARG B C     1 
ATOM   6054  O O     . ARG B 2 665 ? 203.799 171.396 112.127 1.00 181.22 ? 665 ARG B O     1 
ATOM   6055  C CB    . ARG B 2 665 ? 205.871 173.226 113.126 1.00 181.22 ? 665 ARG B CB    1 
ATOM   6056  C CG    . ARG B 2 665 ? 205.055 174.489 113.327 1.00 181.22 ? 665 ARG B CG    1 
ATOM   6057  C CD    . ARG B 2 665 ? 205.671 175.666 112.592 1.00 181.22 ? 665 ARG B CD    1 
ATOM   6058  N NE    . ARG B 2 665 ? 206.992 176.001 113.116 1.00 181.22 ? 665 ARG B NE    1 
ATOM   6059  C CZ    . ARG B 2 665 ? 207.204 176.775 114.175 1.00 181.22 ? 665 ARG B CZ    1 
ATOM   6060  N NH1   . ARG B 2 665 ? 206.179 177.301 114.831 1.00 181.22 ? 665 ARG B NH1   1 
ATOM   6061  N NH2   . ARG B 2 665 ? 208.442 177.024 114.579 1.00 181.22 ? 665 ARG B NH2   1 
ATOM   6062  N N     . VAL B 2 666 ? 202.961 171.571 114.214 1.00 176.87 ? 666 VAL B N     1 
ATOM   6063  C CA    . VAL B 2 666 ? 201.592 171.240 113.845 1.00 176.87 ? 666 VAL B CA    1 
ATOM   6064  C C     . VAL B 2 666 ? 200.737 172.485 114.020 1.00 176.87 ? 666 VAL B C     1 
ATOM   6065  O O     . VAL B 2 666 ? 200.971 173.287 114.931 1.00 176.87 ? 666 VAL B O     1 
ATOM   6066  C CB    . VAL B 2 666 ? 201.044 170.063 114.681 1.00 176.87 ? 666 VAL B CB    1 
ATOM   6067  C CG1   . VAL B 2 666 ? 200.945 170.439 116.154 1.00 176.87 ? 666 VAL B CG1   1 
ATOM   6068  C CG2   . VAL B 2 666 ? 199.696 169.602 114.146 1.00 176.87 ? 666 VAL B CG2   1 
ATOM   6069  N N     . ARG B 2 667 ? 199.763 172.661 113.132 1.00 163.81 ? 667 ARG B N     1 
ATOM   6070  C CA    . ARG B 2 667 ? 198.860 173.808 113.173 1.00 163.81 ? 667 ARG B CA    1 
ATOM   6071  C C     . ARG B 2 667 ? 197.435 173.297 113.350 1.00 163.81 ? 667 ARG B C     1 
ATOM   6072  O O     . ARG B 2 667 ? 196.796 172.867 112.385 1.00 163.81 ? 667 ARG B O     1 
ATOM   6073  C CB    . ARG B 2 667 ? 198.989 174.659 111.914 1.00 163.81 ? 667 ARG B CB    1 
ATOM   6074  C CG    . ARG B 2 667 ? 198.115 175.900 111.931 1.00 163.81 ? 667 ARG B CG    1 
ATOM   6075  C CD    . ARG B 2 667 ? 198.340 176.755 110.700 1.00 163.81 ? 667 ARG B CD    1 
ATOM   6076  N NE    . ARG B 2 667 ? 197.460 177.918 110.679 1.00 163.81 ? 667 ARG B NE    1 
ATOM   6077  C CZ    . ARG B 2 667 ? 197.459 178.834 109.717 1.00 163.81 ? 667 ARG B CZ    1 
ATOM   6078  N NH1   . ARG B 2 667 ? 196.623 179.861 109.776 1.00 163.81 ? 667 ARG B NH1   1 
ATOM   6079  N NH2   . ARG B 2 667 ? 198.295 178.723 108.695 1.00 163.81 ? 667 ARG B NH2   1 
ATOM   6080  N N     . THR B 2 668 ? 196.941 173.347 114.585 1.00 154.23 ? 668 THR B N     1 
ATOM   6081  C CA    . THR B 2 668 ? 195.544 173.043 114.864 1.00 154.23 ? 668 THR B CA    1 
ATOM   6082  C C     . THR B 2 668 ? 194.690 174.272 114.586 1.00 154.23 ? 668 THR B C     1 
ATOM   6083  O O     . THR B 2 668 ? 195.141 175.197 113.903 1.00 154.23 ? 668 THR B O     1 
ATOM   6084  C CB    . THR B 2 668 ? 195.351 172.559 116.304 1.00 154.23 ? 668 THR B CB    1 
ATOM   6085  O OG1   . THR B 2 668 ? 193.993 172.140 116.489 1.00 154.23 ? 668 THR B OG1   1 
ATOM   6086  C CG2   . THR B 2 668 ? 195.675 173.660 117.300 1.00 154.23 ? 668 THR B CG2   1 
ATOM   6087  N N     . HIS B 2 669 ? 193.455 174.268 115.095 1.00 133.56 ? 669 HIS B N     1 
ATOM   6088  C CA    . HIS B 2 669 ? 192.444 175.275 114.793 1.00 133.56 ? 669 HIS B CA    1 
ATOM   6089  C C     . HIS B 2 669 ? 193.009 176.687 114.651 1.00 133.56 ? 669 HIS B C     1 
ATOM   6090  O O     . HIS B 2 669 ? 192.849 177.327 113.606 1.00 133.56 ? 669 HIS B O     1 
ATOM   6091  C CB    . HIS B 2 669 ? 191.379 175.242 115.889 1.00 133.56 ? 669 HIS B CB    1 
ATOM   6092  C CG    . HIS B 2 669 ? 190.692 173.919 116.017 1.00 133.56 ? 669 HIS B CG    1 
ATOM   6093  N ND1   . HIS B 2 669 ? 191.169 172.912 116.827 1.00 133.56 ? 669 HIS B ND1   1 
ATOM   6094  C CD2   . HIS B 2 669 ? 189.572 173.434 115.432 1.00 133.56 ? 669 HIS B CD2   1 
ATOM   6095  C CE1   . HIS B 2 669 ? 190.369 171.864 116.740 1.00 133.56 ? 669 HIS B CE1   1 
ATOM   6096  N NE2   . HIS B 2 669 ? 189.393 172.155 115.899 1.00 133.56 ? 669 HIS B NE2   1 
ATOM   6097  N N     . GLY B 2 670 ? 193.673 177.191 115.687 1.00 157.14 ? 670 GLY B N     1 
ATOM   6098  C CA    . GLY B 2 670 ? 194.164 178.554 115.615 1.00 157.14 ? 670 GLY B CA    1 
ATOM   6099  C C     . GLY B 2 670 ? 195.585 178.812 116.075 1.00 157.14 ? 670 GLY B C     1 
ATOM   6100  O O     . GLY B 2 670 ? 196.121 179.896 115.829 1.00 157.14 ? 670 GLY B O     1 
ATOM   6101  N N     . VAL B 2 671 ? 196.213 177.844 116.738 1.00 175.04 ? 671 VAL B N     1 
ATOM   6102  C CA    . VAL B 2 671 ? 197.523 178.044 117.347 1.00 175.04 ? 671 VAL B CA    1 
ATOM   6103  C C     . VAL B 2 671 ? 198.419 176.861 117.013 1.00 175.04 ? 671 VAL B C     1 
ATOM   6104  O O     . VAL B 2 671 ? 197.984 175.706 117.066 1.00 175.04 ? 671 VAL B O     1 
ATOM   6105  C CB    . VAL B 2 671 ? 197.412 178.226 118.877 1.00 175.04 ? 671 VAL B CB    1 
ATOM   6106  C CG1   . VAL B 2 671 ? 198.793 178.351 119.507 1.00 175.04 ? 671 VAL B CG1   1 
ATOM   6107  C CG2   . VAL B 2 671 ? 196.559 179.440 119.212 1.00 175.04 ? 671 VAL B CG2   1 
ATOM   6108  N N     . ASP B 2 672 ? 199.672 177.148 116.675 1.00 190.23 ? 672 ASP B N     1 
ATOM   6109  C CA    . ASP B 2 672 ? 200.658 176.112 116.410 1.00 190.23 ? 672 ASP B CA    1 
ATOM   6110  C C     . ASP B 2 672 ? 201.331 175.662 117.701 1.00 190.23 ? 672 ASP B C     1 
ATOM   6111  O O     . ASP B 2 672 ? 201.335 176.376 118.708 1.00 190.23 ? 672 ASP B O     1 
ATOM   6112  C CB    . ASP B 2 672 ? 201.708 176.610 115.417 1.00 190.23 ? 672 ASP B CB    1 
ATOM   6113  C CG    . ASP B 2 672 ? 202.410 177.868 115.888 1.00 190.23 ? 672 ASP B CG    1 
ATOM   6114  O OD1   . ASP B 2 672 ? 202.007 178.429 116.928 1.00 190.23 ? 672 ASP B OD1   1 
ATOM   6115  O OD2   . ASP B 2 672 ? 203.373 178.296 115.217 1.00 190.23 ? 672 ASP B OD2   1 
ATOM   6116  N N     . THR B 2 673 ? 201.902 174.459 117.664 1.00 190.45 ? 673 THR B N     1 
ATOM   6117  C CA    . THR B 2 673 ? 202.585 173.888 118.817 1.00 190.45 ? 673 THR B CA    1 
ATOM   6118  C C     . THR B 2 673 ? 203.733 173.013 118.341 1.00 190.45 ? 673 THR B C     1 
ATOM   6119  O O     . THR B 2 673 ? 203.546 172.163 117.466 1.00 190.45 ? 673 THR B O     1 
ATOM   6120  C CB    . THR B 2 673 ? 201.626 173.065 119.683 1.00 190.45 ? 673 THR B CB    1 
ATOM   6121  O OG1   . THR B 2 673 ? 200.561 173.903 120.147 1.00 190.45 ? 673 THR B OG1   1 
ATOM   6122  C CG2   . THR B 2 673 ? 202.359 172.483 120.878 1.00 190.45 ? 673 THR B CG2   1 
ATOM   6123  N N     . ASP B 2 674 ? 204.910 173.219 118.920 1.00 197.41 ? 674 ASP B N     1 
ATOM   6124  C CA    . ASP B 2 674 ? 206.080 172.424 118.582 1.00 197.41 ? 674 ASP B CA    1 
ATOM   6125  C C     . ASP B 2 674 ? 206.233 171.245 119.538 1.00 197.41 ? 674 ASP B C     1 
ATOM   6126  O O     . ASP B 2 674 ? 205.642 171.204 120.619 1.00 197.41 ? 674 ASP B O     1 
ATOM   6127  C CB    . ASP B 2 674 ? 207.343 173.283 118.605 1.00 197.41 ? 674 ASP B CB    1 
ATOM   6128  C CG    . ASP B 2 674 ? 207.592 173.922 119.958 1.00 197.41 ? 674 ASP B CG    1 
ATOM   6129  O OD1   . ASP B 2 674 ? 206.726 173.809 120.851 1.00 197.41 ? 674 ASP B OD1   1 
ATOM   6130  O OD2   . ASP B 2 674 ? 208.668 174.533 120.132 1.00 197.41 ? 674 ASP B OD2   1 
ATOM   6131  N N     . TYR B 2 675 ? 207.049 170.279 119.120 1.00 194.79 ? 675 TYR B N     1 
ATOM   6132  C CA    . TYR B 2 675 ? 207.331 169.095 119.931 1.00 194.79 ? 675 TYR B CA    1 
ATOM   6133  C C     . TYR B 2 675 ? 208.743 168.629 119.626 1.00 194.79 ? 675 TYR B C     1 
ATOM   6134  O O     . TYR B 2 675 ? 208.964 167.794 118.739 1.00 194.79 ? 675 TYR B O     1 
ATOM   6135  C CB    . TYR B 2 675 ? 206.319 167.981 119.675 1.00 194.79 ? 675 TYR B CB    1 
ATOM   6136  C CG    . TYR B 2 675 ? 204.930 168.324 120.149 1.00 194.79 ? 675 TYR B CG    1 
ATOM   6137  C CD1   . TYR B 2 675 ? 204.584 168.197 121.487 1.00 194.79 ? 675 TYR B CD1   1 
ATOM   6138  C CD2   . TYR B 2 675 ? 203.968 168.792 119.266 1.00 194.79 ? 675 TYR B CD2   1 
ATOM   6139  C CE1   . TYR B 2 675 ? 203.319 168.514 121.930 1.00 194.79 ? 675 TYR B CE1   1 
ATOM   6140  C CE2   . TYR B 2 675 ? 202.699 169.113 119.700 1.00 194.79 ? 675 TYR B CE2   1 
ATOM   6141  C CZ    . TYR B 2 675 ? 202.380 168.972 121.033 1.00 194.79 ? 675 TYR B CZ    1 
ATOM   6142  O OH    . TYR B 2 675 ? 201.118 169.288 121.475 1.00 194.79 ? 675 TYR B OH    1 
ATOM   6143  N N     . PRO B 2 676 ? 209.733 169.154 120.341 1.00 203.76 ? 676 PRO B N     1 
ATOM   6144  C CA    . PRO B 2 676 ? 211.127 168.781 120.073 1.00 203.76 ? 676 PRO B CA    1 
ATOM   6145  C C     . PRO B 2 676 ? 211.406 167.335 120.457 1.00 203.76 ? 676 PRO B C     1 
ATOM   6146  O O     . PRO B 2 676 ? 210.611 166.658 121.113 1.00 203.76 ? 676 PRO B O     1 
ATOM   6147  C CB    . PRO B 2 676 ? 211.926 169.752 120.949 1.00 203.76 ? 676 PRO B CB    1 
ATOM   6148  C CG    . PRO B 2 676 ? 210.996 170.900 121.194 1.00 203.76 ? 676 PRO B CG    1 
ATOM   6149  C CD    . PRO B 2 676 ? 209.634 170.283 121.281 1.00 203.76 ? 676 PRO B CD    1 
ATOM   6150  N N     . LEU B 2 677 ? 212.577 166.865 120.029 1.00 212.13 ? 677 LEU B N     1 
ATOM   6151  C CA    . LEU B 2 677 ? 213.045 165.515 120.311 1.00 212.13 ? 677 LEU B CA    1 
ATOM   6152  C C     . LEU B 2 677 ? 214.428 165.601 120.937 1.00 212.13 ? 677 LEU B C     1 
ATOM   6153  O O     . LEU B 2 677 ? 215.321 166.251 120.385 1.00 212.13 ? 677 LEU B O     1 
ATOM   6154  C CB    . LEU B 2 677 ? 213.085 164.659 119.039 1.00 212.13 ? 677 LEU B CB    1 
ATOM   6155  C CG    . LEU B 2 677 ? 211.765 164.078 118.521 1.00 212.13 ? 677 LEU B CG    1 
ATOM   6156  C CD1   . LEU B 2 677 ? 210.885 165.143 117.881 1.00 212.13 ? 677 LEU B CD1   1 
ATOM   6157  C CD2   . LEU B 2 677 ? 212.036 162.949 117.540 1.00 212.13 ? 677 LEU B CD2   1 
ATOM   6158  N N     . ASP B 2 678 ? 214.604 164.951 122.084 1.00 219.97 ? 678 ASP B N     1 
ATOM   6159  C CA    . ASP B 2 678 ? 215.831 165.049 122.860 1.00 219.97 ? 678 ASP B CA    1 
ATOM   6160  C C     . ASP B 2 678 ? 216.397 163.665 123.153 1.00 219.97 ? 678 ASP B C     1 
ATOM   6161  O O     . ASP B 2 678 ? 215.777 162.634 122.872 1.00 219.97 ? 678 ASP B O     1 
ATOM   6162  C CB    . ASP B 2 678 ? 215.591 165.803 124.174 1.00 219.97 ? 678 ASP B CB    1 
ATOM   6163  C CG    . ASP B 2 678 ? 215.294 167.272 123.956 1.00 219.97 ? 678 ASP B CG    1 
ATOM   6164  O OD1   . ASP B 2 678 ? 215.775 167.835 122.951 1.00 219.97 ? 678 ASP B OD1   1 
ATOM   6165  O OD2   . ASP B 2 678 ? 214.579 167.865 124.792 1.00 219.97 ? 678 ASP B OD2   1 
ATOM   6166  N N     . HIS B 2 679 ? 217.605 163.668 123.724 1.00 220.91 ? 679 HIS B N     1 
ATOM   6167  C CA    . HIS B 2 679 ? 218.266 162.419 124.088 1.00 220.91 ? 679 HIS B CA    1 
ATOM   6168  C C     . HIS B 2 679 ? 217.433 161.625 125.082 1.00 220.91 ? 679 HIS B C     1 
ATOM   6169  O O     . HIS B 2 679 ? 217.355 160.394 124.995 1.00 220.91 ? 679 HIS B O     1 
ATOM   6170  C CB    . HIS B 2 679 ? 219.648 162.710 124.671 1.00 220.91 ? 679 HIS B CB    1 
ATOM   6171  C CG    . HIS B 2 679 ? 220.591 163.347 123.700 1.00 220.91 ? 679 HIS B CG    1 
ATOM   6172  N ND1   . HIS B 2 679 ? 221.225 162.637 122.703 1.00 220.91 ? 679 HIS B ND1   1 
ATOM   6173  C CD2   . HIS B 2 679 ? 221.006 164.629 123.571 1.00 220.91 ? 679 HIS B CD2   1 
ATOM   6174  C CE1   . HIS B 2 679 ? 221.993 163.455 122.004 1.00 220.91 ? 679 HIS B CE1   1 
ATOM   6175  N NE2   . HIS B 2 679 ? 221.877 164.669 122.510 1.00 220.91 ? 679 HIS B NE2   1 
ATOM   6176  N N     . GLU B 2 680 ? 216.800 162.314 126.033 1.00 219.96 ? 680 GLU B N     1 
ATOM   6177  C CA    . GLU B 2 680 ? 215.979 161.619 127.016 1.00 219.96 ? 680 GLU B CA    1 
ATOM   6178  C C     . GLU B 2 680 ? 214.764 160.977 126.362 1.00 219.96 ? 680 GLU B C     1 
ATOM   6179  O O     . GLU B 2 680 ? 214.405 159.841 126.690 1.00 219.96 ? 680 GLU B O     1 
ATOM   6180  C CB    . GLU B 2 680 ? 215.554 162.583 128.122 1.00 219.96 ? 680 GLU B CB    1 
ATOM   6181  C CG    . GLU B 2 680 ? 216.708 163.081 128.974 1.00 219.96 ? 680 GLU B CG    1 
ATOM   6182  C CD    . GLU B 2 680 ? 216.256 164.022 130.071 1.00 219.96 ? 680 GLU B CD    1 
ATOM   6183  O OE1   . GLU B 2 680 ? 215.057 164.368 130.104 1.00 219.96 ? 680 GLU B OE1   1 
ATOM   6184  O OE2   . GLU B 2 680 ? 217.102 164.419 130.900 1.00 219.96 ? 680 GLU B OE2   1 
ATOM   6185  N N     . PHE B 2 681 ? 214.124 161.681 125.427 1.00 207.41 ? 681 PHE B N     1 
ATOM   6186  C CA    . PHE B 2 681 ? 213.001 161.087 124.713 1.00 207.41 ? 681 PHE B CA    1 
ATOM   6187  C C     . PHE B 2 681 ? 213.444 159.883 123.895 1.00 207.41 ? 681 PHE B C     1 
ATOM   6188  O O     . PHE B 2 681 ? 212.729 158.878 123.817 1.00 207.41 ? 681 PHE B O     1 
ATOM   6189  C CB    . PHE B 2 681 ? 212.335 162.120 123.810 1.00 207.41 ? 681 PHE B CB    1 
ATOM   6190  C CG    . PHE B 2 681 ? 211.169 161.577 123.040 1.00 207.41 ? 681 PHE B CG    1 
ATOM   6191  C CD1   . PHE B 2 681 ? 209.957 161.349 123.666 1.00 207.41 ? 681 PHE B CD1   1 
ATOM   6192  C CD2   . PHE B 2 681 ? 211.290 161.276 121.694 1.00 207.41 ? 681 PHE B CD2   1 
ATOM   6193  C CE1   . PHE B 2 681 ? 208.882 160.842 122.964 1.00 207.41 ? 681 PHE B CE1   1 
ATOM   6194  C CE2   . PHE B 2 681 ? 210.219 160.769 120.986 1.00 207.41 ? 681 PHE B CE2   1 
ATOM   6195  C CZ    . PHE B 2 681 ? 209.014 160.551 121.622 1.00 207.41 ? 681 PHE B CZ    1 
ATOM   6196  N N     . ILE B 2 682 ? 214.622 159.968 123.275 1.00 207.58 ? 682 ILE B N     1 
ATOM   6197  C CA    . ILE B 2 682 ? 215.113 158.849 122.475 1.00 207.58 ? 682 ILE B CA    1 
ATOM   6198  C C     . ILE B 2 682 ? 215.412 157.645 123.361 1.00 207.58 ? 682 ILE B C     1 
ATOM   6199  O O     . ILE B 2 682 ? 215.140 156.498 122.987 1.00 207.58 ? 682 ILE B O     1 
ATOM   6200  C CB    . ILE B 2 682 ? 216.348 159.270 121.660 1.00 207.58 ? 682 ILE B CB    1 
ATOM   6201  C CG1   . ILE B 2 682 ? 215.994 160.413 120.712 1.00 207.58 ? 682 ILE B CG1   1 
ATOM   6202  C CG2   . ILE B 2 682 ? 216.897 158.091 120.877 1.00 207.58 ? 682 ILE B CG2   1 
ATOM   6203  C CD1   . ILE B 2 682 ? 214.911 160.064 119.725 1.00 207.58 ? 682 ILE B CD1   1 
ATOM   6204  N N     . THR B 2 683 ? 215.967 157.885 124.550 1.00 214.09 ? 683 THR B N     1 
ATOM   6205  C CA    . THR B 2 683 ? 216.373 156.795 125.429 1.00 214.09 ? 683 THR B CA    1 
ATOM   6206  C C     . THR B 2 683 ? 215.216 156.264 126.274 1.00 214.09 ? 683 THR B C     1 
ATOM   6207  O O     . THR B 2 683 ? 215.337 155.180 126.856 1.00 214.09 ? 683 THR B O     1 
ATOM   6208  C CB    . THR B 2 683 ? 217.524 157.269 126.326 1.00 214.09 ? 683 THR B CB    1 
ATOM   6209  O OG1   . THR B 2 683 ? 218.539 157.867 125.511 1.00 214.09 ? 683 THR B OG1   1 
ATOM   6210  C CG2   . THR B 2 683 ? 218.161 156.104 127.077 1.00 214.09 ? 683 THR B CG2   1 
ATOM   6211  N N     . GLY B 2 684 ? 214.100 156.987 126.331 1.00 214.57 ? 684 GLY B N     1 
ATOM   6212  C CA    . GLY B 2 684 ? 212.989 156.557 127.166 1.00 214.57 ? 684 GLY B CA    1 
ATOM   6213  C C     . GLY B 2 684 ? 212.540 155.142 126.846 1.00 214.57 ? 684 GLY B C     1 
ATOM   6214  O O     . GLY B 2 684 ? 212.450 154.740 125.683 1.00 214.57 ? 684 GLY B O     1 
ATOM   6215  N N     . GLY B 2 685 ? 212.256 154.380 127.905 1.00 216.43 ? 685 GLY B N     1 
ATOM   6216  C CA    . GLY B 2 685 ? 211.820 153.007 127.730 1.00 216.43 ? 685 GLY B CA    1 
ATOM   6217  C C     . GLY B 2 685 ? 210.510 152.889 126.981 1.00 216.43 ? 685 GLY B C     1 
ATOM   6218  O O     . GLY B 2 685 ? 210.271 151.893 126.298 1.00 216.43 ? 685 GLY B O     1 
ATOM   6219  N N     . GLU B 2 686 ? 209.649 153.902 127.085 1.00 216.80 ? 686 GLU B N     1 
ATOM   6220  C CA    . GLU B 2 686 ? 208.403 153.885 126.327 1.00 216.80 ? 686 GLU B CA    1 
ATOM   6221  C C     . GLU B 2 686 ? 208.680 153.948 124.830 1.00 216.80 ? 686 GLU B C     1 
ATOM   6222  O O     . GLU B 2 686 ? 208.144 153.150 124.051 1.00 216.80 ? 686 GLU B O     1 
ATOM   6223  C CB    . GLU B 2 686 ? 207.507 155.043 126.768 1.00 216.80 ? 686 GLU B CB    1 
ATOM   6224  C CG    . GLU B 2 686 ? 207.020 154.923 128.206 1.00 216.80 ? 686 GLU B CG    1 
ATOM   6225  C CD    . GLU B 2 686 ? 206.140 156.083 128.627 1.00 216.80 ? 686 GLU B CD    1 
ATOM   6226  O OE1   . GLU B 2 686 ? 205.998 157.041 127.839 1.00 216.80 ? 686 GLU B OE1   1 
ATOM   6227  O OE2   . GLU B 2 686 ? 205.590 156.038 129.749 1.00 216.80 ? 686 GLU B OE2   1 
ATOM   6228  N N     . TYR B 2 687 ? 209.525 154.892 124.412 1.00 209.15 ? 687 TYR B N     1 
ATOM   6229  C CA    . TYR B 2 687 ? 209.938 154.954 123.016 1.00 209.15 ? 687 TYR B CA    1 
ATOM   6230  C C     . TYR B 2 687 ? 210.667 153.685 122.594 1.00 209.15 ? 687 TYR B C     1 
ATOM   6231  O O     . TYR B 2 687 ? 210.530 153.241 121.449 1.00 209.15 ? 687 TYR B O     1 
ATOM   6232  C CB    . TYR B 2 687 ? 210.819 156.182 122.790 1.00 209.15 ? 687 TYR B CB    1 
ATOM   6233  C CG    . TYR B 2 687 ? 211.312 156.340 121.373 1.00 209.15 ? 687 TYR B CG    1 
ATOM   6234  C CD1   . TYR B 2 687 ? 210.451 156.734 120.360 1.00 209.15 ? 687 TYR B CD1   1 
ATOM   6235  C CD2   . TYR B 2 687 ? 212.642 156.112 121.050 1.00 209.15 ? 687 TYR B CD2   1 
ATOM   6236  C CE1   . TYR B 2 687 ? 210.896 156.884 119.065 1.00 209.15 ? 687 TYR B CE1   1 
ATOM   6237  C CE2   . TYR B 2 687 ? 213.098 156.263 119.758 1.00 209.15 ? 687 TYR B CE2   1 
ATOM   6238  C CZ    . TYR B 2 687 ? 212.220 156.649 118.770 1.00 209.15 ? 687 TYR B CZ    1 
ATOM   6239  O OH    . TYR B 2 687 ? 212.665 156.799 117.479 1.00 209.15 ? 687 TYR B OH    1 
ATOM   6240  N N     . ARG B 2 688 ? 211.432 153.082 123.506 1.00 211.89 ? 688 ARG B N     1 
ATOM   6241  C CA    . ARG B 2 688 ? 212.126 151.838 123.185 1.00 211.89 ? 688 ARG B CA    1 
ATOM   6242  C C     . ARG B 2 688 ? 211.136 150.713 122.907 1.00 211.89 ? 688 ARG B C     1 
ATOM   6243  O O     . ARG B 2 688 ? 211.290 149.955 121.942 1.00 211.89 ? 688 ARG B O     1 
ATOM   6244  C CB    . ARG B 2 688 ? 213.068 151.459 124.326 1.00 211.89 ? 688 ARG B CB    1 
ATOM   6245  C CG    . ARG B 2 688 ? 214.222 152.420 124.513 1.00 211.89 ? 688 ARG B CG    1 
ATOM   6246  C CD    . ARG B 2 688 ? 215.061 152.027 125.710 1.00 211.89 ? 688 ARG B CD    1 
ATOM   6247  N NE    . ARG B 2 688 ? 215.672 150.718 125.518 1.00 211.89 ? 688 ARG B NE    1 
ATOM   6248  C CZ    . ARG B 2 688 ? 216.825 150.521 124.889 1.00 211.89 ? 688 ARG B CZ    1 
ATOM   6249  N NH1   . ARG B 2 688 ? 217.492 151.553 124.389 1.00 211.89 ? 688 ARG B NH1   1 
ATOM   6250  N NH2   . ARG B 2 688 ? 217.311 149.295 124.757 1.00 211.89 ? 688 ARG B NH2   1 
ATOM   6251  N N     . ARG B 2 689 ? 210.116 150.582 123.757 1.00 206.58 ? 689 ARG B N     1 
ATOM   6252  C CA    . ARG B 2 689 ? 209.074 149.588 123.527 1.00 206.58 ? 689 ARG B CA    1 
ATOM   6253  C C     . ARG B 2 689 ? 208.347 149.857 122.219 1.00 206.58 ? 689 ARG B C     1 
ATOM   6254  O O     . ARG B 2 689 ? 208.026 148.924 121.470 1.00 206.58 ? 689 ARG B O     1 
ATOM   6255  C CB    . ARG B 2 689 ? 208.083 149.584 124.690 1.00 206.58 ? 689 ARG B CB    1 
ATOM   6256  C CG    . ARG B 2 689 ? 208.661 149.107 126.009 1.00 206.58 ? 689 ARG B CG    1 
ATOM   6257  C CD    . ARG B 2 689 ? 207.615 149.147 127.110 1.00 206.58 ? 689 ARG B CD    1 
ATOM   6258  N NE    . ARG B 2 689 ? 208.159 148.720 128.396 1.00 206.58 ? 689 ARG B NE    1 
ATOM   6259  C CZ    . ARG B 2 689 ? 207.470 148.713 129.532 1.00 206.58 ? 689 ARG B CZ    1 
ATOM   6260  N NH1   . ARG B 2 689 ? 208.046 148.308 130.655 1.00 206.58 ? 689 ARG B NH1   1 
ATOM   6261  N NH2   . ARG B 2 689 ? 206.205 149.109 129.544 1.00 206.58 ? 689 ARG B NH2   1 
ATOM   6262  N N     . ILE B 2 690 ? 208.071 151.131 121.935 1.00 208.34 ? 690 ILE B N     1 
ATOM   6263  C CA    . ILE B 2 690 ? 207.403 151.489 120.688 1.00 208.34 ? 690 ILE B CA    1 
ATOM   6264  C C     . ILE B 2 690 ? 208.240 151.058 119.494 1.00 208.34 ? 690 ILE B C     1 
ATOM   6265  O O     . ILE B 2 690 ? 207.722 150.486 118.529 1.00 208.34 ? 690 ILE B O     1 
ATOM   6266  C CB    . ILE B 2 690 ? 207.102 152.998 120.654 1.00 208.34 ? 690 ILE B CB    1 
ATOM   6267  C CG1   . ILE B 2 690 ? 206.085 153.362 121.734 1.00 208.34 ? 690 ILE B CG1   1 
ATOM   6268  C CG2   . ILE B 2 690 ? 206.592 153.408 119.284 1.00 208.34 ? 690 ILE B CG2   1 
ATOM   6269  C CD1   . ILE B 2 690 ? 205.939 154.850 121.953 1.00 208.34 ? 690 ILE B CD1   1 
ATOM   6270  N N     . CYS B 2 691 ? 209.549 151.312 119.544 1.00 215.26 ? 691 CYS B N     1 
ATOM   6271  C CA    . CYS B 2 691 ? 210.421 150.941 118.433 1.00 215.26 ? 691 CYS B CA    1 
ATOM   6272  C C     . CYS B 2 691 ? 210.528 149.429 118.287 1.00 215.26 ? 691 CYS B C     1 
ATOM   6273  O O     . CYS B 2 691 ? 210.557 148.911 117.164 1.00 215.26 ? 691 CYS B O     1 
ATOM   6274  C CB    . CYS B 2 691 ? 211.803 151.561 118.620 1.00 215.26 ? 691 CYS B CB    1 
ATOM   6275  S SG    . CYS B 2 691 ? 211.816 153.356 118.497 1.00 215.26 ? 691 CYS B SG    1 
ATOM   6276  N N     . THR B 2 692 ? 210.596 148.703 119.405 1.00 211.57 ? 692 THR B N     1 
ATOM   6277  C CA    . THR B 2 692 ? 210.633 147.245 119.333 1.00 211.57 ? 692 THR B CA    1 
ATOM   6278  C C     . THR B 2 692 ? 209.370 146.701 118.677 1.00 211.57 ? 692 THR B C     1 
ATOM   6279  O O     . THR B 2 692 ? 209.435 145.843 117.786 1.00 211.57 ? 692 THR B O     1 
ATOM   6280  C CB    . THR B 2 692 ? 210.814 146.644 120.727 1.00 211.57 ? 692 THR B CB    1 
ATOM   6281  O OG1   . THR B 2 692 ? 209.757 147.091 121.585 1.00 211.57 ? 692 THR B OG1   1 
ATOM   6282  C CG2   . THR B 2 692 ? 212.161 147.036 121.316 1.00 211.57 ? 692 THR B CG2   1 
ATOM   6283  N N     . LEU B 2 693 ? 208.206 147.200 119.100 1.00 215.14 ? 693 LEU B N     1 
ATOM   6284  C CA    . LEU B 2 693 ? 206.958 146.751 118.496 1.00 215.14 ? 693 LEU B CA    1 
ATOM   6285  C C     . LEU B 2 693 ? 206.881 147.145 117.026 1.00 215.14 ? 693 LEU B C     1 
ATOM   6286  O O     . LEU B 2 693 ? 206.382 146.377 116.198 1.00 215.14 ? 693 LEU B O     1 
ATOM   6287  C CB    . LEU B 2 693 ? 205.760 147.312 119.258 1.00 215.14 ? 693 LEU B CB    1 
ATOM   6288  C CG    . LEU B 2 693 ? 204.423 146.858 118.667 1.00 215.14 ? 693 LEU B CG    1 
ATOM   6289  C CD1   . LEU B 2 693 ? 204.291 145.344 118.745 1.00 215.14 ? 693 LEU B CD1   1 
ATOM   6290  C CD2   . LEU B 2 693 ? 203.253 147.540 119.349 1.00 215.14 ? 693 LEU B CD2   1 
ATOM   6291  N N     . GLY B 2 694 ? 207.374 148.335 116.680 1.00 217.96 ? 694 GLY B N     1 
ATOM   6292  C CA    . GLY B 2 694 ? 207.347 148.755 115.291 1.00 217.96 ? 694 GLY B CA    1 
ATOM   6293  C C     . GLY B 2 694 ? 208.211 147.878 114.409 1.00 217.96 ? 694 GLY B C     1 
ATOM   6294  O O     . GLY B 2 694 ? 207.815 147.518 113.300 1.00 217.96 ? 694 GLY B O     1 
ATOM   6295  N N     . GLU B 2 695 ? 209.399 147.516 114.894 1.00 218.50 ? 695 GLU B N     1 
ATOM   6296  C CA    . GLU B 2 695 ? 210.245 146.587 114.153 1.00 218.50 ? 695 GLU B CA    1 
ATOM   6297  C C     . GLU B 2 695 ? 209.572 145.228 114.011 1.00 218.50 ? 695 GLU B C     1 
ATOM   6298  O O     . GLU B 2 695 ? 209.581 144.629 112.927 1.00 218.50 ? 695 GLU B O     1 
ATOM   6299  C CB    . GLU B 2 695 ? 211.602 146.444 114.843 1.00 218.50 ? 695 GLU B CB    1 
ATOM   6300  C CG    . GLU B 2 695 ? 212.467 147.692 114.795 1.00 218.50 ? 695 GLU B CG    1 
ATOM   6301  C CD    . GLU B 2 695 ? 213.793 147.505 115.505 1.00 218.50 ? 695 GLU B CD    1 
ATOM   6302  O OE1   . GLU B 2 695 ? 213.980 146.451 116.149 1.00 218.50 ? 695 GLU B OE1   1 
ATOM   6303  O OE2   . GLU B 2 695 ? 214.650 148.408 115.417 1.00 218.50 ? 695 GLU B OE2   1 
ATOM   6304  N N     . LYS B 2 696 ? 208.975 144.730 115.097 1.00 213.74 ? 696 LYS B N     1 
ATOM   6305  C CA    . LYS B 2 696 ? 208.299 143.438 115.040 1.00 213.74 ? 696 LYS B CA    1 
ATOM   6306  C C     . LYS B 2 696 ? 207.153 143.458 114.035 1.00 213.74 ? 696 LYS B C     1 
ATOM   6307  O O     . LYS B 2 696 ? 206.924 142.475 113.322 1.00 213.74 ? 696 LYS B O     1 
ATOM   6308  C CB    . LYS B 2 696 ? 207.790 143.058 116.429 1.00 213.74 ? 696 LYS B CB    1 
ATOM   6309  C CG    . LYS B 2 696 ? 207.168 141.679 116.510 1.00 213.74 ? 696 LYS B CG    1 
ATOM   6310  C CD    . LYS B 2 696 ? 206.770 141.350 117.937 1.00 213.74 ? 696 LYS B CD    1 
ATOM   6311  C CE    . LYS B 2 696 ? 206.151 139.968 118.032 1.00 213.74 ? 696 LYS B CE    1 
ATOM   6312  N NZ    . LYS B 2 696 ? 205.754 139.638 119.428 1.00 213.74 ? 696 LYS B NZ    1 
ATOM   6313  N N     . LEU B 2 697 ? 206.431 144.575 113.958 1.00 218.85 ? 697 LEU B N     1 
ATOM   6314  C CA    . LEU B 2 697 ? 205.297 144.670 113.047 1.00 218.85 ? 697 LEU B CA    1 
ATOM   6315  C C     . LEU B 2 697 ? 205.734 144.891 111.605 1.00 218.85 ? 697 LEU B C     1 
ATOM   6316  O O     . LEU B 2 697 ? 205.065 144.415 110.682 1.00 218.85 ? 697 LEU B O     1 
ATOM   6317  C CB    . LEU B 2 697 ? 204.362 145.795 113.492 1.00 218.85 ? 697 LEU B CB    1 
ATOM   6318  C CG    . LEU B 2 697 ? 203.650 145.573 114.829 1.00 218.85 ? 697 LEU B CG    1 
ATOM   6319  C CD1   . LEU B 2 697 ? 202.887 146.818 115.252 1.00 218.85 ? 697 LEU B CD1   1 
ATOM   6320  C CD2   . LEU B 2 697 ? 202.720 144.375 114.749 1.00 218.85 ? 697 LEU B CD2   1 
ATOM   6321  N N     . ARG B 2 698 ? 206.839 145.610 111.389 1.00 217.80 ? 698 ARG B N     1 
ATOM   6322  C CA    . ARG B 2 698 ? 207.343 145.795 110.034 1.00 217.80 ? 698 ARG B CA    1 
ATOM   6323  C C     . ARG B 2 698 ? 207.989 144.525 109.502 1.00 217.80 ? 698 ARG B C     1 
ATOM   6324  O O     . ARG B 2 698 ? 208.060 144.332 108.283 1.00 217.80 ? 698 ARG B O     1 
ATOM   6325  C CB    . ARG B 2 698 ? 208.338 146.956 109.991 1.00 217.80 ? 698 ARG B CB    1 
ATOM   6326  C CG    . ARG B 2 698 ? 207.713 148.326 110.208 1.00 217.80 ? 698 ARG B CG    1 
ATOM   6327  C CD    . ARG B 2 698 ? 208.714 149.439 109.940 1.00 217.80 ? 698 ARG B CD    1 
ATOM   6328  N NE    . ARG B 2 698 ? 209.842 149.407 110.867 1.00 217.80 ? 698 ARG B NE    1 
ATOM   6329  C CZ    . ARG B 2 698 ? 209.864 150.029 112.041 1.00 217.80 ? 698 ARG B CZ    1 
ATOM   6330  N NH1   . ARG B 2 698 ? 208.816 150.738 112.439 1.00 217.80 ? 698 ARG B NH1   1 
ATOM   6331  N NH2   . ARG B 2 698 ? 210.935 149.945 112.818 1.00 217.80 ? 698 ARG B NH2   1 
ATOM   6332  N N     . GLY B 2 699 ? 208.464 143.653 110.389 1.00 228.87 ? 699 GLY B N     1 
ATOM   6333  C CA    . GLY B 2 699 ? 209.015 142.384 109.954 1.00 228.87 ? 699 GLY B CA    1 
ATOM   6334  C C     . GLY B 2 699 ? 207.963 141.354 109.592 1.00 228.87 ? 699 GLY B C     1 
ATOM   6335  O O     . GLY B 2 699 ? 208.276 140.170 109.441 1.00 228.87 ? 699 GLY B O     1 
ATOM   6336  N N     . LEU B 2 700 ? 206.713 141.791 109.445 1.00 239.99 ? 700 LEU B N     1 
ATOM   6337  C CA    . LEU B 2 700 ? 205.591 140.900 109.174 1.00 239.99 ? 700 LEU B CA    1 
ATOM   6338  C C     . LEU B 2 700 ? 205.191 140.853 107.707 1.00 239.99 ? 700 LEU B C     1 
ATOM   6339  O O     . LEU B 2 700 ? 204.815 139.786 107.213 1.00 239.99 ? 700 LEU B O     1 
ATOM   6340  C CB    . LEU B 2 700 ? 204.372 141.316 110.003 1.00 239.99 ? 700 LEU B CB    1 
ATOM   6341  C CG    . LEU B 2 700 ? 204.476 141.160 111.518 1.00 239.99 ? 700 LEU B CG    1 
ATOM   6342  C CD1   . LEU B 2 700 ? 203.244 141.741 112.190 1.00 239.99 ? 700 LEU B CD1   1 
ATOM   6343  C CD2   . LEU B 2 700 ? 204.654 139.698 111.885 1.00 239.99 ? 700 LEU B CD2   1 
ATOM   6344  N N     . LEU B 2 701 ? 205.256 141.985 107.004 1.00 250.29 ? 701 LEU B N     1 
ATOM   6345  C CA    . LEU B 2 701 ? 204.754 142.098 105.633 1.00 250.29 ? 701 LEU B CA    1 
ATOM   6346  C C     . LEU B 2 701 ? 203.294 141.660 105.561 1.00 250.29 ? 701 LEU B C     1 
ATOM   6347  O O     . LEU B 2 701 ? 202.914 140.774 104.793 1.00 250.29 ? 701 LEU B O     1 
ATOM   6348  C CB    . LEU B 2 701 ? 205.623 141.304 104.657 1.00 250.29 ? 701 LEU B CB    1 
ATOM   6349  C CG    . LEU B 2 701 ? 207.054 141.810 104.471 1.00 250.29 ? 701 LEU B CG    1 
ATOM   6350  C CD1   . LEU B 2 701 ? 207.846 140.866 103.581 1.00 250.29 ? 701 LEU B CD1   1 
ATOM   6351  C CD2   . LEU B 2 701 ? 207.053 143.219 103.901 1.00 250.29 ? 701 LEU B CD2   1 
ATOM   6352  N N     . GLU B 2 702 ? 202.470 142.301 106.384 1.00 253.77 ? 702 GLU B N     1 
ATOM   6353  C CA    . GLU B 2 702 ? 201.064 141.968 106.555 1.00 253.77 ? 702 GLU B CA    1 
ATOM   6354  C C     . GLU B 2 702 ? 200.151 142.707 105.585 1.00 253.77 ? 702 GLU B C     1 
ATOM   6355  O O     . GLU B 2 702 ? 198.973 142.915 105.902 1.00 253.77 ? 702 GLU B O     1 
ATOM   6356  C CB    . GLU B 2 702 ? 200.647 142.259 107.998 1.00 253.77 ? 702 GLU B CB    1 
ATOM   6357  C CG    . GLU B 2 702 ? 200.816 143.719 108.392 1.00 253.77 ? 702 GLU B CG    1 
ATOM   6358  C CD    . GLU B 2 702 ? 200.536 143.971 109.860 1.00 253.77 ? 702 GLU B CD    1 
ATOM   6359  O OE1   . GLU B 2 702 ? 200.206 143.006 110.580 1.00 253.77 ? 702 GLU B OE1   1 
ATOM   6360  O OE2   . GLU B 2 702 ? 200.657 145.135 110.298 1.00 253.77 ? 702 GLU B OE2   1 
ATOM   6361  N N     . GLU B 2 703 ? 200.656 143.102 104.415 1.00 275.19 ? 703 GLU B N     1 
ATOM   6362  C CA    . GLU B 2 703 ? 199.862 143.911 103.495 1.00 275.19 ? 703 GLU B CA    1 
ATOM   6363  C C     . GLU B 2 703 ? 198.731 143.098 102.874 1.00 275.19 ? 703 GLU B C     1 
ATOM   6364  O O     . GLU B 2 703 ? 197.550 143.405 103.068 1.00 275.19 ? 703 GLU B O     1 
ATOM   6365  C CB    . GLU B 2 703 ? 200.763 144.505 102.413 1.00 275.19 ? 703 GLU B CB    1 
ATOM   6366  C CG    . GLU B 2 703 ? 201.774 145.502 102.945 1.00 275.19 ? 703 GLU B CG    1 
ATOM   6367  C CD    . GLU B 2 703 ? 201.117 146.734 103.537 1.00 275.19 ? 703 GLU B CD    1 
ATOM   6368  O OE1   . GLU B 2 703 ? 200.028 147.118 103.061 1.00 275.19 ? 703 GLU B OE1   1 
ATOM   6369  O OE2   . GLU B 2 703 ? 201.692 147.320 104.478 1.00 275.19 ? 703 GLU B OE2   1 
ATOM   6370  N N     . ASP B 2 704 ? 199.072 142.058 102.117 1.00 292.51 ? 704 ASP B N     1 
ATOM   6371  C CA    . ASP B 2 704 ? 198.071 141.184 101.506 1.00 292.51 ? 704 ASP B CA    1 
ATOM   6372  C C     . ASP B 2 704 ? 197.760 140.066 102.494 1.00 292.51 ? 704 ASP B C     1 
ATOM   6373  O O     . ASP B 2 704 ? 198.471 139.061 102.559 1.00 292.51 ? 704 ASP B O     1 
ATOM   6374  C CB    . ASP B 2 704 ? 198.569 140.643 100.171 1.00 292.51 ? 704 ASP B CB    1 
ATOM   6375  C CG    . ASP B 2 704 ? 197.523 139.815 99.448  1.00 292.51 ? 704 ASP B CG    1 
ATOM   6376  O OD1   . ASP B 2 704 ? 196.557 140.403 98.918  1.00 292.51 ? 704 ASP B OD1   1 
ATOM   6377  O OD2   . ASP B 2 704 ? 197.673 138.576 99.401  1.00 292.51 ? 704 ASP B OD2   1 
ATOM   6378  N N     . ALA B 2 705 ? 196.688 140.240 103.263 1.00 295.34 ? 705 ALA B N     1 
ATOM   6379  C CA    . ALA B 2 705 ? 196.344 139.349 104.359 1.00 295.34 ? 705 ALA B CA    1 
ATOM   6380  C C     . ALA B 2 705 ? 194.987 138.702 104.114 1.00 295.34 ? 705 ALA B C     1 
ATOM   6381  O O     . ALA B 2 705 ? 194.150 139.224 103.374 1.00 295.34 ? 705 ALA B O     1 
ATOM   6382  C CB    . ALA B 2 705 ? 196.330 140.105 105.693 1.00 295.34 ? 705 ALA B CB    1 
ATOM   6383  N N     . PHE B 2 706 ? 194.776 137.548 104.753 1.00 293.16 ? 706 PHE B N     1 
ATOM   6384  C CA    . PHE B 2 706 ? 193.524 136.803 104.613 1.00 293.16 ? 706 PHE B CA    1 
ATOM   6385  C C     . PHE B 2 706 ? 193.294 136.025 105.906 1.00 293.16 ? 706 PHE B C     1 
ATOM   6386  O O     . PHE B 2 706 ? 193.886 134.961 106.101 1.00 293.16 ? 706 PHE B O     1 
ATOM   6387  C CB    . PHE B 2 706 ? 193.569 135.871 103.409 1.00 293.16 ? 706 PHE B CB    1 
ATOM   6388  C CG    . PHE B 2 706 ? 193.624 136.584 102.090 1.00 293.16 ? 706 PHE B CG    1 
ATOM   6389  C CD1   . PHE B 2 706 ? 192.470 137.078 101.507 1.00 293.16 ? 706 PHE B CD1   1 
ATOM   6390  C CD2   . PHE B 2 706 ? 194.831 136.766 101.435 1.00 293.16 ? 706 PHE B CD2   1 
ATOM   6391  C CE1   . PHE B 2 706 ? 192.519 137.735 100.292 1.00 293.16 ? 706 PHE B CE1   1 
ATOM   6392  C CE2   . PHE B 2 706 ? 194.886 137.426 100.222 1.00 293.16 ? 706 PHE B CE2   1 
ATOM   6393  C CZ    . PHE B 2 706 ? 193.729 137.911 99.650  1.00 293.16 ? 706 PHE B CZ    1 
ATOM   6394  N N     . ILE B 2 707 ? 192.431 136.550 106.773 1.00 286.31 ? 707 ILE B N     1 
ATOM   6395  C CA    . ILE B 2 707 ? 192.068 135.888 108.020 1.00 286.31 ? 707 ILE B CA    1 
ATOM   6396  C C     . ILE B 2 707 ? 190.567 135.634 108.026 1.00 286.31 ? 707 ILE B C     1 
ATOM   6397  O O     . ILE B 2 707 ? 189.778 136.497 107.626 1.00 286.31 ? 707 ILE B O     1 
ATOM   6398  C CB    . ILE B 2 707 ? 192.499 136.704 109.257 1.00 286.31 ? 707 ILE B CB    1 
ATOM   6399  C CG1   . ILE B 2 707 ? 192.276 135.896 110.537 1.00 286.31 ? 707 ILE B CG1   1 
ATOM   6400  C CG2   . ILE B 2 707 ? 191.793 138.052 109.312 1.00 286.31 ? 707 ILE B CG2   1 
ATOM   6401  C CD1   . ILE B 2 707 ? 192.966 136.477 111.746 1.00 286.31 ? 707 ILE B CD1   1 
ATOM   6402  N N     . GLU B 2 708 ? 190.177 134.443 108.471 1.00 284.88 ? 708 GLU B N     1 
ATOM   6403  C CA    . GLU B 2 708 ? 188.781 134.037 108.500 1.00 284.88 ? 708 GLU B CA    1 
ATOM   6404  C C     . GLU B 2 708 ? 188.380 133.632 109.912 1.00 284.88 ? 708 GLU B C     1 
ATOM   6405  O O     . GLU B 2 708 ? 189.131 132.946 110.612 1.00 284.88 ? 708 GLU B O     1 
ATOM   6406  C CB    . GLU B 2 708 ? 188.520 132.879 107.525 1.00 284.88 ? 708 GLU B CB    1 
ATOM   6407  C CG    . GLU B 2 708 ? 189.256 131.588 107.857 1.00 284.88 ? 708 GLU B CG    1 
ATOM   6408  C CD    . GLU B 2 708 ? 188.990 130.483 106.853 1.00 284.88 ? 708 GLU B CD    1 
ATOM   6409  O OE1   . GLU B 2 708 ? 188.243 130.725 105.881 1.00 284.88 ? 708 GLU B OE1   1 
ATOM   6410  O OE2   . GLU B 2 708 ? 189.527 129.371 107.037 1.00 284.88 ? 708 GLU B OE2   1 
ATOM   6411  N N     . ARG B 2 709 ? 187.200 134.088 110.334 1.00 275.36 ? 709 ARG B N     1 
ATOM   6412  C CA    . ARG B 2 709 ? 186.612 133.648 111.598 1.00 275.36 ? 709 ARG B CA    1 
ATOM   6413  C C     . ARG B 2 709 ? 185.100 133.813 111.473 1.00 275.36 ? 709 ARG B C     1 
ATOM   6414  O O     . ARG B 2 709 ? 184.576 134.913 111.675 1.00 275.36 ? 709 ARG B O     1 
ATOM   6415  C CB    . ARG B 2 709 ? 187.176 134.439 112.772 1.00 275.36 ? 709 ARG B CB    1 
ATOM   6416  C CG    . ARG B 2 709 ? 186.748 133.943 114.152 1.00 275.36 ? 709 ARG B CG    1 
ATOM   6417  C CD    . ARG B 2 709 ? 185.536 134.702 114.676 1.00 275.36 ? 709 ARG B CD    1 
ATOM   6418  N NE    . ARG B 2 709 ? 185.212 134.352 116.056 1.00 275.36 ? 709 ARG B NE    1 
ATOM   6419  C CZ    . ARG B 2 709 ? 184.106 134.743 116.680 1.00 275.36 ? 709 ARG B CZ    1 
ATOM   6420  N NH1   . ARG B 2 709 ? 183.219 135.498 116.047 1.00 275.36 ? 709 ARG B NH1   1 
ATOM   6421  N NH2   . ARG B 2 709 ? 183.887 134.382 117.937 1.00 275.36 ? 709 ARG B NH2   1 
ATOM   6422  N N     . GLY B 2 710 ? 184.412 132.731 111.127 1.00 274.94 ? 710 GLY B N     1 
ATOM   6423  C CA    . GLY B 2 710 ? 185.058 131.497 110.723 1.00 274.94 ? 710 GLY B CA    1 
ATOM   6424  C C     . GLY B 2 710 ? 184.586 131.081 109.344 1.00 274.94 ? 710 GLY B C     1 
ATOM   6425  O O     . GLY B 2 710 ? 185.155 130.187 108.719 1.00 274.94 ? 710 GLY B O     1 
ATOM   6426  N N     . GLU B 2 711 ? 183.531 131.747 108.873 1.00 280.21 ? 711 GLU B N     1 
ATOM   6427  C CA    . GLU B 2 711 ? 182.922 131.463 107.580 1.00 280.21 ? 711 GLU B CA    1 
ATOM   6428  C C     . GLU B 2 711 ? 183.122 132.591 106.578 1.00 280.21 ? 711 GLU B C     1 
ATOM   6429  O O     . GLU B 2 711 ? 182.511 132.569 105.505 1.00 280.21 ? 711 GLU B O     1 
ATOM   6430  C CB    . GLU B 2 711 ? 181.428 131.184 107.751 1.00 280.21 ? 711 GLU B CB    1 
ATOM   6431  C CG    . GLU B 2 711 ? 181.114 129.919 108.527 1.00 280.21 ? 711 GLU B CG    1 
ATOM   6432  C CD    . GLU B 2 711 ? 179.625 129.701 108.702 1.00 280.21 ? 711 GLU B CD    1 
ATOM   6433  O OE1   . GLU B 2 711 ? 178.844 130.601 108.327 1.00 280.21 ? 711 GLU B OE1   1 
ATOM   6434  O OE2   . GLU B 2 711 ? 179.235 128.632 109.214 1.00 280.21 ? 711 GLU B OE2   1 
ATOM   6435  N N     . ARG B 2 712 ? 183.955 133.576 106.902 1.00 289.14 ? 712 ARG B N     1 
ATOM   6436  C CA    . ARG B 2 712 ? 184.170 134.715 106.023 1.00 289.14 ? 712 ARG B CA    1 
ATOM   6437  C C     . ARG B 2 712 ? 185.560 135.281 106.272 1.00 289.14 ? 712 ARG B C     1 
ATOM   6438  O O     . ARG B 2 712 ? 186.042 135.289 107.408 1.00 289.14 ? 712 ARG B O     1 
ATOM   6439  C CB    . ARG B 2 712 ? 183.105 135.796 106.242 1.00 289.14 ? 712 ARG B CB    1 
ATOM   6440  C CG    . ARG B 2 712 ? 183.184 136.475 107.601 1.00 289.14 ? 712 ARG B CG    1 
ATOM   6441  C CD    . ARG B 2 712 ? 182.041 137.450 107.812 1.00 289.14 ? 712 ARG B CD    1 
ATOM   6442  N NE    . ARG B 2 712 ? 180.761 136.765 107.957 1.00 289.14 ? 712 ARG B NE    1 
ATOM   6443  C CZ    . ARG B 2 712 ? 179.589 137.386 108.033 1.00 289.14 ? 712 ARG B CZ    1 
ATOM   6444  N NH1   . ARG B 2 712 ? 179.534 138.710 107.981 1.00 289.14 ? 712 ARG B NH1   1 
ATOM   6445  N NH2   . ARG B 2 712 ? 178.473 136.684 108.165 1.00 289.14 ? 712 ARG B NH2   1 
ATOM   6446  N N     . ARG B 2 713 ? 186.202 135.741 105.201 1.00 285.13 ? 713 ARG B N     1 
ATOM   6447  C CA    . ARG B 2 713 ? 187.504 136.381 105.298 1.00 285.13 ? 713 ARG B CA    1 
ATOM   6448  C C     . ARG B 2 713 ? 187.520 137.604 104.395 1.00 285.13 ? 713 ARG B C     1 
ATOM   6449  O O     . ARG B 2 713 ? 186.787 137.675 103.406 1.00 285.13 ? 713 ARG B O     1 
ATOM   6450  C CB    . ARG B 2 713 ? 188.644 135.425 104.921 1.00 285.13 ? 713 ARG B CB    1 
ATOM   6451  C CG    . ARG B 2 713 ? 188.664 134.991 103.469 1.00 285.13 ? 713 ARG B CG    1 
ATOM   6452  C CD    . ARG B 2 713 ? 189.801 134.015 103.234 1.00 285.13 ? 713 ARG B CD    1 
ATOM   6453  N NE    . ARG B 2 713 ? 189.881 133.577 101.846 1.00 285.13 ? 713 ARG B NE    1 
ATOM   6454  C CZ    . ARG B 2 713 ? 190.800 132.735 101.386 1.00 285.13 ? 713 ARG B CZ    1 
ATOM   6455  N NH1   . ARG B 2 713 ? 191.717 132.242 102.208 1.00 285.13 ? 713 ARG B NH1   1 
ATOM   6456  N NH2   . ARG B 2 713 ? 190.804 132.387 100.107 1.00 285.13 ? 713 ARG B NH2   1 
ATOM   6457  N N     . GLN B 2 714 ? 188.366 138.573 104.748 1.00 280.48 ? 714 GLN B N     1 
ATOM   6458  C CA    . GLN B 2 714 ? 188.403 139.817 104.015 1.00 280.48 ? 714 GLN B CA    1 
ATOM   6459  C C     . GLN B 2 714 ? 189.804 140.408 104.062 1.00 280.48 ? 714 GLN B C     1 
ATOM   6460  O O     . GLN B 2 714 ? 190.343 140.607 105.162 1.00 280.48 ? 714 GLN B O     1 
ATOM   6461  C CB    . GLN B 2 714 ? 187.396 140.818 104.581 1.00 280.48 ? 714 GLN B CB    1 
ATOM   6462  C CG    . GLN B 2 714 ? 187.308 142.113 103.802 1.00 280.48 ? 714 GLN B CG    1 
ATOM   6463  C CD    . GLN B 2 714 ? 186.243 143.037 104.348 1.00 280.48 ? 714 GLN B CD    1 
ATOM   6464  O OE1   . GLN B 2 714 ? 185.584 142.725 105.340 1.00 280.48 ? 714 GLN B OE1   1 
ATOM   6465  N NE2   . GLN B 2 714 ? 186.066 144.183 103.703 1.00 280.48 ? 714 GLN B NE2   1 
ATOM   6466  N N     . PRO B 2 715 ? 190.414 140.686 102.909 1.00 282.41 ? 715 PRO B N     1 
ATOM   6467  C CA    . PRO B 2 715 ? 191.742 141.313 102.902 1.00 282.41 ? 715 PRO B CA    1 
ATOM   6468  C C     . PRO B 2 715 ? 191.637 142.815 103.128 1.00 282.41 ? 715 PRO B C     1 
ATOM   6469  O O     . PRO B 2 715 ? 190.806 143.494 102.520 1.00 282.41 ? 715 PRO B O     1 
ATOM   6470  C CB    . PRO B 2 715 ? 192.274 140.999 101.500 1.00 282.41 ? 715 PRO B CB    1 
ATOM   6471  C CG    . PRO B 2 715 ? 191.039 140.878 100.665 1.00 282.41 ? 715 PRO B CG    1 
ATOM   6472  C CD    . PRO B 2 715 ? 189.985 140.278 101.560 1.00 282.41 ? 715 PRO B CD    1 
ATOM   6473  N N     . VAL B 2 716 ? 192.484 143.330 104.015 1.00 276.64 ? 716 VAL B N     1 
ATOM   6474  C CA    . VAL B 2 716 ? 192.603 144.755 104.267 1.00 276.64 ? 716 VAL B CA    1 
ATOM   6475  C C     . VAL B 2 716 ? 194.078 145.133 104.190 1.00 276.64 ? 716 VAL B C     1 
ATOM   6476  O O     . VAL B 2 716 ? 194.936 144.303 103.897 1.00 276.64 ? 716 VAL B O     1 
ATOM   6477  C CB    . VAL B 2 716 ? 191.998 145.167 105.625 1.00 276.64 ? 716 VAL B CB    1 
ATOM   6478  C CG1   . VAL B 2 716 ? 190.511 144.858 105.660 1.00 276.64 ? 716 VAL B CG1   1 
ATOM   6479  C CG2   . VAL B 2 716 ? 192.723 144.468 106.760 1.00 276.64 ? 716 VAL B CG2   1 
ATOM   6480  N N     . ALA B 2 717 ? 194.363 146.406 104.454 1.00 272.13 ? 717 ALA B N     1 
ATOM   6481  C CA    . ALA B 2 717 ? 195.726 146.913 104.447 1.00 272.13 ? 717 ALA B CA    1 
ATOM   6482  C C     . ALA B 2 717 ? 196.204 147.353 105.822 1.00 272.13 ? 717 ALA B C     1 
ATOM   6483  O O     . ALA B 2 717 ? 197.319 147.873 105.937 1.00 272.13 ? 717 ALA B O     1 
ATOM   6484  C CB    . ALA B 2 717 ? 195.852 148.079 103.460 1.00 272.13 ? 717 ALA B CB    1 
ATOM   6485  N N     . SER B 2 718 ? 195.400 147.159 106.865 1.00 269.88 ? 718 SER B N     1 
ATOM   6486  C CA    . SER B 2 718 ? 195.737 147.612 108.207 1.00 269.88 ? 718 SER B CA    1 
ATOM   6487  C C     . SER B 2 718 ? 195.480 146.497 109.208 1.00 269.88 ? 718 SER B C     1 
ATOM   6488  O O     . SER B 2 718 ? 194.379 145.936 109.254 1.00 269.88 ? 718 SER B O     1 
ATOM   6489  C CB    . SER B 2 718 ? 194.931 148.856 108.589 1.00 269.88 ? 718 SER B CB    1 
ATOM   6490  O OG    . SER B 2 718 ? 195.222 149.258 109.915 1.00 269.88 ? 718 SER B OG    1 
ATOM   6491  N N     . PHE B 2 719 ? 196.499 146.185 110.012 1.00 258.29 ? 719 PHE B N     1 
ATOM   6492  C CA    . PHE B 2 719 ? 196.340 145.160 111.036 1.00 258.29 ? 719 PHE B CA    1 
ATOM   6493  C C     . PHE B 2 719 ? 195.298 145.572 112.067 1.00 258.29 ? 719 PHE B C     1 
ATOM   6494  O O     . PHE B 2 719 ? 194.476 144.752 112.492 1.00 258.29 ? 719 PHE B O     1 
ATOM   6495  C CB    . PHE B 2 719 ? 197.682 144.882 111.710 1.00 258.29 ? 719 PHE B CB    1 
ATOM   6496  C CG    . PHE B 2 719 ? 197.626 143.797 112.743 1.00 258.29 ? 719 PHE B CG    1 
ATOM   6497  C CD1   . PHE B 2 719 ? 197.556 142.468 112.366 1.00 258.29 ? 719 PHE B CD1   1 
ATOM   6498  C CD2   . PHE B 2 719 ? 197.646 144.106 114.092 1.00 258.29 ? 719 PHE B CD2   1 
ATOM   6499  C CE1   . PHE B 2 719 ? 197.507 141.468 113.313 1.00 258.29 ? 719 PHE B CE1   1 
ATOM   6500  C CE2   . PHE B 2 719 ? 197.596 143.108 115.045 1.00 258.29 ? 719 PHE B CE2   1 
ATOM   6501  C CZ    . PHE B 2 719 ? 197.527 141.788 114.655 1.00 258.29 ? 719 PHE B CZ    1 
ATOM   6502  N N     . GLU B 2 720 ? 195.306 146.844 112.473 1.00 268.21 ? 720 GLU B N     1 
ATOM   6503  C CA    . GLU B 2 720 ? 194.314 147.292 113.443 1.00 268.21 ? 720 GLU B CA    1 
ATOM   6504  C C     . GLU B 2 720 ? 192.915 147.308 112.842 1.00 268.21 ? 720 GLU B C     1 
ATOM   6505  O O     . GLU B 2 720 ? 191.941 147.025 113.546 1.00 268.21 ? 720 GLU B O     1 
ATOM   6506  C CB    . GLU B 2 720 ? 194.682 148.671 113.993 1.00 268.21 ? 720 GLU B CB    1 
ATOM   6507  C CG    . GLU B 2 720 ? 194.594 149.808 112.993 1.00 268.21 ? 720 GLU B CG    1 
ATOM   6508  C CD    . GLU B 2 720 ? 194.993 151.139 113.597 1.00 268.21 ? 720 GLU B CD    1 
ATOM   6509  O OE1   . GLU B 2 720 ? 195.369 151.163 114.788 1.00 268.21 ? 720 GLU B OE1   1 
ATOM   6510  O OE2   . GLU B 2 720 ? 194.927 152.162 112.884 1.00 268.21 ? 720 GLU B OE2   1 
ATOM   6511  N N     . GLN B 2 721 ? 192.792 147.600 111.546 1.00 270.72 ? 721 GLN B N     1 
ATOM   6512  C CA    . GLN B 2 721 ? 191.477 147.549 110.915 1.00 270.72 ? 721 GLN B CA    1 
ATOM   6513  C C     . GLN B 2 721 ? 190.965 146.117 110.833 1.00 270.72 ? 721 GLN B C     1 
ATOM   6514  O O     . GLN B 2 721 ? 189.773 145.862 111.052 1.00 270.72 ? 721 GLN B O     1 
ATOM   6515  C CB    . GLN B 2 721 ? 191.534 148.182 109.527 1.00 270.72 ? 721 GLN B CB    1 
ATOM   6516  C CG    . GLN B 2 721 ? 190.187 148.282 108.844 1.00 270.72 ? 721 GLN B CG    1 
ATOM   6517  C CD    . GLN B 2 721 ? 190.271 148.986 107.509 1.00 270.72 ? 721 GLN B CD    1 
ATOM   6518  O OE1   . GLN B 2 721 ? 191.354 149.366 107.064 1.00 270.72 ? 721 GLN B OE1   1 
ATOM   6519  N NE2   . GLN B 2 721 ? 189.127 149.171 106.864 1.00 270.72 ? 721 GLN B NE2   1 
ATOM   6520  N N     . ALA B 2 722 ? 191.852 145.168 110.530 1.00 281.70 ? 722 ALA B N     1 
ATOM   6521  C CA    . ALA B 2 722 ? 191.463 143.761 110.560 1.00 281.70 ? 722 ALA B CA    1 
ATOM   6522  C C     . ALA B 2 722 ? 191.037 143.341 111.961 1.00 281.70 ? 722 ALA B C     1 
ATOM   6523  O O     . ALA B 2 722 ? 190.052 142.610 112.130 1.00 281.70 ? 722 ALA B O     1 
ATOM   6524  C CB    . ALA B 2 722 ? 192.613 142.886 110.065 1.00 281.70 ? 722 ALA B CB    1 
ATOM   6525  N N     . LEU B 2 723 ? 191.767 143.799 112.980 1.00 284.27 ? 723 LEU B N     1 
ATOM   6526  C CA    . LEU B 2 723 ? 191.406 143.475 114.357 1.00 284.27 ? 723 LEU B CA    1 
ATOM   6527  C C     . LEU B 2 723 ? 190.047 144.060 114.720 1.00 284.27 ? 723 LEU B C     1 
ATOM   6528  O O     . LEU B 2 723 ? 189.239 143.406 115.388 1.00 284.27 ? 723 LEU B O     1 
ATOM   6529  C CB    . LEU B 2 723 ? 192.490 143.980 115.309 1.00 284.27 ? 723 LEU B CB    1 
ATOM   6530  C CG    . LEU B 2 723 ? 192.422 143.586 116.786 1.00 284.27 ? 723 LEU B CG    1 
ATOM   6531  C CD1   . LEU B 2 723 ? 193.825 143.485 117.355 1.00 284.27 ? 723 LEU B CD1   1 
ATOM   6532  C CD2   . LEU B 2 723 ? 191.608 144.589 117.592 1.00 284.27 ? 723 LEU B CD2   1 
ATOM   6533  N N     . ASP B 2 724 ? 189.779 145.294 114.291 1.00 287.58 ? 724 ASP B N     1 
ATOM   6534  C CA    . ASP B 2 724 ? 188.486 145.910 114.566 1.00 287.58 ? 724 ASP B CA    1 
ATOM   6535  C C     . ASP B 2 724 ? 187.361 145.167 113.859 1.00 287.58 ? 724 ASP B C     1 
ATOM   6536  O O     . ASP B 2 724 ? 186.282 144.977 114.431 1.00 287.58 ? 724 ASP B O     1 
ATOM   6537  C CB    . ASP B 2 724 ? 188.504 147.381 114.153 1.00 287.58 ? 724 ASP B CB    1 
ATOM   6538  C CG    . ASP B 2 724 ? 189.376 148.227 115.057 1.00 287.58 ? 724 ASP B CG    1 
ATOM   6539  O OD1   . ASP B 2 724 ? 189.526 147.870 116.244 1.00 287.58 ? 724 ASP B OD1   1 
ATOM   6540  O OD2   . ASP B 2 724 ? 189.909 149.252 114.582 1.00 287.58 ? 724 ASP B OD2   1 
ATOM   6541  N N     . TRP B 2 725 ? 187.593 144.733 112.618 1.00 289.71 ? 725 TRP B N     1 
ATOM   6542  C CA    . TRP B 2 725 ? 186.578 143.953 111.919 1.00 289.71 ? 725 TRP B CA    1 
ATOM   6543  C C     . TRP B 2 725 ? 186.315 142.630 112.629 1.00 289.71 ? 725 TRP B C     1 
ATOM   6544  O O     . TRP B 2 725 ? 185.164 142.195 112.740 1.00 289.71 ? 725 TRP B O     1 
ATOM   6545  C CB    . TRP B 2 725 ? 186.996 143.702 110.472 1.00 289.71 ? 725 TRP B CB    1 
ATOM   6546  C CG    . TRP B 2 725 ? 185.968 142.932 109.699 1.00 289.71 ? 725 TRP B CG    1 
ATOM   6547  C CD1   . TRP B 2 725 ? 184.721 143.359 109.344 1.00 289.71 ? 725 TRP B CD1   1 
ATOM   6548  C CD2   . TRP B 2 725 ? 186.087 141.591 109.209 1.00 289.71 ? 725 TRP B CD2   1 
ATOM   6549  N NE1   . TRP B 2 725 ? 184.062 142.372 108.651 1.00 289.71 ? 725 TRP B NE1   1 
ATOM   6550  C CE2   . TRP B 2 725 ? 184.879 141.276 108.556 1.00 289.71 ? 725 TRP B CE2   1 
ATOM   6551  C CE3   . TRP B 2 725 ? 187.100 140.628 109.253 1.00 289.71 ? 725 TRP B CE3   1 
ATOM   6552  C CZ2   . TRP B 2 725 ? 184.657 140.040 107.953 1.00 289.71 ? 725 TRP B CZ2   1 
ATOM   6553  C CZ3   . TRP B 2 725 ? 186.878 139.401 108.654 1.00 289.71 ? 725 TRP B CZ3   1 
ATOM   6554  C CH2   . TRP B 2 725 ? 185.666 139.118 108.013 1.00 289.71 ? 725 TRP B CH2   1 
ATOM   6555  N N     . LEU B 2 726 ? 187.373 141.975 113.114 1.00 287.46 ? 726 LEU B N     1 
ATOM   6556  C CA    . LEU B 2 726 ? 187.189 140.725 113.847 1.00 287.46 ? 726 LEU B CA    1 
ATOM   6557  C C     . LEU B 2 726 ? 186.415 140.953 115.139 1.00 287.46 ? 726 LEU B C     1 
ATOM   6558  O O     . LEU B 2 726 ? 185.531 140.163 115.492 1.00 287.46 ? 726 LEU B O     1 
ATOM   6559  C CB    . LEU B 2 726 ? 188.542 140.080 114.140 1.00 287.46 ? 726 LEU B CB    1 
ATOM   6560  C CG    . LEU B 2 726 ? 189.316 139.556 112.931 1.00 287.46 ? 726 LEU B CG    1 
ATOM   6561  C CD1   . LEU B 2 726 ? 190.699 139.083 113.343 1.00 287.46 ? 726 LEU B CD1   1 
ATOM   6562  C CD2   . LEU B 2 726 ? 188.546 138.438 112.252 1.00 287.46 ? 726 LEU B CD2   1 
ATOM   6563  N N     . VAL B 2 727 ? 186.732 142.034 115.856 1.00 291.24 ? 727 VAL B N     1 
ATOM   6564  C CA    . VAL B 2 727 ? 186.008 142.356 117.083 1.00 291.24 ? 727 VAL B CA    1 
ATOM   6565  C C     . VAL B 2 727 ? 184.540 142.625 116.780 1.00 291.24 ? 727 VAL B C     1 
ATOM   6566  O O     . VAL B 2 727 ? 183.648 142.205 117.526 1.00 291.24 ? 727 VAL B O     1 
ATOM   6567  C CB    . VAL B 2 727 ? 186.667 143.551 117.797 1.00 291.24 ? 727 VAL B CB    1 
ATOM   6568  C CG1   . VAL B 2 727 ? 185.807 144.016 118.960 1.00 291.24 ? 727 VAL B CG1   1 
ATOM   6569  C CG2   . VAL B 2 727 ? 188.051 143.172 118.293 1.00 291.24 ? 727 VAL B CG2   1 
ATOM   6570  N N     . LYS B 2 728 ? 184.268 143.330 115.682 1.00 286.83 ? 728 LYS B N     1 
ATOM   6571  C CA    . LYS B 2 728 ? 182.889 143.599 115.293 1.00 286.83 ? 728 LYS B CA    1 
ATOM   6572  C C     . LYS B 2 728 ? 182.151 142.306 114.975 1.00 286.83 ? 728 LYS B C     1 
ATOM   6573  O O     . LYS B 2 728 ? 181.010 142.103 115.407 1.00 286.83 ? 728 LYS B O     1 
ATOM   6574  C CB    . LYS B 2 728 ? 182.866 144.547 114.094 1.00 286.83 ? 728 LYS B CB    1 
ATOM   6575  C CG    . LYS B 2 728 ? 181.477 144.955 113.650 1.00 286.83 ? 728 LYS B CG    1 
ATOM   6576  C CD    . LYS B 2 728 ? 180.806 145.826 114.695 1.00 286.83 ? 728 LYS B CD    1 
ATOM   6577  C CE    . LYS B 2 728 ? 179.417 146.244 114.249 1.00 286.83 ? 728 LYS B CE    1 
ATOM   6578  N NZ    . LYS B 2 728 ? 179.471 147.139 113.062 1.00 286.83 ? 728 LYS B NZ    1 
ATOM   6579  N N     . GLU B 2 729 ? 182.792 141.417 114.211 1.00 293.89 ? 729 GLU B N     1 
ATOM   6580  C CA    . GLU B 2 729 ? 182.175 140.136 113.883 1.00 293.89 ? 729 GLU B CA    1 
ATOM   6581  C C     . GLU B 2 729 ? 181.901 139.320 115.139 1.00 293.89 ? 729 GLU B C     1 
ATOM   6582  O O     . GLU B 2 729 ? 180.894 138.608 115.219 1.00 293.89 ? 729 GLU B O     1 
ATOM   6583  C CB    . GLU B 2 729 ? 183.069 139.351 112.924 1.00 293.89 ? 729 GLU B CB    1 
ATOM   6584  C CG    . GLU B 2 729 ? 183.212 139.967 111.541 1.00 293.89 ? 729 GLU B CG    1 
ATOM   6585  C CD    . GLU B 2 729 ? 181.918 139.945 110.753 1.00 293.89 ? 729 GLU B CD    1 
ATOM   6586  O OE1   . GLU B 2 729 ? 181.109 139.015 110.958 1.00 293.89 ? 729 GLU B OE1   1 
ATOM   6587  O OE2   . GLU B 2 729 ? 181.711 140.855 109.922 1.00 293.89 ? 729 GLU B OE2   1 
ATOM   6588  N N     . SER B 2 730 ? 182.787 139.414 116.132 1.00 284.78 ? 730 SER B N     1 
ATOM   6589  C CA    . SER B 2 730 ? 182.585 138.665 117.367 1.00 284.78 ? 730 SER B CA    1 
ATOM   6590  C C     . SER B 2 730 ? 181.458 139.261 118.202 1.00 284.78 ? 730 SER B C     1 
ATOM   6591  O O     . SER B 2 730 ? 180.667 138.524 118.802 1.00 284.78 ? 730 SER B O     1 
ATOM   6592  C CB    . SER B 2 730 ? 183.882 138.624 118.174 1.00 284.78 ? 730 SER B CB    1 
ATOM   6593  O OG    . SER B 2 730 ? 184.236 139.917 118.631 1.00 284.78 ? 730 SER B OG    1 
ATOM   6594  N N     . ARG B 2 731 ? 181.366 140.588 118.250 1.00 282.32 ? 731 ARG B N     1 
ATOM   6595  C CA    . ARG B 2 731 ? 180.396 141.270 119.096 1.00 282.32 ? 731 ARG B CA    1 
ATOM   6596  C C     . ARG B 2 731 ? 179.072 141.547 118.399 1.00 282.32 ? 731 ARG B C     1 
ATOM   6597  O O     . ARG B 2 731 ? 178.215 142.216 118.986 1.00 282.32 ? 731 ARG B O     1 
ATOM   6598  C CB    . ARG B 2 731 ? 180.981 142.589 119.610 1.00 282.32 ? 731 ARG B CB    1 
ATOM   6599  C CG    . ARG B 2 731 ? 182.126 142.426 120.593 1.00 282.32 ? 731 ARG B CG    1 
ATOM   6600  C CD    . ARG B 2 731 ? 182.644 143.779 121.050 1.00 282.32 ? 731 ARG B CD    1 
ATOM   6601  N NE    . ARG B 2 731 ? 183.758 143.657 121.986 1.00 282.32 ? 731 ARG B NE    1 
ATOM   6602  C CZ    . ARG B 2 731 ? 184.430 144.691 122.480 1.00 282.32 ? 731 ARG B CZ    1 
ATOM   6603  N NH1   . ARG B 2 731 ? 184.103 145.926 122.126 1.00 282.32 ? 731 ARG B NH1   1 
ATOM   6604  N NH2   . ARG B 2 731 ? 185.431 144.491 123.326 1.00 282.32 ? 731 ARG B NH2   1 
ATOM   6605  N N     . ARG B 2 732 ? 178.899 141.083 117.159 1.00 290.10 ? 732 ARG B N     1 
ATOM   6606  C CA    . ARG B 2 732 ? 177.618 141.233 116.472 1.00 290.10 ? 732 ARG B CA    1 
ATOM   6607  C C     . ARG B 2 732 ? 176.443 140.802 117.347 1.00 290.10 ? 732 ARG B C     1 
ATOM   6608  O O     . ARG B 2 732 ? 175.548 141.600 117.645 1.00 290.10 ? 732 ARG B O     1 
ATOM   6609  C CB    . ARG B 2 732 ? 177.628 140.434 115.165 1.00 290.10 ? 732 ARG B CB    1 
ATOM   6610  C CG    . ARG B 2 732 ? 178.496 141.023 114.071 1.00 290.10 ? 732 ARG B CG    1 
ATOM   6611  C CD    . ARG B 2 732 ? 178.386 140.231 112.778 1.00 290.10 ? 732 ARG B CD    1 
ATOM   6612  N NE    . ARG B 2 732 ? 179.001 138.911 112.877 1.00 290.10 ? 732 ARG B NE    1 
ATOM   6613  C CZ    . ARG B 2 732 ? 178.326 137.768 112.824 1.00 290.10 ? 732 ARG B CZ    1 
ATOM   6614  N NH1   . ARG B 2 732 ? 177.008 137.782 112.674 1.00 290.10 ? 732 ARG B NH1   1 
ATOM   6615  N NH2   . ARG B 2 732 ? 178.966 136.610 112.919 1.00 290.10 ? 732 ARG B NH2   1 
ATOM   6616  N N     . GLY B 2 733 ? 176.432 139.541 117.774 1.00 275.74 ? 733 GLY B N     1 
ATOM   6617  C CA    . GLY B 2 733 ? 175.239 138.980 118.380 1.00 275.74 ? 733 GLY B CA    1 
ATOM   6618  C C     . GLY B 2 733 ? 175.369 138.401 119.775 1.00 275.74 ? 733 GLY B C     1 
ATOM   6619  O O     . GLY B 2 733 ? 174.814 137.334 120.054 1.00 275.74 ? 733 GLY B O     1 
ATOM   6620  N N     . LEU B 2 734 ? 176.092 139.077 120.661 1.00 254.14 ? 734 LEU B N     1 
ATOM   6621  C CA    . LEU B 2 734 ? 176.205 138.648 122.047 1.00 254.14 ? 734 LEU B CA    1 
ATOM   6622  C C     . LEU B 2 734 ? 175.301 139.483 122.950 1.00 254.14 ? 734 LEU B C     1 
ATOM   6623  O O     . LEU B 2 734 ? 174.862 140.578 122.591 1.00 254.14 ? 734 LEU B O     1 
ATOM   6624  C CB    . LEU B 2 734 ? 177.659 138.726 122.524 1.00 254.14 ? 734 LEU B CB    1 
ATOM   6625  C CG    . LEU B 2 734 ? 178.428 140.046 122.420 1.00 254.14 ? 734 LEU B CG    1 
ATOM   6626  C CD1   . LEU B 2 734 ? 178.153 140.978 123.591 1.00 254.14 ? 734 LEU B CD1   1 
ATOM   6627  C CD2   . LEU B 2 734 ? 179.914 139.749 122.321 1.00 254.14 ? 734 LEU B CD2   1 
ATOM   6628  N N     . SER B 2 735 ? 175.032 138.947 124.139 1.00 222.96 ? 735 SER B N     1 
ATOM   6629  C CA    . SER B 2 735 ? 174.177 139.598 125.124 1.00 222.96 ? 735 SER B CA    1 
ATOM   6630  C C     . SER B 2 735 ? 174.908 139.675 126.454 1.00 222.96 ? 735 SER B C     1 
ATOM   6631  O O     . SER B 2 735 ? 175.516 138.692 126.890 1.00 222.96 ? 735 SER B O     1 
ATOM   6632  C CB    . SER B 2 735 ? 172.854 138.847 125.296 1.00 222.96 ? 735 SER B CB    1 
ATOM   6633  O OG    . SER B 2 735 ? 173.067 137.576 125.885 1.00 222.96 ? 735 SER B OG    1 
ATOM   6634  N N     . ILE B 2 736 ? 174.841 140.837 127.100 1.00 194.95 ? 736 ILE B N     1 
ATOM   6635  C CA    . ILE B 2 736 ? 175.518 141.074 128.369 1.00 194.95 ? 736 ILE B CA    1 
ATOM   6636  C C     . ILE B 2 736 ? 174.548 141.754 129.322 1.00 194.95 ? 736 ILE B C     1 
ATOM   6637  O O     . ILE B 2 736 ? 173.950 142.779 128.981 1.00 194.95 ? 736 ILE B O     1 
ATOM   6638  C CB    . ILE B 2 736 ? 176.780 141.942 128.199 1.00 194.95 ? 736 ILE B CB    1 
ATOM   6639  C CG1   . ILE B 2 736 ? 177.824 141.223 127.346 1.00 194.95 ? 736 ILE B CG1   1 
ATOM   6640  C CG2   . ILE B 2 736 ? 177.359 142.313 129.556 1.00 194.95 ? 736 ILE B CG2   1 
ATOM   6641  C CD1   . ILE B 2 736 ? 178.974 142.112 126.934 1.00 194.95 ? 736 ILE B CD1   1 
ATOM   6642  N N     . GLN B 2 737 ? 174.395 141.187 130.514 1.00 173.35 ? 737 GLN B N     1 
ATOM   6643  C CA    . GLN B 2 737 ? 173.650 141.813 131.595 1.00 173.35 ? 737 GLN B CA    1 
ATOM   6644  C C     . GLN B 2 737 ? 174.616 142.158 132.718 1.00 173.35 ? 737 GLN B C     1 
ATOM   6645  O O     . GLN B 2 737 ? 175.439 141.324 133.112 1.00 173.35 ? 737 GLN B O     1 
ATOM   6646  C CB    . GLN B 2 737 ? 172.540 140.897 132.113 1.00 173.35 ? 737 GLN B CB    1 
ATOM   6647  C CG    . GLN B 2 737 ? 171.666 141.539 133.181 1.00 173.35 ? 737 GLN B CG    1 
ATOM   6648  C CD    . GLN B 2 737 ? 170.553 140.626 133.654 1.00 173.35 ? 737 GLN B CD    1 
ATOM   6649  O OE1   . GLN B 2 737 ? 170.448 139.479 133.221 1.00 173.35 ? 737 GLN B OE1   1 
ATOM   6650  N NE2   . GLN B 2 737 ? 169.712 141.133 134.548 1.00 173.35 ? 737 GLN B NE2   1 
ATOM   6651  N N     . ARG B 2 738 ? 174.519 143.383 133.226 1.00 164.54 ? 738 ARG B N     1 
ATOM   6652  C CA    . ARG B 2 738 ? 175.382 143.862 134.297 1.00 164.54 ? 738 ARG B CA    1 
ATOM   6653  C C     . ARG B 2 738 ? 174.527 144.172 135.515 1.00 164.54 ? 738 ARG B C     1 
ATOM   6654  O O     . ARG B 2 738 ? 173.632 145.022 135.450 1.00 164.54 ? 738 ARG B O     1 
ATOM   6655  C CB    . ARG B 2 738 ? 176.167 145.098 133.858 1.00 164.54 ? 738 ARG B CB    1 
ATOM   6656  C CG    . ARG B 2 738 ? 177.158 145.593 134.890 1.00 164.54 ? 738 ARG B CG    1 
ATOM   6657  C CD    . ARG B 2 738 ? 177.971 146.750 134.350 1.00 164.54 ? 738 ARG B CD    1 
ATOM   6658  N NE    . ARG B 2 738 ? 178.894 147.277 135.348 1.00 164.54 ? 738 ARG B NE    1 
ATOM   6659  C CZ    . ARG B 2 738 ? 179.735 148.281 135.127 1.00 164.54 ? 738 ARG B CZ    1 
ATOM   6660  N NH1   . ARG B 2 738 ? 179.770 148.868 133.938 1.00 164.54 ? 738 ARG B NH1   1 
ATOM   6661  N NH2   . ARG B 2 738 ? 180.540 148.699 136.093 1.00 164.54 ? 738 ARG B NH2   1 
ATOM   6662  N N     . TYR B 2 739 ? 174.803 143.486 136.620 1.00 158.37 ? 739 TYR B N     1 
ATOM   6663  C CA    . TYR B 2 739 ? 174.043 143.650 137.853 1.00 158.37 ? 739 TYR B CA    1 
ATOM   6664  C C     . TYR B 2 739 ? 174.650 144.794 138.655 1.00 158.37 ? 739 TYR B C     1 
ATOM   6665  O O     . TYR B 2 739 ? 175.773 144.682 139.157 1.00 158.37 ? 739 TYR B O     1 
ATOM   6666  C CB    . TYR B 2 739 ? 174.040 142.354 138.656 1.00 158.37 ? 739 TYR B CB    1 
ATOM   6667  C CG    . TYR B 2 739 ? 173.317 141.228 137.963 1.00 158.37 ? 739 TYR B CG    1 
ATOM   6668  C CD1   . TYR B 2 739 ? 171.934 141.147 137.992 1.00 158.37 ? 739 TYR B CD1   1 
ATOM   6669  C CD2   . TYR B 2 739 ? 174.018 140.250 137.273 1.00 158.37 ? 739 TYR B CD2   1 
ATOM   6670  C CE1   . TYR B 2 739 ? 171.267 140.121 137.357 1.00 158.37 ? 739 TYR B CE1   1 
ATOM   6671  C CE2   . TYR B 2 739 ? 173.360 139.219 136.635 1.00 158.37 ? 739 TYR B CE2   1 
ATOM   6672  C CZ    . TYR B 2 739 ? 171.984 139.160 136.679 1.00 158.37 ? 739 TYR B CZ    1 
ATOM   6673  O OH    . TYR B 2 739 ? 171.322 138.135 136.045 1.00 158.37 ? 739 TYR B OH    1 
ATOM   6674  N N     . LYS B 2 740 ? 173.909 145.892 138.775 1.00 155.92 ? 740 LYS B N     1 
ATOM   6675  C CA    . LYS B 2 740 ? 174.355 147.072 139.512 1.00 155.92 ? 740 LYS B CA    1 
ATOM   6676  C C     . LYS B 2 740 ? 173.668 147.184 140.865 1.00 155.92 ? 740 LYS B C     1 
ATOM   6677  O O     . LYS B 2 740 ? 173.320 148.280 141.313 1.00 155.92 ? 740 LYS B O     1 
ATOM   6678  C CB    . LYS B 2 740 ? 174.128 148.330 138.682 1.00 155.92 ? 740 LYS B CB    1 
ATOM   6679  C CG    . LYS B 2 740 ? 174.979 148.387 137.425 1.00 155.92 ? 740 LYS B CG    1 
ATOM   6680  C CD    . LYS B 2 740 ? 174.750 149.672 136.652 1.00 155.92 ? 740 LYS B CD    1 
ATOM   6681  C CE    . LYS B 2 740 ? 175.671 149.754 135.447 1.00 155.92 ? 740 LYS B CE    1 
ATOM   6682  N NZ    . LYS B 2 740 ? 175.337 148.723 134.427 1.00 155.92 ? 740 LYS B NZ    1 
ATOM   6683  N N     . GLY B 2 741 ? 173.455 146.052 141.530 1.00 148.70 ? 741 GLY B N     1 
ATOM   6684  C CA    . GLY B 2 741 ? 172.823 146.031 142.833 1.00 148.70 ? 741 GLY B CA    1 
ATOM   6685  C C     . GLY B 2 741 ? 172.378 144.637 143.219 1.00 148.70 ? 741 GLY B C     1 
ATOM   6686  O O     . GLY B 2 741 ? 171.883 143.885 142.375 1.00 148.70 ? 741 GLY B O     1 
ATOM   6687  N N     . LEU B 2 742 ? 172.553 144.273 144.490 1.00 139.82 ? 742 LEU B N     1 
ATOM   6688  C CA    . LEU B 2 742 ? 172.174 142.933 144.922 1.00 139.82 ? 742 LEU B CA    1 
ATOM   6689  C C     . LEU B 2 742 ? 170.670 142.717 144.836 1.00 139.82 ? 742 LEU B C     1 
ATOM   6690  O O     . LEU B 2 742 ? 170.221 141.596 144.570 1.00 139.82 ? 742 LEU B O     1 
ATOM   6691  C CB    . LEU B 2 742 ? 172.669 142.680 146.344 1.00 139.82 ? 742 LEU B CB    1 
ATOM   6692  C CG    . LEU B 2 742 ? 174.189 142.616 146.493 1.00 139.82 ? 742 LEU B CG    1 
ATOM   6693  C CD1   . LEU B 2 742 ? 174.583 142.490 147.955 1.00 139.82 ? 742 LEU B CD1   1 
ATOM   6694  C CD2   . LEU B 2 742 ? 174.751 141.463 145.678 1.00 139.82 ? 742 LEU B CD2   1 
ATOM   6695  N N     . GLY B 2 743 ? 169.880 143.766 145.044 1.00 139.56 ? 743 GLY B N     1 
ATOM   6696  C CA    . GLY B 2 743 ? 168.439 143.650 144.939 1.00 139.56 ? 743 GLY B CA    1 
ATOM   6697  C C     . GLY B 2 743 ? 167.951 143.713 143.508 1.00 139.56 ? 743 GLY B C     1 
ATOM   6698  O O     . GLY B 2 743 ? 166.984 144.416 143.203 1.00 139.56 ? 743 GLY B O     1 
ATOM   6699  N N     . GLU B 2 744 ? 168.621 142.984 142.616 1.00 149.40 ? 744 GLU B N     1 
ATOM   6700  C CA    . GLU B 2 744 ? 168.274 142.983 141.205 1.00 149.40 ? 744 GLU B CA    1 
ATOM   6701  C C     . GLU B 2 744 ? 168.203 141.592 140.593 1.00 149.40 ? 744 GLU B C     1 
ATOM   6702  O O     . GLU B 2 744 ? 167.490 141.413 139.600 1.00 149.40 ? 744 GLU B O     1 
ATOM   6703  C CB    . GLU B 2 744 ? 169.284 143.829 140.413 1.00 149.40 ? 744 GLU B CB    1 
ATOM   6704  C CG    . GLU B 2 744 ? 168.947 144.035 138.948 1.00 149.40 ? 744 GLU B CG    1 
ATOM   6705  C CD    . GLU B 2 744 ? 169.962 144.909 138.240 1.00 149.40 ? 744 GLU B CD    1 
ATOM   6706  O OE1   . GLU B 2 744 ? 170.942 145.330 138.891 1.00 149.40 ? 744 GLU B OE1   1 
ATOM   6707  O OE2   . GLU B 2 744 ? 169.780 145.175 137.034 1.00 149.40 ? 744 GLU B OE2   1 
ATOM   6708  N N     . MET B 2 745 ? 168.886 140.605 141.158 1.00 147.48 ? 745 MET B N     1 
ATOM   6709  C CA    . MET B 2 745 ? 168.931 139.262 140.603 1.00 147.48 ? 745 MET B CA    1 
ATOM   6710  C C     . MET B 2 745 ? 167.939 138.357 141.320 1.00 147.48 ? 745 MET B C     1 
ATOM   6711  O O     . MET B 2 745 ? 167.394 138.693 142.373 1.00 147.48 ? 745 MET B O     1 
ATOM   6712  C CB    . MET B 2 745 ? 170.346 138.684 140.699 1.00 147.48 ? 745 MET B CB    1 
ATOM   6713  C CG    . MET B 2 745 ? 170.835 138.484 142.120 1.00 147.48 ? 745 MET B CG    1 
ATOM   6714  S SD    . MET B 2 745 ? 172.537 137.895 142.182 1.00 147.48 ? 745 MET B SD    1 
ATOM   6715  C CE    . MET B 2 745 ? 173.420 139.378 141.705 1.00 147.48 ? 745 MET B CE    1 
ATOM   6716  N N     . ASN B 2 746 ? 167.714 137.189 140.727 1.00 144.78 ? 746 ASN B N     1 
ATOM   6717  C CA    . ASN B 2 746 ? 166.790 136.228 141.299 1.00 144.78 ? 746 ASN B CA    1 
ATOM   6718  C C     . ASN B 2 746 ? 167.394 135.586 142.548 1.00 144.78 ? 746 ASN B C     1 
ATOM   6719  O O     . ASN B 2 746 ? 168.617 135.507 142.685 1.00 144.78 ? 746 ASN B O     1 
ATOM   6720  C CB    . ASN B 2 746 ? 166.442 135.152 140.276 1.00 144.78 ? 746 ASN B CB    1 
ATOM   6721  C CG    . ASN B 2 746 ? 165.577 135.680 139.152 1.00 144.78 ? 746 ASN B CG    1 
ATOM   6722  O OD1   . ASN B 2 746 ? 164.641 136.444 139.382 1.00 144.78 ? 746 ASN B OD1   1 
ATOM   6723  N ND2   . ASN B 2 746 ? 165.887 135.278 137.925 1.00 144.78 ? 746 ASN B ND2   1 
ATOM   6724  N N     . PRO B 2 747 ? 166.552 135.132 143.480 1.00 142.42 ? 747 PRO B N     1 
ATOM   6725  C CA    . PRO B 2 747 ? 167.090 134.519 144.707 1.00 142.42 ? 747 PRO B CA    1 
ATOM   6726  C C     . PRO B 2 747 ? 167.923 133.275 144.453 1.00 142.42 ? 747 PRO B C     1 
ATOM   6727  O O     . PRO B 2 747 ? 168.949 133.080 145.116 1.00 142.42 ? 747 PRO B O     1 
ATOM   6728  C CB    . PRO B 2 747 ? 165.825 134.204 145.517 1.00 142.42 ? 747 PRO B CB    1 
ATOM   6729  C CG    . PRO B 2 747 ? 164.802 135.160 145.004 1.00 142.42 ? 747 PRO B CG    1 
ATOM   6730  C CD    . PRO B 2 747 ? 165.092 135.305 143.543 1.00 142.42 ? 747 PRO B CD    1 
ATOM   6731  N N     . GLU B 2 748 ? 167.514 132.420 143.514 1.00 147.36 ? 748 GLU B N     1 
ATOM   6732  C CA    . GLU B 2 748 ? 168.292 131.216 143.240 1.00 147.36 ? 748 GLU B CA    1 
ATOM   6733  C C     . GLU B 2 748 ? 169.643 131.559 142.624 1.00 147.36 ? 748 GLU B C     1 
ATOM   6734  O O     . GLU B 2 748 ? 170.662 130.935 142.954 1.00 147.36 ? 748 GLU B O     1 
ATOM   6735  C CB    . GLU B 2 748 ? 167.496 130.274 142.338 1.00 147.36 ? 748 GLU B CB    1 
ATOM   6736  C CG    . GLU B 2 748 ? 167.163 130.841 140.971 1.00 147.36 ? 748 GLU B CG    1 
ATOM   6737  C CD    . GLU B 2 748 ? 166.319 129.897 140.144 1.00 147.36 ? 748 GLU B CD    1 
ATOM   6738  O OE1   . GLU B 2 748 ? 165.969 128.811 140.652 1.00 147.36 ? 748 GLU B OE1   1 
ATOM   6739  O OE2   . GLU B 2 748 ? 166.008 130.238 138.983 1.00 147.36 ? 748 GLU B OE2   1 
ATOM   6740  N N     . GLN B 2 749 ? 169.675 132.556 141.737 1.00 147.60 ? 749 GLN B N     1 
ATOM   6741  C CA    . GLN B 2 749 ? 170.946 133.017 141.192 1.00 147.60 ? 749 GLN B CA    1 
ATOM   6742  C C     . GLN B 2 749 ? 171.833 133.581 142.291 1.00 147.60 ? 749 GLN B C     1 
ATOM   6743  O O     . GLN B 2 749 ? 173.040 133.310 142.328 1.00 147.60 ? 749 GLN B O     1 
ATOM   6744  C CB    . GLN B 2 749 ? 170.705 134.072 140.116 1.00 147.60 ? 749 GLN B CB    1 
ATOM   6745  C CG    . GLN B 2 749 ? 170.018 133.552 138.874 1.00 147.60 ? 749 GLN B CG    1 
ATOM   6746  C CD    . GLN B 2 749 ? 169.769 134.647 137.861 1.00 147.60 ? 749 GLN B CD    1 
ATOM   6747  O OE1   . GLN B 2 749 ? 170.044 135.818 138.119 1.00 147.60 ? 749 GLN B OE1   1 
ATOM   6748  N NE2   . GLN B 2 749 ? 169.247 134.274 136.699 1.00 147.60 ? 749 GLN B NE2   1 
ATOM   6749  N N     . LEU B 2 750 ? 171.250 134.382 143.185 1.00 145.92 ? 750 LEU B N     1 
ATOM   6750  C CA    . LEU B 2 750 ? 172.012 134.935 144.298 1.00 145.92 ? 750 LEU B CA    1 
ATOM   6751  C C     . LEU B 2 750 ? 172.618 133.824 145.141 1.00 145.92 ? 750 LEU B C     1 
ATOM   6752  O O     . LEU B 2 750 ? 173.804 133.867 145.486 1.00 145.92 ? 750 LEU B O     1 
ATOM   6753  C CB    . LEU B 2 750 ? 171.117 135.830 145.151 1.00 145.92 ? 750 LEU B CB    1 
ATOM   6754  C CG    . LEU B 2 750 ? 171.814 136.505 146.331 1.00 145.92 ? 750 LEU B CG    1 
ATOM   6755  C CD1   . LEU B 2 750 ? 172.896 137.451 145.836 1.00 145.92 ? 750 LEU B CD1   1 
ATOM   6756  C CD2   . LEU B 2 750 ? 170.810 137.234 147.211 1.00 145.92 ? 750 LEU B CD2   1 
ATOM   6757  N N     . TRP B 2 751 ? 171.808 132.822 145.488 1.00 142.10 ? 751 TRP B N     1 
ATOM   6758  C CA    . TRP B 2 751 ? 172.318 131.649 146.186 1.00 142.10 ? 751 TRP B CA    1 
ATOM   6759  C C     . TRP B 2 751 ? 173.522 131.071 145.460 1.00 142.10 ? 751 TRP B C     1 
ATOM   6760  O O     . TRP B 2 751 ? 174.650 131.113 145.966 1.00 142.10 ? 751 TRP B O     1 
ATOM   6761  C CB    . TRP B 2 751 ? 171.222 130.589 146.311 1.00 142.10 ? 751 TRP B CB    1 
ATOM   6762  C CG    . TRP B 2 751 ? 171.703 129.304 146.926 1.00 142.10 ? 751 TRP B CG    1 
ATOM   6763  C CD1   . TRP B 2 751 ? 172.066 128.167 146.263 1.00 142.10 ? 751 TRP B CD1   1 
ATOM   6764  C CD2   . TRP B 2 751 ? 171.862 129.019 148.322 1.00 142.10 ? 751 TRP B CD2   1 
ATOM   6765  N NE1   . TRP B 2 751 ? 172.448 127.198 147.156 1.00 142.10 ? 751 TRP B NE1   1 
ATOM   6766  C CE2   . TRP B 2 751 ? 172.330 127.695 148.427 1.00 142.10 ? 751 TRP B CE2   1 
ATOM   6767  C CE3   . TRP B 2 751 ? 171.653 129.755 149.492 1.00 142.10 ? 751 TRP B CE3   1 
ATOM   6768  C CZ2   . TRP B 2 751 ? 172.596 127.093 149.654 1.00 142.10 ? 751 TRP B CZ2   1 
ATOM   6769  C CZ3   . TRP B 2 751 ? 171.919 129.155 150.709 1.00 142.10 ? 751 TRP B CZ3   1 
ATOM   6770  C CH2   . TRP B 2 751 ? 172.384 127.838 150.781 1.00 142.10 ? 751 TRP B CH2   1 
ATOM   6771  N N     . GLU B 2 752 ? 173.295 130.604 144.228 1.00 142.93 ? 752 GLU B N     1 
ATOM   6772  C CA    . GLU B 2 752 ? 174.309 129.849 143.501 1.00 142.93 ? 752 GLU B CA    1 
ATOM   6773  C C     . GLU B 2 752 ? 175.586 130.649 143.292 1.00 142.93 ? 752 GLU B C     1 
ATOM   6774  O O     . GLU B 2 752 ? 176.672 130.065 143.214 1.00 142.93 ? 752 GLU B O     1 
ATOM   6775  C CB    . GLU B 2 752 ? 173.753 129.399 142.154 1.00 142.93 ? 752 GLU B CB    1 
ATOM   6776  C CG    . GLU B 2 752 ? 172.634 128.384 142.256 1.00 142.93 ? 752 GLU B CG    1 
ATOM   6777  C CD    . GLU B 2 752 ? 172.094 127.988 140.899 1.00 142.93 ? 752 GLU B CD    1 
ATOM   6778  O OE1   . GLU B 2 752 ? 172.504 128.604 139.893 1.00 142.93 ? 752 GLU B OE1   1 
ATOM   6779  O OE2   . GLU B 2 752 ? 171.259 127.061 140.836 1.00 142.93 ? 752 GLU B OE2   1 
ATOM   6780  N N     . THR B 2 753 ? 175.489 131.972 143.201 1.00 140.41 ? 753 THR B N     1 
ATOM   6781  C CA    . THR B 2 753 ? 176.665 132.769 142.893 1.00 140.41 ? 753 THR B CA    1 
ATOM   6782  C C     . THR B 2 753 ? 177.326 133.392 144.113 1.00 140.41 ? 753 THR B C     1 
ATOM   6783  O O     . THR B 2 753 ? 178.460 133.866 143.997 1.00 140.41 ? 753 THR B O     1 
ATOM   6784  C CB    . THR B 2 753 ? 176.305 133.876 141.898 1.00 140.41 ? 753 THR B CB    1 
ATOM   6785  O OG1   . THR B 2 753 ? 175.295 134.718 142.465 1.00 140.41 ? 753 THR B OG1   1 
ATOM   6786  C CG2   . THR B 2 753 ? 175.794 133.274 140.599 1.00 140.41 ? 753 THR B CG2   1 
ATOM   6787  N N     . THR B 2 754 ? 176.672 133.407 145.266 1.00 138.52 ? 754 THR B N     1 
ATOM   6788  C CA    . THR B 2 754 ? 177.351 134.064 146.375 1.00 138.52 ? 754 THR B CA    1 
ATOM   6789  C C     . THR B 2 754 ? 177.435 133.210 147.630 1.00 138.52 ? 754 THR B C     1 
ATOM   6790  O O     . THR B 2 754 ? 178.450 133.257 148.327 1.00 138.52 ? 754 THR B O     1 
ATOM   6791  C CB    . THR B 2 754 ? 176.645 135.389 146.695 1.00 138.52 ? 754 THR B CB    1 
ATOM   6792  O OG1   . THR B 2 754 ? 176.648 136.223 145.531 1.00 138.52 ? 754 THR B OG1   1 
ATOM   6793  C CG2   . THR B 2 754 ? 177.352 136.115 147.821 1.00 138.52 ? 754 THR B CG2   1 
ATOM   6794  N N     . MET B 2 755 ? 176.406 132.427 147.937 1.00 137.93 ? 755 MET B N     1 
ATOM   6795  C CA    . MET B 2 755 ? 176.307 131.768 149.231 1.00 137.93 ? 755 MET B CA    1 
ATOM   6796  C C     . MET B 2 755 ? 176.118 130.265 149.078 1.00 137.93 ? 755 MET B C     1 
ATOM   6797  O O     . MET B 2 755 ? 175.260 129.651 149.716 1.00 137.93 ? 755 MET B O     1 
ATOM   6798  C CB    . MET B 2 755 ? 175.192 132.397 150.059 1.00 137.93 ? 755 MET B CB    1 
ATOM   6799  C CG    . MET B 2 755 ? 173.850 132.443 149.368 1.00 137.93 ? 755 MET B CG    1 
ATOM   6800  S SD    . MET B 2 755 ? 172.655 133.348 150.364 1.00 137.93 ? 755 MET B SD    1 
ATOM   6801  C CE    . MET B 2 755 ? 173.303 135.013 150.232 1.00 137.93 ? 755 MET B CE    1 
ATOM   6802  N N     . ASP B 2 756 ? 176.935 129.657 148.221 1.00 143.53 ? 756 ASP B N     1 
ATOM   6803  C CA    . ASP B 2 756 ? 176.992 128.212 148.095 1.00 143.53 ? 756 ASP B CA    1 
ATOM   6804  C C     . ASP B 2 756 ? 178.304 127.727 148.682 1.00 143.53 ? 756 ASP B C     1 
ATOM   6805  O O     . ASP B 2 756 ? 179.370 128.086 148.158 1.00 143.53 ? 756 ASP B O     1 
ATOM   6806  C CB    . ASP B 2 756 ? 176.880 127.796 146.633 1.00 143.53 ? 756 ASP B CB    1 
ATOM   6807  C CG    . ASP B 2 756 ? 176.699 126.301 146.457 1.00 143.53 ? 756 ASP B CG    1 
ATOM   6808  O OD1   . ASP B 2 756 ? 176.673 125.572 147.472 1.00 143.53 ? 756 ASP B OD1   1 
ATOM   6809  O OD2   . ASP B 2 756 ? 176.582 125.851 145.299 1.00 143.53 ? 756 ASP B OD2   1 
ATOM   6810  N N     . PRO B 2 757 ? 178.289 126.918 149.744 1.00 137.70 ? 757 PRO B N     1 
ATOM   6811  C CA    . PRO B 2 757 ? 179.547 126.509 150.388 1.00 137.70 ? 757 PRO B CA    1 
ATOM   6812  C C     . PRO B 2 757 ? 180.482 125.719 149.485 1.00 137.70 ? 757 PRO B C     1 
ATOM   6813  O O     . PRO B 2 757 ? 181.579 125.343 149.908 1.00 137.70 ? 757 PRO B O     1 
ATOM   6814  C CB    . PRO B 2 757 ? 179.068 125.655 151.569 1.00 137.70 ? 757 PRO B CB    1 
ATOM   6815  C CG    . PRO B 2 757 ? 177.689 126.138 151.844 1.00 137.70 ? 757 PRO B CG    1 
ATOM   6816  C CD    . PRO B 2 757 ? 177.111 126.474 150.504 1.00 137.70 ? 757 PRO B CD    1 
ATOM   6817  N N     . GLU B 2 758 ? 180.067 125.456 148.246 1.00 144.61 ? 758 GLU B N     1 
ATOM   6818  C CA    . GLU B 2 758 ? 180.922 124.800 147.270 1.00 144.61 ? 758 GLU B CA    1 
ATOM   6819  C C     . GLU B 2 758 ? 181.328 125.688 146.107 1.00 144.61 ? 758 GLU B C     1 
ATOM   6820  O O     . GLU B 2 758 ? 182.358 125.417 145.482 1.00 144.61 ? 758 GLU B O     1 
ATOM   6821  C CB    . GLU B 2 758 ? 180.233 123.548 146.704 1.00 144.61 ? 758 GLU B CB    1 
ATOM   6822  C CG    . GLU B 2 758 ? 180.065 122.423 147.704 1.00 144.61 ? 758 GLU B CG    1 
ATOM   6823  C CD    . GLU B 2 758 ? 179.377 121.214 147.103 1.00 144.61 ? 758 GLU B CD    1 
ATOM   6824  O OE1   . GLU B 2 758 ? 178.907 121.310 145.950 1.00 144.61 ? 758 GLU B OE1   1 
ATOM   6825  O OE2   . GLU B 2 758 ? 179.312 120.167 147.779 1.00 144.61 ? 758 GLU B OE2   1 
ATOM   6826  N N     . SER B 2 759 ? 180.561 126.735 145.798 1.00 144.32 ? 759 SER B N     1 
ATOM   6827  C CA    . SER B 2 759 ? 180.834 127.573 144.641 1.00 144.32 ? 759 SER B CA    1 
ATOM   6828  C C     . SER B 2 759 ? 181.271 128.986 144.987 1.00 144.32 ? 759 SER B C     1 
ATOM   6829  O O     . SER B 2 759 ? 181.819 129.671 144.118 1.00 144.32 ? 759 SER B O     1 
ATOM   6830  C CB    . SER B 2 759 ? 179.594 127.653 143.739 1.00 144.32 ? 759 SER B CB    1 
ATOM   6831  O OG    . SER B 2 759 ? 179.262 126.379 143.217 1.00 144.32 ? 759 SER B OG    1 
ATOM   6832  N N     . ARG B 2 760 ? 181.045 129.440 146.215 1.00 137.54 ? 760 ARG B N     1 
ATOM   6833  C CA    . ARG B 2 760 ? 181.400 130.802 146.571 1.00 137.54 ? 760 ARG B CA    1 
ATOM   6834  C C     . ARG B 2 760 ? 182.915 130.962 146.642 1.00 137.54 ? 760 ARG B C     1 
ATOM   6835  O O     . ARG B 2 760 ? 183.671 129.989 146.715 1.00 137.54 ? 760 ARG B O     1 
ATOM   6836  C CB    . ARG B 2 760 ? 180.765 131.193 147.903 1.00 137.54 ? 760 ARG B CB    1 
ATOM   6837  C CG    . ARG B 2 760 ? 181.280 130.420 149.101 1.00 137.54 ? 760 ARG B CG    1 
ATOM   6838  C CD    . ARG B 2 760 ? 180.522 130.815 150.354 1.00 137.54 ? 760 ARG B CD    1 
ATOM   6839  N NE    . ARG B 2 760 ? 180.984 130.092 151.533 1.00 137.54 ? 760 ARG B NE    1 
ATOM   6840  C CZ    . ARG B 2 760 ? 180.486 130.263 152.753 1.00 137.54 ? 760 ARG B CZ    1 
ATOM   6841  N NH1   . ARG B 2 760 ? 179.508 131.133 152.954 1.00 137.54 ? 760 ARG B NH1   1 
ATOM   6842  N NH2   . ARG B 2 760 ? 180.965 129.564 153.772 1.00 137.54 ? 760 ARG B NH2   1 
ATOM   6843  N N     . ARG B 2 761 ? 183.356 132.218 146.615 1.00 141.04 ? 761 ARG B N     1 
ATOM   6844  C CA    . ARG B 2 761 ? 184.780 132.554 146.666 1.00 141.04 ? 761 ARG B CA    1 
ATOM   6845  C C     . ARG B 2 761 ? 184.937 133.718 147.641 1.00 141.04 ? 761 ARG B C     1 
ATOM   6846  O O     . ARG B 2 761 ? 184.859 134.886 147.253 1.00 141.04 ? 761 ARG B O     1 
ATOM   6847  C CB    . ARG B 2 761 ? 185.313 132.891 145.282 1.00 141.04 ? 761 ARG B CB    1 
ATOM   6848  C CG    . ARG B 2 761 ? 186.806 133.125 145.236 1.00 141.04 ? 761 ARG B CG    1 
ATOM   6849  C CD    . ARG B 2 761 ? 187.271 133.372 143.814 1.00 141.04 ? 761 ARG B CD    1 
ATOM   6850  N NE    . ARG B 2 761 ? 187.080 132.197 142.968 1.00 141.04 ? 761 ARG B NE    1 
ATOM   6851  C CZ    . ARG B 2 761 ? 186.217 132.133 141.959 1.00 141.04 ? 761 ARG B CZ    1 
ATOM   6852  N NH1   . ARG B 2 761 ? 185.457 133.179 141.664 1.00 141.04 ? 761 ARG B NH1   1 
ATOM   6853  N NH2   . ARG B 2 761 ? 186.112 131.021 141.246 1.00 141.04 ? 761 ARG B NH2   1 
ATOM   6854  N N     . MET B 2 762 ? 185.165 133.388 148.908 1.00 128.98 ? 762 MET B N     1 
ATOM   6855  C CA    . MET B 2 762 ? 185.248 134.387 149.964 1.00 128.98 ? 762 MET B CA    1 
ATOM   6856  C C     . MET B 2 762 ? 186.634 135.027 149.967 1.00 128.98 ? 762 MET B C     1 
ATOM   6857  O O     . MET B 2 762 ? 187.425 134.873 149.033 1.00 128.98 ? 762 MET B O     1 
ATOM   6858  C CB    . MET B 2 762 ? 184.907 133.761 151.312 1.00 128.98 ? 762 MET B CB    1 
ATOM   6859  C CG    . MET B 2 762 ? 183.461 133.318 151.443 1.00 128.98 ? 762 MET B CG    1 
ATOM   6860  S SD    . MET B 2 762 ? 183.079 132.670 153.081 1.00 128.98 ? 762 MET B SD    1 
ATOM   6861  C CE    . MET B 2 762 ? 183.892 131.076 153.015 1.00 128.98 ? 762 MET B CE    1 
ATOM   6862  N N     . LEU B 2 763 ? 186.938 135.764 151.032 1.00 119.07 ? 763 LEU B N     1 
ATOM   6863  C CA    . LEU B 2 763 ? 188.197 136.487 151.140 1.00 119.07 ? 763 LEU B CA    1 
ATOM   6864  C C     . LEU B 2 763 ? 188.445 136.809 152.606 1.00 119.07 ? 763 LEU B C     1 
ATOM   6865  O O     . LEU B 2 763 ? 187.532 137.261 153.301 1.00 119.07 ? 763 LEU B O     1 
ATOM   6866  C CB    . LEU B 2 763 ? 188.156 137.758 150.288 1.00 119.07 ? 763 LEU B CB    1 
ATOM   6867  C CG    . LEU B 2 763 ? 189.412 138.611 150.162 1.00 119.07 ? 763 LEU B CG    1 
ATOM   6868  C CD1   . LEU B 2 763 ? 189.456 139.259 148.794 1.00 119.07 ? 763 LEU B CD1   1 
ATOM   6869  C CD2   . LEU B 2 763 ? 189.408 139.677 151.239 1.00 119.07 ? 763 LEU B CD2   1 
ATOM   6870  N N     . ARG B 2 764 ? 189.674 136.585 153.065 1.00 109.43 ? 764 ARG B N     1 
ATOM   6871  C CA    . ARG B 2 764 ? 190.032 136.703 154.470 1.00 109.43 ? 764 ARG B CA    1 
ATOM   6872  C C     . ARG B 2 764 ? 190.947 137.903 154.688 1.00 109.43 ? 764 ARG B C     1 
ATOM   6873  O O     . ARG B 2 764 ? 191.739 138.266 153.815 1.00 109.43 ? 764 ARG B O     1 
ATOM   6874  C CB    . ARG B 2 764 ? 190.717 135.422 154.955 1.00 109.43 ? 764 ARG B CB    1 
ATOM   6875  C CG    . ARG B 2 764 ? 191.021 135.381 156.437 1.00 109.43 ? 764 ARG B CG    1 
ATOM   6876  C CD    . ARG B 2 764 ? 191.606 134.037 156.824 1.00 109.43 ? 764 ARG B CD    1 
ATOM   6877  N NE    . ARG B 2 764 ? 191.947 133.976 158.239 1.00 109.43 ? 764 ARG B NE    1 
ATOM   6878  C CZ    . ARG B 2 764 ? 192.462 132.906 158.834 1.00 109.43 ? 764 ARG B CZ    1 
ATOM   6879  N NH1   . ARG B 2 764 ? 192.694 131.806 158.133 1.00 109.43 ? 764 ARG B NH1   1 
ATOM   6880  N NH2   . ARG B 2 764 ? 192.744 132.936 160.129 1.00 109.43 ? 764 ARG B NH2   1 
ATOM   6881  N N     . VAL B 2 765 ? 190.838 138.510 155.866 1.00 108.48 ? 765 VAL B N     1 
ATOM   6882  C CA    . VAL B 2 765 ? 191.570 139.726 156.191 1.00 108.48 ? 765 VAL B CA    1 
ATOM   6883  C C     . VAL B 2 765 ? 192.658 139.397 157.210 1.00 108.48 ? 765 VAL B C     1 
ATOM   6884  O O     . VAL B 2 765 ? 192.570 138.423 157.963 1.00 108.48 ? 765 VAL B O     1 
ATOM   6885  C CB    . VAL B 2 765 ? 190.622 140.824 156.716 1.00 108.48 ? 765 VAL B CB    1 
ATOM   6886  C CG1   . VAL B 2 765 ? 190.075 140.448 158.083 1.00 108.48 ? 765 VAL B CG1   1 
ATOM   6887  C CG2   . VAL B 2 765 ? 191.308 142.183 156.739 1.00 108.48 ? 765 VAL B CG2   1 
ATOM   6888  N N     . THR B 2 766 ? 193.704 140.224 157.223 1.00 121.36 ? 766 THR B N     1 
ATOM   6889  C CA    . THR B 2 766 ? 194.858 140.037 158.094 1.00 121.36 ? 766 THR B CA    1 
ATOM   6890  C C     . THR B 2 766 ? 195.119 141.307 158.897 1.00 121.36 ? 766 THR B C     1 
ATOM   6891  O O     . THR B 2 766 ? 194.405 142.306 158.781 1.00 121.36 ? 766 THR B O     1 
ATOM   6892  C CB    . THR B 2 766 ? 196.107 139.650 157.294 1.00 121.36 ? 766 THR B CB    1 
ATOM   6893  O OG1   . THR B 2 766 ? 196.410 140.687 156.352 1.00 121.36 ? 766 THR B OG1   1 
ATOM   6894  C CG2   . THR B 2 766 ? 195.887 138.340 156.556 1.00 121.36 ? 766 THR B CG2   1 
ATOM   6895  N N     . VAL B 2 767 ? 196.164 141.253 159.722 1.00 125.87 ? 767 VAL B N     1 
ATOM   6896  C CA    . VAL B 2 767 ? 196.489 142.298 160.690 1.00 125.87 ? 767 VAL B CA    1 
ATOM   6897  C C     . VAL B 2 767 ? 197.943 142.733 160.551 1.00 125.87 ? 767 VAL B C     1 
ATOM   6898  O O     . VAL B 2 767 ? 198.605 143.031 161.552 1.00 125.87 ? 767 VAL B O     1 
ATOM   6899  C CB    . VAL B 2 767 ? 196.192 141.828 162.124 1.00 125.87 ? 767 VAL B CB    1 
ATOM   6900  C CG1   . VAL B 2 767 ? 194.699 141.646 162.312 1.00 125.87 ? 767 VAL B CG1   1 
ATOM   6901  C CG2   . VAL B 2 767 ? 196.919 140.524 162.412 1.00 125.87 ? 767 VAL B CG2   1 
ATOM   6902  N N     . LYS B 2 768 ? 198.438 142.776 159.311 1.00 130.68 ? 768 LYS B N     1 
ATOM   6903  C CA    . LYS B 2 768 ? 199.867 142.800 159.005 1.00 130.68 ? 768 LYS B CA    1 
ATOM   6904  C C     . LYS B 2 768 ? 200.721 143.651 159.945 1.00 130.68 ? 768 LYS B C     1 
ATOM   6905  O O     . LYS B 2 768 ? 201.638 143.137 160.593 1.00 130.68 ? 768 LYS B O     1 
ATOM   6906  C CB    . LYS B 2 768 ? 200.051 143.287 157.564 1.00 130.68 ? 768 LYS B CB    1 
ATOM   6907  C CG    . LYS B 2 768 ? 201.492 143.319 157.107 1.00 130.68 ? 768 LYS B CG    1 
ATOM   6908  C CD    . LYS B 2 768 ? 202.063 141.918 157.004 1.00 130.68 ? 768 LYS B CD    1 
ATOM   6909  C CE    . LYS B 2 768 ? 203.516 141.952 156.569 1.00 130.68 ? 768 LYS B CE    1 
ATOM   6910  N NZ    . LYS B 2 768 ? 203.667 142.470 155.182 1.00 130.68 ? 768 LYS B NZ    1 
ATOM   6911  N N     . ASP B 2 769 ? 200.438 144.950 160.042 1.00 142.99 ? 769 ASP B N     1 
ATOM   6912  C CA    . ASP B 2 769 ? 201.305 145.859 160.783 1.00 142.99 ? 769 ASP B CA    1 
ATOM   6913  C C     . ASP B 2 769 ? 200.469 146.842 161.590 1.00 142.99 ? 769 ASP B C     1 
ATOM   6914  O O     . ASP B 2 769 ? 199.236 146.846 161.530 1.00 142.99 ? 769 ASP B O     1 
ATOM   6915  C CB    . ASP B 2 769 ? 202.251 146.617 159.845 1.00 142.99 ? 769 ASP B CB    1 
ATOM   6916  C CG    . ASP B 2 769 ? 203.342 145.736 159.279 1.00 142.99 ? 769 ASP B CG    1 
ATOM   6917  O OD1   . ASP B 2 769 ? 203.762 144.788 159.971 1.00 142.99 ? 769 ASP B OD1   1 
ATOM   6918  O OD2   . ASP B 2 769 ? 203.779 145.992 158.138 1.00 142.99 ? 769 ASP B OD2   1 
ATOM   6919  N N     . ALA B 2 770 ? 201.161 147.684 162.354 1.00 130.28 ? 770 ALA B N     1 
ATOM   6920  C CA    . ALA B 2 770 ? 200.557 148.786 163.097 1.00 130.28 ? 770 ALA B CA    1 
ATOM   6921  C C     . ALA B 2 770 ? 200.989 150.075 162.409 1.00 130.28 ? 770 ALA B C     1 
ATOM   6922  O O     . ALA B 2 770 ? 202.120 150.536 162.587 1.00 130.28 ? 770 ALA B O     1 
ATOM   6923  C CB    . ALA B 2 770 ? 200.977 148.759 164.563 1.00 130.28 ? 770 ALA B CB    1 
ATOM   6924  N N     . ILE B 2 771 ? 200.085 150.655 161.620 1.00 122.60 ? 771 ILE B N     1 
ATOM   6925  C CA    . ILE B 2 771 ? 200.401 151.781 160.755 1.00 122.60 ? 771 ILE B CA    1 
ATOM   6926  C C     . ILE B 2 771 ? 199.398 152.901 160.996 1.00 122.60 ? 771 ILE B C     1 
ATOM   6927  O O     . ILE B 2 771 ? 198.406 152.742 161.708 1.00 122.60 ? 771 ILE B O     1 
ATOM   6928  C CB    . ILE B 2 771 ? 200.416 151.378 159.268 1.00 122.60 ? 771 ILE B CB    1 
ATOM   6929  C CG1   . ILE B 2 771 ? 199.048 150.832 158.860 1.00 122.60 ? 771 ILE B CG1   1 
ATOM   6930  C CG2   . ILE B 2 771 ? 201.506 150.353 159.007 1.00 122.60 ? 771 ILE B CG2   1 
ATOM   6931  C CD1   . ILE B 2 771 ? 198.904 150.597 157.377 1.00 122.60 ? 771 ILE B CD1   1 
ATOM   6932  N N     . ALA B 2 772 ? 199.671 154.048 160.373 1.00 114.36 ? 772 ALA B N     1 
ATOM   6933  C CA    . ALA B 2 772 ? 198.888 155.262 160.556 1.00 114.36 ? 772 ALA B CA    1 
ATOM   6934  C C     . ALA B 2 772 ? 198.014 155.574 159.344 1.00 114.36 ? 772 ALA B C     1 
ATOM   6935  O O     . ALA B 2 772 ? 197.694 156.737 159.082 1.00 114.36 ? 772 ALA B O     1 
ATOM   6936  C CB    . ALA B 2 772 ? 199.805 156.442 160.870 1.00 114.36 ? 772 ALA B CB    1 
ATOM   6937  N N     . ALA B 2 773 ? 197.627 154.544 158.589 1.00 112.87 ? 773 ALA B N     1 
ATOM   6938  C CA    . ALA B 2 773 ? 196.678 154.759 157.504 1.00 112.87 ? 773 ALA B CA    1 
ATOM   6939  C C     . ALA B 2 773 ? 195.344 155.247 158.046 1.00 112.87 ? 773 ALA B C     1 
ATOM   6940  O O     . ALA B 2 773 ? 194.771 156.216 157.534 1.00 112.87 ? 773 ALA B O     1 
ATOM   6941  C CB    . ALA B 2 773 ? 196.495 153.475 156.698 1.00 112.87 ? 773 ALA B CB    1 
ATOM   6942  N N     . ASP B 2 774 ? 194.845 154.608 159.104 1.00 115.27 ? 774 ASP B N     1 
ATOM   6943  C CA    . ASP B 2 774 ? 193.601 155.055 159.712 1.00 115.27 ? 774 ASP B CA    1 
ATOM   6944  C C     . ASP B 2 774 ? 193.743 156.410 160.392 1.00 115.27 ? 774 ASP B C     1 
ATOM   6945  O O     . ASP B 2 774 ? 192.728 157.044 160.687 1.00 115.27 ? 774 ASP B O     1 
ATOM   6946  C CB    . ASP B 2 774 ? 193.100 154.017 160.714 1.00 115.27 ? 774 ASP B CB    1 
ATOM   6947  C CG    . ASP B 2 774 ? 192.604 152.754 160.040 1.00 115.27 ? 774 ASP B CG    1 
ATOM   6948  O OD1   . ASP B 2 774 ? 192.146 152.838 158.883 1.00 115.27 ? 774 ASP B OD1   1 
ATOM   6949  O OD2   . ASP B 2 774 ? 192.666 151.677 160.667 1.00 115.27 ? 774 ASP B OD2   1 
ATOM   6950  N N     . GLN B 2 775 ? 194.968 156.867 160.654 1.00 119.33 ? 775 GLN B N     1 
ATOM   6951  C CA    . GLN B 2 775 ? 195.140 158.210 161.199 1.00 119.33 ? 775 GLN B CA    1 
ATOM   6952  C C     . GLN B 2 775 ? 195.129 159.261 160.098 1.00 119.33 ? 775 GLN B C     1 
ATOM   6953  O O     . GLN B 2 775 ? 194.464 160.294 160.229 1.00 119.33 ? 775 GLN B O     1 
ATOM   6954  C CB    . GLN B 2 775 ? 196.434 158.293 162.006 1.00 119.33 ? 775 GLN B CB    1 
ATOM   6955  C CG    . GLN B 2 775 ? 196.418 157.453 163.265 1.00 119.33 ? 775 GLN B CG    1 
ATOM   6956  C CD    . GLN B 2 775 ? 195.364 157.920 164.248 1.00 119.33 ? 775 GLN B CD    1 
ATOM   6957  O OE1   . GLN B 2 775 ? 195.123 159.118 164.396 1.00 119.33 ? 775 GLN B OE1   1 
ATOM   6958  N NE2   . GLN B 2 775 ? 194.727 156.974 164.927 1.00 119.33 ? 775 GLN B NE2   1 
ATOM   6959  N N     . LEU B 2 776 ? 195.858 159.014 159.009 1.00 111.94 ? 776 LEU B N     1 
ATOM   6960  C CA    . LEU B 2 776 ? 195.766 159.884 157.840 1.00 111.94 ? 776 LEU B CA    1 
ATOM   6961  C C     . LEU B 2 776 ? 194.387 159.837 157.197 1.00 111.94 ? 776 LEU B C     1 
ATOM   6962  O O     . LEU B 2 776 ? 194.091 160.671 156.336 1.00 111.94 ? 776 LEU B O     1 
ATOM   6963  C CB    . LEU B 2 776 ? 196.829 159.517 156.806 1.00 111.94 ? 776 LEU B CB    1 
ATOM   6964  C CG    . LEU B 2 776 ? 198.215 160.141 156.985 1.00 111.94 ? 776 LEU B CG    1 
ATOM   6965  C CD1   . LEU B 2 776 ? 198.961 159.548 158.171 1.00 111.94 ? 776 LEU B CD1   1 
ATOM   6966  C CD2   . LEU B 2 776 ? 199.026 159.995 155.706 1.00 111.94 ? 776 LEU B CD2   1 
ATOM   6967  N N     . PHE B 2 777 ? 193.565 158.856 157.574 1.00 110.31 ? 777 PHE B N     1 
ATOM   6968  C CA    . PHE B 2 777 ? 192.175 158.800 157.131 1.00 110.31 ? 777 PHE B CA    1 
ATOM   6969  C C     . PHE B 2 777 ? 191.471 160.150 157.243 1.00 110.31 ? 777 PHE B C     1 
ATOM   6970  O O     . PHE B 2 777 ? 190.985 160.688 156.242 1.00 110.31 ? 777 PHE B O     1 
ATOM   6971  C CB    . PHE B 2 777 ? 191.435 157.741 157.947 1.00 110.31 ? 777 PHE B CB    1 
ATOM   6972  C CG    . PHE B 2 777 ? 189.999 157.566 157.565 1.00 110.31 ? 777 PHE B CG    1 
ATOM   6973  C CD1   . PHE B 2 777 ? 189.657 156.897 156.406 1.00 110.31 ? 777 PHE B CD1   1 
ATOM   6974  C CD2   . PHE B 2 777 ? 188.990 158.047 158.380 1.00 110.31 ? 777 PHE B CD2   1 
ATOM   6975  C CE1   . PHE B 2 777 ? 188.335 156.724 156.057 1.00 110.31 ? 777 PHE B CE1   1 
ATOM   6976  C CE2   . PHE B 2 777 ? 187.667 157.877 158.036 1.00 110.31 ? 777 PHE B CE2   1 
ATOM   6977  C CZ    . PHE B 2 777 ? 187.339 157.215 156.873 1.00 110.31 ? 777 PHE B CZ    1 
ATOM   6978  N N     . THR B 2 778 ? 191.399 160.716 158.454 1.00 118.10 ? 778 THR B N     1 
ATOM   6979  C CA    . THR B 2 778 ? 190.595 161.926 158.691 1.00 118.10 ? 778 THR B CA    1 
ATOM   6980  C C     . THR B 2 778 ? 191.377 162.974 159.494 1.00 118.10 ? 778 THR B C     1 
ATOM   6981  O O     . THR B 2 778 ? 191.282 163.052 160.721 1.00 118.10 ? 778 THR B O     1 
ATOM   6982  C CB    . THR B 2 778 ? 189.268 161.557 159.361 1.00 118.10 ? 778 THR B CB    1 
ATOM   6983  O OG1   . THR B 2 778 ? 188.516 162.742 159.658 1.00 118.10 ? 778 THR B OG1   1 
ATOM   6984  C CG2   . THR B 2 778 ? 189.469 160.714 160.620 1.00 118.10 ? 778 THR B CG2   1 
ATOM   6985  N N     . THR B 2 779 ? 192.147 163.798 158.779 1.00 127.29 ? 779 THR B N     1 
ATOM   6986  C CA    . THR B 2 779 ? 192.716 165.015 159.344 1.00 127.29 ? 779 THR B CA    1 
ATOM   6987  C C     . THR B 2 779 ? 192.634 166.167 158.349 1.00 127.29 ? 779 THR B C     1 
ATOM   6988  O O     . THR B 2 779 ? 192.988 167.300 158.696 1.00 127.29 ? 779 THR B O     1 
ATOM   6989  C CB    . THR B 2 779 ? 194.179 164.773 159.768 1.00 127.29 ? 779 THR B CB    1 
ATOM   6990  O OG1   . THR B 2 779 ? 194.253 163.559 160.523 1.00 127.29 ? 779 THR B OG1   1 
ATOM   6991  C CG2   . THR B 2 779 ? 194.684 165.893 160.669 1.00 127.29 ? 779 THR B CG2   1 
ATOM   6992  N N     . LEU B 2 780 ? 192.165 165.900 157.129 1.00 120.06 ? 780 LEU B N     1 
ATOM   6993  C CA    . LEU B 2 780 ? 192.024 166.813 155.999 1.00 120.06 ? 780 LEU B CA    1 
ATOM   6994  C C     . LEU B 2 780 ? 193.381 167.156 155.397 1.00 120.06 ? 780 LEU B C     1 
ATOM   6995  O O     . LEU B 2 780 ? 193.469 167.449 154.202 1.00 120.06 ? 780 LEU B O     1 
ATOM   6996  C CB    . LEU B 2 780 ? 191.267 168.079 156.424 1.00 120.06 ? 780 LEU B CB    1 
ATOM   6997  C CG    . LEU B 2 780 ? 190.832 169.119 155.387 1.00 120.06 ? 780 LEU B CG    1 
ATOM   6998  C CD1   . LEU B 2 780 ? 191.955 170.076 155.009 1.00 120.06 ? 780 LEU B CD1   1 
ATOM   6999  C CD2   . LEU B 2 780 ? 190.303 168.416 154.155 1.00 120.06 ? 780 LEU B CD2   1 
ATOM   7000  N N     . MET B 2 781 ? 194.461 166.913 156.132 1.00 117.68 ? 781 MET B N     1 
ATOM   7001  C CA    . MET B 2 781 ? 195.777 167.160 155.560 1.00 117.68 ? 781 MET B CA    1 
ATOM   7002  C C     . MET B 2 781 ? 196.259 165.953 154.768 1.00 117.68 ? 781 MET B C     1 
ATOM   7003  O O     . MET B 2 781 ? 196.665 166.084 153.607 1.00 117.68 ? 781 MET B O     1 
ATOM   7004  C CB    . MET B 2 781 ? 196.780 167.515 156.655 1.00 117.68 ? 781 MET B CB    1 
ATOM   7005  C CG    . MET B 2 781 ? 198.108 167.966 156.096 1.00 117.68 ? 781 MET B CG    1 
ATOM   7006  S SD    . MET B 2 781 ? 197.921 169.481 155.139 1.00 117.68 ? 781 MET B SD    1 
ATOM   7007  C CE    . MET B 2 781 ? 199.323 169.359 154.036 1.00 117.68 ? 781 MET B CE    1 
ATOM   7008  N N     . GLY B 2 782 ? 196.213 164.773 155.386 1.00 114.11 ? 782 GLY B N     1 
ATOM   7009  C CA    . GLY B 2 782 ? 196.369 163.552 154.620 1.00 114.11 ? 782 GLY B CA    1 
ATOM   7010  C C     . GLY B 2 782 ? 195.359 163.459 153.495 1.00 114.11 ? 782 GLY B C     1 
ATOM   7011  O O     . GLY B 2 782 ? 195.672 162.978 152.406 1.00 114.11 ? 782 GLY B O     1 
ATOM   7012  N N     . ASP B 2 783 ? 194.136 163.936 153.736 1.00 113.75 ? 783 ASP B N     1 
ATOM   7013  C CA    . ASP B 2 783 ? 193.129 163.944 152.681 1.00 113.75 ? 783 ASP B CA    1 
ATOM   7014  C C     . ASP B 2 783 ? 193.543 164.831 151.514 1.00 113.75 ? 783 ASP B C     1 
ATOM   7015  O O     . ASP B 2 783 ? 193.294 164.483 150.356 1.00 113.75 ? 783 ASP B O     1 
ATOM   7016  C CB    . ASP B 2 783 ? 191.779 164.398 153.240 1.00 113.75 ? 783 ASP B CB    1 
ATOM   7017  C CG    . ASP B 2 783 ? 191.130 163.353 154.125 1.00 113.75 ? 783 ASP B CG    1 
ATOM   7018  O OD1   . ASP B 2 783 ? 191.362 162.150 153.891 1.00 113.75 ? 783 ASP B OD1   1 
ATOM   7019  O OD2   . ASP B 2 783 ? 190.384 163.735 155.051 1.00 113.75 ? 783 ASP B OD2   1 
ATOM   7020  N N     . ALA B 2 784 ? 194.171 165.975 151.789 1.00 119.02 ? 784 ALA B N     1 
ATOM   7021  C CA    . ALA B 2 784 ? 194.606 166.835 150.697 1.00 119.02 ? 784 ALA B CA    1 
ATOM   7022  C C     . ALA B 2 784 ? 195.836 166.277 149.990 1.00 119.02 ? 784 ALA B C     1 
ATOM   7023  O O     . ALA B 2 784 ? 196.010 166.496 148.787 1.00 119.02 ? 784 ALA B O     1 
ATOM   7024  C CB    . ALA B 2 784 ? 194.886 168.245 151.217 1.00 119.02 ? 784 ALA B CB    1 
ATOM   7025  N N     . VAL B 2 785 ? 196.694 165.555 150.708 1.00 118.43 ? 785 VAL B N     1 
ATOM   7026  C CA    . VAL B 2 785 ? 197.988 165.185 150.137 1.00 118.43 ? 785 VAL B CA    1 
ATOM   7027  C C     . VAL B 2 785 ? 197.956 163.812 149.468 1.00 118.43 ? 785 VAL B C     1 
ATOM   7028  O O     . VAL B 2 785 ? 198.658 163.587 148.480 1.00 118.43 ? 785 VAL B O     1 
ATOM   7029  C CB    . VAL B 2 785 ? 199.086 165.260 151.219 1.00 118.43 ? 785 VAL B CB    1 
ATOM   7030  C CG1   . VAL B 2 785 ? 198.893 164.179 152.268 1.00 118.43 ? 785 VAL B CG1   1 
ATOM   7031  C CG2   . VAL B 2 785 ? 200.465 165.162 150.587 1.00 118.43 ? 785 VAL B CG2   1 
ATOM   7032  N N     . GLU B 2 786 ? 197.152 162.876 149.973 1.00 116.56 ? 786 GLU B N     1 
ATOM   7033  C CA    . GLU B 2 786 ? 197.203 161.509 149.469 1.00 116.56 ? 786 GLU B CA    1 
ATOM   7034  C C     . GLU B 2 786 ? 196.810 161.367 148.001 1.00 116.56 ? 786 GLU B C     1 
ATOM   7035  O O     . GLU B 2 786 ? 197.445 160.551 147.310 1.00 116.56 ? 786 GLU B O     1 
ATOM   7036  C CB    . GLU B 2 786 ? 196.324 160.609 150.352 1.00 116.56 ? 786 GLU B CB    1 
ATOM   7037  C CG    . GLU B 2 786 ? 196.341 159.141 149.962 1.00 116.56 ? 786 GLU B CG    1 
ATOM   7038  C CD    . GLU B 2 786 ? 197.696 158.502 150.169 1.00 116.56 ? 786 GLU B CD    1 
ATOM   7039  O OE1   . GLU B 2 786 ? 198.455 158.984 151.035 1.00 116.56 ? 786 GLU B OE1   1 
ATOM   7040  O OE2   . GLU B 2 786 ? 198.004 157.517 149.467 1.00 116.56 ? 786 GLU B OE2   1 
ATOM   7041  N N     . PRO B 2 787 ? 195.822 162.095 147.461 1.00 120.16 ? 787 PRO B N     1 
ATOM   7042  C CA    . PRO B 2 787 ? 195.555 161.977 146.023 1.00 120.16 ? 787 PRO B CA    1 
ATOM   7043  C C     . PRO B 2 787 ? 196.695 162.529 145.184 1.00 120.16 ? 787 PRO B C     1 
ATOM   7044  O O     . PRO B 2 787 ? 196.621 163.640 144.650 1.00 120.16 ? 787 PRO B O     1 
ATOM   7045  C CB    . PRO B 2 787 ? 194.267 162.786 145.835 1.00 120.16 ? 787 PRO B CB    1 
ATOM   7046  C CG    . PRO B 2 787 ? 193.612 162.758 147.162 1.00 120.16 ? 787 PRO B CG    1 
ATOM   7047  C CD    . PRO B 2 787 ? 194.737 162.820 148.147 1.00 120.16 ? 787 PRO B CD    1 
ATOM   7048  N N     . ARG B 2 788 ? 197.763 161.743 145.077 1.00 135.42 ? 788 ARG B N     1 
ATOM   7049  C CA    . ARG B 2 788 ? 198.907 162.036 144.222 1.00 135.42 ? 788 ARG B CA    1 
ATOM   7050  C C     . ARG B 2 788 ? 198.953 161.037 143.069 1.00 135.42 ? 788 ARG B C     1 
ATOM   7051  O O     . ARG B 2 788 ? 200.006 160.513 142.702 1.00 135.42 ? 788 ARG B O     1 
ATOM   7052  C CB    . ARG B 2 788 ? 200.207 162.011 145.023 1.00 135.42 ? 788 ARG B CB    1 
ATOM   7053  C CG    . ARG B 2 788 ? 201.418 162.558 144.274 1.00 135.42 ? 788 ARG B CG    1 
ATOM   7054  C CD    . ARG B 2 788 ? 202.680 162.501 145.110 1.00 135.42 ? 788 ARG B CD    1 
ATOM   7055  N NE    . ARG B 2 788 ? 203.840 162.955 144.348 1.00 135.42 ? 788 ARG B NE    1 
ATOM   7056  C CZ    . ARG B 2 788 ? 205.080 162.989 144.822 1.00 135.42 ? 788 ARG B CZ    1 
ATOM   7057  N NH1   . ARG B 2 788 ? 205.330 162.589 146.061 1.00 135.42 ? 788 ARG B NH1   1 
ATOM   7058  N NH2   . ARG B 2 788 ? 206.072 163.418 144.054 1.00 135.42 ? 788 ARG B NH2   1 
ATOM   7059  N N     . ARG B 2 789 ? 197.787 160.736 142.503 1.00 128.05 ? 789 ARG B N     1 
ATOM   7060  C CA    . ARG B 2 789 ? 197.689 159.767 141.414 1.00 128.05 ? 789 ARG B CA    1 
ATOM   7061  C C     . ARG B 2 789 ? 197.946 160.476 140.084 1.00 128.05 ? 789 ARG B C     1 
ATOM   7062  O O     . ARG B 2 789 ? 197.057 160.686 139.258 1.00 128.05 ? 789 ARG B O     1 
ATOM   7063  C CB    . ARG B 2 789 ? 196.334 159.076 141.443 1.00 128.05 ? 789 ARG B CB    1 
ATOM   7064  C CG    . ARG B 2 789 ? 196.083 158.326 142.737 1.00 128.05 ? 789 ARG B CG    1 
ATOM   7065  C CD    . ARG B 2 789 ? 197.052 157.168 142.881 1.00 128.05 ? 789 ARG B CD    1 
ATOM   7066  N NE    . ARG B 2 789 ? 196.814 156.396 144.096 1.00 128.05 ? 789 ARG B NE    1 
ATOM   7067  C CZ    . ARG B 2 789 ? 197.580 155.387 144.496 1.00 128.05 ? 789 ARG B CZ    1 
ATOM   7068  N NH1   . ARG B 2 789 ? 198.634 155.029 143.777 1.00 128.05 ? 789 ARG B NH1   1 
ATOM   7069  N NH2   . ARG B 2 789 ? 197.294 154.736 145.615 1.00 128.05 ? 789 ARG B NH2   1 
ATOM   7070  N N     . ALA B 2 790 ? 199.207 160.850 139.897 1.00 132.85 ? 790 ALA B N     1 
ATOM   7071  C CA    . ALA B 2 790 ? 199.635 161.531 138.684 1.00 132.85 ? 790 ALA B CA    1 
ATOM   7072  C C     . ALA B 2 790 ? 200.898 160.885 138.129 1.00 132.85 ? 790 ALA B C     1 
ATOM   7073  O O     . ALA B 2 790 ? 201.464 159.982 138.744 1.00 132.85 ? 790 ALA B O     1 
ATOM   7074  C CB    . ALA B 2 790 ? 199.867 163.007 138.956 1.00 132.85 ? 790 ALA B CB    1 
ATOM   7075  N N     . ILE C 1 8   ? 129.535 189.009 149.153 1.00 131.17 ? 8   ILE C N     1 
ATOM   7076  C CA    . ILE C 1 8   ? 128.489 188.233 148.502 1.00 131.17 ? 8   ILE C CA    1 
ATOM   7077  C C     . ILE C 1 8   ? 128.403 186.852 149.143 1.00 131.17 ? 8   ILE C C     1 
ATOM   7078  O O     . ILE C 1 8   ? 129.198 185.966 148.832 1.00 131.17 ? 8   ILE C O     1 
ATOM   7079  C CB    . ILE C 1 8   ? 128.743 188.124 146.992 1.00 131.17 ? 8   ILE C CB    1 
ATOM   7080  C CG1   . ILE C 1 8   ? 128.789 189.516 146.361 1.00 131.17 ? 8   ILE C CG1   1 
ATOM   7081  C CG2   . ILE C 1 8   ? 127.660 187.284 146.332 1.00 131.17 ? 8   ILE C CG2   1 
ATOM   7082  C CD1   . ILE C 1 8   ? 129.308 189.522 144.942 1.00 131.17 ? 8   ILE C CD1   1 
ATOM   7083  N N     . THR C 1 9   ? 127.442 186.674 150.048 1.00 133.66 ? 9   THR C N     1 
ATOM   7084  C CA    . THR C 1 9   ? 127.265 185.420 150.779 1.00 133.66 ? 9   THR C CA    1 
ATOM   7085  C C     . THR C 1 9   ? 125.810 184.983 150.680 1.00 133.66 ? 9   THR C C     1 
ATOM   7086  O O     . THR C 1 9   ? 124.996 185.290 151.563 1.00 133.66 ? 9   THR C O     1 
ATOM   7087  C CB    . THR C 1 9   ? 127.684 185.564 152.240 1.00 133.66 ? 9   THR C CB    1 
ATOM   7088  O OG1   . THR C 1 9   ? 126.864 186.549 152.880 1.00 133.66 ? 9   THR C OG1   1 
ATOM   7089  C CG2   . THR C 1 9   ? 129.138 185.986 152.341 1.00 133.66 ? 9   THR C CG2   1 
ATOM   7090  N N     . PRO C 1 10  ? 125.445 184.264 149.622 1.00 128.45 ? 10  PRO C N     1 
ATOM   7091  C CA    . PRO C 1 10  ? 124.071 183.765 149.515 1.00 128.45 ? 10  PRO C CA    1 
ATOM   7092  C C     . PRO C 1 10  ? 123.809 182.650 150.512 1.00 128.45 ? 10  PRO C C     1 
ATOM   7093  O O     . PRO C 1 10  ? 124.647 181.774 150.740 1.00 128.45 ? 10  PRO C O     1 
ATOM   7094  C CB    . PRO C 1 10  ? 123.991 183.252 148.074 1.00 128.45 ? 10  PRO C CB    1 
ATOM   7095  C CG    . PRO C 1 10  ? 125.396 182.903 147.731 1.00 128.45 ? 10  PRO C CG    1 
ATOM   7096  C CD    . PRO C 1 10  ? 126.260 183.901 148.451 1.00 128.45 ? 10  PRO C CD    1 
ATOM   7097  N N     . VAL C 1 11  ? 122.627 182.692 151.108 1.00 125.24 ? 11  VAL C N     1 
ATOM   7098  C CA    . VAL C 1 11  ? 122.243 181.707 152.108 1.00 125.24 ? 11  VAL C CA    1 
ATOM   7099  C C     . VAL C 1 11  ? 122.061 180.357 151.434 1.00 125.24 ? 11  VAL C C     1 
ATOM   7100  O O     . VAL C 1 11  ? 121.464 180.259 150.356 1.00 125.24 ? 11  VAL C O     1 
ATOM   7101  C CB    . VAL C 1 11  ? 120.960 182.149 152.832 1.00 125.24 ? 11  VAL C CB    1 
ATOM   7102  C CG1   . VAL C 1 11  ? 120.516 181.089 153.826 1.00 125.24 ? 11  VAL C CG1   1 
ATOM   7103  C CG2   . VAL C 1 11  ? 121.180 183.484 153.522 1.00 125.24 ? 11  VAL C CG2   1 
ATOM   7104  N N     . ASN C 1 12  ? 122.581 179.308 152.065 1.00 126.53 ? 12  ASN C N     1 
ATOM   7105  C CA    . ASN C 1 12  ? 122.440 177.954 151.556 1.00 126.53 ? 12  ASN C CA    1 
ATOM   7106  C C     . ASN C 1 12  ? 121.859 177.056 152.635 1.00 126.53 ? 12  ASN C C     1 
ATOM   7107  O O     . ASN C 1 12  ? 122.201 177.179 153.814 1.00 126.53 ? 12  ASN C O     1 
ATOM   7108  C CB    . ASN C 1 12  ? 123.775 177.385 151.081 1.00 126.53 ? 12  ASN C CB    1 
ATOM   7109  C CG    . ASN C 1 12  ? 123.621 176.050 150.382 1.00 126.53 ? 12  ASN C CG    1 
ATOM   7110  O OD1   . ASN C 1 12  ? 122.517 175.522 150.260 1.00 126.53 ? 12  ASN C OD1   1 
ATOM   7111  N ND2   . ASN C 1 12  ? 124.733 175.494 149.918 1.00 126.53 ? 12  ASN C ND2   1 
ATOM   7112  N N     . ILE C 1 13  ? 120.981 176.146 152.213 1.00 127.59 ? 13  ILE C N     1 
ATOM   7113  C CA    . ILE C 1 13  ? 120.383 175.200 153.139 1.00 127.59 ? 13  ILE C CA    1 
ATOM   7114  C C     . ILE C 1 13  ? 121.427 174.174 153.570 1.00 127.59 ? 13  ILE C C     1 
ATOM   7115  O O     . ILE C 1 13  ? 122.488 174.021 152.954 1.00 127.59 ? 13  ILE C O     1 
ATOM   7116  C CB    . ILE C 1 13  ? 119.163 174.525 152.491 1.00 127.59 ? 13  ILE C CB    1 
ATOM   7117  C CG1   . ILE C 1 13  ? 118.243 173.920 153.549 1.00 127.59 ? 13  ILE C CG1   1 
ATOM   7118  C CG2   . ILE C 1 13  ? 119.604 173.470 151.495 1.00 127.59 ? 13  ILE C CG2   1 
ATOM   7119  C CD1   . ILE C 1 13  ? 117.567 174.959 154.402 1.00 127.59 ? 13  ILE C CD1   1 
ATOM   7120  N N     . GLU C 1 14  ? 121.125 173.469 154.661 1.00 126.21 ? 14  GLU C N     1 
ATOM   7121  C CA    . GLU C 1 14  ? 122.022 172.436 155.164 1.00 126.21 ? 14  GLU C CA    1 
ATOM   7122  C C     . GLU C 1 14  ? 121.990 171.173 154.313 1.00 126.21 ? 14  GLU C C     1 
ATOM   7123  O O     . GLU C 1 14  ? 122.940 170.385 154.367 1.00 126.21 ? 14  GLU C O     1 
ATOM   7124  C CB    . GLU C 1 14  ? 121.665 172.113 156.616 1.00 126.21 ? 14  GLU C CB    1 
ATOM   7125  C CG    . GLU C 1 14  ? 122.691 171.287 157.373 1.00 126.21 ? 14  GLU C CG    1 
ATOM   7126  C CD    . GLU C 1 14  ? 122.513 169.804 157.149 1.00 126.21 ? 14  GLU C CD    1 
ATOM   7127  O OE1   . GLU C 1 14  ? 121.376 169.382 156.852 1.00 126.21 ? 14  GLU C OE1   1 
ATOM   7128  O OE2   . GLU C 1 14  ? 123.507 169.060 157.262 1.00 126.21 ? 14  GLU C OE2   1 
ATOM   7129  N N     . GLU C 1 15  ? 120.943 170.982 153.507 1.00 129.64 ? 15  GLU C N     1 
ATOM   7130  C CA    . GLU C 1 15  ? 120.785 169.812 152.649 1.00 129.64 ? 15  GLU C CA    1 
ATOM   7131  C C     . GLU C 1 15  ? 121.956 169.604 151.690 1.00 129.64 ? 15  GLU C C     1 
ATOM   7132  O O     . GLU C 1 15  ? 122.053 168.533 151.084 1.00 129.64 ? 15  GLU C O     1 
ATOM   7133  C CB    . GLU C 1 15  ? 119.464 169.945 151.882 1.00 129.64 ? 15  GLU C CB    1 
ATOM   7134  C CG    . GLU C 1 15  ? 119.033 168.748 151.059 1.00 129.64 ? 15  GLU C CG    1 
ATOM   7135  C CD    . GLU C 1 15  ? 119.573 168.803 149.647 1.00 129.64 ? 15  GLU C CD    1 
ATOM   7136  O OE1   . GLU C 1 15  ? 119.817 169.921 149.150 1.00 129.64 ? 15  GLU C OE1   1 
ATOM   7137  O OE2   . GLU C 1 15  ? 119.763 167.733 149.035 1.00 129.64 ? 15  GLU C OE2   1 
ATOM   7138  N N     . GLU C 1 16  ? 122.863 170.579 151.570 1.00 128.15 ? 16  GLU C N     1 
ATOM   7139  C CA    . GLU C 1 16  ? 124.014 170.442 150.680 1.00 128.15 ? 16  GLU C CA    1 
ATOM   7140  C C     . GLU C 1 16  ? 124.814 169.176 150.969 1.00 128.15 ? 16  GLU C C     1 
ATOM   7141  O O     . GLU C 1 16  ? 125.505 168.658 150.084 1.00 128.15 ? 16  GLU C O     1 
ATOM   7142  C CB    . GLU C 1 16  ? 124.905 171.677 150.804 1.00 128.15 ? 16  GLU C CB    1 
ATOM   7143  C CG    . GLU C 1 16  ? 126.121 171.679 149.900 1.00 128.15 ? 16  GLU C CG    1 
ATOM   7144  C CD    . GLU C 1 16  ? 125.755 171.750 148.433 1.00 128.15 ? 16  GLU C CD    1 
ATOM   7145  O OE1   . GLU C 1 16  ? 124.671 172.282 148.112 1.00 128.15 ? 16  GLU C OE1   1 
ATOM   7146  O OE2   . GLU C 1 16  ? 126.552 171.274 147.600 1.00 128.15 ? 16  GLU C OE2   1 
ATOM   7147  N N     . LEU C 1 17  ? 124.728 168.660 152.197 1.00 118.06 ? 17  LEU C N     1 
ATOM   7148  C CA    . LEU C 1 17  ? 125.472 167.457 152.554 1.00 118.06 ? 17  LEU C CA    1 
ATOM   7149  C C     . LEU C 1 17  ? 125.065 166.269 151.691 1.00 118.06 ? 17  LEU C C     1 
ATOM   7150  O O     . LEU C 1 17  ? 125.911 165.455 151.306 1.00 118.06 ? 17  LEU C O     1 
ATOM   7151  C CB    . LEU C 1 17  ? 125.266 167.140 154.035 1.00 118.06 ? 17  LEU C CB    1 
ATOM   7152  C CG    . LEU C 1 17  ? 126.085 166.012 154.668 1.00 118.06 ? 17  LEU C CG    1 
ATOM   7153  C CD1   . LEU C 1 17  ? 126.337 166.313 156.134 1.00 118.06 ? 17  LEU C CD1   1 
ATOM   7154  C CD2   . LEU C 1 17  ? 125.379 164.675 154.532 1.00 118.06 ? 17  LEU C CD2   1 
ATOM   7155  N N     . LYS C 1 18  ? 123.773 166.147 151.382 1.00 114.14 ? 18  LYS C N     1 
ATOM   7156  C CA    . LYS C 1 18  ? 123.307 164.976 150.648 1.00 114.14 ? 18  LYS C CA    1 
ATOM   7157  C C     . LYS C 1 18  ? 123.809 164.982 149.211 1.00 114.14 ? 18  LYS C C     1 
ATOM   7158  O O     . LYS C 1 18  ? 124.166 163.931 148.666 1.00 114.14 ? 18  LYS C O     1 
ATOM   7159  C CB    . LYS C 1 18  ? 121.783 164.905 150.676 1.00 114.14 ? 18  LYS C CB    1 
ATOM   7160  C CG    . LYS C 1 18  ? 121.223 163.676 149.983 1.00 114.14 ? 18  LYS C CG    1 
ATOM   7161  C CD    . LYS C 1 18  ? 119.721 163.568 150.161 1.00 114.14 ? 18  LYS C CD    1 
ATOM   7162  C CE    . LYS C 1 18  ? 118.995 164.601 149.321 1.00 114.14 ? 18  LYS C CE    1 
ATOM   7163  N NZ    . LYS C 1 18  ? 119.128 164.317 147.868 1.00 114.14 ? 18  LYS C NZ    1 
ATOM   7164  N N     . SER C 1 19  ? 123.846 166.156 148.580 1.00 112.53 ? 19  SER C N     1 
ATOM   7165  C CA    . SER C 1 19  ? 124.231 166.223 147.175 1.00 112.53 ? 19  SER C CA    1 
ATOM   7166  C C     . SER C 1 19  ? 125.694 165.848 146.980 1.00 112.53 ? 19  SER C C     1 
ATOM   7167  O O     . SER C 1 19  ? 126.040 165.144 146.024 1.00 112.53 ? 19  SER C O     1 
ATOM   7168  C CB    . SER C 1 19  ? 123.960 167.620 146.623 1.00 112.53 ? 19  SER C CB    1 
ATOM   7169  O OG    . SER C 1 19  ? 124.360 167.709 145.268 1.00 112.53 ? 19  SER C OG    1 
ATOM   7170  N N     . SER C 1 20  ? 126.568 166.305 147.877 1.00 112.38 ? 20  SER C N     1 
ATOM   7171  C CA    . SER C 1 20  ? 127.992 166.032 147.718 1.00 112.38 ? 20  SER C CA    1 
ATOM   7172  C C     . SER C 1 20  ? 128.306 164.559 147.948 1.00 112.38 ? 20  SER C C     1 
ATOM   7173  O O     . SER C 1 20  ? 129.001 163.932 147.140 1.00 112.38 ? 20  SER C O     1 
ATOM   7174  C CB    . SER C 1 20  ? 128.800 166.907 148.673 1.00 112.38 ? 20  SER C CB    1 
ATOM   7175  O OG    . SER C 1 20  ? 128.629 168.278 148.364 1.00 112.38 ? 20  SER C OG    1 
ATOM   7176  N N     . TYR C 1 21  ? 127.804 163.991 149.046 1.00 105.88 ? 21  TYR C N     1 
ATOM   7177  C CA    . TYR C 1 21  ? 128.104 162.598 149.362 1.00 105.88 ? 21  TYR C CA    1 
ATOM   7178  C C     . TYR C 1 21  ? 127.574 161.660 148.287 1.00 105.88 ? 21  TYR C C     1 
ATOM   7179  O O     . TYR C 1 21  ? 128.255 160.704 147.892 1.00 105.88 ? 21  TYR C O     1 
ATOM   7180  C CB    . TYR C 1 21  ? 127.512 162.236 150.721 1.00 105.88 ? 21  TYR C CB    1 
ATOM   7181  C CG    . TYR C 1 21  ? 127.818 160.829 151.163 1.00 105.88 ? 21  TYR C CG    1 
ATOM   7182  C CD1   . TYR C 1 21  ? 129.057 160.502 151.690 1.00 105.88 ? 21  TYR C CD1   1 
ATOM   7183  C CD2   . TYR C 1 21  ? 126.870 159.824 151.046 1.00 105.88 ? 21  TYR C CD2   1 
ATOM   7184  C CE1   . TYR C 1 21  ? 129.342 159.218 152.097 1.00 105.88 ? 21  TYR C CE1   1 
ATOM   7185  C CE2   . TYR C 1 21  ? 127.146 158.537 151.448 1.00 105.88 ? 21  TYR C CE2   1 
ATOM   7186  C CZ    . TYR C 1 21  ? 128.384 158.239 151.972 1.00 105.88 ? 21  TYR C CZ    1 
ATOM   7187  O OH    . TYR C 1 21  ? 128.665 156.955 152.375 1.00 105.88 ? 21  TYR C OH    1 
ATOM   7188  N N     . LEU C 1 22  ? 126.355 161.913 147.808 1.00 109.94 ? 22  LEU C N     1 
ATOM   7189  C CA    . LEU C 1 22  ? 125.788 161.081 146.755 1.00 109.94 ? 22  LEU C CA    1 
ATOM   7190  C C     . LEU C 1 22  ? 126.654 161.126 145.504 1.00 109.94 ? 22  LEU C C     1 
ATOM   7191  O O     . LEU C 1 22  ? 126.843 160.105 144.833 1.00 109.94 ? 22  LEU C O     1 
ATOM   7192  C CB    . LEU C 1 22  ? 124.358 161.532 146.453 1.00 109.94 ? 22  LEU C CB    1 
ATOM   7193  C CG    . LEU C 1 22  ? 123.457 160.663 145.571 1.00 109.94 ? 22  LEU C CG    1 
ATOM   7194  C CD1   . LEU C 1 22  ? 123.734 160.847 144.083 1.00 109.94 ? 22  LEU C CD1   1 
ATOM   7195  C CD2   . LEU C 1 22  ? 123.613 159.208 145.966 1.00 109.94 ? 22  LEU C CD2   1 
ATOM   7196  N N     . ASP C 1 23  ? 127.194 162.303 145.181 1.00 108.39 ? 23  ASP C N     1 
ATOM   7197  C CA    . ASP C 1 23  ? 128.094 162.414 144.039 1.00 108.39 ? 23  ASP C CA    1 
ATOM   7198  C C     . ASP C 1 23  ? 129.331 161.548 144.231 1.00 108.39 ? 23  ASP C C     1 
ATOM   7199  O O     . ASP C 1 23  ? 129.749 160.834 143.311 1.00 108.39 ? 23  ASP C O     1 
ATOM   7200  C CB    . ASP C 1 23  ? 128.488 163.875 143.832 1.00 108.39 ? 23  ASP C CB    1 
ATOM   7201  C CG    . ASP C 1 23  ? 129.201 164.109 142.517 1.00 108.39 ? 23  ASP C CG    1 
ATOM   7202  O OD1   . ASP C 1 23  ? 129.390 163.142 141.751 1.00 108.39 ? 23  ASP C OD1   1 
ATOM   7203  O OD2   . ASP C 1 23  ? 129.580 165.267 142.251 1.00 108.39 ? 23  ASP C OD2   1 
ATOM   7204  N N     . TYR C 1 24  ? 129.929 161.600 145.422 1.00 100.04 ? 24  TYR C N     1 
ATOM   7205  C CA    . TYR C 1 24  ? 131.103 160.780 145.700 1.00 100.04 ? 24  TYR C CA    1 
ATOM   7206  C C     . TYR C 1 24  ? 130.795 159.299 145.543 1.00 100.04 ? 24  TYR C C     1 
ATOM   7207  O O     . TYR C 1 24  ? 131.563 158.561 144.913 1.00 100.04 ? 24  TYR C O     1 
ATOM   7208  C CB    . TYR C 1 24  ? 131.614 161.066 147.108 1.00 100.04 ? 24  TYR C CB    1 
ATOM   7209  C CG    . TYR C 1 24  ? 132.792 160.217 147.511 1.00 100.04 ? 24  TYR C CG    1 
ATOM   7210  C CD1   . TYR C 1 24  ? 134.056 160.465 147.002 1.00 100.04 ? 24  TYR C CD1   1 
ATOM   7211  C CD2   . TYR C 1 24  ? 132.640 159.169 148.405 1.00 100.04 ? 24  TYR C CD2   1 
ATOM   7212  C CE1   . TYR C 1 24  ? 135.135 159.692 147.371 1.00 100.04 ? 24  TYR C CE1   1 
ATOM   7213  C CE2   . TYR C 1 24  ? 133.712 158.390 148.780 1.00 100.04 ? 24  TYR C CE2   1 
ATOM   7214  C CZ    . TYR C 1 24  ? 134.958 158.656 148.261 1.00 100.04 ? 24  TYR C CZ    1 
ATOM   7215  O OH    . TYR C 1 24  ? 136.034 157.884 148.630 1.00 100.04 ? 24  TYR C OH    1 
ATOM   7216  N N     . ALA C 1 25  ? 129.680 158.844 146.115 1.00 94.51  ? 25  ALA C N     1 
ATOM   7217  C CA    . ALA C 1 25  ? 129.340 157.428 146.029 1.00 94.51  ? 25  ALA C CA    1 
ATOM   7218  C C     . ALA C 1 25  ? 129.095 157.003 144.588 1.00 94.51  ? 25  ALA C C     1 
ATOM   7219  O O     . ALA C 1 25  ? 129.577 155.949 144.150 1.00 94.51  ? 25  ALA C O     1 
ATOM   7220  C CB    . ALA C 1 25  ? 128.116 157.129 146.891 1.00 94.51  ? 25  ALA C CB    1 
ATOM   7221  N N     . MET C 1 26  ? 128.339 157.807 143.837 1.00 102.18 ? 26  MET C N     1 
ATOM   7222  C CA    . MET C 1 26  ? 128.035 157.456 142.455 1.00 102.18 ? 26  MET C CA    1 
ATOM   7223  C C     . MET C 1 26  ? 129.295 157.439 141.603 1.00 102.18 ? 26  MET C C     1 
ATOM   7224  O O     . MET C 1 26  ? 129.418 156.626 140.681 1.00 102.18 ? 26  MET C O     1 
ATOM   7225  C CB    . MET C 1 26  ? 127.011 158.433 141.883 1.00 102.18 ? 26  MET C CB    1 
ATOM   7226  C CG    . MET C 1 26  ? 126.517 158.066 140.501 1.00 102.18 ? 26  MET C CG    1 
ATOM   7227  S SD    . MET C 1 26  ? 125.643 156.492 140.505 1.00 102.18 ? 26  MET C SD    1 
ATOM   7228  C CE    . MET C 1 26  ? 124.125 156.952 141.337 1.00 102.18 ? 26  MET C CE    1 
ATOM   7229  N N     . SER C 1 27  ? 130.246 158.327 141.895 1.00 93.21  ? 27  SER C N     1 
ATOM   7230  C CA    . SER C 1 27  ? 131.501 158.314 141.154 1.00 93.21  ? 27  SER C CA    1 
ATOM   7231  C C     . SER C 1 27  ? 132.322 157.078 141.487 1.00 93.21  ? 27  SER C C     1 
ATOM   7232  O O     . SER C 1 27  ? 132.834 156.403 140.586 1.00 93.21  ? 27  SER C O     1 
ATOM   7233  C CB    . SER C 1 27  ? 132.299 159.581 141.451 1.00 93.21  ? 27  SER C CB    1 
ATOM   7234  O OG    . SER C 1 27  ? 133.546 159.561 140.779 1.00 93.21  ? 27  SER C OG    1 
ATOM   7235  N N     . VAL C 1 28  ? 132.458 156.764 142.778 1.00 91.29  ? 28  VAL C N     1 
ATOM   7236  C CA    . VAL C 1 28  ? 133.295 155.639 143.183 1.00 91.29  ? 28  VAL C CA    1 
ATOM   7237  C C     . VAL C 1 28  ? 132.747 154.335 142.623 1.00 91.29  ? 28  VAL C C     1 
ATOM   7238  O O     . VAL C 1 28  ? 133.469 153.575 141.965 1.00 91.29  ? 28  VAL C O     1 
ATOM   7239  C CB    . VAL C 1 28  ? 133.423 155.580 144.714 1.00 91.29  ? 28  VAL C CB    1 
ATOM   7240  C CG1   . VAL C 1 28  ? 134.131 154.304 145.126 1.00 91.29  ? 28  VAL C CG1   1 
ATOM   7241  C CG2   . VAL C 1 28  ? 134.184 156.784 145.224 1.00 91.29  ? 28  VAL C CG2   1 
ATOM   7242  N N     . ILE C 1 29  ? 131.459 154.065 142.862 1.00 95.02  ? 29  ILE C N     1 
ATOM   7243  C CA    . ILE C 1 29  ? 130.876 152.780 142.478 1.00 95.02  ? 29  ILE C CA    1 
ATOM   7244  C C     . ILE C 1 29  ? 131.049 152.528 140.986 1.00 95.02  ? 29  ILE C C     1 
ATOM   7245  O O     . ILE C 1 29  ? 131.246 151.387 140.552 1.00 95.02  ? 29  ILE C O     1 
ATOM   7246  C CB    . ILE C 1 29  ? 129.394 152.724 142.890 1.00 95.02  ? 29  ILE C CB    1 
ATOM   7247  C CG1   . ILE C 1 29  ? 129.264 152.770 144.411 1.00 95.02  ? 29  ILE C CG1   1 
ATOM   7248  C CG2   . ILE C 1 29  ? 128.725 151.476 142.345 1.00 95.02  ? 29  ILE C CG2   1 
ATOM   7249  C CD1   . ILE C 1 29  ? 127.846 152.962 144.888 1.00 95.02  ? 29  ILE C CD1   1 
ATOM   7250  N N     . VAL C 1 30  ? 131.002 153.585 140.180 1.00 89.06  ? 30  VAL C N     1 
ATOM   7251  C CA    . VAL C 1 30  ? 131.082 153.401 138.737 1.00 89.06  ? 30  VAL C CA    1 
ATOM   7252  C C     . VAL C 1 30  ? 132.530 153.334 138.270 1.00 89.06  ? 30  VAL C C     1 
ATOM   7253  O O     . VAL C 1 30  ? 132.855 152.591 137.336 1.00 89.06  ? 30  VAL C O     1 
ATOM   7254  C CB    . VAL C 1 30  ? 130.300 154.516 138.021 1.00 89.06  ? 30  VAL C CB    1 
ATOM   7255  C CG1   . VAL C 1 30  ? 130.478 154.416 136.517 1.00 89.06  ? 30  VAL C CG1   1 
ATOM   7256  C CG2   . VAL C 1 30  ? 128.829 154.434 138.383 1.00 89.06  ? 30  VAL C CG2   1 
ATOM   7257  N N     . GLY C 1 31  ? 133.431 154.076 138.909 1.00 83.88  ? 31  GLY C N     1 
ATOM   7258  C CA    . GLY C 1 31  ? 134.750 154.244 138.343 1.00 83.88  ? 31  GLY C CA    1 
ATOM   7259  C C     . GLY C 1 31  ? 135.923 153.576 139.024 1.00 83.88  ? 31  GLY C C     1 
ATOM   7260  O O     . GLY C 1 31  ? 137.000 153.522 138.424 1.00 83.88  ? 31  GLY C O     1 
ATOM   7261  N N     . ARG C 1 32  ? 135.776 153.065 140.246 1.00 85.81  ? 32  ARG C N     1 
ATOM   7262  C CA    . ARG C 1 32  ? 136.976 152.635 140.955 1.00 85.81  ? 32  ARG C CA    1 
ATOM   7263  C C     . ARG C 1 32  ? 137.025 151.143 141.263 1.00 85.81  ? 32  ARG C C     1 
ATOM   7264  O O     . ARG C 1 32  ? 137.987 150.466 140.892 1.00 85.81  ? 32  ARG C O     1 
ATOM   7265  C CB    . ARG C 1 32  ? 137.122 153.421 142.258 1.00 85.81  ? 32  ARG C CB    1 
ATOM   7266  C CG    . ARG C 1 32  ? 138.391 153.094 143.022 1.00 85.81  ? 32  ARG C CG    1 
ATOM   7267  C CD    . ARG C 1 32  ? 138.535 153.962 144.259 1.00 85.81  ? 32  ARG C CD    1 
ATOM   7268  N NE    . ARG C 1 32  ? 138.765 155.362 143.920 1.00 85.81  ? 32  ARG C NE    1 
ATOM   7269  C CZ    . ARG C 1 32  ? 138.787 156.349 144.807 1.00 85.81  ? 32  ARG C CZ    1 
ATOM   7270  N NH1   . ARG C 1 32  ? 138.599 156.090 146.093 1.00 85.81  ? 32  ARG C NH1   1 
ATOM   7271  N NH2   . ARG C 1 32  ? 139.001 157.595 144.410 1.00 85.81  ? 32  ARG C NH2   1 
ATOM   7272  N N     . ALA C 1 33  ? 136.004 150.617 141.938 1.00 82.93  ? 33  ALA C N     1 
ATOM   7273  C CA    . ALA C 1 33  ? 136.144 149.291 142.531 1.00 82.93  ? 33  ALA C CA    1 
ATOM   7274  C C     . ALA C 1 33  ? 135.590 148.186 141.639 1.00 82.93  ? 33  ALA C C     1 
ATOM   7275  O O     . ALA C 1 33  ? 136.326 147.270 141.258 1.00 82.93  ? 33  ALA C O     1 
ATOM   7276  C CB    . ALA C 1 33  ? 135.461 149.256 143.897 1.00 82.93  ? 33  ALA C CB    1 
ATOM   7277  N N     . LEU C 1 34  ? 134.311 148.251 141.302 1.00 87.85  ? 34  LEU C N     1 
ATOM   7278  C CA    . LEU C 1 34  ? 133.640 147.112 140.685 1.00 87.85  ? 34  LEU C CA    1 
ATOM   7279  C C     . LEU C 1 34  ? 134.145 146.893 139.263 1.00 87.85  ? 34  LEU C C     1 
ATOM   7280  O O     . LEU C 1 34  ? 134.225 147.848 138.485 1.00 87.85  ? 34  LEU C O     1 
ATOM   7281  C CB    . LEU C 1 34  ? 132.134 147.327 140.672 1.00 87.85  ? 34  LEU C CB    1 
ATOM   7282  C CG    . LEU C 1 34  ? 131.484 147.358 142.053 1.00 87.85  ? 34  LEU C CG    1 
ATOM   7283  C CD1   . LEU C 1 34  ? 130.009 147.689 141.940 1.00 87.85  ? 34  LEU C CD1   1 
ATOM   7284  C CD2   . LEU C 1 34  ? 131.689 146.031 142.755 1.00 87.85  ? 34  LEU C CD2   1 
ATOM   7285  N N     . PRO C 1 35  ? 134.490 145.665 138.893 1.00 92.01  ? 35  PRO C N     1 
ATOM   7286  C CA    . PRO C 1 35  ? 134.906 145.385 137.517 1.00 92.01  ? 35  PRO C CA    1 
ATOM   7287  C C     . PRO C 1 35  ? 133.705 145.266 136.589 1.00 92.01  ? 35  PRO C C     1 
ATOM   7288  O O     . PRO C 1 35  ? 132.552 145.420 136.988 1.00 92.01  ? 35  PRO C O     1 
ATOM   7289  C CB    . PRO C 1 35  ? 135.638 144.049 137.642 1.00 92.01  ? 35  PRO C CB    1 
ATOM   7290  C CG    . PRO C 1 35  ? 134.983 143.390 138.802 1.00 92.01  ? 35  PRO C CG    1 
ATOM   7291  C CD    . PRO C 1 35  ? 134.630 144.488 139.764 1.00 92.01  ? 35  PRO C CD    1 
ATOM   7292  N N     . ASP C 1 36  ? 134.001 144.976 135.326 1.00 102.45 ? 36  ASP C N     1 
ATOM   7293  C CA    . ASP C 1 36  ? 132.989 144.839 134.290 1.00 102.45 ? 36  ASP C CA    1 
ATOM   7294  C C     . ASP C 1 36  ? 132.777 143.370 133.953 1.00 102.45 ? 36  ASP C C     1 
ATOM   7295  O O     . ASP C 1 36  ? 133.669 142.539 134.141 1.00 102.45 ? 36  ASP C O     1 
ATOM   7296  C CB    . ASP C 1 36  ? 133.389 145.607 133.029 1.00 102.45 ? 36  ASP C CB    1 
ATOM   7297  C CG    . ASP C 1 36  ? 133.363 147.106 133.232 1.00 102.45 ? 36  ASP C CG    1 
ATOM   7298  O OD1   . ASP C 1 36  ? 132.559 147.579 134.061 1.00 102.45 ? 36  ASP C OD1   1 
ATOM   7299  O OD2   . ASP C 1 36  ? 134.148 147.811 132.564 1.00 102.45 ? 36  ASP C OD2   1 
ATOM   7300  N N     . VAL C 1 37  ? 131.583 143.053 133.451 1.00 99.28  ? 37  VAL C N     1 
ATOM   7301  C CA    . VAL C 1 37  ? 131.290 141.673 133.077 1.00 99.28  ? 37  VAL C CA    1 
ATOM   7302  C C     . VAL C 1 37  ? 131.916 141.331 131.735 1.00 99.28  ? 37  VAL C C     1 
ATOM   7303  O O     . VAL C 1 37  ? 132.114 140.154 131.415 1.00 99.28  ? 37  VAL C O     1 
ATOM   7304  C CB    . VAL C 1 37  ? 129.772 141.427 133.058 1.00 99.28  ? 37  VAL C CB    1 
ATOM   7305  C CG1   . VAL C 1 37  ? 129.190 141.630 134.437 1.00 99.28  ? 37  VAL C CG1   1 
ATOM   7306  C CG2   . VAL C 1 37  ? 129.100 142.341 132.050 1.00 99.28  ? 37  VAL C CG2   1 
ATOM   7307  N N     . ARG C 1 38  ? 132.237 142.342 130.928 1.00 90.78  ? 38  ARG C N     1 
ATOM   7308  C CA    . ARG C 1 38  ? 132.688 142.069 129.570 1.00 90.78  ? 38  ARG C CA    1 
ATOM   7309  C C     . ARG C 1 38  ? 134.158 141.673 129.519 1.00 90.78  ? 38  ARG C C     1 
ATOM   7310  O O     . ARG C 1 38  ? 134.557 140.900 128.642 1.00 90.78  ? 38  ARG C O     1 
ATOM   7311  C CB    . ARG C 1 38  ? 132.419 143.278 128.676 1.00 90.78  ? 38  ARG C CB    1 
ATOM   7312  C CG    . ARG C 1 38  ? 130.946 143.457 128.358 1.00 90.78  ? 38  ARG C CG    1 
ATOM   7313  C CD    . ARG C 1 38  ? 130.694 144.671 127.490 1.00 90.78  ? 38  ARG C CD    1 
ATOM   7314  N NE    . ARG C 1 38  ? 130.876 145.916 128.227 1.00 90.78  ? 38  ARG C NE    1 
ATOM   7315  C CZ    . ARG C 1 38  ? 130.824 147.122 127.674 1.00 90.78  ? 38  ARG C CZ    1 
ATOM   7316  N NH1   . ARG C 1 38  ? 130.597 147.246 126.374 1.00 90.78  ? 38  ARG C NH1   1 
ATOM   7317  N NH2   . ARG C 1 38  ? 130.993 148.202 128.422 1.00 90.78  ? 38  ARG C NH2   1 
ATOM   7318  N N     . ASP C 1 39  ? 134.980 142.180 130.435 1.00 98.56  ? 39  ASP C N     1 
ATOM   7319  C CA    . ASP C 1 39  ? 136.389 141.808 130.462 1.00 98.56  ? 39  ASP C CA    1 
ATOM   7320  C C     . ASP C 1 39  ? 136.930 141.521 131.856 1.00 98.56  ? 39  ASP C C     1 
ATOM   7321  O O     . ASP C 1 39  ? 138.022 140.955 131.967 1.00 98.56  ? 39  ASP C O     1 
ATOM   7322  C CB    . ASP C 1 39  ? 137.245 142.894 129.802 1.00 98.56  ? 39  ASP C CB    1 
ATOM   7323  C CG    . ASP C 1 39  ? 137.148 144.225 130.513 1.00 98.56  ? 39  ASP C CG    1 
ATOM   7324  O OD1   . ASP C 1 39  ? 136.343 144.341 131.460 1.00 98.56  ? 39  ASP C OD1   1 
ATOM   7325  O OD2   . ASP C 1 39  ? 137.887 145.155 130.129 1.00 98.56  ? 39  ASP C OD2   1 
ATOM   7326  N N     . GLY C 1 40  ? 136.214 141.888 132.914 1.00 98.08  ? 40  GLY C N     1 
ATOM   7327  C CA    . GLY C 1 40  ? 136.702 141.654 134.258 1.00 98.08  ? 40  GLY C CA    1 
ATOM   7328  C C     . GLY C 1 40  ? 137.994 142.387 134.548 1.00 98.08  ? 40  GLY C C     1 
ATOM   7329  O O     . GLY C 1 40  ? 138.987 141.776 134.953 1.00 98.08  ? 40  GLY C O     1 
ATOM   7330  N N     . LEU C 1 41  ? 137.994 143.701 134.338 1.00 90.51  ? 41  LEU C N     1 
ATOM   7331  C CA    . LEU C 1 41  ? 139.185 144.515 134.521 1.00 90.51  ? 41  LEU C CA    1 
ATOM   7332  C C     . LEU C 1 41  ? 138.812 145.830 135.182 1.00 90.51  ? 41  LEU C C     1 
ATOM   7333  O O     . LEU C 1 41  ? 137.904 146.525 134.719 1.00 90.51  ? 41  LEU C O     1 
ATOM   7334  C CB    . LEU C 1 41  ? 139.879 144.783 133.183 1.00 90.51  ? 41  LEU C CB    1 
ATOM   7335  C CG    . LEU C 1 41  ? 140.498 143.568 132.501 1.00 90.51  ? 41  LEU C CG    1 
ATOM   7336  C CD1   . LEU C 1 41  ? 141.014 143.943 131.127 1.00 90.51  ? 41  LEU C CD1   1 
ATOM   7337  C CD2   . LEU C 1 41  ? 141.613 143.006 133.360 1.00 90.51  ? 41  LEU C CD2   1 
ATOM   7338  N N     . LYS C 1 42  ? 139.512 146.165 136.260 1.00 89.10  ? 42  LYS C N     1 
ATOM   7339  C CA    . LYS C 1 42  ? 139.369 147.480 136.852 1.00 89.10  ? 42  LYS C CA    1 
ATOM   7340  C C     . LYS C 1 42  ? 140.005 148.524 135.935 1.00 89.10  ? 42  LYS C C     1 
ATOM   7341  O O     . LYS C 1 42  ? 140.904 148.206 135.152 1.00 89.10  ? 42  LYS C O     1 
ATOM   7342  C CB    . LYS C 1 42  ? 140.028 147.517 138.225 1.00 89.10  ? 42  LYS C CB    1 
ATOM   7343  C CG    . LYS C 1 42  ? 139.346 146.646 139.264 1.00 89.10  ? 42  LYS C CG    1 
ATOM   7344  C CD    . LYS C 1 42  ? 140.068 146.735 140.596 1.00 89.10  ? 42  LYS C CD    1 
ATOM   7345  C CE    . LYS C 1 42  ? 139.421 145.848 141.641 1.00 89.10  ? 42  LYS C CE    1 
ATOM   7346  N NZ    . LYS C 1 42  ? 140.152 145.910 142.936 1.00 89.10  ? 42  LYS C NZ    1 
ATOM   7347  N N     . PRO C 1 43  ? 139.550 149.777 136.005 1.00 87.43  ? 43  PRO C N     1 
ATOM   7348  C CA    . PRO C 1 43  ? 140.107 150.802 135.107 1.00 87.43  ? 43  PRO C CA    1 
ATOM   7349  C C     . PRO C 1 43  ? 141.607 150.991 135.247 1.00 87.43  ? 43  PRO C C     1 
ATOM   7350  O O     . PRO C 1 43  ? 142.274 151.330 134.260 1.00 87.43  ? 43  PRO C O     1 
ATOM   7351  C CB    . PRO C 1 43  ? 139.336 152.066 135.509 1.00 87.43  ? 43  PRO C CB    1 
ATOM   7352  C CG    . PRO C 1 43  ? 138.062 151.555 136.083 1.00 87.43  ? 43  PRO C CG    1 
ATOM   7353  C CD    . PRO C 1 43  ? 138.422 150.292 136.797 1.00 87.43  ? 43  PRO C CD    1 
ATOM   7354  N N     . VAL C 1 44  ? 142.161 150.775 136.440 1.00 84.14  ? 44  VAL C N     1 
ATOM   7355  C CA    . VAL C 1 44  ? 143.601 150.930 136.630 1.00 84.14  ? 44  VAL C CA    1 
ATOM   7356  C C     . VAL C 1 44  ? 144.360 149.925 135.774 1.00 84.14  ? 44  VAL C C     1 
ATOM   7357  O O     . VAL C 1 44  ? 145.309 150.277 135.061 1.00 84.14  ? 44  VAL C O     1 
ATOM   7358  C CB    . VAL C 1 44  ? 143.962 150.787 138.118 1.00 84.14  ? 44  VAL C CB    1 
ATOM   7359  C CG1   . VAL C 1 44  ? 145.464 150.821 138.300 1.00 84.14  ? 44  VAL C CG1   1 
ATOM   7360  C CG2   . VAL C 1 44  ? 143.298 151.884 138.929 1.00 84.14  ? 44  VAL C CG2   1 
ATOM   7361  N N     . HIS C 1 45  ? 143.960 148.653 135.846 1.00 87.92  ? 45  HIS C N     1 
ATOM   7362  C CA    . HIS C 1 45  ? 144.590 147.628 135.022 1.00 87.92  ? 45  HIS C CA    1 
ATOM   7363  C C     . HIS C 1 45  ? 144.454 147.963 133.545 1.00 87.92  ? 45  HIS C C     1 
ATOM   7364  O O     . HIS C 1 45  ? 145.399 147.787 132.766 1.00 87.92  ? 45  HIS C O     1 
ATOM   7365  C CB    . HIS C 1 45  ? 143.967 146.266 135.318 1.00 87.92  ? 45  HIS C CB    1 
ATOM   7366  C CG    . HIS C 1 45  ? 144.161 145.806 136.729 1.00 87.92  ? 45  HIS C CG    1 
ATOM   7367  N ND1   . HIS C 1 45  ? 143.264 146.093 137.734 1.00 87.92  ? 45  HIS C ND1   1 
ATOM   7368  C CD2   . HIS C 1 45  ? 145.151 145.084 137.303 1.00 87.92  ? 45  HIS C CD2   1 
ATOM   7369  C CE1   . HIS C 1 45  ? 143.691 145.564 138.867 1.00 87.92  ? 45  HIS C CE1   1 
ATOM   7370  N NE2   . HIS C 1 45  ? 144.834 144.947 138.632 1.00 87.92  ? 45  HIS C NE2   1 
ATOM   7371  N N     . ARG C 1 46  ? 143.279 148.452 133.150 1.00 91.97  ? 46  ARG C N     1 
ATOM   7372  C CA    . ARG C 1 46  ? 143.055 148.853 131.768 1.00 91.97  ? 46  ARG C CA    1 
ATOM   7373  C C     . ARG C 1 46  ? 144.067 149.895 131.320 1.00 91.97  ? 46  ARG C C     1 
ATOM   7374  O O     . ARG C 1 46  ? 144.722 149.732 130.282 1.00 91.97  ? 46  ARG C O     1 
ATOM   7375  C CB    . ARG C 1 46  ? 141.642 149.403 131.623 1.00 91.97  ? 46  ARG C CB    1 
ATOM   7376  C CG    . ARG C 1 46  ? 141.269 149.775 130.219 1.00 91.97  ? 46  ARG C CG    1 
ATOM   7377  C CD    . ARG C 1 46  ? 139.857 150.312 130.183 1.00 91.97  ? 46  ARG C CD    1 
ATOM   7378  N NE    . ARG C 1 46  ? 138.928 149.357 130.770 1.00 91.97  ? 46  ARG C NE    1 
ATOM   7379  C CZ    . ARG C 1 46  ? 138.524 148.253 130.159 1.00 91.97  ? 46  ARG C CZ    1 
ATOM   7380  N NH1   . ARG C 1 46  ? 137.669 147.434 130.754 1.00 91.97  ? 46  ARG C NH1   1 
ATOM   7381  N NH2   . ARG C 1 46  ? 138.999 147.960 128.958 1.00 91.97  ? 46  ARG C NH2   1 
ATOM   7382  N N     . ARG C 1 47  ? 144.194 150.980 132.080 1.00 91.50  ? 47  ARG C N     1 
ATOM   7383  C CA    . ARG C 1 47  ? 145.075 152.062 131.664 1.00 91.50  ? 47  ARG C CA    1 
ATOM   7384  C C     . ARG C 1 47  ? 146.530 151.619 131.673 1.00 91.50  ? 47  ARG C C     1 
ATOM   7385  O O     . ARG C 1 47  ? 147.306 152.006 130.792 1.00 91.50  ? 47  ARG C O     1 
ATOM   7386  C CB    . ARG C 1 47  ? 144.860 153.276 132.561 1.00 91.50  ? 47  ARG C CB    1 
ATOM   7387  C CG    . ARG C 1 47  ? 143.478 153.876 132.405 1.00 91.50  ? 47  ARG C CG    1 
ATOM   7388  C CD    . ARG C 1 47  ? 143.274 155.056 133.327 1.00 91.50  ? 47  ARG C CD    1 
ATOM   7389  N NE    . ARG C 1 47  ? 141.925 155.598 133.218 1.00 91.50  ? 47  ARG C NE    1 
ATOM   7390  C CZ    . ARG C 1 47  ? 141.459 156.590 133.967 1.00 91.50  ? 47  ARG C CZ    1 
ATOM   7391  N NH1   . ARG C 1 47  ? 142.235 157.153 134.883 1.00 91.50  ? 47  ARG C NH1   1 
ATOM   7392  N NH2   . ARG C 1 47  ? 140.216 157.021 133.802 1.00 91.50  ? 47  ARG C NH2   1 
ATOM   7393  N N     . VAL C 1 48  ? 146.915 150.783 132.640 1.00 90.18  ? 48  VAL C N     1 
ATOM   7394  C CA    . VAL C 1 48  ? 148.290 150.295 132.675 1.00 90.18  ? 48  VAL C CA    1 
ATOM   7395  C C     . VAL C 1 48  ? 148.597 149.454 131.441 1.00 90.18  ? 48  VAL C C     1 
ATOM   7396  O O     . VAL C 1 48  ? 149.638 149.633 130.793 1.00 90.18  ? 48  VAL C O     1 
ATOM   7397  C CB    . VAL C 1 48  ? 148.547 149.513 133.973 1.00 90.18  ? 48  VAL C CB    1 
ATOM   7398  C CG1   . VAL C 1 48  ? 149.898 148.841 133.920 1.00 90.18  ? 48  VAL C CG1   1 
ATOM   7399  C CG2   . VAL C 1 48  ? 148.478 150.447 135.161 1.00 90.18  ? 48  VAL C CG2   1 
ATOM   7400  N N     . LEU C 1 49  ? 147.705 148.522 131.098 1.00 92.69  ? 49  LEU C N     1 
ATOM   7401  C CA    . LEU C 1 49  ? 147.939 147.692 129.920 1.00 92.69  ? 49  LEU C CA    1 
ATOM   7402  C C     . LEU C 1 49  ? 147.977 148.532 128.652 1.00 92.69  ? 49  LEU C C     1 
ATOM   7403  O O     . LEU C 1 49  ? 148.823 148.312 127.775 1.00 92.69  ? 49  LEU C O     1 
ATOM   7404  C CB    . LEU C 1 49  ? 146.868 146.609 129.815 1.00 92.69  ? 49  LEU C CB    1 
ATOM   7405  C CG    . LEU C 1 49  ? 146.912 145.540 130.903 1.00 92.69  ? 49  LEU C CG    1 
ATOM   7406  C CD1   . LEU C 1 49  ? 145.739 144.589 130.768 1.00 92.69  ? 49  LEU C CD1   1 
ATOM   7407  C CD2   . LEU C 1 49  ? 148.225 144.789 130.836 1.00 92.69  ? 49  LEU C CD2   1 
ATOM   7408  N N     . TYR C 1 50  ? 147.071 149.505 128.537 1.00 95.62  ? 50  TYR C N     1 
ATOM   7409  C CA    . TYR C 1 50  ? 147.064 150.347 127.347 1.00 95.62  ? 50  TYR C CA    1 
ATOM   7410  C C     . TYR C 1 50  ? 148.353 151.147 127.234 1.00 95.62  ? 50  TYR C C     1 
ATOM   7411  O O     . TYR C 1 50  ? 148.900 151.303 126.136 1.00 95.62  ? 50  TYR C O     1 
ATOM   7412  C CB    . TYR C 1 50  ? 145.855 151.277 127.359 1.00 95.62  ? 50  TYR C CB    1 
ATOM   7413  C CG    . TYR C 1 50  ? 145.775 152.147 126.132 1.00 95.62  ? 50  TYR C CG    1 
ATOM   7414  C CD1   . TYR C 1 50  ? 145.400 151.617 124.910 1.00 95.62  ? 50  TYR C CD1   1 
ATOM   7415  C CD2   . TYR C 1 50  ? 146.079 153.497 126.195 1.00 95.62  ? 50  TYR C CD2   1 
ATOM   7416  C CE1   . TYR C 1 50  ? 145.329 152.405 123.784 1.00 95.62  ? 50  TYR C CE1   1 
ATOM   7417  C CE2   . TYR C 1 50  ? 146.009 154.294 125.074 1.00 95.62  ? 50  TYR C CE2   1 
ATOM   7418  C CZ    . TYR C 1 50  ? 145.633 153.743 123.871 1.00 95.62  ? 50  TYR C CZ    1 
ATOM   7419  O OH    . TYR C 1 50  ? 145.562 154.533 122.749 1.00 95.62  ? 50  TYR C OH    1 
ATOM   7420  N N     . ALA C 1 51  ? 148.860 151.656 128.358 1.00 90.39  ? 51  ALA C N     1 
ATOM   7421  C CA    . ALA C 1 51  ? 150.112 152.402 128.321 1.00 90.39  ? 51  ALA C CA    1 
ATOM   7422  C C     . ALA C 1 51  ? 151.272 151.504 127.920 1.00 90.39  ? 51  ALA C C     1 
ATOM   7423  O O     . ALA C 1 51  ? 152.124 151.900 127.114 1.00 90.39  ? 51  ALA C O     1 
ATOM   7424  C CB    . ALA C 1 51  ? 150.377 153.052 129.677 1.00 90.39  ? 51  ALA C CB    1 
ATOM   7425  N N     . MET C 1 52  ? 151.324 150.290 128.471 1.00 97.52  ? 52  MET C N     1 
ATOM   7426  C CA    . MET C 1 52  ? 152.397 149.373 128.102 1.00 97.52  ? 52  MET C CA    1 
ATOM   7427  C C     . MET C 1 52  ? 152.339 149.022 126.623 1.00 97.52  ? 52  MET C C     1 
ATOM   7428  O O     . MET C 1 52  ? 153.379 148.838 125.981 1.00 97.52  ? 52  MET C O     1 
ATOM   7429  C CB    . MET C 1 52  ? 152.334 148.103 128.948 1.00 97.52  ? 52  MET C CB    1 
ATOM   7430  C CG    . MET C 1 52  ? 152.727 148.290 130.395 1.00 97.52  ? 52  MET C CG    1 
ATOM   7431  S SD    . MET C 1 52  ? 152.673 146.725 131.282 1.00 97.52  ? 52  MET C SD    1 
ATOM   7432  C CE    . MET C 1 52  ? 153.066 147.261 132.940 1.00 97.52  ? 52  MET C CE    1 
ATOM   7433  N N     . ASN C 1 53  ? 151.134 148.920 126.063 1.00 100.29 ? 53  ASN C N     1 
ATOM   7434  C CA    . ASN C 1 53  ? 151.031 148.597 124.645 1.00 100.29 ? 53  ASN C CA    1 
ATOM   7435  C C     . ASN C 1 53  ? 151.438 149.785 123.782 1.00 100.29 ? 53  ASN C C     1 
ATOM   7436  O O     . ASN C 1 53  ? 152.128 149.619 122.769 1.00 100.29 ? 53  ASN C O     1 
ATOM   7437  C CB    . ASN C 1 53  ? 149.614 148.148 124.303 1.00 100.29 ? 53  ASN C CB    1 
ATOM   7438  C CG    . ASN C 1 53  ? 149.521 147.517 122.928 1.00 100.29 ? 53  ASN C CG    1 
ATOM   7439  O OD1   . ASN C 1 53  ? 150.517 147.400 122.217 1.00 100.29 ? 53  ASN C OD1   1 
ATOM   7440  N ND2   . ASN C 1 53  ? 148.318 147.107 122.547 1.00 100.29 ? 53  ASN C ND2   1 
ATOM   7441  N N     . VAL C 1 54  ? 151.021 150.993 124.166 1.00 99.58  ? 54  VAL C N     1 
ATOM   7442  C CA    . VAL C 1 54  ? 151.367 152.180 123.388 1.00 99.58  ? 54  VAL C CA    1 
ATOM   7443  C C     . VAL C 1 54  ? 152.870 152.417 123.413 1.00 99.58  ? 54  VAL C C     1 
ATOM   7444  O O     . VAL C 1 54  ? 153.469 152.813 122.406 1.00 99.58  ? 54  VAL C O     1 
ATOM   7445  C CB    . VAL C 1 54  ? 150.594 153.407 123.904 1.00 99.58  ? 54  VAL C CB    1 
ATOM   7446  C CG1   . VAL C 1 54  ? 151.102 154.673 123.241 1.00 99.58  ? 54  VAL C CG1   1 
ATOM   7447  C CG2   . VAL C 1 54  ? 149.111 153.243 123.635 1.00 99.58  ? 54  VAL C CG2   1 
ATOM   7448  N N     . LEU C 1 55  ? 153.505 152.174 124.560 1.00 99.93  ? 55  LEU C N     1 
ATOM   7449  C CA    . LEU C 1 55  ? 154.947 152.376 124.652 1.00 99.93  ? 55  LEU C CA    1 
ATOM   7450  C C     . LEU C 1 55  ? 155.696 151.417 123.734 1.00 99.93  ? 55  LEU C C     1 
ATOM   7451  O O     . LEU C 1 55  ? 156.782 151.740 123.240 1.00 99.93  ? 55  LEU C O     1 
ATOM   7452  C CB    . LEU C 1 55  ? 155.402 152.219 126.103 1.00 99.93  ? 55  LEU C CB    1 
ATOM   7453  C CG    . LEU C 1 55  ? 156.840 152.603 126.456 1.00 99.93  ? 55  LEU C CG    1 
ATOM   7454  C CD1   . LEU C 1 55  ? 156.896 153.130 127.875 1.00 99.93  ? 55  LEU C CD1   1 
ATOM   7455  C CD2   . LEU C 1 55  ? 157.782 151.419 126.307 1.00 99.93  ? 55  LEU C CD2   1 
ATOM   7456  N N     . GLY C 1 56  ? 155.134 150.237 123.491 1.00 102.64 ? 56  GLY C N     1 
ATOM   7457  C CA    . GLY C 1 56  ? 155.755 149.288 122.589 1.00 102.64 ? 56  GLY C CA    1 
ATOM   7458  C C     . GLY C 1 56  ? 156.649 148.290 123.293 1.00 102.64 ? 56  GLY C C     1 
ATOM   7459  O O     . GLY C 1 56  ? 157.766 148.017 122.842 1.00 102.64 ? 56  GLY C O     1 
ATOM   7460  N N     . ASN C 1 57  ? 156.169 147.739 124.406 1.00 107.26 ? 57  ASN C N     1 
ATOM   7461  C CA    . ASN C 1 57  ? 156.941 146.788 125.201 1.00 107.26 ? 57  ASN C CA    1 
ATOM   7462  C C     . ASN C 1 57  ? 156.277 145.418 125.095 1.00 107.26 ? 57  ASN C C     1 
ATOM   7463  O O     . ASN C 1 57  ? 155.419 145.044 125.893 1.00 107.26 ? 57  ASN C O     1 
ATOM   7464  C CB    . ASN C 1 57  ? 157.044 147.264 126.644 1.00 107.26 ? 57  ASN C CB    1 
ATOM   7465  C CG    . ASN C 1 57  ? 158.012 146.440 127.460 1.00 107.26 ? 57  ASN C CG    1 
ATOM   7466  O OD1   . ASN C 1 57  ? 158.594 145.476 126.967 1.00 107.26 ? 57  ASN C OD1   1 
ATOM   7467  N ND2   . ASN C 1 57  ? 158.196 146.819 128.718 1.00 107.26 ? 57  ASN C ND2   1 
ATOM   7468  N N     . ASP C 1 58  ? 156.695 144.657 124.088 1.00 110.54 ? 58  ASP C N     1 
ATOM   7469  C CA    . ASP C 1 58  ? 156.154 143.326 123.869 1.00 110.54 ? 58  ASP C CA    1 
ATOM   7470  C C     . ASP C 1 58  ? 156.904 142.301 124.717 1.00 110.54 ? 58  ASP C C     1 
ATOM   7471  O O     . ASP C 1 58  ? 157.752 142.638 125.547 1.00 110.54 ? 58  ASP C O     1 
ATOM   7472  C CB    . ASP C 1 58  ? 156.211 142.968 122.388 1.00 110.54 ? 58  ASP C CB    1 
ATOM   7473  C CG    . ASP C 1 58  ? 155.229 143.770 121.561 1.00 110.54 ? 58  ASP C CG    1 
ATOM   7474  O OD1   . ASP C 1 58  ? 154.178 144.164 122.106 1.00 110.54 ? 58  ASP C OD1   1 
ATOM   7475  O OD2   . ASP C 1 58  ? 155.507 144.005 120.367 1.00 110.54 ? 58  ASP C OD2   1 
ATOM   7476  N N     . TRP C 1 59  ? 156.585 141.023 124.506 1.00 99.86  ? 59  TRP C N     1 
ATOM   7477  C CA    . TRP C 1 59  ? 157.163 139.972 125.335 1.00 99.86  ? 59  TRP C CA    1 
ATOM   7478  C C     . TRP C 1 59  ? 158.535 139.539 124.835 1.00 99.86  ? 59  TRP C C     1 
ATOM   7479  O O     . TRP C 1 59  ? 159.398 139.165 125.637 1.00 99.86  ? 59  TRP C O     1 
ATOM   7480  C CB    . TRP C 1 59  ? 156.220 138.771 125.393 1.00 99.86  ? 59  TRP C CB    1 
ATOM   7481  C CG    . TRP C 1 59  ? 155.963 138.136 124.065 1.00 99.86  ? 59  TRP C CG    1 
ATOM   7482  C CD1   . TRP C 1 59  ? 154.963 138.441 123.192 1.00 99.86  ? 59  TRP C CD1   1 
ATOM   7483  C CD2   . TRP C 1 59  ? 156.719 137.084 123.458 1.00 99.86  ? 59  TRP C CD2   1 
ATOM   7484  N NE1   . TRP C 1 59  ? 155.047 137.643 122.079 1.00 99.86  ? 59  TRP C NE1   1 
ATOM   7485  C CE2   . TRP C 1 59  ? 156.117 136.801 122.218 1.00 99.86  ? 59  TRP C CE2   1 
ATOM   7486  C CE3   . TRP C 1 59  ? 157.845 136.353 123.844 1.00 99.86  ? 59  TRP C CE3   1 
ATOM   7487  C CZ2   . TRP C 1 59  ? 156.604 135.821 121.360 1.00 99.86  ? 59  TRP C CZ2   1 
ATOM   7488  C CZ3   . TRP C 1 59  ? 158.327 135.381 122.990 1.00 99.86  ? 59  TRP C CZ3   1 
ATOM   7489  C CH2   . TRP C 1 59  ? 157.706 135.123 121.764 1.00 99.86  ? 59  TRP C CH2   1 
ATOM   7490  N N     . ASN C 1 60  ? 158.757 139.579 123.521 1.00 107.51 ? 60  ASN C N     1 
ATOM   7491  C CA    . ASN C 1 60  ? 160.002 139.113 122.922 1.00 107.51 ? 60  ASN C CA    1 
ATOM   7492  C C     . ASN C 1 60  ? 161.063 140.203 122.835 1.00 107.51 ? 60  ASN C C     1 
ATOM   7493  O O     . ASN C 1 60  ? 161.972 140.111 121.999 1.00 107.51 ? 60  ASN C O     1 
ATOM   7494  C CB    . ASN C 1 60  ? 159.724 138.524 121.539 1.00 107.51 ? 60  ASN C CB    1 
ATOM   7495  C CG    . ASN C 1 60  ? 159.080 139.523 120.599 1.00 107.51 ? 60  ASN C CG    1 
ATOM   7496  O OD1   . ASN C 1 60  ? 158.901 140.691 120.940 1.00 107.51 ? 60  ASN C OD1   1 
ATOM   7497  N ND2   . ASN C 1 60  ? 158.731 139.066 119.404 1.00 107.51 ? 60  ASN C ND2   1 
ATOM   7498  N N     . LYS C 1 61  ? 160.976 141.230 123.672 1.00 104.10 ? 61  LYS C N     1 
ATOM   7499  C CA    . LYS C 1 61  ? 161.939 142.318 123.684 1.00 104.10 ? 61  LYS C CA    1 
ATOM   7500  C C     . LYS C 1 61  ? 162.648 142.370 125.029 1.00 104.10 ? 61  LYS C C     1 
ATOM   7501  O O     . LYS C 1 61  ? 162.350 141.599 125.945 1.00 104.10 ? 61  LYS C O     1 
ATOM   7502  C CB    . LYS C 1 61  ? 161.262 143.662 123.399 1.00 104.10 ? 61  LYS C CB    1 
ATOM   7503  C CG    . LYS C 1 61  ? 160.717 143.795 121.991 1.00 104.10 ? 61  LYS C CG    1 
ATOM   7504  C CD    . LYS C 1 61  ? 160.084 145.158 121.791 1.00 104.10 ? 61  LYS C CD    1 
ATOM   7505  C CE    . LYS C 1 61  ? 159.512 145.307 120.395 1.00 104.10 ? 61  LYS C CE    1 
ATOM   7506  N NZ    . LYS C 1 61  ? 158.875 146.639 120.213 1.00 104.10 ? 61  LYS C NZ    1 
ATOM   7507  N N     . ALA C 1 62  ? 163.600 143.292 125.139 1.00 99.27  ? 62  ALA C N     1 
ATOM   7508  C CA    . ALA C 1 62  ? 164.340 143.450 126.379 1.00 99.27  ? 62  ALA C CA    1 
ATOM   7509  C C     . ALA C 1 62  ? 163.462 144.090 127.450 1.00 99.27  ? 62  ALA C C     1 
ATOM   7510  O O     . ALA C 1 62  ? 162.462 144.753 127.162 1.00 99.27  ? 62  ALA C O     1 
ATOM   7511  C CB    . ALA C 1 62  ? 165.592 144.294 126.153 1.00 99.27  ? 62  ALA C CB    1 
ATOM   7512  N N     . TYR C 1 63  ? 163.854 143.886 128.704 1.00 97.48  ? 63  TYR C N     1 
ATOM   7513  C CA    . TYR C 1 63  ? 163.099 144.419 129.824 1.00 97.48  ? 63  TYR C CA    1 
ATOM   7514  C C     . TYR C 1 63  ? 163.248 145.936 129.898 1.00 97.48  ? 63  TYR C C     1 
ATOM   7515  O O     . TYR C 1 63  ? 164.057 146.548 129.196 1.00 97.48  ? 63  TYR C O     1 
ATOM   7516  C CB    . TYR C 1 63  ? 163.560 143.779 131.131 1.00 97.48  ? 63  TYR C CB    1 
ATOM   7517  C CG    . TYR C 1 63  ? 163.250 142.307 131.232 1.00 97.48  ? 63  TYR C CG    1 
ATOM   7518  C CD1   . TYR C 1 63  ? 161.988 141.867 131.599 1.00 97.48  ? 63  TYR C CD1   1 
ATOM   7519  C CD2   . TYR C 1 63  ? 164.220 141.355 130.958 1.00 97.48  ? 63  TYR C CD2   1 
ATOM   7520  C CE1   . TYR C 1 63  ? 161.702 140.522 131.694 1.00 97.48  ? 63  TYR C CE1   1 
ATOM   7521  C CE2   . TYR C 1 63  ? 163.941 140.008 131.048 1.00 97.48  ? 63  TYR C CE2   1 
ATOM   7522  C CZ    . TYR C 1 63  ? 162.681 139.597 131.416 1.00 97.48  ? 63  TYR C CZ    1 
ATOM   7523  O OH    . TYR C 1 63  ? 162.400 138.256 131.507 1.00 97.48  ? 63  TYR C OH    1 
ATOM   7524  N N     . LYS C 1 64  ? 162.447 146.545 130.769 1.00 94.23  ? 64  LYS C N     1 
ATOM   7525  C CA    . LYS C 1 64  ? 162.471 147.985 130.974 1.00 94.23  ? 64  LYS C CA    1 
ATOM   7526  C C     . LYS C 1 64  ? 162.289 148.283 132.453 1.00 94.23  ? 64  LYS C C     1 
ATOM   7527  O O     . LYS C 1 64  ? 161.711 147.486 133.195 1.00 94.23  ? 64  LYS C O     1 
ATOM   7528  C CB    . LYS C 1 64  ? 161.380 148.690 130.160 1.00 94.23  ? 64  LYS C CB    1 
ATOM   7529  C CG    . LYS C 1 64  ? 161.589 148.613 128.661 1.00 94.23  ? 64  LYS C CG    1 
ATOM   7530  C CD    . LYS C 1 64  ? 160.512 149.364 127.906 1.00 94.23  ? 64  LYS C CD    1 
ATOM   7531  C CE    . LYS C 1 64  ? 160.696 149.203 126.407 1.00 94.23  ? 64  LYS C CE    1 
ATOM   7532  N NZ    . LYS C 1 64  ? 161.938 149.872 125.929 1.00 94.23  ? 64  LYS C NZ    1 
ATOM   7533  N N     . LYS C 1 65  ? 162.788 149.441 132.875 1.00 92.48  ? 65  LYS C N     1 
ATOM   7534  C CA    . LYS C 1 65  ? 162.674 149.834 134.270 1.00 92.48  ? 65  LYS C CA    1 
ATOM   7535  C C     . LYS C 1 65  ? 161.243 150.238 134.604 1.00 92.48  ? 65  LYS C C     1 
ATOM   7536  O O     . LYS C 1 65  ? 160.507 150.759 133.764 1.00 92.48  ? 65  LYS C O     1 
ATOM   7537  C CB    . LYS C 1 65  ? 163.623 150.987 134.581 1.00 92.48  ? 65  LYS C CB    1 
ATOM   7538  C CG    . LYS C 1 65  ? 165.087 150.634 134.433 1.00 92.48  ? 65  LYS C CG    1 
ATOM   7539  C CD    . LYS C 1 65  ? 165.512 149.649 135.505 1.00 92.48  ? 65  LYS C CD    1 
ATOM   7540  C CE    . LYS C 1 65  ? 166.984 149.307 135.387 1.00 92.48  ? 65  LYS C CE    1 
ATOM   7541  N NZ    . LYS C 1 65  ? 167.843 150.474 135.724 1.00 92.48  ? 65  LYS C NZ    1 
ATOM   7542  N N     . SER C 1 66  ? 160.856 149.993 135.856 1.00 93.91  ? 66  SER C N     1 
ATOM   7543  C CA    . SER C 1 66  ? 159.497 150.304 136.285 1.00 93.91  ? 66  SER C CA    1 
ATOM   7544  C C     . SER C 1 66  ? 159.237 151.802 136.297 1.00 93.91  ? 66  SER C C     1 
ATOM   7545  O O     . SER C 1 66  ? 158.087 152.232 136.144 1.00 93.91  ? 66  SER C O     1 
ATOM   7546  C CB    . SER C 1 66  ? 159.240 149.718 137.671 1.00 93.91  ? 66  SER C CB    1 
ATOM   7547  O OG    . SER C 1 66  ? 159.337 148.307 137.652 1.00 93.91  ? 66  SER C OG    1 
ATOM   7548  N N     . ALA C 1 67  ? 160.287 152.605 136.481 1.00 93.93  ? 67  ALA C N     1 
ATOM   7549  C CA    . ALA C 1 67  ? 160.109 154.047 136.599 1.00 93.93  ? 67  ALA C CA    1 
ATOM   7550  C C     . ALA C 1 67  ? 159.486 154.634 135.343 1.00 93.93  ? 67  ALA C C     1 
ATOM   7551  O O     . ALA C 1 67  ? 158.604 155.495 135.426 1.00 93.93  ? 67  ALA C O     1 
ATOM   7552  C CB    . ALA C 1 67  ? 161.447 154.719 136.896 1.00 93.93  ? 67  ALA C CB    1 
ATOM   7553  N N     . ARG C 1 68  ? 159.927 154.180 134.169 1.00 87.10  ? 68  ARG C N     1 
ATOM   7554  C CA    . ARG C 1 68  ? 159.374 154.694 132.920 1.00 87.10  ? 68  ARG C CA    1 
ATOM   7555  C C     . ARG C 1 68  ? 157.870 154.467 132.852 1.00 87.10  ? 68  ARG C C     1 
ATOM   7556  O O     . ARG C 1 68  ? 157.099 155.402 132.605 1.00 87.10  ? 68  ARG C O     1 
ATOM   7557  C CB    . ARG C 1 68  ? 160.069 154.034 131.730 1.00 87.10  ? 68  ARG C CB    1 
ATOM   7558  C CG    . ARG C 1 68  ? 161.520 154.432 131.557 1.00 87.10  ? 68  ARG C CG    1 
ATOM   7559  C CD    . ARG C 1 68  ? 162.156 153.668 130.411 1.00 87.10  ? 68  ARG C CD    1 
ATOM   7560  N NE    . ARG C 1 68  ? 161.504 153.955 129.138 1.00 87.10  ? 68  ARG C NE    1 
ATOM   7561  C CZ    . ARG C 1 68  ? 161.824 154.975 128.349 1.00 87.10  ? 68  ARG C CZ    1 
ATOM   7562  N NH1   . ARG C 1 68  ? 162.787 155.812 128.704 1.00 87.10  ? 68  ARG C NH1   1 
ATOM   7563  N NH2   . ARG C 1 68  ? 161.179 155.161 127.207 1.00 87.10  ? 68  ARG C NH2   1 
ATOM   7564  N N     . VAL C 1 69  ? 157.435 153.227 133.079 1.00 86.16  ? 69  VAL C N     1 
ATOM   7565  C CA    . VAL C 1 69  ? 156.019 152.900 132.962 1.00 86.16  ? 69  VAL C CA    1 
ATOM   7566  C C     . VAL C 1 69  ? 155.206 153.650 134.008 1.00 86.16  ? 69  VAL C C     1 
ATOM   7567  O O     . VAL C 1 69  ? 154.141 154.205 133.706 1.00 86.16  ? 69  VAL C O     1 
ATOM   7568  C CB    . VAL C 1 69  ? 155.816 151.380 133.073 1.00 86.16  ? 69  VAL C CB    1 
ATOM   7569  C CG1   . VAL C 1 69  ? 154.339 151.042 133.036 1.00 86.16  ? 69  VAL C CG1   1 
ATOM   7570  C CG2   . VAL C 1 69  ? 156.560 150.669 131.961 1.00 86.16  ? 69  VAL C CG2   1 
ATOM   7571  N N     . VAL C 1 70  ? 155.689 153.678 135.251 1.00 88.16  ? 70  VAL C N     1 
ATOM   7572  C CA    . VAL C 1 70  ? 154.942 154.344 136.315 1.00 88.16  ? 70  VAL C CA    1 
ATOM   7573  C C     . VAL C 1 70  ? 154.800 155.830 136.013 1.00 88.16  ? 70  VAL C C     1 
ATOM   7574  O O     . VAL C 1 70  ? 153.707 156.401 136.117 1.00 88.16  ? 70  VAL C O     1 
ATOM   7575  C CB    . VAL C 1 70  ? 155.615 154.106 137.676 1.00 88.16  ? 70  VAL C CB    1 
ATOM   7576  C CG1   . VAL C 1 70  ? 154.937 154.932 138.749 1.00 88.16  ? 70  VAL C CG1   1 
ATOM   7577  C CG2   . VAL C 1 70  ? 155.557 152.635 138.034 1.00 88.16  ? 70  VAL C CG2   1 
ATOM   7578  N N     . GLY C 1 71  ? 155.902 156.476 135.629 1.00 88.66  ? 71  GLY C N     1 
ATOM   7579  C CA    . GLY C 1 71  ? 155.841 157.889 135.311 1.00 88.66  ? 71  GLY C CA    1 
ATOM   7580  C C     . GLY C 1 71  ? 154.929 158.182 134.139 1.00 88.66  ? 71  GLY C C     1 
ATOM   7581  O O     . GLY C 1 71  ? 154.172 159.153 134.160 1.00 88.66  ? 71  GLY C O     1 
ATOM   7582  N N     . ASP C 1 72  ? 154.970 157.336 133.109 1.00 91.75  ? 72  ASP C N     1 
ATOM   7583  C CA    . ASP C 1 72  ? 154.111 157.563 131.953 1.00 91.75  ? 72  ASP C CA    1 
ATOM   7584  C C     . ASP C 1 72  ? 152.640 157.432 132.327 1.00 91.75  ? 72  ASP C C     1 
ATOM   7585  O O     . ASP C 1 72  ? 151.808 158.252 131.913 1.00 91.75  ? 72  ASP C O     1 
ATOM   7586  C CB    . ASP C 1 72  ? 154.472 156.588 130.837 1.00 91.75  ? 72  ASP C CB    1 
ATOM   7587  C CG    . ASP C 1 72  ? 153.764 156.905 129.544 1.00 91.75  ? 72  ASP C CG    1 
ATOM   7588  O OD1   . ASP C 1 72  ? 154.174 157.874 128.872 1.00 91.75  ? 72  ASP C OD1   1 
ATOM   7589  O OD2   . ASP C 1 72  ? 152.798 156.191 129.204 1.00 91.75  ? 72  ASP C OD2   1 
ATOM   7590  N N     . VAL C 1 73  ? 152.301 156.409 133.116 1.00 89.33  ? 73  VAL C N     1 
ATOM   7591  C CA    . VAL C 1 73  ? 150.913 156.219 133.528 1.00 89.33  ? 73  VAL C CA    1 
ATOM   7592  C C     . VAL C 1 73  ? 150.441 157.390 134.378 1.00 89.33  ? 73  VAL C C     1 
ATOM   7593  O O     . VAL C 1 73  ? 149.318 157.882 134.212 1.00 89.33  ? 73  VAL C O     1 
ATOM   7594  C CB    . VAL C 1 73  ? 150.749 154.881 134.268 1.00 89.33  ? 73  VAL C CB    1 
ATOM   7595  C CG1   . VAL C 1 73  ? 149.355 154.772 134.853 1.00 89.33  ? 73  VAL C CG1   1 
ATOM   7596  C CG2   . VAL C 1 73  ? 151.009 153.727 133.324 1.00 89.33  ? 73  VAL C CG2   1 
ATOM   7597  N N     . ILE C 1 74  ? 151.284 157.857 135.301 1.00 89.47  ? 74  ILE C N     1 
ATOM   7598  C CA    . ILE C 1 74  ? 150.895 159.002 136.118 1.00 89.47  ? 74  ILE C CA    1 
ATOM   7599  C C     . ILE C 1 74  ? 150.745 160.247 135.258 1.00 89.47  ? 74  ILE C C     1 
ATOM   7600  O O     . ILE C 1 74  ? 149.866 161.081 135.506 1.00 89.47  ? 74  ILE C O     1 
ATOM   7601  C CB    . ILE C 1 74  ? 151.909 159.223 137.254 1.00 89.47  ? 74  ILE C CB    1 
ATOM   7602  C CG1   . ILE C 1 74  ? 151.920 158.026 138.200 1.00 89.47  ? 74  ILE C CG1   1 
ATOM   7603  C CG2   . ILE C 1 74  ? 151.586 160.488 138.026 1.00 89.47  ? 74  ILE C CG2   1 
ATOM   7604  C CD1   . ILE C 1 74  ? 153.063 158.051 139.183 1.00 89.47  ? 74  ILE C CD1   1 
ATOM   7605  N N     . GLY C 1 75  ? 151.570 160.386 134.226 1.00 89.81  ? 75  GLY C N     1 
ATOM   7606  C CA    . GLY C 1 75  ? 151.556 161.578 133.408 1.00 89.81  ? 75  GLY C CA    1 
ATOM   7607  C C     . GLY C 1 75  ? 150.374 161.694 132.472 1.00 89.81  ? 75  GLY C C     1 
ATOM   7608  O O     . GLY C 1 75  ? 149.769 162.765 132.379 1.00 89.81  ? 75  GLY C O     1 
ATOM   7609  N N     . LYS C 1 76  ? 150.020 160.614 131.776 1.00 91.28  ? 76  LYS C N     1 
ATOM   7610  C CA    . LYS C 1 76  ? 149.024 160.732 130.716 1.00 91.28  ? 76  LYS C CA    1 
ATOM   7611  C C     . LYS C 1 76  ? 147.637 160.227 131.087 1.00 91.28  ? 76  LYS C C     1 
ATOM   7612  O O     . LYS C 1 76  ? 146.650 160.758 130.571 1.00 91.28  ? 76  LYS C O     1 
ATOM   7613  C CB    . LYS C 1 76  ? 149.483 159.991 129.459 1.00 91.28  ? 76  LYS C CB    1 
ATOM   7614  C CG    . LYS C 1 76  ? 150.678 160.607 128.774 1.00 91.28  ? 76  LYS C CG    1 
ATOM   7615  C CD    . LYS C 1 76  ? 150.877 159.996 127.404 1.00 91.28  ? 76  LYS C CD    1 
ATOM   7616  C CE    . LYS C 1 76  ? 151.369 158.571 127.510 1.00 91.28  ? 76  LYS C CE    1 
ATOM   7617  N NZ    . LYS C 1 76  ? 151.673 157.993 126.177 1.00 91.28  ? 76  LYS C NZ    1 
ATOM   7618  N N     . TYR C 1 77  ? 147.517 159.226 131.941 1.00 93.60  ? 77  TYR C N     1 
ATOM   7619  C CA    . TYR C 1 77  ? 146.189 158.626 131.998 1.00 93.60  ? 77  TYR C CA    1 
ATOM   7620  C C     . TYR C 1 77  ? 145.591 158.546 133.394 1.00 93.60  ? 77  TYR C C     1 
ATOM   7621  O O     . TYR C 1 77  ? 144.385 158.754 133.546 1.00 93.60  ? 77  TYR C O     1 
ATOM   7622  C CB    . TYR C 1 77  ? 146.246 157.226 131.382 1.00 93.60  ? 77  TYR C CB    1 
ATOM   7623  C CG    . TYR C 1 77  ? 146.638 157.232 129.926 1.00 93.60  ? 77  TYR C CG    1 
ATOM   7624  C CD1   . TYR C 1 77  ? 145.723 157.567 128.943 1.00 93.60  ? 77  TYR C CD1   1 
ATOM   7625  C CD2   . TYR C 1 77  ? 147.925 156.898 129.535 1.00 93.60  ? 77  TYR C CD2   1 
ATOM   7626  C CE1   . TYR C 1 77  ? 146.079 157.574 127.612 1.00 93.60  ? 77  TYR C CE1   1 
ATOM   7627  C CE2   . TYR C 1 77  ? 148.291 156.901 128.208 1.00 93.60  ? 77  TYR C CE2   1 
ATOM   7628  C CZ    . TYR C 1 77  ? 147.364 157.240 127.251 1.00 93.60  ? 77  TYR C CZ    1 
ATOM   7629  O OH    . TYR C 1 77  ? 147.723 157.245 125.925 1.00 93.60  ? 77  TYR C OH    1 
ATOM   7630  N N     . HIS C 1 78  ? 146.390 158.251 134.418 1.00 96.76  ? 78  HIS C N     1 
ATOM   7631  C CA    . HIS C 1 78  ? 145.874 157.949 135.752 1.00 96.76  ? 78  HIS C CA    1 
ATOM   7632  C C     . HIS C 1 78  ? 146.494 158.901 136.767 1.00 96.76  ? 78  HIS C C     1 
ATOM   7633  O O     . HIS C 1 78  ? 147.546 158.598 137.354 1.00 96.76  ? 78  HIS C O     1 
ATOM   7634  C CB    . HIS C 1 78  ? 146.157 156.493 136.115 1.00 96.76  ? 78  HIS C CB    1 
ATOM   7635  C CG    . HIS C 1 78  ? 145.436 156.025 137.337 1.00 96.76  ? 78  HIS C CG    1 
ATOM   7636  N ND1   . HIS C 1 78  ? 145.941 156.189 138.608 1.00 96.76  ? 78  HIS C ND1   1 
ATOM   7637  C CD2   . HIS C 1 78  ? 144.251 155.387 137.483 1.00 96.76  ? 78  HIS C CD2   1 
ATOM   7638  C CE1   . HIS C 1 78  ? 145.097 155.675 139.485 1.00 96.76  ? 78  HIS C CE1   1 
ATOM   7639  N NE2   . HIS C 1 78  ? 144.062 155.183 138.828 1.00 96.76  ? 78  HIS C NE2   1 
ATOM   7640  N N     . PRO C 1 79  ? 145.884 160.060 137.000 1.00 93.31  ? 79  PRO C N     1 
ATOM   7641  C CA    . PRO C 1 79  ? 146.450 161.054 137.933 1.00 93.31  ? 79  PRO C CA    1 
ATOM   7642  C C     . PRO C 1 79  ? 146.017 160.839 139.380 1.00 93.31  ? 79  PRO C C     1 
ATOM   7643  O O     . PRO C 1 79  ? 145.243 161.612 139.962 1.00 93.31  ? 79  PRO C O     1 
ATOM   7644  C CB    . PRO C 1 79  ? 145.921 162.372 137.362 1.00 93.31  ? 79  PRO C CB    1 
ATOM   7645  C CG    . PRO C 1 79  ? 144.603 161.995 136.767 1.00 93.31  ? 79  PRO C CG    1 
ATOM   7646  C CD    . PRO C 1 79  ? 144.766 160.604 136.218 1.00 93.31  ? 79  PRO C CD    1 
ATOM   7647  N N     . HIS C 1 80  ? 146.507 159.767 139.996 1.00 94.42  ? 80  HIS C N     1 
ATOM   7648  C CA    . HIS C 1 80  ? 146.157 159.450 141.380 1.00 94.42  ? 80  HIS C CA    1 
ATOM   7649  C C     . HIS C 1 80  ? 147.376 158.947 142.147 1.00 94.42  ? 80  HIS C C     1 
ATOM   7650  O O     . HIS C 1 80  ? 147.318 157.954 142.872 1.00 94.42  ? 80  HIS C O     1 
ATOM   7651  C CB    . HIS C 1 80  ? 145.013 158.443 141.420 1.00 94.42  ? 80  HIS C CB    1 
ATOM   7652  C CG    . HIS C 1 80  ? 143.727 158.982 140.883 1.00 94.42  ? 80  HIS C CG    1 
ATOM   7653  N ND1   . HIS C 1 80  ? 143.408 158.943 139.543 1.00 94.42  ? 80  HIS C ND1   1 
ATOM   7654  C CD2   . HIS C 1 80  ? 142.682 159.581 141.501 1.00 94.42  ? 80  HIS C CD2   1 
ATOM   7655  C CE1   . HIS C 1 80  ? 142.221 159.492 139.359 1.00 94.42  ? 80  HIS C CE1   1 
ATOM   7656  N NE2   . HIS C 1 80  ? 141.759 159.886 140.532 1.00 94.42  ? 80  HIS C NE2   1 
ATOM   7657  N N     . GLY C 1 81  ? 148.502 159.629 141.993 1.00 98.64  ? 81  GLY C N     1 
ATOM   7658  C CA    . GLY C 1 81  ? 149.678 159.263 142.753 1.00 98.64  ? 81  GLY C CA    1 
ATOM   7659  C C     . GLY C 1 81  ? 150.423 158.092 142.138 1.00 98.64  ? 81  GLY C C     1 
ATOM   7660  O O     . GLY C 1 81  ? 150.253 157.747 140.965 1.00 98.64  ? 81  GLY C O     1 
ATOM   7661  N N     . ASP C 1 82  ? 151.257 157.470 142.956 1.00 107.89 ? 82  ASP C N     1 
ATOM   7662  C CA    . ASP C 1 82  ? 152.174 156.436 142.487 1.00 107.89 ? 82  ASP C CA    1 
ATOM   7663  C C     . ASP C 1 82  ? 152.084 155.136 143.268 1.00 107.89 ? 82  ASP C C     1 
ATOM   7664  O O     . ASP C 1 82  ? 152.245 154.063 142.679 1.00 107.89 ? 82  ASP C O     1 
ATOM   7665  C CB    . ASP C 1 82  ? 153.607 156.969 142.554 1.00 107.89 ? 82  ASP C CB    1 
ATOM   7666  C CG    . ASP C 1 82  ? 154.007 157.382 143.955 1.00 107.89 ? 82  ASP C CG    1 
ATOM   7667  O OD1   . ASP C 1 82  ? 153.152 157.331 144.865 1.00 107.89 ? 82  ASP C OD1   1 
ATOM   7668  O OD2   . ASP C 1 82  ? 155.180 157.757 144.151 1.00 107.89 ? 82  ASP C OD2   1 
ATOM   7669  N N     . SER C 1 83  ? 151.853 155.205 144.580 1.00 102.93 ? 83  SER C N     1 
ATOM   7670  C CA    . SER C 1 83  ? 151.901 154.005 145.406 1.00 102.93 ? 83  SER C CA    1 
ATOM   7671  C C     . SER C 1 83  ? 150.851 152.991 144.973 1.00 102.93 ? 83  SER C C     1 
ATOM   7672  O O     . SER C 1 83  ? 151.144 151.795 144.859 1.00 102.93 ? 83  SER C O     1 
ATOM   7673  C CB    . SER C 1 83  ? 151.713 154.374 146.876 1.00 102.93 ? 83  SER C CB    1 
ATOM   7674  O OG    . SER C 1 83  ? 150.408 154.871 147.110 1.00 102.93 ? 83  SER C OG    1 
ATOM   7675  N N     . ALA C 1 84  ? 149.623 153.450 144.728 1.00 100.28 ? 84  ALA C N     1 
ATOM   7676  C CA    . ALA C 1 84  ? 148.569 152.540 144.296 1.00 100.28 ? 84  ALA C CA    1 
ATOM   7677  C C     . ALA C 1 84  ? 148.923 151.875 142.973 1.00 100.28 ? 84  ALA C C     1 
ATOM   7678  O O     . ALA C 1 84  ? 148.754 150.660 142.814 1.00 100.28 ? 84  ALA C O     1 
ATOM   7679  C CB    . ALA C 1 84  ? 147.243 153.290 144.183 1.00 100.28 ? 84  ALA C CB    1 
ATOM   7680  N N     . VAL C 1 85  ? 149.427 152.656 142.016 1.00 95.30  ? 85  VAL C N     1 
ATOM   7681  C CA    . VAL C 1 85  ? 149.770 152.103 140.710 1.00 95.30  ? 85  VAL C CA    1 
ATOM   7682  C C     . VAL C 1 85  ? 150.872 151.063 140.843 1.00 95.30  ? 85  VAL C C     1 
ATOM   7683  O O     . VAL C 1 85  ? 150.793 149.973 140.261 1.00 95.30  ? 85  VAL C O     1 
ATOM   7684  C CB    . VAL C 1 85  ? 150.173 153.232 139.746 1.00 95.30  ? 85  VAL C CB    1 
ATOM   7685  C CG1   . VAL C 1 85  ? 150.644 152.654 138.429 1.00 95.30  ? 85  VAL C CG1   1 
ATOM   7686  C CG2   . VAL C 1 85  ? 149.007 154.173 139.529 1.00 95.30  ? 85  VAL C CG2   1 
ATOM   7687  N N     . TYR C 1 86  ? 151.913 151.375 141.616 1.00 96.03  ? 86  TYR C N     1 
ATOM   7688  C CA    . TYR C 1 86  ? 153.021 150.436 141.742 1.00 96.03  ? 86  TYR C CA    1 
ATOM   7689  C C     . TYR C 1 86  ? 152.602 149.175 142.481 1.00 96.03  ? 86  TYR C C     1 
ATOM   7690  O O     . TYR C 1 86  ? 153.044 148.075 142.131 1.00 96.03  ? 86  TYR C O     1 
ATOM   7691  C CB    . TYR C 1 86  ? 154.203 151.098 142.441 1.00 96.03  ? 86  TYR C CB    1 
ATOM   7692  C CG    . TYR C 1 86  ? 155.397 150.187 142.559 1.00 96.03  ? 86  TYR C CG    1 
ATOM   7693  C CD1   . TYR C 1 86  ? 156.140 149.844 141.441 1.00 96.03  ? 86  TYR C CD1   1 
ATOM   7694  C CD2   . TYR C 1 86  ? 155.786 149.676 143.786 1.00 96.03  ? 86  TYR C CD2   1 
ATOM   7695  C CE1   . TYR C 1 86  ? 157.231 149.008 141.540 1.00 96.03  ? 86  TYR C CE1   1 
ATOM   7696  C CE2   . TYR C 1 86  ? 156.880 148.844 143.896 1.00 96.03  ? 86  TYR C CE2   1 
ATOM   7697  C CZ    . TYR C 1 86  ? 157.600 148.514 142.769 1.00 96.03  ? 86  TYR C CZ    1 
ATOM   7698  O OH    . TYR C 1 86  ? 158.690 147.684 142.876 1.00 96.03  ? 86  TYR C OH    1 
ATOM   7699  N N     . ASP C 1 87  ? 151.744 149.305 143.495 1.00 99.41  ? 87  ASP C N     1 
ATOM   7700  C CA    . ASP C 1 87  ? 151.244 148.119 144.177 1.00 99.41  ? 87  ASP C CA    1 
ATOM   7701  C C     . ASP C 1 87  ? 150.403 147.264 143.242 1.00 99.41  ? 87  ASP C C     1 
ATOM   7702  O O     . ASP C 1 87  ? 150.494 146.031 143.271 1.00 99.41  ? 87  ASP C O     1 
ATOM   7703  C CB    . ASP C 1 87  ? 150.435 148.522 145.406 1.00 99.41  ? 87  ASP C CB    1 
ATOM   7704  C CG    . ASP C 1 87  ? 151.296 149.128 146.490 1.00 99.41  ? 87  ASP C CG    1 
ATOM   7705  O OD1   . ASP C 1 87  ? 152.489 148.771 146.566 1.00 99.41  ? 87  ASP C OD1   1 
ATOM   7706  O OD2   . ASP C 1 87  ? 150.781 149.960 147.265 1.00 99.41  ? 87  ASP C OD2   1 
ATOM   7707  N N     . THR C 1 88  ? 149.588 147.899 142.399 1.00 93.93  ? 88  THR C N     1 
ATOM   7708  C CA    . THR C 1 88  ? 148.799 147.144 141.434 1.00 93.93  ? 88  THR C CA    1 
ATOM   7709  C C     . THR C 1 88  ? 149.697 146.396 140.459 1.00 93.93  ? 88  THR C C     1 
ATOM   7710  O O     . THR C 1 88  ? 149.420 145.245 140.105 1.00 93.93  ? 88  THR C O     1 
ATOM   7711  C CB    . THR C 1 88  ? 147.856 148.082 140.685 1.00 93.93  ? 88  THR C CB    1 
ATOM   7712  O OG1   . THR C 1 88  ? 146.992 148.732 141.623 1.00 93.93  ? 88  THR C OG1   1 
ATOM   7713  C CG2   . THR C 1 88  ? 147.014 147.305 139.693 1.00 93.93  ? 88  THR C CG2   1 
ATOM   7714  N N     . ILE C 1 89  ? 150.785 147.031 140.022 1.00 84.73  ? 89  ILE C N     1 
ATOM   7715  C CA    . ILE C 1 89  ? 151.709 146.361 139.111 1.00 84.73  ? 89  ILE C CA    1 
ATOM   7716  C C     . ILE C 1 89  ? 152.379 145.180 139.800 1.00 84.73  ? 89  ILE C C     1 
ATOM   7717  O O     . ILE C 1 89  ? 152.479 144.087 139.232 1.00 84.73  ? 89  ILE C O     1 
ATOM   7718  C CB    . ILE C 1 89  ? 152.744 147.359 138.566 1.00 84.73  ? 89  ILE C CB    1 
ATOM   7719  C CG1   . ILE C 1 89  ? 152.057 148.412 137.700 1.00 84.73  ? 89  ILE C CG1   1 
ATOM   7720  C CG2   . ILE C 1 89  ? 153.809 146.636 137.769 1.00 84.73  ? 89  ILE C CG2   1 
ATOM   7721  C CD1   . ILE C 1 89  ? 152.954 149.562 137.327 1.00 84.73  ? 89  ILE C CD1   1 
ATOM   7722  N N     . VAL C 1 90  ? 152.845 145.377 141.035 1.00 88.42  ? 90  VAL C N     1 
ATOM   7723  C CA    . VAL C 1 90  ? 153.521 144.298 141.751 1.00 88.42  ? 90  VAL C CA    1 
ATOM   7724  C C     . VAL C 1 90  ? 152.566 143.137 141.996 1.00 88.42  ? 90  VAL C C     1 
ATOM   7725  O O     . VAL C 1 90  ? 152.967 141.967 141.968 1.00 88.42  ? 90  VAL C O     1 
ATOM   7726  C CB    . VAL C 1 90  ? 154.126 144.823 143.065 1.00 88.42  ? 90  VAL C CB    1 
ATOM   7727  C CG1   . VAL C 1 90  ? 154.684 143.680 143.892 1.00 88.42  ? 90  VAL C CG1   1 
ATOM   7728  C CG2   . VAL C 1 90  ? 155.219 145.829 142.769 1.00 88.42  ? 90  VAL C CG2   1 
ATOM   7729  N N     . ARG C 1 91  ? 151.288 143.439 142.224 1.00 91.05  ? 91  ARG C N     1 
ATOM   7730  C CA    . ARG C 1 91  ? 150.322 142.385 142.517 1.00 91.05  ? 91  ARG C CA    1 
ATOM   7731  C C     . ARG C 1 91  ? 150.180 141.426 141.342 1.00 91.05  ? 91  ARG C C     1 
ATOM   7732  O O     . ARG C 1 91  ? 150.038 140.213 141.531 1.00 91.05  ? 91  ARG C O     1 
ATOM   7733  C CB    . ARG C 1 91  ? 148.973 143.006 142.884 1.00 91.05  ? 91  ARG C CB    1 
ATOM   7734  C CG    . ARG C 1 91  ? 147.901 142.003 143.280 1.00 91.05  ? 91  ARG C CG    1 
ATOM   7735  C CD    . ARG C 1 91  ? 146.985 141.672 142.115 1.00 91.05  ? 91  ARG C CD    1 
ATOM   7736  N NE    . ARG C 1 91  ? 145.936 140.732 142.494 1.00 91.05  ? 91  ARG C NE    1 
ATOM   7737  C CZ    . ARG C 1 91  ? 144.767 141.087 143.015 1.00 91.05  ? 91  ARG C CZ    1 
ATOM   7738  N NH1   . ARG C 1 91  ? 144.492 142.366 143.221 1.00 91.05  ? 91  ARG C NH1   1 
ATOM   7739  N NH2   . ARG C 1 91  ? 143.874 140.160 143.330 1.00 91.05  ? 91  ARG C NH2   1 
ATOM   7740  N N     . MET C 1 92  ? 150.221 141.950 140.117 1.00 90.37  ? 92  MET C N     1 
ATOM   7741  C CA    . MET C 1 92  ? 149.986 141.103 138.953 1.00 90.37  ? 92  MET C CA    1 
ATOM   7742  C C     . MET C 1 92  ? 151.169 140.185 138.677 1.00 90.37  ? 92  MET C C     1 
ATOM   7743  O O     . MET C 1 92  ? 151.006 139.115 138.080 1.00 90.37  ? 92  MET C O     1 
ATOM   7744  C CB    . MET C 1 92  ? 149.685 141.966 137.730 1.00 90.37  ? 92  MET C CB    1 
ATOM   7745  C CG    . MET C 1 92  ? 148.369 142.708 137.811 1.00 90.37  ? 92  MET C CG    1 
ATOM   7746  S SD    . MET C 1 92  ? 148.038 143.670 136.327 1.00 90.37  ? 92  MET C SD    1 
ATOM   7747  C CE    . MET C 1 92  ? 149.172 145.034 136.559 1.00 90.37  ? 92  MET C CE    1 
ATOM   7748  N N     . ALA C 1 93  ? 152.369 140.582 139.100 1.00 91.89  ? 93  ALA C N     1 
ATOM   7749  C CA    . ALA C 1 93  ? 153.556 139.810 138.751 1.00 91.89  ? 93  ALA C CA    1 
ATOM   7750  C C     . ALA C 1 93  ? 153.702 138.572 139.628 1.00 91.89  ? 93  ALA C C     1 
ATOM   7751  O O     . ALA C 1 93  ? 154.367 137.605 139.240 1.00 91.89  ? 93  ALA C O     1 
ATOM   7752  C CB    . ALA C 1 93  ? 154.801 140.688 138.853 1.00 91.89  ? 93  ALA C CB    1 
ATOM   7753  N N     . GLN C 1 94  ? 153.094 138.580 140.807 1.00 96.99  ? 94  GLN C N     1 
ATOM   7754  C CA    . GLN C 1 94  ? 153.274 137.471 141.729 1.00 96.99  ? 94  GLN C CA    1 
ATOM   7755  C C     . GLN C 1 94  ? 152.581 136.221 141.193 1.00 96.99  ? 94  GLN C C     1 
ATOM   7756  O O     . GLN C 1 94  ? 151.401 136.270 140.831 1.00 96.99  ? 94  GLN C O     1 
ATOM   7757  C CB    . GLN C 1 94  ? 152.728 137.826 143.110 1.00 96.99  ? 94  GLN C CB    1 
ATOM   7758  C CG    . GLN C 1 94  ? 153.505 138.916 143.814 1.00 96.99  ? 94  GLN C CG    1 
ATOM   7759  C CD    . GLN C 1 94  ? 152.939 139.239 145.176 1.00 96.99  ? 94  GLN C CD    1 
ATOM   7760  O OE1   . GLN C 1 94  ? 151.915 138.692 145.580 1.00 96.99  ? 94  GLN C OE1   1 
ATOM   7761  N NE2   . GLN C 1 94  ? 153.606 140.131 145.896 1.00 96.99  ? 94  GLN C NE2   1 
ATOM   7762  N N     . PRO C 1 95  ? 153.279 135.091 141.125 1.00 96.16  ? 95  PRO C N     1 
ATOM   7763  C CA    . PRO C 1 95  ? 152.648 133.856 140.642 1.00 96.16  ? 95  PRO C CA    1 
ATOM   7764  C C     . PRO C 1 95  ? 151.617 133.314 141.615 1.00 96.16  ? 95  PRO C C     1 
ATOM   7765  O O     . PRO C 1 95  ? 150.575 132.795 141.206 1.00 96.16  ? 95  PRO C O     1 
ATOM   7766  C CB    . PRO C 1 95  ? 153.832 132.891 140.500 1.00 96.16  ? 95  PRO C CB    1 
ATOM   7767  C CG    . PRO C 1 95  ? 155.034 133.772 140.404 1.00 96.16  ? 95  PRO C CG    1 
ATOM   7768  C CD    . PRO C 1 95  ? 154.733 134.939 141.285 1.00 96.16  ? 95  PRO C CD    1 
ATOM   7769  N N     . PHE C 1 96  ? 151.896 133.437 142.910 1.00 99.47  ? 96  PHE C N     1 
ATOM   7770  C CA    . PHE C 1 96  ? 151.048 132.873 143.950 1.00 99.47  ? 96  PHE C CA    1 
ATOM   7771  C C     . PHE C 1 96  ? 149.844 133.746 144.275 1.00 99.47  ? 96  PHE C C     1 
ATOM   7772  O O     . PHE C 1 96  ? 149.212 133.542 145.315 1.00 99.47  ? 96  PHE C O     1 
ATOM   7773  C CB    . PHE C 1 96  ? 151.870 132.627 145.217 1.00 99.47  ? 96  PHE C CB    1 
ATOM   7774  C CG    . PHE C 1 96  ? 152.436 133.877 145.827 1.00 99.47  ? 96  PHE C CG    1 
ATOM   7775  C CD1   . PHE C 1 96  ? 153.664 134.366 145.420 1.00 99.47  ? 96  PHE C CD1   1 
ATOM   7776  C CD2   . PHE C 1 96  ? 151.750 134.553 146.820 1.00 99.47  ? 96  PHE C CD2   1 
ATOM   7777  C CE1   . PHE C 1 96  ? 154.189 135.511 145.980 1.00 99.47  ? 96  PHE C CE1   1 
ATOM   7778  C CE2   . PHE C 1 96  ? 152.270 135.697 147.383 1.00 99.47  ? 96  PHE C CE2   1 
ATOM   7779  C CZ    . PHE C 1 96  ? 153.491 136.177 146.963 1.00 99.47  ? 96  PHE C CZ    1 
ATOM   7780  N N     . SER C 1 97  ? 149.512 134.708 143.418 1.00 96.47  ? 97  SER C N     1 
ATOM   7781  C CA    . SER C 1 97  ? 148.352 135.557 143.630 1.00 96.47  ? 97  SER C CA    1 
ATOM   7782  C C     . SER C 1 97  ? 147.405 135.605 142.443 1.00 96.47  ? 97  SER C C     1 
ATOM   7783  O O     . SER C 1 97  ? 146.297 136.134 142.583 1.00 96.47  ? 97  SER C O     1 
ATOM   7784  C CB    . SER C 1 97  ? 148.787 136.989 143.977 1.00 96.47  ? 97  SER C CB    1 
ATOM   7785  O OG    . SER C 1 97  ? 147.661 137.822 144.175 1.00 96.47  ? 97  SER C OG    1 
ATOM   7786  N N     . LEU C 1 98  ? 147.800 135.080 141.287 1.00 95.11  ? 98  LEU C N     1 
ATOM   7787  C CA    . LEU C 1 98  ? 146.932 135.009 140.122 1.00 95.11  ? 98  LEU C CA    1 
ATOM   7788  C C     . LEU C 1 98  ? 147.123 133.665 139.440 1.00 95.11  ? 98  LEU C C     1 
ATOM   7789  O O     . LEU C 1 98  ? 148.246 133.162 139.351 1.00 95.11  ? 98  LEU C O     1 
ATOM   7790  C CB    . LEU C 1 98  ? 147.218 136.140 139.131 1.00 95.11  ? 98  LEU C CB    1 
ATOM   7791  C CG    . LEU C 1 98  ? 146.864 137.550 139.595 1.00 95.11  ? 98  LEU C CG    1 
ATOM   7792  C CD1   . LEU C 1 98  ? 147.327 138.571 138.576 1.00 95.11  ? 98  LEU C CD1   1 
ATOM   7793  C CD2   . LEU C 1 98  ? 145.370 137.662 139.824 1.00 95.11  ? 98  LEU C CD2   1 
ATOM   7794  N N     . ARG C 1 99  ? 146.021 133.086 138.963 1.00 94.74  ? 99  ARG C N     1 
ATOM   7795  C CA    . ARG C 1 99  ? 146.106 131.797 138.286 1.00 94.74  ? 99  ARG C CA    1 
ATOM   7796  C C     . ARG C 1 99  ? 146.890 131.912 136.986 1.00 94.74  ? 99  ARG C C     1 
ATOM   7797  O O     . ARG C 1 99  ? 147.636 130.997 136.619 1.00 94.74  ? 99  ARG C O     1 
ATOM   7798  C CB    . ARG C 1 99  ? 144.705 131.249 138.027 1.00 94.74  ? 99  ARG C CB    1 
ATOM   7799  C CG    . ARG C 1 99  ? 144.686 129.911 137.318 1.00 94.74  ? 99  ARG C CG    1 
ATOM   7800  C CD    . ARG C 1 99  ? 145.307 128.827 138.176 1.00 94.74  ? 99  ARG C CD    1 
ATOM   7801  N NE    . ARG C 1 99  ? 145.251 127.525 137.522 1.00 94.74  ? 99  ARG C NE    1 
ATOM   7802  C CZ    . ARG C 1 99  ? 146.151 127.093 136.648 1.00 94.74  ? 99  ARG C CZ    1 
ATOM   7803  N NH1   . ARG C 1 99  ? 146.024 125.893 136.100 1.00 94.74  ? 99  ARG C NH1   1 
ATOM   7804  N NH2   . ARG C 1 99  ? 147.179 127.861 136.319 1.00 94.74  ? 99  ARG C NH2   1 
ATOM   7805  N N     . TYR C 1 100 ? 146.738 133.028 136.279 1.00 92.66  ? 100 TYR C N     1 
ATOM   7806  C CA    . TYR C 1 100 ? 147.473 133.290 135.044 1.00 92.66  ? 100 TYR C CA    1 
ATOM   7807  C C     . TYR C 1 100 ? 148.009 134.715 135.117 1.00 92.66  ? 100 TYR C C     1 
ATOM   7808  O O     . TYR C 1 100 ? 147.266 135.674 134.894 1.00 92.66  ? 100 TYR C O     1 
ATOM   7809  C CB    . TYR C 1 100 ? 146.588 133.094 133.821 1.00 92.66  ? 100 TYR C CB    1 
ATOM   7810  C CG    . TYR C 1 100 ? 146.152 131.666 133.624 1.00 92.66  ? 100 TYR C CG    1 
ATOM   7811  C CD1   . TYR C 1 100 ? 147.001 130.735 133.050 1.00 92.66  ? 100 TYR C CD1   1 
ATOM   7812  C CD2   . TYR C 1 100 ? 144.891 131.249 134.015 1.00 92.66  ? 100 TYR C CD2   1 
ATOM   7813  C CE1   . TYR C 1 100 ? 146.606 129.426 132.870 1.00 92.66  ? 100 TYR C CE1   1 
ATOM   7814  C CE2   . TYR C 1 100 ? 144.486 129.945 133.838 1.00 92.66  ? 100 TYR C CE2   1 
ATOM   7815  C CZ    . TYR C 1 100 ? 145.346 129.038 133.267 1.00 92.66  ? 100 TYR C CZ    1 
ATOM   7816  O OH    . TYR C 1 100 ? 144.942 127.736 133.092 1.00 92.66  ? 100 TYR C OH    1 
ATOM   7817  N N     . MET C 1 101 ? 149.294 134.849 135.431 1.00 98.33  ? 101 MET C N     1 
ATOM   7818  C CA    . MET C 1 101 ? 149.901 136.164 135.554 1.00 98.33  ? 101 MET C CA    1 
ATOM   7819  C C     . MET C 1 101 ? 149.902 136.884 134.211 1.00 98.33  ? 101 MET C C     1 
ATOM   7820  O O     . MET C 1 101 ? 149.859 136.264 133.146 1.00 98.33  ? 101 MET C O     1 
ATOM   7821  C CB    . MET C 1 101 ? 151.328 136.043 136.081 1.00 98.33  ? 101 MET C CB    1 
ATOM   7822  C CG    . MET C 1 101 ? 152.265 135.325 135.135 1.00 98.33  ? 101 MET C CG    1 
ATOM   7823  S SD    . MET C 1 101 ? 153.901 135.086 135.845 1.00 98.33  ? 101 MET C SD    1 
ATOM   7824  C CE    . MET C 1 101 ? 153.553 133.792 137.030 1.00 98.33  ? 101 MET C CE    1 
ATOM   7825  N N     . LEU C 1 102 ? 149.948 138.213 134.271 1.00 85.85  ? 102 LEU C N     1 
ATOM   7826  C CA    . LEU C 1 102 ? 149.924 139.044 133.076 1.00 85.85  ? 102 LEU C CA    1 
ATOM   7827  C C     . LEU C 1 102 ? 151.209 139.814 132.838 1.00 85.85  ? 102 LEU C C     1 
ATOM   7828  O O     . LEU C 1 102 ? 151.582 140.021 131.683 1.00 85.85  ? 102 LEU C O     1 
ATOM   7829  C CB    . LEU C 1 102 ? 148.764 140.042 133.147 1.00 85.85  ? 102 LEU C CB    1 
ATOM   7830  C CG    . LEU C 1 102 ? 147.370 139.423 133.123 1.00 85.85  ? 102 LEU C CG    1 
ATOM   7831  C CD1   . LEU C 1 102 ? 146.313 140.488 133.341 1.00 85.85  ? 102 LEU C CD1   1 
ATOM   7832  C CD2   . LEU C 1 102 ? 147.145 138.700 131.811 1.00 85.85  ? 102 LEU C CD2   1 
ATOM   7833  N N     . VAL C 1 103 ? 151.894 140.238 133.892 1.00 93.12  ? 103 VAL C N     1 
ATOM   7834  C CA    . VAL C 1 103 ? 153.084 141.068 133.776 1.00 93.12  ? 103 VAL C CA    1 
ATOM   7835  C C     . VAL C 1 103 ? 154.274 140.213 134.191 1.00 93.12  ? 103 VAL C C     1 
ATOM   7836  O O     . VAL C 1 103 ? 154.508 139.987 135.383 1.00 93.12  ? 103 VAL C O     1 
ATOM   7837  C CB    . VAL C 1 103 ? 152.980 142.336 134.627 1.00 93.12  ? 103 VAL C CB    1 
ATOM   7838  C CG1   . VAL C 1 103 ? 154.264 143.136 134.537 1.00 93.12  ? 103 VAL C CG1   1 
ATOM   7839  C CG2   . VAL C 1 103 ? 151.793 143.167 134.180 1.00 93.12  ? 103 VAL C CG2   1 
ATOM   7840  N N     . ASP C 1 104 ? 155.031 139.736 133.208 1.00 106.11 ? 104 ASP C N     1 
ATOM   7841  C CA    . ASP C 1 104 ? 156.240 138.970 133.478 1.00 106.11 ? 104 ASP C CA    1 
ATOM   7842  C C     . ASP C 1 104 ? 157.339 139.921 133.932 1.00 106.11 ? 104 ASP C C     1 
ATOM   7843  O O     . ASP C 1 104 ? 157.724 140.831 133.190 1.00 106.11 ? 104 ASP C O     1 
ATOM   7844  C CB    . ASP C 1 104 ? 156.671 138.201 132.233 1.00 106.11 ? 104 ASP C CB    1 
ATOM   7845  C CG    . ASP C 1 104 ? 157.774 137.206 132.517 1.00 106.11 ? 104 ASP C CG    1 
ATOM   7846  O OD1   . ASP C 1 104 ? 158.210 137.113 133.683 1.00 106.11 ? 104 ASP C OD1   1 
ATOM   7847  O OD2   . ASP C 1 104 ? 158.210 136.517 131.571 1.00 106.11 ? 104 ASP C OD2   1 
ATOM   7848  N N     . GLY C 1 105 ? 157.848 139.711 135.142 1.00 108.82 ? 105 GLY C N     1 
ATOM   7849  C CA    . GLY C 1 105 ? 158.838 140.611 135.695 1.00 108.82 ? 105 GLY C CA    1 
ATOM   7850  C C     . GLY C 1 105 ? 160.151 139.948 136.053 1.00 108.82 ? 105 GLY C C     1 
ATOM   7851  O O     . GLY C 1 105 ? 160.373 138.778 135.732 1.00 108.82 ? 105 GLY C O     1 
ATOM   7852  N N     . GLN C 1 106 ? 161.029 140.692 136.724 1.00 109.11 ? 106 GLN C N     1 
ATOM   7853  C CA    . GLN C 1 106 ? 162.344 140.175 137.093 1.00 109.11 ? 106 GLN C CA    1 
ATOM   7854  C C     . GLN C 1 106 ? 162.868 140.999 138.260 1.00 109.11 ? 106 GLN C C     1 
ATOM   7855  O O     . GLN C 1 106 ? 163.177 142.182 138.090 1.00 109.11 ? 106 GLN C O     1 
ATOM   7856  C CB    . GLN C 1 106 ? 163.299 140.236 135.911 1.00 109.11 ? 106 GLN C CB    1 
ATOM   7857  C CG    . GLN C 1 106 ? 164.679 139.695 136.211 1.00 109.11 ? 106 GLN C CG    1 
ATOM   7858  C CD    . GLN C 1 106 ? 165.592 139.746 135.006 1.00 109.11 ? 106 GLN C CD    1 
ATOM   7859  O OE1   . GLN C 1 106 ? 165.202 140.217 133.939 1.00 109.11 ? 106 GLN C OE1   1 
ATOM   7860  N NE2   . GLN C 1 106 ? 166.818 139.265 135.172 1.00 109.11 ? 106 GLN C NE2   1 
ATOM   7861  N N     . GLY C 1 107 ? 162.974 140.380 139.425 1.00 109.37 ? 107 GLY C N     1 
ATOM   7862  C CA    . GLY C 1 107 ? 163.459 141.040 140.612 1.00 109.37 ? 107 GLY C CA    1 
ATOM   7863  C C     . GLY C 1 107 ? 162.716 140.549 141.832 1.00 109.37 ? 107 GLY C C     1 
ATOM   7864  O O     . GLY C 1 107 ? 161.900 139.632 141.764 1.00 109.37 ? 107 GLY C O     1 
ATOM   7865  N N     . ASN C 1 108 ? 163.007 141.175 142.967 1.00 112.98 ? 108 ASN C N     1 
ATOM   7866  C CA    . ASN C 1 108 ? 162.391 140.797 144.235 1.00 112.98 ? 108 ASN C CA    1 
ATOM   7867  C C     . ASN C 1 108 ? 160.954 141.295 144.257 1.00 112.98 ? 108 ASN C C     1 
ATOM   7868  O O     . ASN C 1 108 ? 160.693 142.472 144.512 1.00 112.98 ? 108 ASN C O     1 
ATOM   7869  C CB    . ASN C 1 108 ? 163.185 141.368 145.403 1.00 112.98 ? 108 ASN C CB    1 
ATOM   7870  C CG    . ASN C 1 108 ? 162.716 140.833 146.739 1.00 112.98 ? 108 ASN C CG    1 
ATOM   7871  O OD1   . ASN C 1 108 ? 161.786 140.030 146.809 1.00 112.98 ? 108 ASN C OD1   1 
ATOM   7872  N ND2   . ASN C 1 108 ? 163.356 141.281 147.811 1.00 112.98 ? 108 ASN C ND2   1 
ATOM   7873  N N     . PHE C 1 109 ? 160.011 140.392 143.998 1.00 98.61  ? 109 PHE C N     1 
ATOM   7874  C CA    . PHE C 1 109 ? 158.590 140.704 144.029 1.00 98.61  ? 109 PHE C CA    1 
ATOM   7875  C C     . PHE C 1 109 ? 157.911 140.197 145.293 1.00 98.61  ? 109 PHE C C     1 
ATOM   7876  O O     . PHE C 1 109 ? 156.690 140.016 145.303 1.00 98.61  ? 109 PHE C O     1 
ATOM   7877  C CB    . PHE C 1 109 ? 157.897 140.126 142.797 1.00 98.61  ? 109 PHE C CB    1 
ATOM   7878  C CG    . PHE C 1 109 ? 158.229 140.842 141.525 1.00 98.61  ? 109 PHE C CG    1 
ATOM   7879  C CD1   . PHE C 1 109 ? 158.776 142.111 141.552 1.00 98.61  ? 109 PHE C CD1   1 
ATOM   7880  C CD2   . PHE C 1 109 ? 157.999 140.244 140.302 1.00 98.61  ? 109 PHE C CD2   1 
ATOM   7881  C CE1   . PHE C 1 109 ? 159.079 142.770 140.382 1.00 98.61  ? 109 PHE C CE1   1 
ATOM   7882  C CE2   . PHE C 1 109 ? 158.303 140.899 139.131 1.00 98.61  ? 109 PHE C CE2   1 
ATOM   7883  C CZ    . PHE C 1 109 ? 158.843 142.163 139.170 1.00 98.61  ? 109 PHE C CZ    1 
ATOM   7884  N N     . GLY C 1 110 ? 158.673 139.963 146.354 1.00 114.95 ? 110 GLY C N     1 
ATOM   7885  C CA    . GLY C 1 110 ? 158.114 139.413 147.571 1.00 114.95 ? 110 GLY C CA    1 
ATOM   7886  C C     . GLY C 1 110 ? 157.768 137.944 147.406 1.00 114.95 ? 110 GLY C C     1 
ATOM   7887  O O     . GLY C 1 110 ? 157.958 137.335 146.355 1.00 114.95 ? 110 GLY C O     1 
ATOM   7888  N N     . SER C 1 111 ? 157.248 137.369 148.485 1.00 121.19 ? 111 SER C N     1 
ATOM   7889  C CA    . SER C 1 111 ? 156.865 135.965 148.484 1.00 121.19 ? 111 SER C CA    1 
ATOM   7890  C C     . SER C 1 111 ? 155.763 135.759 149.515 1.00 121.19 ? 111 SER C C     1 
ATOM   7891  O O     . SER C 1 111 ? 155.210 136.718 150.061 1.00 121.19 ? 111 SER C O     1 
ATOM   7892  C CB    . SER C 1 111 ? 158.079 135.070 148.758 1.00 121.19 ? 111 SER C CB    1 
ATOM   7893  O OG    . SER C 1 111 ? 158.565 135.266 150.074 1.00 121.19 ? 111 SER C OG    1 
ATOM   7894  N N     . ILE C 1 112 ? 155.453 134.490 149.788 1.00 116.97 ? 112 ILE C N     1 
ATOM   7895  C CA    . ILE C 1 112 ? 154.383 134.154 150.717 1.00 116.97 ? 112 ILE C CA    1 
ATOM   7896  C C     . ILE C 1 112 ? 154.730 134.520 152.152 1.00 116.97 ? 112 ILE C C     1 
ATOM   7897  O O     . ILE C 1 112 ? 153.836 134.592 153.002 1.00 116.97 ? 112 ILE C O     1 
ATOM   7898  C CB    . ILE C 1 112 ? 154.051 132.653 150.594 1.00 116.97 ? 112 ILE C CB    1 
ATOM   7899  C CG1   . ILE C 1 112 ? 152.702 132.339 151.240 1.00 116.97 ? 112 ILE C CG1   1 
ATOM   7900  C CG2   . ILE C 1 112 ? 155.155 131.812 151.211 1.00 116.97 ? 112 ILE C CG2   1 
ATOM   7901  C CD1   . ILE C 1 112 ? 151.530 132.979 150.535 1.00 116.97 ? 112 ILE C CD1   1 
ATOM   7902  N N     . ASP C 1 113 ? 156.005 134.777 152.444 1.00 128.94 ? 113 ASP C N     1 
ATOM   7903  C CA    . ASP C 1 113 ? 156.420 135.117 153.800 1.00 128.94 ? 113 ASP C CA    1 
ATOM   7904  C C     . ASP C 1 113 ? 155.951 136.495 154.243 1.00 128.94 ? 113 ASP C C     1 
ATOM   7905  O O     . ASP C 1 113 ? 156.225 136.881 155.384 1.00 128.94 ? 113 ASP C O     1 
ATOM   7906  C CB    . ASP C 1 113 ? 157.943 135.038 153.917 1.00 128.94 ? 113 ASP C CB    1 
ATOM   7907  C CG    . ASP C 1 113 ? 158.458 133.619 153.836 1.00 128.94 ? 113 ASP C CG    1 
ATOM   7908  O OD1   . ASP C 1 113 ? 157.720 132.697 154.238 1.00 128.94 ? 113 ASP C OD1   1 
ATOM   7909  O OD2   . ASP C 1 113 ? 159.601 133.425 153.371 1.00 128.94 ? 113 ASP C OD2   1 
ATOM   7910  N N     . GLY C 1 114 ? 155.260 137.242 153.388 1.00 128.10 ? 114 GLY C N     1 
ATOM   7911  C CA    . GLY C 1 114 ? 154.827 138.577 153.729 1.00 128.10 ? 114 GLY C CA    1 
ATOM   7912  C C     . GLY C 1 114 ? 155.841 139.666 153.462 1.00 128.10 ? 114 GLY C C     1 
ATOM   7913  O O     . GLY C 1 114 ? 155.555 140.836 153.743 1.00 128.10 ? 114 GLY C O     1 
ATOM   7914  N N     . ASP C 1 115 ? 157.012 139.324 152.933 1.00 126.50 ? 115 ASP C N     1 
ATOM   7915  C CA    . ASP C 1 115 ? 158.015 140.332 152.623 1.00 126.50 ? 115 ASP C CA    1 
ATOM   7916  C C     . ASP C 1 115 ? 157.568 141.168 151.432 1.00 126.50 ? 115 ASP C C     1 
ATOM   7917  O O     . ASP C 1 115 ? 157.144 140.629 150.406 1.00 126.50 ? 115 ASP C O     1 
ATOM   7918  C CB    . ASP C 1 115 ? 159.360 139.672 152.330 1.00 126.50 ? 115 ASP C CB    1 
ATOM   7919  C CG    . ASP C 1 115 ? 159.974 139.035 153.558 1.00 126.50 ? 115 ASP C CG    1 
ATOM   7920  O OD1   . ASP C 1 115 ? 159.701 139.516 154.677 1.00 126.50 ? 115 ASP C OD1   1 
ATOM   7921  O OD2   . ASP C 1 115 ? 160.732 138.055 153.403 1.00 126.50 ? 115 ASP C OD2   1 
ATOM   7922  N N     . SER C 1 116 ? 157.660 142.485 151.571 1.00 119.04 ? 116 SER C N     1 
ATOM   7923  C CA    . SER C 1 116 ? 157.270 143.378 150.495 1.00 119.04 ? 116 SER C CA    1 
ATOM   7924  C C     . SER C 1 116 ? 158.316 143.367 149.386 1.00 119.04 ? 116 SER C C     1 
ATOM   7925  O O     . SER C 1 116 ? 159.467 142.969 149.582 1.00 119.04 ? 116 SER C O     1 
ATOM   7926  C CB    . SER C 1 116 ? 157.076 144.799 151.019 1.00 119.04 ? 116 SER C CB    1 
ATOM   7927  O OG    . SER C 1 116 ? 156.013 144.853 151.954 1.00 119.04 ? 116 SER C OG    1 
ATOM   7928  N N     . ALA C 1 117 ? 157.899 143.816 148.206 1.00 110.64 ? 117 ALA C N     1 
ATOM   7929  C CA    . ALA C 1 117 ? 158.802 143.866 147.071 1.00 110.64 ? 117 ALA C CA    1 
ATOM   7930  C C     . ALA C 1 117 ? 159.789 145.019 147.228 1.00 110.64 ? 117 ALA C C     1 
ATOM   7931  O O     . ALA C 1 117 ? 159.664 145.871 148.112 1.00 110.64 ? 117 ALA C O     1 
ATOM   7932  C CB    . ALA C 1 117 ? 158.017 144.008 145.769 1.00 110.64 ? 117 ALA C CB    1 
ATOM   7933  N N     . ALA C 1 118 ? 160.785 145.040 146.348 1.00 107.83 ? 118 ALA C N     1 
ATOM   7934  C CA    . ALA C 1 118 ? 161.810 146.068 146.393 1.00 107.83 ? 118 ALA C CA    1 
ATOM   7935  C C     . ALA C 1 118 ? 161.254 147.392 145.874 1.00 107.83 ? 118 ALA C C     1 
ATOM   7936  O O     . ALA C 1 118 ? 160.095 147.498 145.466 1.00 107.83 ? 118 ALA C O     1 
ATOM   7937  C CB    . ALA C 1 118 ? 163.032 145.633 145.590 1.00 107.83 ? 118 ALA C CB    1 
ATOM   7938  N N     . ALA C 1 119 ? 162.100 148.419 145.889 1.00 102.96 ? 119 ALA C N     1 
ATOM   7939  C CA    . ALA C 1 119 ? 161.697 149.727 145.406 1.00 102.96 ? 119 ALA C CA    1 
ATOM   7940  C C     . ALA C 1 119 ? 161.458 149.688 143.899 1.00 102.96 ? 119 ALA C C     1 
ATOM   7941  O O     . ALA C 1 119 ? 161.837 148.744 143.201 1.00 102.96 ? 119 ALA C O     1 
ATOM   7942  C CB    . ALA C 1 119 ? 162.754 150.774 145.750 1.00 102.96 ? 119 ALA C CB    1 
ATOM   7943  N N     . MET C 1 120 ? 160.820 150.741 143.394 1.00 106.76 ? 120 MET C N     1 
ATOM   7944  C CA    . MET C 1 120 ? 160.481 150.813 141.979 1.00 106.76 ? 120 MET C CA    1 
ATOM   7945  C C     . MET C 1 120 ? 161.652 151.229 141.101 1.00 106.76 ? 120 MET C C     1 
ATOM   7946  O O     . MET C 1 120 ? 161.441 151.527 139.922 1.00 106.76 ? 120 MET C O     1 
ATOM   7947  C CB    . MET C 1 120 ? 159.313 151.777 141.765 1.00 106.76 ? 120 MET C CB    1 
ATOM   7948  C CG    . MET C 1 120 ? 159.620 153.221 142.098 1.00 106.76 ? 120 MET C CG    1 
ATOM   7949  S SD    . MET C 1 120 ? 158.163 154.264 141.913 1.00 106.76 ? 120 MET C SD    1 
ATOM   7950  C CE    . MET C 1 120 ? 157.219 153.783 143.354 1.00 106.76 ? 120 MET C CE    1 
ATOM   7951  N N     . ARG C 1 121 ? 162.869 151.263 141.636 1.00 103.76 ? 121 ARG C N     1 
ATOM   7952  C CA    . ARG C 1 121 ? 164.048 151.613 140.859 1.00 103.76 ? 121 ARG C CA    1 
ATOM   7953  C C     . ARG C 1 121 ? 164.970 150.425 140.628 1.00 103.76 ? 121 ARG C C     1 
ATOM   7954  O O     . ARG C 1 121 ? 166.104 150.611 140.176 1.00 103.76 ? 121 ARG C O     1 
ATOM   7955  C CB    . ARG C 1 121 ? 164.812 152.747 141.544 1.00 103.76 ? 121 ARG C CB    1 
ATOM   7956  C CG    . ARG C 1 121 ? 165.406 152.377 142.889 1.00 103.76 ? 121 ARG C CG    1 
ATOM   7957  C CD    . ARG C 1 121 ? 166.083 153.573 143.534 1.00 103.76 ? 121 ARG C CD    1 
ATOM   7958  N NE    . ARG C 1 121 ? 167.243 154.019 142.771 1.00 103.76 ? 121 ARG C NE    1 
ATOM   7959  C CZ    . ARG C 1 121 ? 168.461 153.502 142.893 1.00 103.76 ? 121 ARG C CZ    1 
ATOM   7960  N NH1   . ARG C 1 121 ? 169.458 153.970 142.155 1.00 103.76 ? 121 ARG C NH1   1 
ATOM   7961  N NH2   . ARG C 1 121 ? 168.683 152.518 143.753 1.00 103.76 ? 121 ARG C NH2   1 
ATOM   7962  N N     . TYR C 1 122 ? 164.513 149.215 140.922 1.00 105.59 ? 122 TYR C N     1 
ATOM   7963  C CA    . TYR C 1 122 ? 165.309 148.011 140.724 1.00 105.59 ? 122 TYR C CA    1 
ATOM   7964  C C     . TYR C 1 122 ? 164.656 147.006 139.791 1.00 105.59 ? 122 TYR C C     1 
ATOM   7965  O O     . TYR C 1 122 ? 165.357 146.319 139.045 1.00 105.59 ? 122 TYR C O     1 
ATOM   7966  C CB    . TYR C 1 122 ? 165.585 147.328 142.069 1.00 105.59 ? 122 TYR C CB    1 
ATOM   7967  C CG    . TYR C 1 122 ? 166.471 148.117 143.001 1.00 105.59 ? 122 TYR C CG    1 
ATOM   7968  C CD1   . TYR C 1 122 ? 167.850 148.109 142.851 1.00 105.59 ? 122 TYR C CD1   1 
ATOM   7969  C CD2   . TYR C 1 122 ? 165.930 148.861 144.038 1.00 105.59 ? 122 TYR C CD2   1 
ATOM   7970  C CE1   . TYR C 1 122 ? 168.664 148.825 143.705 1.00 105.59 ? 122 TYR C CE1   1 
ATOM   7971  C CE2   . TYR C 1 122 ? 166.735 149.579 144.897 1.00 105.59 ? 122 TYR C CE2   1 
ATOM   7972  C CZ    . TYR C 1 122 ? 168.101 149.558 144.726 1.00 105.59 ? 122 TYR C CZ    1 
ATOM   7973  O OH    . TYR C 1 122 ? 168.907 150.275 145.580 1.00 105.59 ? 122 TYR C OH    1 
ATOM   7974  N N     . THR C 1 123 ? 163.333 146.902 139.810 1.00 104.09 ? 123 THR C N     1 
ATOM   7975  C CA    . THR C 1 123 ? 162.647 145.842 139.095 1.00 104.09 ? 123 THR C CA    1 
ATOM   7976  C C     . THR C 1 123 ? 162.591 146.130 137.598 1.00 104.09 ? 123 THR C C     1 
ATOM   7977  O O     . THR C 1 123 ? 162.804 147.256 137.143 1.00 104.09 ? 123 THR C O     1 
ATOM   7978  C CB    . THR C 1 123 ? 161.232 145.665 139.638 1.00 104.09 ? 123 THR C CB    1 
ATOM   7979  O OG1   . THR C 1 123 ? 160.479 146.859 139.397 1.00 104.09 ? 123 THR C OG1   1 
ATOM   7980  C CG2   . THR C 1 123 ? 161.277 145.407 141.132 1.00 104.09 ? 123 THR C CG2   1 
ATOM   7981  N N     . GLU C 1 124 ? 162.299 145.083 136.833 1.00 106.43 ? 124 GLU C N     1 
ATOM   7982  C CA    . GLU C 1 124 ? 162.136 145.167 135.389 1.00 106.43 ? 124 GLU C CA    1 
ATOM   7983  C C     . GLU C 1 124 ? 160.903 144.374 134.989 1.00 106.43 ? 124 GLU C C     1 
ATOM   7984  O O     . GLU C 1 124 ? 160.644 143.300 135.540 1.00 106.43 ? 124 GLU C O     1 
ATOM   7985  C CB    . GLU C 1 124 ? 163.365 144.628 134.660 1.00 106.43 ? 124 GLU C CB    1 
ATOM   7986  C CG    . GLU C 1 124 ? 164.620 145.449 134.874 1.00 106.43 ? 124 GLU C CG    1 
ATOM   7987  C CD    . GLU C 1 124 ? 165.827 144.854 134.177 1.00 106.43 ? 124 GLU C CD    1 
ATOM   7988  O OE1   . GLU C 1 124 ? 165.708 143.736 133.633 1.00 106.43 ? 124 GLU C OE1   1 
ATOM   7989  O OE2   . GLU C 1 124 ? 166.895 145.502 134.176 1.00 106.43 ? 124 GLU C OE2   1 
ATOM   7990  N N     . ILE C 1 125 ? 160.141 144.902 134.030 1.00 92.57  ? 125 ILE C N     1 
ATOM   7991  C CA    . ILE C 1 125 ? 158.861 144.316 133.652 1.00 92.57  ? 125 ILE C CA    1 
ATOM   7992  C C     . ILE C 1 125 ? 158.705 144.324 132.139 1.00 92.57  ? 125 ILE C C     1 
ATOM   7993  O O     . ILE C 1 125 ? 159.366 145.077 131.422 1.00 92.57  ? 125 ILE C O     1 
ATOM   7994  C CB    . ILE C 1 125 ? 157.672 145.057 134.299 1.00 92.57  ? 125 ILE C CB    1 
ATOM   7995  C CG1   . ILE C 1 125 ? 157.664 146.519 133.866 1.00 92.57  ? 125 ILE C CG1   1 
ATOM   7996  C CG2   . ILE C 1 125 ? 157.722 144.948 135.810 1.00 92.57  ? 125 ILE C CG2   1 
ATOM   7997  C CD1   . ILE C 1 125 ? 156.430 147.266 134.291 1.00 92.57  ? 125 ILE C CD1   1 
ATOM   7998  N N     . ARG C 1 126 ? 157.811 143.461 131.666 1.00 98.40  ? 126 ARG C N     1 
ATOM   7999  C CA    . ARG C 1 126 ? 157.396 143.399 130.271 1.00 98.40  ? 126 ARG C CA    1 
ATOM   8000  C C     . ARG C 1 126 ? 156.158 142.518 130.211 1.00 98.40  ? 126 ARG C C     1 
ATOM   8001  O O     . ARG C 1 126 ? 155.864 141.767 131.144 1.00 98.40  ? 126 ARG C O     1 
ATOM   8002  C CB    . ARG C 1 126 ? 158.499 142.852 129.364 1.00 98.40  ? 126 ARG C CB    1 
ATOM   8003  C CG    . ARG C 1 126 ? 158.841 141.401 129.625 1.00 98.40  ? 126 ARG C CG    1 
ATOM   8004  C CD    . ARG C 1 126 ? 159.956 140.929 128.712 1.00 98.40  ? 126 ARG C CD    1 
ATOM   8005  N NE    . ARG C 1 126 ? 160.303 139.534 128.957 1.00 98.40  ? 126 ARG C NE    1 
ATOM   8006  C CZ    . ARG C 1 126 ? 161.232 138.869 128.282 1.00 98.40  ? 126 ARG C CZ    1 
ATOM   8007  N NH1   . ARG C 1 126 ? 161.911 139.471 127.317 1.00 98.40  ? 126 ARG C NH1   1 
ATOM   8008  N NH2   . ARG C 1 126 ? 161.483 137.600 128.571 1.00 98.40  ? 126 ARG C NH2   1 
ATOM   8009  N N     . LEU C 1 127 ? 155.437 142.612 129.100 1.00 91.81  ? 127 LEU C N     1 
ATOM   8010  C CA    . LEU C 1 127 ? 154.207 141.852 128.961 1.00 91.81  ? 127 LEU C CA    1 
ATOM   8011  C C     . LEU C 1 127 ? 154.503 140.370 128.760 1.00 91.81  ? 127 LEU C C     1 
ATOM   8012  O O     . LEU C 1 127 ? 155.597 139.975 128.351 1.00 91.81  ? 127 LEU C O     1 
ATOM   8013  C CB    . LEU C 1 127 ? 153.379 142.380 127.794 1.00 91.81  ? 127 LEU C CB    1 
ATOM   8014  C CG    . LEU C 1 127 ? 152.846 143.798 127.975 1.00 91.81  ? 127 LEU C CG    1 
ATOM   8015  C CD1   . LEU C 1 127 ? 152.126 144.261 126.723 1.00 91.81  ? 127 LEU C CD1   1 
ATOM   8016  C CD2   . LEU C 1 127 ? 151.929 143.856 129.177 1.00 91.81  ? 127 LEU C CD2   1 
ATOM   8017  N N     . ALA C 1 128 ? 153.505 139.546 129.060 1.00 92.26  ? 128 ALA C N     1 
ATOM   8018  C CA    . ALA C 1 128 ? 153.586 138.108 128.867 1.00 92.26  ? 128 ALA C CA    1 
ATOM   8019  C C     . ALA C 1 128 ? 152.880 137.708 127.576 1.00 92.26  ? 128 ALA C C     1 
ATOM   8020  O O     . ALA C 1 128 ? 152.147 138.491 126.969 1.00 92.26  ? 128 ALA C O     1 
ATOM   8021  C CB    . ALA C 1 128 ? 152.980 137.367 130.061 1.00 92.26  ? 128 ALA C CB    1 
ATOM   8022  N N     . LYS C 1 129 ? 153.111 136.461 127.159 1.00 99.00  ? 129 LYS C N     1 
ATOM   8023  C CA    . LYS C 1 129 ? 152.538 135.990 125.902 1.00 99.00  ? 129 LYS C CA    1 
ATOM   8024  C C     . LYS C 1 129 ? 151.019 136.019 125.929 1.00 99.00  ? 129 LYS C C     1 
ATOM   8025  O O     . LYS C 1 129 ? 150.387 136.302 124.906 1.00 99.00  ? 129 LYS C O     1 
ATOM   8026  C CB    . LYS C 1 129 ? 153.030 134.578 125.591 1.00 99.00  ? 129 LYS C CB    1 
ATOM   8027  C CG    . LYS C 1 129 ? 154.498 134.501 125.225 1.00 99.00  ? 129 LYS C CG    1 
ATOM   8028  C CD    . LYS C 1 129 ? 154.894 133.078 124.881 1.00 99.00  ? 129 LYS C CD    1 
ATOM   8029  C CE    . LYS C 1 129 ? 156.369 132.987 124.543 1.00 99.00  ? 129 LYS C CE    1 
ATOM   8030  N NZ    . LYS C 1 129 ? 156.775 131.595 124.211 1.00 99.00  ? 129 LYS C NZ    1 
ATOM   8031  N N     . ILE C 1 130 ? 150.415 135.736 127.082 1.00 97.54  ? 130 ILE C N     1 
ATOM   8032  C CA    . ILE C 1 130 ? 148.961 135.754 127.170 1.00 97.54  ? 130 ILE C CA    1 
ATOM   8033  C C     . ILE C 1 130 ? 148.409 137.172 127.130 1.00 97.54  ? 130 ILE C C     1 
ATOM   8034  O O     . ILE C 1 130 ? 147.221 137.361 126.844 1.00 97.54  ? 130 ILE C O     1 
ATOM   8035  C CB    . ILE C 1 130 ? 148.496 135.029 128.443 1.00 97.54  ? 130 ILE C CB    1 
ATOM   8036  C CG1   . ILE C 1 130 ? 146.998 134.733 128.380 1.00 97.54  ? 130 ILE C CG1   1 
ATOM   8037  C CG2   . ILE C 1 130 ? 148.814 135.856 129.670 1.00 97.54  ? 130 ILE C CG2   1 
ATOM   8038  C CD1   . ILE C 1 130 ? 146.527 133.772 129.437 1.00 97.54  ? 130 ILE C CD1   1 
ATOM   8039  N N     . ALA C 1 131 ? 149.245 138.181 127.382 1.00 101.45 ? 131 ALA C N     1 
ATOM   8040  C CA    . ALA C 1 131 ? 148.747 139.552 127.428 1.00 101.45 ? 131 ALA C CA    1 
ATOM   8041  C C     . ALA C 1 131 ? 148.303 140.030 126.053 1.00 101.45 ? 131 ALA C C     1 
ATOM   8042  O O     . ALA C 1 131 ? 147.271 140.699 125.928 1.00 101.45 ? 131 ALA C O     1 
ATOM   8043  C CB    . ALA C 1 131 ? 149.817 140.481 127.997 1.00 101.45 ? 131 ALA C CB    1 
ATOM   8044  N N     . HIS C 1 132 ? 149.064 139.697 125.007 1.00 101.78 ? 132 HIS C N     1 
ATOM   8045  C CA    . HIS C 1 132 ? 148.704 140.139 123.666 1.00 101.78 ? 132 HIS C CA    1 
ATOM   8046  C C     . HIS C 1 132 ? 147.393 139.533 123.187 1.00 101.78 ? 132 HIS C C     1 
ATOM   8047  O O     . HIS C 1 132 ? 146.799 140.049 122.235 1.00 101.78 ? 132 HIS C O     1 
ATOM   8048  C CB    . HIS C 1 132 ? 149.822 139.806 122.680 1.00 101.78 ? 132 HIS C CB    1 
ATOM   8049  C CG    . HIS C 1 132 ? 151.072 140.596 122.900 1.00 101.78 ? 132 HIS C CG    1 
ATOM   8050  N ND1   . HIS C 1 132 ? 152.082 140.174 123.736 1.00 101.78 ? 132 HIS C ND1   1 
ATOM   8051  C CD2   . HIS C 1 132 ? 151.473 141.788 122.398 1.00 101.78 ? 132 HIS C CD2   1 
ATOM   8052  C CE1   . HIS C 1 132 ? 153.054 141.068 123.736 1.00 101.78 ? 132 HIS C CE1   1 
ATOM   8053  N NE2   . HIS C 1 132 ? 152.710 142.058 122.932 1.00 101.78 ? 132 HIS C NE2   1 
ATOM   8054  N N     . GLU C 1 133 ? 146.929 138.456 123.819 1.00 105.74 ? 133 GLU C N     1 
ATOM   8055  C CA    . GLU C 1 133 ? 145.615 137.918 123.499 1.00 105.74 ? 133 GLU C CA    1 
ATOM   8056  C C     . GLU C 1 133 ? 144.489 138.770 124.063 1.00 105.74 ? 133 GLU C C     1 
ATOM   8057  O O     . GLU C 1 133 ? 143.371 138.720 123.541 1.00 105.74 ? 133 GLU C O     1 
ATOM   8058  C CB    . GLU C 1 133 ? 145.488 136.488 124.021 1.00 105.74 ? 133 GLU C CB    1 
ATOM   8059  C CG    . GLU C 1 133 ? 146.400 135.498 123.325 1.00 105.74 ? 133 GLU C CG    1 
ATOM   8060  C CD    . GLU C 1 133 ? 146.041 135.310 121.866 1.00 105.74 ? 133 GLU C CD    1 
ATOM   8061  O OE1   . GLU C 1 133 ? 144.844 135.420 121.527 1.00 105.74 ? 133 GLU C OE1   1 
ATOM   8062  O OE2   . GLU C 1 133 ? 146.957 135.054 121.056 1.00 105.74 ? 133 GLU C OE2   1 
ATOM   8063  N N     . LEU C 1 134 ? 144.758 139.549 125.111 1.00 103.33 ? 134 LEU C N     1 
ATOM   8064  C CA    . LEU C 1 134 ? 143.740 140.450 125.640 1.00 103.33 ? 134 LEU C CA    1 
ATOM   8065  C C     . LEU C 1 134 ? 143.510 141.626 124.703 1.00 103.33 ? 134 LEU C C     1 
ATOM   8066  O O     . LEU C 1 134 ? 142.364 142.022 124.463 1.00 103.33 ? 134 LEU C O     1 
ATOM   8067  C CB    . LEU C 1 134 ? 144.145 140.956 127.024 1.00 103.33 ? 134 LEU C CB    1 
ATOM   8068  C CG    . LEU C 1 134 ? 143.793 140.126 128.259 1.00 103.33 ? 134 LEU C CG    1 
ATOM   8069  C CD1   . LEU C 1 134 ? 142.288 140.028 128.418 1.00 103.33 ? 134 LEU C CD1   1 
ATOM   8070  C CD2   . LEU C 1 134 ? 144.423 138.745 128.201 1.00 103.33 ? 134 LEU C CD2   1 
ATOM   8071  N N     . MET C 1 135 ? 144.587 142.195 124.163 1.00 109.07 ? 135 MET C N     1 
ATOM   8072  C CA    . MET C 1 135 ? 144.523 143.427 123.388 1.00 109.07 ? 135 MET C CA    1 
ATOM   8073  C C     . MET C 1 135 ? 144.711 143.186 121.895 1.00 109.07 ? 135 MET C C     1 
ATOM   8074  O O     . MET C 1 135 ? 145.254 144.044 121.192 1.00 109.07 ? 135 MET C O     1 
ATOM   8075  C CB    . MET C 1 135 ? 145.563 144.418 123.904 1.00 109.07 ? 135 MET C CB    1 
ATOM   8076  C CG    . MET C 1 135 ? 145.331 144.832 125.343 1.00 109.07 ? 135 MET C CG    1 
ATOM   8077  S SD    . MET C 1 135 ? 146.587 145.958 125.968 1.00 109.07 ? 135 MET C SD    1 
ATOM   8078  C CE    . MET C 1 135 ? 146.145 147.453 125.091 1.00 109.07 ? 135 MET C CE    1 
ATOM   8079  N N     . ALA C 1 136 ? 144.274 142.035 121.397 1.00 110.08 ? 136 ALA C N     1 
ATOM   8080  C CA    . ALA C 1 136 ? 144.382 141.754 119.973 1.00 110.08 ? 136 ALA C CA    1 
ATOM   8081  C C     . ALA C 1 136 ? 143.368 142.576 119.189 1.00 110.08 ? 136 ALA C C     1 
ATOM   8082  O O     . ALA C 1 136 ? 142.234 142.778 119.631 1.00 110.08 ? 136 ALA C O     1 
ATOM   8083  C CB    . ALA C 1 136 ? 144.169 140.265 119.707 1.00 110.08 ? 136 ALA C CB    1 
ATOM   8084  N N     . ASP C 1 137 ? 143.789 143.053 118.016 1.00 112.25 ? 137 ASP C N     1 
ATOM   8085  C CA    . ASP C 1 137 ? 142.924 143.811 117.111 1.00 112.25 ? 137 ASP C CA    1 
ATOM   8086  C C     . ASP C 1 137 ? 142.416 145.092 117.765 1.00 112.25 ? 137 ASP C C     1 
ATOM   8087  O O     . ASP C 1 137 ? 141.218 145.377 117.766 1.00 112.25 ? 137 ASP C O     1 
ATOM   8088  C CB    . ASP C 1 137 ? 141.755 142.956 116.619 1.00 112.25 ? 137 ASP C CB    1 
ATOM   8089  C CG    . ASP C 1 137 ? 142.203 141.828 115.720 1.00 112.25 ? 137 ASP C CG    1 
ATOM   8090  O OD1   . ASP C 1 137 ? 143.235 141.989 115.036 1.00 112.25 ? 137 ASP C OD1   1 
ATOM   8091  O OD2   . ASP C 1 137 ? 141.528 140.778 115.700 1.00 112.25 ? 137 ASP C OD2   1 
ATOM   8092  N N     . LEU C 1 138 ? 143.337 145.874 118.326 1.00 105.32 ? 138 LEU C N     1 
ATOM   8093  C CA    . LEU C 1 138 ? 142.944 147.103 119.003 1.00 105.32 ? 138 LEU C CA    1 
ATOM   8094  C C     . LEU C 1 138 ? 142.859 148.285 118.048 1.00 105.32 ? 138 LEU C C     1 
ATOM   8095  O O     . LEU C 1 138 ? 142.023 149.174 118.244 1.00 105.32 ? 138 LEU C O     1 
ATOM   8096  C CB    . LEU C 1 138 ? 143.926 147.416 120.131 1.00 105.32 ? 138 LEU C CB    1 
ATOM   8097  C CG    . LEU C 1 138 ? 143.600 148.647 120.976 1.00 105.32 ? 138 LEU C CG    1 
ATOM   8098  C CD1   . LEU C 1 138 ? 142.278 148.458 121.695 1.00 105.32 ? 138 LEU C CD1   1 
ATOM   8099  C CD2   . LEU C 1 138 ? 144.717 148.934 121.963 1.00 105.32 ? 138 LEU C CD2   1 
ATOM   8100  N N     . GLU C 1 139 ? 143.696 148.312 117.016 1.00 119.52 ? 139 GLU C N     1 
ATOM   8101  C CA    . GLU C 1 139 ? 143.785 149.459 116.123 1.00 119.52 ? 139 GLU C CA    1 
ATOM   8102  C C     . GLU C 1 139 ? 142.753 149.441 115.005 1.00 119.52 ? 139 GLU C C     1 
ATOM   8103  O O     . GLU C 1 139 ? 142.625 150.439 114.289 1.00 119.52 ? 139 GLU C O     1 
ATOM   8104  C CB    . GLU C 1 139 ? 145.183 149.532 115.506 1.00 119.52 ? 139 GLU C CB    1 
ATOM   8105  C CG    . GLU C 1 139 ? 145.459 148.434 114.496 1.00 119.52 ? 139 GLU C CG    1 
ATOM   8106  C CD    . GLU C 1 139 ? 145.920 147.145 115.146 1.00 119.52 ? 139 GLU C CD    1 
ATOM   8107  O OE1   . GLU C 1 139 ? 145.743 146.995 116.374 1.00 119.52 ? 139 GLU C OE1   1 
ATOM   8108  O OE2   . GLU C 1 139 ? 146.461 146.280 114.428 1.00 119.52 ? 139 GLU C OE2   1 
ATOM   8109  N N     . LYS C 1 140 ? 142.018 148.348 114.835 1.00 110.12 ? 140 LYS C N     1 
ATOM   8110  C CA    . LYS C 1 140 ? 141.093 148.216 113.719 1.00 110.12 ? 140 LYS C CA    1 
ATOM   8111  C C     . LYS C 1 140 ? 139.699 148.743 114.030 1.00 110.12 ? 140 LYS C C     1 
ATOM   8112  O O     . LYS C 1 140 ? 138.732 148.280 113.418 1.00 110.12 ? 140 LYS C O     1 
ATOM   8113  C CB    . LYS C 1 140 ? 141.011 146.752 113.281 1.00 110.12 ? 140 LYS C CB    1 
ATOM   8114  C CG    . LYS C 1 140 ? 142.298 146.239 112.667 1.00 110.12 ? 140 LYS C CG    1 
ATOM   8115  C CD    . LYS C 1 140 ? 142.167 144.799 112.217 1.00 110.12 ? 140 LYS C CD    1 
ATOM   8116  C CE    . LYS C 1 140 ? 143.471 144.297 111.624 1.00 110.12 ? 140 LYS C CE    1 
ATOM   8117  N NZ    . LYS C 1 140 ? 143.369 142.882 111.182 1.00 110.12 ? 140 LYS C NZ    1 
ATOM   8118  N N     . GLU C 1 141 ? 139.577 149.686 114.965 1.00 113.45 ? 141 GLU C N     1 
ATOM   8119  C CA    . GLU C 1 141 ? 138.310 150.335 115.281 1.00 113.45 ? 141 GLU C CA    1 
ATOM   8120  C C     . GLU C 1 141 ? 137.262 149.333 115.743 1.00 113.45 ? 141 GLU C C     1 
ATOM   8121  O O     . GLU C 1 141 ? 136.188 149.229 115.144 1.00 113.45 ? 141 GLU C O     1 
ATOM   8122  C CB    . GLU C 1 141 ? 137.789 151.113 114.071 1.00 113.45 ? 141 GLU C CB    1 
ATOM   8123  C CG    . GLU C 1 141 ? 138.655 152.289 113.674 1.00 113.45 ? 141 GLU C CG    1 
ATOM   8124  C CD    . GLU C 1 141 ? 138.128 153.005 112.448 1.00 113.45 ? 141 GLU C CD    1 
ATOM   8125  O OE1   . GLU C 1 141 ? 137.160 152.505 111.838 1.00 113.45 ? 141 GLU C OE1   1 
ATOM   8126  O OE2   . GLU C 1 141 ? 138.682 154.068 112.095 1.00 113.45 ? 141 GLU C OE2   1 
ATOM   8127  N N     . THR C 1 142 ? 137.563 148.592 116.807 1.00 101.46 ? 142 THR C N     1 
ATOM   8128  C CA    . THR C 1 142 ? 136.632 147.609 117.337 1.00 101.46 ? 142 THR C CA    1 
ATOM   8129  C C     . THR C 1 142 ? 135.856 148.106 118.547 1.00 101.46 ? 142 THR C C     1 
ATOM   8130  O O     . THR C 1 142 ? 134.793 147.554 118.848 1.00 101.46 ? 142 THR C O     1 
ATOM   8131  C CB    . THR C 1 142 ? 137.377 146.328 117.721 1.00 101.46 ? 142 THR C CB    1 
ATOM   8132  O OG1   . THR C 1 142 ? 138.300 146.616 118.777 1.00 101.46 ? 142 THR C OG1   1 
ATOM   8133  C CG2   . THR C 1 142 ? 138.145 145.794 116.528 1.00 101.46 ? 142 THR C CG2   1 
ATOM   8134  N N     . VAL C 1 143 ? 136.359 149.119 119.247 1.00 101.49 ? 143 VAL C N     1 
ATOM   8135  C CA    . VAL C 1 143 ? 135.716 149.666 120.429 1.00 101.49 ? 143 VAL C CA    1 
ATOM   8136  C C     . VAL C 1 143 ? 135.720 151.188 120.329 1.00 101.49 ? 143 VAL C C     1 
ATOM   8137  O O     . VAL C 1 143 ? 136.230 151.767 119.371 1.00 101.49 ? 143 VAL C O     1 
ATOM   8138  C CB    . VAL C 1 143 ? 136.395 149.202 121.731 1.00 101.49 ? 143 VAL C CB    1 
ATOM   8139  C CG1   . VAL C 1 143 ? 136.288 147.696 121.873 1.00 101.49 ? 143 VAL C CG1   1 
ATOM   8140  C CG2   . VAL C 1 143 ? 137.846 149.640 121.747 1.00 101.49 ? 143 VAL C CG2   1 
ATOM   8141  N N     . ASP C 1 144 ? 135.147 151.830 121.339 1.00 108.59 ? 144 ASP C N     1 
ATOM   8142  C CA    . ASP C 1 144 ? 135.056 153.280 121.379 1.00 108.59 ? 144 ASP C CA    1 
ATOM   8143  C C     . ASP C 1 144 ? 136.209 153.872 122.180 1.00 108.59 ? 144 ASP C C     1 
ATOM   8144  O O     . ASP C 1 144 ? 136.871 153.190 122.965 1.00 108.59 ? 144 ASP C O     1 
ATOM   8145  C CB    . ASP C 1 144 ? 133.724 153.718 121.982 1.00 108.59 ? 144 ASP C CB    1 
ATOM   8146  C CG    . ASP C 1 144 ? 132.548 153.396 121.088 1.00 108.59 ? 144 ASP C CG    1 
ATOM   8147  O OD1   . ASP C 1 144 ? 132.733 153.358 119.854 1.00 108.59 ? 144 ASP C OD1   1 
ATOM   8148  O OD2   . ASP C 1 144 ? 131.439 153.180 121.618 1.00 108.59 ? 144 ASP C OD2   1 
ATOM   8149  N N     . PHE C 1 145 ? 136.441 155.164 121.972 1.00 109.13 ? 145 PHE C N     1 
ATOM   8150  C CA    . PHE C 1 145 ? 137.496 155.896 122.656 1.00 109.13 ? 145 PHE C CA    1 
ATOM   8151  C C     . PHE C 1 145 ? 136.889 156.987 123.525 1.00 109.13 ? 145 PHE C C     1 
ATOM   8152  O O     . PHE C 1 145 ? 135.953 157.676 123.111 1.00 109.13 ? 145 PHE C O     1 
ATOM   8153  C CB    . PHE C 1 145 ? 138.481 156.505 121.659 1.00 109.13 ? 145 PHE C CB    1 
ATOM   8154  C CG    . PHE C 1 145 ? 139.371 155.496 120.999 1.00 109.13 ? 145 PHE C CG    1 
ATOM   8155  C CD1   . PHE C 1 145 ? 139.519 154.230 121.537 1.00 109.13 ? 145 PHE C CD1   1 
ATOM   8156  C CD2   . PHE C 1 145 ? 140.057 155.810 119.841 1.00 109.13 ? 145 PHE C CD2   1 
ATOM   8157  C CE1   . PHE C 1 145 ? 140.336 153.299 120.936 1.00 109.13 ? 145 PHE C CE1   1 
ATOM   8158  C CE2   . PHE C 1 145 ? 140.876 154.881 119.233 1.00 109.13 ? 145 PHE C CE2   1 
ATOM   8159  C CZ    . PHE C 1 145 ? 141.015 153.624 119.782 1.00 109.13 ? 145 PHE C CZ    1 
ATOM   8160  N N     . VAL C 1 146 ? 137.430 157.136 124.731 1.00 116.77 ? 146 VAL C N     1 
ATOM   8161  C CA    . VAL C 1 146 ? 136.951 158.106 125.706 1.00 116.77 ? 146 VAL C CA    1 
ATOM   8162  C C     . VAL C 1 146 ? 138.084 159.071 126.020 1.00 116.77 ? 146 VAL C C     1 
ATOM   8163  O O     . VAL C 1 146 ? 139.250 158.670 126.093 1.00 116.77 ? 146 VAL C O     1 
ATOM   8164  C CB    . VAL C 1 146 ? 136.445 157.411 126.987 1.00 116.77 ? 146 VAL C CB    1 
ATOM   8165  C CG1   . VAL C 1 146 ? 135.988 158.433 128.014 1.00 116.77 ? 146 VAL C CG1   1 
ATOM   8166  C CG2   . VAL C 1 146 ? 135.325 156.440 126.653 1.00 116.77 ? 146 VAL C CG2   1 
ATOM   8167  N N     . ASP C 1 147 ? 137.739 160.342 126.197 1.00 126.80 ? 147 ASP C N     1 
ATOM   8168  C CA    . ASP C 1 147 ? 138.738 161.358 126.478 1.00 126.80 ? 147 ASP C CA    1 
ATOM   8169  C C     . ASP C 1 147 ? 139.325 161.175 127.875 1.00 126.80 ? 147 ASP C C     1 
ATOM   8170  O O     . ASP C 1 147 ? 138.705 160.601 128.773 1.00 126.80 ? 147 ASP C O     1 
ATOM   8171  C CB    . ASP C 1 147 ? 138.130 162.751 126.350 1.00 126.80 ? 147 ASP C CB    1 
ATOM   8172  C CG    . ASP C 1 147 ? 137.744 163.084 124.928 1.00 126.80 ? 147 ASP C CG    1 
ATOM   8173  O OD1   . ASP C 1 147 ? 138.393 162.559 124.000 1.00 126.80 ? 147 ASP C OD1   1 
ATOM   8174  O OD2   . ASP C 1 147 ? 136.791 163.866 124.738 1.00 126.80 ? 147 ASP C OD2   1 
ATOM   8175  N N     . ASN C 1 148 ? 140.541 161.683 128.048 1.00 129.58 ? 148 ASN C N     1 
ATOM   8176  C CA    . ASN C 1 148 ? 141.221 161.640 129.333 1.00 129.58 ? 148 ASN C CA    1 
ATOM   8177  C C     . ASN C 1 148 ? 140.703 162.759 130.236 1.00 129.58 ? 148 ASN C C     1 
ATOM   8178  O O     . ASN C 1 148 ? 139.682 163.395 129.960 1.00 129.58 ? 148 ASN C O     1 
ATOM   8179  C CB    . ASN C 1 148 ? 142.732 161.712 129.132 1.00 129.58 ? 148 ASN C CB    1 
ATOM   8180  C CG    . ASN C 1 148 ? 143.157 162.930 128.343 1.00 129.58 ? 148 ASN C CG    1 
ATOM   8181  O OD1   . ASN C 1 148 ? 142.334 163.764 127.976 1.00 129.58 ? 148 ASN C OD1   1 
ATOM   8182  N ND2   . ASN C 1 148 ? 144.453 163.042 128.084 1.00 129.58 ? 148 ASN C ND2   1 
ATOM   8183  N N     . TYR C 1 149 ? 141.413 162.999 131.341 1.00 127.45 ? 149 TYR C N     1 
ATOM   8184  C CA    . TYR C 1 149 ? 140.937 163.953 132.339 1.00 127.45 ? 149 TYR C CA    1 
ATOM   8185  C C     . TYR C 1 149 ? 140.868 165.369 131.778 1.00 127.45 ? 149 TYR C C     1 
ATOM   8186  O O     . TYR C 1 149 ? 139.944 166.125 132.100 1.00 127.45 ? 149 TYR C O     1 
ATOM   8187  C CB    . TYR C 1 149 ? 141.832 163.903 133.578 1.00 127.45 ? 149 TYR C CB    1 
ATOM   8188  C CG    . TYR C 1 149 ? 143.270 164.300 133.327 1.00 127.45 ? 149 TYR C CG    1 
ATOM   8189  C CD1   . TYR C 1 149 ? 144.209 163.360 132.927 1.00 127.45 ? 149 TYR C CD1   1 
ATOM   8190  C CD2   . TYR C 1 149 ? 143.692 165.610 133.508 1.00 127.45 ? 149 TYR C CD2   1 
ATOM   8191  C CE1   . TYR C 1 149 ? 145.524 163.716 132.701 1.00 127.45 ? 149 TYR C CE1   1 
ATOM   8192  C CE2   . TYR C 1 149 ? 145.004 165.974 133.284 1.00 127.45 ? 149 TYR C CE2   1 
ATOM   8193  C CZ    . TYR C 1 149 ? 145.915 165.023 132.882 1.00 127.45 ? 149 TYR C CZ    1 
ATOM   8194  O OH    . TYR C 1 149 ? 147.222 165.384 132.660 1.00 127.45 ? 149 TYR C OH    1 
ATOM   8195  N N     . ASP C 1 150 ? 141.831 165.750 130.944 1.00 134.09 ? 150 ASP C N     1 
ATOM   8196  C CA    . ASP C 1 150 ? 141.857 167.090 130.375 1.00 134.09 ? 150 ASP C CA    1 
ATOM   8197  C C     . ASP C 1 150 ? 141.343 167.145 128.943 1.00 134.09 ? 150 ASP C C     1 
ATOM   8198  O O     . ASP C 1 150 ? 141.365 168.220 128.335 1.00 134.09 ? 150 ASP C O     1 
ATOM   8199  C CB    . ASP C 1 150 ? 143.275 167.667 130.437 1.00 134.09 ? 150 ASP C CB    1 
ATOM   8200  C CG    . ASP C 1 150 ? 144.281 166.831 129.675 1.00 134.09 ? 150 ASP C CG    1 
ATOM   8201  O OD1   . ASP C 1 150 ? 143.906 165.753 129.172 1.00 134.09 ? 150 ASP C OD1   1 
ATOM   8202  O OD2   . ASP C 1 150 ? 145.449 167.255 129.573 1.00 134.09 ? 150 ASP C OD2   1 
ATOM   8203  N N     . GLY C 1 151 ? 140.892 166.023 128.389 1.00 132.25 ? 151 GLY C N     1 
ATOM   8204  C CA    . GLY C 1 151 ? 140.352 166.025 127.045 1.00 132.25 ? 151 GLY C CA    1 
ATOM   8205  C C     . GLY C 1 151 ? 141.381 166.164 125.949 1.00 132.25 ? 151 GLY C C     1 
ATOM   8206  O O     . GLY C 1 151 ? 141.109 166.814 124.935 1.00 132.25 ? 151 GLY C O     1 
ATOM   8207  N N     . THR C 1 152 ? 142.564 165.574 126.121 1.00 134.15 ? 152 THR C N     1 
ATOM   8208  C CA    . THR C 1 152 ? 143.625 165.671 125.132 1.00 134.15 ? 152 THR C CA    1 
ATOM   8209  C C     . THR C 1 152 ? 144.052 164.331 124.553 1.00 134.15 ? 152 THR C C     1 
ATOM   8210  O O     . THR C 1 152 ? 144.836 164.316 123.598 1.00 134.15 ? 152 THR C O     1 
ATOM   8211  C CB    . THR C 1 152 ? 144.860 166.362 125.731 1.00 134.15 ? 152 THR C CB    1 
ATOM   8212  O OG1   . THR C 1 152 ? 145.365 165.579 126.819 1.00 134.15 ? 152 THR C OG1   1 
ATOM   8213  C CG2   . THR C 1 152 ? 144.502 167.750 126.236 1.00 134.15 ? 152 THR C CG2   1 
ATOM   8214  N N     . GLU C 1 153 ? 143.572 163.215 125.095 1.00 130.43 ? 153 GLU C N     1 
ATOM   8215  C CA    . GLU C 1 153 ? 143.926 161.894 124.601 1.00 130.43 ? 153 GLU C CA    1 
ATOM   8216  C C     . GLU C 1 153 ? 142.677 161.029 124.511 1.00 130.43 ? 153 GLU C C     1 
ATOM   8217  O O     . GLU C 1 153 ? 141.570 161.452 124.852 1.00 130.43 ? 153 GLU C O     1 
ATOM   8218  C CB    . GLU C 1 153 ? 144.974 161.221 125.496 1.00 130.43 ? 153 GLU C CB    1 
ATOM   8219  C CG    . GLU C 1 153 ? 146.320 161.921 125.496 1.00 130.43 ? 153 GLU C CG    1 
ATOM   8220  C CD    . GLU C 1 153 ? 147.003 161.859 124.146 1.00 130.43 ? 153 GLU C CD    1 
ATOM   8221  O OE1   . GLU C 1 153 ? 146.819 160.852 123.430 1.00 130.43 ? 153 GLU C OE1   1 
ATOM   8222  O OE2   . GLU C 1 153 ? 147.719 162.821 123.797 1.00 130.43 ? 153 GLU C OE2   1 
ATOM   8223  N N     . LYS C 1 154 ? 142.870 159.802 124.040 1.00 111.91 ? 154 LYS C N     1 
ATOM   8224  C CA    . LYS C 1 154 ? 141.795 158.833 123.896 1.00 111.91 ? 154 LYS C CA    1 
ATOM   8225  C C     . LYS C 1 154 ? 142.147 157.566 124.661 1.00 111.91 ? 154 LYS C C     1 
ATOM   8226  O O     . LYS C 1 154 ? 143.311 157.155 124.700 1.00 111.91 ? 154 LYS C O     1 
ATOM   8227  C CB    . LYS C 1 154 ? 141.545 158.505 122.425 1.00 111.91 ? 154 LYS C CB    1 
ATOM   8228  C CG    . LYS C 1 154 ? 141.119 159.701 121.593 1.00 111.91 ? 154 LYS C CG    1 
ATOM   8229  C CD    . LYS C 1 154 ? 139.745 160.196 122.005 1.00 111.91 ? 154 LYS C CD    1 
ATOM   8230  C CE    . LYS C 1 154 ? 139.280 161.329 121.108 1.00 111.91 ? 154 LYS C CE    1 
ATOM   8231  N NZ    . LYS C 1 154 ? 137.948 161.848 121.521 1.00 111.91 ? 154 LYS C NZ    1 
ATOM   8232  N N     . ILE C 1 155 ? 141.138 156.953 125.272 1.00 104.24 ? 155 ILE C N     1 
ATOM   8233  C CA    . ILE C 1 155 ? 141.327 155.719 126.029 1.00 104.24 ? 155 ILE C CA    1 
ATOM   8234  C C     . ILE C 1 155 ? 140.278 154.705 125.593 1.00 104.24 ? 155 ILE C C     1 
ATOM   8235  O O     . ILE C 1 155 ? 139.093 155.049 125.487 1.00 104.24 ? 155 ILE C O     1 
ATOM   8236  C CB    . ILE C 1 155 ? 141.247 155.967 127.542 1.00 104.24 ? 155 ILE C CB    1 
ATOM   8237  C CG1   . ILE C 1 155 ? 142.399 156.853 128.009 1.00 104.24 ? 155 ILE C CG1   1 
ATOM   8238  C CG2   . ILE C 1 155 ? 141.252 154.652 128.297 1.00 104.24 ? 155 ILE C CG2   1 
ATOM   8239  C CD1   . ILE C 1 155 ? 142.080 158.325 128.019 1.00 104.24 ? 155 ILE C CD1   1 
ATOM   8240  N N     . PRO C 1 156 ? 140.663 153.462 125.319 1.00 99.50  ? 156 PRO C N     1 
ATOM   8241  C CA    . PRO C 1 156 ? 139.662 152.440 124.999 1.00 99.50  ? 156 PRO C CA    1 
ATOM   8242  C C     . PRO C 1 156 ? 138.730 152.201 126.175 1.00 99.50  ? 156 PRO C C     1 
ATOM   8243  O O     . PRO C 1 156 ? 139.148 152.187 127.334 1.00 99.50  ? 156 PRO C O     1 
ATOM   8244  C CB    . PRO C 1 156 ? 140.509 151.201 124.691 1.00 99.50  ? 156 PRO C CB    1 
ATOM   8245  C CG    . PRO C 1 156 ? 141.838 151.747 124.298 1.00 99.50  ? 156 PRO C CG    1 
ATOM   8246  C CD    . PRO C 1 156 ? 142.036 152.963 125.146 1.00 99.50  ? 156 PRO C CD    1 
ATOM   8247  N N     . ASP C 1 157 ? 137.448 152.024 125.864 1.00 103.75 ? 157 ASP C N     1 
ATOM   8248  C CA    . ASP C 1 157 ? 136.462 151.785 126.908 1.00 103.75 ? 157 ASP C CA    1 
ATOM   8249  C C     . ASP C 1 157 ? 136.562 150.361 127.440 1.00 103.75 ? 157 ASP C C     1 
ATOM   8250  O O     . ASP C 1 157 ? 136.747 150.146 128.642 1.00 103.75 ? 157 ASP C O     1 
ATOM   8251  C CB    . ASP C 1 157 ? 135.058 152.064 126.375 1.00 103.75 ? 157 ASP C CB    1 
ATOM   8252  C CG    . ASP C 1 157 ? 134.002 151.958 127.448 1.00 103.75 ? 157 ASP C CG    1 
ATOM   8253  O OD1   . ASP C 1 157 ? 133.918 152.879 128.289 1.00 103.75 ? 157 ASP C OD1   1 
ATOM   8254  O OD2   . ASP C 1 157 ? 133.256 150.958 127.451 1.00 103.75 ? 157 ASP C OD2   1 
ATOM   8255  N N     . VAL C 1 158 ? 136.429 149.374 126.560 1.00 95.22  ? 158 VAL C N     1 
ATOM   8256  C CA    . VAL C 1 158 ? 136.545 147.970 126.927 1.00 95.22  ? 158 VAL C CA    1 
ATOM   8257  C C     . VAL C 1 158 ? 137.533 147.303 125.982 1.00 95.22  ? 158 VAL C C     1 
ATOM   8258  O O     . VAL C 1 158 ? 137.602 147.645 124.797 1.00 95.22  ? 158 VAL C O     1 
ATOM   8259  C CB    . VAL C 1 158 ? 135.184 147.250 126.900 1.00 95.22  ? 158 VAL C CB    1 
ATOM   8260  C CG1   . VAL C 1 158 ? 134.255 147.844 127.946 1.00 95.22  ? 158 VAL C CG1   1 
ATOM   8261  C CG2   . VAL C 1 158 ? 134.559 147.343 125.514 1.00 95.22  ? 158 VAL C CG2   1 
ATOM   8262  N N     . MET C 1 159 ? 138.303 146.363 126.507 1.00 95.97  ? 159 MET C N     1 
ATOM   8263  C CA    . MET C 1 159 ? 139.322 145.703 125.703 1.00 95.97  ? 159 MET C CA    1 
ATOM   8264  C C     . MET C 1 159 ? 138.682 144.657 124.798 1.00 95.97  ? 159 MET C C     1 
ATOM   8265  O O     . MET C 1 159 ? 137.815 143.900 125.249 1.00 95.97  ? 159 MET C O     1 
ATOM   8266  C CB    . MET C 1 159 ? 140.368 145.052 126.602 1.00 95.97  ? 159 MET C CB    1 
ATOM   8267  C CG    . MET C 1 159 ? 141.242 146.033 127.362 1.00 95.97  ? 159 MET C CG    1 
ATOM   8268  S SD    . MET C 1 159 ? 142.260 147.023 126.255 1.00 95.97  ? 159 MET C SD    1 
ATOM   8269  C CE    . MET C 1 159 ? 143.008 148.160 127.414 1.00 95.97  ? 159 MET C CE    1 
ATOM   8270  N N     . PRO C 1 160 ? 139.068 144.585 123.529 1.00 93.77  ? 160 PRO C N     1 
ATOM   8271  C CA    . PRO C 1 160 ? 138.554 143.520 122.661 1.00 93.77  ? 160 PRO C CA    1 
ATOM   8272  C C     . PRO C 1 160 ? 139.188 142.186 123.005 1.00 93.77  ? 160 PRO C C     1 
ATOM   8273  O O     . PRO C 1 160 ? 140.100 141.723 122.313 1.00 93.77  ? 160 PRO C O     1 
ATOM   8274  C CB    . PRO C 1 160 ? 138.950 143.991 121.259 1.00 93.77  ? 160 PRO C CB    1 
ATOM   8275  C CG    . PRO C 1 160 ? 140.164 144.824 121.487 1.00 93.77  ? 160 PRO C CG    1 
ATOM   8276  C CD    . PRO C 1 160 ? 139.960 145.508 122.809 1.00 93.77  ? 160 PRO C CD    1 
ATOM   8277  N N     . THR C 1 161 ? 138.713 141.562 124.075 1.00 96.44  ? 161 THR C N     1 
ATOM   8278  C CA    . THR C 1 161 ? 139.370 140.386 124.614 1.00 96.44  ? 161 THR C CA    1 
ATOM   8279  C C     . THR C 1 161 ? 138.992 139.133 123.830 1.00 96.44  ? 161 THR C C     1 
ATOM   8280  O O     . THR C 1 161 ? 138.029 139.105 123.060 1.00 96.44  ? 161 THR C O     1 
ATOM   8281  C CB    . THR C 1 161 ? 139.009 140.200 126.084 1.00 96.44  ? 161 THR C CB    1 
ATOM   8282  O OG1   . THR C 1 161 ? 139.745 139.094 126.618 1.00 96.44  ? 161 THR C OG1   1 
ATOM   8283  C CG2   . THR C 1 161 ? 137.525 139.931 126.230 1.00 96.44  ? 161 THR C CG2   1 
ATOM   8284  N N     . LYS C 1 162 ? 139.785 138.083 124.037 1.00 93.89  ? 162 LYS C N     1 
ATOM   8285  C CA    . LYS C 1 162 ? 139.482 136.749 123.544 1.00 93.89  ? 162 LYS C CA    1 
ATOM   8286  C C     . LYS C 1 162 ? 139.337 135.740 124.670 1.00 93.89  ? 162 LYS C C     1 
ATOM   8287  O O     . LYS C 1 162 ? 139.090 134.560 124.398 1.00 93.89  ? 162 LYS C O     1 
ATOM   8288  C CB    . LYS C 1 162 ? 140.572 136.270 122.578 1.00 93.89  ? 162 LYS C CB    1 
ATOM   8289  C CG    . LYS C 1 162 ? 140.634 137.036 121.276 1.00 93.89  ? 162 LYS C CG    1 
ATOM   8290  C CD    . LYS C 1 162 ? 141.718 136.480 120.372 1.00 93.89  ? 162 LYS C CD    1 
ATOM   8291  C CE    . LYS C 1 162 ? 141.801 137.257 119.072 1.00 93.89  ? 162 LYS C CE    1 
ATOM   8292  N NZ    . LYS C 1 162 ? 142.868 136.724 118.184 1.00 93.89  ? 162 LYS C NZ    1 
ATOM   8293  N N     . ILE C 1 163 ? 139.490 136.163 125.920 1.00 97.43  ? 163 ILE C N     1 
ATOM   8294  C CA    . ILE C 1 163 ? 139.440 135.263 127.067 1.00 97.43  ? 163 ILE C CA    1 
ATOM   8295  C C     . ILE C 1 163 ? 138.487 135.838 128.106 1.00 97.43  ? 163 ILE C C     1 
ATOM   8296  O O     . ILE C 1 163 ? 138.597 137.021 128.455 1.00 97.43  ? 163 ILE C O     1 
ATOM   8297  C CB    . ILE C 1 163 ? 140.836 135.045 127.672 1.00 97.43  ? 163 ILE C CB    1 
ATOM   8298  C CG1   . ILE C 1 163 ? 141.756 134.323 126.686 1.00 97.43  ? 163 ILE C CG1   1 
ATOM   8299  C CG2   . ILE C 1 163 ? 140.735 134.275 128.974 1.00 97.43  ? 163 ILE C CG2   1 
ATOM   8300  C CD1   . ILE C 1 163 ? 142.571 135.250 125.814 1.00 97.43  ? 163 ILE C CD1   1 
ATOM   8301  N N     . PRO C 1 164 ? 137.552 135.051 128.629 1.00 98.55  ? 164 PRO C N     1 
ATOM   8302  C CA    . PRO C 1 164 ? 136.668 135.562 129.685 1.00 98.55  ? 164 PRO C CA    1 
ATOM   8303  C C     . PRO C 1 164 ? 137.411 135.732 130.999 1.00 98.55  ? 164 PRO C C     1 
ATOM   8304  O O     . PRO C 1 164 ? 137.332 134.878 131.888 1.00 98.55  ? 164 PRO C O     1 
ATOM   8305  C CB    . PRO C 1 164 ? 135.579 134.489 129.778 1.00 98.55  ? 164 PRO C CB    1 
ATOM   8306  C CG    . PRO C 1 164 ? 136.245 133.246 129.300 1.00 98.55  ? 164 PRO C CG    1 
ATOM   8307  C CD    . PRO C 1 164 ? 137.216 133.672 128.240 1.00 98.55  ? 164 PRO C CD    1 
ATOM   8308  N N     . ASN C 1 165 ? 138.139 136.844 131.122 1.00 98.66  ? 165 ASN C N     1 
ATOM   8309  C CA    . ASN C 1 165 ? 139.014 137.046 132.271 1.00 98.66  ? 165 ASN C CA    1 
ATOM   8310  C C     . ASN C 1 165 ? 138.240 137.060 133.582 1.00 98.66  ? 165 ASN C C     1 
ATOM   8311  O O     . ASN C 1 165 ? 138.773 136.648 134.619 1.00 98.66  ? 165 ASN C O     1 
ATOM   8312  C CB    . ASN C 1 165 ? 139.792 138.351 132.104 1.00 98.66  ? 165 ASN C CB    1 
ATOM   8313  C CG    . ASN C 1 165 ? 140.924 138.491 133.099 1.00 98.66  ? 165 ASN C CG    1 
ATOM   8314  O OD1   . ASN C 1 165 ? 141.188 137.593 133.895 1.00 98.66  ? 165 ASN C OD1   1 
ATOM   8315  N ND2   . ASN C 1 165 ? 141.594 139.635 133.066 1.00 98.66  ? 165 ASN C ND2   1 
ATOM   8316  N N     . LEU C 1 166 ? 136.987 137.519 133.560 1.00 91.76  ? 166 LEU C N     1 
ATOM   8317  C CA    . LEU C 1 166 ? 136.225 137.644 134.798 1.00 91.76  ? 166 LEU C CA    1 
ATOM   8318  C C     . LEU C 1 166 ? 136.099 136.306 135.515 1.00 91.76  ? 166 LEU C C     1 
ATOM   8319  O O     . LEU C 1 166 ? 136.201 136.241 136.745 1.00 91.76  ? 166 LEU C O     1 
ATOM   8320  C CB    . LEU C 1 166 ? 134.844 138.230 134.509 1.00 91.76  ? 166 LEU C CB    1 
ATOM   8321  C CG    . LEU C 1 166 ? 133.968 138.470 135.738 1.00 91.76  ? 166 LEU C CG    1 
ATOM   8322  C CD1   . LEU C 1 166 ? 134.631 139.460 136.675 1.00 91.76  ? 166 LEU C CD1   1 
ATOM   8323  C CD2   . LEU C 1 166 ? 132.599 138.968 135.319 1.00 91.76  ? 166 LEU C CD2   1 
ATOM   8324  N N     . LEU C 1 167 ? 135.885 135.226 134.765 1.00 86.53  ? 167 LEU C N     1 
ATOM   8325  C CA    . LEU C 1 167 ? 135.773 133.909 135.376 1.00 86.53  ? 167 LEU C CA    1 
ATOM   8326  C C     . LEU C 1 167 ? 137.122 133.240 135.584 1.00 86.53  ? 167 LEU C C     1 
ATOM   8327  O O     . LEU C 1 167 ? 137.210 132.284 136.361 1.00 86.53  ? 167 LEU C O     1 
ATOM   8328  C CB    . LEU C 1 167 ? 134.886 133.006 134.522 1.00 86.53  ? 167 LEU C CB    1 
ATOM   8329  C CG    . LEU C 1 167 ? 133.420 133.421 134.442 1.00 86.53  ? 167 LEU C CG    1 
ATOM   8330  C CD1   . LEU C 1 167 ? 132.673 132.535 133.463 1.00 86.53  ? 167 LEU C CD1   1 
ATOM   8331  C CD2   . LEU C 1 167 ? 132.782 133.367 135.818 1.00 86.53  ? 167 LEU C CD2   1 
ATOM   8332  N N     . VAL C 1 168 ? 138.169 133.712 134.912 1.00 85.76  ? 168 VAL C N     1 
ATOM   8333  C CA    . VAL C 1 168 ? 139.473 133.072 135.035 1.00 85.76  ? 168 VAL C CA    1 
ATOM   8334  C C     . VAL C 1 168 ? 140.188 133.538 136.295 1.00 85.76  ? 168 VAL C C     1 
ATOM   8335  O O     . VAL C 1 168 ? 140.717 132.727 137.061 1.00 85.76  ? 168 VAL C O     1 
ATOM   8336  C CB    . VAL C 1 168 ? 140.316 133.336 133.778 1.00 85.76  ? 168 VAL C CB    1 
ATOM   8337  C CG1   . VAL C 1 168 ? 141.716 132.793 133.965 1.00 85.76  ? 168 VAL C CG1   1 
ATOM   8338  C CG2   . VAL C 1 168 ? 139.660 132.703 132.570 1.00 85.76  ? 168 VAL C CG2   1 
ATOM   8339  N N     . ASN C 1 169 ? 140.213 134.847 136.533 1.00 85.14  ? 169 ASN C N     1 
ATOM   8340  C CA    . ASN C 1 169 ? 140.913 135.415 137.676 1.00 85.14  ? 169 ASN C CA    1 
ATOM   8341  C C     . ASN C 1 169 ? 139.975 135.942 138.748 1.00 85.14  ? 169 ASN C C     1 
ATOM   8342  O O     . ASN C 1 169 ? 140.175 135.667 139.934 1.00 85.14  ? 169 ASN C O     1 
ATOM   8343  C CB    . ASN C 1 169 ? 141.846 136.541 137.216 1.00 85.14  ? 169 ASN C CB    1 
ATOM   8344  C CG    . ASN C 1 169 ? 143.036 136.026 136.445 1.00 85.14  ? 169 ASN C CG    1 
ATOM   8345  O OD1   . ASN C 1 169 ? 143.632 135.014 136.807 1.00 85.14  ? 169 ASN C OD1   1 
ATOM   8346  N ND2   . ASN C 1 169 ? 143.392 136.723 135.374 1.00 85.14  ? 169 ASN C ND2   1 
ATOM   8347  N N     . GLY C 1 170 ? 138.957 136.702 138.366 1.00 86.07  ? 170 GLY C N     1 
ATOM   8348  C CA    . GLY C 1 170 ? 138.088 137.330 139.339 1.00 86.07  ? 170 GLY C CA    1 
ATOM   8349  C C     . GLY C 1 170 ? 138.809 138.445 140.076 1.00 86.07  ? 170 GLY C C     1 
ATOM   8350  O O     . GLY C 1 170 ? 139.991 138.713 139.873 1.00 86.07  ? 170 GLY C O     1 
ATOM   8351  N N     . SER C 1 171 ? 138.066 139.106 140.959 1.00 92.07  ? 171 SER C N     1 
ATOM   8352  C CA    . SER C 1 171 ? 138.608 140.225 141.712 1.00 92.07  ? 171 SER C CA    1 
ATOM   8353  C C     . SER C 1 171 ? 137.843 140.364 143.019 1.00 92.07  ? 171 SER C C     1 
ATOM   8354  O O     . SER C 1 171 ? 136.899 139.619 143.295 1.00 92.07  ? 171 SER C O     1 
ATOM   8355  C CB    . SER C 1 171 ? 138.546 141.518 140.898 1.00 92.07  ? 171 SER C CB    1 
ATOM   8356  O OG    . SER C 1 171 ? 139.033 142.609 141.658 1.00 92.07  ? 171 SER C OG    1 
ATOM   8357  N N     . SER C 1 172 ? 138.262 141.334 143.828 1.00 97.63  ? 172 SER C N     1 
ATOM   8358  C CA    . SER C 1 172 ? 137.629 141.586 145.118 1.00 97.63  ? 172 SER C CA    1 
ATOM   8359  C C     . SER C 1 172 ? 137.755 143.069 145.424 1.00 97.63  ? 172 SER C C     1 
ATOM   8360  O O     . SER C 1 172 ? 138.861 143.561 145.664 1.00 97.63  ? 172 SER C O     1 
ATOM   8361  C CB    . SER C 1 172 ? 138.270 140.747 146.218 1.00 97.63  ? 172 SER C CB    1 
ATOM   8362  O OG    . SER C 1 172 ? 138.072 139.366 145.981 1.00 97.63  ? 172 SER C OG    1 
ATOM   8363  N N     . GLY C 1 173 ? 136.626 143.775 145.421 1.00 96.89  ? 173 GLY C N     1 
ATOM   8364  C CA    . GLY C 1 173 ? 136.615 145.184 145.731 1.00 96.89  ? 173 GLY C CA    1 
ATOM   8365  C C     . GLY C 1 173 ? 135.517 145.506 146.725 1.00 96.89  ? 173 GLY C C     1 
ATOM   8366  O O     . GLY C 1 173 ? 134.587 144.730 146.936 1.00 96.89  ? 173 GLY C O     1 
ATOM   8367  N N     . ILE C 1 174 ? 135.642 146.681 147.333 1.00 95.07  ? 174 ILE C N     1 
ATOM   8368  C CA    . ILE C 1 174 ? 134.706 147.148 148.347 1.00 95.07  ? 174 ILE C CA    1 
ATOM   8369  C C     . ILE C 1 174 ? 134.309 148.582 148.017 1.00 95.07  ? 174 ILE C C     1 
ATOM   8370  O O     . ILE C 1 174 ? 135.133 149.499 148.106 1.00 95.07  ? 174 ILE C O     1 
ATOM   8371  C CB    . ILE C 1 174 ? 135.287 147.029 149.763 1.00 95.07  ? 174 ILE C CB    1 
ATOM   8372  C CG1   . ILE C 1 174 ? 136.695 147.614 149.835 1.00 95.07  ? 174 ILE C CG1   1 
ATOM   8373  C CG2   . ILE C 1 174 ? 135.308 145.584 150.209 1.00 95.07  ? 174 ILE C CG2   1 
ATOM   8374  C CD1   . ILE C 1 174 ? 137.238 147.662 151.229 1.00 95.07  ? 174 ILE C CD1   1 
ATOM   8375  N N     . ALA C 1 175 ? 133.058 148.770 147.614 1.00 99.67  ? 175 ALA C N     1 
ATOM   8376  C CA    . ALA C 1 175 ? 132.537 150.080 147.260 1.00 99.67  ? 175 ALA C CA    1 
ATOM   8377  C C     . ALA C 1 175 ? 131.866 150.721 148.473 1.00 99.67  ? 175 ALA C C     1 
ATOM   8378  O O     . ALA C 1 175 ? 132.025 150.276 149.612 1.00 99.67  ? 175 ALA C O     1 
ATOM   8379  C CB    . ALA C 1 175 ? 131.577 149.966 146.081 1.00 99.67  ? 175 ALA C CB    1 
ATOM   8380  N N     . VAL C 1 176 ? 131.103 151.788 148.234 1.00 97.09  ? 176 VAL C N     1 
ATOM   8381  C CA    . VAL C 1 176 ? 130.408 152.469 149.321 1.00 97.09  ? 176 VAL C CA    1 
ATOM   8382  C C     . VAL C 1 176 ? 129.240 151.627 149.821 1.00 97.09  ? 176 VAL C C     1 
ATOM   8383  O O     . VAL C 1 176 ? 128.982 151.548 151.027 1.00 97.09  ? 176 VAL C O     1 
ATOM   8384  C CB    . VAL C 1 176 ? 129.944 153.863 148.864 1.00 97.09  ? 176 VAL C CB    1 
ATOM   8385  C CG1   . VAL C 1 176 ? 129.122 154.534 149.947 1.00 97.09  ? 176 VAL C CG1   1 
ATOM   8386  C CG2   . VAL C 1 176 ? 131.142 154.717 148.496 1.00 97.09  ? 176 VAL C CG2   1 
ATOM   8387  N N     . GLY C 1 177 ? 128.516 150.990 148.906 1.00 102.14 ? 177 GLY C N     1 
ATOM   8388  C CA    . GLY C 1 177 ? 127.350 150.220 149.287 1.00 102.14 ? 177 GLY C CA    1 
ATOM   8389  C C     . GLY C 1 177 ? 127.459 148.736 149.009 1.00 102.14 ? 177 GLY C C     1 
ATOM   8390  O O     . GLY C 1 177 ? 126.835 147.925 149.699 1.00 102.14 ? 177 GLY C O     1 
ATOM   8391  N N     . MET C 1 178 ? 128.241 148.366 148.003 1.00 107.05 ? 178 MET C N     1 
ATOM   8392  C CA    . MET C 1 178 ? 128.345 146.985 147.564 1.00 107.05 ? 178 MET C CA    1 
ATOM   8393  C C     . MET C 1 178 ? 129.750 146.448 147.803 1.00 107.05 ? 178 MET C C     1 
ATOM   8394  O O     . MET C 1 178 ? 130.682 147.193 148.118 1.00 107.05 ? 178 MET C O     1 
ATOM   8395  C CB    . MET C 1 178 ? 127.985 146.861 146.080 1.00 107.05 ? 178 MET C CB    1 
ATOM   8396  C CG    . MET C 1 178 ? 126.547 147.233 145.763 1.00 107.05 ? 178 MET C CG    1 
ATOM   8397  S SD    . MET C 1 178 ? 125.348 146.171 146.588 1.00 107.05 ? 178 MET C SD    1 
ATOM   8398  C CE    . MET C 1 178 ? 125.594 144.635 145.700 1.00 107.05 ? 178 MET C CE    1 
ATOM   8399  N N     . ALA C 1 179 ? 129.887 145.134 147.649 1.00 104.84 ? 179 ALA C N     1 
ATOM   8400  C CA    . ALA C 1 179 ? 131.175 144.464 147.747 1.00 104.84 ? 179 ALA C CA    1 
ATOM   8401  C C     . ALA C 1 179 ? 131.097 143.161 146.967 1.00 104.84 ? 179 ALA C C     1 
ATOM   8402  O O     . ALA C 1 179 ? 130.058 142.497 146.966 1.00 104.84 ? 179 ALA C O     1 
ATOM   8403  C CB    . ALA C 1 179 ? 131.562 144.194 149.203 1.00 104.84 ? 179 ALA C CB    1 
ATOM   8404  N N     . THR C 1 180 ? 132.195 142.798 146.308 1.00 102.40 ? 180 THR C N     1 
ATOM   8405  C CA    . THR C 1 180 ? 132.211 141.650 145.414 1.00 102.40 ? 180 THR C CA    1 
ATOM   8406  C C     . THR C 1 180 ? 133.356 140.712 145.767 1.00 102.40 ? 180 THR C C     1 
ATOM   8407  O O     . THR C 1 180 ? 134.317 141.092 146.441 1.00 102.40 ? 180 THR C O     1 
ATOM   8408  C CB    . THR C 1 180 ? 132.337 142.084 143.950 1.00 102.40 ? 180 THR C CB    1 
ATOM   8409  O OG1   . THR C 1 180 ? 132.181 140.942 143.100 1.00 102.40 ? 180 THR C OG1   1 
ATOM   8410  C CG2   . THR C 1 180 ? 133.696 142.712 143.701 1.00 102.40 ? 180 THR C CG2   1 
ATOM   8411  N N     . ASN C 1 181 ? 133.234 139.470 145.297 1.00 99.64  ? 181 ASN C N     1 
ATOM   8412  C CA    . ASN C 1 181 ? 134.260 138.454 145.498 1.00 99.64  ? 181 ASN C CA    1 
ATOM   8413  C C     . ASN C 1 181 ? 134.013 137.266 144.574 1.00 99.64  ? 181 ASN C C     1 
ATOM   8414  O O     . ASN C 1 181 ? 132.927 136.679 144.593 1.00 99.64  ? 181 ASN C O     1 
ATOM   8415  C CB    . ASN C 1 181 ? 134.282 138.002 146.958 1.00 99.64  ? 181 ASN C CB    1 
ATOM   8416  C CG    . ASN C 1 181 ? 135.493 137.162 147.287 1.00 99.64  ? 181 ASN C CG    1 
ATOM   8417  O OD1   . ASN C 1 181 ? 136.329 136.891 146.426 1.00 99.64  ? 181 ASN C OD1   1 
ATOM   8418  N ND2   . ASN C 1 181 ? 135.598 136.747 148.542 1.00 99.64  ? 181 ASN C ND2   1 
ATOM   8419  N N     . ILE C 1 182 ? 135.006 136.893 143.771 1.00 86.44  ? 182 ILE C N     1 
ATOM   8420  C CA    . ILE C 1 182 ? 134.843 135.808 142.803 1.00 86.44  ? 182 ILE C CA    1 
ATOM   8421  C C     . ILE C 1 182 ? 136.071 134.906 142.806 1.00 86.44  ? 182 ILE C C     1 
ATOM   8422  O O     . ILE C 1 182 ? 137.205 135.401 142.733 1.00 86.44  ? 182 ILE C O     1 
ATOM   8423  C CB    . ILE C 1 182 ? 134.578 136.353 141.392 1.00 86.44  ? 182 ILE C CB    1 
ATOM   8424  C CG1   . ILE C 1 182 ? 133.246 137.098 141.339 1.00 86.44  ? 182 ILE C CG1   1 
ATOM   8425  C CG2   . ILE C 1 182 ? 134.578 135.225 140.383 1.00 86.44  ? 182 ILE C CG2   1 
ATOM   8426  C CD1   . ILE C 1 182 ? 133.036 137.864 140.062 1.00 86.44  ? 182 ILE C CD1   1 
ATOM   8427  N N     . PRO C 1 183 ? 135.900 133.590 142.884 1.00 84.56  ? 183 PRO C N     1 
ATOM   8428  C CA    . PRO C 1 183 ? 137.049 132.680 142.863 1.00 84.56  ? 183 PRO C CA    1 
ATOM   8429  C C     . PRO C 1 183 ? 137.560 132.479 141.448 1.00 84.56  ? 183 PRO C C     1 
ATOM   8430  O O     . PRO C 1 183 ? 136.814 132.664 140.475 1.00 84.56  ? 183 PRO C O     1 
ATOM   8431  C CB    . PRO C 1 183 ? 136.472 131.375 143.426 1.00 84.56  ? 183 PRO C CB    1 
ATOM   8432  C CG    . PRO C 1 183 ? 135.218 131.774 144.122 1.00 84.56  ? 183 PRO C CG    1 
ATOM   8433  C CD    . PRO C 1 183 ? 134.676 132.913 143.326 1.00 84.56  ? 183 PRO C CD    1 
ATOM   8434  N N     . PRO C 1 184 ? 138.825 132.097 141.291 1.00 87.32  ? 184 PRO C N     1 
ATOM   8435  C CA    . PRO C 1 184 ? 139.338 131.765 139.955 1.00 87.32  ? 184 PRO C CA    1 
ATOM   8436  C C     . PRO C 1 184 ? 138.764 130.464 139.417 1.00 87.32  ? 184 PRO C C     1 
ATOM   8437  O O     . PRO C 1 184 ? 137.984 129.793 140.098 1.00 87.32  ? 184 PRO C O     1 
ATOM   8438  C CB    . PRO C 1 184 ? 140.851 131.653 140.182 1.00 87.32  ? 184 PRO C CB    1 
ATOM   8439  C CG    . PRO C 1 184 ? 141.109 132.425 141.428 1.00 87.32  ? 184 PRO C CG    1 
ATOM   8440  C CD    . PRO C 1 184 ? 139.904 132.204 142.282 1.00 87.32  ? 184 PRO C CD    1 
ATOM   8441  N N     . HIS C 1 185 ? 139.144 130.098 138.196 1.00 90.33  ? 185 HIS C N     1 
ATOM   8442  C CA    . HIS C 1 185 ? 138.712 128.849 137.586 1.00 90.33  ? 185 HIS C CA    1 
ATOM   8443  C C     . HIS C 1 185 ? 139.815 128.357 136.659 1.00 90.33  ? 185 HIS C C     1 
ATOM   8444  O O     . HIS C 1 185 ? 140.858 128.996 136.507 1.00 90.33  ? 185 HIS C O     1 
ATOM   8445  C CB    . HIS C 1 185 ? 137.396 129.022 136.823 1.00 90.33  ? 185 HIS C CB    1 
ATOM   8446  C CG    . HIS C 1 185 ? 136.230 129.359 137.697 1.00 90.33  ? 185 HIS C CG    1 
ATOM   8447  N ND1   . HIS C 1 185 ? 135.890 130.654 138.017 1.00 90.33  ? 185 HIS C ND1   1 
ATOM   8448  C CD2   . HIS C 1 185 ? 135.324 128.568 138.317 1.00 90.33  ? 185 HIS C CD2   1 
ATOM   8449  C CE1   . HIS C 1 185 ? 134.824 130.648 138.797 1.00 90.33  ? 185 HIS C CE1   1 
ATOM   8450  N NE2   . HIS C 1 185 ? 134.461 129.394 138.994 1.00 90.33  ? 185 HIS C NE2   1 
ATOM   8451  N N     . ASN C 1 186 ? 139.578 127.209 136.034 1.00 102.07 ? 186 ASN C N     1 
ATOM   8452  C CA    . ASN C 1 186 ? 140.505 126.677 135.049 1.00 102.07 ? 186 ASN C CA    1 
ATOM   8453  C C     . ASN C 1 186 ? 140.061 127.080 133.649 1.00 102.07 ? 186 ASN C C     1 
ATOM   8454  O O     . ASN C 1 186 ? 138.875 127.291 133.391 1.00 102.07 ? 186 ASN C O     1 
ATOM   8455  C CB    . ASN C 1 186 ? 140.598 125.156 135.158 1.00 102.07 ? 186 ASN C CB    1 
ATOM   8456  C CG    . ASN C 1 186 ? 141.737 124.584 134.344 1.00 102.07 ? 186 ASN C CG    1 
ATOM   8457  O OD1   . ASN C 1 186 ? 142.451 125.315 133.657 1.00 102.07 ? 186 ASN C OD1   1 
ATOM   8458  N ND2   . ASN C 1 186 ? 141.921 123.274 134.422 1.00 102.07 ? 186 ASN C ND2   1 
ATOM   8459  N N     . LEU C 1 187 ? 141.029 127.174 132.739 1.00 99.04  ? 187 LEU C N     1 
ATOM   8460  C CA    . LEU C 1 187 ? 140.756 127.737 131.421 1.00 99.04  ? 187 LEU C CA    1 
ATOM   8461  C C     . LEU C 1 187 ? 140.025 126.751 130.515 1.00 99.04  ? 187 LEU C C     1 
ATOM   8462  O O     . LEU C 1 187 ? 139.007 127.099 129.902 1.00 99.04  ? 187 LEU C O     1 
ATOM   8463  C CB    . LEU C 1 187 ? 142.062 128.190 130.772 1.00 99.04  ? 187 LEU C CB    1 
ATOM   8464  C CG    . LEU C 1 187 ? 141.906 128.849 129.406 1.00 99.04  ? 187 LEU C CG    1 
ATOM   8465  C CD1   . LEU C 1 187 ? 141.057 130.097 129.522 1.00 99.04  ? 187 LEU C CD1   1 
ATOM   8466  C CD2   . LEU C 1 187 ? 143.264 129.182 128.824 1.00 99.04  ? 187 LEU C CD2   1 
ATOM   8467  N N     . THR C 1 188 ? 140.540 125.523 130.407 1.00 106.24 ? 188 THR C N     1 
ATOM   8468  C CA    . THR C 1 188 ? 139.977 124.560 129.466 1.00 106.24 ? 188 THR C CA    1 
ATOM   8469  C C     . THR C 1 188 ? 138.511 124.278 129.764 1.00 106.24 ? 188 THR C C     1 
ATOM   8470  O O     . THR C 1 188 ? 137.703 124.108 128.843 1.00 106.24 ? 188 THR C O     1 
ATOM   8471  C CB    . THR C 1 188 ? 140.778 123.260 129.499 1.00 106.24 ? 188 THR C CB    1 
ATOM   8472  O OG1   . THR C 1 188 ? 140.701 122.686 130.808 1.00 106.24 ? 188 THR C OG1   1 
ATOM   8473  C CG2   . THR C 1 188 ? 142.229 123.526 129.157 1.00 106.24 ? 188 THR C CG2   1 
ATOM   8474  N N     . GLU C 1 189 ? 138.145 124.230 131.044 1.00 111.05 ? 189 GLU C N     1 
ATOM   8475  C CA    . GLU C 1 189 ? 136.757 123.956 131.392 1.00 111.05 ? 189 GLU C CA    1 
ATOM   8476  C C     . GLU C 1 189 ? 135.851 125.111 130.994 1.00 111.05 ? 189 GLU C C     1 
ATOM   8477  O O     . GLU C 1 189 ? 134.734 124.893 130.512 1.00 111.05 ? 189 GLU C O     1 
ATOM   8478  C CB    . GLU C 1 189 ? 136.646 123.664 132.884 1.00 111.05 ? 189 GLU C CB    1 
ATOM   8479  C CG    . GLU C 1 189 ? 137.336 122.382 133.284 1.00 111.05 ? 189 GLU C CG    1 
ATOM   8480  C CD    . GLU C 1 189 ? 137.206 122.098 134.758 1.00 111.05 ? 189 GLU C CD    1 
ATOM   8481  O OE1   . GLU C 1 189 ? 136.723 122.982 135.495 1.00 111.05 ? 189 GLU C OE1   1 
ATOM   8482  O OE2   . GLU C 1 189 ? 137.567 120.983 135.181 1.00 111.05 ? 189 GLU C OE2   1 
ATOM   8483  N N     . VAL C 1 190 ? 136.317 126.347 131.177 1.00 101.98 ? 190 VAL C N     1 
ATOM   8484  C CA    . VAL C 1 190 ? 135.526 127.499 130.758 1.00 101.98 ? 190 VAL C CA    1 
ATOM   8485  C C     . VAL C 1 190 ? 135.352 127.500 129.246 1.00 101.98 ? 190 VAL C C     1 
ATOM   8486  O O     . VAL C 1 190 ? 134.271 127.806 128.729 1.00 101.98 ? 190 VAL C O     1 
ATOM   8487  C CB    . VAL C 1 190 ? 136.173 128.802 131.257 1.00 101.98 ? 190 VAL C CB    1 
ATOM   8488  C CG1   . VAL C 1 190 ? 135.425 130.000 130.712 1.00 101.98 ? 190 VAL C CG1   1 
ATOM   8489  C CG2   . VAL C 1 190 ? 136.184 128.836 132.771 1.00 101.98 ? 190 VAL C CG2   1 
ATOM   8490  N N     . ILE C 1 191 ? 136.407 127.142 128.512 1.00 106.01 ? 191 ILE C N     1 
ATOM   8491  C CA    . ILE C 1 191 ? 136.292 127.077 127.058 1.00 106.01 ? 191 ILE C CA    1 
ATOM   8492  C C     . ILE C 1 191 ? 135.300 125.995 126.648 1.00 106.01 ? 191 ILE C C     1 
ATOM   8493  O O     . ILE C 1 191 ? 134.494 126.186 125.729 1.00 106.01 ? 191 ILE C O     1 
ATOM   8494  C CB    . ILE C 1 191 ? 137.674 126.852 126.421 1.00 106.01 ? 191 ILE C CB    1 
ATOM   8495  C CG1   . ILE C 1 191 ? 138.606 128.009 126.768 1.00 106.01 ? 191 ILE C CG1   1 
ATOM   8496  C CG2   . ILE C 1 191 ? 137.554 126.717 124.916 1.00 106.01 ? 191 ILE C CG2   1 
ATOM   8497  C CD1   . ILE C 1 191 ? 138.121 129.345 126.262 1.00 106.01 ? 191 ILE C CD1   1 
ATOM   8498  N N     . ASN C 1 192 ? 135.339 124.846 127.324 1.00 107.83 ? 192 ASN C N     1 
ATOM   8499  C CA    . ASN C 1 192 ? 134.405 123.773 127.001 1.00 107.83 ? 192 ASN C CA    1 
ATOM   8500  C C     . ASN C 1 192 ? 132.970 124.190 127.294 1.00 107.83 ? 192 ASN C C     1 
ATOM   8501  O O     . ASN C 1 192 ? 132.052 123.878 126.526 1.00 107.83 ? 192 ASN C O     1 
ATOM   8502  C CB    . ASN C 1 192 ? 134.771 122.512 127.778 1.00 107.83 ? 192 ASN C CB    1 
ATOM   8503  C CG    . ASN C 1 192 ? 136.074 121.904 127.309 1.00 107.83 ? 192 ASN C CG    1 
ATOM   8504  O OD1   . ASN C 1 192 ? 136.342 121.836 126.111 1.00 107.83 ? 192 ASN C OD1   1 
ATOM   8505  N ND2   . ASN C 1 192 ? 136.897 121.464 128.253 1.00 107.83 ? 192 ASN C ND2   1 
ATOM   8506  N N     . GLY C 1 193 ? 132.759 124.906 128.398 1.00 110.88 ? 193 GLY C N     1 
ATOM   8507  C CA    . GLY C 1 193 ? 131.427 125.400 128.700 1.00 110.88 ? 193 GLY C CA    1 
ATOM   8508  C C     . GLY C 1 193 ? 130.937 126.404 127.674 1.00 110.88 ? 193 GLY C C     1 
ATOM   8509  O O     . GLY C 1 193 ? 129.766 126.390 127.285 1.00 110.88 ? 193 GLY C O     1 
ATOM   8510  N N     . CYS C 1 194 ? 131.828 127.288 127.221 1.00 116.70 ? 194 CYS C N     1 
ATOM   8511  C CA    . CYS C 1 194 ? 131.455 128.236 126.178 1.00 116.70 ? 194 CYS C CA    1 
ATOM   8512  C C     . CYS C 1 194 ? 131.085 127.515 124.890 1.00 116.70 ? 194 CYS C C     1 
ATOM   8513  O O     . CYS C 1 194 ? 130.117 127.887 124.217 1.00 116.70 ? 194 CYS C O     1 
ATOM   8514  C CB    . CYS C 1 194 ? 132.592 129.224 125.931 1.00 116.70 ? 194 CYS C CB    1 
ATOM   8515  S SG    . CYS C 1 194 ? 132.928 130.323 127.319 1.00 116.70 ? 194 CYS C SG    1 
ATOM   8516  N N     . LEU C 1 195 ? 131.844 126.478 124.530 1.00 112.85 ? 195 LEU C N     1 
ATOM   8517  C CA    . LEU C 1 195 ? 131.495 125.686 123.355 1.00 112.85 ? 195 LEU C CA    1 
ATOM   8518  C C     . LEU C 1 195 ? 130.125 125.041 123.516 1.00 112.85 ? 195 LEU C C     1 
ATOM   8519  O O     . LEU C 1 195 ? 129.305 125.059 122.588 1.00 112.85 ? 195 LEU C O     1 
ATOM   8520  C CB    . LEU C 1 195 ? 132.559 124.620 123.106 1.00 112.85 ? 195 LEU C CB    1 
ATOM   8521  C CG    . LEU C 1 195 ? 133.939 125.148 122.726 1.00 112.85 ? 195 LEU C CG    1 
ATOM   8522  C CD1   . LEU C 1 195 ? 134.936 124.008 122.634 1.00 112.85 ? 195 LEU C CD1   1 
ATOM   8523  C CD2   . LEU C 1 195 ? 133.869 125.913 121.419 1.00 112.85 ? 195 LEU C CD2   1 
ATOM   8524  N N     . ALA C 1 196 ? 129.859 124.470 124.692 1.00 115.66 ? 196 ALA C N     1 
ATOM   8525  C CA    . ALA C 1 196 ? 128.565 123.843 124.932 1.00 115.66 ? 196 ALA C CA    1 
ATOM   8526  C C     . ALA C 1 196 ? 127.431 124.852 124.810 1.00 115.66 ? 196 ALA C C     1 
ATOM   8527  O O     . ALA C 1 196 ? 126.373 124.542 124.251 1.00 115.66 ? 196 ALA C O     1 
ATOM   8528  C CB    . ALA C 1 196 ? 128.549 123.181 126.309 1.00 115.66 ? 196 ALA C CB    1 
ATOM   8529  N N     . TYR C 1 197 ? 127.633 126.067 125.320 1.00 113.45 ? 197 TYR C N     1 
ATOM   8530  C CA    . TYR C 1 197 ? 126.581 127.071 125.216 1.00 113.45 ? 197 TYR C CA    1 
ATOM   8531  C C     . TYR C 1 197 ? 126.425 127.579 123.790 1.00 113.45 ? 197 TYR C C     1 
ATOM   8532  O O     . TYR C 1 197 ? 125.326 127.980 123.393 1.00 113.45 ? 197 TYR C O     1 
ATOM   8533  C CB    . TYR C 1 197 ? 126.854 128.240 126.155 1.00 113.45 ? 197 TYR C CB    1 
ATOM   8534  C CG    . TYR C 1 197 ? 125.786 129.304 126.087 1.00 113.45 ? 197 TYR C CG    1 
ATOM   8535  C CD1   . TYR C 1 197 ? 124.558 129.122 126.704 1.00 113.45 ? 197 TYR C CD1   1 
ATOM   8536  C CD2   . TYR C 1 197 ? 125.998 130.482 125.387 1.00 113.45 ? 197 TYR C CD2   1 
ATOM   8537  C CE1   . TYR C 1 197 ? 123.578 130.090 126.638 1.00 113.45 ? 197 TYR C CE1   1 
ATOM   8538  C CE2   . TYR C 1 197 ? 125.024 131.453 125.315 1.00 113.45 ? 197 TYR C CE2   1 
ATOM   8539  C CZ    . TYR C 1 197 ? 123.817 131.253 125.942 1.00 113.45 ? 197 TYR C CZ    1 
ATOM   8540  O OH    . TYR C 1 197 ? 122.844 132.222 125.871 1.00 113.45 ? 197 TYR C OH    1 
ATOM   8541  N N     . ILE C 1 198 ? 127.505 127.590 123.012 1.00 112.60 ? 198 ILE C N     1 
ATOM   8542  C CA    . ILE C 1 198 ? 127.379 127.951 121.606 1.00 112.60 ? 198 ILE C CA    1 
ATOM   8543  C C     . ILE C 1 198 ? 126.581 126.892 120.859 1.00 112.60 ? 198 ILE C C     1 
ATOM   8544  O O     . ILE C 1 198 ? 125.780 127.209 119.972 1.00 112.60 ? 198 ILE C O     1 
ATOM   8545  C CB    . ILE C 1 198 ? 128.768 128.173 120.982 1.00 112.60 ? 198 ILE C CB    1 
ATOM   8546  C CG1   . ILE C 1 198 ? 129.417 129.428 121.560 1.00 112.60 ? 198 ILE C CG1   1 
ATOM   8547  C CG2   . ILE C 1 198 ? 128.673 128.280 119.476 1.00 112.60 ? 198 ILE C CG2   1 
ATOM   8548  C CD1   . ILE C 1 198 ? 130.868 129.574 121.187 1.00 112.60 ? 198 ILE C CD1   1 
ATOM   8549  N N     . ASP C 1 199 ? 126.766 125.621 121.220 1.00 127.86 ? 199 ASP C N     1 
ATOM   8550  C CA    . ASP C 1 199 ? 125.990 124.564 120.579 1.00 127.86 ? 199 ASP C CA    1 
ATOM   8551  C C     . ASP C 1 199 ? 124.508 124.672 120.918 1.00 127.86 ? 199 ASP C C     1 
ATOM   8552  O O     . ASP C 1 199 ? 123.658 124.540 120.031 1.00 127.86 ? 199 ASP C O     1 
ATOM   8553  C CB    . ASP C 1 199 ? 126.526 123.193 120.984 1.00 127.86 ? 199 ASP C CB    1 
ATOM   8554  C CG    . ASP C 1 199 ? 127.868 122.886 120.358 1.00 127.86 ? 199 ASP C CG    1 
ATOM   8555  O OD1   . ASP C 1 199 ? 128.132 123.395 119.249 1.00 127.86 ? 199 ASP C OD1   1 
ATOM   8556  O OD2   . ASP C 1 199 ? 128.655 122.136 120.970 1.00 127.86 ? 199 ASP C OD2   1 
ATOM   8557  N N     . ASP C 1 200 ? 124.179 124.915 122.184 1.00 136.09 ? 200 ASP C N     1 
ATOM   8558  C CA    . ASP C 1 200 ? 122.792 124.972 122.623 1.00 136.09 ? 200 ASP C CA    1 
ATOM   8559  C C     . ASP C 1 200 ? 122.574 126.247 123.420 1.00 136.09 ? 200 ASP C C     1 
ATOM   8560  O O     . ASP C 1 200 ? 123.294 126.512 124.387 1.00 136.09 ? 200 ASP C O     1 
ATOM   8561  C CB    . ASP C 1 200 ? 122.425 123.748 123.470 1.00 136.09 ? 200 ASP C CB    1 
ATOM   8562  C CG    . ASP C 1 200 ? 120.937 123.657 123.752 1.00 136.09 ? 200 ASP C CG    1 
ATOM   8563  O OD1   . ASP C 1 200 ? 120.181 124.539 123.293 1.00 136.09 ? 200 ASP C OD1   1 
ATOM   8564  O OD2   . ASP C 1 200 ? 120.522 122.702 124.441 1.00 136.09 ? 200 ASP C OD2   1 
ATOM   8565  N N     . GLU C 1 201 ? 121.566 127.021 123.023 1.00 136.66 ? 201 GLU C N     1 
ATOM   8566  C CA    . GLU C 1 201 ? 121.280 128.282 123.694 1.00 136.66 ? 201 GLU C CA    1 
ATOM   8567  C C     . GLU C 1 201 ? 120.547 128.076 125.013 1.00 136.66 ? 201 GLU C C     1 
ATOM   8568  O O     . GLU C 1 201 ? 120.710 128.873 125.944 1.00 136.66 ? 201 GLU C O     1 
ATOM   8569  C CB    . GLU C 1 201 ? 120.458 129.185 122.774 1.00 136.66 ? 201 GLU C CB    1 
ATOM   8570  C CG    . GLU C 1 201 ? 120.163 130.558 123.350 1.00 136.66 ? 201 GLU C CG    1 
ATOM   8571  C CD    . GLU C 1 201 ? 119.385 131.439 122.393 1.00 136.66 ? 201 GLU C CD    1 
ATOM   8572  O OE1   . GLU C 1 201 ? 119.071 130.977 121.276 1.00 136.66 ? 201 GLU C OE1   1 
ATOM   8573  O OE2   . GLU C 1 201 ? 119.084 132.594 122.760 1.00 136.66 ? 201 GLU C OE2   1 
ATOM   8574  N N     . ASP C 1 202 ? 119.747 127.016 125.119 1.00 141.95 ? 202 ASP C N     1 
ATOM   8575  C CA    . ASP C 1 202 ? 118.892 126.796 126.277 1.00 141.95 ? 202 ASP C CA    1 
ATOM   8576  C C     . ASP C 1 202 ? 119.435 125.709 127.201 1.00 141.95 ? 202 ASP C C     1 
ATOM   8577  O O     . ASP C 1 202 ? 118.663 124.895 127.718 1.00 141.95 ? 202 ASP C O     1 
ATOM   8578  C CB    . ASP C 1 202 ? 117.474 126.456 125.817 1.00 141.95 ? 202 ASP C CB    1 
ATOM   8579  C CG    . ASP C 1 202 ? 116.444 126.622 126.919 1.00 141.95 ? 202 ASP C CG    1 
ATOM   8580  O OD1   . ASP C 1 202 ? 116.821 127.007 128.044 1.00 141.95 ? 202 ASP C OD1   1 
ATOM   8581  O OD2   . ASP C 1 202 ? 115.252 126.364 126.659 1.00 141.95 ? 202 ASP C OD2   1 
ATOM   8582  N N     . ILE C 1 203 ? 120.749 125.666 127.404 1.00 131.93 ? 203 ILE C N     1 
ATOM   8583  C CA    . ILE C 1 203 ? 121.348 124.697 128.313 1.00 131.93 ? 203 ILE C CA    1 
ATOM   8584  C C     . ILE C 1 203 ? 120.900 125.011 129.736 1.00 131.93 ? 203 ILE C C     1 
ATOM   8585  O O     . ILE C 1 203 ? 120.611 126.166 130.066 1.00 131.93 ? 203 ILE C O     1 
ATOM   8586  C CB    . ILE C 1 203 ? 122.882 124.700 128.191 1.00 131.93 ? 203 ILE C CB    1 
ATOM   8587  C CG1   . ILE C 1 203 ? 123.483 123.508 128.937 1.00 131.93 ? 203 ILE C CG1   1 
ATOM   8588  C CG2   . ILE C 1 203 ? 123.455 126.006 128.710 1.00 131.93 ? 203 ILE C CG2   1 
ATOM   8589  C CD1   . ILE C 1 203 ? 124.932 123.251 128.608 1.00 131.93 ? 203 ILE C CD1   1 
ATOM   8590  N N     . SER C 1 204 ? 120.821 123.986 130.579 1.00 130.16 ? 204 SER C N     1 
ATOM   8591  C CA    . SER C 1 204 ? 120.417 124.166 131.964 1.00 130.16 ? 204 SER C CA    1 
ATOM   8592  C C     . SER C 1 204 ? 121.638 124.392 132.848 1.00 130.16 ? 204 SER C C     1 
ATOM   8593  O O     . SER C 1 204 ? 122.784 124.207 132.432 1.00 130.16 ? 204 SER C O     1 
ATOM   8594  C CB    . SER C 1 204 ? 119.627 122.955 132.455 1.00 130.16 ? 204 SER C CB    1 
ATOM   8595  O OG    . SER C 1 204 ? 120.456 121.808 132.529 1.00 130.16 ? 204 SER C OG    1 
ATOM   8596  N N     . ILE C 1 205 ? 121.379 124.797 134.093 1.00 125.28 ? 205 ILE C N     1 
ATOM   8597  C CA    . ILE C 1 205 ? 122.468 125.008 135.041 1.00 125.28 ? 205 ILE C CA    1 
ATOM   8598  C C     . ILE C 1 205 ? 123.146 123.686 135.370 1.00 125.28 ? 205 ILE C C     1 
ATOM   8599  O O     . ILE C 1 205 ? 124.363 123.630 135.582 1.00 125.28 ? 205 ILE C O     1 
ATOM   8600  C CB    . ILE C 1 205 ? 121.947 125.710 136.307 1.00 125.28 ? 205 ILE C CB    1 
ATOM   8601  C CG1   . ILE C 1 205 ? 121.275 127.032 135.941 1.00 125.28 ? 205 ILE C CG1   1 
ATOM   8602  C CG2   . ILE C 1 205 ? 123.082 125.954 137.289 1.00 125.28 ? 205 ILE C CG2   1 
ATOM   8603  C CD1   . ILE C 1 205 ? 122.199 128.016 135.266 1.00 125.28 ? 205 ILE C CD1   1 
ATOM   8604  N N     . GLU C 1 206 ? 122.371 122.601 135.410 1.00 130.31 ? 206 GLU C N     1 
ATOM   8605  C CA    . GLU C 1 206 ? 122.953 121.289 135.665 1.00 130.31 ? 206 GLU C CA    1 
ATOM   8606  C C     . GLU C 1 206 ? 123.928 120.894 134.564 1.00 130.31 ? 206 GLU C C     1 
ATOM   8607  O O     . GLU C 1 206 ? 124.992 120.327 134.840 1.00 130.31 ? 206 GLU C O     1 
ATOM   8608  C CB    . GLU C 1 206 ? 121.848 120.244 135.803 1.00 130.31 ? 206 GLU C CB    1 
ATOM   8609  C CG    . GLU C 1 206 ? 122.357 118.846 136.092 1.00 130.31 ? 206 GLU C CG    1 
ATOM   8610  C CD    . GLU C 1 206 ? 123.048 118.744 137.436 1.00 130.31 ? 206 GLU C CD    1 
ATOM   8611  O OE1   . GLU C 1 206 ? 122.721 119.543 138.339 1.00 130.31 ? 206 GLU C OE1   1 
ATOM   8612  O OE2   . GLU C 1 206 ? 123.921 117.866 137.588 1.00 130.31 ? 206 GLU C OE2   1 
ATOM   8613  N N     . GLY C 1 207 ? 123.583 121.185 133.309 1.00 125.46 ? 207 GLY C N     1 
ATOM   8614  C CA    . GLY C 1 207 ? 124.483 120.859 132.215 1.00 125.46 ? 207 GLY C CA    1 
ATOM   8615  C C     . GLY C 1 207 ? 125.794 121.616 132.294 1.00 125.46 ? 207 GLY C C     1 
ATOM   8616  O O     . GLY C 1 207 ? 126.868 121.038 132.114 1.00 125.46 ? 207 GLY C O     1 
ATOM   8617  N N     . LEU C 1 208 ? 125.725 122.920 132.566 1.00 122.08 ? 208 LEU C N     1 
ATOM   8618  C CA    . LEU C 1 208 ? 126.944 123.706 132.703 1.00 122.08 ? 208 LEU C CA    1 
ATOM   8619  C C     . LEU C 1 208 ? 127.761 123.245 133.900 1.00 122.08 ? 208 LEU C C     1 
ATOM   8620  O O     . LEU C 1 208 ? 128.996 123.210 133.843 1.00 122.08 ? 208 LEU C O     1 
ATOM   8621  C CB    . LEU C 1 208 ? 126.601 125.188 132.827 1.00 122.08 ? 208 LEU C CB    1 
ATOM   8622  C CG    . LEU C 1 208 ? 125.988 125.814 131.577 1.00 122.08 ? 208 LEU C CG    1 
ATOM   8623  C CD1   . LEU C 1 208 ? 125.551 127.241 131.851 1.00 122.08 ? 208 LEU C CD1   1 
ATOM   8624  C CD2   . LEU C 1 208 ? 126.983 125.768 130.435 1.00 122.08 ? 208 LEU C CD2   1 
ATOM   8625  N N     . MET C 1 209 ? 127.090 122.885 134.995 1.00 129.91 ? 209 MET C N     1 
ATOM   8626  C CA    . MET C 1 209 ? 127.807 122.400 136.168 1.00 129.91 ? 209 MET C CA    1 
ATOM   8627  C C     . MET C 1 209 ? 128.507 121.081 135.872 1.00 129.91 ? 209 MET C C     1 
ATOM   8628  O O     . MET C 1 209 ? 129.489 120.726 136.533 1.00 129.91 ? 209 MET C O     1 
ATOM   8629  C CB    . MET C 1 209 ? 126.845 122.254 137.346 1.00 129.91 ? 209 MET C CB    1 
ATOM   8630  C CG    . MET C 1 209 ? 127.514 121.887 138.659 1.00 129.91 ? 209 MET C CG    1 
ATOM   8631  S SD    . MET C 1 209 ? 126.355 121.835 140.037 1.00 129.91 ? 209 MET C SD    1 
ATOM   8632  C CE    . MET C 1 209 ? 127.429 121.288 141.361 1.00 129.91 ? 209 MET C CE    1 
ATOM   8633  N N     . GLU C 1 210 ? 128.022 120.343 134.871 1.00 133.82 ? 210 GLU C N     1 
ATOM   8634  C CA    . GLU C 1 210 ? 128.682 119.101 134.491 1.00 133.82 ? 210 GLU C CA    1 
ATOM   8635  C C     . GLU C 1 210 ? 130.026 119.375 133.828 1.00 133.82 ? 210 GLU C C     1 
ATOM   8636  O O     . GLU C 1 210 ? 130.998 118.646 134.054 1.00 133.82 ? 210 GLU C O     1 
ATOM   8637  C CB    . GLU C 1 210 ? 127.780 118.289 133.563 1.00 133.82 ? 210 GLU C CB    1 
ATOM   8638  C CG    . GLU C 1 210 ? 128.250 116.863 133.328 1.00 133.82 ? 210 GLU C CG    1 
ATOM   8639  C CD    . GLU C 1 210 ? 129.301 116.764 132.241 1.00 133.82 ? 210 GLU C CD    1 
ATOM   8640  O OE1   . GLU C 1 210 ? 129.297 117.620 131.331 1.00 133.82 ? 210 GLU C OE1   1 
ATOM   8641  O OE2   . GLU C 1 210 ? 130.133 115.835 132.300 1.00 133.82 ? 210 GLU C OE2   1 
ATOM   8642  N N     . HIS C 1 211 ? 130.099 120.418 132.999 1.00 123.19 ? 211 HIS C N     1 
ATOM   8643  C CA    . HIS C 1 211 ? 131.351 120.728 132.319 1.00 123.19 ? 211 HIS C CA    1 
ATOM   8644  C C     . HIS C 1 211 ? 132.329 121.431 133.252 1.00 123.19 ? 211 HIS C C     1 
ATOM   8645  O O     . HIS C 1 211 ? 133.544 121.221 133.161 1.00 123.19 ? 211 HIS C O     1 
ATOM   8646  C CB    . HIS C 1 211 ? 131.080 121.582 131.083 1.00 123.19 ? 211 HIS C CB    1 
ATOM   8647  C CG    . HIS C 1 211 ? 130.322 120.866 130.012 1.00 123.19 ? 211 HIS C CG    1 
ATOM   8648  N ND1   . HIS C 1 211 ? 128.945 120.835 129.969 1.00 123.19 ? 211 HIS C ND1   1 
ATOM   8649  C CD2   . HIS C 1 211 ? 130.747 120.153 128.942 1.00 123.19 ? 211 HIS C CD2   1 
ATOM   8650  C CE1   . HIS C 1 211 ? 128.555 120.134 128.919 1.00 123.19 ? 211 HIS C CE1   1 
ATOM   8651  N NE2   . HIS C 1 211 ? 129.629 119.709 128.279 1.00 123.19 ? 211 HIS C NE2   1 
ATOM   8652  N N     . ILE C 1 212 ? 131.824 122.269 134.148 1.00 112.71 ? 212 ILE C N     1 
ATOM   8653  C CA    . ILE C 1 212 ? 132.650 122.996 135.103 1.00 112.71 ? 212 ILE C CA    1 
ATOM   8654  C C     . ILE C 1 212 ? 132.410 122.411 136.488 1.00 112.71 ? 212 ILE C C     1 
ATOM   8655  O O     . ILE C 1 212 ? 131.412 122.727 137.141 1.00 112.71 ? 212 ILE C O     1 
ATOM   8656  C CB    . ILE C 1 212 ? 132.347 124.503 135.079 1.00 112.71 ? 212 ILE C CB    1 
ATOM   8657  C CG1   . ILE C 1 212 ? 132.664 125.091 133.706 1.00 112.71 ? 212 ILE C CG1   1 
ATOM   8658  C CG2   . ILE C 1 212 ? 133.148 125.219 136.150 1.00 112.71 ? 212 ILE C CG2   1 
ATOM   8659  C CD1   . ILE C 1 212 ? 132.172 126.508 133.532 1.00 112.71 ? 212 ILE C CD1   1 
ATOM   8660  N N     . PRO C 1 213 ? 133.299 121.540 136.968 1.00 106.67 ? 213 PRO C N     1 
ATOM   8661  C CA    . PRO C 1 213 ? 133.104 120.982 138.316 1.00 106.67 ? 213 PRO C CA    1 
ATOM   8662  C C     . PRO C 1 213 ? 133.148 122.028 139.414 1.00 106.67 ? 213 PRO C C     1 
ATOM   8663  O O     . PRO C 1 213 ? 132.195 122.139 140.195 1.00 106.67 ? 213 PRO C O     1 
ATOM   8664  C CB    . PRO C 1 213 ? 134.249 119.968 138.434 1.00 106.67 ? 213 PRO C CB    1 
ATOM   8665  C CG    . PRO C 1 213 ? 134.583 119.612 137.028 1.00 106.67 ? 213 PRO C CG    1 
ATOM   8666  C CD    . PRO C 1 213 ? 134.391 120.872 136.245 1.00 106.67 ? 213 PRO C CD    1 
ATOM   8667  N N     . GLY C 1 214 ? 134.222 122.807 139.496 1.00 99.36  ? 214 GLY C N     1 
ATOM   8668  C CA    . GLY C 1 214 ? 134.360 123.774 140.559 1.00 99.36  ? 214 GLY C CA    1 
ATOM   8669  C C     . GLY C 1 214 ? 135.501 124.748 140.354 1.00 99.36  ? 214 GLY C C     1 
ATOM   8670  O O     . GLY C 1 214 ? 136.127 124.799 139.290 1.00 99.36  ? 214 GLY C O     1 
ATOM   8671  N N     . PRO C 1 215 ? 135.794 125.544 141.383 1.00 88.53  ? 215 PRO C N     1 
ATOM   8672  C CA    . PRO C 1 215 ? 136.824 126.582 141.254 1.00 88.53  ? 215 PRO C CA    1 
ATOM   8673  C C     . PRO C 1 215 ? 138.233 126.025 141.145 1.00 88.53  ? 215 PRO C C     1 
ATOM   8674  O O     . PRO C 1 215 ? 138.440 124.808 141.132 1.00 88.53  ? 215 PRO C O     1 
ATOM   8675  C CB    . PRO C 1 215 ? 136.662 127.396 142.544 1.00 88.53  ? 215 PRO C CB    1 
ATOM   8676  C CG    . PRO C 1 215 ? 135.285 127.100 143.012 1.00 88.53  ? 215 PRO C CG    1 
ATOM   8677  C CD    . PRO C 1 215 ? 135.038 125.678 142.635 1.00 88.53  ? 215 PRO C CD    1 
ATOM   8678  N N     . ASP C 1 216 ? 139.208 126.926 141.065 1.00 98.36  ? 216 ASP C N     1 
ATOM   8679  C CA    . ASP C 1 216 ? 140.613 126.559 141.058 1.00 98.36  ? 216 ASP C CA    1 
ATOM   8680  C C     . ASP C 1 216 ? 141.393 127.653 141.769 1.00 98.36  ? 216 ASP C C     1 
ATOM   8681  O O     . ASP C 1 216 ? 140.962 128.807 141.835 1.00 98.36  ? 216 ASP C O     1 
ATOM   8682  C CB    . ASP C 1 216 ? 141.140 126.357 139.631 1.00 98.36  ? 216 ASP C CB    1 
ATOM   8683  C CG    . ASP C 1 216 ? 142.518 125.726 139.604 1.00 98.36  ? 216 ASP C CG    1 
ATOM   8684  O OD1   . ASP C 1 216 ? 143.068 125.446 140.688 1.00 98.36  ? 216 ASP C OD1   1 
ATOM   8685  O OD2   . ASP C 1 216 ? 143.057 125.514 138.497 1.00 98.36  ? 216 ASP C OD2   1 
ATOM   8686  N N     . PHE C 1 217 ? 142.550 127.281 142.302 1.00 99.15  ? 217 PHE C N     1 
ATOM   8687  C CA    . PHE C 1 217 ? 143.370 128.206 143.064 1.00 99.15  ? 217 PHE C CA    1 
ATOM   8688  C C     . PHE C 1 217 ? 144.808 128.161 142.575 1.00 99.15  ? 217 PHE C C     1 
ATOM   8689  O O     . PHE C 1 217 ? 145.244 127.153 142.012 1.00 99.15  ? 217 PHE C O     1 
ATOM   8690  C CB    . PHE C 1 217 ? 143.323 127.868 144.560 1.00 99.15  ? 217 PHE C CB    1 
ATOM   8691  C CG    . PHE C 1 217 ? 141.990 128.120 145.190 1.00 99.15  ? 217 PHE C CG    1 
ATOM   8692  C CD1   . PHE C 1 217 ? 141.625 129.395 145.578 1.00 99.15  ? 217 PHE C CD1   1 
ATOM   8693  C CD2   . PHE C 1 217 ? 141.100 127.084 145.391 1.00 99.15  ? 217 PHE C CD2   1 
ATOM   8694  C CE1   . PHE C 1 217 ? 140.399 129.631 146.159 1.00 99.15  ? 217 PHE C CE1   1 
ATOM   8695  C CE2   . PHE C 1 217 ? 139.871 127.315 145.973 1.00 99.15  ? 217 PHE C CE2   1 
ATOM   8696  C CZ    . PHE C 1 217 ? 139.521 128.590 146.357 1.00 99.15  ? 217 PHE C CZ    1 
ATOM   8697  N N     . PRO C 1 218 ? 145.567 129.244 142.767 1.00 103.51 ? 218 PRO C N     1 
ATOM   8698  C CA    . PRO C 1 218 ? 146.982 129.207 142.365 1.00 103.51 ? 218 PRO C CA    1 
ATOM   8699  C C     . PRO C 1 218 ? 147.780 128.166 143.123 1.00 103.51 ? 218 PRO C C     1 
ATOM   8700  O O     . PRO C 1 218 ? 148.663 127.522 142.544 1.00 103.51 ? 218 PRO C O     1 
ATOM   8701  C CB    . PRO C 1 218 ? 147.464 130.634 142.659 1.00 103.51 ? 218 PRO C CB    1 
ATOM   8702  C CG    . PRO C 1 218 ? 146.534 131.141 143.696 1.00 103.51 ? 218 PRO C CG    1 
ATOM   8703  C CD    . PRO C 1 218 ? 145.203 130.528 143.387 1.00 103.51 ? 218 PRO C CD    1 
ATOM   8704  N N     . THR C 1 219 ? 147.492 127.980 144.407 1.00 106.84 ? 219 THR C N     1 
ATOM   8705  C CA    . THR C 1 219 ? 148.057 126.896 145.197 1.00 106.84 ? 219 THR C CA    1 
ATOM   8706  C C     . THR C 1 219 ? 146.949 125.904 145.513 1.00 106.84 ? 219 THR C C     1 
ATOM   8707  O O     . THR C 1 219 ? 145.849 126.303 145.906 1.00 106.84 ? 219 THR C O     1 
ATOM   8708  C CB    . THR C 1 219 ? 148.689 127.416 146.487 1.00 106.84 ? 219 THR C CB    1 
ATOM   8709  O OG1   . THR C 1 219 ? 147.690 128.069 147.279 1.00 106.84 ? 219 THR C OG1   1 
ATOM   8710  C CG2   . THR C 1 219 ? 149.801 128.399 146.173 1.00 106.84 ? 219 THR C CG2   1 
ATOM   8711  N N     . ALA C 1 220 ? 147.239 124.619 145.337 1.00 111.13 ? 220 ALA C N     1 
ATOM   8712  C CA    . ALA C 1 220 ? 146.215 123.601 145.492 1.00 111.13 ? 220 ALA C CA    1 
ATOM   8713  C C     . ALA C 1 220 ? 145.763 123.500 146.946 1.00 111.13 ? 220 ALA C C     1 
ATOM   8714  O O     . ALA C 1 220 ? 146.422 123.981 147.870 1.00 111.13 ? 220 ALA C O     1 
ATOM   8715  C CB    . ALA C 1 220 ? 146.727 122.248 145.002 1.00 111.13 ? 220 ALA C CB    1 
ATOM   8716  N N     . ALA C 1 221 ? 144.608 122.872 147.135 1.00 110.22 ? 221 ALA C N     1 
ATOM   8717  C CA    . ALA C 1 221 ? 144.013 122.682 148.451 1.00 110.22 ? 221 ALA C CA    1 
ATOM   8718  C C     . ALA C 1 221 ? 142.958 121.589 148.332 1.00 110.22 ? 221 ALA C C     1 
ATOM   8719  O O     . ALA C 1 221 ? 142.895 120.873 147.328 1.00 110.22 ? 221 ALA C O     1 
ATOM   8720  C CB    . ALA C 1 221 ? 143.429 123.993 148.985 1.00 110.22 ? 221 ALA C CB    1 
ATOM   8721  N N     . ILE C 1 222 ? 142.131 121.453 149.363 1.00 104.10 ? 222 ILE C N     1 
ATOM   8722  C CA    . ILE C 1 222 ? 141.045 120.484 149.374 1.00 104.10 ? 222 ILE C CA    1 
ATOM   8723  C C     . ILE C 1 222 ? 139.754 121.209 149.726 1.00 104.10 ? 222 ILE C C     1 
ATOM   8724  O O     . ILE C 1 222 ? 139.730 122.050 150.630 1.00 104.10 ? 222 ILE C O     1 
ATOM   8725  C CB    . ILE C 1 222 ? 141.321 119.335 150.364 1.00 104.10 ? 222 ILE C CB    1 
ATOM   8726  C CG1   . ILE C 1 222 ? 142.590 118.585 149.957 1.00 104.10 ? 222 ILE C CG1   1 
ATOM   8727  C CG2   . ILE C 1 222 ? 140.147 118.375 150.413 1.00 104.10 ? 222 ILE C CG2   1 
ATOM   8728  C CD1   . ILE C 1 222 ? 143.086 117.614 151.001 1.00 104.10 ? 222 ILE C CD1   1 
ATOM   8729  N N     . ILE C 1 223 ? 138.684 120.887 149.005 1.00 101.86 ? 223 ILE C N     1 
ATOM   8730  C CA    . ILE C 1 223 ? 137.378 121.502 149.198 1.00 101.86 ? 223 ILE C CA    1 
ATOM   8731  C C     . ILE C 1 223 ? 136.397 120.425 149.635 1.00 101.86 ? 223 ILE C C     1 
ATOM   8732  O O     . ILE C 1 223 ? 136.391 119.319 149.084 1.00 101.86 ? 223 ILE C O     1 
ATOM   8733  C CB    . ILE C 1 223 ? 136.896 122.201 147.913 1.00 101.86 ? 223 ILE C CB    1 
ATOM   8734  C CG1   . ILE C 1 223 ? 137.871 123.310 147.527 1.00 101.86 ? 223 ILE C CG1   1 
ATOM   8735  C CG2   . ILE C 1 223 ? 135.506 122.770 148.101 1.00 101.86 ? 223 ILE C CG2   1 
ATOM   8736  C CD1   . ILE C 1 223 ? 137.627 123.878 146.154 1.00 101.86 ? 223 ILE C CD1   1 
ATOM   8737  N N     . ASN C 1 224 ? 135.562 120.751 150.622 1.00 107.90 ? 224 ASN C N     1 
ATOM   8738  C CA    . ASN C 1 224 ? 134.673 119.776 151.244 1.00 107.90 ? 224 ASN C CA    1 
ATOM   8739  C C     . ASN C 1 224 ? 133.232 119.874 150.759 1.00 107.90 ? 224 ASN C C     1 
ATOM   8740  O O     . ASN C 1 224 ? 132.671 118.883 150.283 1.00 107.90 ? 224 ASN C O     1 
ATOM   8741  C CB    . ASN C 1 224 ? 134.712 119.936 152.768 1.00 107.90 ? 224 ASN C CB    1 
ATOM   8742  C CG    . ASN C 1 224 ? 136.023 119.481 153.367 1.00 107.90 ? 224 ASN C CG    1 
ATOM   8743  O OD1   . ASN C 1 224 ? 136.570 118.450 152.980 1.00 107.90 ? 224 ASN C OD1   1 
ATOM   8744  N ND2   . ASN C 1 224 ? 136.536 120.249 154.318 1.00 107.90 ? 224 ASN C ND2   1 
ATOM   8745  N N     . GLY C 1 225 ? 132.619 121.049 150.865 1.00 111.83 ? 225 GLY C N     1 
ATOM   8746  C CA    . GLY C 1 225 ? 131.192 121.176 150.638 1.00 111.83 ? 225 GLY C CA    1 
ATOM   8747  C C     . GLY C 1 225 ? 130.778 121.414 149.201 1.00 111.83 ? 225 GLY C C     1 
ATOM   8748  O O     . GLY C 1 225 ? 131.297 122.314 148.536 1.00 111.83 ? 225 GLY C O     1 
ATOM   8749  N N     . ARG C 1 226 ? 129.835 120.608 148.711 1.00 110.81 ? 226 ARG C N     1 
ATOM   8750  C CA    . ARG C 1 226 ? 129.312 120.818 147.366 1.00 110.81 ? 226 ARG C CA    1 
ATOM   8751  C C     . ARG C 1 226 ? 128.115 121.758 147.379 1.00 110.81 ? 226 ARG C C     1 
ATOM   8752  O O     . ARG C 1 226 ? 127.842 122.437 146.383 1.00 110.81 ? 226 ARG C O     1 
ATOM   8753  C CB    . ARG C 1 226 ? 128.931 119.481 146.736 1.00 110.81 ? 226 ARG C CB    1 
ATOM   8754  C CG    . ARG C 1 226 ? 130.105 118.558 146.522 1.00 110.81 ? 226 ARG C CG    1 
ATOM   8755  C CD    . ARG C 1 226 ? 131.032 119.109 145.462 1.00 110.81 ? 226 ARG C CD    1 
ATOM   8756  N NE    . ARG C 1 226 ? 130.356 119.251 144.178 1.00 110.81 ? 226 ARG C NE    1 
ATOM   8757  C CZ    . ARG C 1 226 ? 130.249 118.277 143.281 1.00 110.81 ? 226 ARG C CZ    1 
ATOM   8758  N NH1   . ARG C 1 226 ? 129.616 118.493 142.137 1.00 110.81 ? 226 ARG C NH1   1 
ATOM   8759  N NH2   . ARG C 1 226 ? 130.776 117.086 143.529 1.00 110.81 ? 226 ARG C NH2   1 
ATOM   8760  N N     . ARG C 1 227 ? 127.383 121.801 148.494 1.00 119.98 ? 227 ARG C N     1 
ATOM   8761  C CA    . ARG C 1 227 ? 126.197 122.648 148.573 1.00 119.98 ? 227 ARG C CA    1 
ATOM   8762  C C     . ARG C 1 227 ? 126.548 124.115 148.363 1.00 119.98 ? 227 ARG C C     1 
ATOM   8763  O O     . ARG C 1 227 ? 125.809 124.850 147.695 1.00 119.98 ? 227 ARG C O     1 
ATOM   8764  C CB    . ARG C 1 227 ? 125.503 122.453 149.921 1.00 119.98 ? 227 ARG C CB    1 
ATOM   8765  C CG    . ARG C 1 227 ? 124.649 121.199 150.011 1.00 119.98 ? 227 ARG C CG    1 
ATOM   8766  C CD    . ARG C 1 227 ? 125.482 119.966 150.324 1.00 119.98 ? 227 ARG C CD    1 
ATOM   8767  N NE    . ARG C 1 227 ? 126.217 120.099 151.578 1.00 119.98 ? 227 ARG C NE    1 
ATOM   8768  C CZ    . ARG C 1 227 ? 125.710 119.816 152.773 1.00 119.98 ? 227 ARG C CZ    1 
ATOM   8769  N NH1   . ARG C 1 227 ? 124.463 119.382 152.880 1.00 119.98 ? 227 ARG C NH1   1 
ATOM   8770  N NH2   . ARG C 1 227 ? 126.451 119.964 153.863 1.00 119.98 ? 227 ARG C NH2   1 
ATOM   8771  N N     . GLY C 1 228 ? 127.680 124.554 148.915 1.00 112.33 ? 228 GLY C N     1 
ATOM   8772  C CA    . GLY C 1 228 ? 128.029 125.962 148.838 1.00 112.33 ? 228 GLY C CA    1 
ATOM   8773  C C     . GLY C 1 228 ? 128.231 126.439 147.414 1.00 112.33 ? 228 GLY C C     1 
ATOM   8774  O O     . GLY C 1 228 ? 127.627 127.425 146.986 1.00 112.33 ? 228 GLY C O     1 
ATOM   8775  N N     . ILE C 1 229 ? 129.086 125.745 146.661 1.00 110.98 ? 229 ILE C N     1 
ATOM   8776  C CA    . ILE C 1 229 ? 129.381 126.187 145.303 1.00 110.98 ? 229 ILE C CA    1 
ATOM   8777  C C     . ILE C 1 229 ? 128.156 126.056 144.414 1.00 110.98 ? 229 ILE C C     1 
ATOM   8778  O O     . ILE C 1 229 ? 127.947 126.875 143.511 1.00 110.98 ? 229 ILE C O     1 
ATOM   8779  C CB    . ILE C 1 229 ? 130.580 125.409 144.735 1.00 110.98 ? 229 ILE C CB    1 
ATOM   8780  C CG1   . ILE C 1 229 ? 130.270 123.916 144.667 1.00 110.98 ? 229 ILE C CG1   1 
ATOM   8781  C CG2   . ILE C 1 229 ? 131.812 125.649 145.584 1.00 110.98 ? 229 ILE C CG2   1 
ATOM   8782  C CD1   . ILE C 1 229 ? 131.304 123.120 143.911 1.00 110.98 ? 229 ILE C CD1   1 
ATOM   8783  N N     . GLU C 1 230 ? 127.318 125.048 144.656 1.00 119.01 ? 230 GLU C N     1 
ATOM   8784  C CA    . GLU C 1 230 ? 126.098 124.905 143.872 1.00 119.01 ? 230 GLU C CA    1 
ATOM   8785  C C     . GLU C 1 230 ? 125.164 126.082 144.112 1.00 119.01 ? 230 GLU C C     1 
ATOM   8786  O O     . GLU C 1 230 ? 124.659 126.696 143.163 1.00 119.01 ? 230 GLU C O     1 
ATOM   8787  C CB    . GLU C 1 230 ? 125.411 123.584 144.216 1.00 119.01 ? 230 GLU C CB    1 
ATOM   8788  C CG    . GLU C 1 230 ? 124.266 123.211 143.291 1.00 119.01 ? 230 GLU C CG    1 
ATOM   8789  C CD    . GLU C 1 230 ? 122.953 123.850 143.698 1.00 119.01 ? 230 GLU C CD    1 
ATOM   8790  O OE1   . GLU C 1 230 ? 122.776 124.126 144.903 1.00 119.01 ? 230 GLU C OE1   1 
ATOM   8791  O OE2   . GLU C 1 230 ? 122.100 124.075 142.815 1.00 119.01 ? 230 GLU C OE2   1 
ATOM   8792  N N     . GLU C 1 231 ? 124.924 126.412 145.383 1.00 123.79 ? 231 GLU C N     1 
ATOM   8793  C CA    . GLU C 1 231 ? 124.067 127.548 145.697 1.00 123.79 ? 231 GLU C CA    1 
ATOM   8794  C C     . GLU C 1 231 ? 124.654 128.844 145.157 1.00 123.79 ? 231 GLU C C     1 
ATOM   8795  O O     . GLU C 1 231 ? 123.916 129.734 144.719 1.00 123.79 ? 231 GLU C O     1 
ATOM   8796  C CB    . GLU C 1 231 ? 123.852 127.643 147.206 1.00 123.79 ? 231 GLU C CB    1 
ATOM   8797  C CG    . GLU C 1 231 ? 122.908 128.757 147.629 1.00 123.79 ? 231 GLU C CG    1 
ATOM   8798  C CD    . GLU C 1 231 ? 122.667 128.781 149.126 1.00 123.79 ? 231 GLU C CD    1 
ATOM   8799  O OE1   . GLU C 1 231 ? 123.247 127.934 149.838 1.00 123.79 ? 231 GLU C OE1   1 
ATOM   8800  O OE2   . GLU C 1 231 ? 121.897 129.647 149.591 1.00 123.79 ? 231 GLU C OE2   1 
ATOM   8801  N N     . ALA C 1 232 ? 125.982 128.963 145.164 1.00 115.43 ? 232 ALA C N     1 
ATOM   8802  C CA    . ALA C 1 232 ? 126.615 130.180 144.669 1.00 115.43 ? 232 ALA C CA    1 
ATOM   8803  C C     . ALA C 1 232 ? 126.429 130.320 143.164 1.00 115.43 ? 232 ALA C C     1 
ATOM   8804  O O     . ALA C 1 232 ? 126.052 131.390 142.672 1.00 115.43 ? 232 ALA C O     1 
ATOM   8805  C CB    . ALA C 1 232 ? 128.098 130.186 145.035 1.00 115.43 ? 232 ALA C CB    1 
ATOM   8806  N N     . TYR C 1 233 ? 126.688 129.248 142.413 1.00 112.07 ? 233 TYR C N     1 
ATOM   8807  C CA    . TYR C 1 233 ? 126.509 129.308 140.967 1.00 112.07 ? 233 TYR C CA    1 
ATOM   8808  C C     . TYR C 1 233 ? 125.050 129.503 140.586 1.00 112.07 ? 233 TYR C C     1 
ATOM   8809  O O     . TYR C 1 233 ? 124.759 130.148 139.572 1.00 112.07 ? 233 TYR C O     1 
ATOM   8810  C CB    . TYR C 1 233 ? 127.054 128.043 140.307 1.00 112.07 ? 233 TYR C CB    1 
ATOM   8811  C CG    . TYR C 1 233 ? 128.559 127.948 140.304 1.00 112.07 ? 233 TYR C CG    1 
ATOM   8812  C CD1   . TYR C 1 233 ? 129.343 129.049 140.605 1.00 112.07 ? 233 TYR C CD1   1 
ATOM   8813  C CD2   . TYR C 1 233 ? 129.196 126.758 139.986 1.00 112.07 ? 233 TYR C CD2   1 
ATOM   8814  C CE1   . TYR C 1 233 ? 130.720 128.967 140.600 1.00 112.07 ? 233 TYR C CE1   1 
ATOM   8815  C CE2   . TYR C 1 233 ? 130.572 126.666 139.977 1.00 112.07 ? 233 TYR C CE2   1 
ATOM   8816  C CZ    . TYR C 1 233 ? 131.329 127.773 140.285 1.00 112.07 ? 233 TYR C CZ    1 
ATOM   8817  O OH    . TYR C 1 233 ? 132.701 127.687 140.279 1.00 112.07 ? 233 TYR C OH    1 
ATOM   8818  N N     . ARG C 1 234 ? 124.120 128.967 141.376 1.00 114.56 ? 234 ARG C N     1 
ATOM   8819  C CA    . ARG C 1 234 ? 122.717 129.068 140.995 1.00 114.56 ? 234 ARG C CA    1 
ATOM   8820  C C     . ARG C 1 234 ? 122.124 130.425 141.361 1.00 114.56 ? 234 ARG C C     1 
ATOM   8821  O O     . ARG C 1 234 ? 121.368 131.004 140.573 1.00 114.56 ? 234 ARG C O     1 
ATOM   8822  C CB    . ARG C 1 234 ? 121.920 127.939 141.644 1.00 114.56 ? 234 ARG C CB    1 
ATOM   8823  C CG    . ARG C 1 234 ? 120.460 127.900 141.244 1.00 114.56 ? 234 ARG C CG    1 
ATOM   8824  C CD    . ARG C 1 234 ? 119.758 126.727 141.896 1.00 114.56 ? 234 ARG C CD    1 
ATOM   8825  N NE    . ARG C 1 234 ? 119.796 126.820 143.351 1.00 114.56 ? 234 ARG C NE    1 
ATOM   8826  C CZ    . ARG C 1 234 ? 118.950 127.545 144.074 1.00 114.56 ? 234 ARG C CZ    1 
ATOM   8827  N NH1   . ARG C 1 234 ? 117.994 128.242 143.476 1.00 114.56 ? 234 ARG C NH1   1 
ATOM   8828  N NH2   . ARG C 1 234 ? 119.059 127.573 145.394 1.00 114.56 ? 234 ARG C NH2   1 
ATOM   8829  N N     . THR C 1 235 ? 122.454 130.951 142.539 1.00 113.34 ? 235 THR C N     1 
ATOM   8830  C CA    . THR C 1 235 ? 121.864 132.189 143.030 1.00 113.34 ? 235 THR C CA    1 
ATOM   8831  C C     . THR C 1 235 ? 122.833 133.361 142.952 1.00 113.34 ? 235 THR C C     1 
ATOM   8832  O O     . THR C 1 235 ? 122.511 134.392 142.359 1.00 113.34 ? 235 THR C O     1 
ATOM   8833  C CB    . THR C 1 235 ? 121.381 132.001 144.473 1.00 113.34 ? 235 THR C CB    1 
ATOM   8834  O OG1   . THR C 1 235 ? 122.501 131.698 145.313 1.00 113.34 ? 235 THR C OG1   1 
ATOM   8835  C CG2   . THR C 1 235 ? 120.380 130.863 144.551 1.00 113.34 ? 235 THR C CG2   1 
ATOM   8836  N N     . GLY C 1 236 ? 124.014 133.232 143.546 1.00 107.18 ? 236 GLY C N     1 
ATOM   8837  C CA    . GLY C 1 236 ? 124.970 134.319 143.546 1.00 107.18 ? 236 GLY C CA    1 
ATOM   8838  C C     . GLY C 1 236 ? 125.653 134.508 144.883 1.00 107.18 ? 236 GLY C C     1 
ATOM   8839  O O     . GLY C 1 236 ? 126.596 135.294 145.001 1.00 107.18 ? 236 GLY C O     1 
ATOM   8840  N N     . ARG C 1 237 ? 125.183 133.793 145.902 1.00 107.77 ? 237 ARG C N     1 
ATOM   8841  C CA    . ARG C 1 237 ? 125.762 133.859 147.233 1.00 107.77 ? 237 ARG C CA    1 
ATOM   8842  C C     . ARG C 1 237 ? 125.957 132.451 147.775 1.00 107.77 ? 237 ARG C C     1 
ATOM   8843  O O     . ARG C 1 237 ? 125.214 131.528 147.432 1.00 107.77 ? 237 ARG C O     1 
ATOM   8844  C CB    . ARG C 1 237 ? 124.882 134.667 148.190 1.00 107.77 ? 237 ARG C CB    1 
ATOM   8845  C CG    . ARG C 1 237 ? 124.783 136.137 147.838 1.00 107.77 ? 237 ARG C CG    1 
ATOM   8846  C CD    . ARG C 1 237 ? 123.846 136.864 148.784 1.00 107.77 ? 237 ARG C CD    1 
ATOM   8847  N NE    . ARG C 1 237 ? 124.355 136.884 150.151 1.00 107.77 ? 237 ARG C NE    1 
ATOM   8848  C CZ    . ARG C 1 237 ? 125.162 137.824 150.631 1.00 107.77 ? 237 ARG C CZ    1 
ATOM   8849  N NH1   . ARG C 1 237 ? 125.552 138.824 149.854 1.00 107.77 ? 237 ARG C NH1   1 
ATOM   8850  N NH2   . ARG C 1 237 ? 125.578 137.765 151.888 1.00 107.77 ? 237 ARG C NH2   1 
ATOM   8851  N N     . GLY C 1 238 ? 126.967 132.297 148.619 1.00 103.38 ? 238 GLY C N     1 
ATOM   8852  C CA    . GLY C 1 238 ? 127.251 131.005 149.216 1.00 103.38 ? 238 GLY C CA    1 
ATOM   8853  C C     . GLY C 1 238 ? 128.584 131.045 149.927 1.00 103.38 ? 238 GLY C C     1 
ATOM   8854  O O     . GLY C 1 238 ? 129.351 132.006 149.810 1.00 103.38 ? 238 GLY C O     1 
ATOM   8855  N N     . LYS C 1 239 ? 128.850 129.977 150.672 1.00 103.77 ? 239 LYS C N     1 
ATOM   8856  C CA    . LYS C 1 239 ? 130.091 129.831 151.415 1.00 103.77 ? 239 LYS C CA    1 
ATOM   8857  C C     . LYS C 1 239 ? 130.749 128.510 151.053 1.00 103.77 ? 239 LYS C C     1 
ATOM   8858  O O     . LYS C 1 239 ? 130.077 127.540 150.696 1.00 103.77 ? 239 LYS C O     1 
ATOM   8859  C CB    . LYS C 1 239 ? 129.857 129.891 152.924 1.00 103.77 ? 239 LYS C CB    1 
ATOM   8860  C CG    . LYS C 1 239 ? 129.483 131.264 153.440 1.00 103.77 ? 239 LYS C CG    1 
ATOM   8861  C CD    . LYS C 1 239 ? 129.124 131.202 154.911 1.00 103.77 ? 239 LYS C CD    1 
ATOM   8862  C CE    . LYS C 1 239 ? 130.347 130.898 155.755 1.00 103.77 ? 239 LYS C CE    1 
ATOM   8863  N NZ    . LYS C 1 239 ? 130.038 130.943 157.208 1.00 103.77 ? 239 LYS C NZ    1 
ATOM   8864  N N     . VAL C 1 240 ? 132.074 128.481 151.153 1.00 95.35  ? 240 VAL C N     1 
ATOM   8865  C CA    . VAL C 1 240 ? 132.854 127.298 150.822 1.00 95.35  ? 240 VAL C CA    1 
ATOM   8866  C C     . VAL C 1 240 ? 134.027 127.206 151.787 1.00 95.35  ? 240 VAL C C     1 
ATOM   8867  O O     . VAL C 1 240 ? 134.564 128.221 152.241 1.00 95.35  ? 240 VAL C O     1 
ATOM   8868  C CB    . VAL C 1 240 ? 133.332 127.330 149.351 1.00 95.35  ? 240 VAL C CB    1 
ATOM   8869  C CG1   . VAL C 1 240 ? 134.291 128.483 149.123 1.00 95.35  ? 240 VAL C CG1   1 
ATOM   8870  C CG2   . VAL C 1 240 ? 133.970 126.011 148.961 1.00 95.35  ? 240 VAL C CG2   1 
ATOM   8871  N N     . TYR C 1 241 ? 134.411 125.978 152.117 1.00 94.86  ? 241 TYR C N     1 
ATOM   8872  C CA    . TYR C 1 241 ? 135.505 125.725 153.039 1.00 94.86  ? 241 TYR C CA    1 
ATOM   8873  C C     . TYR C 1 241 ? 136.760 125.320 152.279 1.00 94.86  ? 241 TYR C C     1 
ATOM   8874  O O     . TYR C 1 241 ? 136.693 124.675 151.230 1.00 94.86  ? 241 TYR C O     1 
ATOM   8875  C CB    . TYR C 1 241 ? 135.130 124.631 154.037 1.00 94.86  ? 241 TYR C CB    1 
ATOM   8876  C CG    . TYR C 1 241 ? 134.028 125.031 154.986 1.00 94.86  ? 241 TYR C CG    1 
ATOM   8877  C CD1   . TYR C 1 241 ? 134.301 125.780 156.120 1.00 94.86  ? 241 TYR C CD1   1 
ATOM   8878  C CD2   . TYR C 1 241 ? 132.712 124.668 154.742 1.00 94.86  ? 241 TYR C CD2   1 
ATOM   8879  C CE1   . TYR C 1 241 ? 133.296 126.149 156.988 1.00 94.86  ? 241 TYR C CE1   1 
ATOM   8880  C CE2   . TYR C 1 241 ? 131.701 125.032 155.604 1.00 94.86  ? 241 TYR C CE2   1 
ATOM   8881  C CZ    . TYR C 1 241 ? 131.998 125.773 156.725 1.00 94.86  ? 241 TYR C CZ    1 
ATOM   8882  O OH    . TYR C 1 241 ? 130.992 126.140 157.587 1.00 94.86  ? 241 TYR C OH    1 
ATOM   8883  N N     . ILE C 1 242 ? 137.910 125.706 152.822 1.00 92.31  ? 242 ILE C N     1 
ATOM   8884  C CA    . ILE C 1 242 ? 139.209 125.370 152.256 1.00 92.31  ? 242 ILE C CA    1 
ATOM   8885  C C     . ILE C 1 242 ? 140.009 124.630 153.316 1.00 92.31  ? 242 ILE C C     1 
ATOM   8886  O O     . ILE C 1 242 ? 140.139 125.110 154.447 1.00 92.31  ? 242 ILE C O     1 
ATOM   8887  C CB    . ILE C 1 242 ? 139.965 126.622 151.781 1.00 92.31  ? 242 ILE C CB    1 
ATOM   8888  C CG1   . ILE C 1 242 ? 139.134 127.382 150.750 1.00 92.31  ? 242 ILE C CG1   1 
ATOM   8889  C CG2   . ILE C 1 242 ? 141.305 126.236 151.196 1.00 92.31  ? 242 ILE C CG2   1 
ATOM   8890  C CD1   . ILE C 1 242 ? 138.829 126.581 149.515 1.00 92.31  ? 242 ILE C CD1   1 
ATOM   8891  N N     . ARG C 1 243 ? 140.543 123.468 152.951 1.00 102.91 ? 243 ARG C N     1 
ATOM   8892  C CA    . ARG C 1 243 ? 141.280 122.619 153.875 1.00 102.91 ? 243 ARG C CA    1 
ATOM   8893  C C     . ARG C 1 243 ? 142.659 122.327 153.307 1.00 102.91 ? 243 ARG C C     1 
ATOM   8894  O O     . ARG C 1 243 ? 142.788 121.967 152.132 1.00 102.91 ? 243 ARG C O     1 
ATOM   8895  C CB    . ARG C 1 243 ? 140.532 121.312 154.136 1.00 102.91 ? 243 ARG C CB    1 
ATOM   8896  C CG    . ARG C 1 243 ? 141.153 120.450 155.214 1.00 102.91 ? 243 ARG C CG    1 
ATOM   8897  C CD    . ARG C 1 243 ? 140.345 119.184 155.420 1.00 102.91 ? 243 ARG C CD    1 
ATOM   8898  N NE    . ARG C 1 243 ? 138.984 119.490 155.842 1.00 102.91 ? 243 ARG C NE    1 
ATOM   8899  C CZ    . ARG C 1 243 ? 138.633 119.758 157.095 1.00 102.91 ? 243 ARG C CZ    1 
ATOM   8900  N NH1   . ARG C 1 243 ? 137.370 120.028 157.389 1.00 102.91 ? 243 ARG C NH1   1 
ATOM   8901  N NH2   . ARG C 1 243 ? 139.547 119.763 158.054 1.00 102.91 ? 243 ARG C NH2   1 
ATOM   8902  N N     . ALA C 1 244 ? 143.682 122.475 154.143 1.00 96.18  ? 244 ALA C N     1 
ATOM   8903  C CA    . ALA C 1 244 ? 145.041 122.205 153.710 1.00 96.18  ? 244 ALA C CA    1 
ATOM   8904  C C     . ALA C 1 244 ? 145.261 120.702 153.560 1.00 96.18  ? 244 ALA C C     1 
ATOM   8905  O O     . ALA C 1 244 ? 144.444 119.878 153.978 1.00 96.18  ? 244 ALA C O     1 
ATOM   8906  C CB    . ALA C 1 244 ? 146.043 122.796 154.698 1.00 96.18  ? 244 ALA C CB    1 
ATOM   8907  N N     . ARG C 1 245 ? 146.388 120.348 152.951 1.00 111.64 ? 245 ARG C N     1 
ATOM   8908  C CA    . ARG C 1 245 ? 146.758 118.959 152.725 1.00 111.64 ? 245 ARG C CA    1 
ATOM   8909  C C     . ARG C 1 245 ? 147.841 118.555 153.712 1.00 111.64 ? 245 ARG C C     1 
ATOM   8910  O O     . ARG C 1 245 ? 148.899 119.190 153.773 1.00 111.64 ? 245 ARG C O     1 
ATOM   8911  C CB    . ARG C 1 245 ? 147.247 118.742 151.293 1.00 111.64 ? 245 ARG C CB    1 
ATOM   8912  C CG    . ARG C 1 245 ? 147.536 117.290 150.967 1.00 111.64 ? 245 ARG C CG    1 
ATOM   8913  C CD    . ARG C 1 245 ? 148.002 117.127 149.535 1.00 111.64 ? 245 ARG C CD    1 
ATOM   8914  N NE    . ARG C 1 245 ? 146.964 117.502 148.581 1.00 111.64 ? 245 ARG C NE    1 
ATOM   8915  C CZ    . ARG C 1 245 ? 145.985 116.695 148.188 1.00 111.64 ? 245 ARG C CZ    1 
ATOM   8916  N NH1   . ARG C 1 245 ? 145.905 115.462 148.670 1.00 111.64 ? 245 ARG C NH1   1 
ATOM   8917  N NH2   . ARG C 1 245 ? 145.084 117.120 147.314 1.00 111.64 ? 245 ARG C NH2   1 
ATOM   8918  N N     . ALA C 1 246 ? 147.578 117.499 154.474 1.00 120.16 ? 246 ALA C N     1 
ATOM   8919  C CA    . ALA C 1 246 ? 148.535 116.995 155.448 1.00 120.16 ? 246 ALA C CA    1 
ATOM   8920  C C     . ALA C 1 246 ? 148.248 115.521 155.684 1.00 120.16 ? 246 ALA C C     1 
ATOM   8921  O O     . ALA C 1 246 ? 147.218 114.993 155.261 1.00 120.16 ? 246 ALA C O     1 
ATOM   8922  C CB    . ALA C 1 246 ? 148.472 117.786 156.757 1.00 120.16 ? 246 ALA C CB    1 
ATOM   8923  N N     . GLU C 1 247 ? 149.177 114.862 156.370 1.00 138.44 ? 247 GLU C N     1 
ATOM   8924  C CA    . GLU C 1 247 ? 149.037 113.443 156.660 1.00 138.44 ? 247 GLU C CA    1 
ATOM   8925  C C     . GLU C 1 247 ? 149.962 113.084 157.812 1.00 138.44 ? 247 GLU C C     1 
ATOM   8926  O O     . GLU C 1 247 ? 150.818 113.872 158.220 1.00 138.44 ? 247 GLU C O     1 
ATOM   8927  C CB    . GLU C 1 247 ? 149.347 112.589 155.428 1.00 138.44 ? 247 GLU C CB    1 
ATOM   8928  C CG    . GLU C 1 247 ? 150.794 112.663 154.978 1.00 138.44 ? 247 GLU C CG    1 
ATOM   8929  C CD    . GLU C 1 247 ? 151.054 111.853 153.725 1.00 138.44 ? 247 GLU C CD    1 
ATOM   8930  O OE1   . GLU C 1 247 ? 150.095 111.259 153.191 1.00 138.44 ? 247 GLU C OE1   1 
ATOM   8931  O OE2   . GLU C 1 247 ? 152.218 111.809 153.275 1.00 138.44 ? 247 GLU C OE2   1 
ATOM   8932  N N     . VAL C 1 248 ? 149.777 111.876 158.329 1.00 145.48 ? 248 VAL C N     1 
ATOM   8933  C CA    . VAL C 1 248 ? 150.610 111.363 159.403 1.00 145.48 ? 248 VAL C CA    1 
ATOM   8934  C C     . VAL C 1 248 ? 151.770 110.581 158.801 1.00 145.48 ? 248 VAL C C     1 
ATOM   8935  O O     . VAL C 1 248 ? 151.724 110.133 157.653 1.00 145.48 ? 248 VAL C O     1 
ATOM   8936  C CB    . VAL C 1 248 ? 149.800 110.484 160.374 1.00 145.48 ? 248 VAL C CB    1 
ATOM   8937  C CG1   . VAL C 1 248 ? 148.662 111.281 160.988 1.00 145.48 ? 248 VAL C CG1   1 
ATOM   8938  C CG2   . VAL C 1 248 ? 149.274 109.253 159.656 1.00 145.48 ? 248 VAL C CG2   1 
ATOM   8939  N N     . GLU C 1 249 ? 152.826 110.410 159.592 1.00 153.27 ? 249 GLU C N     1 
ATOM   8940  C CA    . GLU C 1 249 ? 153.979 109.633 159.147 1.00 153.27 ? 249 GLU C CA    1 
ATOM   8941  C C     . GLU C 1 249 ? 154.520 108.862 160.340 1.00 153.27 ? 249 GLU C C     1 
ATOM   8942  O O     . GLU C 1 249 ? 154.650 109.423 161.432 1.00 153.27 ? 249 GLU C O     1 
ATOM   8943  C CB    . GLU C 1 249 ? 155.056 110.530 158.555 1.00 153.27 ? 249 GLU C CB    1 
ATOM   8944  C CG    . GLU C 1 249 ? 156.228 109.747 157.987 1.00 153.27 ? 249 GLU C CG    1 
ATOM   8945  C CD    . GLU C 1 249 ? 157.345 110.638 157.492 1.00 153.27 ? 249 GLU C CD    1 
ATOM   8946  O OE1   . GLU C 1 249 ? 157.244 111.868 157.666 1.00 153.27 ? 249 GLU C OE1   1 
ATOM   8947  O OE2   . GLU C 1 249 ? 158.325 110.110 156.927 1.00 153.27 ? 249 GLU C OE2   1 
ATOM   8948  N N     . VAL C 1 250 ? 154.827 107.586 160.132 1.00 165.11 ? 250 VAL C N     1 
ATOM   8949  C CA    . VAL C 1 250 ? 155.485 106.751 161.128 1.00 165.11 ? 250 VAL C CA    1 
ATOM   8950  C C     . VAL C 1 250 ? 156.633 106.028 160.442 1.00 165.11 ? 250 VAL C C     1 
ATOM   8951  O O     . VAL C 1 250 ? 156.442 105.419 159.383 1.00 165.11 ? 250 VAL C O     1 
ATOM   8952  C CB    . VAL C 1 250 ? 154.513 105.744 161.768 1.00 165.11 ? 250 VAL C CB    1 
ATOM   8953  C CG1   . VAL C 1 250 ? 155.248 104.859 162.761 1.00 165.11 ? 250 VAL C CG1   1 
ATOM   8954  C CG2   . VAL C 1 250 ? 153.357 106.466 162.437 1.00 165.11 ? 250 VAL C CG2   1 
ATOM   8955  N N     . ASP C 1 251 ? 157.819 106.100 161.038 1.00 177.27 ? 251 ASP C N     1 
ATOM   8956  C CA    . ASP C 1 251 ? 158.963 105.392 160.488 1.00 177.27 ? 251 ASP C CA    1 
ATOM   8957  C C     . ASP C 1 251 ? 158.745 103.887 160.579 1.00 177.27 ? 251 ASP C C     1 
ATOM   8958  O O     . ASP C 1 251 ? 157.991 103.395 161.423 1.00 177.27 ? 251 ASP C O     1 
ATOM   8959  C CB    . ASP C 1 251 ? 160.241 105.786 161.228 1.00 177.27 ? 251 ASP C CB    1 
ATOM   8960  C CG    . ASP C 1 251 ? 160.653 107.218 160.954 1.00 177.27 ? 251 ASP C CG    1 
ATOM   8961  O OD1   . ASP C 1 251 ? 160.356 107.722 159.851 1.00 177.27 ? 251 ASP C OD1   1 
ATOM   8962  O OD2   . ASP C 1 251 ? 161.270 107.840 161.843 1.00 177.27 ? 251 ASP C OD2   1 
ATOM   8963  N N     . ALA C 1 252 ? 159.407 103.152 159.682 1.00 181.63 ? 252 ALA C N     1 
ATOM   8964  C CA    . ALA C 1 252 ? 159.285 101.698 159.687 1.00 181.63 ? 252 ALA C CA    1 
ATOM   8965  C C     . ALA C 1 252 ? 159.739 101.111 161.016 1.00 181.63 ? 252 ALA C C     1 
ATOM   8966  O O     . ALA C 1 252 ? 159.209 100.089 161.468 1.00 181.63 ? 252 ALA C O     1 
ATOM   8967  C CB    . ALA C 1 252 ? 160.091 101.100 158.535 1.00 181.63 ? 252 ALA C CB    1 
ATOM   8968  N N     . LYS C 1 253 ? 160.716 101.742 161.655 1.00 183.36 ? 253 LYS C N     1 
ATOM   8969  C CA    . LYS C 1 253 ? 161.216 101.322 162.956 1.00 183.36 ? 253 LYS C CA    1 
ATOM   8970  C C     . LYS C 1 253 ? 160.627 102.231 164.024 1.00 183.36 ? 253 LYS C C     1 
ATOM   8971  O O     . LYS C 1 253 ? 159.741 103.040 163.727 1.00 183.36 ? 253 LYS C O     1 
ATOM   8972  C CB    . LYS C 1 253 ? 162.742 101.333 162.983 1.00 183.36 ? 253 LYS C CB    1 
ATOM   8973  C CG    . LYS C 1 253 ? 163.322 100.358 161.978 1.00 183.36 ? 253 LYS C CG    1 
ATOM   8974  C CD    . LYS C 1 253 ? 162.926 98.934  162.349 1.00 183.36 ? 253 LYS C CD    1 
ATOM   8975  C CE    . LYS C 1 253 ? 163.486 97.916  161.373 1.00 183.36 ? 253 LYS C CE    1 
ATOM   8976  N NZ    . LYS C 1 253 ? 162.804 98.011  160.051 1.00 183.36 ? 253 LYS C NZ    1 
ATOM   8977  N N     . THR C 1 254 ? 161.114 102.082 165.258 1.00 180.71 ? 254 THR C N     1 
ATOM   8978  C CA    . THR C 1 254 ? 160.509 102.647 166.476 1.00 180.71 ? 254 THR C CA    1 
ATOM   8979  C C     . THR C 1 254 ? 160.100 104.100 166.221 1.00 180.71 ? 254 THR C C     1 
ATOM   8980  O O     . THR C 1 254 ? 158.894 104.379 166.219 1.00 180.71 ? 254 THR C O     1 
ATOM   8981  C CB    . THR C 1 254 ? 161.470 102.418 167.640 1.00 180.71 ? 254 THR C CB    1 
ATOM   8982  O OG1   . THR C 1 254 ? 160.948 103.031 168.827 1.00 180.71 ? 254 THR C OG1   1 
ATOM   8983  C CG2   . THR C 1 254 ? 162.874 102.939 167.330 1.00 180.71 ? 254 THR C CG2   1 
ATOM   8984  N N     . GLY C 1 255 ? 161.037 105.020 165.974 1.00 171.30 ? 255 GLY C N     1 
ATOM   8985  C CA    . GLY C 1 255 ? 160.735 106.402 165.636 1.00 171.30 ? 255 GLY C CA    1 
ATOM   8986  C C     . GLY C 1 255 ? 159.640 107.019 166.497 1.00 171.30 ? 255 GLY C C     1 
ATOM   8987  O O     . GLY C 1 255 ? 159.494 106.735 167.689 1.00 171.30 ? 255 GLY C O     1 
ATOM   8988  N N     . ARG C 1 256 ? 158.857 107.883 165.853 1.00 149.48 ? 256 ARG C N     1 
ATOM   8989  C CA    . ARG C 1 256 ? 157.651 108.447 166.440 1.00 149.48 ? 256 ARG C CA    1 
ATOM   8990  C C     . ARG C 1 256 ? 156.801 109.045 165.328 1.00 149.48 ? 256 ARG C C     1 
ATOM   8991  O O     . ARG C 1 256 ? 157.242 109.175 164.184 1.00 149.48 ? 256 ARG C O     1 
ATOM   8992  C CB    . ARG C 1 256 ? 157.967 109.504 167.507 1.00 149.48 ? 256 ARG C CB    1 
ATOM   8993  C CG    . ARG C 1 256 ? 158.630 110.756 166.973 1.00 149.48 ? 256 ARG C CG    1 
ATOM   8994  C CD    . ARG C 1 256 ? 158.853 111.764 168.088 1.00 149.48 ? 256 ARG C CD    1 
ATOM   8995  N NE    . ARG C 1 256 ? 159.802 111.278 169.083 1.00 149.48 ? 256 ARG C NE    1 
ATOM   8996  C CZ    . ARG C 1 256 ? 161.115 111.472 169.016 1.00 149.48 ? 256 ARG C CZ    1 
ATOM   8997  N NH1   . ARG C 1 256 ? 161.636 112.151 168.004 1.00 149.48 ? 256 ARG C NH1   1 
ATOM   8998  N NH2   . ARG C 1 256 ? 161.906 110.992 169.965 1.00 149.48 ? 256 ARG C NH2   1 
ATOM   8999  N N     . GLU C 1 257 ? 155.569 109.405 165.676 1.00 149.38 ? 257 GLU C N     1 
ATOM   9000  C CA    . GLU C 1 257 ? 154.635 109.927 164.688 1.00 149.38 ? 257 GLU C CA    1 
ATOM   9001  C C     . GLU C 1 257 ? 154.946 111.385 164.371 1.00 149.38 ? 257 GLU C C     1 
ATOM   9002  O O     . GLU C 1 257 ? 155.336 112.160 165.248 1.00 149.38 ? 257 GLU C O     1 
ATOM   9003  C CB    . GLU C 1 257 ? 153.204 109.788 165.197 1.00 149.38 ? 257 GLU C CB    1 
ATOM   9004  C CG    . GLU C 1 257 ? 152.785 108.347 165.416 1.00 149.38 ? 257 GLU C CG    1 
ATOM   9005  C CD    . GLU C 1 257 ? 151.371 108.223 165.934 1.00 149.38 ? 257 GLU C CD    1 
ATOM   9006  O OE1   . GLU C 1 257 ? 150.751 109.266 166.224 1.00 149.38 ? 257 GLU C OE1   1 
ATOM   9007  O OE2   . GLU C 1 257 ? 150.880 107.081 166.054 1.00 149.38 ? 257 GLU C OE2   1 
ATOM   9008  N N     . THR C 1 258 ? 154.766 111.758 163.106 1.00 141.25 ? 258 THR C N     1 
ATOM   9009  C CA    . THR C 1 258 ? 155.134 113.083 162.633 1.00 141.25 ? 258 THR C CA    1 
ATOM   9010  C C     . THR C 1 258 ? 154.155 113.517 161.549 1.00 141.25 ? 258 THR C C     1 
ATOM   9011  O O     . THR C 1 258 ? 153.632 112.695 160.793 1.00 141.25 ? 258 THR C O     1 
ATOM   9012  C CB    . THR C 1 258 ? 156.578 113.094 162.106 1.00 141.25 ? 258 THR C CB    1 
ATOM   9013  O OG1   . THR C 1 258 ? 157.456 112.587 163.118 1.00 141.25 ? 258 THR C OG1   1 
ATOM   9014  C CG2   . THR C 1 258 ? 157.018 114.501 161.758 1.00 141.25 ? 258 THR C CG2   1 
ATOM   9015  N N     . ILE C 1 259 ? 153.912 114.824 161.482 1.00 129.59 ? 259 ILE C N     1 
ATOM   9016  C CA    . ILE C 1 259 ? 152.962 115.416 160.547 1.00 129.59 ? 259 ILE C CA    1 
ATOM   9017  C C     . ILE C 1 259 ? 153.737 116.202 159.500 1.00 129.59 ? 259 ILE C C     1 
ATOM   9018  O O     . ILE C 1 259 ? 154.707 116.897 159.827 1.00 129.59 ? 259 ILE C O     1 
ATOM   9019  C CB    . ILE C 1 259 ? 151.955 116.321 161.275 1.00 129.59 ? 259 ILE C CB    1 
ATOM   9020  C CG1   . ILE C 1 259 ? 151.225 115.528 162.354 1.00 129.59 ? 259 ILE C CG1   1 
ATOM   9021  C CG2   . ILE C 1 259 ? 150.956 116.909 160.298 1.00 129.59 ? 259 ILE C CG2   1 
ATOM   9022  C CD1   . ILE C 1 259 ? 150.454 114.356 161.812 1.00 129.59 ? 259 ILE C CD1   1 
ATOM   9023  N N     . ILE C 1 260 ? 153.310 116.093 158.245 1.00 120.32 ? 260 ILE C N     1 
ATOM   9024  C CA    . ILE C 1 260 ? 153.888 116.841 157.135 1.00 120.32 ? 260 ILE C CA    1 
ATOM   9025  C C     . ILE C 1 260 ? 152.793 117.681 156.500 1.00 120.32 ? 260 ILE C C     1 
ATOM   9026  O O     . ILE C 1 260 ? 151.694 117.181 156.236 1.00 120.32 ? 260 ILE C O     1 
ATOM   9027  C CB    . ILE C 1 260 ? 154.528 115.913 156.088 1.00 120.32 ? 260 ILE C CB    1 
ATOM   9028  C CG1   . ILE C 1 260 ? 155.742 115.199 156.667 1.00 120.32 ? 260 ILE C CG1   1 
ATOM   9029  C CG2   . ILE C 1 260 ? 154.921 116.689 154.843 1.00 120.32 ? 260 ILE C CG2   1 
ATOM   9030  C CD1   . ILE C 1 260 ? 156.286 114.149 155.747 1.00 120.32 ? 260 ILE C CD1   1 
ATOM   9031  N N     . VAL C 1 261 ? 153.094 118.952 156.253 1.00 118.75 ? 261 VAL C N     1 
ATOM   9032  C CA    . VAL C 1 261 ? 152.197 119.860 155.553 1.00 118.75 ? 261 VAL C CA    1 
ATOM   9033  C C     . VAL C 1 261 ? 152.856 120.253 154.241 1.00 118.75 ? 261 VAL C C     1 
ATOM   9034  O O     . VAL C 1 261 ? 154.003 120.715 154.232 1.00 118.75 ? 261 VAL C O     1 
ATOM   9035  C CB    . VAL C 1 261 ? 151.872 121.103 156.398 1.00 118.75 ? 261 VAL C CB    1 
ATOM   9036  C CG1   . VAL C 1 261 ? 151.040 122.081 155.593 1.00 118.75 ? 261 VAL C CG1   1 
ATOM   9037  C CG2   . VAL C 1 261 ? 151.145 120.699 157.664 1.00 118.75 ? 261 VAL C CG2   1 
ATOM   9038  N N     . HIS C 1 262 ? 152.133 120.075 153.139 1.00 117.81 ? 262 HIS C N     1 
ATOM   9039  C CA    . HIS C 1 262 ? 152.663 120.354 151.811 1.00 117.81 ? 262 HIS C CA    1 
ATOM   9040  C C     . HIS C 1 262 ? 152.214 121.695 151.250 1.00 117.81 ? 262 HIS C C     1 
ATOM   9041  O O     . HIS C 1 262 ? 152.981 122.344 150.534 1.00 117.81 ? 262 HIS C O     1 
ATOM   9042  C CB    . HIS C 1 262 ? 152.260 119.243 150.839 1.00 117.81 ? 262 HIS C CB    1 
ATOM   9043  C CG    . HIS C 1 262 ? 152.888 117.920 151.144 1.00 117.81 ? 262 HIS C CG    1 
ATOM   9044  N ND1   . HIS C 1 262 ? 154.206 117.641 150.859 1.00 117.81 ? 262 HIS C ND1   1 
ATOM   9045  C CD2   . HIS C 1 262 ? 152.380 116.802 151.713 1.00 117.81 ? 262 HIS C CD2   1 
ATOM   9046  C CE1   . HIS C 1 262 ? 154.483 116.406 151.237 1.00 117.81 ? 262 HIS C CE1   1 
ATOM   9047  N NE2   . HIS C 1 262 ? 153.392 115.875 151.758 1.00 117.81 ? 262 HIS C NE2   1 
ATOM   9048  N N     . GLU C 1 263 ? 150.994 122.130 151.553 1.00 120.20 ? 263 GLU C N     1 
ATOM   9049  C CA    . GLU C 1 263 ? 150.471 123.357 150.970 1.00 120.20 ? 263 GLU C CA    1 
ATOM   9050  C C     . GLU C 1 263 ? 149.402 123.951 151.876 1.00 120.20 ? 263 GLU C C     1 
ATOM   9051  O O     . GLU C 1 263 ? 148.599 123.223 152.465 1.00 120.20 ? 263 GLU C O     1 
ATOM   9052  C CB    . GLU C 1 263 ? 149.921 123.095 149.566 1.00 120.20 ? 263 GLU C CB    1 
ATOM   9053  C CG    . GLU C 1 263 ? 148.775 122.106 149.521 1.00 120.20 ? 263 GLU C CG    1 
ATOM   9054  C CD    . GLU C 1 263 ? 148.376 121.758 148.104 1.00 120.20 ? 263 GLU C CD    1 
ATOM   9055  O OE1   . GLU C 1 263 ? 149.026 122.266 147.168 1.00 120.20 ? 263 GLU C OE1   1 
ATOM   9056  O OE2   . GLU C 1 263 ? 147.415 120.978 147.927 1.00 120.20 ? 263 GLU C OE2   1 
ATOM   9057  N N     . ILE C 1 264 ? 149.404 125.276 151.978 1.00 100.34 ? 264 ILE C N     1 
ATOM   9058  C CA    . ILE C 1 264 ? 148.512 126.006 152.874 1.00 100.34 ? 264 ILE C CA    1 
ATOM   9059  C C     . ILE C 1 264 ? 147.338 126.564 152.078 1.00 100.34 ? 264 ILE C C     1 
ATOM   9060  O O     . ILE C 1 264 ? 147.403 126.619 150.842 1.00 100.34 ? 264 ILE C O     1 
ATOM   9061  C CB    . ILE C 1 264 ? 149.267 127.126 153.606 1.00 100.34 ? 264 ILE C CB    1 
ATOM   9062  C CG1   . ILE C 1 264 ? 149.867 128.105 152.598 1.00 100.34 ? 264 ILE C CG1   1 
ATOM   9063  C CG2   . ILE C 1 264 ? 150.330 126.545 154.514 1.00 100.34 ? 264 ILE C CG2   1 
ATOM   9064  C CD1   . ILE C 1 264 ? 150.431 129.353 153.230 1.00 100.34 ? 264 ILE C CD1   1 
ATOM   9065  N N     . PRO C 1 265 ? 146.253 126.978 152.729 1.00 94.36  ? 265 PRO C N     1 
ATOM   9066  C CA    . PRO C 1 265 ? 145.114 127.529 151.990 1.00 94.36  ? 265 PRO C CA    1 
ATOM   9067  C C     . PRO C 1 265 ? 145.447 128.842 151.300 1.00 94.36  ? 265 PRO C C     1 
ATOM   9068  O O     . PRO C 1 265 ? 146.562 129.362 151.371 1.00 94.36  ? 265 PRO C O     1 
ATOM   9069  C CB    . PRO C 1 265 ? 144.055 127.737 153.076 1.00 94.36  ? 265 PRO C CB    1 
ATOM   9070  C CG    . PRO C 1 265 ? 144.422 126.780 154.139 1.00 94.36  ? 265 PRO C CG    1 
ATOM   9071  C CD    . PRO C 1 265 ? 145.916 126.741 154.142 1.00 94.36  ? 265 PRO C CD    1 
ATOM   9072  N N     . TYR C 1 266 ? 144.433 129.376 150.627 1.00 92.16  ? 266 TYR C N     1 
ATOM   9073  C CA    . TYR C 1 266 ? 144.598 130.566 149.806 1.00 92.16  ? 266 TYR C CA    1 
ATOM   9074  C C     . TYR C 1 266 ? 144.726 131.815 150.671 1.00 92.16  ? 266 TYR C C     1 
ATOM   9075  O O     . TYR C 1 266 ? 143.922 132.046 151.577 1.00 92.16  ? 266 TYR C O     1 
ATOM   9076  C CB    . TYR C 1 266 ? 143.404 130.684 148.858 1.00 92.16  ? 266 TYR C CB    1 
ATOM   9077  C CG    . TYR C 1 266 ? 143.442 131.834 147.885 1.00 92.16  ? 266 TYR C CG    1 
ATOM   9078  C CD1   . TYR C 1 266 ? 144.310 131.828 146.806 1.00 92.16  ? 266 TYR C CD1   1 
ATOM   9079  C CD2   . TYR C 1 266 ? 142.570 132.903 148.016 1.00 92.16  ? 266 TYR C CD2   1 
ATOM   9080  C CE1   . TYR C 1 266 ? 144.333 132.871 145.903 1.00 92.16  ? 266 TYR C CE1   1 
ATOM   9081  C CE2   . TYR C 1 266 ? 142.582 133.947 147.116 1.00 92.16  ? 266 TYR C CE2   1 
ATOM   9082  C CZ    . TYR C 1 266 ? 143.466 133.928 146.063 1.00 92.16  ? 266 TYR C CZ    1 
ATOM   9083  O OH    . TYR C 1 266 ? 143.481 134.970 145.168 1.00 92.16  ? 266 TYR C OH    1 
ATOM   9084  N N     . GLN C 1 267 ? 145.753 132.619 150.384 1.00 96.48  ? 267 GLN C N     1 
ATOM   9085  C CA    . GLN C 1 267 ? 145.989 133.898 151.065 1.00 96.48  ? 267 GLN C CA    1 
ATOM   9086  C C     . GLN C 1 267 ? 146.179 133.725 152.570 1.00 96.48  ? 267 GLN C C     1 
ATOM   9087  O O     . GLN C 1 267 ? 145.372 134.198 153.372 1.00 96.48  ? 267 GLN C O     1 
ATOM   9088  C CB    . GLN C 1 267 ? 144.862 134.893 150.783 1.00 96.48  ? 267 GLN C CB    1 
ATOM   9089  C CG    . GLN C 1 267 ? 144.820 135.399 149.361 1.00 96.48  ? 267 GLN C CG    1 
ATOM   9090  C CD    . GLN C 1 267 ? 143.683 136.371 149.130 1.00 96.48  ? 267 GLN C CD    1 
ATOM   9091  O OE1   . GLN C 1 267 ? 142.875 136.620 150.024 1.00 96.48  ? 267 GLN C OE1   1 
ATOM   9092  N NE2   . GLN C 1 267 ? 143.614 136.927 147.927 1.00 96.48  ? 267 GLN C NE2   1 
ATOM   9093  N N     . VAL C 1 268 ? 147.253 133.046 152.962 1.00 102.11 ? 268 VAL C N     1 
ATOM   9094  C CA    . VAL C 1 268 ? 147.602 132.863 154.365 1.00 102.11 ? 268 VAL C CA    1 
ATOM   9095  C C     . VAL C 1 268 ? 149.086 133.148 154.539 1.00 102.11 ? 268 VAL C C     1 
ATOM   9096  O O     . VAL C 1 268 ? 149.921 132.561 153.842 1.00 102.11 ? 268 VAL C O     1 
ATOM   9097  C CB    . VAL C 1 268 ? 147.266 131.444 154.856 1.00 102.11 ? 268 VAL C CB    1 
ATOM   9098  C CG1   . VAL C 1 268 ? 147.736 131.262 156.286 1.00 102.11 ? 268 VAL C CG1   1 
ATOM   9099  C CG2   . VAL C 1 268 ? 145.775 131.181 154.747 1.00 102.11 ? 268 VAL C CG2   1 
ATOM   9100  N N     . ASN C 1 269 ? 149.413 134.042 155.470 1.00 113.60 ? 269 ASN C N     1 
ATOM   9101  C CA    . ASN C 1 269 ? 150.807 134.313 155.795 1.00 113.60 ? 269 ASN C CA    1 
ATOM   9102  C C     . ASN C 1 269 ? 151.399 133.139 156.562 1.00 113.60 ? 269 ASN C C     1 
ATOM   9103  O O     . ASN C 1 269 ? 150.848 132.707 157.579 1.00 113.60 ? 269 ASN C O     1 
ATOM   9104  C CB    . ASN C 1 269 ? 150.930 135.594 156.619 1.00 113.60 ? 269 ASN C CB    1 
ATOM   9105  C CG    . ASN C 1 269 ? 150.530 136.826 155.842 1.00 113.60 ? 269 ASN C CG    1 
ATOM   9106  O OD1   . ASN C 1 269 ? 149.539 137.482 156.162 1.00 113.60 ? 269 ASN C OD1   1 
ATOM   9107  N ND2   . ASN C 1 269 ? 151.303 137.153 154.815 1.00 113.60 ? 269 ASN C ND2   1 
ATOM   9108  N N     . LYS C 1 270 ? 152.528 132.627 156.075 1.00 119.93 ? 270 LYS C N     1 
ATOM   9109  C CA    . LYS C 1 270 ? 153.133 131.459 156.705 1.00 119.93 ? 270 LYS C CA    1 
ATOM   9110  C C     . LYS C 1 270 ? 153.772 131.820 158.041 1.00 119.93 ? 270 LYS C C     1 
ATOM   9111  O O     . LYS C 1 270 ? 153.659 131.066 159.016 1.00 119.93 ? 270 LYS C O     1 
ATOM   9112  C CB    . LYS C 1 270 ? 154.158 130.834 155.761 1.00 119.93 ? 270 LYS C CB    1 
ATOM   9113  C CG    . LYS C 1 270 ? 154.783 129.556 156.283 1.00 119.93 ? 270 LYS C CG    1 
ATOM   9114  C CD    . LYS C 1 270 ? 155.650 128.896 155.227 1.00 119.93 ? 270 LYS C CD    1 
ATOM   9115  C CE    . LYS C 1 270 ? 156.946 129.656 155.025 1.00 119.93 ? 270 LYS C CE    1 
ATOM   9116  N NZ    . LYS C 1 270 ? 157.857 128.956 154.079 1.00 119.93 ? 270 LYS C NZ    1 
ATOM   9117  N N     . ALA C 1 271 ? 154.443 132.972 158.108 1.00 121.03 ? 271 ALA C N     1 
ATOM   9118  C CA    . ALA C 1 271 ? 155.095 133.376 159.349 1.00 121.03 ? 271 ALA C CA    1 
ATOM   9119  C C     . ALA C 1 271 ? 154.078 133.624 160.454 1.00 121.03 ? 271 ALA C C     1 
ATOM   9120  O O     . ALA C 1 271 ? 154.279 133.196 161.599 1.00 121.03 ? 271 ALA C O     1 
ATOM   9121  C CB    . ALA C 1 271 ? 155.946 134.622 159.113 1.00 121.03 ? 271 ALA C CB    1 
ATOM   9122  N N     . ARG C 1 272 ? 152.987 134.326 160.136 1.00 123.42 ? 272 ARG C N     1 
ATOM   9123  C CA    . ARG C 1 272 ? 151.929 134.527 161.119 1.00 123.42 ? 272 ARG C CA    1 
ATOM   9124  C C     . ARG C 1 272 ? 151.369 133.196 161.596 1.00 123.42 ? 272 ARG C C     1 
ATOM   9125  O O     . ARG C 1 272 ? 151.079 133.025 162.785 1.00 123.42 ? 272 ARG C O     1 
ATOM   9126  C CB    . ARG C 1 272 ? 150.814 135.388 160.529 1.00 123.42 ? 272 ARG C CB    1 
ATOM   9127  C CG    . ARG C 1 272 ? 151.199 136.831 160.270 1.00 123.42 ? 272 ARG C CG    1 
ATOM   9128  C CD    . ARG C 1 272 ? 150.015 137.604 159.717 1.00 123.42 ? 272 ARG C CD    1 
ATOM   9129  N NE    . ARG C 1 272 ? 150.340 139.000 159.450 1.00 123.42 ? 272 ARG C NE    1 
ATOM   9130  C CZ    . ARG C 1 272 ? 149.488 139.876 158.928 1.00 123.42 ? 272 ARG C CZ    1 
ATOM   9131  N NH1   . ARG C 1 272 ? 148.255 139.499 158.617 1.00 123.42 ? 272 ARG C NH1   1 
ATOM   9132  N NH2   . ARG C 1 272 ? 149.867 141.129 158.718 1.00 123.42 ? 272 ARG C NH2   1 
ATOM   9133  N N     . LEU C 1 273 ? 151.219 132.238 160.680 1.00 117.75 ? 273 LEU C N     1 
ATOM   9134  C CA    . LEU C 1 273 ? 150.708 130.923 161.050 1.00 117.75 ? 273 LEU C CA    1 
ATOM   9135  C C     . LEU C 1 273 ? 151.642 130.229 162.031 1.00 117.75 ? 273 LEU C C     1 
ATOM   9136  O O     . LEU C 1 273 ? 151.203 129.701 163.061 1.00 117.75 ? 273 LEU C O     1 
ATOM   9137  C CB    . LEU C 1 273 ? 150.516 130.072 159.796 1.00 117.75 ? 273 LEU C CB    1 
ATOM   9138  C CG    . LEU C 1 273 ? 149.915 128.687 160.014 1.00 117.75 ? 273 LEU C CG    1 
ATOM   9139  C CD1   . LEU C 1 273 ? 148.502 128.811 160.556 1.00 117.75 ? 273 LEU C CD1   1 
ATOM   9140  C CD2   . LEU C 1 273 ? 149.933 127.884 158.725 1.00 117.75 ? 273 LEU C CD2   1 
ATOM   9141  N N     . ILE C 1 274 ? 152.940 130.213 161.720 1.00 118.33 ? 274 ILE C N     1 
ATOM   9142  C CA    . ILE C 1 274 ? 153.908 129.567 162.602 1.00 118.33 ? 274 ILE C CA    1 
ATOM   9143  C C     . ILE C 1 274 ? 153.909 130.230 163.971 1.00 118.33 ? 274 ILE C C     1 
ATOM   9144  O O     . ILE C 1 274 ? 153.939 129.552 165.008 1.00 118.33 ? 274 ILE C O     1 
ATOM   9145  C CB    . ILE C 1 274 ? 155.308 129.588 161.965 1.00 118.33 ? 274 ILE C CB    1 
ATOM   9146  C CG1   . ILE C 1 274 ? 155.297 128.823 160.643 1.00 118.33 ? 274 ILE C CG1   1 
ATOM   9147  C CG2   . ILE C 1 274 ? 156.333 128.999 162.914 1.00 118.33 ? 274 ILE C CG2   1 
ATOM   9148  C CD1   . ILE C 1 274 ? 154.917 127.371 160.790 1.00 118.33 ? 274 ILE C CD1   1 
ATOM   9149  N N     . GLU C 1 275 ? 153.871 131.563 164.001 1.00 132.61 ? 275 GLU C N     1 
ATOM   9150  C CA    . GLU C 1 275 ? 153.887 132.261 165.280 1.00 132.61 ? 275 GLU C CA    1 
ATOM   9151  C C     . GLU C 1 275 ? 152.632 131.962 166.089 1.00 132.61 ? 275 GLU C C     1 
ATOM   9152  O O     . GLU C 1 275 ? 152.706 131.746 167.305 1.00 132.61 ? 275 GLU C O     1 
ATOM   9153  C CB    . GLU C 1 275 ? 154.037 133.764 165.060 1.00 132.61 ? 275 GLU C CB    1 
ATOM   9154  C CG    . GLU C 1 275 ? 154.120 134.554 166.349 1.00 132.61 ? 275 GLU C CG    1 
ATOM   9155  C CD    . GLU C 1 275 ? 154.335 136.030 166.111 1.00 132.61 ? 275 GLU C CD    1 
ATOM   9156  O OE1   . GLU C 1 275 ? 154.423 136.435 164.933 1.00 132.61 ? 275 GLU C OE1   1 
ATOM   9157  O OE2   . GLU C 1 275 ? 154.409 136.786 167.101 1.00 132.61 ? 275 GLU C OE2   1 
ATOM   9158  N N     . LYS C 1 276 ? 151.470 131.939 165.435 1.00 127.20 ? 276 LYS C N     1 
ATOM   9159  C CA    . LYS C 1 276 ? 150.234 131.664 166.155 1.00 127.20 ? 276 LYS C CA    1 
ATOM   9160  C C     . LYS C 1 276 ? 150.217 130.240 166.693 1.00 127.20 ? 276 LYS C C     1 
ATOM   9161  O O     . LYS C 1 276 ? 149.717 129.992 167.795 1.00 127.20 ? 276 LYS C O     1 
ATOM   9162  C CB    . LYS C 1 276 ? 149.031 131.915 165.249 1.00 127.20 ? 276 LYS C CB    1 
ATOM   9163  C CG    . LYS C 1 276 ? 147.693 131.800 165.957 1.00 127.20 ? 276 LYS C CG    1 
ATOM   9164  C CD    . LYS C 1 276 ? 146.546 132.148 165.026 1.00 127.20 ? 276 LYS C CD    1 
ATOM   9165  C CE    . LYS C 1 276 ? 145.207 132.027 165.732 1.00 127.20 ? 276 LYS C CE    1 
ATOM   9166  N NZ    . LYS C 1 276 ? 144.072 132.352 164.825 1.00 127.20 ? 276 LYS C NZ    1 
ATOM   9167  N N     . ILE C 1 277 ? 150.771 129.291 165.937 1.00 123.51 ? 277 ILE C N     1 
ATOM   9168  C CA    . ILE C 1 277 ? 150.836 127.916 166.427 1.00 123.51 ? 277 ILE C CA    1 
ATOM   9169  C C     . ILE C 1 277 ? 151.777 127.815 167.618 1.00 123.51 ? 277 ILE C C     1 
ATOM   9170  O O     . ILE C 1 277 ? 151.479 127.129 168.606 1.00 123.51 ? 277 ILE C O     1 
ATOM   9171  C CB    . ILE C 1 277 ? 151.246 126.960 165.294 1.00 123.51 ? 277 ILE C CB    1 
ATOM   9172  C CG1   . ILE C 1 277 ? 150.150 126.924 164.237 1.00 123.51 ? 277 ILE C CG1   1 
ATOM   9173  C CG2   . ILE C 1 277 ? 151.508 125.569 165.838 1.00 123.51 ? 277 ILE C CG2   1 
ATOM   9174  C CD1   . ILE C 1 277 ? 148.834 126.445 164.786 1.00 123.51 ? 277 ILE C CD1   1 
ATOM   9175  N N     . ALA C 1 278 ? 152.930 128.481 167.543 1.00 129.41 ? 278 ALA C N     1 
ATOM   9176  C CA    . ALA C 1 278 ? 153.831 128.504 168.690 1.00 129.41 ? 278 ALA C CA    1 
ATOM   9177  C C     . ALA C 1 278 ? 153.137 129.089 169.912 1.00 129.41 ? 278 ALA C C     1 
ATOM   9178  O O     . ALA C 1 278 ? 153.281 128.575 171.028 1.00 129.41 ? 278 ALA C O     1 
ATOM   9179  C CB    . ALA C 1 278 ? 155.092 129.297 168.355 1.00 129.41 ? 278 ALA C CB    1 
ATOM   9180  N N     . GLU C 1 279 ? 152.358 130.153 169.714 1.00 135.68 ? 279 GLU C N     1 
ATOM   9181  C CA    . GLU C 1 279 ? 151.646 130.764 170.830 1.00 135.68 ? 279 GLU C CA    1 
ATOM   9182  C C     . GLU C 1 279 ? 150.602 129.817 171.407 1.00 135.68 ? 279 GLU C C     1 
ATOM   9183  O O     . GLU C 1 279 ? 150.459 129.713 172.630 1.00 135.68 ? 279 GLU C O     1 
ATOM   9184  C CB    . GLU C 1 279 ? 150.990 132.067 170.385 1.00 135.68 ? 279 GLU C CB    1 
ATOM   9185  C CG    . GLU C 1 279 ? 150.290 132.806 171.508 1.00 135.68 ? 279 GLU C CG    1 
ATOM   9186  C CD    . GLU C 1 279 ? 149.690 134.117 171.053 1.00 135.68 ? 279 GLU C CD    1 
ATOM   9187  O OE1   . GLU C 1 279 ? 149.788 134.430 169.848 1.00 135.68 ? 279 GLU C OE1   1 
ATOM   9188  O OE2   . GLU C 1 279 ? 149.124 134.838 171.900 1.00 135.68 ? 279 GLU C OE2   1 
ATOM   9189  N N     . LEU C 1 280 ? 149.856 129.126 170.544 1.00 130.94 ? 280 LEU C N     1 
ATOM   9190  C CA    . LEU C 1 280 ? 148.850 128.188 171.032 1.00 130.94 ? 280 LEU C CA    1 
ATOM   9191  C C     . LEU C 1 280 ? 149.491 127.059 171.824 1.00 130.94 ? 280 LEU C C     1 
ATOM   9192  O O     . LEU C 1 280 ? 148.961 126.638 172.859 1.00 130.94 ? 280 LEU C O     1 
ATOM   9193  C CB    . LEU C 1 280 ? 148.036 127.627 169.869 1.00 130.94 ? 280 LEU C CB    1 
ATOM   9194  C CG    . LEU C 1 280 ? 147.109 128.610 169.156 1.00 130.94 ? 280 LEU C CG    1 
ATOM   9195  C CD1   . LEU C 1 280 ? 146.476 127.958 167.941 1.00 130.94 ? 280 LEU C CD1   1 
ATOM   9196  C CD2   . LEU C 1 280 ? 146.043 129.118 170.109 1.00 130.94 ? 280 LEU C CD2   1 
ATOM   9197  N N     . VAL C 1 281 ? 150.631 126.553 171.354 1.00 132.51 ? 281 VAL C N     1 
ATOM   9198  C CA    . VAL C 1 281 ? 151.326 125.505 172.093 1.00 132.51 ? 281 VAL C CA    1 
ATOM   9199  C C     . VAL C 1 281 ? 151.810 126.037 173.434 1.00 132.51 ? 281 VAL C C     1 
ATOM   9200  O O     . VAL C 1 281 ? 151.728 125.350 174.460 1.00 132.51 ? 281 VAL C O     1 
ATOM   9201  C CB    . VAL C 1 281 ? 152.485 124.935 171.256 1.00 132.51 ? 281 VAL C CB    1 
ATOM   9202  C CG1   . VAL C 1 281 ? 153.286 123.936 172.071 1.00 132.51 ? 281 VAL C CG1   1 
ATOM   9203  C CG2   . VAL C 1 281 ? 151.947 124.282 170.002 1.00 132.51 ? 281 VAL C CG2   1 
ATOM   9204  N N     . LYS C 1 282 ? 152.310 127.273 173.450 1.00 131.20 ? 282 LYS C N     1 
ATOM   9205  C CA    . LYS C 1 282 ? 152.780 127.863 174.698 1.00 131.20 ? 282 LYS C CA    1 
ATOM   9206  C C     . LYS C 1 282 ? 151.633 128.062 175.683 1.00 131.20 ? 282 LYS C C     1 
ATOM   9207  O O     . LYS C 1 282 ? 151.819 127.939 176.899 1.00 131.20 ? 282 LYS C O     1 
ATOM   9208  C CB    . LYS C 1 282 ? 153.481 129.189 174.409 1.00 131.20 ? 282 LYS C CB    1 
ATOM   9209  C CG    . LYS C 1 282 ? 154.063 129.866 175.630 1.00 131.20 ? 282 LYS C CG    1 
ATOM   9210  C CD    . LYS C 1 282 ? 155.218 129.066 176.197 1.00 131.20 ? 282 LYS C CD    1 
ATOM   9211  C CE    . LYS C 1 282 ? 155.806 129.752 177.416 1.00 131.20 ? 282 LYS C CE    1 
ATOM   9212  N NZ    . LYS C 1 282 ? 156.444 131.050 177.059 1.00 131.20 ? 282 LYS C NZ    1 
ATOM   9213  N N     . GLU C 1 283 ? 150.437 128.364 175.176 1.00 137.29 ? 283 GLU C N     1 
ATOM   9214  C CA    . GLU C 1 283 ? 149.310 128.640 176.060 1.00 137.29 ? 283 GLU C CA    1 
ATOM   9215  C C     . GLU C 1 283 ? 148.660 127.354 176.549 1.00 137.29 ? 283 GLU C C     1 
ATOM   9216  O O     . GLU C 1 283 ? 147.720 127.395 177.352 1.00 137.29 ? 283 GLU C O     1 
ATOM   9217  C CB    . GLU C 1 283 ? 148.286 129.518 175.344 1.00 137.29 ? 283 GLU C CB    1 
ATOM   9218  C CG    . GLU C 1 283 ? 148.784 130.914 175.029 1.00 137.29 ? 283 GLU C CG    1 
ATOM   9219  C CD    . GLU C 1 283 ? 147.752 131.744 174.296 1.00 137.29 ? 283 GLU C CD    1 
ATOM   9220  O OE1   . GLU C 1 283 ? 146.687 131.195 173.946 1.00 137.29 ? 283 GLU C OE1   1 
ATOM   9221  O OE2   . GLU C 1 283 ? 148.006 132.944 174.063 1.00 137.29 ? 283 GLU C OE2   1 
ATOM   9222  N N     . LYS C 1 284 ? 149.122 126.206 176.046 1.00 143.40 ? 284 LYS C N     1 
ATOM   9223  C CA    . LYS C 1 284 ? 148.643 124.890 176.460 1.00 143.40 ? 284 LYS C CA    1 
ATOM   9224  C C     . LYS C 1 284 ? 147.197 124.671 176.016 1.00 143.40 ? 284 LYS C C     1 
ATOM   9225  O O     . LYS C 1 284 ? 146.580 123.658 176.358 1.00 143.40 ? 284 LYS C O     1 
ATOM   9226  C CB    . LYS C 1 284 ? 148.799 124.724 177.980 1.00 143.40 ? 284 LYS C CB    1 
ATOM   9227  C CG    . LYS C 1 284 ? 148.595 123.315 178.513 1.00 143.40 ? 284 LYS C CG    1 
ATOM   9228  C CD    . LYS C 1 284 ? 148.829 123.254 180.011 1.00 143.40 ? 284 LYS C CD    1 
ATOM   9229  C CE    . LYS C 1 284 ? 148.595 121.853 180.548 1.00 143.40 ? 284 LYS C CE    1 
ATOM   9230  N NZ    . LYS C 1 284 ? 148.823 121.778 182.017 1.00 143.40 ? 284 LYS C NZ    1 
ATOM   9231  N N     . ARG C 1 285 ? 146.650 125.605 175.232 1.00 139.51 ? 285 ARG C N     1 
ATOM   9232  C CA    . ARG C 1 285 ? 145.303 125.429 174.701 1.00 139.51 ? 285 ARG C CA    1 
ATOM   9233  C C     . ARG C 1 285 ? 145.195 124.205 173.805 1.00 139.51 ? 285 ARG C C     1 
ATOM   9234  O O     . ARG C 1 285 ? 144.119 123.606 173.716 1.00 139.51 ? 285 ARG C O     1 
ATOM   9235  C CB    . ARG C 1 285 ? 144.872 126.671 173.923 1.00 139.51 ? 285 ARG C CB    1 
ATOM   9236  C CG    . ARG C 1 285 ? 144.680 127.908 174.776 1.00 139.51 ? 285 ARG C CG    1 
ATOM   9237  C CD    . ARG C 1 285 ? 144.236 129.078 173.920 1.00 139.51 ? 285 ARG C CD    1 
ATOM   9238  N NE    . ARG C 1 285 ? 144.122 130.315 174.686 1.00 139.51 ? 285 ARG C NE    1 
ATOM   9239  C CZ    . ARG C 1 285 ? 143.013 130.714 175.299 1.00 139.51 ? 285 ARG C CZ    1 
ATOM   9240  N NH1   . ARG C 1 285 ? 141.915 129.974 175.238 1.00 139.51 ? 285 ARG C NH1   1 
ATOM   9241  N NH2   . ARG C 1 285 ? 143.002 131.856 175.972 1.00 139.51 ? 285 ARG C NH2   1 
ATOM   9242  N N     . VAL C 1 286 ? 146.281 123.824 173.138 1.00 136.61 ? 286 VAL C N     1 
ATOM   9243  C CA    . VAL C 1 286 ? 146.317 122.627 172.312 1.00 136.61 ? 286 VAL C CA    1 
ATOM   9244  C C     . VAL C 1 286 ? 147.281 121.643 172.964 1.00 136.61 ? 286 VAL C C     1 
ATOM   9245  O O     . VAL C 1 286 ? 148.176 122.023 173.723 1.00 136.61 ? 286 VAL C O     1 
ATOM   9246  C CB    . VAL C 1 286 ? 146.731 122.941 170.860 1.00 136.61 ? 286 VAL C CB    1 
ATOM   9247  C CG1   . VAL C 1 286 ? 148.192 123.366 170.798 1.00 136.61 ? 286 VAL C CG1   1 
ATOM   9248  C CG2   . VAL C 1 286 ? 146.448 121.761 169.940 1.00 136.61 ? 286 VAL C CG2   1 
ATOM   9249  N N     . GLU C 1 287 ? 147.083 120.362 172.670 1.00 142.37 ? 287 GLU C N     1 
ATOM   9250  C CA    . GLU C 1 287 ? 147.819 119.294 173.326 1.00 142.37 ? 287 GLU C CA    1 
ATOM   9251  C C     . GLU C 1 287 ? 148.595 118.469 172.310 1.00 142.37 ? 287 GLU C C     1 
ATOM   9252  O O     . GLU C 1 287 ? 148.300 118.475 171.113 1.00 142.37 ? 287 GLU C O     1 
ATOM   9253  C CB    . GLU C 1 287 ? 146.871 118.380 174.110 1.00 142.37 ? 287 GLU C CB    1 
ATOM   9254  C CG    . GLU C 1 287 ? 146.140 119.077 175.239 1.00 142.37 ? 287 GLU C CG    1 
ATOM   9255  C CD    . GLU C 1 287 ? 147.072 119.517 176.344 1.00 142.37 ? 287 GLU C CD    1 
ATOM   9256  O OE1   . GLU C 1 287 ? 148.085 118.826 176.579 1.00 142.37 ? 287 GLU C OE1   1 
ATOM   9257  O OE2   . GLU C 1 287 ? 146.794 120.556 176.978 1.00 142.37 ? 287 GLU C OE2   1 
ATOM   9258  N N     . GLY C 1 288 ? 149.602 117.757 172.809 1.00 139.28 ? 288 GLY C N     1 
ATOM   9259  C CA    . GLY C 1 288 ? 150.305 116.769 172.017 1.00 139.28 ? 288 GLY C CA    1 
ATOM   9260  C C     . GLY C 1 288 ? 151.350 117.298 171.063 1.00 139.28 ? 288 GLY C C     1 
ATOM   9261  O O     . GLY C 1 288 ? 151.834 116.532 170.221 1.00 139.28 ? 288 GLY C O     1 
ATOM   9262  N N     . ILE C 1 289 ? 151.725 118.568 171.162 1.00 136.91 ? 289 ILE C N     1 
ATOM   9263  C CA    . ILE C 1 289 ? 152.734 119.157 170.290 1.00 136.91 ? 289 ILE C CA    1 
ATOM   9264  C C     . ILE C 1 289 ? 153.990 119.396 171.113 1.00 136.91 ? 289 ILE C C     1 
ATOM   9265  O O     . ILE C 1 289 ? 153.943 120.065 172.153 1.00 136.91 ? 289 ILE C O     1 
ATOM   9266  C CB    . ILE C 1 289 ? 152.241 120.458 169.643 1.00 136.91 ? 289 ILE C CB    1 
ATOM   9267  C CG1   . ILE C 1 289 ? 151.046 120.173 168.733 1.00 136.91 ? 289 ILE C CG1   1 
ATOM   9268  C CG2   . ILE C 1 289 ? 153.364 121.112 168.859 1.00 136.91 ? 289 ILE C CG2   1 
ATOM   9269  C CD1   . ILE C 1 289 ? 150.341 121.415 168.247 1.00 136.91 ? 289 ILE C CD1   1 
ATOM   9270  N N     . SER C 1 290 ? 155.113 118.853 170.647 1.00 143.09 ? 290 SER C N     1 
ATOM   9271  C CA    . SER C 1 290 ? 156.376 118.961 171.369 1.00 143.09 ? 290 SER C CA    1 
ATOM   9272  C C     . SER C 1 290 ? 157.204 120.151 170.891 1.00 143.09 ? 290 SER C C     1 
ATOM   9273  O O     . SER C 1 290 ? 157.542 121.037 171.681 1.00 143.09 ? 290 SER C O     1 
ATOM   9274  C CB    . SER C 1 290 ? 157.171 117.660 171.221 1.00 143.09 ? 290 SER C CB    1 
ATOM   9275  O OG    . SER C 1 290 ? 157.558 117.455 169.874 1.00 143.09 ? 290 SER C OG    1 
ATOM   9276  N N     . ALA C 1 291 ? 157.535 120.183 169.603 1.00 136.81 ? 291 ALA C N     1 
ATOM   9277  C CA    . ALA C 1 291 ? 158.388 121.225 169.047 1.00 136.81 ? 291 ALA C CA    1 
ATOM   9278  C C     . ALA C 1 291 ? 157.841 121.621 167.681 1.00 136.81 ? 291 ALA C C     1 
ATOM   9279  O O     . ALA C 1 291 ? 156.720 121.260 167.309 1.00 136.81 ? 291 ALA C O     1 
ATOM   9280  C CB    . ALA C 1 291 ? 159.846 120.752 168.973 1.00 136.81 ? 291 ALA C CB    1 
ATOM   9281  N N     . LEU C 1 292 ? 158.641 122.372 166.928 1.00 132.35 ? 292 LEU C N     1 
ATOM   9282  C CA    . LEU C 1 292 ? 158.235 122.835 165.608 1.00 132.35 ? 292 LEU C CA    1 
ATOM   9283  C C     . LEU C 1 292 ? 159.485 123.148 164.801 1.00 132.35 ? 292 LEU C C     1 
ATOM   9284  O O     . LEU C 1 292 ? 160.408 123.788 165.311 1.00 132.35 ? 292 LEU C O     1 
ATOM   9285  C CB    . LEU C 1 292 ? 157.333 124.070 165.716 1.00 132.35 ? 292 LEU C CB    1 
ATOM   9286  C CG    . LEU C 1 292 ? 156.626 124.562 164.453 1.00 132.35 ? 292 LEU C CG    1 
ATOM   9287  C CD1   . LEU C 1 292 ? 155.325 125.243 164.834 1.00 132.35 ? 292 LEU C CD1   1 
ATOM   9288  C CD2   . LEU C 1 292 ? 157.503 125.512 163.654 1.00 132.35 ? 292 LEU C CD2   1 
ATOM   9289  N N     . ARG C 1 293 ? 159.508 122.703 163.547 1.00 135.74 ? 293 ARG C N     1 
ATOM   9290  C CA    . ARG C 1 293 ? 160.655 122.908 162.677 1.00 135.74 ? 293 ARG C CA    1 
ATOM   9291  C C     . ARG C 1 293 ? 160.175 123.313 161.292 1.00 135.74 ? 293 ARG C C     1 
ATOM   9292  O O     . ARG C 1 293 ? 158.977 123.468 161.043 1.00 135.74 ? 293 ARG C O     1 
ATOM   9293  C CB    . ARG C 1 293 ? 161.531 121.652 162.597 1.00 135.74 ? 293 ARG C CB    1 
ATOM   9294  C CG    . ARG C 1 293 ? 162.250 121.319 163.892 1.00 135.74 ? 293 ARG C CG    1 
ATOM   9295  C CD    . ARG C 1 293 ? 163.084 120.060 163.755 1.00 135.74 ? 293 ARG C CD    1 
ATOM   9296  N NE    . ARG C 1 293 ? 162.253 118.873 163.589 1.00 135.74 ? 293 ARG C NE    1 
ATOM   9297  C CZ    . ARG C 1 293 ? 162.727 117.660 163.325 1.00 135.74 ? 293 ARG C CZ    1 
ATOM   9298  N NH1   . ARG C 1 293 ? 164.033 117.471 163.197 1.00 135.74 ? 293 ARG C NH1   1 
ATOM   9299  N NH2   . ARG C 1 293 ? 161.896 116.636 163.191 1.00 135.74 ? 293 ARG C NH2   1 
ATOM   9300  N N     . ASP C 1 294 ? 161.134 123.495 160.388 1.00 144.04 ? 294 ASP C N     1 
ATOM   9301  C CA    . ASP C 1 294 ? 160.856 123.874 159.012 1.00 144.04 ? 294 ASP C CA    1 
ATOM   9302  C C     . ASP C 1 294 ? 161.897 123.249 158.097 1.00 144.04 ? 294 ASP C C     1 
ATOM   9303  O O     . ASP C 1 294 ? 163.070 123.138 158.462 1.00 144.04 ? 294 ASP C O     1 
ATOM   9304  C CB    . ASP C 1 294 ? 160.856 125.396 158.841 1.00 144.04 ? 294 ASP C CB    1 
ATOM   9305  C CG    . ASP C 1 294 ? 160.373 125.831 157.471 1.00 144.04 ? 294 ASP C CG    1 
ATOM   9306  O OD1   . ASP C 1 294 ? 160.047 124.957 156.640 1.00 144.04 ? 294 ASP C OD1   1 
ATOM   9307  O OD2   . ASP C 1 294 ? 160.325 127.052 157.224 1.00 144.04 ? 294 ASP C OD2   1 
ATOM   9308  N N     . GLU C 1 295 ? 161.458 122.843 156.905 1.00 141.98 ? 295 GLU C N     1 
ATOM   9309  C CA    . GLU C 1 295 ? 162.349 122.272 155.905 1.00 141.98 ? 295 GLU C CA    1 
ATOM   9310  C C     . GLU C 1 295 ? 162.062 122.805 154.508 1.00 141.98 ? 295 GLU C C     1 
ATOM   9311  O O     . GLU C 1 295 ? 162.551 122.230 153.528 1.00 141.98 ? 295 GLU C O     1 
ATOM   9312  C CB    . GLU C 1 295 ? 162.250 120.742 155.898 1.00 141.98 ? 295 GLU C CB    1 
ATOM   9313  C CG    . GLU C 1 295 ? 162.762 120.072 157.159 1.00 141.98 ? 295 GLU C CG    1 
ATOM   9314  C CD    . GLU C 1 295 ? 162.622 118.563 157.111 1.00 141.98 ? 295 GLU C CD    1 
ATOM   9315  O OE1   . GLU C 1 295 ? 162.029 118.049 156.139 1.00 141.98 ? 295 GLU C OE1   1 
ATOM   9316  O OE2   . GLU C 1 295 ? 163.101 117.891 158.048 1.00 141.98 ? 295 GLU C OE2   1 
ATOM   9317  N N     . SER C 1 296 ? 161.283 123.877 154.389 1.00 144.25 ? 296 SER C N     1 
ATOM   9318  C CA    . SER C 1 296 ? 160.918 124.392 153.077 1.00 144.25 ? 296 SER C CA    1 
ATOM   9319  C C     . SER C 1 296 ? 162.147 124.899 152.336 1.00 144.25 ? 296 SER C C     1 
ATOM   9320  O O     . SER C 1 296 ? 163.028 125.537 152.918 1.00 144.25 ? 296 SER C O     1 
ATOM   9321  C CB    . SER C 1 296 ? 159.886 125.509 153.218 1.00 144.25 ? 296 SER C CB    1 
ATOM   9322  O OG    . SER C 1 296 ? 158.685 125.014 153.781 1.00 144.25 ? 296 SER C OG    1 
ATOM   9323  N N     . ASP C 1 297 ? 162.198 124.612 151.040 1.00 158.45 ? 297 ASP C N     1 
ATOM   9324  C CA    . ASP C 1 297 ? 163.344 124.957 150.212 1.00 158.45 ? 297 ASP C CA    1 
ATOM   9325  C C     . ASP C 1 297 ? 162.847 125.275 148.807 1.00 158.45 ? 297 ASP C C     1 
ATOM   9326  O O     . ASP C 1 297 ? 161.650 125.481 148.584 1.00 158.45 ? 297 ASP C O     1 
ATOM   9327  C CB    . ASP C 1 297 ? 164.376 123.822 150.224 1.00 158.45 ? 297 ASP C CB    1 
ATOM   9328  C CG    . ASP C 1 297 ? 163.807 122.506 149.720 1.00 158.45 ? 297 ASP C CG    1 
ATOM   9329  O OD1   . ASP C 1 297 ? 162.592 122.441 149.435 1.00 158.45 ? 297 ASP C OD1   1 
ATOM   9330  O OD2   . ASP C 1 297 ? 164.579 121.532 149.608 1.00 158.45 ? 297 ASP C OD2   1 
ATOM   9331  N N     . LYS C 1 298 ? 163.773 125.307 147.853 1.00 163.55 ? 298 LYS C N     1 
ATOM   9332  C CA    . LYS C 1 298 ? 163.444 125.604 146.466 1.00 163.55 ? 298 LYS C CA    1 
ATOM   9333  C C     . LYS C 1 298 ? 162.837 124.417 145.730 1.00 163.55 ? 298 LYS C C     1 
ATOM   9334  O O     . LYS C 1 298 ? 162.744 124.453 144.499 1.00 163.55 ? 298 LYS C O     1 
ATOM   9335  C CB    . LYS C 1 298 ? 164.691 126.090 145.723 1.00 163.55 ? 298 LYS C CB    1 
ATOM   9336  C CG    . LYS C 1 298 ? 165.790 125.048 145.603 1.00 163.55 ? 298 LYS C CG    1 
ATOM   9337  C CD    . LYS C 1 298 ? 167.013 125.618 144.901 1.00 163.55 ? 298 LYS C CD    1 
ATOM   9338  C CE    . LYS C 1 298 ? 168.104 124.571 144.756 1.00 163.55 ? 298 LYS C CE    1 
ATOM   9339  N NZ    . LYS C 1 298 ? 168.670 124.180 146.076 1.00 163.55 ? 298 LYS C NZ    1 
ATOM   9340  N N     . ASP C 1 299 ? 162.428 123.371 146.445 1.00 167.17 ? 299 ASP C N     1 
ATOM   9341  C CA    . ASP C 1 299 ? 161.821 122.198 145.834 1.00 167.17 ? 299 ASP C CA    1 
ATOM   9342  C C     . ASP C 1 299 ? 160.394 121.956 146.301 1.00 167.17 ? 299 ASP C C     1 
ATOM   9343  O O     . ASP C 1 299 ? 159.819 120.912 145.975 1.00 167.17 ? 299 ASP C O     1 
ATOM   9344  C CB    . ASP C 1 299 ? 162.673 120.957 146.115 1.00 167.17 ? 299 ASP C CB    1 
ATOM   9345  C CG    . ASP C 1 299 ? 164.011 121.005 145.411 1.00 167.17 ? 299 ASP C CG    1 
ATOM   9346  O OD1   . ASP C 1 299 ? 164.096 121.649 144.345 1.00 167.17 ? 299 ASP C OD1   1 
ATOM   9347  O OD2   . ASP C 1 299 ? 164.976 120.401 145.922 1.00 167.17 ? 299 ASP C OD2   1 
ATOM   9348  N N     . GLY C 1 300 ? 159.813 122.876 147.050 1.00 158.00 ? 300 GLY C N     1 
ATOM   9349  C CA    . GLY C 1 300 ? 158.461 122.736 147.558 1.00 158.00 ? 300 GLY C CA    1 
ATOM   9350  C C     . GLY C 1 300 ? 158.418 123.029 149.044 1.00 158.00 ? 300 GLY C C     1 
ATOM   9351  O O     . GLY C 1 300 ? 159.349 122.741 149.796 1.00 158.00 ? 300 GLY C O     1 
ATOM   9352  N N     . MET C 1 301 ? 157.305 123.612 149.478 1.00 142.32 ? 301 MET C N     1 
ATOM   9353  C CA    . MET C 1 301 ? 157.140 123.970 150.878 1.00 142.32 ? 301 MET C CA    1 
ATOM   9354  C C     . MET C 1 301 ? 156.941 122.719 151.722 1.00 142.32 ? 301 MET C C     1 
ATOM   9355  O O     . MET C 1 301 ? 156.244 121.784 151.318 1.00 142.32 ? 301 MET C O     1 
ATOM   9356  C CB    . MET C 1 301 ? 155.957 124.920 151.052 1.00 142.32 ? 301 MET C CB    1 
ATOM   9357  C CG    . MET C 1 301 ? 155.779 125.422 152.469 1.00 142.32 ? 301 MET C CG    1 
ATOM   9358  S SD    . MET C 1 301 ? 154.416 126.583 152.613 1.00 142.32 ? 301 MET C SD    1 
ATOM   9359  C CE    . MET C 1 301 ? 153.038 125.468 152.389 1.00 142.32 ? 301 MET C CE    1 
ATOM   9360  N N     . ARG C 1 302 ? 157.561 122.706 152.899 1.00 136.96 ? 302 ARG C N     1 
ATOM   9361  C CA    . ARG C 1 302 ? 157.550 121.523 153.754 1.00 136.96 ? 302 ARG C CA    1 
ATOM   9362  C C     . ARG C 1 302 ? 157.644 121.973 155.204 1.00 136.96 ? 302 ARG C C     1 
ATOM   9363  O O     . ARG C 1 302 ? 158.669 122.522 155.618 1.00 136.96 ? 302 ARG C O     1 
ATOM   9364  C CB    . ARG C 1 302 ? 158.700 120.589 153.395 1.00 136.96 ? 302 ARG C CB    1 
ATOM   9365  C CG    . ARG C 1 302 ? 158.729 119.299 154.185 1.00 136.96 ? 302 ARG C CG    1 
ATOM   9366  C CD    . ARG C 1 302 ? 159.852 118.402 153.701 1.00 136.96 ? 302 ARG C CD    1 
ATOM   9367  N NE    . ARG C 1 302 ? 159.963 117.187 154.498 1.00 136.96 ? 302 ARG C NE    1 
ATOM   9368  C CZ    . ARG C 1 302 ? 159.266 116.081 154.267 1.00 136.96 ? 302 ARG C CZ    1 
ATOM   9369  N NH1   . ARG C 1 302 ? 158.404 116.040 153.260 1.00 136.96 ? 302 ARG C NH1   1 
ATOM   9370  N NH2   . ARG C 1 302 ? 159.428 115.018 155.041 1.00 136.96 ? 302 ARG C NH2   1 
ATOM   9371  N N     . ILE C 1 303 ? 156.581 121.742 155.968 1.00 120.60 ? 303 ILE C N     1 
ATOM   9372  C CA    . ILE C 1 303 ? 156.539 122.052 157.391 1.00 120.60 ? 303 ILE C CA    1 
ATOM   9373  C C     . ILE C 1 303 ? 156.419 120.744 158.156 1.00 120.60 ? 303 ILE C C     1 
ATOM   9374  O O     . ILE C 1 303 ? 155.579 119.900 157.825 1.00 120.60 ? 303 ILE C O     1 
ATOM   9375  C CB    . ILE C 1 303 ? 155.376 122.998 157.738 1.00 120.60 ? 303 ILE C CB    1 
ATOM   9376  C CG1   . ILE C 1 303 ? 155.573 124.351 157.060 1.00 120.60 ? 303 ILE C CG1   1 
ATOM   9377  C CG2   . ILE C 1 303 ? 155.261 123.174 159.240 1.00 120.60 ? 303 ILE C CG2   1 
ATOM   9378  C CD1   . ILE C 1 303 ? 154.372 125.255 157.163 1.00 120.60 ? 303 ILE C CD1   1 
ATOM   9379  N N     . VAL C 1 304 ? 157.256 120.578 159.175 1.00 127.36 ? 304 VAL C N     1 
ATOM   9380  C CA    . VAL C 1 304 ? 157.311 119.359 159.969 1.00 127.36 ? 304 VAL C CA    1 
ATOM   9381  C C     . VAL C 1 304 ? 156.924 119.699 161.400 1.00 127.36 ? 304 VAL C C     1 
ATOM   9382  O O     . VAL C 1 304 ? 157.450 120.656 161.980 1.00 127.36 ? 304 VAL C O     1 
ATOM   9383  C CB    . VAL C 1 304 ? 158.709 118.718 159.918 1.00 127.36 ? 304 VAL C CB    1 
ATOM   9384  C CG1   . VAL C 1 304 ? 158.779 117.518 160.841 1.00 127.36 ? 304 VAL C CG1   1 
ATOM   9385  C CG2   . VAL C 1 304 ? 159.052 118.321 158.494 1.00 127.36 ? 304 VAL C CG2   1 
ATOM   9386  N N     . ILE C 1 305 ? 156.008 118.917 161.966 1.00 126.65 ? 305 ILE C N     1 
ATOM   9387  C CA    . ILE C 1 305 ? 155.565 119.081 163.344 1.00 126.65 ? 305 ILE C CA    1 
ATOM   9388  C C     . ILE C 1 305 ? 155.789 117.767 164.077 1.00 126.65 ? 305 ILE C C     1 
ATOM   9389  O O     . ILE C 1 305 ? 155.345 116.710 163.615 1.00 126.65 ? 305 ILE C O     1 
ATOM   9390  C CB    . ILE C 1 305 ? 154.088 119.505 163.420 1.00 126.65 ? 305 ILE C CB    1 
ATOM   9391  C CG1   . ILE C 1 305 ? 153.904 120.884 162.790 1.00 126.65 ? 305 ILE C CG1   1 
ATOM   9392  C CG2   . ILE C 1 305 ? 153.611 119.507 164.859 1.00 126.65 ? 305 ILE C CG2   1 
ATOM   9393  C CD1   . ILE C 1 305 ? 152.461 121.275 162.601 1.00 126.65 ? 305 ILE C CD1   1 
ATOM   9394  N N     . GLU C 1 306 ? 156.471 117.836 165.216 1.00 143.95 ? 306 GLU C N     1 
ATOM   9395  C CA    . GLU C 1 306 ? 156.812 116.649 165.988 1.00 143.95 ? 306 GLU C CA    1 
ATOM   9396  C C     . GLU C 1 306 ? 155.713 116.368 167.004 1.00 143.95 ? 306 GLU C C     1 
ATOM   9397  O O     . GLU C 1 306 ? 155.441 117.196 167.880 1.00 143.95 ? 306 GLU C O     1 
ATOM   9398  C CB    . GLU C 1 306 ? 158.156 116.829 166.689 1.00 143.95 ? 306 GLU C CB    1 
ATOM   9399  C CG    . GLU C 1 306 ? 158.632 115.588 167.419 1.00 143.95 ? 306 GLU C CG    1 
ATOM   9400  C CD    . GLU C 1 306 ? 159.995 115.774 168.048 1.00 143.95 ? 306 GLU C CD    1 
ATOM   9401  O OE1   . GLU C 1 306 ? 160.549 116.888 167.946 1.00 143.95 ? 306 GLU C OE1   1 
ATOM   9402  O OE2   . GLU C 1 306 ? 160.515 114.804 168.639 1.00 143.95 ? 306 GLU C OE2   1 
ATOM   9403  N N     . VAL C 1 307 ? 155.093 115.202 166.889 1.00 140.24 ? 307 VAL C N     1 
ATOM   9404  C CA    . VAL C 1 307 ? 154.003 114.821 167.777 1.00 140.24 ? 307 VAL C CA    1 
ATOM   9405  C C     . VAL C 1 307 ? 154.570 114.409 169.128 1.00 140.24 ? 307 VAL C C     1 
ATOM   9406  O O     . VAL C 1 307 ? 155.619 113.762 169.217 1.00 140.24 ? 307 VAL C O     1 
ATOM   9407  C CB    . VAL C 1 307 ? 153.173 113.685 167.147 1.00 140.24 ? 307 VAL C CB    1 
ATOM   9408  C CG1   . VAL C 1 307 ? 152.044 113.260 168.075 1.00 140.24 ? 307 VAL C CG1   1 
ATOM   9409  C CG2   . VAL C 1 307 ? 152.639 114.108 165.789 1.00 140.24 ? 307 VAL C CG2   1 
ATOM   9410  N N     . LYS C 1 308 ? 153.875 114.796 170.194 1.00 142.22 ? 308 LYS C N     1 
ATOM   9411  C CA    . LYS C 1 308 ? 154.246 114.337 171.523 1.00 142.22 ? 308 LYS C CA    1 
ATOM   9412  C C     . LYS C 1 308 ? 154.121 112.820 171.606 1.00 142.22 ? 308 LYS C C     1 
ATOM   9413  O O     . LYS C 1 308 ? 153.224 112.215 171.013 1.00 142.22 ? 308 LYS C O     1 
ATOM   9414  C CB    . LYS C 1 308 ? 153.364 114.999 172.581 1.00 142.22 ? 308 LYS C CB    1 
ATOM   9415  C CG    . LYS C 1 308 ? 153.739 114.672 174.015 1.00 142.22 ? 308 LYS C CG    1 
ATOM   9416  C CD    . LYS C 1 308 ? 152.865 115.440 174.992 1.00 142.22 ? 308 LYS C CD    1 
ATOM   9417  C CE    . LYS C 1 308 ? 153.220 115.110 176.431 1.00 142.22 ? 308 LYS C CE    1 
ATOM   9418  N NZ    . LYS C 1 308 ? 152.367 115.859 177.394 1.00 142.22 ? 308 LYS C NZ    1 
ATOM   9419  N N     . ARG C 1 309 ? 155.042 112.207 172.344 1.00 152.66 ? 309 ARG C N     1 
ATOM   9420  C CA    . ARG C 1 309 ? 155.066 110.757 172.465 1.00 152.66 ? 309 ARG C CA    1 
ATOM   9421  C C     . ARG C 1 309 ? 153.774 110.247 173.096 1.00 152.66 ? 309 ARG C C     1 
ATOM   9422  O O     . ARG C 1 309 ? 153.164 110.908 173.941 1.00 152.66 ? 309 ARG C O     1 
ATOM   9423  C CB    . ARG C 1 309 ? 156.271 110.317 173.295 1.00 152.66 ? 309 ARG C CB    1 
ATOM   9424  C CG    . ARG C 1 309 ? 156.447 108.814 173.394 1.00 152.66 ? 309 ARG C CG    1 
ATOM   9425  C CD    . ARG C 1 309 ? 157.685 108.462 174.194 1.00 152.66 ? 309 ARG C CD    1 
ATOM   9426  N NE    . ARG C 1 309 ? 157.878 107.019 174.296 1.00 152.66 ? 309 ARG C NE    1 
ATOM   9427  C CZ    . ARG C 1 309 ? 157.358 106.265 175.259 1.00 152.66 ? 309 ARG C CZ    1 
ATOM   9428  N NH1   . ARG C 1 309 ? 156.608 106.817 176.203 1.00 152.66 ? 309 ARG C NH1   1 
ATOM   9429  N NH2   . ARG C 1 309 ? 157.585 104.960 175.278 1.00 152.66 ? 309 ARG C NH2   1 
ATOM   9430  N N     . ASP C 1 310 ? 153.356 109.059 172.658 1.00 159.71 ? 310 ASP C N     1 
ATOM   9431  C CA    . ASP C 1 310 ? 152.137 108.410 173.138 1.00 159.71 ? 310 ASP C CA    1 
ATOM   9432  C C     . ASP C 1 310 ? 150.901 109.257 172.849 1.00 159.71 ? 310 ASP C C     1 
ATOM   9433  O O     . ASP C 1 310 ? 150.090 109.523 173.739 1.00 159.71 ? 310 ASP C O     1 
ATOM   9434  C CB    . ASP C 1 310 ? 152.227 108.079 174.631 1.00 159.71 ? 310 ASP C CB    1 
ATOM   9435  C CG    . ASP C 1 310 ? 151.145 107.116 175.081 1.00 159.71 ? 310 ASP C CG    1 
ATOM   9436  O OD1   . ASP C 1 310 ? 150.327 106.696 174.237 1.00 159.71 ? 310 ASP C OD1   1 
ATOM   9437  O OD2   . ASP C 1 310 ? 151.109 106.782 176.283 1.00 159.71 ? 310 ASP C OD2   1 
ATOM   9438  N N     . ALA C 1 311 ? 150.763 109.701 171.604 1.00 150.07 ? 311 ALA C N     1 
ATOM   9439  C CA    . ALA C 1 311 ? 149.586 110.421 171.145 1.00 150.07 ? 311 ALA C CA    1 
ATOM   9440  C C     . ALA C 1 311 ? 149.260 109.963 169.734 1.00 150.07 ? 311 ALA C C     1 
ATOM   9441  O O     . ALA C 1 311 ? 150.146 109.923 168.874 1.00 150.07 ? 311 ALA C O     1 
ATOM   9442  C CB    . ALA C 1 311 ? 149.809 111.936 171.182 1.00 150.07 ? 311 ALA C CB    1 
ATOM   9443  N N     . VAL C 1 312 ? 147.997 109.603 169.501 1.00 144.54 ? 312 VAL C N     1 
ATOM   9444  C CA    . VAL C 1 312 ? 147.580 109.183 168.166 1.00 144.54 ? 312 VAL C CA    1 
ATOM   9445  C C     . VAL C 1 312 ? 147.787 110.313 167.167 1.00 144.54 ? 312 VAL C C     1 
ATOM   9446  O O     . VAL C 1 312 ? 148.094 110.078 165.992 1.00 144.54 ? 312 VAL C O     1 
ATOM   9447  C CB    . VAL C 1 312 ? 146.116 108.705 168.192 1.00 144.54 ? 312 VAL C CB    1 
ATOM   9448  C CG1   . VAL C 1 312 ? 145.636 108.358 166.791 1.00 144.54 ? 312 VAL C CG1   1 
ATOM   9449  C CG2   . VAL C 1 312 ? 145.971 107.510 169.119 1.00 144.54 ? 312 VAL C CG2   1 
ATOM   9450  N N     . GLY C 1 313 ? 147.632 111.555 167.617 1.00 133.85 ? 313 GLY C N     1 
ATOM   9451  C CA    . GLY C 1 313 ? 147.877 112.708 166.783 1.00 133.85 ? 313 GLY C CA    1 
ATOM   9452  C C     . GLY C 1 313 ? 146.755 113.071 165.839 1.00 133.85 ? 313 GLY C C     1 
ATOM   9453  O O     . GLY C 1 313 ? 146.713 114.212 165.368 1.00 133.85 ? 313 GLY C O     1 
ATOM   9454  N N     . GLU C 1 314 ? 145.844 112.144 165.545 1.00 132.49 ? 314 GLU C N     1 
ATOM   9455  C CA    . GLU C 1 314 ? 144.736 112.469 164.655 1.00 132.49 ? 314 GLU C CA    1 
ATOM   9456  C C     . GLU C 1 314 ? 143.719 113.359 165.355 1.00 132.49 ? 314 GLU C C     1 
ATOM   9457  O O     . GLU C 1 314 ? 143.128 114.249 164.731 1.00 132.49 ? 314 GLU C O     1 
ATOM   9458  C CB    . GLU C 1 314 ? 144.086 111.186 164.147 1.00 132.49 ? 314 GLU C CB    1 
ATOM   9459  C CG    . GLU C 1 314 ? 145.015 110.354 163.286 1.00 132.49 ? 314 GLU C CG    1 
ATOM   9460  C CD    . GLU C 1 314 ? 144.376 109.072 162.807 1.00 132.49 ? 314 GLU C CD    1 
ATOM   9461  O OE1   . GLU C 1 314 ? 143.239 108.778 163.230 1.00 132.49 ? 314 GLU C OE1   1 
ATOM   9462  O OE2   . GLU C 1 314 ? 145.015 108.354 162.011 1.00 132.49 ? 314 GLU C OE2   1 
ATOM   9463  N N     . VAL C 1 315 ? 143.506 113.139 166.653 1.00 124.50 ? 315 VAL C N     1 
ATOM   9464  C CA    . VAL C 1 315 ? 142.681 114.061 167.427 1.00 124.50 ? 315 VAL C CA    1 
ATOM   9465  C C     . VAL C 1 315 ? 143.329 115.438 167.459 1.00 124.50 ? 315 VAL C C     1 
ATOM   9466  O O     . VAL C 1 315 ? 142.647 116.466 167.375 1.00 124.50 ? 315 VAL C O     1 
ATOM   9467  C CB    . VAL C 1 315 ? 142.448 113.506 168.843 1.00 124.50 ? 315 VAL C CB    1 
ATOM   9468  C CG1   . VAL C 1 315 ? 141.651 114.496 169.678 1.00 124.50 ? 315 VAL C CG1   1 
ATOM   9469  C CG2   . VAL C 1 315 ? 141.739 112.164 168.772 1.00 124.50 ? 315 VAL C CG2   1 
ATOM   9470  N N     . VAL C 1 316 ? 144.659 115.476 167.566 1.00 121.68 ? 316 VAL C N     1 
ATOM   9471  C CA    . VAL C 1 316 ? 145.380 116.742 167.495 1.00 121.68 ? 316 VAL C CA    1 
ATOM   9472  C C     . VAL C 1 316 ? 145.153 117.409 166.146 1.00 121.68 ? 316 VAL C C     1 
ATOM   9473  O O     . VAL C 1 316 ? 144.932 118.622 166.064 1.00 121.68 ? 316 VAL C O     1 
ATOM   9474  C CB    . VAL C 1 316 ? 146.878 116.510 167.764 1.00 121.68 ? 316 VAL C CB    1 
ATOM   9475  C CG1   . VAL C 1 316 ? 147.659 117.799 167.583 1.00 121.68 ? 316 VAL C CG1   1 
ATOM   9476  C CG2   . VAL C 1 316 ? 147.082 115.947 169.158 1.00 121.68 ? 316 VAL C CG2   1 
ATOM   9477  N N     . LEU C 1 317 ? 145.203 116.626 165.069 1.00 118.96 ? 317 LEU C N     1 
ATOM   9478  C CA    . LEU C 1 317 ? 144.998 117.172 163.733 1.00 118.96 ? 317 LEU C CA    1 
ATOM   9479  C C     . LEU C 1 317 ? 143.594 117.738 163.583 1.00 118.96 ? 317 LEU C C     1 
ATOM   9480  O O     . LEU C 1 317 ? 143.404 118.805 162.987 1.00 118.96 ? 317 LEU C O     1 
ATOM   9481  C CB    . LEU C 1 317 ? 145.254 116.085 162.692 1.00 118.96 ? 317 LEU C CB    1 
ATOM   9482  C CG    . LEU C 1 317 ? 145.200 116.499 161.226 1.00 118.96 ? 317 LEU C CG    1 
ATOM   9483  C CD1   . LEU C 1 317 ? 146.312 117.483 160.919 1.00 118.96 ? 317 LEU C CD1   1 
ATOM   9484  C CD2   . LEU C 1 317 ? 145.295 115.278 160.333 1.00 118.96 ? 317 LEU C CD2   1 
ATOM   9485  N N     . ASN C 1 318 ? 142.596 117.032 164.116 1.00 117.31 ? 318 ASN C N     1 
ATOM   9486  C CA    . ASN C 1 318 ? 141.226 117.525 164.052 1.00 117.31 ? 318 ASN C CA    1 
ATOM   9487  C C     . ASN C 1 318 ? 141.064 118.800 164.868 1.00 117.31 ? 318 ASN C C     1 
ATOM   9488  O O     . ASN C 1 318 ? 140.395 119.746 164.436 1.00 117.31 ? 318 ASN C O     1 
ATOM   9489  C CB    . ASN C 1 318 ? 140.262 116.446 164.538 1.00 117.31 ? 318 ASN C CB    1 
ATOM   9490  C CG    . ASN C 1 318 ? 140.183 115.272 163.588 1.00 117.31 ? 318 ASN C CG    1 
ATOM   9491  O OD1   . ASN C 1 318 ? 140.142 115.447 162.371 1.00 117.31 ? 318 ASN C OD1   1 
ATOM   9492  N ND2   . ASN C 1 318 ? 140.167 114.065 164.137 1.00 117.31 ? 318 ASN C ND2   1 
ATOM   9493  N N     . ASN C 1 319 ? 141.683 118.849 166.049 1.00 118.87 ? 319 ASN C N     1 
ATOM   9494  C CA    . ASN C 1 319 ? 141.621 120.056 166.862 1.00 118.87 ? 319 ASN C CA    1 
ATOM   9495  C C     . ASN C 1 319 ? 142.270 121.231 166.144 1.00 118.87 ? 319 ASN C C     1 
ATOM   9496  O O     . ASN C 1 319 ? 141.773 122.362 166.208 1.00 118.87 ? 319 ASN C O     1 
ATOM   9497  C CB    . ASN C 1 319 ? 142.293 119.805 168.208 1.00 118.87 ? 319 ASN C CB    1 
ATOM   9498  C CG    . ASN C 1 319 ? 141.530 118.813 169.057 1.00 118.87 ? 319 ASN C CG    1 
ATOM   9499  O OD1   . ASN C 1 319 ? 140.304 118.864 169.137 1.00 118.87 ? 319 ASN C OD1   1 
ATOM   9500  N ND2   . ASN C 1 319 ? 142.251 117.893 169.683 1.00 118.87 ? 319 ASN C ND2   1 
ATOM   9501  N N     . LEU C 1 320 ? 143.378 120.979 165.446 1.00 112.49 ? 320 LEU C N     1 
ATOM   9502  C CA    . LEU C 1 320 ? 144.005 122.027 164.650 1.00 112.49 ? 320 LEU C CA    1 
ATOM   9503  C C     . LEU C 1 320 ? 143.066 122.505 163.552 1.00 112.49 ? 320 LEU C C     1 
ATOM   9504  O O     . LEU C 1 320 ? 142.775 123.701 163.445 1.00 112.49 ? 320 LEU C O     1 
ATOM   9505  C CB    . LEU C 1 320 ? 145.316 121.522 164.054 1.00 112.49 ? 320 LEU C CB    1 
ATOM   9506  C CG    . LEU C 1 320 ? 146.422 121.227 165.064 1.00 112.49 ? 320 LEU C CG    1 
ATOM   9507  C CD1   . LEU C 1 320 ? 147.621 120.612 164.370 1.00 112.49 ? 320 LEU C CD1   1 
ATOM   9508  C CD2   . LEU C 1 320 ? 146.813 122.491 165.804 1.00 112.49 ? 320 LEU C CD2   1 
ATOM   9509  N N     . TYR C 1 321 ? 142.572 121.573 162.731 1.00 107.34 ? 321 TYR C N     1 
ATOM   9510  C CA    . TYR C 1 321 ? 141.602 121.915 161.695 1.00 107.34 ? 321 TYR C CA    1 
ATOM   9511  C C     . TYR C 1 321 ? 140.449 122.738 162.249 1.00 107.34 ? 321 TYR C C     1 
ATOM   9512  O O     . TYR C 1 321 ? 139.901 123.596 161.547 1.00 107.34 ? 321 TYR C O     1 
ATOM   9513  C CB    . TYR C 1 321 ? 141.065 120.642 161.041 1.00 107.34 ? 321 TYR C CB    1 
ATOM   9514  C CG    . TYR C 1 321 ? 142.058 119.934 160.152 1.00 107.34 ? 321 TYR C CG    1 
ATOM   9515  C CD1   . TYR C 1 321 ? 143.191 120.584 159.691 1.00 107.34 ? 321 TYR C CD1   1 
ATOM   9516  C CD2   . TYR C 1 321 ? 141.864 118.613 159.778 1.00 107.34 ? 321 TYR C CD2   1 
ATOM   9517  C CE1   . TYR C 1 321 ? 144.098 119.941 158.878 1.00 107.34 ? 321 TYR C CE1   1 
ATOM   9518  C CE2   . TYR C 1 321 ? 142.765 117.963 158.965 1.00 107.34 ? 321 TYR C CE2   1 
ATOM   9519  C CZ    . TYR C 1 321 ? 143.881 118.630 158.519 1.00 107.34 ? 321 TYR C CZ    1 
ATOM   9520  O OH    . TYR C 1 321 ? 144.784 117.984 157.710 1.00 107.34 ? 321 TYR C OH    1 
ATOM   9521  N N     . SER C 1 322 ? 140.069 122.495 163.503 1.00 108.99 ? 322 SER C N     1 
ATOM   9522  C CA    . SER C 1 322 ? 138.999 123.280 164.107 1.00 108.99 ? 322 SER C CA    1 
ATOM   9523  C C     . SER C 1 322 ? 139.477 124.676 164.488 1.00 108.99 ? 322 SER C C     1 
ATOM   9524  O O     . SER C 1 322 ? 138.751 125.658 164.296 1.00 108.99 ? 322 SER C O     1 
ATOM   9525  C CB    . SER C 1 322 ? 138.445 122.552 165.329 1.00 108.99 ? 322 SER C CB    1 
ATOM   9526  O OG    . SER C 1 322 ? 137.839 121.326 164.959 1.00 108.99 ? 322 SER C OG    1 
ATOM   9527  N N     . GLN C 1 323 ? 140.692 124.790 165.021 1.00 106.31 ? 323 GLN C N     1 
ATOM   9528  C CA    . GLN C 1 323 ? 141.167 126.050 165.579 1.00 106.31 ? 323 GLN C CA    1 
ATOM   9529  C C     . GLN C 1 323 ? 142.202 126.766 164.726 1.00 106.31 ? 323 GLN C C     1 
ATOM   9530  O O     . GLN C 1 323 ? 142.275 127.994 164.774 1.00 106.31 ? 323 GLN C O     1 
ATOM   9531  C CB    . GLN C 1 323 ? 141.761 125.817 166.972 1.00 106.31 ? 323 GLN C CB    1 
ATOM   9532  C CG    . GLN C 1 323 ? 140.751 125.344 167.996 1.00 106.31 ? 323 GLN C CG    1 
ATOM   9533  C CD    . GLN C 1 323 ? 141.378 125.093 169.349 1.00 106.31 ? 323 GLN C CD    1 
ATOM   9534  O OE1   . GLN C 1 323 ? 142.590 125.219 169.516 1.00 106.31 ? 323 GLN C OE1   1 
ATOM   9535  N NE2   . GLN C 1 323 ? 140.554 124.732 170.326 1.00 106.31 ? 323 GLN C NE2   1 
ATOM   9536  N N     . THR C 1 324 ? 143.002 126.039 163.957 1.00 110.29 ? 324 THR C N     1 
ATOM   9537  C CA    . THR C 1 324 ? 144.084 126.646 163.201 1.00 110.29 ? 324 THR C CA    1 
ATOM   9538  C C     . THR C 1 324 ? 143.552 127.267 161.910 1.00 110.29 ? 324 THR C C     1 
ATOM   9539  O O     . THR C 1 324 ? 142.497 126.887 161.394 1.00 110.29 ? 324 THR C O     1 
ATOM   9540  C CB    . THR C 1 324 ? 145.156 125.596 162.892 1.00 110.29 ? 324 THR C CB    1 
ATOM   9541  O OG1   . THR C 1 324 ? 145.571 124.974 164.113 1.00 110.29 ? 324 THR C OG1   1 
ATOM   9542  C CG2   . THR C 1 324 ? 146.374 126.217 162.229 1.00 110.29 ? 324 THR C CG2   1 
ATOM   9543  N N     . GLN C 1 325 ? 144.302 128.242 161.388 1.00 106.62 ? 325 GLN C N     1 
ATOM   9544  C CA    . GLN C 1 325 ? 143.995 128.838 160.094 1.00 106.62 ? 325 GLN C CA    1 
ATOM   9545  C C     . GLN C 1 325 ? 144.007 127.828 158.954 1.00 106.62 ? 325 GLN C C     1 
ATOM   9546  O O     . GLN C 1 325 ? 143.644 128.189 157.830 1.00 106.62 ? 325 GLN C O     1 
ATOM   9547  C CB    . GLN C 1 325 ? 144.988 129.959 159.786 1.00 106.62 ? 325 GLN C CB    1 
ATOM   9548  C CG    . GLN C 1 325 ? 144.893 131.155 160.714 1.00 106.62 ? 325 GLN C CG    1 
ATOM   9549  C CD    . GLN C 1 325 ? 143.605 131.930 160.529 1.00 106.62 ? 325 GLN C CD    1 
ATOM   9550  O OE1   . GLN C 1 325 ? 143.129 132.103 159.408 1.00 106.62 ? 325 GLN C OE1   1 
ATOM   9551  N NE2   . GLN C 1 325 ? 143.035 132.403 161.630 1.00 106.62 ? 325 GLN C NE2   1 
ATOM   9552  N N     . LEU C 1 326 ? 144.416 126.581 159.207 1.00 98.32  ? 326 LEU C N     1 
ATOM   9553  C CA    . LEU C 1 326 ? 144.470 125.576 158.152 1.00 98.32  ? 326 LEU C CA    1 
ATOM   9554  C C     . LEU C 1 326 ? 143.114 125.323 157.509 1.00 98.32  ? 326 LEU C C     1 
ATOM   9555  O O     . LEU C 1 326 ? 143.056 124.763 156.408 1.00 98.32  ? 326 LEU C O     1 
ATOM   9556  C CB    . LEU C 1 326 ? 145.028 124.267 158.707 1.00 98.32  ? 326 LEU C CB    1 
ATOM   9557  C CG    . LEU C 1 326 ? 146.485 124.330 159.156 1.00 98.32  ? 326 LEU C CG    1 
ATOM   9558  C CD1   . LEU C 1 326 ? 146.903 123.028 159.812 1.00 98.32  ? 326 LEU C CD1   1 
ATOM   9559  C CD2   . LEU C 1 326 ? 147.387 124.659 157.983 1.00 98.32  ? 326 LEU C CD2   1 
ATOM   9560  N N     . GLN C 1 327 ? 142.023 125.708 158.166 1.00 95.30  ? 327 GLN C N     1 
ATOM   9561  C CA    . GLN C 1 327 ? 140.686 125.608 157.592 1.00 95.30  ? 327 GLN C CA    1 
ATOM   9562  C C     . GLN C 1 327 ? 140.019 126.970 157.712 1.00 95.30  ? 327 GLN C C     1 
ATOM   9563  O O     . GLN C 1 327 ? 139.725 127.424 158.821 1.00 95.30  ? 327 GLN C O     1 
ATOM   9564  C CB    . GLN C 1 327 ? 139.859 124.530 158.288 1.00 95.30  ? 327 GLN C CB    1 
ATOM   9565  C CG    . GLN C 1 327 ? 138.487 124.329 157.675 1.00 95.30  ? 327 GLN C CG    1 
ATOM   9566  C CD    . GLN C 1 327 ? 137.722 123.196 158.321 1.00 95.30  ? 327 GLN C CD    1 
ATOM   9567  O OE1   . GLN C 1 327 ? 138.204 122.562 159.259 1.00 95.30  ? 327 GLN C OE1   1 
ATOM   9568  N NE2   . GLN C 1 327 ? 136.520 122.933 157.822 1.00 95.30  ? 327 GLN C NE2   1 
ATOM   9569  N N     . VAL C 1 328 ? 139.781 127.617 156.574 1.00 93.78  ? 328 VAL C N     1 
ATOM   9570  C CA    . VAL C 1 328 ? 139.196 128.949 156.538 1.00 93.78  ? 328 VAL C CA    1 
ATOM   9571  C C     . VAL C 1 328 ? 138.066 128.956 155.519 1.00 93.78  ? 328 VAL C C     1 
ATOM   9572  O O     . VAL C 1 328 ? 138.076 128.196 154.546 1.00 93.78  ? 328 VAL C O     1 
ATOM   9573  C CB    . VAL C 1 328 ? 140.255 130.023 156.203 1.00 93.78  ? 328 VAL C CB    1 
ATOM   9574  C CG1   . VAL C 1 328 ? 140.755 129.853 154.782 1.00 93.78  ? 328 VAL C CG1   1 
ATOM   9575  C CG2   . VAL C 1 328 ? 139.705 131.420 156.425 1.00 93.78  ? 328 VAL C CG2   1 
ATOM   9576  N N     . SER C 1 329 ? 137.076 129.812 155.758 1.00 99.56  ? 329 SER C N     1 
ATOM   9577  C CA    . SER C 1 329 ? 135.928 129.930 154.876 1.00 99.56  ? 329 SER C CA    1 
ATOM   9578  C C     . SER C 1 329 ? 136.210 130.948 153.773 1.00 99.56  ? 329 SER C C     1 
ATOM   9579  O O     . SER C 1 329 ? 137.309 131.494 153.659 1.00 99.56  ? 329 SER C O     1 
ATOM   9580  C CB    . SER C 1 329 ? 134.685 130.312 155.675 1.00 99.56  ? 329 SER C CB    1 
ATOM   9581  O OG    . SER C 1 329 ? 134.822 131.605 156.236 1.00 99.56  ? 329 SER C OG    1 
ATOM   9582  N N     . PHE C 1 330 ? 135.197 131.214 152.950 1.00 97.33  ? 330 PHE C N     1 
ATOM   9583  C CA    . PHE C 1 330 ? 135.360 132.119 151.820 1.00 97.33  ? 330 PHE C CA    1 
ATOM   9584  C C     . PHE C 1 330 ? 133.991 132.622 151.389 1.00 97.33  ? 330 PHE C C     1 
ATOM   9585  O O     . PHE C 1 330 ? 133.087 131.822 151.135 1.00 97.33  ? 330 PHE C O     1 
ATOM   9586  C CB    . PHE C 1 330 ? 136.063 131.413 150.660 1.00 97.33  ? 330 PHE C CB    1 
ATOM   9587  C CG    . PHE C 1 330 ? 136.387 132.314 149.513 1.00 97.33  ? 330 PHE C CG    1 
ATOM   9588  C CD1   . PHE C 1 330 ? 137.468 133.173 149.577 1.00 97.33  ? 330 PHE C CD1   1 
ATOM   9589  C CD2   . PHE C 1 330 ? 135.611 132.308 148.371 1.00 97.33  ? 330 PHE C CD2   1 
ATOM   9590  C CE1   . PHE C 1 330 ? 137.771 134.004 148.521 1.00 97.33  ? 330 PHE C CE1   1 
ATOM   9591  C CE2   . PHE C 1 330 ? 135.909 133.138 147.313 1.00 97.33  ? 330 PHE C CE2   1 
ATOM   9592  C CZ    . PHE C 1 330 ? 136.991 133.987 147.387 1.00 97.33  ? 330 PHE C CZ    1 
ATOM   9593  N N     . GLY C 1 331 ? 133.845 133.942 151.312 1.00 99.20  ? 331 GLY C N     1 
ATOM   9594  C CA    . GLY C 1 331 ? 132.575 134.571 151.002 1.00 99.20  ? 331 GLY C CA    1 
ATOM   9595  C C     . GLY C 1 331 ? 132.296 134.827 149.533 1.00 99.20  ? 331 GLY C C     1 
ATOM   9596  O O     . GLY C 1 331 ? 132.410 135.968 149.077 1.00 99.20  ? 331 GLY C O     1 
ATOM   9597  N N     . ILE C 1 332 ? 131.946 133.785 148.777 1.00 96.51  ? 332 ILE C N     1 
ATOM   9598  C CA    . ILE C 1 332 ? 131.601 133.974 147.372 1.00 96.51  ? 332 ILE C CA    1 
ATOM   9599  C C     . ILE C 1 332 ? 130.419 134.923 147.252 1.00 96.51  ? 332 ILE C C     1 
ATOM   9600  O O     . ILE C 1 332 ? 129.384 134.741 147.905 1.00 96.51  ? 332 ILE C O     1 
ATOM   9601  C CB    . ILE C 1 332 ? 131.299 132.626 146.704 1.00 96.51  ? 332 ILE C CB    1 
ATOM   9602  C CG1   . ILE C 1 332 ? 132.553 131.759 146.661 1.00 96.51  ? 332 ILE C CG1   1 
ATOM   9603  C CG2   . ILE C 1 332 ? 130.755 132.835 145.305 1.00 96.51  ? 332 ILE C CG2   1 
ATOM   9604  C CD1   . ILE C 1 332 ? 132.289 130.342 146.220 1.00 96.51  ? 332 ILE C CD1   1 
ATOM   9605  N N     . ASN C 1 333 ? 130.571 135.947 146.413 1.00 100.11 ? 333 ASN C N     1 
ATOM   9606  C CA    . ASN C 1 333 ? 129.500 136.911 146.169 1.00 100.11 ? 333 ASN C CA    1 
ATOM   9607  C C     . ASN C 1 333 ? 129.779 137.581 144.831 1.00 100.11 ? 333 ASN C C     1 
ATOM   9608  O O     . ASN C 1 333 ? 130.738 138.349 144.716 1.00 100.11 ? 333 ASN C O     1 
ATOM   9609  C CB    . ASN C 1 333 ? 129.423 137.935 147.293 1.00 100.11 ? 333 ASN C CB    1 
ATOM   9610  C CG    . ASN C 1 333 ? 128.209 138.831 147.180 1.00 100.11 ? 333 ASN C CG    1 
ATOM   9611  O OD1   . ASN C 1 333 ? 127.415 138.705 146.249 1.00 100.11 ? 333 ASN C OD1   1 
ATOM   9612  N ND2   . ASN C 1 333 ? 128.060 139.746 148.129 1.00 100.11 ? 333 ASN C ND2   1 
ATOM   9613  N N     . MET C 1 334 ? 128.939 137.309 143.837 1.00 103.52 ? 334 MET C N     1 
ATOM   9614  C CA    . MET C 1 334 ? 129.165 137.764 142.469 1.00 103.52 ? 334 MET C CA    1 
ATOM   9615  C C     . MET C 1 334 ? 128.393 139.055 142.229 1.00 103.52 ? 334 MET C C     1 
ATOM   9616  O O     . MET C 1 334 ? 127.160 139.048 142.173 1.00 103.52 ? 334 MET C O     1 
ATOM   9617  C CB    . MET C 1 334 ? 128.749 136.688 141.470 1.00 103.52 ? 334 MET C CB    1 
ATOM   9618  C CG    . MET C 1 334 ? 129.613 135.445 141.512 1.00 103.52 ? 334 MET C CG    1 
ATOM   9619  S SD    . MET C 1 334 ? 129.085 134.204 140.321 1.00 103.52 ? 334 MET C SD    1 
ATOM   9620  C CE    . MET C 1 334 ? 130.226 132.879 140.696 1.00 103.52 ? 334 MET C CE    1 
ATOM   9621  N N     . VAL C 1 335 ? 129.122 140.159 142.081 1.00 99.60  ? 335 VAL C N     1 
ATOM   9622  C CA    . VAL C 1 335 ? 128.543 141.463 141.771 1.00 99.60  ? 335 VAL C CA    1 
ATOM   9623  C C     . VAL C 1 335 ? 129.462 142.168 140.786 1.00 99.60  ? 335 VAL C C     1 
ATOM   9624  O O     . VAL C 1 335 ? 130.673 142.253 141.013 1.00 99.60  ? 335 VAL C O     1 
ATOM   9625  C CB    . VAL C 1 335 ? 128.350 142.329 143.032 1.00 99.60  ? 335 VAL C CB    1 
ATOM   9626  C CG1   . VAL C 1 335 ? 127.902 143.724 142.646 1.00 99.60  ? 335 VAL C CG1   1 
ATOM   9627  C CG2   . VAL C 1 335 ? 127.339 141.697 143.970 1.00 99.60  ? 335 VAL C CG2   1 
ATOM   9628  N N     . ALA C 1 336 ? 128.893 142.676 139.695 1.00 99.84  ? 336 ALA C N     1 
ATOM   9629  C CA    . ALA C 1 336 ? 129.666 143.390 138.691 1.00 99.84  ? 336 ALA C CA    1 
ATOM   9630  C C     . ALA C 1 336 ? 128.745 144.345 137.943 1.00 99.84  ? 336 ALA C C     1 
ATOM   9631  O O     . ALA C 1 336 ? 127.541 144.413 138.204 1.00 99.84  ? 336 ALA C O     1 
ATOM   9632  C CB    . ALA C 1 336 ? 130.359 142.416 137.736 1.00 99.84  ? 336 ALA C CB    1 
ATOM   9633  N N     . LEU C 1 337 ? 129.323 145.087 137.003 1.00 105.31 ? 337 LEU C N     1 
ATOM   9634  C CA    . LEU C 1 337 ? 128.594 146.077 136.224 1.00 105.31 ? 337 LEU C CA    1 
ATOM   9635  C C     . LEU C 1 337 ? 128.152 145.483 134.895 1.00 105.31 ? 337 LEU C C     1 
ATOM   9636  O O     . LEU C 1 337 ? 128.937 144.829 134.203 1.00 105.31 ? 337 LEU C O     1 
ATOM   9637  C CB    . LEU C 1 337 ? 129.453 147.316 135.974 1.00 105.31 ? 337 LEU C CB    1 
ATOM   9638  C CG    . LEU C 1 337 ? 129.790 148.147 137.209 1.00 105.31 ? 337 LEU C CG    1 
ATOM   9639  C CD1   . LEU C 1 337 ? 130.756 149.264 136.856 1.00 105.31 ? 337 LEU C CD1   1 
ATOM   9640  C CD2   . LEU C 1 337 ? 128.521 148.707 137.825 1.00 105.31 ? 337 LEU C CD2   1 
ATOM   9641  N N     . HIS C 1 338 ? 126.893 145.727 134.537 1.00 108.54 ? 338 HIS C N     1 
ATOM   9642  C CA    . HIS C 1 338 ? 126.306 145.190 133.318 1.00 108.54 ? 338 HIS C CA    1 
ATOM   9643  C C     . HIS C 1 338 ? 126.050 146.266 132.274 1.00 108.54 ? 338 HIS C C     1 
ATOM   9644  O O     . HIS C 1 338 ? 126.368 146.074 131.097 1.00 108.54 ? 338 HIS C O     1 
ATOM   9645  C CB    . HIS C 1 338 ? 125.003 144.452 133.655 1.00 108.54 ? 338 HIS C CB    1 
ATOM   9646  C CG    . HIS C 1 338 ? 124.395 143.735 132.492 1.00 108.54 ? 338 HIS C CG    1 
ATOM   9647  N ND1   . HIS C 1 338 ? 124.949 142.596 131.949 1.00 108.54 ? 338 HIS C ND1   1 
ATOM   9648  C CD2   . HIS C 1 338 ? 123.269 143.980 131.783 1.00 108.54 ? 338 HIS C CD2   1 
ATOM   9649  C CE1   . HIS C 1 338 ? 124.198 142.178 130.946 1.00 108.54 ? 338 HIS C CE1   1 
ATOM   9650  N NE2   . HIS C 1 338 ? 123.173 143.002 130.823 1.00 108.54 ? 338 HIS C NE2   1 
ATOM   9651  N N     . HIS C 1 339 ? 125.472 147.395 132.674 1.00 115.13 ? 339 HIS C N     1 
ATOM   9652  C CA    . HIS C 1 339 ? 125.386 148.583 131.829 1.00 115.13 ? 339 HIS C CA    1 
ATOM   9653  C C     . HIS C 1 339 ? 125.684 149.826 132.651 1.00 115.13 ? 339 HIS C C     1 
ATOM   9654  O O     . HIS C 1 339 ? 125.004 150.850 132.534 1.00 115.13 ? 339 HIS C O     1 
ATOM   9655  C CB    . HIS C 1 339 ? 124.021 148.702 131.154 1.00 115.13 ? 339 HIS C CB    1 
ATOM   9656  C CG    . HIS C 1 339 ? 123.750 147.631 130.144 1.00 115.13 ? 339 HIS C CG    1 
ATOM   9657  N ND1   . HIS C 1 339 ? 124.384 147.582 128.921 1.00 115.13 ? 339 HIS C ND1   1 
ATOM   9658  C CD2   . HIS C 1 339 ? 122.892 146.584 130.164 1.00 115.13 ? 339 HIS C CD2   1 
ATOM   9659  C CE1   . HIS C 1 339 ? 123.944 146.539 128.240 1.00 115.13 ? 339 HIS C CE1   1 
ATOM   9660  N NE2   . HIS C 1 339 ? 123.038 145.916 128.973 1.00 115.13 ? 339 HIS C NE2   1 
ATOM   9661  N N     . GLY C 1 340 ? 126.711 149.753 133.492 1.00 115.57 ? 340 GLY C N     1 
ATOM   9662  C CA    . GLY C 1 340 ? 126.997 150.834 134.409 1.00 115.57 ? 340 GLY C CA    1 
ATOM   9663  C C     . GLY C 1 340 ? 126.188 150.799 135.681 1.00 115.57 ? 340 GLY C C     1 
ATOM   9664  O O     . GLY C 1 340 ? 126.043 151.833 136.339 1.00 115.57 ? 340 GLY C O     1 
ATOM   9665  N N     . GLN C 1 341 ? 125.647 149.637 136.047 1.00 115.85 ? 341 GLN C N     1 
ATOM   9666  C CA    . GLN C 1 341 ? 124.826 149.489 137.235 1.00 115.85 ? 341 GLN C CA    1 
ATOM   9667  C C     . GLN C 1 341 ? 125.109 148.132 137.867 1.00 115.85 ? 341 GLN C C     1 
ATOM   9668  O O     . GLN C 1 341 ? 125.209 147.124 137.152 1.00 115.85 ? 341 GLN C O     1 
ATOM   9669  C CB    . GLN C 1 341 ? 123.336 149.608 136.905 1.00 115.85 ? 341 GLN C CB    1 
ATOM   9670  C CG    . GLN C 1 341 ? 122.917 150.984 136.424 1.00 115.85 ? 341 GLN C CG    1 
ATOM   9671  C CD    . GLN C 1 341 ? 121.455 151.049 136.053 1.00 115.85 ? 341 GLN C CD    1 
ATOM   9672  O OE1   . GLN C 1 341 ? 120.748 150.043 136.092 1.00 115.85 ? 341 GLN C OE1   1 
ATOM   9673  N NE2   . GLN C 1 341 ? 120.993 152.236 135.683 1.00 115.85 ? 341 GLN C NE2   1 
ATOM   9674  N N     . PRO C 1 342 ? 125.253 148.077 139.190 1.00 101.32 ? 342 PRO C N     1 
ATOM   9675  C CA    . PRO C 1 342 ? 125.536 146.797 139.850 1.00 101.32 ? 342 PRO C CA    1 
ATOM   9676  C C     . PRO C 1 342 ? 124.333 145.868 139.783 1.00 101.32 ? 342 PRO C C     1 
ATOM   9677  O O     . PRO C 1 342 ? 123.208 146.263 140.093 1.00 101.32 ? 342 PRO C O     1 
ATOM   9678  C CB    . PRO C 1 342 ? 125.847 147.207 141.292 1.00 101.32 ? 342 PRO C CB    1 
ATOM   9679  C CG    . PRO C 1 342 ? 126.223 148.649 141.206 1.00 101.32 ? 342 PRO C CG    1 
ATOM   9680  C CD    . PRO C 1 342 ? 125.372 149.210 140.114 1.00 101.32 ? 342 PRO C CD    1 
ATOM   9681  N N     . LYS C 1 343 ? 124.582 144.622 139.383 1.00 100.36 ? 343 LYS C N     1 
ATOM   9682  C CA    . LYS C 1 343 ? 123.541 143.605 139.317 1.00 100.36 ? 343 LYS C CA    1 
ATOM   9683  C C     . LYS C 1 343 ? 124.136 142.257 139.688 1.00 100.36 ? 343 LYS C C     1 
ATOM   9684  O O     . LYS C 1 343 ? 125.181 141.871 139.158 1.00 100.36 ? 343 LYS C O     1 
ATOM   9685  C CB    . LYS C 1 343 ? 122.917 143.535 137.919 1.00 100.36 ? 343 LYS C CB    1 
ATOM   9686  C CG    . LYS C 1 343 ? 122.022 144.712 137.569 1.00 100.36 ? 343 LYS C CG    1 
ATOM   9687  C CD    . LYS C 1 343 ? 121.535 144.640 136.131 1.00 100.36 ? 343 LYS C CD    1 
ATOM   9688  C CE    . LYS C 1 343 ? 120.204 143.913 136.026 1.00 100.36 ? 343 LYS C CE    1 
ATOM   9689  N NZ    . LYS C 1 343 ? 120.331 142.450 136.271 1.00 100.36 ? 343 LYS C NZ    1 
ATOM   9690  N N     . ILE C 1 344 ? 123.469 141.545 140.594 1.00 98.39  ? 344 ILE C N     1 
ATOM   9691  C CA    . ILE C 1 344 ? 123.896 140.199 140.956 1.00 98.39  ? 344 ILE C CA    1 
ATOM   9692  C C     . ILE C 1 344 ? 123.617 139.270 139.784 1.00 98.39  ? 344 ILE C C     1 
ATOM   9693  O O     . ILE C 1 344 ? 122.463 139.079 139.384 1.00 98.39  ? 344 ILE C O     1 
ATOM   9694  C CB    . ILE C 1 344 ? 123.189 139.714 142.227 1.00 98.39  ? 344 ILE C CB    1 
ATOM   9695  C CG1   . ILE C 1 344 ? 123.612 140.552 143.433 1.00 98.39  ? 344 ILE C CG1   1 
ATOM   9696  C CG2   . ILE C 1 344 ? 123.484 138.248 142.466 1.00 98.39  ? 344 ILE C CG2   1 
ATOM   9697  C CD1   . ILE C 1 344 ? 122.724 141.748 143.694 1.00 98.39  ? 344 ILE C CD1   1 
ATOM   9698  N N     . MET C 1 345 ? 124.674 138.684 139.230 1.00 109.55 ? 345 MET C N     1 
ATOM   9699  C CA    . MET C 1 345 ? 124.586 137.914 138.000 1.00 109.55 ? 345 MET C CA    1 
ATOM   9700  C C     . MET C 1 345 ? 125.159 136.521 138.215 1.00 109.55 ? 345 MET C C     1 
ATOM   9701  O O     . MET C 1 345 ? 126.187 136.357 138.880 1.00 109.55 ? 345 MET C O     1 
ATOM   9702  C CB    . MET C 1 345 ? 125.329 138.628 136.869 1.00 109.55 ? 345 MET C CB    1 
ATOM   9703  C CG    . MET C 1 345 ? 124.738 139.986 136.529 1.00 109.55 ? 345 MET C CG    1 
ATOM   9704  S SD    . MET C 1 345 ? 125.659 140.888 135.272 1.00 109.55 ? 345 MET C SD    1 
ATOM   9705  C CE    . MET C 1 345 ? 125.250 139.938 133.812 1.00 109.55 ? 345 MET C CE    1 
ATOM   9706  N N     . ASN C 1 346 ? 124.488 135.522 137.652 1.00 105.76 ? 346 ASN C N     1 
ATOM   9707  C CA    . ASN C 1 346 ? 124.927 134.139 137.758 1.00 105.76 ? 346 ASN C CA    1 
ATOM   9708  C C     . ASN C 1 346 ? 125.821 133.782 136.569 1.00 105.76 ? 346 ASN C C     1 
ATOM   9709  O O     . ASN C 1 346 ? 126.259 134.646 135.806 1.00 105.76 ? 346 ASN C O     1 
ATOM   9710  C CB    . ASN C 1 346 ? 123.720 133.211 137.878 1.00 105.76 ? 346 ASN C CB    1 
ATOM   9711  C CG    . ASN C 1 346 ? 122.787 133.307 136.689 1.00 105.76 ? 346 ASN C CG    1 
ATOM   9712  O OD1   . ASN C 1 346 ? 123.069 133.996 135.710 1.00 105.76 ? 346 ASN C OD1   1 
ATOM   9713  N ND2   . ASN C 1 346 ? 121.661 132.610 136.771 1.00 105.76 ? 346 ASN C ND2   1 
ATOM   9714  N N     . LEU C 1 347 ? 126.092 132.487 136.401 1.00 105.97 ? 347 LEU C N     1 
ATOM   9715  C CA    . LEU C 1 347 ? 127.056 132.043 135.400 1.00 105.97 ? 347 LEU C CA    1 
ATOM   9716  C C     . LEU C 1 347 ? 126.529 132.246 133.983 1.00 105.97 ? 347 LEU C C     1 
ATOM   9717  O O     . LEU C 1 347 ? 127.233 132.782 133.113 1.00 105.97 ? 347 LEU C O     1 
ATOM   9718  C CB    . LEU C 1 347 ? 127.398 130.574 135.643 1.00 105.97 ? 347 LEU C CB    1 
ATOM   9719  C CG    . LEU C 1 347 ? 128.454 129.949 134.740 1.00 105.97 ? 347 LEU C CG    1 
ATOM   9720  C CD1   . LEU C 1 347 ? 129.789 130.635 134.945 1.00 105.97 ? 347 LEU C CD1   1 
ATOM   9721  C CD2   . LEU C 1 347 ? 128.567 128.463 135.013 1.00 105.97 ? 347 LEU C CD2   1 
ATOM   9722  N N     . LYS C 1 348 ? 125.291 131.812 133.733 1.00 101.66 ? 348 LYS C N     1 
ATOM   9723  C CA    . LYS C 1 348 ? 124.733 131.877 132.387 1.00 101.66 ? 348 LYS C CA    1 
ATOM   9724  C C     . LYS C 1 348 ? 124.745 133.301 131.849 1.00 101.66 ? 348 LYS C C     1 
ATOM   9725  O O     . LYS C 1 348 ? 125.028 133.525 130.665 1.00 101.66 ? 348 LYS C O     1 
ATOM   9726  C CB    . LYS C 1 348 ? 123.313 131.315 132.387 1.00 101.66 ? 348 LYS C CB    1 
ATOM   9727  C CG    . LYS C 1 348 ? 122.677 131.239 131.015 1.00 101.66 ? 348 LYS C CG    1 
ATOM   9728  C CD    . LYS C 1 348 ? 121.304 130.597 131.083 1.00 101.66 ? 348 LYS C CD    1 
ATOM   9729  C CE    . LYS C 1 348 ? 120.662 130.533 129.710 1.00 101.66 ? 348 LYS C CE    1 
ATOM   9730  N NZ    . LYS C 1 348 ? 119.312 129.912 129.758 1.00 101.66 ? 348 LYS C NZ    1 
ATOM   9731  N N     . ASP C 1 349 ? 124.451 134.278 132.707 1.00 103.67 ? 349 ASP C N     1 
ATOM   9732  C CA    . ASP C 1 349 ? 124.455 135.668 132.270 1.00 103.67 ? 349 ASP C CA    1 
ATOM   9733  C C     . ASP C 1 349 ? 125.847 136.102 131.834 1.00 103.67 ? 349 ASP C C     1 
ATOM   9734  O O     . ASP C 1 349 ? 126.006 136.775 130.807 1.00 103.67 ? 349 ASP C O     1 
ATOM   9735  C CB    . ASP C 1 349 ? 123.938 136.563 133.393 1.00 103.67 ? 349 ASP C CB    1 
ATOM   9736  C CG    . ASP C 1 349 ? 122.483 136.303 133.716 1.00 103.67 ? 349 ASP C CG    1 
ATOM   9737  O OD1   . ASP C 1 349 ? 121.742 135.877 132.806 1.00 103.67 ? 349 ASP C OD1   1 
ATOM   9738  O OD2   . ASP C 1 349 ? 122.081 136.522 134.877 1.00 103.67 ? 349 ASP C OD2   1 
ATOM   9739  N N     . ILE C 1 350 ? 126.868 135.721 132.603 1.00 91.68  ? 350 ILE C N     1 
ATOM   9740  C CA    . ILE C 1 350 ? 128.241 136.070 132.250 1.00 91.68  ? 350 ILE C CA    1 
ATOM   9741  C C     . ILE C 1 350 ? 128.605 135.475 130.897 1.00 91.68  ? 350 ILE C C     1 
ATOM   9742  O O     . ILE C 1 350 ? 129.186 136.149 130.034 1.00 91.68  ? 350 ILE C O     1 
ATOM   9743  C CB    . ILE C 1 350 ? 129.209 135.605 133.350 1.00 91.68  ? 350 ILE C CB    1 
ATOM   9744  C CG1   . ILE C 1 350 ? 128.921 136.341 134.657 1.00 91.68  ? 350 ILE C CG1   1 
ATOM   9745  C CG2   . ILE C 1 350 ? 130.648 135.821 132.925 1.00 91.68  ? 350 ILE C CG2   1 
ATOM   9746  C CD1   . ILE C 1 350 ? 129.662 135.779 135.840 1.00 91.68  ? 350 ILE C CD1   1 
ATOM   9747  N N     . ILE C 1 351 ? 128.264 134.202 130.690 1.00 95.16  ? 351 ILE C N     1 
ATOM   9748  C CA    . ILE C 1 351 ? 128.613 133.552 129.430 1.00 95.16  ? 351 ILE C CA    1 
ATOM   9749  C C     . ILE C 1 351 ? 127.904 134.226 128.261 1.00 95.16  ? 351 ILE C C     1 
ATOM   9750  O O     . ILE C 1 351 ? 128.505 134.466 127.202 1.00 95.16  ? 351 ILE C O     1 
ATOM   9751  C CB    . ILE C 1 351 ? 128.300 132.048 129.503 1.00 95.16  ? 351 ILE C CB    1 
ATOM   9752  C CG1   . ILE C 1 351 ? 129.203 131.380 130.537 1.00 95.16  ? 351 ILE C CG1   1 
ATOM   9753  C CG2   . ILE C 1 351 ? 128.478 131.400 128.147 1.00 95.16  ? 351 ILE C CG2   1 
ATOM   9754  C CD1   . ILE C 1 351 ? 128.818 129.960 130.849 1.00 95.16  ? 351 ILE C CD1   1 
ATOM   9755  N N     . ALA C 1 352 ? 126.620 134.549 128.432 1.00 99.96  ? 352 ALA C N     1 
ATOM   9756  C CA    . ALA C 1 352 ? 125.885 135.215 127.363 1.00 99.96  ? 352 ALA C CA    1 
ATOM   9757  C C     . ALA C 1 352 ? 126.501 136.567 127.030 1.00 99.96  ? 352 ALA C C     1 
ATOM   9758  O O     . ALA C 1 352 ? 126.647 136.920 125.851 1.00 99.96  ? 352 ALA C O     1 
ATOM   9759  C CB    . ALA C 1 352 ? 124.417 135.375 127.755 1.00 99.96  ? 352 ALA C CB    1 
ATOM   9760  N N     . ALA C 1 353 ? 126.868 137.339 128.056 1.00 93.52  ? 353 ALA C N     1 
ATOM   9761  C CA    . ALA C 1 353 ? 127.485 138.638 127.814 1.00 93.52  ? 353 ALA C CA    1 
ATOM   9762  C C     . ALA C 1 353 ? 128.797 138.489 127.058 1.00 93.52  ? 353 ALA C C     1 
ATOM   9763  O O     . ALA C 1 353 ? 129.079 139.255 126.125 1.00 93.52  ? 353 ALA C O     1 
ATOM   9764  C CB    . ALA C 1 353 ? 127.709 139.366 129.138 1.00 93.52  ? 353 ALA C CB    1 
ATOM   9765  N N     . PHE C 1 354 ? 129.613 137.509 127.449 1.00 84.43  ? 354 PHE C N     1 
ATOM   9766  C CA    . PHE C 1 354 ? 130.871 137.266 126.751 1.00 84.43  ? 354 PHE C CA    1 
ATOM   9767  C C     . PHE C 1 354 ? 130.629 136.964 125.278 1.00 84.43  ? 354 PHE C C     1 
ATOM   9768  O O     . PHE C 1 354 ? 131.295 137.523 124.395 1.00 84.43  ? 354 PHE C O     1 
ATOM   9769  C CB    . PHE C 1 354 ? 131.617 136.117 127.423 1.00 84.43  ? 354 PHE C CB    1 
ATOM   9770  C CG    . PHE C 1 354 ? 132.934 135.795 126.788 1.00 84.43  ? 354 PHE C CG    1 
ATOM   9771  C CD1   . PHE C 1 354 ? 134.035 136.600 127.005 1.00 84.43  ? 354 PHE C CD1   1 
ATOM   9772  C CD2   . PHE C 1 354 ? 133.071 134.684 125.979 1.00 84.43  ? 354 PHE C CD2   1 
ATOM   9773  C CE1   . PHE C 1 354 ? 135.249 136.303 126.423 1.00 84.43  ? 354 PHE C CE1   1 
ATOM   9774  C CE2   . PHE C 1 354 ? 134.282 134.382 125.395 1.00 84.43  ? 354 PHE C CE2   1 
ATOM   9775  C CZ    . PHE C 1 354 ? 135.373 135.193 125.617 1.00 84.43  ? 354 PHE C CZ    1 
ATOM   9776  N N     . VAL C 1 355 ? 129.668 136.083 124.996 1.00 90.35  ? 355 VAL C N     1 
ATOM   9777  C CA    . VAL C 1 355 ? 129.397 135.705 123.612 1.00 90.35  ? 355 VAL C CA    1 
ATOM   9778  C C     . VAL C 1 355 ? 128.933 136.910 122.803 1.00 90.35  ? 355 VAL C C     1 
ATOM   9779  O O     . VAL C 1 355 ? 129.361 137.112 121.657 1.00 90.35  ? 355 VAL C O     1 
ATOM   9780  C CB    . VAL C 1 355 ? 128.373 134.560 123.565 1.00 90.35  ? 355 VAL C CB    1 
ATOM   9781  C CG1   . VAL C 1 355 ? 127.963 134.279 122.135 1.00 90.35  ? 355 VAL C CG1   1 
ATOM   9782  C CG2   . VAL C 1 355 ? 128.961 133.316 124.197 1.00 90.35  ? 355 VAL C CG2   1 
ATOM   9783  N N     . ARG C 1 356 ? 128.050 137.729 123.379 1.00 98.52  ? 356 ARG C N     1 
ATOM   9784  C CA    . ARG C 1 356 ? 127.563 138.902 122.657 1.00 98.52  ? 356 ARG C CA    1 
ATOM   9785  C C     . ARG C 1 356 ? 128.697 139.873 122.352 1.00 98.52  ? 356 ARG C C     1 
ATOM   9786  O O     . ARG C 1 356 ? 128.802 140.394 121.229 1.00 98.52  ? 356 ARG C O     1 
ATOM   9787  C CB    . ARG C 1 356 ? 126.469 139.595 123.465 1.00 98.52  ? 356 ARG C CB    1 
ATOM   9788  C CG    . ARG C 1 356 ? 125.233 138.746 123.675 1.00 98.52  ? 356 ARG C CG    1 
ATOM   9789  C CD    . ARG C 1 356 ? 124.492 138.531 122.372 1.00 98.52  ? 356 ARG C CD    1 
ATOM   9790  N NE    . ARG C 1 356 ? 124.038 139.793 121.800 1.00 98.52  ? 356 ARG C NE    1 
ATOM   9791  C CZ    . ARG C 1 356 ? 122.899 140.393 122.131 1.00 98.52  ? 356 ARG C CZ    1 
ATOM   9792  N NH1   . ARG C 1 356 ? 122.561 141.541 121.560 1.00 98.52  ? 356 ARG C NH1   1 
ATOM   9793  N NH2   . ARG C 1 356 ? 122.099 139.846 123.035 1.00 98.52  ? 356 ARG C NH2   1 
ATOM   9794  N N     . HIS C 1 357 ? 129.547 140.138 123.347 1.00 89.78  ? 357 HIS C N     1 
ATOM   9795  C CA    . HIS C 1 357 ? 130.694 141.011 123.130 1.00 89.78  ? 357 HIS C CA    1 
ATOM   9796  C C     . HIS C 1 357 ? 131.568 140.494 121.997 1.00 89.78  ? 357 HIS C C     1 
ATOM   9797  O O     . HIS C 1 357 ? 131.996 141.265 121.124 1.00 89.78  ? 357 HIS C O     1 
ATOM   9798  C CB    . HIS C 1 357 ? 131.500 141.127 124.422 1.00 89.78  ? 357 HIS C CB    1 
ATOM   9799  C CG    . HIS C 1 357 ? 132.627 142.106 124.347 1.00 89.78  ? 357 HIS C CG    1 
ATOM   9800  N ND1   . HIS C 1 357 ? 133.876 141.768 123.878 1.00 89.78  ? 357 HIS C ND1   1 
ATOM   9801  C CD2   . HIS C 1 357 ? 132.695 143.413 124.692 1.00 89.78  ? 357 HIS C CD2   1 
ATOM   9802  C CE1   . HIS C 1 357 ? 134.666 142.825 123.931 1.00 89.78  ? 357 HIS C CE1   1 
ATOM   9803  N NE2   . HIS C 1 357 ? 133.973 143.837 124.421 1.00 89.78  ? 357 HIS C NE2   1 
ATOM   9804  N N     . ARG C 1 358 ? 131.833 139.186 121.989 1.00 89.67  ? 358 ARG C N     1 
ATOM   9805  C CA    . ARG C 1 358 ? 132.691 138.623 120.953 1.00 89.67  ? 358 ARG C CA    1 
ATOM   9806  C C     . ARG C 1 358 ? 132.061 138.776 119.573 1.00 89.67  ? 358 ARG C C     1 
ATOM   9807  O O     . ARG C 1 358 ? 132.746 139.138 118.605 1.00 89.67  ? 358 ARG C O     1 
ATOM   9808  C CB    . ARG C 1 358 ? 132.980 137.157 121.261 1.00 89.67  ? 358 ARG C CB    1 
ATOM   9809  C CG    . ARG C 1 358 ? 133.974 136.533 120.318 1.00 89.67  ? 358 ARG C CG    1 
ATOM   9810  C CD    . ARG C 1 358 ? 135.321 137.208 120.472 1.00 89.67  ? 358 ARG C CD    1 
ATOM   9811  N NE    . ARG C 1 358 ? 136.327 136.629 119.591 1.00 89.67  ? 358 ARG C NE    1 
ATOM   9812  C CZ    . ARG C 1 358 ? 137.524 137.163 119.380 1.00 89.67  ? 358 ARG C CZ    1 
ATOM   9813  N NH1   . ARG C 1 358 ? 137.861 138.293 119.985 1.00 89.67  ? 358 ARG C NH1   1 
ATOM   9814  N NH2   . ARG C 1 358 ? 138.381 136.570 118.560 1.00 89.67  ? 358 ARG C NH2   1 
ATOM   9815  N N     . ARG C 1 359 ? 130.757 138.503 119.464 1.00 93.08  ? 359 ARG C N     1 
ATOM   9816  C CA    . ARG C 1 359 ? 130.065 138.690 118.191 1.00 93.08  ? 359 ARG C CA    1 
ATOM   9817  C C     . ARG C 1 359 ? 130.229 140.115 117.682 1.00 93.08  ? 359 ARG C C     1 
ATOM   9818  O O     . ARG C 1 359 ? 130.571 140.339 116.511 1.00 93.08  ? 359 ARG C O     1 
ATOM   9819  C CB    . ARG C 1 359 ? 128.580 138.361 118.339 1.00 93.08  ? 359 ARG C CB    1 
ATOM   9820  C CG    . ARG C 1 359 ? 128.260 136.899 118.534 1.00 93.08  ? 359 ARG C CG    1 
ATOM   9821  C CD    . ARG C 1 359 ? 126.759 136.703 118.634 1.00 93.08  ? 359 ARG C CD    1 
ATOM   9822  N NE    . ARG C 1 359 ? 126.399 135.304 118.821 1.00 93.08  ? 359 ARG C NE    1 
ATOM   9823  C CZ    . ARG C 1 359 ? 125.156 134.874 118.998 1.00 93.08  ? 359 ARG C CZ    1 
ATOM   9824  N NH1   . ARG C 1 359 ? 124.152 135.739 119.014 1.00 93.08  ? 359 ARG C NH1   1 
ATOM   9825  N NH2   . ARG C 1 359 ? 124.916 133.581 119.161 1.00 93.08  ? 359 ARG C NH2   1 
ATOM   9826  N N     . GLU C 1 360 ? 129.969 141.093 118.551 1.00 101.03 ? 360 GLU C N     1 
ATOM   9827  C CA    . GLU C 1 360 ? 130.041 142.487 118.125 1.00 101.03 ? 360 GLU C CA    1 
ATOM   9828  C C     . GLU C 1 360 ? 131.444 142.850 117.654 1.00 101.03 ? 360 GLU C C     1 
ATOM   9829  O O     . GLU C 1 360 ? 131.614 143.512 116.617 1.00 101.03 ? 360 GLU C O     1 
ATOM   9830  C CB    . GLU C 1 360 ? 129.603 143.401 119.266 1.00 101.03 ? 360 GLU C CB    1 
ATOM   9831  C CG    . GLU C 1 360 ? 129.565 144.867 118.903 1.00 101.03 ? 360 GLU C CG    1 
ATOM   9832  C CD    . GLU C 1 360 ? 129.077 145.729 120.047 1.00 101.03 ? 360 GLU C CD    1 
ATOM   9833  O OE1   . GLU C 1 360 ? 128.775 145.172 121.123 1.00 101.03 ? 360 GLU C OE1   1 
ATOM   9834  O OE2   . GLU C 1 360 ? 129.001 146.962 119.875 1.00 101.03 ? 360 GLU C OE2   1 
ATOM   9835  N N     . VAL C 1 361 ? 132.463 142.420 118.402 1.00 91.88  ? 361 VAL C N     1 
ATOM   9836  C CA    . VAL C 1 361 ? 133.838 142.736 118.023 1.00 91.88  ? 361 VAL C CA    1 
ATOM   9837  C C     . VAL C 1 361 ? 134.160 142.153 116.654 1.00 91.88  ? 361 VAL C C     1 
ATOM   9838  O O     . VAL C 1 361 ? 134.747 142.825 115.794 1.00 91.88  ? 361 VAL C O     1 
ATOM   9839  C CB    . VAL C 1 361 ? 134.820 142.232 119.094 1.00 91.88  ? 361 VAL C CB    1 
ATOM   9840  C CG1   . VAL C 1 361 ? 136.247 142.394 118.613 1.00 91.88  ? 361 VAL C CG1   1 
ATOM   9841  C CG2   . VAL C 1 361 ? 134.615 142.994 120.386 1.00 91.88  ? 361 VAL C CG2   1 
ATOM   9842  N N     . VAL C 1 362 ? 133.783 140.891 116.433 1.00 91.25  ? 362 VAL C N     1 
ATOM   9843  C CA    . VAL C 1 362 ? 134.079 140.254 115.152 1.00 91.25  ? 362 VAL C CA    1 
ATOM   9844  C C     . VAL C 1 362 ? 133.408 141.006 114.012 1.00 91.25  ? 362 VAL C C     1 
ATOM   9845  O O     . VAL C 1 362 ? 134.027 141.265 112.968 1.00 91.25  ? 362 VAL C O     1 
ATOM   9846  C CB    . VAL C 1 362 ? 133.660 138.775 115.178 1.00 91.25  ? 362 VAL C CB    1 
ATOM   9847  C CG1   . VAL C 1 362 ? 133.777 138.175 113.795 1.00 91.25  ? 362 VAL C CG1   1 
ATOM   9848  C CG2   . VAL C 1 362 ? 134.531 138.008 116.147 1.00 91.25  ? 362 VAL C CG2   1 
ATOM   9849  N N     . THR C 1 363 ? 132.138 141.372 114.190 1.00 90.33  ? 363 THR C N     1 
ATOM   9850  C CA    . THR C 1 363 ? 131.422 142.063 113.122 1.00 90.33  ? 363 THR C CA    1 
ATOM   9851  C C     . THR C 1 363 ? 132.090 143.390 112.779 1.00 90.33  ? 363 THR C C     1 
ATOM   9852  O O     . THR C 1 363 ? 132.293 143.715 111.598 1.00 90.33  ? 363 THR C O     1 
ATOM   9853  C CB    . THR C 1 363 ? 129.967 142.282 113.527 1.00 90.33  ? 363 THR C CB    1 
ATOM   9854  O OG1   . THR C 1 363 ? 129.346 141.015 113.772 1.00 90.33  ? 363 THR C OG1   1 
ATOM   9855  C CG2   . THR C 1 363 ? 129.215 142.997 112.423 1.00 90.33  ? 363 THR C CG2   1 
ATOM   9856  N N     . ARG C 1 364 ? 132.447 144.171 113.802 1.00 94.56  ? 364 ARG C N     1 
ATOM   9857  C CA    . ARG C 1 364 ? 133.054 145.472 113.534 1.00 94.56  ? 364 ARG C CA    1 
ATOM   9858  C C     . ARG C 1 364 ? 134.406 145.323 112.845 1.00 94.56  ? 364 ARG C C     1 
ATOM   9859  O O     . ARG C 1 364 ? 134.715 146.065 111.899 1.00 94.56  ? 364 ARG C O     1 
ATOM   9860  C CB    . ARG C 1 364 ? 133.182 146.266 114.831 1.00 94.56  ? 364 ARG C CB    1 
ATOM   9861  C CG    . ARG C 1 364 ? 131.839 146.649 115.425 1.00 94.56  ? 364 ARG C CG    1 
ATOM   9862  C CD    . ARG C 1 364 ? 131.990 147.409 116.728 1.00 94.56  ? 364 ARG C CD    1 
ATOM   9863  N NE    . ARG C 1 364 ? 132.585 148.725 116.528 1.00 94.56  ? 364 ARG C NE    1 
ATOM   9864  C CZ    . ARG C 1 364 ? 132.955 149.533 117.516 1.00 94.56  ? 364 ARG C CZ    1 
ATOM   9865  N NH1   . ARG C 1 364 ? 132.790 149.158 118.777 1.00 94.56  ? 364 ARG C NH1   1 
ATOM   9866  N NH2   . ARG C 1 364 ? 133.490 150.715 117.244 1.00 94.56  ? 364 ARG C NH2   1 
ATOM   9867  N N     . ARG C 1 365 ? 135.226 144.370 113.300 1.00 97.75  ? 365 ARG C N     1 
ATOM   9868  C CA    . ARG C 1 365 ? 136.511 144.143 112.648 1.00 97.75  ? 365 ARG C CA    1 
ATOM   9869  C C     . ARG C 1 365 ? 136.327 143.775 111.183 1.00 97.75  ? 365 ARG C C     1 
ATOM   9870  O O     . ARG C 1 365 ? 137.069 144.253 110.311 1.00 97.75  ? 365 ARG C O     1 
ATOM   9871  C CB    . ARG C 1 365 ? 137.286 143.046 113.371 1.00 97.75  ? 365 ARG C CB    1 
ATOM   9872  C CG    . ARG C 1 365 ? 138.667 142.809 112.800 1.00 97.75  ? 365 ARG C CG    1 
ATOM   9873  C CD    . ARG C 1 365 ? 139.371 141.680 113.518 1.00 97.75  ? 365 ARG C CD    1 
ATOM   9874  N NE    . ARG C 1 365 ? 138.733 140.395 113.254 1.00 97.75  ? 365 ARG C NE    1 
ATOM   9875  C CZ    . ARG C 1 365 ? 139.044 139.266 113.880 1.00 97.75  ? 365 ARG C CZ    1 
ATOM   9876  N NH1   . ARG C 1 365 ? 139.989 139.260 114.809 1.00 97.75  ? 365 ARG C NH1   1 
ATOM   9877  N NH2   . ARG C 1 365 ? 138.411 138.143 113.576 1.00 97.75  ? 365 ARG C NH2   1 
ATOM   9878  N N     . THR C 1 366 ? 135.348 142.914 110.895 1.00 102.19 ? 366 THR C N     1 
ATOM   9879  C CA    . THR C 1 366 ? 135.107 142.515 109.515 1.00 102.19 ? 366 THR C CA    1 
ATOM   9880  C C     . THR C 1 366 ? 134.728 143.713 108.656 1.00 102.19 ? 366 THR C C     1 
ATOM   9881  O O     . THR C 1 366 ? 135.239 143.876 107.540 1.00 102.19 ? 366 THR C O     1 
ATOM   9882  C CB    . THR C 1 366 ? 134.018 141.449 109.459 1.00 102.19 ? 366 THR C CB    1 
ATOM   9883  O OG1   . THR C 1 366 ? 134.438 140.302 110.206 1.00 102.19 ? 366 THR C OG1   1 
ATOM   9884  C CG2   . THR C 1 366 ? 133.759 141.041 108.025 1.00 102.19 ? 366 THR C CG2   1 
ATOM   9885  N N     . ILE C 1 367 ? 133.832 144.564 109.160 1.00 93.54  ? 367 ILE C N     1 
ATOM   9886  C CA    . ILE C 1 367 ? 133.441 145.749 108.398 1.00 93.54  ? 367 ILE C CA    1 
ATOM   9887  C C     . ILE C 1 367 ? 134.654 146.623 108.104 1.00 93.54  ? 367 ILE C C     1 
ATOM   9888  O O     . ILE C 1 367 ? 134.835 147.112 106.976 1.00 93.54  ? 367 ILE C O     1 
ATOM   9889  C CB    . ILE C 1 367 ? 132.352 146.536 109.147 1.00 93.54  ? 367 ILE C CB    1 
ATOM   9890  C CG1   . ILE C 1 367 ? 131.065 145.720 109.224 1.00 93.54  ? 367 ILE C CG1   1 
ATOM   9891  C CG2   . ILE C 1 367 ? 132.103 147.871 108.473 1.00 93.54  ? 367 ILE C CG2   1 
ATOM   9892  C CD1   . ILE C 1 367 ? 130.025 146.323 110.136 1.00 93.54  ? 367 ILE C CD1   1 
ATOM   9893  N N     . PHE C 1 368 ? 135.501 146.837 109.113 1.00 102.81 ? 368 PHE C N     1 
ATOM   9894  C CA    . PHE C 1 368 ? 136.669 147.691 108.921 1.00 102.81 ? 368 PHE C CA    1 
ATOM   9895  C C     . PHE C 1 368 ? 137.590 147.138 107.840 1.00 102.81 ? 368 PHE C C     1 
ATOM   9896  O O     . PHE C 1 368 ? 138.019 147.871 106.935 1.00 102.81 ? 368 PHE C O     1 
ATOM   9897  C CB    . PHE C 1 368 ? 137.426 147.845 110.237 1.00 102.81 ? 368 PHE C CB    1 
ATOM   9898  C CG    . PHE C 1 368 ? 138.645 148.709 110.134 1.00 102.81 ? 368 PHE C CG    1 
ATOM   9899  C CD1   . PHE C 1 368 ? 138.530 150.085 110.067 1.00 102.81 ? 368 PHE C CD1   1 
ATOM   9900  C CD2   . PHE C 1 368 ? 139.907 148.144 110.103 1.00 102.81 ? 368 PHE C CD2   1 
ATOM   9901  C CE1   . PHE C 1 368 ? 139.650 150.881 109.972 1.00 102.81 ? 368 PHE C CE1   1 
ATOM   9902  C CE2   . PHE C 1 368 ? 141.030 148.935 110.008 1.00 102.81 ? 368 PHE C CE2   1 
ATOM   9903  C CZ    . PHE C 1 368 ? 140.902 150.305 109.942 1.00 102.81 ? 368 PHE C CZ    1 
ATOM   9904  N N     . GLU C 1 369 ? 137.915 145.845 107.924 1.00 109.08 ? 369 GLU C N     1 
ATOM   9905  C CA    . GLU C 1 369 ? 138.815 145.260 106.935 1.00 109.08 ? 369 GLU C CA    1 
ATOM   9906  C C     . GLU C 1 369 ? 138.208 145.305 105.539 1.00 109.08 ? 369 GLU C C     1 
ATOM   9907  O O     . GLU C 1 369 ? 138.920 145.530 104.549 1.00 109.08 ? 369 GLU C O     1 
ATOM   9908  C CB    . GLU C 1 369 ? 139.170 143.827 107.323 1.00 109.08 ? 369 GLU C CB    1 
ATOM   9909  C CG    . GLU C 1 369 ? 140.047 143.732 108.555 1.00 109.08 ? 369 GLU C CG    1 
ATOM   9910  C CD    . GLU C 1 369 ? 140.409 142.305 108.902 1.00 109.08 ? 369 GLU C CD    1 
ATOM   9911  O OE1   . GLU C 1 369 ? 139.881 141.382 108.247 1.00 109.08 ? 369 GLU C OE1   1 
ATOM   9912  O OE2   . GLU C 1 369 ? 141.222 142.104 109.829 1.00 109.08 ? 369 GLU C OE2   1 
ATOM   9913  N N     . LEU C 1 370 ? 136.893 145.099 105.439 1.00 104.22 ? 370 LEU C N     1 
ATOM   9914  C CA    . LEU C 1 370 ? 136.230 145.197 104.144 1.00 104.22 ? 370 LEU C CA    1 
ATOM   9915  C C     . LEU C 1 370 ? 136.417 146.578 103.537 1.00 104.22 ? 370 LEU C C     1 
ATOM   9916  O O     . LEU C 1 370 ? 136.789 146.708 102.364 1.00 104.22 ? 370 LEU C O     1 
ATOM   9917  C CB    . LEU C 1 370 ? 134.745 144.879 104.284 1.00 104.22 ? 370 LEU C CB    1 
ATOM   9918  C CG    . LEU C 1 370 ? 133.977 144.981 102.968 1.00 104.22 ? 370 LEU C CG    1 
ATOM   9919  C CD1   . LEU C 1 370 ? 134.504 143.966 101.971 1.00 104.22 ? 370 LEU C CD1   1 
ATOM   9920  C CD2   . LEU C 1 370 ? 132.489 144.796 103.195 1.00 104.22 ? 370 LEU C CD2   1 
ATOM   9921  N N     . ARG C 1 371 ? 136.155 147.626 104.322 1.00 109.87 ? 371 ARG C N     1 
ATOM   9922  C CA    . ARG C 1 371 ? 136.286 148.980 103.788 1.00 109.87 ? 371 ARG C CA    1 
ATOM   9923  C C     . ARG C 1 371 ? 137.724 149.272 103.370 1.00 109.87 ? 371 ARG C C     1 
ATOM   9924  O O     . ARG C 1 371 ? 137.967 149.896 102.323 1.00 109.87 ? 371 ARG C O     1 
ATOM   9925  C CB    . ARG C 1 371 ? 135.806 149.999 104.818 1.00 109.87 ? 371 ARG C CB    1 
ATOM   9926  C CG    . ARG C 1 371 ? 135.823 151.428 104.314 1.00 109.87 ? 371 ARG C CG    1 
ATOM   9927  C CD    . ARG C 1 371 ? 135.275 152.388 105.353 1.00 109.87 ? 371 ARG C CD    1 
ATOM   9928  N NE    . ARG C 1 371 ? 136.093 152.416 106.559 1.00 109.87 ? 371 ARG C NE    1 
ATOM   9929  C CZ    . ARG C 1 371 ? 137.196 153.144 106.694 1.00 109.87 ? 371 ARG C CZ    1 
ATOM   9930  N NH1   . ARG C 1 371 ? 137.617 153.906 105.695 1.00 109.87 ? 371 ARG C NH1   1 
ATOM   9931  N NH2   . ARG C 1 371 ? 137.880 153.110 107.829 1.00 109.87 ? 371 ARG C NH2   1 
ATOM   9932  N N     . LYS C 1 372 ? 138.691 148.819 104.172 1.00 112.72 ? 372 LYS C N     1 
ATOM   9933  C CA    . LYS C 1 372 ? 140.090 149.059 103.832 1.00 112.72 ? 372 LYS C CA    1 
ATOM   9934  C C     . LYS C 1 372 ? 140.462 148.398 102.510 1.00 112.72 ? 372 LYS C C     1 
ATOM   9935  O O     . LYS C 1 372 ? 141.058 149.039 101.630 1.00 112.72 ? 372 LYS C O     1 
ATOM   9936  C CB    . LYS C 1 372 ? 140.995 148.554 104.951 1.00 112.72 ? 372 LYS C CB    1 
ATOM   9937  C CG    . LYS C 1 372 ? 142.464 148.824 104.710 1.00 112.72 ? 372 LYS C CG    1 
ATOM   9938  C CD    . LYS C 1 372 ? 142.723 150.317 104.653 1.00 112.72 ? 372 LYS C CD    1 
ATOM   9939  C CE    . LYS C 1 372 ? 142.510 150.956 106.015 1.00 112.72 ? 372 LYS C CE    1 
ATOM   9940  N NZ    . LYS C 1 372 ? 142.813 152.412 106.000 1.00 112.72 ? 372 LYS C NZ    1 
ATOM   9941  N N     . ALA C 1 373 ? 140.124 147.115 102.355 1.00 112.13 ? 373 ALA C N     1 
ATOM   9942  C CA    . ALA C 1 373 ? 140.430 146.430 101.105 1.00 112.13 ? 373 ALA C CA    1 
ATOM   9943  C C     . ALA C 1 373 ? 139.708 147.070 99.928  1.00 112.13 ? 373 ALA C C     1 
ATOM   9944  O O     . ALA C 1 373 ? 140.260 147.132 98.822  1.00 112.13 ? 373 ALA C O     1 
ATOM   9945  C CB    . ALA C 1 373 ? 140.066 144.951 101.212 1.00 112.13 ? 373 ALA C CB    1 
ATOM   9946  N N     . ARG C 1 374 ? 138.482 147.550 100.148 1.00 117.77 ? 374 ARG C N     1 
ATOM   9947  C CA    . ARG C 1 374 ? 137.755 148.244 99.093  1.00 117.77 ? 374 ARG C CA    1 
ATOM   9948  C C     . ARG C 1 374 ? 138.536 149.448 98.590  1.00 117.77 ? 374 ARG C C     1 
ATOM   9949  O O     . ARG C 1 374 ? 138.743 149.604 97.379  1.00 117.77 ? 374 ARG C O     1 
ATOM   9950  C CB    . ARG C 1 374 ? 136.388 148.683 99.609  1.00 117.77 ? 374 ARG C CB    1 
ATOM   9951  C CG    . ARG C 1 374 ? 135.518 149.345 98.562  1.00 117.77 ? 374 ARG C CG    1 
ATOM   9952  C CD    . ARG C 1 374 ? 135.030 148.336 97.544  1.00 117.77 ? 374 ARG C CD    1 
ATOM   9953  N NE    . ARG C 1 374 ? 134.232 147.292 98.179  1.00 117.77 ? 374 ARG C NE    1 
ATOM   9954  C CZ    . ARG C 1 374 ? 132.943 147.415 98.476  1.00 117.77 ? 374 ARG C CZ    1 
ATOM   9955  N NH1   . ARG C 1 374 ? 132.299 148.538 98.194  1.00 117.77 ? 374 ARG C NH1   1 
ATOM   9956  N NH2   . ARG C 1 374 ? 132.297 146.411 99.052  1.00 117.77 ? 374 ARG C NH2   1 
ATOM   9957  N N     . ASP C 1 375 ? 138.974 150.314 99.506  1.00 118.06 ? 375 ASP C N     1 
ATOM   9958  C CA    . ASP C 1 375 ? 139.711 151.503 99.085  1.00 118.06 ? 375 ASP C CA    1 
ATOM   9959  C C     . ASP C 1 375 ? 141.018 151.131 98.393  1.00 118.06 ? 375 ASP C C     1 
ATOM   9960  O O     . ASP C 1 375 ? 141.403 151.756 97.391  1.00 118.06 ? 375 ASP C O     1 
ATOM   9961  C CB    . ASP C 1 375 ? 139.978 152.410 100.283 1.00 118.06 ? 375 ASP C CB    1 
ATOM   9962  C CG    . ASP C 1 375 ? 138.720 153.069 100.803 1.00 118.06 ? 375 ASP C CG    1 
ATOM   9963  O OD1   . ASP C 1 375 ? 137.789 153.288 100.000 1.00 118.06 ? 375 ASP C OD1   1 
ATOM   9964  O OD2   . ASP C 1 375 ? 138.661 153.372 102.012 1.00 118.06 ? 375 ASP C OD2   1 
ATOM   9965  N N     . ARG C 1 376 ? 141.712 150.115 98.911  1.00 116.34 ? 376 ARG C N     1 
ATOM   9966  C CA    . ARG C 1 376 ? 142.964 149.698 98.289  1.00 116.34 ? 376 ARG C CA    1 
ATOM   9967  C C     . ARG C 1 376 ? 142.739 149.252 96.850  1.00 116.34 ? 376 ARG C C     1 
ATOM   9968  O O     . ARG C 1 376 ? 143.474 149.653 95.936  1.00 116.34 ? 376 ARG C O     1 
ATOM   9969  C CB    . ARG C 1 376 ? 143.610 148.580 99.103  1.00 116.34 ? 376 ARG C CB    1 
ATOM   9970  C CG    . ARG C 1 376 ? 144.916 148.087 98.515  1.00 116.34 ? 376 ARG C CG    1 
ATOM   9971  C CD    . ARG C 1 376 ? 145.970 149.176 98.544  1.00 116.34 ? 376 ARG C CD    1 
ATOM   9972  N NE    . ARG C 1 376 ? 147.242 148.717 97.999  1.00 116.34 ? 376 ARG C NE    1 
ATOM   9973  C CZ    . ARG C 1 376 ? 148.274 149.515 97.748  1.00 116.34 ? 376 ARG C CZ    1 
ATOM   9974  N NH1   . ARG C 1 376 ? 148.184 150.814 97.994  1.00 116.34 ? 376 ARG C NH1   1 
ATOM   9975  N NH2   . ARG C 1 376 ? 149.395 149.014 97.250  1.00 116.34 ? 376 ARG C NH2   1 
ATOM   9976  N N     . ALA C 1 377 ? 141.722 148.417 96.629  1.00 118.23 ? 377 ALA C N     1 
ATOM   9977  C CA    . ALA C 1 377 ? 141.431 147.958 95.276  1.00 118.23 ? 377 ALA C CA    1 
ATOM   9978  C C     . ALA C 1 377 ? 141.031 149.119 94.377  1.00 118.23 ? 377 ALA C C     1 
ATOM   9979  O O     . ALA C 1 377 ? 141.391 149.152 93.193  1.00 118.23 ? 377 ALA C O     1 
ATOM   9980  C CB    . ALA C 1 377 ? 140.333 146.897 95.305  1.00 118.23 ? 377 ALA C CB    1 
ATOM   9981  N N     . HIS C 1 378 ? 140.282 150.081 94.920  1.00 116.60 ? 378 HIS C N     1 
ATOM   9982  C CA    . HIS C 1 378 ? 139.878 151.231 94.119  1.00 116.60 ? 378 HIS C CA    1 
ATOM   9983  C C     . HIS C 1 378 ? 141.085 152.020 93.634  1.00 116.60 ? 378 HIS C C     1 
ATOM   9984  O O     . HIS C 1 378 ? 141.111 152.485 92.489  1.00 116.60 ? 378 HIS C O     1 
ATOM   9985  C CB    . HIS C 1 378 ? 138.939 152.130 94.919  1.00 116.60 ? 378 HIS C CB    1 
ATOM   9986  C CG    . HIS C 1 378 ? 138.428 153.301 94.143  1.00 116.60 ? 378 HIS C CG    1 
ATOM   9987  N ND1   . HIS C 1 378 ? 139.087 154.510 94.105  1.00 116.60 ? 378 HIS C ND1   1 
ATOM   9988  C CD2   . HIS C 1 378 ? 137.331 153.445 93.364  1.00 116.60 ? 378 HIS C CD2   1 
ATOM   9989  C CE1   . HIS C 1 378 ? 138.410 155.353 93.346  1.00 116.60 ? 378 HIS C CE1   1 
ATOM   9990  N NE2   . HIS C 1 378 ? 137.342 154.731 92.882  1.00 116.60 ? 378 HIS C NE2   1 
ATOM   9991  N N     . ILE C 1 379 ? 142.092 152.190 94.490  1.00 109.86 ? 379 ILE C N     1 
ATOM   9992  C CA    . ILE C 1 379 ? 143.296 152.892 94.046  1.00 109.86 ? 379 ILE C CA    1 
ATOM   9993  C C     . ILE C 1 379 ? 144.061 152.056 93.025  1.00 109.86 ? 379 ILE C C     1 
ATOM   9994  O O     . ILE C 1 379 ? 144.553 152.575 92.009  1.00 109.86 ? 379 ILE C O     1 
ATOM   9995  C CB    . ILE C 1 379 ? 144.182 153.260 95.248  1.00 109.86 ? 379 ILE C CB    1 
ATOM   9996  C CG1   . ILE C 1 379 ? 143.433 154.203 96.187  1.00 109.86 ? 379 ILE C CG1   1 
ATOM   9997  C CG2   . ILE C 1 379 ? 145.477 153.896 94.775  1.00 109.86 ? 379 ILE C CG2   1 
ATOM   9998  C CD1   . ILE C 1 379 ? 143.044 155.511 95.542  1.00 109.86 ? 379 ILE C CD1   1 
ATOM   9999  N N     . LEU C 1 380 ? 144.172 150.751 93.276  1.00 118.26 ? 380 LEU C N     1 
ATOM   10000 C CA    . LEU C 1 380 ? 144.983 149.904 92.409  1.00 118.26 ? 380 LEU C CA    1 
ATOM   10001 C C     . LEU C 1 380 ? 144.392 149.816 91.007  1.00 118.26 ? 380 LEU C C     1 
ATOM   10002 O O     . LEU C 1 380 ? 145.132 149.701 90.022  1.00 118.26 ? 380 LEU C O     1 
ATOM   10003 C CB    . LEU C 1 380 ? 145.130 148.517 93.033  1.00 118.26 ? 380 LEU C CB    1 
ATOM   10004 C CG    . LEU C 1 380 ? 146.121 147.549 92.389  1.00 118.26 ? 380 LEU C CG    1 
ATOM   10005 C CD1   . LEU C 1 380 ? 146.736 146.671 93.455  1.00 118.26 ? 380 LEU C CD1   1 
ATOM   10006 C CD2   . LEU C 1 380 ? 145.438 146.684 91.344  1.00 118.26 ? 380 LEU C CD2   1 
ATOM   10007 N N     . GLU C 1 381 ? 143.063 149.862 90.894  1.00 126.96 ? 381 GLU C N     1 
ATOM   10008 C CA    . GLU C 1 381 ? 142.439 149.838 89.573  1.00 126.96 ? 381 GLU C CA    1 
ATOM   10009 C C     . GLU C 1 381 ? 142.913 151.009 88.722  1.00 126.96 ? 381 GLU C C     1 
ATOM   10010 O O     . GLU C 1 381 ? 143.349 150.830 87.577  1.00 126.96 ? 381 GLU C O     1 
ATOM   10011 C CB    . GLU C 1 381 ? 140.916 149.862 89.706  1.00 126.96 ? 381 GLU C CB    1 
ATOM   10012 C CG    . GLU C 1 381 ? 140.308 148.594 90.271  1.00 126.96 ? 381 GLU C CG    1 
ATOM   10013 C CD    . GLU C 1 381 ? 138.797 148.673 90.382  1.00 126.96 ? 381 GLU C CD    1 
ATOM   10014 O OE1   . GLU C 1 381 ? 138.238 149.763 90.138  1.00 126.96 ? 381 GLU C OE1   1 
ATOM   10015 O OE2   . GLU C 1 381 ? 138.169 147.644 90.709  1.00 126.96 ? 381 GLU C OE2   1 
ATOM   10016 N N     . ALA C 1 382 ? 142.824 152.222 89.269  1.00 121.49 ? 382 ALA C N     1 
ATOM   10017 C CA    . ALA C 1 382 ? 143.257 153.399 88.528  1.00 121.49 ? 382 ALA C CA    1 
ATOM   10018 C C     . ALA C 1 382 ? 144.748 153.343 88.238  1.00 121.49 ? 382 ALA C C     1 
ATOM   10019 O O     . ALA C 1 382 ? 145.197 153.775 87.169  1.00 121.49 ? 382 ALA C O     1 
ATOM   10020 C CB    . ALA C 1 382 ? 142.908 154.667 89.304  1.00 121.49 ? 382 ALA C CB    1 
ATOM   10021 N N     . LEU C 1 383 ? 145.535 152.809 89.174  1.00 116.45 ? 383 LEU C N     1 
ATOM   10022 C CA    . LEU C 1 383 ? 146.967 152.703 88.922  1.00 116.45 ? 383 LEU C CA    1 
ATOM   10023 C C     . LEU C 1 383 ? 147.243 151.784 87.736  1.00 116.45 ? 383 LEU C C     1 
ATOM   10024 O O     . LEU C 1 383 ? 148.085 152.091 86.883  1.00 116.45 ? 383 LEU C O     1 
ATOM   10025 C CB    . LEU C 1 383 ? 147.686 152.214 90.179  1.00 116.45 ? 383 LEU C CB    1 
ATOM   10026 C CG    . LEU C 1 383 ? 149.207 152.379 90.222  1.00 116.45 ? 383 LEU C CG    1 
ATOM   10027 C CD1   . LEU C 1 383 ? 149.660 152.562 91.660  1.00 116.45 ? 383 LEU C CD1   1 
ATOM   10028 C CD2   . LEU C 1 383 ? 149.930 151.205 89.585  1.00 116.45 ? 383 LEU C CD2   1 
ATOM   10029 N N     . ALA C 1 384 ? 146.528 150.661 87.654  1.00 118.09 ? 384 ALA C N     1 
ATOM   10030 C CA    . ALA C 1 384 ? 146.702 149.757 86.521  1.00 118.09 ? 384 ALA C CA    1 
ATOM   10031 C C     . ALA C 1 384 ? 146.264 150.411 85.218  1.00 118.09 ? 384 ALA C C     1 
ATOM   10032 O O     . ALA C 1 384 ? 146.944 150.282 84.191  1.00 118.09 ? 384 ALA C O     1 
ATOM   10033 C CB    . ALA C 1 384 ? 145.924 148.463 86.754  1.00 118.09 ? 384 ALA C CB    1 
ATOM   10034 N N     . VAL C 1 385 ? 145.129 151.112 85.238  1.00 118.15 ? 385 VAL C N     1 
ATOM   10035 C CA    . VAL C 1 385 ? 144.658 151.782 84.028  1.00 118.15 ? 385 VAL C CA    1 
ATOM   10036 C C     . VAL C 1 385 ? 145.681 152.803 83.553  1.00 118.15 ? 385 VAL C C     1 
ATOM   10037 O O     . VAL C 1 385 ? 145.924 152.949 82.349  1.00 118.15 ? 385 VAL C O     1 
ATOM   10038 C CB    . VAL C 1 385 ? 143.282 152.428 84.270  1.00 118.15 ? 385 VAL C CB    1 
ATOM   10039 C CG1   . VAL C 1 385 ? 142.871 153.251 83.067  1.00 118.15 ? 385 VAL C CG1   1 
ATOM   10040 C CG2   . VAL C 1 385 ? 142.245 151.360 84.548  1.00 118.15 ? 385 VAL C CG2   1 
ATOM   10041 N N     . ALA C 1 386 ? 146.307 153.517 84.491  1.00 127.32 ? 386 ALA C N     1 
ATOM   10042 C CA    . ALA C 1 386 ? 147.354 154.462 84.119  1.00 127.32 ? 386 ALA C CA    1 
ATOM   10043 C C     . ALA C 1 386 ? 148.568 153.742 83.549  1.00 127.32 ? 386 ALA C C     1 
ATOM   10044 O O     . ALA C 1 386 ? 149.195 154.222 82.599  1.00 127.32 ? 386 ALA C O     1 
ATOM   10045 C CB    . ALA C 1 386 ? 147.755 155.307 85.325  1.00 127.32 ? 386 ALA C CB    1 
ATOM   10046 N N     . LEU C 1 387 ? 148.923 152.592 84.126  1.00 120.08 ? 387 LEU C N     1 
ATOM   10047 C CA    . LEU C 1 387 ? 150.046 151.827 83.596  1.00 120.08 ? 387 LEU C CA    1 
ATOM   10048 C C     . LEU C 1 387 ? 149.760 151.347 82.180  1.00 120.08 ? 387 LEU C C     1 
ATOM   10049 O O     . LEU C 1 387 ? 150.686 151.152 81.383  1.00 120.08 ? 387 LEU C O     1 
ATOM   10050 C CB    . LEU C 1 387 ? 150.358 150.648 84.519  1.00 120.08 ? 387 LEU C CB    1 
ATOM   10051 C CG    . LEU C 1 387 ? 151.634 149.840 84.268  1.00 120.08 ? 387 LEU C CG    1 
ATOM   10052 C CD1   . LEU C 1 387 ? 152.168 149.302 85.580  1.00 120.08 ? 387 LEU C CD1   1 
ATOM   10053 C CD2   . LEU C 1 387 ? 151.390 148.689 83.307  1.00 120.08 ? 387 LEU C CD2   1 
ATOM   10054 N N     . ALA C 1 388 ? 148.482 151.147 81.849  1.00 125.17 ? 388 ALA C N     1 
ATOM   10055 C CA    . ALA C 1 388 ? 148.134 150.689 80.507  1.00 125.17 ? 388 ALA C CA    1 
ATOM   10056 C C     . ALA C 1 388 ? 148.577 151.688 79.445  1.00 125.17 ? 388 ALA C C     1 
ATOM   10057 O O     . ALA C 1 388 ? 149.375 151.355 78.562  1.00 125.17 ? 388 ALA C O     1 
ATOM   10058 C CB    . ALA C 1 388 ? 146.630 150.440 80.407  1.00 125.17 ? 388 ALA C CB    1 
ATOM   10059 N N     . ASN C 1 389 ? 148.081 152.914 79.515  1.00 123.69 ? 389 ASN C N     1 
ATOM   10060 C CA    . ASN C 1 389 ? 148.439 153.961 78.565  1.00 123.69 ? 389 ASN C CA    1 
ATOM   10061 C C     . ASN C 1 389 ? 149.509 154.826 79.222  1.00 123.69 ? 389 ASN C C     1 
ATOM   10062 O O     . ASN C 1 389 ? 149.225 155.575 80.160  1.00 123.69 ? 389 ASN C O     1 
ATOM   10063 C CB    . ASN C 1 389 ? 147.213 154.774 78.165  1.00 123.69 ? 389 ASN C CB    1 
ATOM   10064 C CG    . ASN C 1 389 ? 146.169 153.937 77.445  1.00 123.69 ? 389 ASN C CG    1 
ATOM   10065 O OD1   . ASN C 1 389 ? 145.044 153.777 77.919  1.00 123.69 ? 389 ASN C OD1   1 
ATOM   10066 N ND2   . ASN C 1 389 ? 146.544 153.389 76.296  1.00 123.69 ? 389 ASN C ND2   1 
ATOM   10067 N N     . ILE C 1 390 ? 150.742 154.719 78.734  1.00 125.21 ? 390 ILE C N     1 
ATOM   10068 C CA    . ILE C 1 390 ? 151.874 155.428 79.323  1.00 125.21 ? 390 ILE C CA    1 
ATOM   10069 C C     . ILE C 1 390 ? 152.330 156.603 78.460  1.00 125.21 ? 390 ILE C C     1 
ATOM   10070 O O     . ILE C 1 390 ? 152.568 157.696 78.977  1.00 125.21 ? 390 ILE C O     1 
ATOM   10071 C CB    . ILE C 1 390 ? 153.040 154.451 79.610  1.00 125.21 ? 390 ILE C CB    1 
ATOM   10072 C CG1   . ILE C 1 390 ? 154.186 155.177 80.320  1.00 125.21 ? 390 ILE C CG1   1 
ATOM   10073 C CG2   . ILE C 1 390 ? 153.503 153.732 78.352  1.00 125.21 ? 390 ILE C CG2   1 
ATOM   10074 C CD1   . ILE C 1 390 ? 155.250 154.262 80.878  1.00 125.21 ? 390 ILE C CD1   1 
ATOM   10075 N N     . ASP C 1 391 ? 152.419 156.412 77.139  1.00 138.29 ? 391 ASP C N     1 
ATOM   10076 C CA    . ASP C 1 391 ? 153.049 157.426 76.291  1.00 138.29 ? 391 ASP C CA    1 
ATOM   10077 C C     . ASP C 1 391 ? 152.223 158.706 76.180  1.00 138.29 ? 391 ASP C C     1 
ATOM   10078 O O     . ASP C 1 391 ? 152.806 159.803 76.292  1.00 138.29 ? 391 ASP C O     1 
ATOM   10079 C CB    . ASP C 1 391 ? 153.359 156.810 74.921  1.00 138.29 ? 391 ASP C CB    1 
ATOM   10080 C CG    . ASP C 1 391 ? 154.240 157.679 74.062  1.00 138.29 ? 391 ASP C CG    1 
ATOM   10081 O OD1   . ASP C 1 391 ? 154.580 158.793 74.494  1.00 138.29 ? 391 ASP C OD1   1 
ATOM   10082 O OD2   . ASP C 1 391 ? 154.590 157.238 72.948  1.00 138.29 ? 391 ASP C OD2   1 
ATOM   10083 N N     . PRO C 1 392 ? 150.903 158.662 75.951  1.00 130.49 ? 392 PRO C N     1 
ATOM   10084 C CA    . PRO C 1 392 ? 150.139 159.919 75.958  1.00 130.49 ? 392 PRO C CA    1 
ATOM   10085 C C     . PRO C 1 392 ? 150.211 160.652 77.284  1.00 130.49 ? 392 PRO C C     1 
ATOM   10086 O O     . PRO C 1 392 ? 150.233 161.888 77.300  1.00 130.49 ? 392 PRO C O     1 
ATOM   10087 C CB    . PRO C 1 392 ? 148.714 159.461 75.627  1.00 130.49 ? 392 PRO C CB    1 
ATOM   10088 C CG    . PRO C 1 392 ? 148.902 158.198 74.873  1.00 130.49 ? 392 PRO C CG    1 
ATOM   10089 C CD    . PRO C 1 392 ? 150.069 157.528 75.522  1.00 130.49 ? 392 PRO C CD    1 
ATOM   10090 N N     . ILE C 1 393 ? 150.253 159.930 78.404  1.00 133.65 ? 393 ILE C N     1 
ATOM   10091 C CA    . ILE C 1 393 ? 150.404 160.597 79.691  1.00 133.65 ? 393 ILE C CA    1 
ATOM   10092 C C     . ILE C 1 393 ? 151.781 161.235 79.795  1.00 133.65 ? 393 ILE C C     1 
ATOM   10093 O O     . ILE C 1 393 ? 151.931 162.333 80.343  1.00 133.65 ? 393 ILE C O     1 
ATOM   10094 C CB    . ILE C 1 393 ? 150.132 159.611 80.841  1.00 133.65 ? 393 ILE C CB    1 
ATOM   10095 C CG1   . ILE C 1 393 ? 148.658 159.197 80.846  1.00 133.65 ? 393 ILE C CG1   1 
ATOM   10096 C CG2   . ILE C 1 393 ? 150.518 160.212 82.177  1.00 133.65 ? 393 ILE C CG2   1 
ATOM   10097 C CD1   . ILE C 1 393 ? 148.336 158.095 81.845  1.00 133.65 ? 393 ILE C CD1   1 
ATOM   10098 N N     . ILE C 1 394 ? 152.802 160.580 79.239  1.00 132.91 ? 394 ILE C N     1 
ATOM   10099 C CA    . ILE C 1 394 ? 154.132 161.180 79.216  1.00 132.91 ? 394 ILE C CA    1 
ATOM   10100 C C     . ILE C 1 394 ? 154.101 162.508 78.477  1.00 132.91 ? 394 ILE C C     1 
ATOM   10101 O O     . ILE C 1 394 ? 154.591 163.527 78.977  1.00 132.91 ? 394 ILE C O     1 
ATOM   10102 C CB    . ILE C 1 394 ? 155.154 160.214 78.594  1.00 132.91 ? 394 ILE C CB    1 
ATOM   10103 C CG1   . ILE C 1 394 ? 155.402 159.037 79.535  1.00 132.91 ? 394 ILE C CG1   1 
ATOM   10104 C CG2   . ILE C 1 394 ? 156.444 160.943 78.292  1.00 132.91 ? 394 ILE C CG2   1 
ATOM   10105 C CD1   . ILE C 1 394 ? 156.157 157.886 78.909  1.00 132.91 ? 394 ILE C CD1   1 
ATOM   10106 N N     . GLU C 1 395 ? 153.525 162.521 77.274  1.00 140.42 ? 395 GLU C N     1 
ATOM   10107 C CA    . GLU C 1 395 ? 153.477 163.780 76.531  1.00 140.42 ? 395 GLU C CA    1 
ATOM   10108 C C     . GLU C 1 395 ? 152.616 164.824 77.233  1.00 140.42 ? 395 GLU C C     1 
ATOM   10109 O O     . GLU C 1 395 ? 152.944 166.018 77.218  1.00 140.42 ? 395 GLU C O     1 
ATOM   10110 C CB    . GLU C 1 395 ? 152.986 163.577 75.095  1.00 140.42 ? 395 GLU C CB    1 
ATOM   10111 C CG    . GLU C 1 395 ? 154.061 163.092 74.113  1.00 140.42 ? 395 GLU C CG    1 
ATOM   10112 C CD    . GLU C 1 395 ? 153.990 161.626 73.743  1.00 140.42 ? 395 GLU C CD    1 
ATOM   10113 O OE1   . GLU C 1 395 ? 152.964 160.988 74.054  1.00 140.42 ? 395 GLU C OE1   1 
ATOM   10114 O OE2   . GLU C 1 395 ? 154.963 161.126 73.143  1.00 140.42 ? 395 GLU C OE2   1 
ATOM   10115 N N     . LEU C 1 396 ? 151.509 164.403 77.841  1.00 134.15 ? 396 LEU C N     1 
ATOM   10116 C CA    . LEU C 1 396 ? 150.630 165.362 78.497  1.00 134.15 ? 396 LEU C CA    1 
ATOM   10117 C C     . LEU C 1 396 ? 151.316 165.999 79.697  1.00 134.15 ? 396 LEU C C     1 
ATOM   10118 O O     . LEU C 1 396 ? 151.114 167.185 79.974  1.00 134.15 ? 396 LEU C O     1 
ATOM   10119 C CB    . LEU C 1 396 ? 149.326 164.684 78.909  1.00 134.15 ? 396 LEU C CB    1 
ATOM   10120 C CG    . LEU C 1 396 ? 148.199 165.591 79.409  1.00 134.15 ? 396 LEU C CG    1 
ATOM   10121 C CD1   . LEU C 1 396 ? 146.848 164.996 79.062  1.00 134.15 ? 396 LEU C CD1   1 
ATOM   10122 C CD2   . LEU C 1 396 ? 148.292 165.820 80.910  1.00 134.15 ? 396 LEU C CD2   1 
ATOM   10123 N N     . ILE C 1 397 ? 152.143 165.237 80.412  1.00 132.31 ? 397 ILE C N     1 
ATOM   10124 C CA    . ILE C 1 397 ? 152.907 165.827 81.506  1.00 132.31 ? 397 ILE C CA    1 
ATOM   10125 C C     . ILE C 1 397 ? 154.010 166.731 80.968  1.00 132.31 ? 397 ILE C C     1 
ATOM   10126 O O     . ILE C 1 397 ? 154.258 167.817 81.506  1.00 132.31 ? 397 ILE C O     1 
ATOM   10127 C CB    . ILE C 1 397 ? 153.473 164.725 82.418  1.00 132.31 ? 397 ILE C CB    1 
ATOM   10128 C CG1   . ILE C 1 397 ? 152.336 163.947 83.073  1.00 132.31 ? 397 ILE C CG1   1 
ATOM   10129 C CG2   . ILE C 1 397 ? 154.385 165.319 83.467  1.00 132.31 ? 397 ILE C CG2   1 
ATOM   10130 C CD1   . ILE C 1 397 ? 152.801 162.727 83.816  1.00 132.31 ? 397 ILE C CD1   1 
ATOM   10131 N N     . ARG C 1 398 ? 154.690 166.305 79.899  1.00 136.63 ? 398 ARG C N     1 
ATOM   10132 C CA    . ARG C 1 398 ? 155.787 167.107 79.366  1.00 136.63 ? 398 ARG C CA    1 
ATOM   10133 C C     . ARG C 1 398 ? 155.304 168.445 78.827  1.00 136.63 ? 398 ARG C C     1 
ATOM   10134 O O     . ARG C 1 398 ? 156.025 169.444 78.918  1.00 136.63 ? 398 ARG C O     1 
ATOM   10135 C CB    . ARG C 1 398 ? 156.529 166.332 78.278  1.00 136.63 ? 398 ARG C CB    1 
ATOM   10136 C CG    . ARG C 1 398 ? 157.314 165.152 78.815  1.00 136.63 ? 398 ARG C CG    1 
ATOM   10137 C CD    . ARG C 1 398 ? 158.035 164.398 77.713  1.00 136.63 ? 398 ARG C CD    1 
ATOM   10138 N NE    . ARG C 1 398 ? 159.100 165.193 77.111  1.00 136.63 ? 398 ARG C NE    1 
ATOM   10139 C CZ    . ARG C 1 398 ? 159.784 164.830 76.031  1.00 136.63 ? 398 ARG C CZ    1 
ATOM   10140 N NH1   . ARG C 1 398 ? 159.517 163.679 75.429  1.00 136.63 ? 398 ARG C NH1   1 
ATOM   10141 N NH2   . ARG C 1 398 ? 160.736 165.618 75.552  1.00 136.63 ? 398 ARG C NH2   1 
ATOM   10142 N N     . HIS C 1 399 ? 154.094 168.492 78.267  1.00 142.82 ? 399 HIS C N     1 
ATOM   10143 C CA    . HIS C 1 399 ? 153.572 169.764 77.779  1.00 142.82 ? 399 HIS C CA    1 
ATOM   10144 C C     . HIS C 1 399 ? 152.987 170.621 78.896  1.00 142.82 ? 399 HIS C C     1 
ATOM   10145 O O     . HIS C 1 399 ? 153.076 171.851 78.832  1.00 142.82 ? 399 HIS C O     1 
ATOM   10146 C CB    . HIS C 1 399 ? 152.523 169.529 76.691  1.00 142.82 ? 399 HIS C CB    1 
ATOM   10147 C CG    . HIS C 1 399 ? 153.089 168.981 75.419  1.00 142.82 ? 399 HIS C CG    1 
ATOM   10148 N ND1   . HIS C 1 399 ? 153.868 169.737 74.570  1.00 142.82 ? 399 HIS C ND1   1 
ATOM   10149 C CD2   . HIS C 1 399 ? 152.981 167.761 74.843  1.00 142.82 ? 399 HIS C CD2   1 
ATOM   10150 C CE1   . HIS C 1 399 ? 154.226 169.002 73.532  1.00 142.82 ? 399 HIS C CE1   1 
ATOM   10151 N NE2   . HIS C 1 399 ? 153.700 167.799 73.673  1.00 142.82 ? 399 HIS C NE2   1 
ATOM   10152 N N     . ALA C 1 400 ? 152.406 170.007 79.918  1.00 144.05 ? 400 ALA C N     1 
ATOM   10153 C CA    . ALA C 1 400 ? 151.733 170.767 80.967  1.00 144.05 ? 400 ALA C CA    1 
ATOM   10154 C C     . ALA C 1 400 ? 152.737 171.561 81.792  1.00 144.05 ? 400 ALA C C     1 
ATOM   10155 O O     . ALA C 1 400 ? 153.673 170.971 82.345  1.00 144.05 ? 400 ALA C O     1 
ATOM   10156 C CB    . ALA C 1 400 ? 150.933 169.834 81.866  1.00 144.05 ? 400 ALA C CB    1 
ATOM   10157 N N     . PRO C 1 401 ? 152.594 172.885 81.894  1.00 144.48 ? 401 PRO C N     1 
ATOM   10158 C CA    . PRO C 1 401 ? 153.530 173.648 82.737  1.00 144.48 ? 401 PRO C CA    1 
ATOM   10159 C C     . PRO C 1 401 ? 153.303 173.438 84.222  1.00 144.48 ? 401 PRO C C     1 
ATOM   10160 O O     . PRO C 1 401 ? 154.271 173.318 84.984  1.00 144.48 ? 401 PRO C O     1 
ATOM   10161 C CB    . PRO C 1 401 ? 153.256 175.101 82.328  1.00 144.48 ? 401 PRO C CB    1 
ATOM   10162 C CG    . PRO C 1 401 ? 152.580 175.008 80.997  1.00 144.48 ? 401 PRO C CG    1 
ATOM   10163 C CD    . PRO C 1 401 ? 151.761 173.764 81.061  1.00 144.48 ? 401 PRO C CD    1 
ATOM   10164 N N     . THR C 1 402 ? 152.051 173.400 84.658  1.00 143.68 ? 402 THR C N     1 
ATOM   10165 C CA    . THR C 1 402 ? 151.687 173.337 86.061  1.00 143.68 ? 402 THR C CA    1 
ATOM   10166 C C     . THR C 1 402 ? 151.232 171.934 86.440  1.00 143.68 ? 402 THR C C     1 
ATOM   10167 O O     . THR C 1 402 ? 150.439 171.326 85.714  1.00 143.68 ? 402 THR C O     1 
ATOM   10168 C CB    . THR C 1 402 ? 150.563 174.334 86.367  1.00 143.68 ? 402 THR C CB    1 
ATOM   10169 O OG1   . THR C 1 402 ? 151.002 175.660 86.055  1.00 143.68 ? 402 THR C OG1   1 
ATOM   10170 C CG2   . THR C 1 402 ? 150.157 174.273 87.831  1.00 143.68 ? 402 THR C CG2   1 
ATOM   10171 N N     . PRO C 1 403 ? 151.713 171.394 87.564  1.00 137.87 ? 403 PRO C N     1 
ATOM   10172 C CA    . PRO C 1 403 ? 151.233 170.069 87.990  1.00 137.87 ? 403 PRO C CA    1 
ATOM   10173 C C     . PRO C 1 403 ? 149.737 170.029 88.256  1.00 137.87 ? 403 PRO C C     1 
ATOM   10174 O O     . PRO C 1 403 ? 149.079 169.037 87.916  1.00 137.87 ? 403 PRO C O     1 
ATOM   10175 C CB    . PRO C 1 403 ? 152.054 169.794 89.258  1.00 137.87 ? 403 PRO C CB    1 
ATOM   10176 C CG    . PRO C 1 403 ? 152.474 171.139 89.745  1.00 137.87 ? 403 PRO C CG    1 
ATOM   10177 C CD    . PRO C 1 403 ? 152.686 171.964 88.512  1.00 137.87 ? 403 PRO C CD    1 
ATOM   10178 N N     . ALA C 1 404 ? 149.176 171.085 88.849  1.00 144.92 ? 404 ALA C N     1 
ATOM   10179 C CA    . ALA C 1 404 ? 147.732 171.125 89.054  1.00 144.92 ? 404 ALA C CA    1 
ATOM   10180 C C     . ALA C 1 404 ? 146.991 171.128 87.724  1.00 144.92 ? 404 ALA C C     1 
ATOM   10181 O O     . ALA C 1 404 ? 145.966 170.451 87.570  1.00 144.92 ? 404 ALA C O     1 
ATOM   10182 C CB    . ALA C 1 404 ? 147.351 172.347 89.888  1.00 144.92 ? 404 ALA C CB    1 
ATOM   10183 N N     . GLU C 1 405 ? 147.496 171.884 86.747  1.00 152.00 ? 405 GLU C N     1 
ATOM   10184 C CA    . GLU C 1 405 ? 146.884 171.880 85.424  1.00 152.00 ? 405 GLU C CA    1 
ATOM   10185 C C     . GLU C 1 405 ? 146.985 170.506 84.778  1.00 152.00 ? 405 GLU C C     1 
ATOM   10186 O O     . GLU C 1 405 ? 146.063 170.072 84.079  1.00 152.00 ? 405 GLU C O     1 
ATOM   10187 C CB    . GLU C 1 405 ? 147.536 172.942 84.540  1.00 152.00 ? 405 GLU C CB    1 
ATOM   10188 C CG    . GLU C 1 405 ? 147.261 174.365 84.988  1.00 152.00 ? 405 GLU C CG    1 
ATOM   10189 C CD    . GLU C 1 405 ? 145.803 174.747 84.846  1.00 152.00 ? 405 GLU C CD    1 
ATOM   10190 O OE1   . GLU C 1 405 ? 145.141 174.241 83.916  1.00 152.00 ? 405 GLU C OE1   1 
ATOM   10191 O OE2   . GLU C 1 405 ? 145.317 175.552 85.668  1.00 152.00 ? 405 GLU C OE2   1 
ATOM   10192 N N     . ALA C 1 406 ? 148.100 169.807 84.998  1.00 141.32 ? 406 ALA C N     1 
ATOM   10193 C CA    . ALA C 1 406 ? 148.232 168.451 84.477  1.00 141.32 ? 406 ALA C CA    1 
ATOM   10194 C C     . ALA C 1 406 ? 147.205 167.521 85.107  1.00 141.32 ? 406 ALA C C     1 
ATOM   10195 O O     . ALA C 1 406 ? 146.594 166.698 84.416  1.00 141.32 ? 406 ALA C O     1 
ATOM   10196 C CB    . ALA C 1 406 ? 149.647 167.931 84.717  1.00 141.32 ? 406 ALA C CB    1 
ATOM   10197 N N     . LYS C 1 407 ? 147.009 167.634 86.421  1.00 135.46 ? 407 LYS C N     1 
ATOM   10198 C CA    . LYS C 1 407 ? 145.974 166.849 87.083  1.00 135.46 ? 407 LYS C CA    1 
ATOM   10199 C C     . LYS C 1 407 ? 144.601 167.142 86.492  1.00 135.46 ? 407 LYS C C     1 
ATOM   10200 O O     . LYS C 1 407 ? 143.823 166.221 86.211  1.00 135.46 ? 407 LYS C O     1 
ATOM   10201 C CB    . LYS C 1 407 ? 145.983 167.139 88.583  1.00 135.46 ? 407 LYS C CB    1 
ATOM   10202 C CG    . LYS C 1 407 ? 144.998 166.311 89.382  1.00 135.46 ? 407 LYS C CG    1 
ATOM   10203 C CD    . LYS C 1 407 ? 144.990 166.724 90.844  1.00 135.46 ? 407 LYS C CD    1 
ATOM   10204 C CE    . LYS C 1 407 ? 146.238 166.244 91.561  1.00 135.46 ? 407 LYS C CE    1 
ATOM   10205 N NZ    . LYS C 1 407 ? 146.179 166.527 93.020  1.00 135.46 ? 407 LYS C NZ    1 
ATOM   10206 N N     . THR C 1 408 ? 144.292 168.424 86.290  1.00 141.73 ? 408 THR C N     1 
ATOM   10207 C CA    . THR C 1 408 ? 142.993 168.793 85.737  1.00 141.73 ? 408 THR C CA    1 
ATOM   10208 C C     . THR C 1 408 ? 142.817 168.240 84.327  1.00 141.73 ? 408 THR C C     1 
ATOM   10209 O O     . THR C 1 408 ? 141.736 167.757 83.971  1.00 141.73 ? 408 THR C O     1 
ATOM   10210 C CB    . THR C 1 408 ? 142.834 170.313 85.745  1.00 141.73 ? 408 THR C CB    1 
ATOM   10211 O OG1   . THR C 1 408 ? 142.939 170.796 87.090  1.00 141.73 ? 408 THR C OG1   1 
ATOM   10212 C CG2   . THR C 1 408 ? 141.481 170.711 85.180  1.00 141.73 ? 408 THR C CG2   1 
ATOM   10213 N N     . ALA C 1 409 ? 143.873 168.294 83.515  1.00 136.35 ? 409 ALA C N     1 
ATOM   10214 C CA    . ALA C 1 409 ? 143.794 167.754 82.162  1.00 136.35 ? 409 ALA C CA    1 
ATOM   10215 C C     . ALA C 1 409 ? 143.588 166.247 82.183  1.00 136.35 ? 409 ALA C C     1 
ATOM   10216 O O     . ALA C 1 409 ? 142.822 165.706 81.378  1.00 136.35 ? 409 ALA C O     1 
ATOM   10217 C CB    . ALA C 1 409 ? 145.055 168.113 81.378  1.00 136.35 ? 409 ALA C CB    1 
ATOM   10218 N N     . LEU C 1 410 ? 144.272 165.549 83.094  1.00 130.99 ? 410 LEU C N     1 
ATOM   10219 C CA    . LEU C 1 410 ? 144.057 164.112 83.234  1.00 130.99 ? 410 LEU C CA    1 
ATOM   10220 C C     . LEU C 1 410 ? 142.619 163.808 83.627  1.00 130.99 ? 410 LEU C C     1 
ATOM   10221 O O     . LEU C 1 410 ? 142.032 162.827 83.158  1.00 130.99 ? 410 LEU C O     1 
ATOM   10222 C CB    . LEU C 1 410 ? 145.023 163.532 84.265  1.00 130.99 ? 410 LEU C CB    1 
ATOM   10223 C CG    . LEU C 1 410 ? 146.501 163.503 83.881  1.00 130.99 ? 410 LEU C CG    1 
ATOM   10224 C CD1   . LEU C 1 410 ? 147.342 163.053 85.060  1.00 130.99 ? 410 LEU C CD1   1 
ATOM   10225 C CD2   . LEU C 1 410 ? 146.716 162.588 82.690  1.00 130.99 ? 410 LEU C CD2   1 
ATOM   10226 N N     . VAL C 1 411 ? 142.038 164.639 84.491  1.00 131.58 ? 411 VAL C N     1 
ATOM   10227 C CA    . VAL C 1 411 ? 140.652 164.425 84.895  1.00 131.58 ? 411 VAL C CA    1 
ATOM   10228 C C     . VAL C 1 411 ? 139.705 164.700 83.732  1.00 131.58 ? 411 VAL C C     1 
ATOM   10229 O O     . VAL C 1 411 ? 138.673 164.035 83.580  1.00 131.58 ? 411 VAL C O     1 
ATOM   10230 C CB    . VAL C 1 411 ? 140.316 165.294 86.122  1.00 131.58 ? 411 VAL C CB    1 
ATOM   10231 C CG1   . VAL C 1 411 ? 138.842 165.186 86.470  1.00 131.58 ? 411 VAL C CG1   1 
ATOM   10232 C CG2   . VAL C 1 411 ? 141.163 164.878 87.306  1.00 131.58 ? 411 VAL C CG2   1 
ATOM   10233 N N     . ALA C 1 412 ? 140.052 165.668 82.880  1.00 133.76 ? 412 ALA C N     1 
ATOM   10234 C CA    . ALA C 1 412 ? 139.100 166.158 81.887  1.00 133.76 ? 412 ALA C CA    1 
ATOM   10235 C C     . ALA C 1 412 ? 138.847 165.141 80.780  1.00 133.76 ? 412 ALA C C     1 
ATOM   10236 O O     . ALA C 1 412 ? 137.710 164.988 80.318  1.00 133.76 ? 412 ALA C O     1 
ATOM   10237 C CB    . ALA C 1 412 ? 139.595 167.477 81.296  1.00 133.76 ? 412 ALA C CB    1 
ATOM   10238 N N     . ASN C 1 413 ? 139.885 164.442 80.336  1.00 130.48 ? 413 ASN C N     1 
ATOM   10239 C CA    . ASN C 1 413 ? 139.706 163.614 79.146  1.00 130.48 ? 413 ASN C CA    1 
ATOM   10240 C C     . ASN C 1 413 ? 139.384 162.178 79.527  1.00 130.48 ? 413 ASN C C     1 
ATOM   10241 O O     . ASN C 1 413 ? 139.882 161.688 80.548  1.00 130.48 ? 413 ASN C O     1 
ATOM   10242 C CB    . ASN C 1 413 ? 140.959 163.638 78.279  1.00 130.48 ? 413 ASN C CB    1 
ATOM   10243 C CG    . ASN C 1 413 ? 141.174 164.975 77.607  1.00 130.48 ? 413 ASN C CG    1 
ATOM   10244 O OD1   . ASN C 1 413 ? 140.229 165.601 77.128  1.00 130.48 ? 413 ASN C OD1   1 
ATOM   10245 N ND2   . ASN C 1 413 ? 142.423 165.419 77.561  1.00 130.48 ? 413 ASN C ND2   1 
ATOM   10246 N N     . PRO C 1 414 ? 138.562 161.481 78.740  1.00 120.10 ? 414 PRO C N     1 
ATOM   10247 C CA    . PRO C 1 414 ? 138.361 160.042 78.962  1.00 120.10 ? 414 PRO C CA    1 
ATOM   10248 C C     . PRO C 1 414 ? 139.608 159.247 78.603  1.00 120.10 ? 414 PRO C C     1 
ATOM   10249 O O     . PRO C 1 414 ? 140.632 159.832 78.239  1.00 120.10 ? 414 PRO C O     1 
ATOM   10250 C CB    . PRO C 1 414 ? 137.191 159.702 78.030  1.00 120.10 ? 414 PRO C CB    1 
ATOM   10251 C CG    . PRO C 1 414 ? 136.518 161.010 77.765  1.00 120.10 ? 414 PRO C CG    1 
ATOM   10252 C CD    . PRO C 1 414 ? 137.622 162.019 77.746  1.00 120.10 ? 414 PRO C CD    1 
ATOM   10253 N N     . TRP C 1 415 ? 139.543 157.922 78.700  1.00 107.69 ? 415 TRP C N     1 
ATOM   10254 C CA    . TRP C 1 415 ? 140.700 157.090 78.416  1.00 107.69 ? 415 TRP C CA    1 
ATOM   10255 C C     . TRP C 1 415 ? 140.287 155.869 77.612  1.00 107.69 ? 415 TRP C C     1 
ATOM   10256 O O     . TRP C 1 415 ? 139.118 155.477 77.594  1.00 107.69 ? 415 TRP C O     1 
ATOM   10257 C CB    . TRP C 1 415 ? 141.417 156.678 79.701  1.00 107.69 ? 415 TRP C CB    1 
ATOM   10258 C CG    . TRP C 1 415 ? 142.047 157.852 80.349  1.00 107.69 ? 415 TRP C CG    1 
ATOM   10259 C CD1   . TRP C 1 415 ? 141.560 158.568 81.398  1.00 107.69 ? 415 TRP C CD1   1 
ATOM   10260 C CD2   . TRP C 1 415 ? 143.260 158.494 79.952  1.00 107.69 ? 415 TRP C CD2   1 
ATOM   10261 N NE1   . TRP C 1 415 ? 142.409 159.603 81.698  1.00 107.69 ? 415 TRP C NE1   1 
ATOM   10262 C CE2   . TRP C 1 415 ? 143.462 159.579 80.823  1.00 107.69 ? 415 TRP C CE2   1 
ATOM   10263 C CE3   . TRP C 1 415 ? 144.204 158.248 78.952  1.00 107.69 ? 415 TRP C CE3   1 
ATOM   10264 C CZ2   . TRP C 1 415 ? 144.565 160.417 80.726  1.00 107.69 ? 415 TRP C CZ2   1 
ATOM   10265 C CZ3   . TRP C 1 415 ? 145.298 159.080 78.857  1.00 107.69 ? 415 TRP C CZ3   1 
ATOM   10266 C CH2   . TRP C 1 415 ? 145.470 160.152 79.738  1.00 107.69 ? 415 TRP C CH2   1 
ATOM   10267 N N     . GLN C 1 416 ? 141.274 155.268 76.950  1.00 116.16 ? 416 GLN C N     1 
ATOM   10268 C CA    . GLN C 1 416 ? 141.027 154.260 75.929  1.00 116.16 ? 416 GLN C CA    1 
ATOM   10269 C C     . GLN C 1 416 ? 140.813 152.869 76.512  1.00 116.16 ? 416 GLN C C     1 
ATOM   10270 O O     . GLN C 1 416 ? 140.024 152.093 75.966  1.00 116.16 ? 416 GLN C O     1 
ATOM   10271 C CB    . GLN C 1 416 ? 142.187 154.253 74.931  1.00 116.16 ? 416 GLN C CB    1 
ATOM   10272 C CG    . GLN C 1 416 ? 141.952 153.419 73.691  1.00 116.16 ? 416 GLN C CG    1 
ATOM   10273 C CD    . GLN C 1 416 ? 142.437 151.999 73.847  1.00 116.16 ? 416 GLN C CD    1 
ATOM   10274 O OE1   . GLN C 1 416 ? 143.387 151.736 74.584  1.00 116.16 ? 416 GLN C OE1   1 
ATOM   10275 N NE2   . GLN C 1 416 ? 141.793 151.072 73.152  1.00 116.16 ? 416 GLN C NE2   1 
ATOM   10276 N N     . LEU C 1 417 ? 141.494 152.539 77.611  1.00 113.38 ? 417 LEU C N     1 
ATOM   10277 C CA    . LEU C 1 417 ? 141.315 151.260 78.297  1.00 113.38 ? 417 LEU C CA    1 
ATOM   10278 C C     . LEU C 1 417 ? 141.616 150.097 77.343  1.00 113.38 ? 417 LEU C C     1 
ATOM   10279 O O     . LEU C 1 417 ? 140.732 149.371 76.891  1.00 113.38 ? 417 LEU C O     1 
ATOM   10280 C CB    . LEU C 1 417 ? 139.906 151.165 78.899  1.00 113.38 ? 417 LEU C CB    1 
ATOM   10281 C CG    . LEU C 1 417 ? 139.616 150.110 79.973  1.00 113.38 ? 417 LEU C CG    1 
ATOM   10282 C CD1   . LEU C 1 417 ? 138.564 150.634 80.939  1.00 113.38 ? 417 LEU C CD1   1 
ATOM   10283 C CD2   . LEU C 1 417 ? 139.158 148.786 79.389  1.00 113.38 ? 417 LEU C CD2   1 
ATOM   10284 N N     . GLY C 1 418 ? 142.897 149.993 76.993  1.00 118.97 ? 418 GLY C N     1 
ATOM   10285 C CA    . GLY C 1 418 ? 143.363 148.956 76.090  1.00 118.97 ? 418 GLY C CA    1 
ATOM   10286 C C     . GLY C 1 418 ? 142.901 147.557 76.446  1.00 118.97 ? 418 GLY C C     1 
ATOM   10287 O O     . GLY C 1 418 ? 142.524 147.292 77.590  1.00 118.97 ? 418 GLY C O     1 
ATOM   10288 N N     . ASN C 1 419 ? 142.936 146.649 75.467  1.00 132.98 ? 419 ASN C N     1 
ATOM   10289 C CA    . ASN C 1 419 ? 142.333 145.332 75.652  1.00 132.98 ? 419 ASN C CA    1 
ATOM   10290 C C     . ASN C 1 419 ? 143.053 144.524 76.724  1.00 132.98 ? 419 ASN C C     1 
ATOM   10291 O O     . ASN C 1 419 ? 142.414 143.802 77.499  1.00 132.98 ? 419 ASN C O     1 
ATOM   10292 C CB    . ASN C 1 419 ? 142.322 144.573 74.326  1.00 132.98 ? 419 ASN C CB    1 
ATOM   10293 C CG    . ASN C 1 419 ? 141.349 145.163 73.329  1.00 132.98 ? 419 ASN C CG    1 
ATOM   10294 O OD1   . ASN C 1 419 ? 140.242 145.560 73.689  1.00 132.98 ? 419 ASN C OD1   1 
ATOM   10295 N ND2   . ASN C 1 419 ? 141.754 145.222 72.067  1.00 132.98 ? 419 ASN C ND2   1 
ATOM   10296 N N     . VAL C 1 420 ? 144.382 144.627 76.787  1.00 124.34 ? 420 VAL C N     1 
ATOM   10297 C CA    . VAL C 1 420 ? 145.126 143.869 77.788  1.00 124.34 ? 420 VAL C CA    1 
ATOM   10298 C C     . VAL C 1 420 ? 144.827 144.380 79.189  1.00 124.34 ? 420 VAL C C     1 
ATOM   10299 O O     . VAL C 1 420 ? 145.051 143.671 80.177  1.00 124.34 ? 420 VAL C O     1 
ATOM   10300 C CB    . VAL C 1 420 ? 146.635 143.912 77.483  1.00 124.34 ? 420 VAL C CB    1 
ATOM   10301 C CG1   . VAL C 1 420 ? 146.921 143.228 76.159  1.00 124.34 ? 420 VAL C CG1   1 
ATOM   10302 C CG2   . VAL C 1 420 ? 147.130 145.348 77.463  1.00 124.34 ? 420 VAL C CG2   1 
ATOM   10303 N N     . ALA C 1 421 ? 144.319 145.609 79.303  1.00 117.35 ? 421 ALA C N     1 
ATOM   10304 C CA    . ALA C 1 421 ? 143.980 146.143 80.617  1.00 117.35 ? 421 ALA C CA    1 
ATOM   10305 C C     . ALA C 1 421 ? 142.775 145.425 81.211  1.00 117.35 ? 421 ALA C C     1 
ATOM   10306 O O     . ALA C 1 421 ? 142.672 145.278 82.434  1.00 117.35 ? 421 ALA C O     1 
ATOM   10307 C CB    . ALA C 1 421 ? 143.718 147.645 80.522  1.00 117.35 ? 421 ALA C CB    1 
ATOM   10308 N N     . ALA C 1 422 ? 141.854 144.974 80.367  1.00 109.85 ? 422 ALA C N     1 
ATOM   10309 C CA    . ALA C 1 422 ? 140.669 144.272 80.843  1.00 109.85 ? 422 ALA C CA    1 
ATOM   10310 C C     . ALA C 1 422 ? 140.773 142.778 80.570  1.00 109.85 ? 422 ALA C C     1 
ATOM   10311 O O     . ALA C 1 422 ? 139.832 142.165 80.066  1.00 109.85 ? 422 ALA C O     1 
ATOM   10312 C CB    . ALA C 1 422 ? 139.420 144.843 80.198  1.00 109.85 ? 422 ALA C CB    1 
ATOM   10313 N N     . ALA C 1 427 ? 135.713 141.277 86.742  1.00 181.21 ? 427 ALA C N     1 
ATOM   10314 C CA    . ALA C 1 427 ? 135.656 140.994 88.171  1.00 181.21 ? 427 ALA C CA    1 
ATOM   10315 C C     . ALA C 1 427 ? 134.218 140.774 88.624  1.00 181.21 ? 427 ALA C C     1 
ATOM   10316 O O     . ALA C 1 427 ? 133.366 140.366 87.836  1.00 181.21 ? 427 ALA C O     1 
ATOM   10317 C CB    . ALA C 1 427 ? 136.294 142.123 88.961  1.00 181.21 ? 427 ALA C CB    1 
ATOM   10318 N N     . GLY C 1 428 ? 133.958 141.045 89.901  1.00 189.48 ? 428 GLY C N     1 
ATOM   10319 C CA    . GLY C 1 428 ? 132.626 140.891 90.451  1.00 189.48 ? 428 GLY C CA    1 
ATOM   10320 C C     . GLY C 1 428 ? 131.617 141.828 89.823  1.00 189.48 ? 428 GLY C C     1 
ATOM   10321 O O     . GLY C 1 428 ? 131.989 142.859 89.254  1.00 189.48 ? 428 GLY C O     1 
ATOM   10322 N N     . ASP C 1 429 ? 130.333 141.472 89.910  1.00 190.32 ? 429 ASP C N     1 
ATOM   10323 C CA    . ASP C 1 429 ? 129.283 142.327 89.365  1.00 190.32 ? 429 ASP C CA    1 
ATOM   10324 C C     . ASP C 1 429 ? 129.286 143.697 90.030  1.00 190.32 ? 429 ASP C C     1 
ATOM   10325 O O     . ASP C 1 429 ? 129.091 144.722 89.368  1.00 190.32 ? 429 ASP C O     1 
ATOM   10326 C CB    . ASP C 1 429 ? 127.923 141.649 89.533  1.00 190.32 ? 429 ASP C CB    1 
ATOM   10327 C CG    . ASP C 1 429 ? 126.807 142.409 88.856  1.00 190.32 ? 429 ASP C CG    1 
ATOM   10328 O OD1   . ASP C 1 429 ? 126.725 142.362 87.612  1.00 190.32 ? 429 ASP C OD1   1 
ATOM   10329 O OD2   . ASP C 1 429 ? 126.011 143.055 89.568  1.00 190.32 ? 429 ASP C OD2   1 
ATOM   10330 N N     . ASP C 1 430 ? 129.504 143.730 91.338  1.00 172.49 ? 430 ASP C N     1 
ATOM   10331 C CA    . ASP C 1 430 ? 129.620 144.970 92.093  1.00 172.49 ? 430 ASP C CA    1 
ATOM   10332 C C     . ASP C 1 430 ? 130.545 144.708 93.277  1.00 172.49 ? 430 ASP C C     1 
ATOM   10333 O O     . ASP C 1 430 ? 131.309 143.737 93.278  1.00 172.49 ? 430 ASP C O     1 
ATOM   10334 C CB    . ASP C 1 430 ? 128.230 145.489 92.504  1.00 172.49 ? 430 ASP C CB    1 
ATOM   10335 C CG    . ASP C 1 430 ? 127.450 144.488 93.338  1.00 172.49 ? 430 ASP C CG    1 
ATOM   10336 O OD1   . ASP C 1 430 ? 127.932 143.352 93.527  1.00 172.49 ? 430 ASP C OD1   1 
ATOM   10337 O OD2   . ASP C 1 430 ? 126.348 144.843 93.809  1.00 172.49 ? 430 ASP C OD2   1 
ATOM   10338 N N     . ALA C 1 431 ? 130.496 145.592 94.274  1.00 145.52 ? 431 ALA C N     1 
ATOM   10339 C CA    . ALA C 1 431 ? 131.242 145.511 95.526  1.00 145.52 ? 431 ALA C CA    1 
ATOM   10340 C C     . ALA C 1 431 ? 132.739 145.702 95.335  1.00 145.52 ? 431 ALA C C     1 
ATOM   10341 O O     . ALA C 1 431 ? 133.498 145.513 96.291  1.00 145.52 ? 431 ALA C O     1 
ATOM   10342 C CB    . ALA C 1 431 ? 131.001 144.192 96.274  1.00 145.52 ? 431 ALA C CB    1 
ATOM   10343 N N     . ALA C 1 432 ? 133.194 146.052 94.138  1.00 132.15 ? 432 ALA C N     1 
ATOM   10344 C CA    . ALA C 1 432 ? 134.589 146.408 93.929  1.00 132.15 ? 432 ALA C CA    1 
ATOM   10345 C C     . ALA C 1 432 ? 134.828 147.907 94.012  1.00 132.15 ? 432 ALA C C     1 
ATOM   10346 O O     . ALA C 1 432 ? 135.964 148.350 93.817  1.00 132.15 ? 432 ALA C O     1 
ATOM   10347 C CB    . ALA C 1 432 ? 135.073 145.882 92.575  1.00 132.15 ? 432 ALA C CB    1 
ATOM   10348 N N     . ARG C 1 433 ? 133.792 148.692 94.293  1.00 124.79 ? 433 ARG C N     1 
ATOM   10349 C CA    . ARG C 1 433 ? 133.872 150.138 94.369  1.00 124.79 ? 433 ARG C CA    1 
ATOM   10350 C C     . ARG C 1 433 ? 133.315 150.634 95.698  1.00 124.79 ? 433 ARG C C     1 
ATOM   10351 O O     . ARG C 1 433 ? 132.410 150.016 96.265  1.00 124.79 ? 433 ARG C O     1 
ATOM   10352 C CB    . ARG C 1 433 ? 133.106 150.782 93.207  1.00 124.79 ? 433 ARG C CB    1 
ATOM   10353 C CG    . ARG C 1 433 ? 131.632 150.428 93.174  1.00 124.79 ? 433 ARG C CG    1 
ATOM   10354 C CD    . ARG C 1 433 ? 130.953 151.016 91.952  1.00 124.79 ? 433 ARG C CD    1 
ATOM   10355 N NE    . ARG C 1 433 ? 130.901 152.473 91.997  1.00 124.79 ? 433 ARG C NE    1 
ATOM   10356 C CZ    . ARG C 1 433 ? 130.614 153.240 90.952  1.00 124.79 ? 433 ARG C CZ    1 
ATOM   10357 N NH1   . ARG C 1 433 ? 130.586 154.558 91.080  1.00 124.79 ? 433 ARG C NH1   1 
ATOM   10358 N NH2   . ARG C 1 433 ? 130.351 152.686 89.776  1.00 124.79 ? 433 ARG C NH2   1 
ATOM   10359 N N     . PRO C 1 434 ? 133.845 151.736 96.226  1.00 126.37 ? 434 PRO C N     1 
ATOM   10360 C CA    . PRO C 1 434 ? 133.393 152.226 97.533  1.00 126.37 ? 434 PRO C CA    1 
ATOM   10361 C C     . PRO C 1 434 ? 131.940 152.673 97.502  1.00 126.37 ? 434 PRO C C     1 
ATOM   10362 O O     . PRO C 1 434 ? 131.302 152.785 96.453  1.00 126.37 ? 434 PRO C O     1 
ATOM   10363 C CB    . PRO C 1 434 ? 134.330 153.405 97.815  1.00 126.37 ? 434 PRO C CB    1 
ATOM   10364 C CG    . PRO C 1 434 ? 135.533 153.134 96.986  1.00 126.37 ? 434 PRO C CG    1 
ATOM   10365 C CD    . PRO C 1 434 ? 135.015 152.483 95.739  1.00 126.37 ? 434 PRO C CD    1 
ATOM   10366 N N     . GLU C 1 435 ? 131.414 152.937 98.699  1.00 143.15 ? 435 GLU C N     1 
ATOM   10367 C CA    . GLU C 1 435 ? 130.027 153.372 98.823  1.00 143.15 ? 435 GLU C CA    1 
ATOM   10368 C C     . GLU C 1 435 ? 129.868 154.826 98.403  1.00 143.15 ? 435 GLU C C     1 
ATOM   10369 O O     . GLU C 1 435 ? 128.992 155.158 97.596  1.00 143.15 ? 435 GLU C O     1 
ATOM   10370 C CB    . GLU C 1 435 ? 129.546 153.178 100.259 1.00 143.15 ? 435 GLU C CB    1 
ATOM   10371 C CG    . GLU C 1 435 ? 129.449 151.730 100.696 1.00 143.15 ? 435 GLU C CG    1 
ATOM   10372 C CD    . GLU C 1 435 ? 128.997 151.594 102.135 1.00 143.15 ? 435 GLU C CD    1 
ATOM   10373 O OE1   . GLU C 1 435 ? 128.876 152.632 102.820 1.00 143.15 ? 435 GLU C OE1   1 
ATOM   10374 O OE2   . GLU C 1 435 ? 128.763 150.452 102.584 1.00 143.15 ? 435 GLU C OE2   1 
ATOM   10375 N N     . TRP C 1 436 ? 130.711 155.708 98.941  1.00 136.24 ? 436 TRP C N     1 
ATOM   10376 C CA    . TRP C 1 436 ? 130.582 157.133 98.665  1.00 136.24 ? 436 TRP C CA    1 
ATOM   10377 C C     . TRP C 1 436 ? 130.921 157.481 97.222  1.00 136.24 ? 436 TRP C C     1 
ATOM   10378 O O     . TRP C 1 436 ? 130.722 158.628 96.809  1.00 136.24 ? 436 TRP C O     1 
ATOM   10379 C CB    . TRP C 1 436 ? 131.472 157.927 99.618  1.00 136.24 ? 436 TRP C CB    1 
ATOM   10380 C CG    . TRP C 1 436 ? 132.921 157.603 99.477  1.00 136.24 ? 436 TRP C CG    1 
ATOM   10381 C CD1   . TRP C 1 436 ? 133.608 156.625 100.131 1.00 136.24 ? 436 TRP C CD1   1 
ATOM   10382 C CD2   . TRP C 1 436 ? 133.866 158.261 98.630  1.00 136.24 ? 436 TRP C CD2   1 
ATOM   10383 N NE1   . TRP C 1 436 ? 134.925 156.631 99.742  1.00 136.24 ? 436 TRP C NE1   1 
ATOM   10384 C CE2   . TRP C 1 436 ? 135.109 157.628 98.821  1.00 136.24 ? 436 TRP C CE2   1 
ATOM   10385 C CE3   . TRP C 1 436 ? 133.782 159.325 97.728  1.00 136.24 ? 436 TRP C CE3   1 
ATOM   10386 C CZ2   . TRP C 1 436 ? 136.259 158.023 98.144  1.00 136.24 ? 436 TRP C CZ2   1 
ATOM   10387 C CZ3   . TRP C 1 436 ? 134.924 159.715 97.056  1.00 136.24 ? 436 TRP C CZ3   1 
ATOM   10388 C CH2   . TRP C 1 436 ? 136.146 159.066 97.267  1.00 136.24 ? 436 TRP C CH2   1 
ATOM   10389 N N     . LEU C 1 437 ? 131.433 156.528 96.450  1.00 133.12 ? 437 LEU C N     1 
ATOM   10390 C CA    . LEU C 1 437 ? 131.709 156.781 95.044  1.00 133.12 ? 437 LEU C CA    1 
ATOM   10391 C C     . LEU C 1 437 ? 130.405 156.924 94.272  1.00 133.12 ? 437 LEU C C     1 
ATOM   10392 O O     . LEU C 1 437 ? 129.474 156.133 94.447  1.00 133.12 ? 437 LEU C O     1 
ATOM   10393 C CB    . LEU C 1 437 ? 132.551 155.649 94.461  1.00 133.12 ? 437 LEU C CB    1 
ATOM   10394 C CG    . LEU