data_6RZ5
# 
_entry.id   6RZ5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.324 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6RZ5         
WWPDB D_1200011358 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6RZ5 
_pdbx_database_status.recvd_initial_deposition_date   2019-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Luginina, A.'        1  0000-0003-2697-456X 
'Gusach, A.'          2  0000-0002-2594-8573 
'Marin, E.'           3  0000-0003-2369-1732 
'Mishin, A.'          4  0000-0003-3759-380X 
'Brouillette, R.'     5  ?                   
'Popov, P.'           6  ?                   
'Shiryaeva, A.'       7  ?                   
'Besserer-Offroy, E.' 8  ?                   
'Longpre, J.M.'       9  ?                   
'Lyapina, E.'         10 ?                   
'Ishchenko, A.'       11 ?                   
'Patel, N.'           12 ?                   
'Polovinkin, V.'      13 ?                   
'Safronova, N.'       14 ?                   
'Bogorodskiy, A.'     15 ?                   
'Edelweiss, E.'       16 ?                   
'Liu, W.'             17 ?                   
'Batyuk, A.'          18 ?                   
'Gordeliy, V.'        19 ?                   
'Han, G.W.'           20 0000-0003-4107-835X 
'Sarret, P.'          21 ?                   
'Katritch, V.'        22 0000-0003-3883-4505 
'Borshchevskiy, V.'   23 0000-0003-4398-9712 
'Cherezov, V.'        24 0000-0002-5265-3914 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Adv' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2375-2548 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            5 
_citation.language                  ? 
_citation.page_first                eaax2518 
_citation.page_last                 eaax2518 
_citation.title                     
'Structure-based mechanism of cysteinyl leukotriene receptor inhibition by antiasthmatic drugs.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/sciadv.aax2518 
_citation.pdbx_database_id_PubMed   31633023 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Luginina, A.'        1  0000-0003-2697-456X 
primary 'Gusach, A.'          2  0000-0002-2594-8573 
primary 'Marin, E.'           3  0000-0003-2369-1732 
primary 'Mishin, A.'          4  0000-0003-3759-380X 
primary 'Brouillette, R.'     5  0000-0002-5466-9653 
primary 'Popov, P.'           6  ?                   
primary 'Shiriaeva, A.'       7  ?                   
primary 'Besserer-Offroy, E.' 8  0000-0002-7473-7043 
primary 'Longpre, J.M.'       9  0000-0003-3985-2318 
primary 'Lyapina, E.'         10 0000-0003-0719-8497 
primary 'Ishchenko, A.'       11 ?                   
primary 'Patel, N.'           12 0000-0002-9856-3041 
primary 'Polovinkin, V.'      13 0000-0002-3630-5565 
primary 'Safronova, N.'       14 0000-0002-7770-0174 
primary 'Bogorodskiy, A.'     15 ?                   
primary 'Edelweiss, E.'       16 ?                   
primary 'Hu, H.'              17 0000-0003-3472-0404 
primary 'Weierstall, U.'      18 0000-0002-3594-930X 
primary 'Liu, W.'             19 ?                   
primary 'Batyuk, A.'          20 0000-0002-9393-2880 
primary 'Gordeliy, V.'        21 ?                   
primary 'Han, G.W.'           22 0000-0003-4107-835X 
primary 'Sarret, P.'          23 0000-0002-7627-701X 
primary 'Katritch, V.'        24 0000-0003-3883-4505 
primary 'Borshchevskiy, V.'   25 0000-0003-4398-9712 
primary 'Cherezov, V.'        26 0000-0002-5265-3914 
# 
_cell.angle_alpha                  76.31 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   76.68 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  81.21 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6RZ5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     41.590 
_cell.length_a_esd                 ? 
_cell.length_b                     68.580 
_cell.length_b_esd                 ? 
_cell.length_c                     87.390 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6RZ5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Cysteinyl leukotriene receptor 1,Soluble cytochrome b562,Cysteinyl leukotriene receptor 1' 47927.090 2  ? ? ? ? 
2 non-polymer syn zafirlukast                                                                                 575.675   3  ? ? ? ? 
3 non-polymer syn '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate'                                            356.540   17 ? ? ? ? 
4 non-polymer syn 'OLEIC ACID'                                                                                282.461   19 ? ? ? ? 
5 non-polymer syn 'PENTAETHYLENE GLYCOL'                                                                      238.278   1  ? ? ? ? 
6 non-polymer syn 'SODIUM ION'                                                                                22.990    2  ? ? ? ? 
7 water       nat water                                                                                       18.015    10 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;CysLTR1,Cysteinyl leukotriene D4 receptor,LTD4 receptor,G-protein coupled receptor HG55,HMTMF81,Cytochrome b-562,CysLTR1,Cysteinyl leukotriene D4 receptor,LTD4 receptor,G-protein coupled receptor HG55,HMTMF81
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GGTMDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLP
LRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSP
FLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKSADLEDNWETLNDNL
KVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQL
KTTRNAYIQKYLSGKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNC
CFDPLLYFFSGGNFRKRLSTFRK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GGTMDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLP
LRVVYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSP
FLMAKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMKSADLEDNWETLNDNL
KVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQL
KTTRNAYIQKYLSGKNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNC
CFDPLLYFFSGGNFRKRLSTFRK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   GLY n 
1 3   THR n 
1 4   MET n 
1 5   ASP n 
1 6   GLU n 
1 7   THR n 
1 8   GLY n 
1 9   ASN n 
1 10  LEU n 
1 11  THR n 
1 12  VAL n 
1 13  SER n 
1 14  SER n 
1 15  ALA n 
1 16  THR n 
1 17  CYS n 
1 18  HIS n 
1 19  ASP n 
1 20  THR n 
1 21  ILE n 
1 22  ASP n 
1 23  ASP n 
1 24  PHE n 
1 25  ARG n 
1 26  ASN n 
1 27  GLN n 
1 28  VAL n 
1 29  TYR n 
1 30  SER n 
1 31  THR n 
1 32  LEU n 
1 33  TYR n 
1 34  SER n 
1 35  MET n 
1 36  ILE n 
1 37  SER n 
1 38  VAL n 
1 39  VAL n 
1 40  GLY n 
1 41  PHE n 
1 42  PHE n 
1 43  GLY n 
1 44  ASN n 
1 45  GLY n 
1 46  PHE n 
1 47  VAL n 
1 48  LEU n 
1 49  TYR n 
1 50  VAL n 
1 51  LEU n 
1 52  ILE n 
1 53  LYS n 
1 54  THR n 
1 55  TYR n 
1 56  HIS n 
1 57  LYS n 
1 58  LYS n 
1 59  SER n 
1 60  ALA n 
1 61  PHE n 
1 62  GLN n 
1 63  VAL n 
1 64  TYR n 
1 65  MET n 
1 66  ILE n 
1 67  ASN n 
1 68  LEU n 
1 69  ALA n 
1 70  VAL n 
1 71  ALA n 
1 72  ASP n 
1 73  LEU n 
1 74  LEU n 
1 75  CYS n 
1 76  VAL n 
1 77  CYS n 
1 78  THR n 
1 79  LEU n 
1 80  PRO n 
1 81  LEU n 
1 82  ARG n 
1 83  VAL n 
1 84  VAL n 
1 85  TYR n 
1 86  TYR n 
1 87  VAL n 
1 88  HIS n 
1 89  LYS n 
1 90  GLY n 
1 91  ILE n 
1 92  TRP n 
1 93  LEU n 
1 94  PHE n 
1 95  GLY n 
1 96  ASP n 
1 97  PHE n 
1 98  LEU n 
1 99  CYS n 
1 100 ARG n 
1 101 LEU n 
1 102 SER n 
1 103 THR n 
1 104 TYR n 
1 105 ALA n 
1 106 LEU n 
1 107 TYR n 
1 108 VAL n 
1 109 ASN n 
1 110 LEU n 
1 111 TYR n 
1 112 CYS n 
1 113 SER n 
1 114 ILE n 
1 115 PHE n 
1 116 PHE n 
1 117 MET n 
1 118 THR n 
1 119 ALA n 
1 120 MET n 
1 121 SER n 
1 122 PHE n 
1 123 PHE n 
1 124 ARG n 
1 125 CYS n 
1 126 ILE n 
1 127 ALA n 
1 128 ILE n 
1 129 VAL n 
1 130 PHE n 
1 131 PRO n 
1 132 VAL n 
1 133 GLN n 
1 134 ASN n 
1 135 ILE n 
1 136 ASN n 
1 137 LEU n 
1 138 VAL n 
1 139 THR n 
1 140 GLN n 
1 141 LYS n 
1 142 LYS n 
1 143 ALA n 
1 144 ARG n 
1 145 PHE n 
1 146 VAL n 
1 147 CYS n 
1 148 VAL n 
1 149 GLY n 
1 150 ILE n 
1 151 TRP n 
1 152 ILE n 
1 153 PHE n 
1 154 VAL n 
1 155 ILE n 
1 156 LEU n 
1 157 THR n 
1 158 SER n 
1 159 SER n 
1 160 PRO n 
1 161 PHE n 
1 162 LEU n 
1 163 MET n 
1 164 ALA n 
1 165 LYS n 
1 166 PRO n 
1 167 GLN n 
1 168 LYS n 
1 169 ASP n 
1 170 GLU n 
1 171 LYS n 
1 172 ASN n 
1 173 ASN n 
1 174 THR n 
1 175 LYS n 
1 176 CYS n 
1 177 PHE n 
1 178 GLU n 
1 179 PRO n 
1 180 PRO n 
1 181 GLN n 
1 182 ASP n 
1 183 ASN n 
1 184 GLN n 
1 185 THR n 
1 186 LYS n 
1 187 ASN n 
1 188 HIS n 
1 189 VAL n 
1 190 LEU n 
1 191 VAL n 
1 192 LEU n 
1 193 HIS n 
1 194 TYR n 
1 195 VAL n 
1 196 SER n 
1 197 LEU n 
1 198 PHE n 
1 199 VAL n 
1 200 GLY n 
1 201 PHE n 
1 202 ILE n 
1 203 ILE n 
1 204 PRO n 
1 205 PHE n 
1 206 VAL n 
1 207 ILE n 
1 208 ILE n 
1 209 ILE n 
1 210 VAL n 
1 211 CYS n 
1 212 TYR n 
1 213 THR n 
1 214 MET n 
1 215 ILE n 
1 216 ILE n 
1 217 LEU n 
1 218 THR n 
1 219 LEU n 
1 220 LEU n 
1 221 LYS n 
1 222 LYS n 
1 223 SER n 
1 224 MET n 
1 225 LYS n 
1 226 SER n 
1 227 ALA n 
1 228 ASP n 
1 229 LEU n 
1 230 GLU n 
1 231 ASP n 
1 232 ASN n 
1 233 TRP n 
1 234 GLU n 
1 235 THR n 
1 236 LEU n 
1 237 ASN n 
1 238 ASP n 
1 239 ASN n 
1 240 LEU n 
1 241 LYS n 
1 242 VAL n 
1 243 ILE n 
1 244 GLU n 
1 245 LYS n 
1 246 ALA n 
1 247 ASP n 
1 248 ASN n 
1 249 ALA n 
1 250 ALA n 
1 251 GLN n 
1 252 VAL n 
1 253 LYS n 
1 254 ASP n 
1 255 ALA n 
1 256 LEU n 
1 257 THR n 
1 258 LYS n 
1 259 MET n 
1 260 ARG n 
1 261 ALA n 
1 262 ALA n 
1 263 ALA n 
1 264 LEU n 
1 265 ASP n 
1 266 ALA n 
1 267 GLN n 
1 268 LYS n 
1 269 ALA n 
1 270 THR n 
1 271 PRO n 
1 272 PRO n 
1 273 LYS n 
1 274 LEU n 
1 275 GLU n 
1 276 ASP n 
1 277 LYS n 
1 278 SER n 
1 279 PRO n 
1 280 ASP n 
1 281 SER n 
1 282 PRO n 
1 283 GLU n 
1 284 MET n 
1 285 LYS n 
1 286 ASP n 
1 287 PHE n 
1 288 ARG n 
1 289 HIS n 
1 290 GLY n 
1 291 PHE n 
1 292 ASP n 
1 293 ILE n 
1 294 LEU n 
1 295 VAL n 
1 296 GLY n 
1 297 GLN n 
1 298 ILE n 
1 299 ASP n 
1 300 ASP n 
1 301 ALA n 
1 302 LEU n 
1 303 LYS n 
1 304 LEU n 
1 305 ALA n 
1 306 ASN n 
1 307 GLU n 
1 308 GLY n 
1 309 LYS n 
1 310 VAL n 
1 311 LYS n 
1 312 GLU n 
1 313 ALA n 
1 314 GLN n 
1 315 ALA n 
1 316 ALA n 
1 317 ALA n 
1 318 GLU n 
1 319 GLN n 
1 320 LEU n 
1 321 LYS n 
1 322 THR n 
1 323 THR n 
1 324 ARG n 
1 325 ASN n 
1 326 ALA n 
1 327 TYR n 
1 328 ILE n 
1 329 GLN n 
1 330 LYS n 
1 331 TYR n 
1 332 LEU n 
1 333 SER n 
1 334 GLY n 
1 335 LYS n 
1 336 ASN n 
1 337 LEU n 
1 338 SER n 
1 339 SER n 
1 340 HIS n 
1 341 LYS n 
1 342 LYS n 
1 343 ALA n 
1 344 ILE n 
1 345 GLY n 
1 346 MET n 
1 347 ILE n 
1 348 MET n 
1 349 VAL n 
1 350 VAL n 
1 351 THR n 
1 352 ALA n 
1 353 ALA n 
1 354 PHE n 
1 355 LEU n 
1 356 VAL n 
1 357 SER n 
1 358 PHE n 
1 359 MET n 
1 360 PRO n 
1 361 TYR n 
1 362 HIS n 
1 363 ILE n 
1 364 GLN n 
1 365 ARG n 
1 366 THR n 
1 367 ILE n 
1 368 HIS n 
1 369 LEU n 
1 370 HIS n 
1 371 PHE n 
1 372 LEU n 
1 373 HIS n 
1 374 ASN n 
1 375 GLU n 
1 376 THR n 
1 377 LYS n 
1 378 PRO n 
1 379 CYS n 
1 380 ASP n 
1 381 SER n 
1 382 VAL n 
1 383 LEU n 
1 384 ARG n 
1 385 MET n 
1 386 GLN n 
1 387 LYS n 
1 388 SER n 
1 389 VAL n 
1 390 VAL n 
1 391 ILE n 
1 392 THR n 
1 393 LEU n 
1 394 SER n 
1 395 LEU n 
1 396 ALA n 
1 397 ALA n 
1 398 SER n 
1 399 ASN n 
1 400 CYS n 
1 401 CYS n 
1 402 PHE n 
1 403 ASP n 
1 404 PRO n 
1 405 LEU n 
1 406 LEU n 
1 407 TYR n 
1 408 PHE n 
1 409 PHE n 
1 410 SER n 
1 411 GLY n 
1 412 GLY n 
1 413 ASN n 
1 414 PHE n 
1 415 ARG n 
1 416 LYS n 
1 417 ARG n 
1 418 LEU n 
1 419 SER n 
1 420 THR n 
1 421 PHE n 
1 422 ARG n 
1 423 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   225 Human ? 'CYSLTR1, CYSLT1' ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 226 331 ?     ? cybC              ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample 'Biological sequence' 332 423 Human ? 'CYSLTR1, CYSLT1' ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? ? ? ? ? 
'Fall armyworm' 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? ? ? Sf9 ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CLTR1_HUMAN Q9Y271 ? 1 
;MDETGNLTVSSATCHDTIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLIKTYHKKSAFQVYMINLAVADLLCVCTLPLRV
VYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCIAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLM
AKPQKDEKNNTKCFEPPQDNQTKNHVLVLHYVSLFVGFIIPFVIIIVCYTMIILTLLKKSMK
;
1   
2 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYHQKY
;
23  
3 UNP CLTR1_HUMAN Q9Y271 ? 1 
;KNLSSHKKAIGMIMVVTAAFLVSFMPYHIQRTIHLHFLHNETKPCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNF
RKRLSTFRK
;
223 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6RZ5 A 4   ? 225 ? Q9Y271 1   ? 222 ? 1    222  
2 2 6RZ5 A 227 ? 331 ? P0ABE7 23  ? 127 ? 1001 1105 
3 3 6RZ5 A 335 ? 423 ? Q9Y271 223 ? 311 ? ?    311  
4 1 6RZ5 B 4   ? 225 ? Q9Y271 1   ? 222 ? 1    222  
5 2 6RZ5 B 227 ? 331 ? P0ABE7 23  ? 127 ? 1001 1105 
6 3 6RZ5 B 335 ? 423 ? Q9Y271 223 ? 311 ? ?    311  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6RZ5 GLY A 1   ? UNP Q9Y271 ?   ?   'expression tag' -2   1  
1 6RZ5 GLY A 2   ? UNP Q9Y271 ?   ?   'expression tag' -1   2  
1 6RZ5 THR A 3   ? UNP Q9Y271 ?   ?   'expression tag' 0    3  
1 6RZ5 SER A 226 ? UNP Q9Y271 ?   ?   linker           1000 4  
2 6RZ5 TRP A 233 ? UNP P0ABE7 MET 29  conflict         1007 5  
2 6RZ5 ILE A 328 ? UNP P0ABE7 HIS 124 conflict         1102 6  
2 6RZ5 LEU A 332 ? UNP P0ABE7 ?   ?   linker           1106 7  
2 6RZ5 SER A 333 ? UNP P0ABE7 ?   ?   linker           ?    8  
2 6RZ5 GLY A 334 ? UNP P0ABE7 ?   ?   linker           ?    9  
4 6RZ5 GLY B 1   ? UNP Q9Y271 ?   ?   'expression tag' -2   10 
4 6RZ5 GLY B 2   ? UNP Q9Y271 ?   ?   'expression tag' -1   11 
4 6RZ5 THR B 3   ? UNP Q9Y271 ?   ?   'expression tag' 0    12 
4 6RZ5 SER B 226 ? UNP Q9Y271 ?   ?   linker           1000 13 
5 6RZ5 TRP B 233 ? UNP P0ABE7 MET 29  conflict         1007 14 
5 6RZ5 ILE B 328 ? UNP P0ABE7 HIS 124 conflict         1102 15 
5 6RZ5 LEU B 332 ? UNP P0ABE7 ?   ?   linker           1106 16 
5 6RZ5 SER B 333 ? UNP P0ABE7 ?   ?   linker           ?    17 
5 6RZ5 GLY B 334 ? UNP P0ABE7 ?   ?   linker           ?    18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
1PE non-polymer         . 'PENTAETHYLENE GLYCOL'                           PEG400              'C10 H22 O6'      238.278 
ALA 'L-peptide linking' y ALANINE                                          ?                   'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                         ?                   'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                       ?                   'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                  ?                   'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                         ?                   'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                        ?                   'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                  ?                   'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                          ?                   'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                        ?                   'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                            ?                   'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                       ?                   'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                          ?                   'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                           ?                   'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                       ?                   'C5 H11 N O2 S'   149.211 
NA  non-polymer         . 'SODIUM ION'                                     ?                   'Na 1'            22.990  
OLA non-polymer         . 'OLEIC ACID'                                     ?                   'C18 H34 O2'      282.461 
OLC non-polymer         . '(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate' 1-Oleoyl-R-glycerol 'C21 H40 O4'      356.540 
PHE 'L-peptide linking' y PHENYLALANINE                                    ?                   'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                          ?                   'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                           ?                   'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                        ?                   'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                       ?                   'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                         ?                   'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                           ?                   'C5 H11 N O2'     117.146 
ZLK non-polymer         . zafirlukast                                      ?                   'C31 H33 N3 O6 S' 575.675 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6RZ5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.46 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;75-175 mM sodium phosphate
24-34% v/v PEG400
100 mM HEPES pH 7.0
1 uM zafirlukast
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     293 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   Y 
# 
_diffrn_detector.details                      'pair of Kirkpatrick-Baez mirrors' 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'CS-PAD CXI-1' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-08-21 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.302 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLAC LCLS BEAMLINE CXI' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.302 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   CXI 
_diffrn_source.pdbx_synchrotron_site       'SLAC LCLS' 
# 
_reflns.B_iso_Wilson_estimate            65.20 
_reflns.entry_id                         6RZ5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.53 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       30258 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  82.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            3.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.98 
_reflns.pdbx_R_split                     0.20 
# 
_reflns_shell.d_res_high                  2.53 
_reflns_shell.d_res_low                   2.62 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2988 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             43.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.20 
_reflns_shell.pdbx_R_split                2.19 
# 
_refine.aniso_B[1][1]                            -0.08920 
_refine.aniso_B[1][2]                            1.11080 
_refine.aniso_B[1][3]                            2.97940 
_refine.aniso_B[2][2]                            7.83570 
_refine.aniso_B[2][3]                            0.11260 
_refine.aniso_B[3][3]                            -7.74650 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               92.66 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.923 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6RZ5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.53 
_refine.ls_d_res_low                             19.84 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     30186 
_refine.ls_number_reflns_R_free                  1508 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_R_factor_R_free                       0.223 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6RZ4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.255 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.242 
_refine.pdbx_overall_SU_R_Blow_DPI               0.415 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.500 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        6RZ5 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.38 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.details                          ? 
_refine_hist.d_res_high                       2.53 
_refine_hist.d_res_low                        19.84 
_refine_hist.number_atoms_solvent             10 
_refine_hist.number_atoms_total               6109 
_refine_hist.number_reflns_all                ? 
_refine_hist.number_reflns_obs                ? 
_refine_hist.number_reflns_R_free             ? 
_refine_hist.number_reflns_R_work             ? 
_refine_hist.R_factor_all                     ? 
_refine_hist.R_factor_obs                     ? 
_refine_hist.R_factor_R_free                  ? 
_refine_hist.R_factor_R_work                  ? 
_refine_hist.pdbx_number_residues_total       ? 
_refine_hist.pdbx_B_iso_mean_ligand           ? 
_refine_hist.pdbx_B_iso_mean_solvent          ? 
_refine_hist.pdbx_number_atoms_protein        5527 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         572 
_refine_hist.pdbx_number_atoms_lipid          ? 
_refine_hist.pdbx_number_atoms_carb           ? 
_refine_hist.pdbx_pseudo_atom_details         ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 6237 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.08  ? 8375 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 2082 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_trig_c_planes           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 1005 ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 6237 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 0    ? t_nbd                     5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 2.30  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 20.24 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 819  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 6750 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.53 
_refine_ls_shell.d_res_low                        2.55 
_refine_ls_shell.number_reflns_all                604 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             574 
_refine_ls_shell.percent_reflns_obs               98.40 
_refine_ls_shell.percent_reflns_R_free            4.97 
_refine_ls_shell.R_factor_all                     0.2219 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2633 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2197 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6RZ5 
_struct.title                        
'XFEL crystal structure of the human cysteinyl leukotriene receptor 1 in complex with zafirlukast' 
_struct.pdbx_descriptor              'Cysteinyl leukotriene receptor 1,Soluble cytochrome b562,Cysteinyl leukotriene receptor 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6RZ5 
_struct_keywords.text            
;GPCR, LCP, MEMBRANE PROTEIN, cysteinyl leukotriene, LTD4, cyslt1, cysltr1, cyslt1r, asthma, zafirlukast, BRIL, sodium site, Cysteinyl Leukotriene Receptor 1, XFEL, Serial Femtosecond Crystallography, SFX
;
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 2 ? 
D  N N 3 ? 
E  N N 3 ? 
F  N N 3 ? 
G  N N 3 ? 
H  N N 3 ? 
I  N N 3 ? 
J  N N 3 ? 
K  N N 3 ? 
L  N N 4 ? 
M  N N 4 ? 
N  N N 4 ? 
O  N N 4 ? 
P  N N 4 ? 
Q  N N 4 ? 
R  N N 4 ? 
S  N N 4 ? 
T  N N 4 ? 
U  N N 4 ? 
V  N N 4 ? 
W  N N 5 ? 
X  N N 6 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 3 ? 
BA N N 3 ? 
CA N N 3 ? 
DA N N 3 ? 
EA N N 3 ? 
FA N N 3 ? 
GA N N 3 ? 
HA N N 3 ? 
IA N N 4 ? 
JA N N 4 ? 
KA N N 4 ? 
LA N N 4 ? 
MA N N 4 ? 
NA N N 4 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 2 ? 
RA N N 6 ? 
SA N N 7 ? 
TA N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 20  ? LYS A 53  ? THR A 17   LYS A 50   1 ? 34 
HELX_P HELX_P2  AA2 SER A 59  ? CYS A 77  ? SER A 56   CYS A 74   1 ? 19 
HELX_P HELX_P3  AA3 THR A 78  ? HIS A 88  ? THR A 75   HIS A 85   1 ? 11 
HELX_P HELX_P4  AA4 PHE A 94  ? PHE A 130 ? PHE A 91   PHE A 127  1 ? 37 
HELX_P HELX_P5  AA5 GLN A 133 ? VAL A 138 ? GLN A 130  VAL A 135  1 ? 6  
HELX_P HELX_P6  AA6 THR A 139 ? SER A 158 ? THR A 136  SER A 155  1 ? 20 
HELX_P HELX_P7  AA7 SER A 159 ? LEU A 162 ? SER A 156  LEU A 159  5 ? 4  
HELX_P HELX_P8  AA8 LYS A 186 ? PHE A 201 ? LYS A 183  PHE A 198  1 ? 16 
HELX_P HELX_P9  AA9 PHE A 201 ? GLU A 244 ? PHE A 198  GLU A 1018 1 ? 44 
HELX_P HELX_P10 AB1 LYS A 253 ? ALA A 269 ? LYS A 1027 ALA A 1043 1 ? 17 
HELX_P HELX_P11 AB2 SER A 281 ? ALA A 301 ? SER A 1055 ALA A 1075 1 ? 21 
HELX_P HELX_P12 AB3 GLN A 319 ? ARG A 324 ? GLN A 1093 ARG A 1098 1 ? 6  
HELX_P HELX_P13 AB4 SER A 338 ? SER A 357 ? SER A 226  SER A 245  1 ? 20 
HELX_P HELX_P14 AB5 SER A 357 ? LEU A 372 ? SER A 245  LEU A 260  1 ? 16 
HELX_P HELX_P15 AB6 PRO A 378 ? SER A 398 ? PRO A 266  SER A 286  1 ? 21 
HELX_P HELX_P16 AB7 CYS A 401 ? GLY A 411 ? CYS A 289  GLY A 299  1 ? 11 
HELX_P HELX_P17 AB8 THR B 20  ? LYS B 53  ? THR B 17   LYS B 50   1 ? 34 
HELX_P HELX_P18 AB9 SER B 59  ? CYS B 77  ? SER B 56   CYS B 74   1 ? 19 
HELX_P HELX_P19 AC1 THR B 78  ? HIS B 88  ? THR B 75   HIS B 85   1 ? 11 
HELX_P HELX_P20 AC2 PHE B 94  ? PHE B 130 ? PHE B 91   PHE B 127  1 ? 37 
HELX_P HELX_P21 AC3 GLN B 133 ? VAL B 138 ? GLN B 130  VAL B 135  1 ? 6  
HELX_P HELX_P22 AC4 THR B 139 ? SER B 158 ? THR B 136  SER B 155  1 ? 20 
HELX_P HELX_P23 AC5 SER B 159 ? LEU B 162 ? SER B 156  LEU B 159  5 ? 4  
HELX_P HELX_P24 AC6 LYS B 186 ? PHE B 201 ? LYS B 183  PHE B 198  1 ? 16 
HELX_P HELX_P25 AC7 PHE B 201 ? GLU B 244 ? PHE B 198  GLU B 1018 1 ? 44 
HELX_P HELX_P26 AC8 ASN B 248 ? ALA B 269 ? ASN B 1022 ALA B 1043 1 ? 22 
HELX_P HELX_P27 AC9 SER B 281 ? GLU B 307 ? SER B 1055 GLU B 1081 1 ? 27 
HELX_P HELX_P28 AD1 LYS B 309 ? ALA B 315 ? LYS B 1083 ALA B 1089 1 ? 7  
HELX_P HELX_P29 AD2 ALA B 316 ? ILE B 328 ? ALA B 1090 ILE B 1102 1 ? 13 
HELX_P HELX_P30 AD3 SER B 338 ? SER B 357 ? SER B 226  SER B 245  1 ? 20 
HELX_P HELX_P31 AD4 SER B 357 ? LEU B 372 ? SER B 245  LEU B 260  1 ? 16 
HELX_P HELX_P32 AD5 PRO B 378 ? SER B 398 ? PRO B 266  SER B 286  1 ? 21 
HELX_P HELX_P33 AD6 CYS B 401 ? SER B 410 ? CYS B 289  SER B 298  1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A  CYS 17  SG  ? ? ? 1_555 A  CYS 379 SG ? ? A CYS 14   A CYS 267  1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2  disulf ? ? A  CYS 99  SG  ? ? ? 1_555 A  CYS 176 SG ? ? A CYS 96   A CYS 173  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf3  disulf ? ? B  CYS 17  SG  ? ? ? 1_555 B  CYS 379 SG ? ? B CYS 14   B CYS 267  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf4  disulf ? ? B  CYS 99  SG  ? ? ? 1_555 B  CYS 176 SG ? ? B CYS 96   B CYS 173  1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc1  metalc ? ? A  ASP 72  OD1 ? ? ? 1_555 X  NA  .   NA ? ? A ASP 69   A NA  2022 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc2  metalc ? ? A  SER 113 OG  ? ? ? 1_555 X  NA  .   NA ? ? A SER 110  A NA  2022 1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc3  metalc ? ? A  ASN 399 OD1 ? ? ? 1_555 X  NA  .   NA ? ? A ASN 287  A NA  2022 1_555 ? ? ? ? ? ? ? 2.328 ? 
metalc4  metalc ? ? A  ASP 403 OD2 ? ? ? 1_555 X  NA  .   NA ? ? A ASP 291  A NA  2022 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc5  metalc ? ? B  ASP 72  OD1 ? ? ? 1_555 RA NA  .   NA ? ? B ASP 69   B NA  2020 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc6  metalc ? ? B  SER 113 OG  ? ? ? 1_555 RA NA  .   NA ? ? B SER 110  B NA  2020 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc7  metalc ? ? B  ASN 399 OD1 ? ? ? 1_555 RA NA  .   NA ? ? B ASN 287  B NA  2020 1_555 ? ? ? ? ? ? ? 2.326 ? 
metalc8  metalc ? ? B  ASP 403 OD2 ? ? ? 1_555 RA NA  .   NA ? ? B ASP 291  B NA  2020 1_555 ? ? ? ? ? ? ? 2.415 ? 
metalc9  metalc ? ? X  NA  .   NA  ? ? ? 1_555 SA HOH .   O  ? ? A NA  2022 A HOH 2105 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc10 metalc ? ? RA NA  .   NA  ? ? ? 1_555 TA HOH .   O  ? ? B NA  2020 B HOH 2105 1_555 ? ? ? ? ? ? ? 2.433 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A 167 ? LYS A 168 ? GLN A 164 LYS A 165 
AA1 2 THR A 174 ? LYS A 175 ? THR A 171 LYS A 172 
AA2 1 GLN B 167 ? LYS B 168 ? GLN B 164 LYS B 165 
AA2 2 THR B 174 ? LYS B 175 ? THR B 171 LYS B 172 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 167 ? N GLN A 164 O LYS A 175 ? O LYS A 172 
AA2 1 2 N GLN B 167 ? N GLN B 164 O LYS B 175 ? O LYS B 172 
# 
_atom_sites.entry_id                    6RZ5 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   0.024044 
_atom_sites.fract_transf_matrix[1][2]   -0.003718 
_atom_sites.fract_transf_matrix[1][3]   -0.005025 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014755 
_atom_sites.fract_transf_matrix[2][3]   -0.003161 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012026 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . CYS A  1 17  ? 4.695   19.098  -40.455 1.00 134.32 ? 14   CYS A N   1 
ATOM   2    C  CA  . CYS A  1 17  ? 5.369   18.560  -39.276 1.00 134.01 ? 14   CYS A CA  1 
ATOM   3    C  C   . CYS A  1 17  ? 6.841   18.989  -39.169 1.00 138.33 ? 14   CYS A C   1 
ATOM   4    O  O   . CYS A  1 17  ? 7.554   19.061  -40.176 1.00 137.77 ? 14   CYS A O   1 
ATOM   5    C  CB  . CYS A  1 17  ? 5.215   17.041  -39.201 1.00 134.01 ? 14   CYS A CB  1 
ATOM   6    S  SG  . CYS A  1 17  ? 6.310   16.235  -37.996 1.00 137.61 ? 14   CYS A SG  1 
ATOM   7    N  N   . HIS A  1 18  ? 7.279   19.246  -37.919 1.00 135.30 ? 15   HIS A N   1 
ATOM   8    C  CA  . HIS A  1 18  ? 8.629   19.638  -37.497 1.00 135.25 ? 15   HIS A CA  1 
ATOM   9    C  C   . HIS A  1 18  ? 8.695   19.588  -35.955 1.00 138.79 ? 15   HIS A C   1 
ATOM   10   O  O   . HIS A  1 18  ? 7.889   18.886  -35.333 1.00 138.13 ? 15   HIS A O   1 
ATOM   11   C  CB  . HIS A  1 18  ? 8.975   21.050  -38.016 1.00 136.11 ? 15   HIS A CB  1 
ATOM   12   N  N   . ASP A  1 19  ? 9.654   20.324  -35.344 1.00 135.02 ? 16   ASP A N   1 
ATOM   13   C  CA  . ASP A  1 19  ? 9.821   20.424  -33.891 1.00 134.40 ? 16   ASP A CA  1 
ATOM   14   C  C   . ASP A  1 19  ? 9.118   21.705  -33.404 1.00 137.02 ? 16   ASP A C   1 
ATOM   15   O  O   . ASP A  1 19  ? 9.758   22.630  -32.895 1.00 136.46 ? 16   ASP A O   1 
ATOM   16   C  CB  . ASP A  1 19  ? 11.312  20.393  -33.514 1.00 136.20 ? 16   ASP A CB  1 
ATOM   17   N  N   . THR A  1 20  ? 7.780   21.745  -33.604 1.00 132.47 ? 17   THR A N   1 
ATOM   18   C  CA  . THR A  1 20  ? 6.861   22.841  -33.265 1.00 131.63 ? 17   THR A CA  1 
ATOM   19   C  C   . THR A  1 20  ? 6.761   23.038  -31.730 1.00 134.10 ? 17   THR A C   1 
ATOM   20   O  O   . THR A  1 20  ? 6.485   24.147  -31.267 1.00 134.18 ? 17   THR A O   1 
ATOM   21   C  CB  . THR A  1 20  ? 5.509   22.601  -33.981 1.00 138.51 ? 17   THR A CB  1 
ATOM   22   O  OG1 . THR A  1 20  ? 5.752   22.434  -35.383 1.00 137.47 ? 17   THR A OG1 1 
ATOM   23   C  CG2 . THR A  1 20  ? 4.495   23.727  -33.766 1.00 136.34 ? 17   THR A CG2 1 
ATOM   24   N  N   . ILE A  1 21  ? 7.014   21.970  -30.959 1.00 129.09 ? 18   ILE A N   1 
ATOM   25   C  CA  . ILE A  1 21  ? 7.021   21.979  -29.498 1.00 128.36 ? 18   ILE A CA  1 
ATOM   26   C  C   . ILE A  1 21  ? 8.159   22.827  -28.909 1.00 130.94 ? 18   ILE A C   1 
ATOM   27   O  O   . ILE A  1 21  ? 7.971   23.390  -27.837 1.00 130.92 ? 18   ILE A O   1 
ATOM   28   C  CB  . ILE A  1 21  ? 7.077   20.536  -28.955 1.00 131.40 ? 18   ILE A CB  1 
ATOM   29   N  N   . ASP A  1 22  ? 9.326   22.916  -29.602 1.00 125.46 ? 19   ASP A N   1 
ATOM   30   C  CA  . ASP A  1 22  ? 10.542  23.632  -29.172 1.00 124.01 ? 19   ASP A CA  1 
ATOM   31   C  C   . ASP A  1 22  ? 10.301  25.041  -28.599 1.00 124.70 ? 19   ASP A C   1 
ATOM   32   O  O   . ASP A  1 22  ? 10.860  25.353  -27.551 1.00 123.96 ? 19   ASP A O   1 
ATOM   33   C  CB  . ASP A  1 22  ? 11.587  23.677  -30.302 1.00 125.89 ? 19   ASP A CB  1 
ATOM   34   C  CG  . ASP A  1 22  ? 12.230  22.339  -30.645 1.00 137.46 ? 19   ASP A CG  1 
ATOM   35   O  OD1 . ASP A  1 22  ? 11.629  21.282  -30.324 1.00 138.34 ? 19   ASP A OD1 1 
ATOM   36   O  OD2 . ASP A  1 22  ? 13.323  22.345  -31.249 1.00 143.55 ? 19   ASP A OD2 1 
ATOM   37   N  N   . ASP A  1 23  ? 9.468   25.873  -29.252 1.00 119.24 ? 20   ASP A N   1 
ATOM   38   C  CA  . ASP A  1 23  ? 9.176   27.218  -28.740 1.00 117.92 ? 20   ASP A CA  1 
ATOM   39   C  C   . ASP A  1 23  ? 8.191   27.181  -27.564 1.00 117.03 ? 20   ASP A C   1 
ATOM   40   O  O   . ASP A  1 23  ? 8.314   27.993  -26.648 1.00 117.01 ? 20   ASP A O   1 
ATOM   41   C  CB  . ASP A  1 23  ? 8.718   28.182  -29.852 1.00 120.35 ? 20   ASP A CB  1 
ATOM   42   C  CG  . ASP A  1 23  ? 7.531   27.690  -30.658 1.00 136.16 ? 20   ASP A CG  1 
ATOM   43   O  OD1 . ASP A  1 23  ? 7.732   26.833  -31.549 1.00 137.42 ? 20   ASP A OD1 1 
ATOM   44   O  OD2 . ASP A  1 23  ? 6.401   28.169  -30.404 1.00 143.62 ? 20   ASP A OD2 1 
ATOM   45   N  N   . PHE A  1 24  ? 7.234   26.230  -27.580 1.00 109.33 ? 21   PHE A N   1 
ATOM   46   C  CA  . PHE A  1 24  ? 6.243   26.033  -26.514 1.00 107.12 ? 21   PHE A CA  1 
ATOM   47   C  C   . PHE A  1 24  ? 6.953   25.577  -25.234 1.00 106.88 ? 21   PHE A C   1 
ATOM   48   O  O   . PHE A  1 24  ? 6.668   26.097  -24.152 1.00 106.16 ? 21   PHE A O   1 
ATOM   49   C  CB  . PHE A  1 24  ? 5.170   25.004  -26.952 1.00 108.54 ? 21   PHE A CB  1 
ATOM   50   C  CG  . PHE A  1 24  ? 4.385   24.350  -25.833 1.00 109.42 ? 21   PHE A CG  1 
ATOM   51   C  CD1 . PHE A  1 24  ? 3.235   24.947  -25.327 1.00 111.99 ? 21   PHE A CD1 1 
ATOM   52   C  CD2 . PHE A  1 24  ? 4.790   23.133  -25.297 1.00 110.89 ? 21   PHE A CD2 1 
ATOM   53   C  CE1 . PHE A  1 24  ? 2.508   24.339  -24.298 1.00 112.72 ? 21   PHE A CE1 1 
ATOM   54   C  CE2 . PHE A  1 24  ? 4.077   22.541  -24.256 1.00 113.66 ? 21   PHE A CE2 1 
ATOM   55   C  CZ  . PHE A  1 24  ? 2.937   23.144  -23.766 1.00 111.78 ? 21   PHE A CZ  1 
ATOM   56   N  N   . ARG A  1 25  ? 7.876   24.604  -25.386 1.00 99.94  ? 22   ARG A N   1 
ATOM   57   C  CA  . ARG A  1 25  ? 8.705   23.980  -24.357 1.00 98.22  ? 22   ARG A CA  1 
ATOM   58   C  C   . ARG A  1 25  ? 9.482   25.059  -23.604 1.00 98.80  ? 22   ARG A C   1 
ATOM   59   O  O   . ARG A  1 25  ? 9.388   25.120  -22.376 1.00 97.66  ? 22   ARG A O   1 
ATOM   60   C  CB  . ARG A  1 25  ? 9.664   22.970  -25.028 1.00 97.59  ? 22   ARG A CB  1 
ATOM   61   C  CG  . ARG A  1 25  ? 10.403  22.027  -24.091 1.00 102.10 ? 22   ARG A CG  1 
ATOM   62   C  CD  . ARG A  1 25  ? 11.387  21.140  -24.826 1.00 103.36 ? 22   ARG A CD  1 
ATOM   63   N  NE  . ARG A  1 25  ? 12.598  21.870  -25.195 1.00 110.79 ? 22   ARG A NE  1 
ATOM   64   C  CZ  . ARG A  1 25  ? 13.815  21.338  -25.216 1.00 129.97 ? 22   ARG A CZ  1 
ATOM   65   N  NH1 . ARG A  1 25  ? 14.860  22.075  -25.567 1.00 113.41 ? 22   ARG A NH1 1 
ATOM   66   N  NH2 . ARG A  1 25  ? 13.997  20.065  -24.885 1.00 125.23 ? 22   ARG A NH2 1 
ATOM   67   N  N   . ASN A  1 26  ? 10.191  25.944  -24.357 1.00 93.12  ? 23   ASN A N   1 
ATOM   68   C  CA  . ASN A  1 26  ? 10.999  27.050  -23.832 1.00 91.56  ? 23   ASN A CA  1 
ATOM   69   C  C   . ASN A  1 26  ? 10.145  28.176  -23.211 1.00 93.41  ? 23   ASN A C   1 
ATOM   70   O  O   . ASN A  1 26  ? 10.636  28.893  -22.343 1.00 93.64  ? 23   ASN A O   1 
ATOM   71   C  CB  . ASN A  1 26  ? 11.920  27.623  -24.921 1.00 89.69  ? 23   ASN A CB  1 
ATOM   72   C  CG  . ASN A  1 26  ? 12.910  26.670  -25.560 1.00 110.62 ? 23   ASN A CG  1 
ATOM   73   O  OD1 . ASN A  1 26  ? 13.149  25.544  -25.102 1.00 105.25 ? 23   ASN A OD1 1 
ATOM   74   N  ND2 . ASN A  1 26  ? 13.510  27.111  -26.657 1.00 100.96 ? 23   ASN A ND2 1 
ATOM   75   N  N   . GLN A  1 27  ? 8.895   28.346  -23.654 1.00 87.75  ? 24   GLN A N   1 
ATOM   76   C  CA  . GLN A  1 27  ? 8.023   29.393  -23.120 1.00 87.41  ? 24   GLN A CA  1 
ATOM   77   C  C   . GLN A  1 27  ? 7.359   28.981  -21.803 1.00 90.56  ? 24   GLN A C   1 
ATOM   78   O  O   . GLN A  1 27  ? 7.385   29.749  -20.842 1.00 90.08  ? 24   GLN A O   1 
ATOM   79   C  CB  . GLN A  1 27  ? 6.969   29.826  -24.153 1.00 88.91  ? 24   GLN A CB  1 
ATOM   80   N  N   . VAL A  1 28  ? 6.749   27.776  -21.772 1.00 86.24  ? 25   VAL A N   1 
ATOM   81   C  CA  . VAL A  1 28  ? 6.045   27.217  -20.609 1.00 84.66  ? 25   VAL A CA  1 
ATOM   82   C  C   . VAL A  1 28  ? 7.056   26.892  -19.498 1.00 84.87  ? 25   VAL A C   1 
ATOM   83   O  O   . VAL A  1 28  ? 6.818   27.279  -18.349 1.00 84.91  ? 25   VAL A O   1 
ATOM   84   C  CB  . VAL A  1 28  ? 5.106   26.028  -20.997 1.00 88.28  ? 25   VAL A CB  1 
ATOM   85   C  CG1 . VAL A  1 28  ? 4.473   25.373  -19.773 1.00 88.09  ? 25   VAL A CG1 1 
ATOM   86   C  CG2 . VAL A  1 28  ? 4.023   26.478  -21.970 1.00 87.75  ? 25   VAL A CG2 1 
ATOM   87   N  N   . TYR A  1 29  ? 8.202   26.252  -19.837 1.00 77.78  ? 26   TYR A N   1 
ATOM   88   C  CA  . TYR A  1 29  ? 9.215   25.943  -18.829 1.00 76.23  ? 26   TYR A CA  1 
ATOM   89   C  C   . TYR A  1 29  ? 9.754   27.194  -18.142 1.00 76.65  ? 26   TYR A C   1 
ATOM   90   O  O   . TYR A  1 29  ? 9.767   27.229  -16.915 1.00 76.66  ? 26   TYR A O   1 
ATOM   91   C  CB  . TYR A  1 29  ? 10.362  25.084  -19.378 1.00 77.56  ? 26   TYR A CB  1 
ATOM   92   C  CG  . TYR A  1 29  ? 10.103  23.591  -19.446 1.00 79.97  ? 26   TYR A CG  1 
ATOM   93   C  CD1 . TYR A  1 29  ? 9.497   22.914  -18.388 1.00 82.24  ? 26   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A  1 29  ? 10.552  22.836  -20.525 1.00 80.70  ? 26   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A  1 29  ? 9.317   21.529  -18.421 1.00 82.50  ? 26   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A  1 29  ? 10.382  21.452  -20.566 1.00 81.29  ? 26   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A  1 29  ? 9.759   20.804  -19.516 1.00 86.70  ? 26   TYR A CZ  1 
ATOM   98   O  OH  . TYR A  1 29  ? 9.575   19.448  -19.591 1.00 85.91  ? 26   TYR A OH  1 
ATOM   99   N  N   . SER A  1 30  ? 10.148  28.228  -18.913 1.00 70.78  ? 27   SER A N   1 
ATOM   100  C  CA  . SER A  1 30  ? 10.674  29.481  -18.358 1.00 69.75  ? 27   SER A CA  1 
ATOM   101  C  C   . SER A  1 30  ? 9.705   30.139  -17.374 1.00 73.35  ? 27   SER A C   1 
ATOM   102  O  O   . SER A  1 30  ? 10.132  30.541  -16.297 1.00 72.76  ? 27   SER A O   1 
ATOM   103  C  CB  . SER A  1 30  ? 11.041  30.459  -19.465 1.00 73.19  ? 27   SER A CB  1 
ATOM   104  O  OG  . SER A  1 30  ? 12.259  30.099  -20.092 1.00 84.84  ? 27   SER A OG  1 
ATOM   105  N  N   . THR A  1 31  ? 8.403   30.213  -17.728 1.00 69.67  ? 28   THR A N   1 
ATOM   106  C  CA  . THR A  1 31  ? 7.357   30.808  -16.893 1.00 68.72  ? 28   THR A CA  1 
ATOM   107  C  C   . THR A  1 31  ? 7.164   30.036  -15.582 1.00 70.73  ? 28   THR A C   1 
ATOM   108  O  O   . THR A  1 31  ? 7.371   30.608  -14.499 1.00 69.38  ? 28   THR A O   1 
ATOM   109  C  CB  . THR A  1 31  ? 6.054   30.955  -17.703 1.00 76.31  ? 28   THR A CB  1 
ATOM   110  O  OG1 . THR A  1 31  ? 6.315   31.786  -18.829 1.00 80.59  ? 28   THR A OG1 1 
ATOM   111  C  CG2 . THR A  1 31  ? 4.908   31.551  -16.892 1.00 74.28  ? 28   THR A CG2 1 
ATOM   112  N  N   . LEU A  1 32  ? 6.785   28.735  -15.693 1.00 65.65  ? 29   LEU A N   1 
ATOM   113  C  CA  . LEU A  1 32  ? 6.491   27.867  -14.556 1.00 64.73  ? 29   LEU A CA  1 
ATOM   114  C  C   . LEU A  1 32  ? 7.676   27.663  -13.609 1.00 67.76  ? 29   LEU A C   1 
ATOM   115  O  O   . LEU A  1 32  ? 7.482   27.807  -12.396 1.00 67.78  ? 29   LEU A O   1 
ATOM   116  C  CB  . LEU A  1 32  ? 5.889   26.530  -14.997 1.00 64.61  ? 29   LEU A CB  1 
ATOM   117  C  CG  . LEU A  1 32  ? 4.574   26.609  -15.786 1.00 68.37  ? 29   LEU A CG  1 
ATOM   118  C  CD1 . LEU A  1 32  ? 4.102   25.231  -16.146 1.00 68.88  ? 29   LEU A CD1 1 
ATOM   119  C  CD2 . LEU A  1 32  ? 3.483   27.340  -15.004 1.00 66.93  ? 29   LEU A CD2 1 
ATOM   120  N  N   . TYR A  1 33  ? 8.893   27.401  -14.136 1.00 62.53  ? 30   TYR A N   1 
ATOM   121  C  CA  . TYR A  1 33  ? 10.048  27.236  -13.252 1.00 61.86  ? 30   TYR A CA  1 
ATOM   122  C  C   . TYR A  1 33  ? 10.365  28.530  -12.511 1.00 67.64  ? 30   TYR A C   1 
ATOM   123  O  O   . TYR A  1 33  ? 10.631  28.470  -11.310 1.00 67.82  ? 30   TYR A O   1 
ATOM   124  C  CB  . TYR A  1 33  ? 11.282  26.637  -13.959 1.00 61.77  ? 30   TYR A CB  1 
ATOM   125  C  CG  . TYR A  1 33  ? 11.176  25.166  -14.347 1.00 61.27  ? 30   TYR A CG  1 
ATOM   126  C  CD1 . TYR A  1 33  ? 10.584  24.237  -13.492 1.00 62.53  ? 30   TYR A CD1 1 
ATOM   127  C  CD2 . TYR A  1 33  ? 11.763  24.688  -15.515 1.00 61.18  ? 30   TYR A CD2 1 
ATOM   128  C  CE1 . TYR A  1 33  ? 10.490  22.889  -13.841 1.00 61.27  ? 30   TYR A CE1 1 
ATOM   129  C  CE2 . TYR A  1 33  ? 11.699  23.341  -15.861 1.00 61.37  ? 30   TYR A CE2 1 
ATOM   130  C  CZ  . TYR A  1 33  ? 11.045  22.448  -15.027 1.00 61.67  ? 30   TYR A CZ  1 
ATOM   131  O  OH  . TYR A  1 33  ? 10.968  21.127  -15.371 1.00 51.55  ? 30   TYR A OH  1 
ATOM   132  N  N   . SER A  1 34  ? 10.238  29.703  -13.191 1.00 65.42  ? 31   SER A N   1 
ATOM   133  C  CA  . SER A  1 34  ? 10.444  31.026  -12.579 1.00 65.32  ? 31   SER A CA  1 
ATOM   134  C  C   . SER A  1 34  ? 9.457   31.240  -11.435 1.00 68.32  ? 31   SER A C   1 
ATOM   135  O  O   . SER A  1 34  ? 9.873   31.619  -10.345 1.00 68.19  ? 31   SER A O   1 
ATOM   136  C  CB  . SER A  1 34  ? 10.310  32.140  -13.610 1.00 69.49  ? 31   SER A CB  1 
ATOM   137  O  OG  . SER A  1 34  ? 11.482  32.254  -14.397 1.00 82.48  ? 31   SER A OG  1 
ATOM   138  N  N   . MET A  1 35  ? 8.171   30.935  -11.663 1.00 64.33  ? 32   MET A N   1 
ATOM   139  C  CA  . MET A  1 35  ? 7.128   31.036  -10.648 1.00 65.27  ? 32   MET A CA  1 
ATOM   140  C  C   . MET A  1 35  ? 7.366   30.107  -9.449  1.00 67.89  ? 32   MET A C   1 
ATOM   141  O  O   . MET A  1 35  ? 7.284   30.577  -8.314  1.00 67.02  ? 32   MET A O   1 
ATOM   142  C  CB  . MET A  1 35  ? 5.776   30.724  -11.252 1.00 68.72  ? 32   MET A CB  1 
ATOM   143  C  CG  . MET A  1 35  ? 5.191   31.855  -12.017 1.00 74.17  ? 32   MET A CG  1 
ATOM   144  S  SD  . MET A  1 35  ? 3.591   31.370  -12.662 1.00 80.54  ? 32   MET A SD  1 
ATOM   145  C  CE  . MET A  1 35  ? 2.719   30.996  -11.118 1.00 77.58  ? 32   MET A CE  1 
ATOM   146  N  N   . ILE A  1 36  ? 7.655   28.789  -9.704  1.00 63.09  ? 33   ILE A N   1 
ATOM   147  C  CA  . ILE A  1 36  ? 7.928   27.774  -8.669  1.00 60.69  ? 33   ILE A CA  1 
ATOM   148  C  C   . ILE A  1 36  ? 9.169   28.187  -7.821  1.00 62.72  ? 33   ILE A C   1 
ATOM   149  O  O   . ILE A  1 36  ? 9.124   28.077  -6.590  1.00 61.92  ? 33   ILE A O   1 
ATOM   150  C  CB  . ILE A  1 36  ? 8.007   26.326  -9.246  1.00 62.52  ? 33   ILE A CB  1 
ATOM   151  C  CG1 . ILE A  1 36  ? 6.697   25.909  -9.936  1.00 61.47  ? 33   ILE A CG1 1 
ATOM   152  C  CG2 . ILE A  1 36  ? 8.383   25.293  -8.171  1.00 62.81  ? 33   ILE A CG2 1 
ATOM   153  C  CD1 . ILE A  1 36  ? 6.867   24.821  -11.051 1.00 52.95  ? 33   ILE A CD1 1 
ATOM   154  N  N   . SER A  1 37  ? 10.235  28.705  -8.467  1.00 57.46  ? 34   SER A N   1 
ATOM   155  C  CA  . SER A  1 37  ? 11.442  29.149  -7.763  1.00 58.02  ? 34   SER A CA  1 
ATOM   156  C  C   . SER A  1 37  ? 11.156  30.295  -6.775  1.00 62.23  ? 34   SER A C   1 
ATOM   157  O  O   . SER A  1 37  ? 11.645  30.241  -5.651  1.00 61.77  ? 34   SER A O   1 
ATOM   158  C  CB  . SER A  1 37  ? 12.511  29.606  -8.750  1.00 64.04  ? 34   SER A CB  1 
ATOM   159  O  OG  . SER A  1 37  ? 12.824  28.584  -9.680  1.00 79.14  ? 34   SER A OG  1 
ATOM   160  N  N   . VAL A  1 38  ? 10.369  31.323  -7.185  1.00 58.07  ? 35   VAL A N   1 
ATOM   161  C  CA  . VAL A  1 38  ? 10.064  32.468  -6.335  1.00 57.09  ? 35   VAL A CA  1 
ATOM   162  C  C   . VAL A  1 38  ? 9.116   32.049  -5.189  1.00 59.44  ? 35   VAL A C   1 
ATOM   163  O  O   . VAL A  1 38  ? 9.480   32.238  -4.033  1.00 59.83  ? 35   VAL A O   1 
ATOM   164  C  CB  . VAL A  1 38  ? 9.597   33.734  -7.120  1.00 61.36  ? 35   VAL A CB  1 
ATOM   165  C  CG1 . VAL A  1 38  ? 9.358   34.915  -6.177  1.00 61.38  ? 35   VAL A CG1 1 
ATOM   166  C  CG2 . VAL A  1 38  ? 10.620  34.130  -8.194  1.00 60.90  ? 35   VAL A CG2 1 
ATOM   167  N  N   . VAL A  1 39  ? 7.960   31.440  -5.490  1.00 55.56  ? 36   VAL A N   1 
ATOM   168  C  CA  . VAL A  1 39  ? 6.974   30.979  -4.493  1.00 55.71  ? 36   VAL A CA  1 
ATOM   169  C  C   . VAL A  1 39  ? 7.571   29.906  -3.526  1.00 64.07  ? 36   VAL A C   1 
ATOM   170  O  O   . VAL A  1 39  ? 7.317   29.961  -2.309  1.00 65.32  ? 36   VAL A O   1 
ATOM   171  C  CB  . VAL A  1 39  ? 5.651   30.510  -5.169  1.00 58.64  ? 36   VAL A CB  1 
ATOM   172  C  CG1 . VAL A  1 39  ? 4.673   29.929  -4.158  1.00 58.41  ? 36   VAL A CG1 1 
ATOM   173  C  CG2 . VAL A  1 39  ? 4.993   31.643  -5.941  1.00 58.38  ? 36   VAL A CG2 1 
ATOM   174  N  N   . GLY A  1 40  ? 8.354   28.969  -4.086  1.00 60.35  ? 37   GLY A N   1 
ATOM   175  C  CA  . GLY A  1 40  ? 9.007   27.888  -3.355  1.00 60.09  ? 37   GLY A CA  1 
ATOM   176  C  C   . GLY A  1 40  ? 10.095  28.351  -2.406  1.00 65.17  ? 37   GLY A C   1 
ATOM   177  O  O   . GLY A  1 40  ? 10.122  27.924  -1.249  1.00 65.09  ? 37   GLY A O   1 
ATOM   178  N  N   . PHE A  1 41  ? 11.007  29.227  -2.887  1.00 62.20  ? 38   PHE A N   1 
ATOM   179  C  CA  . PHE A  1 41  ? 12.091  29.778  -2.080  1.00 62.47  ? 38   PHE A CA  1 
ATOM   180  C  C   . PHE A  1 41  ? 11.564  30.601  -0.898  1.00 66.04  ? 38   PHE A C   1 
ATOM   181  O  O   . PHE A  1 41  ? 11.967  30.313  0.228   1.00 66.20  ? 38   PHE A O   1 
ATOM   182  C  CB  . PHE A  1 41  ? 13.107  30.572  -2.927  1.00 64.91  ? 38   PHE A CB  1 
ATOM   183  C  CG  . PHE A  1 41  ? 14.190  31.247  -2.123  1.00 67.11  ? 38   PHE A CG  1 
ATOM   184  C  CD1 . PHE A  1 41  ? 15.287  30.528  -1.669  1.00 71.11  ? 38   PHE A CD1 1 
ATOM   185  C  CD2 . PHE A  1 41  ? 14.092  32.595  -1.785  1.00 70.24  ? 38   PHE A CD2 1 
ATOM   186  C  CE1 . PHE A  1 41  ? 16.261  31.138  -0.874  1.00 72.67  ? 38   PHE A CE1 1 
ATOM   187  C  CE2 . PHE A  1 41  ? 15.058  33.201  -0.982  1.00 73.80  ? 38   PHE A CE2 1 
ATOM   188  C  CZ  . PHE A  1 41  ? 16.136  32.465  -0.528  1.00 72.00  ? 38   PHE A CZ  1 
ATOM   189  N  N   . PHE A  1 42  ? 10.672  31.598  -1.133  1.00 61.85  ? 39   PHE A N   1 
ATOM   190  C  CA  . PHE A  1 42  ? 10.126  32.429  -0.060  1.00 63.01  ? 39   PHE A CA  1 
ATOM   191  C  C   . PHE A  1 42  ? 9.194   31.687  0.902   1.00 65.00  ? 39   PHE A C   1 
ATOM   192  O  O   . PHE A  1 42  ? 9.265   31.928  2.108   1.00 64.69  ? 39   PHE A O   1 
ATOM   193  C  CB  . PHE A  1 42  ? 9.450   33.695  -0.602  1.00 66.81  ? 39   PHE A CB  1 
ATOM   194  C  CG  . PHE A  1 42  ? 10.431  34.688  -1.169  1.00 70.61  ? 39   PHE A CG  1 
ATOM   195  C  CD1 . PHE A  1 42  ? 11.238  35.447  -0.331  1.00 75.91  ? 39   PHE A CD1 1 
ATOM   196  C  CD2 . PHE A  1 42  ? 10.554  34.860  -2.541  1.00 74.33  ? 39   PHE A CD2 1 
ATOM   197  C  CE1 . PHE A  1 42  ? 12.163  36.357  -0.858  1.00 78.13  ? 39   PHE A CE1 1 
ATOM   198  C  CE2 . PHE A  1 42  ? 11.482  35.761  -3.067  1.00 78.35  ? 39   PHE A CE2 1 
ATOM   199  C  CZ  . PHE A  1 42  ? 12.273  36.513  -2.224  1.00 77.23  ? 39   PHE A CZ  1 
ATOM   200  N  N   . GLY A  1 43  ? 8.362   30.786  0.369   1.00 59.63  ? 40   GLY A N   1 
ATOM   201  C  CA  . GLY A  1 43  ? 7.421   29.989  1.150   1.00 58.21  ? 40   GLY A CA  1 
ATOM   202  C  C   . GLY A  1 43  ? 8.108   29.042  2.108   1.00 61.68  ? 40   GLY A C   1 
ATOM   203  O  O   . GLY A  1 43  ? 7.776   29.014  3.294   1.00 60.21  ? 40   GLY A O   1 
ATOM   204  N  N   . ASN A  1 44  ? 9.083   28.263  1.601   1.00 59.22  ? 41   ASN A N   1 
ATOM   205  C  CA  . ASN A  1 44  ? 9.808   27.287  2.419   1.00 59.58  ? 41   ASN A CA  1 
ATOM   206  C  C   . ASN A  1 44  ? 10.903  27.911  3.228   1.00 65.55  ? 41   ASN A C   1 
ATOM   207  O  O   . ASN A  1 44  ? 11.197  27.396  4.308   1.00 65.44  ? 41   ASN A O   1 
ATOM   208  C  CB  . ASN A  1 44  ? 10.317  26.112  1.605   1.00 58.52  ? 41   ASN A CB  1 
ATOM   209  C  CG  . ASN A  1 44  ? 9.207   25.379  0.943   1.00 61.63  ? 41   ASN A CG  1 
ATOM   210  O  OD1 . ASN A  1 44  ? 8.323   24.817  1.609   1.00 54.34  ? 41   ASN A OD1 1 
ATOM   211  N  ND2 . ASN A  1 44  ? 9.215   25.418  -0.383  1.00 49.56  ? 41   ASN A ND2 1 
ATOM   212  N  N   . GLY A  1 45  ? 11.477  29.014  2.719   1.00 63.02  ? 42   GLY A N   1 
ATOM   213  C  CA  . GLY A  1 45  ? 12.470  29.822  3.425   1.00 62.05  ? 42   GLY A CA  1 
ATOM   214  C  C   . GLY A  1 45  ? 11.854  30.403  4.681   1.00 65.31  ? 42   GLY A C   1 
ATOM   215  O  O   . GLY A  1 45  ? 12.450  30.330  5.753   1.00 64.21  ? 42   GLY A O   1 
ATOM   216  N  N   . PHE A  1 46  ? 10.613  30.903  4.573   1.00 63.74  ? 43   PHE A N   1 
ATOM   217  C  CA  . PHE A  1 46  ? 9.850   31.445  5.699   1.00 64.62  ? 43   PHE A CA  1 
ATOM   218  C  C   . PHE A  1 46  ? 9.510   30.364  6.728   1.00 69.13  ? 43   PHE A C   1 
ATOM   219  O  O   . PHE A  1 46  ? 9.698   30.585  7.925   1.00 68.56  ? 43   PHE A O   1 
ATOM   220  C  CB  . PHE A  1 46  ? 8.580   32.168  5.215   1.00 66.80  ? 43   PHE A CB  1 
ATOM   221  C  CG  . PHE A  1 46  ? 7.716   32.687  6.342   1.00 69.12  ? 43   PHE A CG  1 
ATOM   222  C  CD1 . PHE A  1 46  ? 8.099   33.809  7.075   1.00 72.04  ? 43   PHE A CD1 1 
ATOM   223  C  CD2 . PHE A  1 46  ? 6.533   32.033  6.693   1.00 70.95  ? 43   PHE A CD2 1 
ATOM   224  C  CE1 . PHE A  1 46  ? 7.311   34.278  8.129   1.00 72.85  ? 43   PHE A CE1 1 
ATOM   225  C  CE2 . PHE A  1 46  ? 5.753   32.494  7.752   1.00 73.45  ? 43   PHE A CE2 1 
ATOM   226  C  CZ  . PHE A  1 46  ? 6.136   33.625  8.449   1.00 71.96  ? 43   PHE A CZ  1 
ATOM   227  N  N   . VAL A  1 47  ? 9.010   29.203  6.250   1.00 66.85  ? 44   VAL A N   1 
ATOM   228  C  CA  . VAL A  1 47  ? 8.629   28.040  7.063   1.00 66.07  ? 44   VAL A CA  1 
ATOM   229  C  C   . VAL A  1 47  ? 9.853   27.504  7.825   1.00 72.31  ? 44   VAL A C   1 
ATOM   230  O  O   . VAL A  1 47  ? 9.765   27.215  9.022   1.00 72.57  ? 44   VAL A O   1 
ATOM   231  C  CB  . VAL A  1 47  ? 7.881   26.968  6.215   1.00 67.92  ? 44   VAL A CB  1 
ATOM   232  C  CG1 . VAL A  1 47  ? 7.730   25.658  6.975   1.00 67.03  ? 44   VAL A CG1 1 
ATOM   233  C  CG2 . VAL A  1 47  ? 6.510   27.481  5.764   1.00 67.45  ? 44   VAL A CG2 1 
ATOM   234  N  N   . LEU A  1 48  ? 11.002  27.456  7.147   1.00 70.02  ? 45   LEU A N   1 
ATOM   235  C  CA  . LEU A  1 48  ? 12.254  27.022  7.747   1.00 70.84  ? 45   LEU A CA  1 
ATOM   236  C  C   . LEU A  1 48  ? 12.702  28.003  8.833   1.00 76.62  ? 45   LEU A C   1 
ATOM   237  O  O   . LEU A  1 48  ? 13.074  27.558  9.918   1.00 76.19  ? 45   LEU A O   1 
ATOM   238  C  CB  . LEU A  1 48  ? 13.338  26.851  6.673   1.00 70.88  ? 45   LEU A CB  1 
ATOM   239  C  CG  . LEU A  1 48  ? 14.422  25.817  6.953   1.00 75.70  ? 45   LEU A CG  1 
ATOM   240  C  CD1 . LEU A  1 48  ? 13.864  24.540  7.601   1.00 75.61  ? 45   LEU A CD1 1 
ATOM   241  C  CD2 . LEU A  1 48  ? 15.145  25.471  5.696   1.00 79.09  ? 45   LEU A CD2 1 
ATOM   242  N  N   . TYR A  1 49  ? 12.594  29.334  8.564   1.00 73.68  ? 46   TYR A N   1 
ATOM   243  C  CA  . TYR A  1 49  ? 12.926  30.407  9.496   1.00 73.46  ? 46   TYR A CA  1 
ATOM   244  C  C   . TYR A  1 49  ? 12.097  30.267  10.777  1.00 79.76  ? 46   TYR A C   1 
ATOM   245  O  O   . TYR A  1 49  ? 12.674  30.164  11.858  1.00 79.91  ? 46   TYR A O   1 
ATOM   246  C  CB  . TYR A  1 49  ? 12.735  31.794  8.830   1.00 74.74  ? 46   TYR A CB  1 
ATOM   247  C  CG  . TYR A  1 49  ? 12.839  32.958  9.792   1.00 77.03  ? 46   TYR A CG  1 
ATOM   248  C  CD1 . TYR A  1 49  ? 14.077  33.417  10.229  1.00 79.34  ? 46   TYR A CD1 1 
ATOM   249  C  CD2 . TYR A  1 49  ? 11.699  33.584  10.286  1.00 77.84  ? 46   TYR A CD2 1 
ATOM   250  C  CE1 . TYR A  1 49  ? 14.178  34.451  11.155  1.00 81.22  ? 46   TYR A CE1 1 
ATOM   251  C  CE2 . TYR A  1 49  ? 11.788  34.614  11.219  1.00 79.04  ? 46   TYR A CE2 1 
ATOM   252  C  CZ  . TYR A  1 49  ? 13.032  35.044  11.654  1.00 89.92  ? 46   TYR A CZ  1 
ATOM   253  O  OH  . TYR A  1 49  ? 13.143  36.081  12.554  1.00 95.19  ? 46   TYR A OH  1 
ATOM   254  N  N   . VAL A  1 50  ? 10.754  30.216  10.643  1.00 78.18  ? 47   VAL A N   1 
ATOM   255  C  CA  . VAL A  1 50  ? 9.787   30.069  11.742  1.00 78.64  ? 47   VAL A CA  1 
ATOM   256  C  C   . VAL A  1 50  ? 10.037  28.786  12.576  1.00 84.32  ? 47   VAL A C   1 
ATOM   257  O  O   . VAL A  1 50  ? 9.943   28.844  13.802  1.00 82.34  ? 47   VAL A O   1 
ATOM   258  C  CB  . VAL A  1 50  ? 8.327   30.187  11.215  1.00 82.47  ? 47   VAL A CB  1 
ATOM   259  C  CG1 . VAL A  1 50  ? 7.298   29.761  12.256  1.00 82.34  ? 47   VAL A CG1 1 
ATOM   260  C  CG2 . VAL A  1 50  ? 8.041   31.605  10.745  1.00 82.29  ? 47   VAL A CG2 1 
ATOM   261  N  N   . LEU A  1 51  ? 10.383  27.654  11.920  1.00 84.64  ? 48   LEU A N   1 
ATOM   262  C  CA  . LEU A  1 51  ? 10.654  26.370  12.599  1.00 85.55  ? 48   LEU A CA  1 
ATOM   263  C  C   . LEU A  1 51  ? 12.013  26.304  13.314  1.00 91.63  ? 48   LEU A C   1 
ATOM   264  O  O   . LEU A  1 51  ? 12.118  25.661  14.361  1.00 91.07  ? 48   LEU A O   1 
ATOM   265  C  CB  . LEU A  1 51  ? 10.498  25.176  11.646  1.00 85.41  ? 48   LEU A CB  1 
ATOM   266  C  CG  . LEU A  1 51  ? 9.081   24.748  11.293  1.00 89.69  ? 48   LEU A CG  1 
ATOM   267  C  CD1 . LEU A  1 51  ? 9.078   23.971  10.013  1.00 89.85  ? 48   LEU A CD1 1 
ATOM   268  C  CD2 . LEU A  1 51  ? 8.465   23.927  12.393  1.00 91.54  ? 48   LEU A CD2 1 
ATOM   269  N  N   . ILE A  1 52  ? 13.050  26.939  12.740  1.00 90.19  ? 49   ILE A N   1 
ATOM   270  C  CA  . ILE A  1 52  ? 14.396  26.984  13.316  1.00 91.29  ? 49   ILE A CA  1 
ATOM   271  C  C   . ILE A  1 52  ? 14.387  27.836  14.594  1.00 100.62 ? 49   ILE A C   1 
ATOM   272  O  O   . ILE A  1 52  ? 14.927  27.404  15.611  1.00 101.30 ? 49   ILE A O   1 
ATOM   273  C  CB  . ILE A  1 52  ? 15.441  27.446  12.248  1.00 94.00  ? 49   ILE A CB  1 
ATOM   274  C  CG1 . ILE A  1 52  ? 15.846  26.294  11.292  1.00 94.39  ? 49   ILE A CG1 1 
ATOM   275  C  CG2 . ILE A  1 52  ? 16.671  28.143  12.833  1.00 94.15  ? 49   ILE A CG2 1 
ATOM   276  C  CD1 . ILE A  1 52  ? 16.414  24.939  11.928  1.00 104.20 ? 49   ILE A CD1 1 
ATOM   277  N  N   . LYS A  1 53  ? 13.719  29.009  14.550  1.00 100.30 ? 50   LYS A N   1 
ATOM   278  C  CA  . LYS A  1 53  ? 13.612  29.957  15.662  1.00 101.33 ? 50   LYS A CA  1 
ATOM   279  C  C   . LYS A  1 53  ? 12.485  29.607  16.672  1.00 108.11 ? 50   LYS A C   1 
ATOM   280  O  O   . LYS A  1 53  ? 11.973  30.503  17.355  1.00 108.22 ? 50   LYS A O   1 
ATOM   281  C  CB  . LYS A  1 53  ? 13.479  31.399  15.117  1.00 104.15 ? 50   LYS A CB  1 
ATOM   282  N  N   . THR A  1 54  ? 12.157  28.301  16.818  1.00 106.65 ? 51   THR A N   1 
ATOM   283  C  CA  . THR A  1 54  ? 11.123  27.819  17.747  1.00 107.75 ? 51   THR A CA  1 
ATOM   284  C  C   . THR A  1 54  ? 11.673  27.720  19.189  1.00 114.63 ? 51   THR A C   1 
ATOM   285  O  O   . THR A  1 54  ? 12.825  27.302  19.396  1.00 114.09 ? 51   THR A O   1 
ATOM   286  C  CB  . THR A  1 54  ? 10.453  26.508  17.228  1.00 114.51 ? 51   THR A CB  1 
ATOM   287  O  OG1 . THR A  1 54  ? 9.134   26.378  17.765  1.00 112.35 ? 51   THR A OG1 1 
ATOM   288  C  CG2 . THR A  1 54  ? 11.271  25.241  17.505  1.00 112.42 ? 51   THR A CG2 1 
ATOM   289  N  N   . TYR A  1 55  ? 10.838  28.127  20.176  1.00 112.82 ? 52   TYR A N   1 
ATOM   290  C  CA  . TYR A  1 55  ? 11.171  28.089  21.605  1.00 113.14 ? 52   TYR A CA  1 
ATOM   291  C  C   . TYR A  1 55  ? 10.627  26.807  22.233  1.00 115.20 ? 52   TYR A C   1 
ATOM   292  O  O   . TYR A  1 55  ? 11.390  26.066  22.861  1.00 114.91 ? 52   TYR A O   1 
ATOM   293  C  CB  . TYR A  1 55  ? 10.648  29.339  22.349  1.00 115.27 ? 52   TYR A CB  1 
ATOM   294  C  CG  . TYR A  1 55  ? 11.122  30.653  21.766  1.00 118.02 ? 52   TYR A CG  1 
ATOM   295  C  CD1 . TYR A  1 55  ? 12.450  31.054  21.884  1.00 120.17 ? 52   TYR A CD1 1 
ATOM   296  C  CD2 . TYR A  1 55  ? 10.235  31.513  21.124  1.00 119.08 ? 52   TYR A CD2 1 
ATOM   297  C  CE1 . TYR A  1 55  ? 12.892  32.262  21.345  1.00 121.40 ? 52   TYR A CE1 1 
ATOM   298  C  CE2 . TYR A  1 55  ? 10.663  32.727  20.590  1.00 120.13 ? 52   TYR A CE2 1 
ATOM   299  C  CZ  . TYR A  1 55  ? 11.993  33.097  20.702  1.00 127.91 ? 52   TYR A CZ  1 
ATOM   300  O  OH  . TYR A  1 55  ? 12.415  34.295  20.178  1.00 129.39 ? 52   TYR A OH  1 
ATOM   301  N  N   . HIS A  1 56  ? 9.316   26.534  22.033  1.00 110.07 ? 53   HIS A N   1 
ATOM   302  C  CA  . HIS A  1 56  ? 8.647   25.327  22.520  1.00 109.25 ? 53   HIS A CA  1 
ATOM   303  C  C   . HIS A  1 56  ? 9.162   24.067  21.779  1.00 111.85 ? 53   HIS A C   1 
ATOM   304  O  O   . HIS A  1 56  ? 9.663   24.170  20.651  1.00 111.89 ? 53   HIS A O   1 
ATOM   305  C  CB  . HIS A  1 56  ? 7.122   25.465  22.402  1.00 109.90 ? 53   HIS A CB  1 
ATOM   306  N  N   . LYS A  1 57  ? 9.058   22.889  22.439  1.00 106.22 ? 54   LYS A N   1 
ATOM   307  C  CA  . LYS A  1 57  ? 9.517   21.579  21.953  1.00 104.23 ? 54   LYS A CA  1 
ATOM   308  C  C   . LYS A  1 57  ? 9.011   21.228  20.555  1.00 104.80 ? 54   LYS A C   1 
ATOM   309  O  O   . LYS A  1 57  ? 7.841   21.468  20.224  1.00 104.77 ? 54   LYS A O   1 
ATOM   310  C  CB  . LYS A  1 57  ? 9.155   20.458  22.944  1.00 105.73 ? 54   LYS A CB  1 
ATOM   311  C  CG  . LYS A  1 57  ? 10.040  19.224  22.822  1.00 107.52 ? 54   LYS A CG  1 
ATOM   312  C  CD  . LYS A  1 57  ? 9.331   17.981  23.294  1.00 110.05 ? 54   LYS A CD  1 
ATOM   313  C  CE  . LYS A  1 57  ? 10.318  16.890  23.590  1.00 119.35 ? 54   LYS A CE  1 
ATOM   314  N  NZ  . LYS A  1 57  ? 9.670   15.725  24.247  1.00 131.92 ? 54   LYS A NZ  1 
ATOM   315  N  N   . LYS A  1 58  ? 9.927   20.658  19.747  1.00 97.57  ? 55   LYS A N   1 
ATOM   316  C  CA  . LYS A  1 58  ? 9.724   20.206  18.375  1.00 95.22  ? 55   LYS A CA  1 
ATOM   317  C  C   . LYS A  1 58  ? 8.857   18.948  18.344  1.00 94.24  ? 55   LYS A C   1 
ATOM   318  O  O   . LYS A  1 58  ? 9.114   18.019  19.103  1.00 94.20  ? 55   LYS A O   1 
ATOM   319  C  CB  . LYS A  1 58  ? 11.087  19.954  17.707  1.00 97.30  ? 55   LYS A CB  1 
ATOM   320  C  CG  . LYS A  1 58  ? 11.513  21.060  16.743  1.00 109.21 ? 55   LYS A CG  1 
ATOM   321  C  CD  . LYS A  1 58  ? 12.774  21.786  17.204  1.00 121.38 ? 55   LYS A CD  1 
ATOM   322  C  CE  . LYS A  1 58  ? 14.060  21.101  16.791  1.00 134.96 ? 55   LYS A CE  1 
ATOM   323  N  NZ  . LYS A  1 58  ? 15.260  21.806  17.318  1.00 143.01 ? 55   LYS A NZ  1 
ATOM   324  N  N   . SER A  1 59  ? 7.823   18.934  17.486  1.00 86.55  ? 56   SER A N   1 
ATOM   325  C  CA  . SER A  1 59  ? 6.899   17.809  17.293  1.00 84.23  ? 56   SER A CA  1 
ATOM   326  C  C   . SER A  1 59  ? 7.436   16.884  16.205  1.00 83.94  ? 56   SER A C   1 
ATOM   327  O  O   . SER A  1 59  ? 8.373   17.268  15.502  1.00 83.42  ? 56   SER A O   1 
ATOM   328  C  CB  . SER A  1 59  ? 5.541   18.335  16.840  1.00 87.90  ? 56   SER A CB  1 
ATOM   329  O  OG  . SER A  1 59  ? 4.971   19.226  17.783  1.00 101.34 ? 56   SER A OG  1 
ATOM   330  N  N   . ALA A  1 60  ? 6.822   15.682  16.027  1.00 77.44  ? 57   ALA A N   1 
ATOM   331  C  CA  . ALA A  1 60  ? 7.193   14.751  14.946  1.00 75.37  ? 57   ALA A CA  1 
ATOM   332  C  C   . ALA A  1 60  ? 6.837   15.418  13.609  1.00 74.94  ? 57   ALA A C   1 
ATOM   333  O  O   . ALA A  1 60  ? 7.631   15.364  12.667  1.00 74.99  ? 57   ALA A O   1 
ATOM   334  C  CB  . ALA A  1 60  ? 6.452   13.428  15.090  1.00 76.05  ? 57   ALA A CB  1 
ATOM   335  N  N   . PHE A  1 61  ? 5.680   16.128  13.570  1.00 67.56  ? 58   PHE A N   1 
ATOM   336  C  CA  . PHE A  1 61  ? 5.206   16.877  12.405  1.00 66.28  ? 58   PHE A CA  1 
ATOM   337  C  C   . PHE A  1 61  ? 6.215   17.951  12.005  1.00 71.60  ? 58   PHE A C   1 
ATOM   338  O  O   . PHE A  1 61  ? 6.450   18.135  10.811  1.00 72.93  ? 58   PHE A O   1 
ATOM   339  C  CB  . PHE A  1 61  ? 3.802   17.474  12.651  1.00 67.44  ? 58   PHE A CB  1 
ATOM   340  C  CG  . PHE A  1 61  ? 3.359   18.522  11.657  1.00 68.68  ? 58   PHE A CG  1 
ATOM   341  C  CD1 . PHE A  1 61  ? 2.790   18.156  10.444  1.00 71.93  ? 58   PHE A CD1 1 
ATOM   342  C  CD2 . PHE A  1 61  ? 3.532   19.877  11.925  1.00 70.31  ? 58   PHE A CD2 1 
ATOM   343  C  CE1 . PHE A  1 61  ? 2.415   19.126  9.513   1.00 72.62  ? 58   PHE A CE1 1 
ATOM   344  C  CE2 . PHE A  1 61  ? 3.165   20.844  10.992  1.00 72.90  ? 58   PHE A CE2 1 
ATOM   345  C  CZ  . PHE A  1 61  ? 2.600   20.465  9.798   1.00 71.15  ? 58   PHE A CZ  1 
ATOM   346  N  N   . GLN A  1 62  ? 6.810   18.648  12.994  1.00 66.87  ? 59   GLN A N   1 
ATOM   347  C  CA  . GLN A  1 62  ? 7.814   19.697  12.772  1.00 65.90  ? 59   GLN A CA  1 
ATOM   348  C  C   . GLN A  1 62  ? 9.113   19.133  12.182  1.00 66.64  ? 59   GLN A C   1 
ATOM   349  O  O   . GLN A  1 62  ? 9.707   19.779  11.318  1.00 64.79  ? 59   GLN A O   1 
ATOM   350  C  CB  . GLN A  1 62  ? 8.073   20.489  14.058  1.00 67.56  ? 59   GLN A CB  1 
ATOM   351  C  CG  . GLN A  1 62  ? 6.827   21.249  14.512  1.00 80.27  ? 59   GLN A CG  1 
ATOM   352  C  CD  . GLN A  1 62  ? 7.035   22.158  15.688  1.00 97.58  ? 59   GLN A CD  1 
ATOM   353  O  OE1 . GLN A  1 62  ? 8.028   22.084  16.415  1.00 89.85  ? 59   GLN A OE1 1 
ATOM   354  N  NE2 . GLN A  1 62  ? 6.074   23.036  15.903  1.00 95.52  ? 59   GLN A NE2 1 
ATOM   355  N  N   . VAL A  1 63  ? 9.522   17.907  12.616  1.00 62.54  ? 60   VAL A N   1 
ATOM   356  C  CA  . VAL A  1 63  ? 10.717  17.189  12.119  1.00 61.23  ? 60   VAL A CA  1 
ATOM   357  C  C   . VAL A  1 63  ? 10.507  16.940  10.615  1.00 65.25  ? 60   VAL A C   1 
ATOM   358  O  O   . VAL A  1 63  ? 11.355  17.337  9.805   1.00 65.85  ? 60   VAL A O   1 
ATOM   359  C  CB  . VAL A  1 63  ? 11.005  15.875  12.902  1.00 64.15  ? 60   VAL A CB  1 
ATOM   360  C  CG1 . VAL A  1 63  ? 12.123  15.066  12.246  1.00 63.79  ? 60   VAL A CG1 1 
ATOM   361  C  CG2 . VAL A  1 63  ? 11.341  16.161  14.360  1.00 63.88  ? 60   VAL A CG2 1 
ATOM   362  N  N   . TYR A  1 64  ? 9.334   16.356  10.251  1.00 59.17  ? 61   TYR A N   1 
ATOM   363  C  CA  . TYR A  1 64  ? 8.950   16.108  8.876   1.00 58.22  ? 61   TYR A CA  1 
ATOM   364  C  C   . TYR A  1 64  ? 8.851   17.416  8.094   1.00 65.46  ? 61   TYR A C   1 
ATOM   365  O  O   . TYR A  1 64  ? 9.310   17.470  6.955   1.00 66.56  ? 61   TYR A O   1 
ATOM   366  C  CB  . TYR A  1 64  ? 7.635   15.330  8.811   1.00 58.07  ? 61   TYR A CB  1 
ATOM   367  C  CG  . TYR A  1 64  ? 7.729   13.919  9.339   1.00 56.19  ? 61   TYR A CG  1 
ATOM   368  C  CD1 . TYR A  1 64  ? 8.657   13.021  8.819   1.00 57.22  ? 61   TYR A CD1 1 
ATOM   369  C  CD2 . TYR A  1 64  ? 6.838   13.453  10.299  1.00 55.65  ? 61   TYR A CD2 1 
ATOM   370  C  CE1 . TYR A  1 64  ? 8.745   11.716  9.295   1.00 55.59  ? 61   TYR A CE1 1 
ATOM   371  C  CE2 . TYR A  1 64  ? 6.902   12.143  10.767  1.00 56.01  ? 61   TYR A CE2 1 
ATOM   372  C  CZ  . TYR A  1 64  ? 7.858   11.278  10.258  1.00 61.88  ? 61   TYR A CZ  1 
ATOM   373  O  OH  . TYR A  1 64  ? 7.938   9.985   10.706  1.00 65.43  ? 61   TYR A OH  1 
ATOM   374  N  N   . MET A  1 65  ? 8.307   18.482  8.718   1.00 63.18  ? 62   MET A N   1 
ATOM   375  C  CA  . MET A  1 65  ? 8.206   19.820  8.117   1.00 62.74  ? 62   MET A CA  1 
ATOM   376  C  C   . MET A  1 65  ? 9.582   20.420  7.764   1.00 62.10  ? 62   MET A C   1 
ATOM   377  O  O   . MET A  1 65  ? 9.725   20.908  6.647   1.00 61.83  ? 62   MET A O   1 
ATOM   378  C  CB  . MET A  1 65  ? 7.423   20.798  9.014   1.00 65.98  ? 62   MET A CB  1 
ATOM   379  C  CG  . MET A  1 65  ? 5.956   20.993  8.660   1.00 71.08  ? 62   MET A CG  1 
ATOM   380  S  SD  . MET A  1 65  ? 5.424   20.860  6.928   1.00 77.10  ? 62   MET A SD  1 
ATOM   381  C  CE  . MET A  1 65  ? 6.383   22.176  6.130   1.00 73.55  ? 62   MET A CE  1 
ATOM   382  N  N   . ILE A  1 66  ? 10.577  20.386  8.694   1.00 56.12  ? 63   ILE A N   1 
ATOM   383  C  CA  . ILE A  1 66  ? 11.941  20.921  8.470   1.00 55.81  ? 63   ILE A CA  1 
ATOM   384  C  C   . ILE A  1 66  ? 12.595  20.188  7.283   1.00 58.14  ? 63   ILE A C   1 
ATOM   385  O  O   . ILE A  1 66  ? 13.203  20.825  6.415   1.00 56.72  ? 63   ILE A O   1 
ATOM   386  C  CB  . ILE A  1 66  ? 12.839  20.833  9.754   1.00 59.28  ? 63   ILE A CB  1 
ATOM   387  C  CG1 . ILE A  1 66  ? 12.277  21.665  10.914  1.00 59.82  ? 63   ILE A CG1 1 
ATOM   388  C  CG2 . ILE A  1 66  ? 14.300  21.244  9.480   1.00 59.56  ? 63   ILE A CG2 1 
ATOM   389  C  CD1 . ILE A  1 66  ? 12.618  21.101  12.294  1.00 68.20  ? 63   ILE A CD1 1 
ATOM   390  N  N   . ASN A  1 67  ? 12.444  18.843  7.254   1.00 53.41  ? 64   ASN A N   1 
ATOM   391  C  CA  . ASN A  1 67  ? 12.988  17.977  6.216   1.00 51.94  ? 64   ASN A CA  1 
ATOM   392  C  C   . ASN A  1 67  ? 12.385  18.221  4.839   1.00 54.26  ? 64   ASN A C   1 
ATOM   393  O  O   . ASN A  1 67  ? 13.132  18.207  3.859   1.00 53.64  ? 64   ASN A O   1 
ATOM   394  C  CB  . ASN A  1 67  ? 12.881  16.542  6.633   1.00 48.03  ? 64   ASN A CB  1 
ATOM   395  C  CG  . ASN A  1 67  ? 14.009  16.232  7.551   1.00 66.72  ? 64   ASN A CG  1 
ATOM   396  O  OD1 . ASN A  1 67  ? 15.093  15.858  7.107   1.00 67.98  ? 64   ASN A OD1 1 
ATOM   397  N  ND2 . ASN A  1 67  ? 13.806  16.442  8.845   1.00 53.28  ? 64   ASN A ND2 1 
ATOM   398  N  N   . LEU A  1 68  ? 11.051  18.471  4.769   1.00 49.03  ? 65   LEU A N   1 
ATOM   399  C  CA  . LEU A  1 68  ? 10.335  18.822  3.542   1.00 48.68  ? 65   LEU A CA  1 
ATOM   400  C  C   . LEU A  1 68  ? 10.842  20.174  3.035   1.00 53.91  ? 65   LEU A C   1 
ATOM   401  O  O   . LEU A  1 68  ? 11.166  20.292  1.854   1.00 55.37  ? 65   LEU A O   1 
ATOM   402  C  CB  . LEU A  1 68  ? 8.816   18.904  3.784   1.00 48.59  ? 65   LEU A CB  1 
ATOM   403  C  CG  . LEU A  1 68  ? 8.059   17.607  3.747   1.00 53.15  ? 65   LEU A CG  1 
ATOM   404  C  CD1 . LEU A  1 68  ? 6.720   17.763  4.381   1.00 52.69  ? 65   LEU A CD1 1 
ATOM   405  C  CD2 . LEU A  1 68  ? 7.919   17.092  2.331   1.00 57.15  ? 65   LEU A CD2 1 
ATOM   406  N  N   . ALA A  1 69  ? 10.932  21.170  3.945   1.00 49.21  ? 66   ALA A N   1 
ATOM   407  C  CA  . ALA A  1 69  ? 11.435  22.500  3.662   1.00 50.34  ? 66   ALA A CA  1 
ATOM   408  C  C   . ALA A  1 69  ? 12.842  22.453  3.005   1.00 56.58  ? 66   ALA A C   1 
ATOM   409  O  O   . ALA A  1 69  ? 13.015  23.047  1.937   1.00 56.76  ? 66   ALA A O   1 
ATOM   410  C  CB  . ALA A  1 69  ? 11.471  23.324  4.944   1.00 51.38  ? 66   ALA A CB  1 
ATOM   411  N  N   . VAL A  1 70  ? 13.808  21.690  3.608   1.00 52.67  ? 67   VAL A N   1 
ATOM   412  C  CA  . VAL A  1 70  ? 15.195  21.511  3.145   1.00 51.61  ? 67   VAL A CA  1 
ATOM   413  C  C   . VAL A  1 70  ? 15.242  20.806  1.779   1.00 57.58  ? 67   VAL A C   1 
ATOM   414  O  O   . VAL A  1 70  ? 15.995  21.243  0.905   1.00 57.52  ? 67   VAL A O   1 
ATOM   415  C  CB  . VAL A  1 70  ? 16.068  20.810  4.213   1.00 54.44  ? 67   VAL A CB  1 
ATOM   416  C  CG1 . VAL A  1 70  ? 17.453  20.483  3.681   1.00 54.00  ? 67   VAL A CG1 1 
ATOM   417  C  CG2 . VAL A  1 70  ? 16.181  21.664  5.463   1.00 54.53  ? 67   VAL A CG2 1 
ATOM   418  N  N   . ALA A  1 71  ? 14.417  19.747  1.589   1.00 55.00  ? 68   ALA A N   1 
ATOM   419  C  CA  . ALA A  1 71  ? 14.326  19.007  0.327   1.00 55.67  ? 68   ALA A CA  1 
ATOM   420  C  C   . ALA A  1 71  ? 13.762  19.901  -0.782  1.00 61.33  ? 68   ALA A C   1 
ATOM   421  O  O   . ALA A  1 71  ? 14.205  19.802  -1.931  1.00 63.18  ? 68   ALA A O   1 
ATOM   422  C  CB  . ALA A  1 71  ? 13.477  17.751  0.492   1.00 56.24  ? 68   ALA A CB  1 
ATOM   423  N  N   . ASP A  1 72  ? 12.827  20.802  -0.427  1.00 56.53  ? 69   ASP A N   1 
ATOM   424  C  CA  . ASP A  1 72  ? 12.245  21.783  -1.341  1.00 55.81  ? 69   ASP A CA  1 
ATOM   425  C  C   . ASP A  1 72  ? 13.264  22.863  -1.714  1.00 60.82  ? 69   ASP A C   1 
ATOM   426  O  O   . ASP A  1 72  ? 13.355  23.186  -2.901  1.00 61.61  ? 69   ASP A O   1 
ATOM   427  C  CB  . ASP A  1 72  ? 11.007  22.440  -0.724  1.00 56.49  ? 69   ASP A CB  1 
ATOM   428  C  CG  . ASP A  1 72  ? 9.785   21.552  -0.586  1.00 54.18  ? 69   ASP A CG  1 
ATOM   429  O  OD1 . ASP A  1 72  ? 9.819   20.421  -1.069  1.00 51.73  ? 69   ASP A OD1 1 
ATOM   430  O  OD2 . ASP A  1 72  ? 8.797   22.001  0.008   1.00 58.20  ? 69   ASP A OD2 1 
ATOM   431  N  N   . LEU A  1 73  ? 14.041  23.416  -0.727  1.00 57.20  ? 70   LEU A N   1 
ATOM   432  C  CA  . LEU A  1 73  ? 15.052  24.480  -0.976  1.00 57.46  ? 70   LEU A CA  1 
ATOM   433  C  C   . LEU A  1 73  ? 16.227  24.001  -1.827  1.00 65.96  ? 70   LEU A C   1 
ATOM   434  O  O   . LEU A  1 73  ? 16.661  24.730  -2.720  1.00 65.85  ? 70   LEU A O   1 
ATOM   435  C  CB  . LEU A  1 73  ? 15.546  25.193  0.293   1.00 56.40  ? 70   LEU A CB  1 
ATOM   436  C  CG  . LEU A  1 73  ? 14.482  25.991  1.058   1.00 59.74  ? 70   LEU A CG  1 
ATOM   437  C  CD1 . LEU A  1 73  ? 15.084  26.723  2.232   1.00 59.61  ? 70   LEU A CD1 1 
ATOM   438  C  CD2 . LEU A  1 73  ? 13.736  26.954  0.153   1.00 60.69  ? 70   LEU A CD2 1 
ATOM   439  N  N   . LEU A  1 74  ? 16.695  22.761  -1.585  1.00 65.43  ? 71   LEU A N   1 
ATOM   440  C  CA  . LEU A  1 74  ? 17.723  22.050  -2.350  1.00 66.22  ? 71   LEU A CA  1 
ATOM   441  C  C   . LEU A  1 74  ? 17.371  22.065  -3.872  1.00 70.61  ? 71   LEU A C   1 
ATOM   442  O  O   . LEU A  1 74  ? 18.245  22.281  -4.706  1.00 72.03  ? 71   LEU A O   1 
ATOM   443  C  CB  . LEU A  1 74  ? 17.811  20.590  -1.805  1.00 66.66  ? 71   LEU A CB  1 
ATOM   444  C  CG  . LEU A  1 74  ? 18.129  19.417  -2.780  1.00 72.40  ? 71   LEU A CG  1 
ATOM   445  C  CD1 . LEU A  1 74  ? 19.593  19.410  -3.174  1.00 73.10  ? 71   LEU A CD1 1 
ATOM   446  C  CD2 . LEU A  1 74  ? 17.773  18.053  -2.165  1.00 74.91  ? 71   LEU A CD2 1 
ATOM   447  N  N   . CYS A  1 75  ? 16.101  21.851  -4.207  1.00 65.51  ? 72   CYS A N   1 
ATOM   448  C  CA  . CYS A  1 75  ? 15.612  21.797  -5.571  1.00 65.29  ? 72   CYS A CA  1 
ATOM   449  C  C   . CYS A  1 75  ? 15.301  23.192  -6.149  1.00 71.21  ? 72   CYS A C   1 
ATOM   450  O  O   . CYS A  1 75  ? 15.612  23.408  -7.324  1.00 70.33  ? 72   CYS A O   1 
ATOM   451  C  CB  . CYS A  1 75  ? 14.413  20.858  -5.658  1.00 65.29  ? 72   CYS A CB  1 
ATOM   452  S  SG  . CYS A  1 75  ? 13.476  20.958  -7.206  1.00 69.05  ? 72   CYS A SG  1 
ATOM   453  N  N   . VAL A  1 76  ? 14.692  24.139  -5.350  1.00 68.97  ? 73   VAL A N   1 
ATOM   454  C  CA  . VAL A  1 76  ? 14.385  25.502  -5.847  1.00 69.06  ? 73   VAL A CA  1 
ATOM   455  C  C   . VAL A  1 76  ? 15.665  26.281  -6.189  1.00 74.18  ? 73   VAL A C   1 
ATOM   456  O  O   . VAL A  1 76  ? 15.602  27.191  -7.006  1.00 74.40  ? 73   VAL A O   1 
ATOM   457  C  CB  . VAL A  1 76  ? 13.407  26.371  -5.006  1.00 72.51  ? 73   VAL A CB  1 
ATOM   458  C  CG1 . VAL A  1 76  ? 12.083  25.657  -4.786  1.00 72.45  ? 73   VAL A CG1 1 
ATOM   459  C  CG2 . VAL A  1 76  ? 14.020  26.837  -3.692  1.00 72.33  ? 73   VAL A CG2 1 
ATOM   460  N  N   . CYS A  1 77  ? 16.811  25.930  -5.576  1.00 70.57  ? 74   CYS A N   1 
ATOM   461  C  CA  . CYS A  1 77  ? 18.087  26.568  -5.858  1.00 70.20  ? 74   CYS A CA  1 
ATOM   462  C  C   . CYS A  1 77  ? 18.717  26.085  -7.165  1.00 70.39  ? 74   CYS A C   1 
ATOM   463  O  O   . CYS A  1 77  ? 19.621  26.746  -7.671  1.00 68.62  ? 74   CYS A O   1 
ATOM   464  C  CB  . CYS A  1 77  ? 19.022  26.423  -4.670  1.00 71.82  ? 74   CYS A CB  1 
ATOM   465  S  SG  . CYS A  1 77  ? 18.485  27.385  -3.227  1.00 76.93  ? 74   CYS A SG  1 
ATOM   466  N  N   . THR A  1 78  ? 18.195  24.977  -7.749  1.00 65.39  ? 75   THR A N   1 
ATOM   467  C  CA  . THR A  1 78  ? 18.654  24.433  -9.032  1.00 64.30  ? 75   THR A CA  1 
ATOM   468  C  C   . THR A  1 78  ? 17.727  24.861  -10.186 1.00 67.62  ? 75   THR A C   1 
ATOM   469  O  O   . THR A  1 78  ? 18.204  25.016  -11.308 1.00 67.46  ? 75   THR A O   1 
ATOM   470  C  CB  . THR A  1 78  ? 18.895  22.911  -8.985  1.00 61.95  ? 75   THR A CB  1 
ATOM   471  O  OG1 . THR A  1 78  ? 17.682  22.242  -8.634  1.00 58.33  ? 75   THR A OG1 1 
ATOM   472  C  CG2 . THR A  1 78  ? 20.024  22.526  -8.044  1.00 58.49  ? 75   THR A CG2 1 
ATOM   473  N  N   . LEU A  1 79  ? 16.424  25.082  -9.907  1.00 63.21  ? 76   LEU A N   1 
ATOM   474  C  CA  . LEU A  1 79  ? 15.426  25.514  -10.907 1.00 62.09  ? 76   LEU A CA  1 
ATOM   475  C  C   . LEU A  1 79  ? 15.835  26.780  -11.677 1.00 64.84  ? 76   LEU A C   1 
ATOM   476  O  O   . LEU A  1 79  ? 15.608  26.764  -12.889 1.00 62.48  ? 76   LEU A O   1 
ATOM   477  C  CB  . LEU A  1 79  ? 14.002  25.661  -10.340 1.00 61.54  ? 76   LEU A CB  1 
ATOM   478  C  CG  . LEU A  1 79  ? 13.284  24.402  -9.851  1.00 65.50  ? 76   LEU A CG  1 
ATOM   479  C  CD1 . LEU A  1 79  ? 11.916  24.761  -9.348  1.00 65.34  ? 76   LEU A CD1 1 
ATOM   480  C  CD2 . LEU A  1 79  ? 13.160  23.334  -10.946 1.00 65.63  ? 76   LEU A CD2 1 
ATOM   481  N  N   . PRO A  1 80  ? 16.489  27.838  -11.071 1.00 63.37  ? 77   PRO A N   1 
ATOM   482  C  CA  . PRO A  1 80  ? 16.942  28.992  -11.880 1.00 63.18  ? 77   PRO A CA  1 
ATOM   483  C  C   . PRO A  1 80  ? 17.897  28.617  -13.027 1.00 66.81  ? 77   PRO A C   1 
ATOM   484  O  O   . PRO A  1 80  ? 17.877  29.308  -14.041 1.00 66.69  ? 77   PRO A O   1 
ATOM   485  C  CB  . PRO A  1 80  ? 17.616  29.903  -10.850 1.00 64.81  ? 77   PRO A CB  1 
ATOM   486  C  CG  . PRO A  1 80  ? 16.997  29.551  -9.565  1.00 69.08  ? 77   PRO A CG  1 
ATOM   487  C  CD  . PRO A  1 80  ? 16.846  28.059  -9.652  1.00 65.04  ? 77   PRO A CD  1 
ATOM   488  N  N   . LEU A  1 81  ? 18.684  27.514  -12.896 1.00 63.31  ? 78   LEU A N   1 
ATOM   489  C  CA  . LEU A  1 81  ? 19.557  26.997  -13.963 1.00 63.57  ? 78   LEU A CA  1 
ATOM   490  C  C   . LEU A  1 81  ? 18.712  26.459  -15.125 1.00 69.07  ? 78   LEU A C   1 
ATOM   491  O  O   . LEU A  1 81  ? 19.046  26.730  -16.278 1.00 68.97  ? 78   LEU A O   1 
ATOM   492  C  CB  . LEU A  1 81  ? 20.541  25.911  -13.475 1.00 63.72  ? 78   LEU A CB  1 
ATOM   493  C  CG  . LEU A  1 81  ? 21.602  26.277  -12.431 1.00 68.87  ? 78   LEU A CG  1 
ATOM   494  C  CD1 . LEU A  1 81  ? 22.515  25.084  -12.158 1.00 69.08  ? 78   LEU A CD1 1 
ATOM   495  C  CD2 . LEU A  1 81  ? 22.432  27.485  -12.850 1.00 71.86  ? 78   LEU A CD2 1 
ATOM   496  N  N   . ARG A  1 82  ? 17.600  25.726  -14.824 1.00 67.16  ? 79   ARG A N   1 
ATOM   497  C  CA  . ARG A  1 82  ? 16.638  25.228  -15.826 1.00 67.51  ? 79   ARG A CA  1 
ATOM   498  C  C   . ARG A  1 82  ? 16.057  26.422  -16.602 1.00 72.90  ? 79   ARG A C   1 
ATOM   499  O  O   . ARG A  1 82  ? 15.962  26.356  -17.823 1.00 71.45  ? 79   ARG A O   1 
ATOM   500  C  CB  . ARG A  1 82  ? 15.486  24.440  -15.174 1.00 65.72  ? 79   ARG A CB  1 
ATOM   501  C  CG  . ARG A  1 82  ? 15.725  22.945  -15.076 1.00 69.35  ? 79   ARG A CG  1 
ATOM   502  C  CD  . ARG A  1 82  ? 14.755  22.305  -14.100 1.00 72.65  ? 79   ARG A CD  1 
ATOM   503  N  NE  . ARG A  1 82  ? 15.319  21.137  -13.427 1.00 68.41  ? 79   ARG A NE  1 
ATOM   504  C  CZ  . ARG A  1 82  ? 15.147  19.887  -13.842 1.00 75.27  ? 79   ARG A CZ  1 
ATOM   505  N  NH1 . ARG A  1 82  ? 14.411  19.632  -14.916 1.00 54.82  ? 79   ARG A NH1 1 
ATOM   506  N  NH2 . ARG A  1 82  ? 15.709  18.882  -13.187 1.00 65.18  ? 79   ARG A NH2 1 
ATOM   507  N  N   . VAL A  1 83  ? 15.728  27.525  -15.887 1.00 71.98  ? 80   VAL A N   1 
ATOM   508  C  CA  . VAL A  1 83  ? 15.200  28.775  -16.463 1.00 72.97  ? 80   VAL A CA  1 
ATOM   509  C  C   . VAL A  1 83  ? 16.189  29.365  -17.498 1.00 77.08  ? 80   VAL A C   1 
ATOM   510  O  O   . VAL A  1 83  ? 15.776  29.640  -18.625 1.00 77.23  ? 80   VAL A O   1 
ATOM   511  C  CB  . VAL A  1 83  ? 14.788  29.814  -15.383 1.00 77.15  ? 80   VAL A CB  1 
ATOM   512  C  CG1 . VAL A  1 83  ? 14.190  31.075  -16.017 1.00 76.70  ? 80   VAL A CG1 1 
ATOM   513  C  CG2 . VAL A  1 83  ? 13.812  29.206  -14.375 1.00 76.97  ? 80   VAL A CG2 1 
ATOM   514  N  N   . VAL A  1 84  ? 17.485  29.496  -17.126 1.00 73.15  ? 81   VAL A N   1 
ATOM   515  C  CA  . VAL A  1 84  ? 18.583  30.021  -17.962 1.00 73.16  ? 81   VAL A CA  1 
ATOM   516  C  C   . VAL A  1 84  ? 18.780  29.171  -19.232 1.00 77.69  ? 81   VAL A C   1 
ATOM   517  O  O   . VAL A  1 84  ? 19.099  29.725  -20.288 1.00 77.80  ? 81   VAL A O   1 
ATOM   518  C  CB  . VAL A  1 84  ? 19.898  30.197  -17.136 1.00 77.12  ? 81   VAL A CB  1 
ATOM   519  C  CG1 . VAL A  1 84  ? 21.109  30.490  -18.023 1.00 77.02  ? 81   VAL A CG1 1 
ATOM   520  C  CG2 . VAL A  1 84  ? 19.743  31.275  -16.064 1.00 76.59  ? 81   VAL A CG2 1 
ATOM   521  N  N   . TYR A  1 85  ? 18.566  27.843  -19.125 1.00 74.03  ? 82   TYR A N   1 
ATOM   522  C  CA  . TYR A  1 85  ? 18.680  26.870  -20.218 1.00 74.16  ? 82   TYR A CA  1 
ATOM   523  C  C   . TYR A  1 85  ? 17.594  27.078  -21.293 1.00 79.59  ? 82   TYR A C   1 
ATOM   524  O  O   . TYR A  1 85  ? 17.909  27.075  -22.481 1.00 80.35  ? 82   TYR A O   1 
ATOM   525  C  CB  . TYR A  1 85  ? 18.649  25.427  -19.649 1.00 75.11  ? 82   TYR A CB  1 
ATOM   526  C  CG  . TYR A  1 85  ? 18.542  24.322  -20.683 1.00 76.56  ? 82   TYR A CG  1 
ATOM   527  C  CD1 . TYR A  1 85  ? 19.658  23.901  -21.400 1.00 78.85  ? 82   TYR A CD1 1 
ATOM   528  C  CD2 . TYR A  1 85  ? 17.341  23.652  -20.896 1.00 76.88  ? 82   TYR A CD2 1 
ATOM   529  C  CE1 . TYR A  1 85  ? 19.568  22.877  -22.345 1.00 79.49  ? 82   TYR A CE1 1 
ATOM   530  C  CE2 . TYR A  1 85  ? 17.239  22.633  -21.843 1.00 77.65  ? 82   TYR A CE2 1 
ATOM   531  C  CZ  . TYR A  1 85  ? 18.354  22.252  -22.568 1.00 84.39  ? 82   TYR A CZ  1 
ATOM   532  O  OH  . TYR A  1 85  ? 18.249  21.247  -23.495 1.00 84.93  ? 82   TYR A OH  1 
ATOM   533  N  N   . TYR A  1 86  ? 16.327  27.215  -20.872 1.00 76.63  ? 83   TYR A N   1 
ATOM   534  C  CA  . TYR A  1 86  ? 15.184  27.391  -21.765 1.00 77.13  ? 83   TYR A CA  1 
ATOM   535  C  C   . TYR A  1 86  ? 15.077  28.827  -22.320 1.00 84.75  ? 83   TYR A C   1 
ATOM   536  O  O   . TYR A  1 86  ? 14.518  29.016  -23.401 1.00 85.51  ? 83   TYR A O   1 
ATOM   537  C  CB  . TYR A  1 86  ? 13.887  26.906  -21.090 1.00 77.58  ? 83   TYR A CB  1 
ATOM   538  C  CG  . TYR A  1 86  ? 13.890  25.408  -20.857 1.00 78.48  ? 83   TYR A CG  1 
ATOM   539  C  CD1 . TYR A  1 86  ? 13.886  24.516  -21.924 1.00 80.15  ? 83   TYR A CD1 1 
ATOM   540  C  CD2 . TYR A  1 86  ? 13.926  24.882  -19.570 1.00 79.45  ? 83   TYR A CD2 1 
ATOM   541  C  CE1 . TYR A  1 86  ? 13.901  23.137  -21.718 1.00 80.48  ? 83   TYR A CE1 1 
ATOM   542  C  CE2 . TYR A  1 86  ? 13.952  23.502  -19.350 1.00 80.32  ? 83   TYR A CE2 1 
ATOM   543  C  CZ  . TYR A  1 86  ? 13.958  22.632  -20.430 1.00 85.03  ? 83   TYR A CZ  1 
ATOM   544  O  OH  . TYR A  1 86  ? 13.962  21.268  -20.241 1.00 82.32  ? 83   TYR A OH  1 
ATOM   545  N  N   . VAL A  1 87  ? 15.670  29.820  -21.613 1.00 82.59  ? 84   VAL A N   1 
ATOM   546  C  CA  . VAL A  1 87  ? 15.776  31.224  -22.033 1.00 82.85  ? 84   VAL A CA  1 
ATOM   547  C  C   . VAL A  1 87  ? 16.829  31.291  -23.177 1.00 89.47  ? 84   VAL A C   1 
ATOM   548  O  O   . VAL A  1 87  ? 16.690  32.091  -24.101 1.00 89.56  ? 84   VAL A O   1 
ATOM   549  C  CB  . VAL A  1 87  ? 16.090  32.146  -20.808 1.00 85.99  ? 84   VAL A CB  1 
ATOM   550  C  CG1 . VAL A  1 87  ? 16.941  33.365  -21.171 1.00 85.76  ? 84   VAL A CG1 1 
ATOM   551  C  CG2 . VAL A  1 87  ? 14.808  32.571  -20.101 1.00 85.46  ? 84   VAL A CG2 1 
ATOM   552  N  N   . HIS A  1 88  ? 17.823  30.386  -23.138 1.00 88.24  ? 85   HIS A N   1 
ATOM   553  C  CA  . HIS A  1 88  ? 18.890  30.249  -24.127 1.00 89.51  ? 85   HIS A CA  1 
ATOM   554  C  C   . HIS A  1 88  ? 18.549  29.308  -25.291 1.00 94.75  ? 85   HIS A C   1 
ATOM   555  O  O   . HIS A  1 88  ? 19.455  28.828  -25.984 1.00 94.66  ? 85   HIS A O   1 
ATOM   556  C  CB  . HIS A  1 88  ? 20.194  29.835  -23.437 1.00 90.91  ? 85   HIS A CB  1 
ATOM   557  C  CG  . HIS A  1 88  ? 21.004  31.021  -23.057 1.00 95.13  ? 85   HIS A CG  1 
ATOM   558  N  ND1 . HIS A  1 88  ? 22.181  31.327  -23.713 1.00 97.23  ? 85   HIS A ND1 1 
ATOM   559  C  CD2 . HIS A  1 88  ? 20.712  32.017  -22.187 1.00 97.41  ? 85   HIS A CD2 1 
ATOM   560  C  CE1 . HIS A  1 88  ? 22.598  32.463  -23.181 1.00 96.92  ? 85   HIS A CE1 1 
ATOM   561  N  NE2 . HIS A  1 88  ? 21.743  32.918  -22.260 1.00 97.29  ? 85   HIS A NE2 1 
ATOM   562  N  N   . LYS A  1 89  ? 17.242  29.083  -25.527 1.00 91.87  ? 86   LYS A N   1 
ATOM   563  C  CA  . LYS A  1 89  ? 16.710  28.223  -26.586 1.00 92.37  ? 86   LYS A CA  1 
ATOM   564  C  C   . LYS A  1 89  ? 17.281  26.773  -26.535 1.00 96.01  ? 86   LYS A C   1 
ATOM   565  O  O   . LYS A  1 89  ? 17.662  26.204  -27.567 1.00 96.00  ? 86   LYS A O   1 
ATOM   566  C  CB  . LYS A  1 89  ? 16.887  28.883  -27.974 1.00 95.56  ? 86   LYS A CB  1 
ATOM   567  N  N   . GLY A  1 90  ? 17.342  26.216  -25.322 1.00 91.16  ? 87   GLY A N   1 
ATOM   568  C  CA  . GLY A  1 90  ? 17.824  24.863  -25.060 1.00 89.98  ? 87   GLY A CA  1 
ATOM   569  C  C   . GLY A  1 90  ? 19.308  24.615  -25.247 1.00 91.02  ? 87   GLY A C   1 
ATOM   570  O  O   . GLY A  1 90  ? 19.690  23.607  -25.838 1.00 91.09  ? 87   GLY A O   1 
ATOM   571  N  N   . ILE A  1 91  ? 20.158  25.497  -24.718 1.00 85.41  ? 88   ILE A N   1 
ATOM   572  C  CA  . ILE A  1 91  ? 21.614  25.328  -24.781 1.00 84.42  ? 88   ILE A CA  1 
ATOM   573  C  C   . ILE A  1 91  ? 22.142  25.326  -23.345 1.00 85.43  ? 88   ILE A C   1 
ATOM   574  O  O   . ILE A  1 91  ? 21.936  26.311  -22.623 1.00 84.92  ? 88   ILE A O   1 
ATOM   575  C  CB  . ILE A  1 91  ? 22.320  26.417  -25.662 1.00 87.93  ? 88   ILE A CB  1 
ATOM   576  C  CG1 . ILE A  1 91  ? 21.790  26.464  -27.133 1.00 88.62  ? 88   ILE A CG1 1 
ATOM   577  C  CG2 . ILE A  1 91  ? 23.848  26.293  -25.624 1.00 89.26  ? 88   ILE A CG2 1 
ATOM   578  C  CD1 . ILE A  1 91  ? 21.857  25.141  -28.001 1.00 99.51  ? 88   ILE A CD1 1 
ATOM   579  N  N   . TRP A  1 92  ? 22.774  24.208  -22.912 1.00 79.51  ? 89   TRP A N   1 
ATOM   580  C  CA  . TRP A  1 92  ? 23.332  24.128  -21.554 1.00 77.47  ? 89   TRP A CA  1 
ATOM   581  C  C   . TRP A  1 92  ? 24.717  24.767  -21.534 1.00 83.29  ? 89   TRP A C   1 
ATOM   582  O  O   . TRP A  1 92  ? 25.547  24.439  -22.386 1.00 83.60  ? 89   TRP A O   1 
ATOM   583  C  CB  . TRP A  1 92  ? 23.361  22.693  -21.017 1.00 73.88  ? 89   TRP A CB  1 
ATOM   584  C  CG  . TRP A  1 92  ? 23.691  22.623  -19.560 1.00 73.03  ? 89   TRP A CG  1 
ATOM   585  C  CD1 . TRP A  1 92  ? 24.884  22.266  -19.009 1.00 75.51  ? 89   TRP A CD1 1 
ATOM   586  C  CD2 . TRP A  1 92  ? 22.824  22.947  -18.468 1.00 72.32  ? 89   TRP A CD2 1 
ATOM   587  N  NE1 . TRP A  1 92  ? 24.818  22.352  -17.639 1.00 74.34  ? 89   TRP A NE1 1 
ATOM   588  C  CE2 . TRP A  1 92  ? 23.558  22.744  -17.277 1.00 75.82  ? 89   TRP A CE2 1 
ATOM   589  C  CE3 . TRP A  1 92  ? 21.485  23.373  -18.377 1.00 72.98  ? 89   TRP A CE3 1 
ATOM   590  C  CZ2 . TRP A  1 92  ? 23.002  22.959  -16.011 1.00 75.01  ? 89   TRP A CZ2 1 
ATOM   591  C  CZ3 . TRP A  1 92  ? 20.944  23.612  -17.124 1.00 74.01  ? 89   TRP A CZ3 1 
ATOM   592  C  CH2 . TRP A  1 92  ? 21.697  23.406  -15.959 1.00 74.69  ? 89   TRP A CH2 1 
ATOM   593  N  N   . LEU A  1 93  ? 24.959  25.703  -20.594 1.00 79.91  ? 90   LEU A N   1 
ATOM   594  C  CA  . LEU A  1 93  ? 26.246  26.400  -20.546 1.00 80.21  ? 90   LEU A CA  1 
ATOM   595  C  C   . LEU A  1 93  ? 26.954  26.352  -19.178 1.00 86.05  ? 90   LEU A C   1 
ATOM   596  O  O   . LEU A  1 93  ? 27.811  27.200  -18.918 1.00 86.67  ? 90   LEU A O   1 
ATOM   597  C  CB  . LEU A  1 93  ? 26.094  27.854  -21.044 1.00 80.33  ? 90   LEU A CB  1 
ATOM   598  C  CG  . LEU A  1 93  ? 24.918  28.662  -20.504 1.00 85.82  ? 90   LEU A CG  1 
ATOM   599  C  CD1 . LEU A  1 93  ? 25.350  29.555  -19.354 1.00 86.37  ? 90   LEU A CD1 1 
ATOM   600  C  CD2 . LEU A  1 93  ? 24.300  29.519  -21.591 1.00 88.51  ? 90   LEU A CD2 1 
ATOM   601  N  N   . PHE A  1 94  ? 26.660  25.333  -18.337 1.00 82.18  ? 91   PHE A N   1 
ATOM   602  C  CA  . PHE A  1 94  ? 27.258  25.193  -17.003 1.00 81.32  ? 91   PHE A CA  1 
ATOM   603  C  C   . PHE A  1 94  ? 28.100  23.920  -16.810 1.00 86.06  ? 91   PHE A C   1 
ATOM   604  O  O   . PHE A  1 94  ? 28.593  23.682  -15.703 1.00 86.54  ? 91   PHE A O   1 
ATOM   605  C  CB  . PHE A  1 94  ? 26.177  25.303  -15.911 1.00 83.03  ? 91   PHE A CB  1 
ATOM   606  C  CG  . PHE A  1 94  ? 25.259  26.505  -16.018 1.00 84.86  ? 91   PHE A CG  1 
ATOM   607  C  CD1 . PHE A  1 94  ? 25.706  27.777  -15.682 1.00 88.17  ? 91   PHE A CD1 1 
ATOM   608  C  CD2 . PHE A  1 94  ? 23.939  26.358  -16.425 1.00 87.45  ? 91   PHE A CD2 1 
ATOM   609  C  CE1 . PHE A  1 94  ? 24.851  28.884  -15.772 1.00 89.35  ? 91   PHE A CE1 1 
ATOM   610  C  CE2 . PHE A  1 94  ? 23.086  27.466  -16.515 1.00 90.49  ? 91   PHE A CE2 1 
ATOM   611  C  CZ  . PHE A  1 94  ? 23.548  28.720  -16.182 1.00 88.36  ? 91   PHE A CZ  1 
ATOM   612  N  N   . GLY A  1 95  ? 28.276  23.133  -17.875 1.00 82.59  ? 92   GLY A N   1 
ATOM   613  C  CA  . GLY A  1 95  ? 29.050  21.894  -17.845 1.00 82.46  ? 92   GLY A CA  1 
ATOM   614  C  C   . GLY A  1 95  ? 28.244  20.649  -17.534 1.00 86.91  ? 92   GLY A C   1 
ATOM   615  O  O   . GLY A  1 95  ? 27.055  20.728  -17.226 1.00 87.11  ? 92   GLY A O   1 
ATOM   616  N  N   . ASP A  1 96  ? 28.896  19.481  -17.623 1.00 83.27  ? 93   ASP A N   1 
ATOM   617  C  CA  . ASP A  1 96  ? 28.290  18.180  -17.368 1.00 82.74  ? 93   ASP A CA  1 
ATOM   618  C  C   . ASP A  1 96  ? 27.841  18.017  -15.930 1.00 83.24  ? 93   ASP A C   1 
ATOM   619  O  O   . ASP A  1 96  ? 26.689  17.618  -15.719 1.00 84.03  ? 93   ASP A O   1 
ATOM   620  C  CB  . ASP A  1 96  ? 29.247  17.032  -17.744 1.00 85.76  ? 93   ASP A CB  1 
ATOM   621  C  CG  . ASP A  1 96  ? 29.274  16.626  -19.211 1.00 106.38 ? 93   ASP A CG  1 
ATOM   622  O  OD1 . ASP A  1 96  ? 28.477  17.193  -20.007 1.00 107.14 ? 93   ASP A OD1 1 
ATOM   623  O  OD2 . ASP A  1 96  ? 30.100  15.744  -19.567 1.00 117.52 ? 93   ASP A OD2 1 
ATOM   624  N  N   . PHE A  1 97  ? 28.738  18.303  -14.943 1.00 75.65  ? 94   PHE A N   1 
ATOM   625  C  CA  . PHE A  1 97  ? 28.438  18.138  -13.510 1.00 73.46  ? 94   PHE A CA  1 
ATOM   626  C  C   . PHE A  1 97  ? 27.145  18.804  -13.093 1.00 75.63  ? 94   PHE A C   1 
ATOM   627  O  O   . PHE A  1 97  ? 26.287  18.120  -12.522 1.00 74.69  ? 94   PHE A O   1 
ATOM   628  C  CB  . PHE A  1 97  ? 29.591  18.564  -12.581 1.00 73.76  ? 94   PHE A CB  1 
ATOM   629  C  CG  . PHE A  1 97  ? 29.313  18.264  -11.125 1.00 73.72  ? 94   PHE A CG  1 
ATOM   630  C  CD1 . PHE A  1 97  ? 29.275  16.948  -10.661 1.00 75.64  ? 94   PHE A CD1 1 
ATOM   631  C  CD2 . PHE A  1 97  ? 29.054  19.291  -10.222 1.00 74.77  ? 94   PHE A CD2 1 
ATOM   632  C  CE1 . PHE A  1 97  ? 28.985  16.666  -9.318  1.00 75.70  ? 94   PHE A CE1 1 
ATOM   633  C  CE2 . PHE A  1 97  ? 28.773  19.010  -8.876  1.00 76.87  ? 94   PHE A CE2 1 
ATOM   634  C  CZ  . PHE A  1 97  ? 28.742  17.700  -8.434  1.00 74.57  ? 94   PHE A CZ  1 
ATOM   635  N  N   . LEU A  1 98  ? 26.987  20.108  -13.428 1.00 70.24  ? 95   LEU A N   1 
ATOM   636  C  CA  . LEU A  1 98  ? 25.789  20.860  -13.098 1.00 69.56  ? 95   LEU A CA  1 
ATOM   637  C  C   . LEU A  1 98  ? 24.551  20.371  -13.845 1.00 73.23  ? 95   LEU A C   1 
ATOM   638  O  O   . LEU A  1 98  ? 23.449  20.540  -13.328 1.00 74.13  ? 95   LEU A O   1 
ATOM   639  C  CB  . LEU A  1 98  ? 25.977  22.372  -13.235 1.00 69.68  ? 95   LEU A CB  1 
ATOM   640  C  CG  . LEU A  1 98  ? 26.740  23.021  -12.075 1.00 74.53  ? 95   LEU A CG  1 
ATOM   641  C  CD1 . LEU A  1 98  ? 27.089  24.467  -12.380 1.00 74.04  ? 95   LEU A CD1 1 
ATOM   642  C  CD2 . LEU A  1 98  ? 25.966  22.914  -10.759 1.00 78.13  ? 95   LEU A CD2 1 
ATOM   643  N  N   . CYS A  1 99  ? 24.713  19.714  -15.005 1.00 68.45  ? 96   CYS A N   1 
ATOM   644  C  CA  . CYS A  1 99  ? 23.558  19.162  -15.695 1.00 68.85  ? 96   CYS A CA  1 
ATOM   645  C  C   . CYS A  1 99  ? 23.039  17.941  -14.939 1.00 72.04  ? 96   CYS A C   1 
ATOM   646  O  O   . CYS A  1 99  ? 21.828  17.812  -14.727 1.00 72.34  ? 96   CYS A O   1 
ATOM   647  C  CB  . CYS A  1 99  ? 23.863  18.814  -17.146 1.00 69.92  ? 96   CYS A CB  1 
ATOM   648  S  SG  . CYS A  1 99  ? 22.522  17.901  -17.963 1.00 74.39  ? 96   CYS A SG  1 
ATOM   649  N  N   . ARG A  1 100 ? 23.971  17.048  -14.539 1.00 66.79  ? 97   ARG A N   1 
ATOM   650  C  CA  . ARG A  1 100 ? 23.701  15.809  -13.810 1.00 64.69  ? 97   ARG A CA  1 
ATOM   651  C  C   . ARG A  1 100 ? 23.199  16.104  -12.406 1.00 63.57  ? 97   ARG A C   1 
ATOM   652  O  O   . ARG A  1 100 ? 22.298  15.424  -11.947 1.00 61.91  ? 97   ARG A O   1 
ATOM   653  C  CB  . ARG A  1 100 ? 24.923  14.868  -13.837 1.00 65.50  ? 97   ARG A CB  1 
ATOM   654  C  CG  . ARG A  1 100 ? 25.238  14.348  -15.245 1.00 73.74  ? 97   ARG A CG  1 
ATOM   655  C  CD  . ARG A  1 100 ? 26.522  13.544  -15.352 1.00 85.93  ? 97   ARG A CD  1 
ATOM   656  N  NE  . ARG A  1 100 ? 27.728  14.365  -15.240 1.00 107.34 ? 97   ARG A NE  1 
ATOM   657  C  CZ  . ARG A  1 100 ? 28.972  13.899  -15.366 1.00 130.28 ? 97   ARG A CZ  1 
ATOM   658  N  NH1 . ARG A  1 100 ? 29.184  12.612  -15.615 1.00 117.29 ? 97   ARG A NH1 1 
ATOM   659  N  NH2 . ARG A  1 100 ? 30.009  14.719  -15.247 1.00 121.33 ? 97   ARG A NH2 1 
ATOM   660  N  N   . LEU A  1 101 ? 23.707  17.178  -11.775 1.00 59.89  ? 98   LEU A N   1 
ATOM   661  C  CA  . LEU A  1 101 ? 23.291  17.654  -10.450 1.00 58.97  ? 98   LEU A CA  1 
ATOM   662  C  C   . LEU A  1 101 ? 21.896  18.287  -10.472 1.00 59.03  ? 98   LEU A C   1 
ATOM   663  O  O   . LEU A  1 101 ? 21.150  18.084  -9.526  1.00 57.47  ? 98   LEU A O   1 
ATOM   664  C  CB  . LEU A  1 101 ? 24.328  18.623  -9.845  1.00 59.35  ? 98   LEU A CB  1 
ATOM   665  C  CG  . LEU A  1 101 ? 24.198  18.854  -8.345  1.00 64.38  ? 98   LEU A CG  1 
ATOM   666  C  CD1 . LEU A  1 101 ? 24.636  17.632  -7.566  1.00 64.34  ? 98   LEU A CD1 1 
ATOM   667  C  CD2 . LEU A  1 101 ? 24.935  20.095  -7.911  1.00 64.92  ? 98   LEU A CD2 1 
ATOM   668  N  N   . SER A  1 102 ? 21.536  19.033  -11.534 1.00 55.88  ? 99   SER A N   1 
ATOM   669  C  CA  . SER A  1 102 ? 20.206  19.640  -11.659 1.00 55.91  ? 99   SER A CA  1 
ATOM   670  C  C   . SER A  1 102 ? 19.132  18.590  -11.908 1.00 61.40  ? 99   SER A C   1 
ATOM   671  O  O   . SER A  1 102 ? 18.030  18.735  -11.382 1.00 62.60  ? 99   SER A O   1 
ATOM   672  C  CB  . SER A  1 102 ? 20.179  20.698  -12.750 1.00 60.27  ? 99   SER A CB  1 
ATOM   673  O  OG  . SER A  1 102 ? 20.806  21.890  -12.301 1.00 73.69  ? 99   SER A OG  1 
ATOM   674  N  N   . THR A  1 103 ? 19.453  17.516  -12.675 1.00 57.05  ? 100  THR A N   1 
ATOM   675  C  CA  . THR A  1 103 ? 18.529  16.407  -12.956 1.00 56.31  ? 100  THR A CA  1 
ATOM   676  C  C   . THR A  1 103 ? 18.256  15.609  -11.682 1.00 60.36  ? 100  THR A C   1 
ATOM   677  O  O   . THR A  1 103 ? 17.103  15.369  -11.342 1.00 61.40  ? 100  THR A O   1 
ATOM   678  C  CB  . THR A  1 103 ? 19.072  15.509  -14.065 1.00 62.54  ? 100  THR A CB  1 
ATOM   679  O  OG1 . THR A  1 103 ? 19.307  16.291  -15.240 1.00 66.82  ? 100  THR A OG1 1 
ATOM   680  C  CG2 . THR A  1 103 ? 18.135  14.343  -14.385 1.00 61.37  ? 100  THR A CG2 1 
ATOM   681  N  N   . TYR A  1 104 ? 19.330  15.197  -10.996 1.00 56.16  ? 101  TYR A N   1 
ATOM   682  C  CA  . TYR A  1 104 ? 19.345  14.428  -9.755  1.00 55.00  ? 101  TYR A CA  1 
ATOM   683  C  C   . TYR A  1 104 ? 18.531  15.138  -8.684  1.00 58.76  ? 101  TYR A C   1 
ATOM   684  O  O   . TYR A  1 104 ? 17.684  14.507  -8.068  1.00 58.54  ? 101  TYR A O   1 
ATOM   685  C  CB  . TYR A  1 104 ? 20.811  14.261  -9.308  1.00 55.07  ? 101  TYR A CB  1 
ATOM   686  C  CG  . TYR A  1 104 ? 21.027  13.537  -8.003  1.00 54.85  ? 101  TYR A CG  1 
ATOM   687  C  CD1 . TYR A  1 104 ? 20.844  12.165  -7.909  1.00 56.37  ? 101  TYR A CD1 1 
ATOM   688  C  CD2 . TYR A  1 104 ? 21.499  14.211  -6.881  1.00 54.76  ? 101  TYR A CD2 1 
ATOM   689  C  CE1 . TYR A  1 104 ? 21.093  11.484  -6.722  1.00 56.25  ? 101  TYR A CE1 1 
ATOM   690  C  CE2 . TYR A  1 104 ? 21.760  13.540  -5.694  1.00 55.27  ? 101  TYR A CE2 1 
ATOM   691  C  CZ  . TYR A  1 104 ? 21.565  12.174  -5.622  1.00 59.46  ? 101  TYR A CZ  1 
ATOM   692  O  OH  . TYR A  1 104 ? 21.804  11.510  -4.449  1.00 59.55  ? 101  TYR A OH  1 
ATOM   693  N  N   . ALA A  1 105 ? 18.765  16.462  -8.503  1.00 54.45  ? 102  ALA A N   1 
ATOM   694  C  CA  . ALA A  1 105 ? 18.109  17.320  -7.530  1.00 53.26  ? 102  ALA A CA  1 
ATOM   695  C  C   . ALA A  1 105 ? 16.601  17.291  -7.618  1.00 55.20  ? 102  ALA A C   1 
ATOM   696  O  O   . ALA A  1 105 ? 15.964  17.304  -6.572  1.00 55.24  ? 102  ALA A O   1 
ATOM   697  C  CB  . ALA A  1 105 ? 18.613  18.739  -7.660  1.00 54.19  ? 102  ALA A CB  1 
ATOM   698  N  N   . LEU A  1 106 ? 16.018  17.238  -8.835  1.00 50.55  ? 103  LEU A N   1 
ATOM   699  C  CA  . LEU A  1 106 ? 14.562  17.188  -8.963  1.00 50.18  ? 103  LEU A CA  1 
ATOM   700  C  C   . LEU A  1 106 ? 13.989  15.856  -8.506  1.00 52.50  ? 103  LEU A C   1 
ATOM   701  O  O   . LEU A  1 106 ? 12.993  15.863  -7.778  1.00 50.41  ? 103  LEU A O   1 
ATOM   702  C  CB  . LEU A  1 106 ? 14.051  17.569  -10.370 1.00 50.33  ? 103  LEU A CB  1 
ATOM   703  C  CG  . LEU A  1 106 ? 12.510  17.493  -10.591 1.00 55.43  ? 103  LEU A CG  1 
ATOM   704  C  CD1 . LEU A  1 106 ? 11.758  18.448  -9.669  1.00 56.03  ? 103  LEU A CD1 1 
ATOM   705  C  CD2 . LEU A  1 106 ? 12.141  17.790  -12.007 1.00 58.42  ? 103  LEU A CD2 1 
ATOM   706  N  N   . TYR A  1 107 ? 14.637  14.722  -8.893  1.00 48.81  ? 104  TYR A N   1 
ATOM   707  C  CA  . TYR A  1 107 ? 14.171  13.388  -8.512  1.00 48.19  ? 104  TYR A CA  1 
ATOM   708  C  C   . TYR A  1 107 ? 14.330  13.119  -7.000  1.00 49.99  ? 104  TYR A C   1 
ATOM   709  O  O   . TYR A  1 107 ? 13.454  12.484  -6.399  1.00 49.81  ? 104  TYR A O   1 
ATOM   710  C  CB  . TYR A  1 107 ? 14.813  12.296  -9.390  1.00 49.53  ? 104  TYR A CB  1 
ATOM   711  C  CG  . TYR A  1 107 ? 14.454  12.438  -10.856 1.00 50.86  ? 104  TYR A CG  1 
ATOM   712  C  CD1 . TYR A  1 107 ? 13.131  12.603  -11.257 1.00 53.07  ? 104  TYR A CD1 1 
ATOM   713  C  CD2 . TYR A  1 107 ? 15.438  12.420  -11.841 1.00 50.72  ? 104  TYR A CD2 1 
ATOM   714  C  CE1 . TYR A  1 107 ? 12.800  12.786  -12.598 1.00 54.43  ? 104  TYR A CE1 1 
ATOM   715  C  CE2 . TYR A  1 107 ? 15.116  12.585  -13.186 1.00 50.82  ? 104  TYR A CE2 1 
ATOM   716  C  CZ  . TYR A  1 107 ? 13.795  12.765  -13.559 1.00 59.60  ? 104  TYR A CZ  1 
ATOM   717  O  OH  . TYR A  1 107 ? 13.466  12.952  -14.876 1.00 64.46  ? 104  TYR A OH  1 
ATOM   718  N  N   . VAL A  1 108 ? 15.388  13.664  -6.386  1.00 45.07  ? 105  VAL A N   1 
ATOM   719  C  CA  . VAL A  1 108 ? 15.639  13.545  -4.952  1.00 46.28  ? 105  VAL A CA  1 
ATOM   720  C  C   . VAL A  1 108 ? 14.514  14.289  -4.183  1.00 53.17  ? 105  VAL A C   1 
ATOM   721  O  O   . VAL A  1 108 ? 13.869  13.678  -3.327  1.00 52.90  ? 105  VAL A O   1 
ATOM   722  C  CB  . VAL A  1 108 ? 17.093  13.959  -4.538  1.00 50.00  ? 105  VAL A CB  1 
ATOM   723  C  CG1 . VAL A  1 108 ? 17.242  14.075  -3.020  1.00 49.31  ? 105  VAL A CG1 1 
ATOM   724  C  CG2 . VAL A  1 108 ? 18.106  12.949  -5.076  1.00 49.91  ? 105  VAL A CG2 1 
ATOM   725  N  N   . ASN A  1 109 ? 14.233  15.563  -4.555  1.00 50.08  ? 106  ASN A N   1 
ATOM   726  C  CA  . ASN A  1 109 ? 13.177  16.380  -3.965  1.00 49.41  ? 106  ASN A CA  1 
ATOM   727  C  C   . ASN A  1 109 ? 11.805  15.705  -4.107  1.00 54.71  ? 106  ASN A C   1 
ATOM   728  O  O   . ASN A  1 109 ? 11.044  15.655  -3.131  1.00 55.52  ? 106  ASN A O   1 
ATOM   729  C  CB  . ASN A  1 109 ? 13.144  17.758  -4.622  1.00 47.26  ? 106  ASN A CB  1 
ATOM   730  C  CG  . ASN A  1 109 ? 11.830  18.497  -4.493  1.00 53.70  ? 106  ASN A CG  1 
ATOM   731  O  OD1 . ASN A  1 109 ? 11.077  18.660  -5.461  1.00 44.58  ? 106  ASN A OD1 1 
ATOM   732  N  ND2 . ASN A  1 109 ? 11.512  18.924  -3.290  1.00 48.10  ? 106  ASN A ND2 1 
ATOM   733  N  N   . LEU A  1 110 ? 11.496  15.196  -5.315  1.00 50.32  ? 107  LEU A N   1 
ATOM   734  C  CA  . LEU A  1 110 ? 10.216  14.556  -5.604  1.00 50.42  ? 107  LEU A CA  1 
ATOM   735  C  C   . LEU A  1 110 ? 9.968   13.297  -4.775  1.00 53.07  ? 107  LEU A C   1 
ATOM   736  O  O   . LEU A  1 110 ? 8.905   13.196  -4.166  1.00 53.29  ? 107  LEU A O   1 
ATOM   737  C  CB  . LEU A  1 110 ? 10.082  14.272  -7.108  1.00 50.81  ? 107  LEU A CB  1 
ATOM   738  C  CG  . LEU A  1 110 ? 8.751   13.720  -7.606  1.00 56.39  ? 107  LEU A CG  1 
ATOM   739  C  CD1 . LEU A  1 110 ? 7.724   14.829  -7.771  1.00 57.18  ? 107  LEU A CD1 1 
ATOM   740  C  CD2 . LEU A  1 110 ? 8.951   13.011  -8.916  1.00 58.87  ? 107  LEU A CD2 1 
ATOM   741  N  N   . TYR A  1 111 ? 10.939  12.357  -4.729  1.00 47.96  ? 108  TYR A N   1 
ATOM   742  C  CA  . TYR A  1 111 ? 10.767  11.116  -3.973  1.00 46.64  ? 108  TYR A CA  1 
ATOM   743  C  C   . TYR A  1 111 ? 10.976  11.299  -2.452  1.00 53.54  ? 108  TYR A C   1 
ATOM   744  O  O   . TYR A  1 111 ? 10.335  10.584  -1.682  1.00 53.00  ? 108  TYR A O   1 
ATOM   745  C  CB  . TYR A  1 111 ? 11.596  9.988   -4.567  1.00 45.46  ? 108  TYR A CB  1 
ATOM   746  C  CG  . TYR A  1 111 ? 11.015  9.563   -5.902  1.00 44.52  ? 108  TYR A CG  1 
ATOM   747  C  CD1 . TYR A  1 111 ? 9.793   8.881   -5.973  1.00 45.60  ? 108  TYR A CD1 1 
ATOM   748  C  CD2 . TYR A  1 111 ? 11.630  9.921   -7.097  1.00 43.76  ? 108  TYR A CD2 1 
ATOM   749  C  CE1 . TYR A  1 111 ? 9.220   8.540   -7.201  1.00 41.90  ? 108  TYR A CE1 1 
ATOM   750  C  CE2 . TYR A  1 111 ? 11.083  9.559   -8.328  1.00 43.88  ? 108  TYR A CE2 1 
ATOM   751  C  CZ  . TYR A  1 111 ? 9.878   8.870   -8.374  1.00 49.36  ? 108  TYR A CZ  1 
ATOM   752  O  OH  . TYR A  1 111 ? 9.355   8.499   -9.585  1.00 52.67  ? 108  TYR A OH  1 
ATOM   753  N  N   . CYS A  1 112 ? 11.781  12.299  -2.019  1.00 51.65  ? 109  CYS A N   1 
ATOM   754  C  CA  . CYS A  1 112 ? 11.924  12.638  -0.605  1.00 52.61  ? 109  CYS A CA  1 
ATOM   755  C  C   . CYS A  1 112 ? 10.568  13.177  -0.103  1.00 56.67  ? 109  CYS A C   1 
ATOM   756  O  O   . CYS A  1 112 ? 10.101  12.714  0.940   1.00 56.74  ? 109  CYS A O   1 
ATOM   757  C  CB  . CYS A  1 112 ? 13.041  13.657  -0.369  1.00 54.11  ? 109  CYS A CB  1 
ATOM   758  S  SG  . CYS A  1 112 ? 14.676  12.929  -0.045  1.00 58.84  ? 109  CYS A SG  1 
ATOM   759  N  N   . SER A  1 113 ? 9.928   14.130  -0.849  1.00 52.11  ? 110  SER A N   1 
ATOM   760  C  CA  . SER A  1 113 ? 8.634   14.735  -0.473  1.00 51.32  ? 110  SER A CA  1 
ATOM   761  C  C   . SER A  1 113 ? 7.506   13.705  -0.352  1.00 53.98  ? 110  SER A C   1 
ATOM   762  O  O   . SER A  1 113 ? 6.732   13.769  0.603   1.00 53.60  ? 110  SER A O   1 
ATOM   763  C  CB  . SER A  1 113 ? 8.243   15.864  -1.422  1.00 53.43  ? 110  SER A CB  1 
ATOM   764  O  OG  . SER A  1 113 ? 9.208   16.903  -1.419  1.00 55.79  ? 110  SER A OG  1 
ATOM   765  N  N   . ILE A  1 114 ? 7.459   12.727  -1.284  1.00 50.34  ? 111  ILE A N   1 
ATOM   766  C  CA  . ILE A  1 114 ? 6.490   11.615  -1.279  1.00 49.59  ? 111  ILE A CA  1 
ATOM   767  C  C   . ILE A  1 114 ? 6.680   10.791  0.002   1.00 52.74  ? 111  ILE A C   1 
ATOM   768  O  O   . ILE A  1 114 ? 5.697   10.542  0.697   1.00 52.26  ? 111  ILE A O   1 
ATOM   769  C  CB  . ILE A  1 114 ? 6.532   10.750  -2.587  1.00 51.69  ? 111  ILE A CB  1 
ATOM   770  C  CG1 . ILE A  1 114 ? 6.022   11.564  -3.805  1.00 51.45  ? 111  ILE A CG1 1 
ATOM   771  C  CG2 . ILE A  1 114 ? 5.700   9.461   -2.441  1.00 51.71  ? 111  ILE A CG2 1 
ATOM   772  C  CD1 . ILE A  1 114 ? 6.311   10.975  -5.134  1.00 52.51  ? 111  ILE A CD1 1 
ATOM   773  N  N   . PHE A  1 115 ? 7.939   10.439  0.349   1.00 48.04  ? 112  PHE A N   1 
ATOM   774  C  CA  . PHE A  1 115 ? 8.228   9.642   1.539   1.00 47.70  ? 112  PHE A CA  1 
ATOM   775  C  C   . PHE A  1 115 ? 7.994   10.377  2.871   1.00 53.08  ? 112  PHE A C   1 
ATOM   776  O  O   . PHE A  1 115 ? 7.502   9.741   3.802   1.00 53.39  ? 112  PHE A O   1 
ATOM   777  C  CB  . PHE A  1 115 ? 9.624   9.047   1.465   1.00 49.33  ? 112  PHE A CB  1 
ATOM   778  C  CG  . PHE A  1 115 ? 9.792   7.960   0.425   1.00 52.04  ? 112  PHE A CG  1 
ATOM   779  C  CD1 . PHE A  1 115 ? 8.717   7.154   0.045   1.00 55.90  ? 112  PHE A CD1 1 
ATOM   780  C  CD2 . PHE A  1 115 ? 11.038  7.682   -0.113  1.00 55.63  ? 112  PHE A CD2 1 
ATOM   781  C  CE1 . PHE A  1 115 ? 8.884   6.125   -0.891  1.00 56.83  ? 112  PHE A CE1 1 
ATOM   782  C  CE2 . PHE A  1 115 ? 11.206  6.637   -1.040  1.00 59.02  ? 112  PHE A CE2 1 
ATOM   783  C  CZ  . PHE A  1 115 ? 10.125  5.877   -1.429  1.00 56.82  ? 112  PHE A CZ  1 
ATOM   784  N  N   . PHE A  1 116 ? 8.316   11.695  2.963   1.00 49.11  ? 113  PHE A N   1 
ATOM   785  C  CA  . PHE A  1 116 ? 8.105   12.495  4.169   1.00 48.45  ? 113  PHE A CA  1 
ATOM   786  C  C   . PHE A  1 116 ? 6.612   12.698  4.420   1.00 52.59  ? 113  PHE A C   1 
ATOM   787  O  O   . PHE A  1 116 ? 6.182   12.601  5.575   1.00 52.11  ? 113  PHE A O   1 
ATOM   788  C  CB  . PHE A  1 116 ? 8.838   13.860  4.132   1.00 50.35  ? 113  PHE A CB  1 
ATOM   789  C  CG  . PHE A  1 116 ? 10.360  13.856  4.124   1.00 51.22  ? 113  PHE A CG  1 
ATOM   790  C  CD1 . PHE A  1 116 ? 11.079  13.003  4.955   1.00 53.73  ? 113  PHE A CD1 1 
ATOM   791  C  CD2 . PHE A  1 116 ? 11.070  14.738  3.312   1.00 51.57  ? 113  PHE A CD2 1 
ATOM   792  C  CE1 . PHE A  1 116 ? 12.477  13.010  4.941   1.00 53.86  ? 113  PHE A CE1 1 
ATOM   793  C  CE2 . PHE A  1 116 ? 12.465  14.725  3.286   1.00 53.40  ? 113  PHE A CE2 1 
ATOM   794  C  CZ  . PHE A  1 116 ? 13.157  13.863  4.095   1.00 51.68  ? 113  PHE A CZ  1 
ATOM   795  N  N   . MET A  1 117 ? 5.817   12.947  3.351   1.00 49.29  ? 114  MET A N   1 
ATOM   796  C  CA  . MET A  1 117 ? 4.352   13.106  3.458   1.00 49.08  ? 114  MET A CA  1 
ATOM   797  C  C   . MET A  1 117 ? 3.697   11.802  3.944   1.00 52.87  ? 114  MET A C   1 
ATOM   798  O  O   . MET A  1 117 ? 2.810   11.864  4.801   1.00 52.09  ? 114  MET A O   1 
ATOM   799  C  CB  . MET A  1 117 ? 3.717   13.596  2.138   1.00 51.16  ? 114  MET A CB  1 
ATOM   800  C  CG  . MET A  1 117 ? 3.920   15.082  1.876   1.00 55.08  ? 114  MET A CG  1 
ATOM   801  S  SD  . MET A  1 117 ? 3.106   15.663  0.353   1.00 60.12  ? 114  MET A SD  1 
ATOM   802  C  CE  . MET A  1 117 ? 3.053   17.403  0.655   1.00 57.51  ? 114  MET A CE  1 
ATOM   803  N  N   . THR A  1 118 ? 4.177   10.624  3.438   1.00 49.75  ? 115  THR A N   1 
ATOM   804  C  CA  . THR A  1 118 ? 3.706   9.280   3.820   1.00 49.55  ? 115  THR A CA  1 
ATOM   805  C  C   . THR A  1 118 ? 3.987   9.016   5.309   1.00 55.87  ? 115  THR A C   1 
ATOM   806  O  O   . THR A  1 118 ? 3.090   8.587   6.038   1.00 55.76  ? 115  THR A O   1 
ATOM   807  C  CB  . THR A  1 118 ? 4.301   8.174   2.906   1.00 50.61  ? 115  THR A CB  1 
ATOM   808  O  OG1 . THR A  1 118 ? 4.109   8.500   1.530   1.00 43.59  ? 115  THR A OG1 1 
ATOM   809  C  CG2 . THR A  1 118 ? 3.690   6.788   3.174   1.00 44.23  ? 115  THR A CG2 1 
ATOM   810  N  N   . ALA A  1 119 ? 5.238   9.283   5.745   1.00 54.13  ? 116  ALA A N   1 
ATOM   811  C  CA  . ALA A  1 119 ? 5.714   9.107   7.117   1.00 53.93  ? 116  ALA A CA  1 
ATOM   812  C  C   . ALA A  1 119 ? 4.949   9.998   8.088   1.00 59.71  ? 116  ALA A C   1 
ATOM   813  O  O   . ALA A  1 119 ? 4.612   9.543   9.168   1.00 59.66  ? 116  ALA A O   1 
ATOM   814  C  CB  . ALA A  1 119 ? 7.200   9.389   7.188   1.00 54.37  ? 116  ALA A CB  1 
ATOM   815  N  N   . MET A  1 120 ? 4.634   11.239  7.682   1.00 58.03  ? 117  MET A N   1 
ATOM   816  C  CA  . MET A  1 120 ? 3.871   12.222  8.455   1.00 58.70  ? 117  MET A CA  1 
ATOM   817  C  C   . MET A  1 120 ? 2.438   11.729  8.654   1.00 61.04  ? 117  MET A C   1 
ATOM   818  O  O   . MET A  1 120 ? 1.933   11.771  9.782   1.00 60.37  ? 117  MET A O   1 
ATOM   819  C  CB  . MET A  1 120 ? 3.886   13.567  7.709   1.00 62.25  ? 117  MET A CB  1 
ATOM   820  C  CG  . MET A  1 120 ? 3.102   14.691  8.378   1.00 66.93  ? 117  MET A CG  1 
ATOM   821  S  SD  . MET A  1 120 ? 2.959   16.125  7.285   1.00 71.87  ? 117  MET A SD  1 
ATOM   822  C  CE  . MET A  1 120 ? 4.599   16.770  7.395   1.00 68.56  ? 117  MET A CE  1 
ATOM   823  N  N   . SER A  1 121 ? 1.794   11.252  7.555   1.00 56.61  ? 118  SER A N   1 
ATOM   824  C  CA  . SER A  1 121 ? 0.429   10.721  7.559   1.00 55.70  ? 118  SER A CA  1 
ATOM   825  C  C   . SER A  1 121 ? 0.334   9.481   8.445   1.00 61.65  ? 118  SER A C   1 
ATOM   826  O  O   . SER A  1 121 ? -0.588  9.392   9.251   1.00 62.41  ? 118  SER A O   1 
ATOM   827  C  CB  . SER A  1 121 ? -0.016  10.383  6.146   1.00 56.18  ? 118  SER A CB  1 
ATOM   828  O  OG  . SER A  1 121 ? 0.076   11.521  5.313   1.00 60.37  ? 118  SER A OG  1 
ATOM   829  N  N   . PHE A  1 122 ? 1.301   8.552   8.320   1.00 59.27  ? 119  PHE A N   1 
ATOM   830  C  CA  . PHE A  1 122 ? 1.359   7.320   9.106   1.00 59.90  ? 119  PHE A CA  1 
ATOM   831  C  C   . PHE A  1 122 ? 1.435   7.604   10.602  1.00 63.93  ? 119  PHE A C   1 
ATOM   832  O  O   . PHE A  1 122 ? 0.714   6.970   11.372  1.00 63.27  ? 119  PHE A O   1 
ATOM   833  C  CB  . PHE A  1 122 ? 2.531   6.427   8.661   1.00 61.99  ? 119  PHE A CB  1 
ATOM   834  C  CG  . PHE A  1 122 ? 2.471   5.034   9.229   1.00 64.13  ? 119  PHE A CG  1 
ATOM   835  C  CD1 . PHE A  1 122 ? 1.700   4.050   8.620   1.00 68.36  ? 119  PHE A CD1 1 
ATOM   836  C  CD2 . PHE A  1 122 ? 3.152   4.712   10.394  1.00 67.34  ? 119  PHE A CD2 1 
ATOM   837  C  CE1 . PHE A  1 122 ? 1.617   2.761   9.165   1.00 69.82  ? 119  PHE A CE1 1 
ATOM   838  C  CE2 . PHE A  1 122 ? 3.071   3.422   10.938  1.00 70.96  ? 119  PHE A CE2 1 
ATOM   839  C  CZ  . PHE A  1 122 ? 2.308   2.453   10.315  1.00 69.14  ? 119  PHE A CZ  1 
ATOM   840  N  N   . PHE A  1 123 ? 2.284   8.573   10.997  1.00 60.62  ? 120  PHE A N   1 
ATOM   841  C  CA  . PHE A  1 123 ? 2.483   8.996   12.383  1.00 60.14  ? 120  PHE A CA  1 
ATOM   842  C  C   . PHE A  1 123 ? 1.220   9.629   12.966  1.00 66.64  ? 120  PHE A C   1 
ATOM   843  O  O   . PHE A  1 123 ? 0.785   9.218   14.049  1.00 66.65  ? 120  PHE A O   1 
ATOM   844  C  CB  . PHE A  1 123 ? 3.700   9.925   12.507  1.00 60.65  ? 120  PHE A CB  1 
ATOM   845  C  CG  . PHE A  1 123 ? 5.009   9.225   12.787  1.00 61.39  ? 120  PHE A CG  1 
ATOM   846  C  CD1 . PHE A  1 123 ? 5.310   8.004   12.186  1.00 64.78  ? 120  PHE A CD1 1 
ATOM   847  C  CD2 . PHE A  1 123 ? 5.964   9.811   13.600  1.00 62.58  ? 120  PHE A CD2 1 
ATOM   848  C  CE1 . PHE A  1 123 ? 6.519   7.364   12.440  1.00 65.59  ? 120  PHE A CE1 1 
ATOM   849  C  CE2 . PHE A  1 123 ? 7.175   9.176   13.846  1.00 65.41  ? 120  PHE A CE2 1 
ATOM   850  C  CZ  . PHE A  1 123 ? 7.442   7.956   13.271  1.00 64.28  ? 120  PHE A CZ  1 
ATOM   851  N  N   . ARG A  1 124 ? 0.601   10.565  12.218  1.00 63.93  ? 121  ARG A N   1 
ATOM   852  C  CA  . ARG A  1 124 ? -0.641  11.229  12.615  1.00 64.97  ? 121  ARG A CA  1 
ATOM   853  C  C   . ARG A  1 124 ? -1.808  10.229  12.760  1.00 69.48  ? 121  ARG A C   1 
ATOM   854  O  O   . ARG A  1 124 ? -2.649  10.406  13.638  1.00 69.31  ? 121  ARG A O   1 
ATOM   855  C  CB  . ARG A  1 124 ? -0.983  12.381  11.642  1.00 65.60  ? 121  ARG A CB  1 
ATOM   856  C  CG  . ARG A  1 124 ? -1.993  13.400  12.179  1.00 72.04  ? 121  ARG A CG  1 
ATOM   857  C  CD  . ARG A  1 124 ? -1.444  14.276  13.293  1.00 81.66  ? 121  ARG A CD  1 
ATOM   858  N  NE  . ARG A  1 124 ? -0.563  15.346  12.816  1.00 87.54  ? 121  ARG A NE  1 
ATOM   859  C  CZ  . ARG A  1 124 ? -0.989  16.542  12.418  1.00 104.73 ? 121  ARG A CZ  1 
ATOM   860  N  NH1 . ARG A  1 124 ? -2.285  16.821  12.400  1.00 101.60 ? 121  ARG A NH1 1 
ATOM   861  N  NH2 . ARG A  1 124 ? -0.123  17.461  12.017  1.00 86.43  ? 121  ARG A NH2 1 
ATOM   862  N  N   . CYS A  1 125 ? -1.825  9.173   11.932  1.00 66.52  ? 122  CYS A N   1 
ATOM   863  C  CA  . CYS A  1 125 ? -2.820  8.104   11.966  1.00 67.48  ? 122  CYS A CA  1 
ATOM   864  C  C   . CYS A  1 125 ? -2.766  7.363   13.299  1.00 72.97  ? 122  CYS A C   1 
ATOM   865  O  O   . CYS A  1 125 ? -3.782  7.298   13.987  1.00 72.36  ? 122  CYS A O   1 
ATOM   866  C  CB  . CYS A  1 125 ? -2.639  7.152   10.786  1.00 68.19  ? 122  CYS A CB  1 
ATOM   867  S  SG  . CYS A  1 125 ? -3.800  5.759   10.769  1.00 72.25  ? 122  CYS A SG  1 
ATOM   868  N  N   . ILE A  1 126 ? -1.566  6.854   13.682  1.00 71.11  ? 123  ILE A N   1 
ATOM   869  C  CA  . ILE A  1 126 ? -1.317  6.123   14.929  1.00 71.08  ? 123  ILE A CA  1 
ATOM   870  C  C   . ILE A  1 126 ? -1.645  7.017   16.143  1.00 77.23  ? 123  ILE A C   1 
ATOM   871  O  O   . ILE A  1 126 ? -2.231  6.526   17.107  1.00 77.97  ? 123  ILE A O   1 
ATOM   872  C  CB  . ILE A  1 126 ? 0.096   5.483   14.927  1.00 73.80  ? 123  ILE A CB  1 
ATOM   873  C  CG1 . ILE A  1 126 ? 0.061   4.084   14.274  1.00 74.27  ? 123  ILE A CG1 1 
ATOM   874  C  CG2 . ILE A  1 126 ? 0.684   5.352   16.322  1.00 76.15  ? 123  ILE A CG2 1 
ATOM   875  C  CD1 . ILE A  1 126 ? -0.081  4.001   12.746  1.00 86.11  ? 123  ILE A CD1 1 
ATOM   876  N  N   . ALA A  1 127 ? -1.392  8.331   16.040  1.00 74.36  ? 124  ALA A N   1 
ATOM   877  C  CA  . ALA A  1 127 ? -1.741  9.308   17.070  1.00 74.03  ? 124  ALA A CA  1 
ATOM   878  C  C   . ALA A  1 127 ? -3.272  9.417   17.249  1.00 79.00  ? 124  ALA A C   1 
ATOM   879  O  O   . ALA A  1 127 ? -3.740  9.293   18.379  1.00 79.47  ? 124  ALA A O   1 
ATOM   880  C  CB  . ALA A  1 127 ? -1.147  10.669  16.729  1.00 74.53  ? 124  ALA A CB  1 
ATOM   881  N  N   . ILE A  1 128 ? -4.043  9.607   16.144  1.00 76.08  ? 125  ILE A N   1 
ATOM   882  C  CA  . ILE A  1 128 ? -5.515  9.760   16.146  1.00 76.08  ? 125  ILE A CA  1 
ATOM   883  C  C   . ILE A  1 128 ? -6.241  8.447   16.497  1.00 85.07  ? 125  ILE A C   1 
ATOM   884  O  O   . ILE A  1 128 ? -7.046  8.438   17.427  1.00 85.58  ? 125  ILE A O   1 
ATOM   885  C  CB  . ILE A  1 128 ? -6.070  10.400  14.817  1.00 77.84  ? 125  ILE A CB  1 
ATOM   886  C  CG1 . ILE A  1 128 ? -5.423  11.782  14.474  1.00 78.12  ? 125  ILE A CG1 1 
ATOM   887  C  CG2 . ILE A  1 128 ? -7.592  10.491  14.790  1.00 76.50  ? 125  ILE A CG2 1 
ATOM   888  C  CD1 . ILE A  1 128 ? -5.703  13.005  15.398  1.00 88.13  ? 125  ILE A CD1 1 
ATOM   889  N  N   . VAL A  1 129 ? -5.983  7.366   15.740  1.00 84.97  ? 126  VAL A N   1 
ATOM   890  C  CA  . VAL A  1 129 ? -6.627  6.057   15.879  1.00 86.95  ? 126  VAL A CA  1 
ATOM   891  C  C   . VAL A  1 129 ? -6.323  5.373   17.215  1.00 98.40  ? 126  VAL A C   1 
ATOM   892  O  O   . VAL A  1 129 ? -7.238  4.813   17.820  1.00 99.36  ? 126  VAL A O   1 
ATOM   893  C  CB  . VAL A  1 129 ? -6.300  5.146   14.677  1.00 90.71  ? 126  VAL A CB  1 
ATOM   894  C  CG1 . VAL A  1 129 ? -6.873  3.741   14.856  1.00 90.39  ? 126  VAL A CG1 1 
ATOM   895  C  CG2 . VAL A  1 129 ? -6.797  5.771   13.374  1.00 90.63  ? 126  VAL A CG2 1 
ATOM   896  N  N   . PHE A  1 130 ? -5.056  5.409   17.670  1.00 99.74  ? 127  PHE A N   1 
ATOM   897  C  CA  . PHE A  1 130 ? -4.629  4.784   18.931  1.00 101.51 ? 127  PHE A CA  1 
ATOM   898  C  C   . PHE A  1 130 ? -4.116  5.845   19.945  1.00 109.70 ? 127  PHE A C   1 
ATOM   899  O  O   . PHE A  1 130 ? -2.903  5.942   20.133  1.00 108.77 ? 127  PHE A O   1 
ATOM   900  C  CB  . PHE A  1 130 ? -3.573  3.667   18.681  1.00 103.26 ? 127  PHE A CB  1 
ATOM   901  C  CG  . PHE A  1 130 ? -3.881  2.694   17.563  1.00 104.81 ? 127  PHE A CG  1 
ATOM   902  C  CD1 . PHE A  1 130 ? -4.690  1.586   17.785  1.00 108.22 ? 127  PHE A CD1 1 
ATOM   903  C  CD2 . PHE A  1 130 ? -3.341  2.873   16.293  1.00 106.69 ? 127  PHE A CD2 1 
ATOM   904  C  CE1 . PHE A  1 130 ? -4.975  0.686   16.747  1.00 109.17 ? 127  PHE A CE1 1 
ATOM   905  C  CE2 . PHE A  1 130 ? -3.631  1.978   15.255  1.00 109.53 ? 127  PHE A CE2 1 
ATOM   906  C  CZ  . PHE A  1 130 ? -4.447  0.891   15.487  1.00 107.78 ? 127  PHE A CZ  1 
ATOM   907  N  N   . PRO A  1 131 ? -5.001  6.637   20.621  1.00 110.62 ? 128  PRO A N   1 
ATOM   908  C  CA  . PRO A  1 131 ? -4.504  7.649   21.581  1.00 112.33 ? 128  PRO A CA  1 
ATOM   909  C  C   . PRO A  1 131 ? -3.921  7.072   22.886  1.00 121.95 ? 128  PRO A C   1 
ATOM   910  O  O   . PRO A  1 131 ? -3.346  7.821   23.690  1.00 122.44 ? 128  PRO A O   1 
ATOM   911  C  CB  . PRO A  1 131 ? -5.723  8.557   21.826  1.00 113.65 ? 128  PRO A CB  1 
ATOM   912  C  CG  . PRO A  1 131 ? -6.765  8.124   20.830  1.00 117.32 ? 128  PRO A CG  1 
ATOM   913  C  CD  . PRO A  1 131 ? -6.473  6.687   20.534  1.00 112.45 ? 128  PRO A CD  1 
ATOM   914  N  N   . VAL A  1 132 ? -4.063  5.738   23.091  1.00 120.95 ? 129  VAL A N   1 
ATOM   915  C  CA  . VAL A  1 132 ? -3.503  5.000   24.224  1.00 121.60 ? 129  VAL A CA  1 
ATOM   916  C  C   . VAL A  1 132 ? -2.064  4.631   23.841  1.00 127.21 ? 129  VAL A C   1 
ATOM   917  O  O   . VAL A  1 132 ? -1.857  3.843   22.910  1.00 126.81 ? 129  VAL A O   1 
ATOM   918  C  CB  . VAL A  1 132 ? -4.349  3.751   24.561  1.00 125.56 ? 129  VAL A CB  1 
ATOM   919  N  N   . GLN A  1 133 ? -1.078  5.259   24.521  1.00 124.97 ? 130  GLN A N   1 
ATOM   920  C  CA  . GLN A  1 133 ? 0.370   5.114   24.296  1.00 125.30 ? 130  GLN A CA  1 
ATOM   921  C  C   . GLN A  1 133 ? 0.805   5.696   22.919  1.00 129.26 ? 130  GLN A C   1 
ATOM   922  O  O   . GLN A  1 133 ? 1.851   5.315   22.379  1.00 129.01 ? 130  GLN A O   1 
ATOM   923  C  CB  . GLN A  1 133 ? 0.850   3.661   24.520  1.00 126.87 ? 130  GLN A CB  1 
ATOM   924  N  N   . ASN A  1 134 ? 0.019   6.664   22.389  1.00 125.44 ? 131  ASN A N   1 
ATOM   925  C  CA  . ASN A  1 134 ? 0.288   7.362   21.128  1.00 125.15 ? 131  ASN A CA  1 
ATOM   926  C  C   . ASN A  1 134 ? 1.515   8.260   21.259  1.00 129.17 ? 131  ASN A C   1 
ATOM   927  O  O   . ASN A  1 134 ? 2.352   8.272   20.358  1.00 129.13 ? 131  ASN A O   1 
ATOM   928  C  CB  . ASN A  1 134 ? -0.907  8.211   20.713  1.00 126.15 ? 131  ASN A CB  1 
ATOM   929  N  N   . ILE A  1 135 ? 1.621   9.003   22.388  1.00 125.22 ? 132  ILE A N   1 
ATOM   930  C  CA  . ILE A  1 135 ? 2.723   9.918   22.701  1.00 124.63 ? 132  ILE A CA  1 
ATOM   931  C  C   . ILE A  1 135 ? 4.076   9.200   22.921  1.00 127.80 ? 132  ILE A C   1 
ATOM   932  O  O   . ILE A  1 135 ? 5.116   9.862   22.904  1.00 128.10 ? 132  ILE A O   1 
ATOM   933  C  CB  . ILE A  1 135 ? 2.349   10.824  23.896  1.00 127.63 ? 132  ILE A CB  1 
ATOM   934  N  N   . ASN A  1 136 ? 4.058   7.862   23.125  1.00 122.58 ? 133  ASN A N   1 
ATOM   935  C  CA  . ASN A  1 136 ? 5.249   7.027   23.332  1.00 121.28 ? 133  ASN A CA  1 
ATOM   936  C  C   . ASN A  1 136 ? 5.629   6.214   22.075  1.00 121.99 ? 133  ASN A C   1 
ATOM   937  O  O   . ASN A  1 136 ? 6.804   5.868   21.907  1.00 121.51 ? 133  ASN A O   1 
ATOM   938  C  CB  . ASN A  1 136 ? 5.055   6.102   24.538  1.00 122.47 ? 133  ASN A CB  1 
ATOM   939  N  N   . LEU A  1 137 ? 4.632   5.906   21.206  1.00 115.73 ? 134  LEU A N   1 
ATOM   940  C  CA  . LEU A  1 137 ? 4.805   5.143   19.961  1.00 113.83 ? 134  LEU A CA  1 
ATOM   941  C  C   . LEU A  1 137 ? 5.238   6.026   18.784  1.00 113.45 ? 134  LEU A C   1 
ATOM   942  O  O   . LEU A  1 137 ? 6.093   5.609   18.005  1.00 113.42 ? 134  LEU A O   1 
ATOM   943  C  CB  . LEU A  1 137 ? 3.523   4.374   19.608  1.00 113.84 ? 134  LEU A CB  1 
ATOM   944  N  N   . VAL A  1 138 ? 4.642   7.228   18.653  1.00 105.76 ? 135  VAL A N   1 
ATOM   945  C  CA  . VAL A  1 138 ? 4.929   8.198   17.596  1.00 103.29 ? 135  VAL A CA  1 
ATOM   946  C  C   . VAL A  1 138 ? 5.625   9.432   18.206  1.00 101.48 ? 135  VAL A C   1 
ATOM   947  O  O   . VAL A  1 138 ? 4.998   10.470  18.451  1.00 100.42 ? 135  VAL A O   1 
ATOM   948  C  CB  . VAL A  1 138 ? 3.650   8.554   16.798  1.00 107.29 ? 135  VAL A CB  1 
ATOM   949  N  N   . THR A  1 139 ? 6.933   9.287   18.470  1.00 93.84  ? 136  THR A N   1 
ATOM   950  C  CA  . THR A  1 139 ? 7.784   10.303  19.100  1.00 90.96  ? 136  THR A CA  1 
ATOM   951  C  C   . THR A  1 139 ? 8.647   11.086  18.101  1.00 87.97  ? 136  THR A C   1 
ATOM   952  O  O   . THR A  1 139 ? 8.873   10.625  16.982  1.00 86.12  ? 136  THR A O   1 
ATOM   953  C  CB  . THR A  1 139 ? 8.668   9.647   20.185  1.00 98.95  ? 136  THR A CB  1 
ATOM   954  O  OG1 . THR A  1 139 ? 9.468   8.612   19.604  1.00 99.21  ? 136  THR A OG1 1 
ATOM   955  C  CG2 . THR A  1 139 ? 7.863   9.081   21.334  1.00 96.59  ? 136  THR A CG2 1 
ATOM   956  N  N   . GLN A  1 140 ? 9.159   12.257  18.538  1.00 81.37  ? 137  GLN A N   1 
ATOM   957  C  CA  . GLN A  1 140 ? 10.064  13.132  17.777  1.00 80.01  ? 137  GLN A CA  1 
ATOM   958  C  C   . GLN A  1 140 ? 11.389  12.419  17.498  1.00 81.53  ? 137  GLN A C   1 
ATOM   959  O  O   . GLN A  1 140 ? 12.031  12.719  16.493  1.00 81.59  ? 137  GLN A O   1 
ATOM   960  C  CB  . GLN A  1 140 ? 10.358  14.436  18.531  1.00 81.16  ? 137  GLN A CB  1 
ATOM   961  C  CG  . GLN A  1 140 ? 9.123   15.169  19.003  1.00 101.12 ? 137  GLN A CG  1 
ATOM   962  C  CD  . GLN A  1 140 ? 8.783   14.928  20.457  1.00 126.82 ? 137  GLN A CD  1 
ATOM   963  O  OE1 . GLN A  1 140 ? 7.623   15.068  20.878  1.00 123.94 ? 137  GLN A OE1 1 
ATOM   964  N  NE2 . GLN A  1 140 ? 9.774   14.561  21.264  1.00 118.83 ? 137  GLN A NE2 1 
ATOM   965  N  N   . LYS A  1 141 ? 11.799  11.489  18.398  1.00 75.23  ? 138  LYS A N   1 
ATOM   966  C  CA  . LYS A  1 141 ? 13.013  10.675  18.283  1.00 73.88  ? 138  LYS A CA  1 
ATOM   967  C  C   . LYS A  1 141 ? 12.855  9.692   17.107  1.00 76.12  ? 138  LYS A C   1 
ATOM   968  O  O   . LYS A  1 141 ? 13.802  9.482   16.336  1.00 75.85  ? 138  LYS A O   1 
ATOM   969  C  CB  . LYS A  1 141 ? 13.266  9.908   19.597  1.00 75.51  ? 138  LYS A CB  1 
ATOM   970  C  CG  . LYS A  1 141 ? 14.632  9.246   19.674  1.00 80.28  ? 138  LYS A CG  1 
ATOM   971  C  CD  . LYS A  1 141 ? 14.575  7.875   20.311  1.00 89.75  ? 138  LYS A CD  1 
ATOM   972  C  CE  . LYS A  1 141 ? 15.024  7.868   21.753  1.00 98.05  ? 138  LYS A CE  1 
ATOM   973  N  NZ  . LYS A  1 141 ? 15.356  6.489   22.206  1.00 104.91 ? 138  LYS A NZ  1 
ATOM   974  N  N   . LYS A  1 142 ? 11.638  9.121   16.973  1.00 70.60  ? 139  LYS A N   1 
ATOM   975  C  CA  . LYS A  1 142 ? 11.286  8.164   15.928  1.00 69.22  ? 139  LYS A CA  1 
ATOM   976  C  C   . LYS A  1 142 ? 11.222  8.854   14.572  1.00 71.82  ? 139  LYS A C   1 
ATOM   977  O  O   . LYS A  1 142 ? 11.726  8.302   13.585  1.00 71.66  ? 139  LYS A O   1 
ATOM   978  C  CB  . LYS A  1 142 ? 9.975   7.430   16.263  1.00 70.52  ? 139  LYS A CB  1 
ATOM   979  C  CG  . LYS A  1 142 ? 10.157  6.365   17.342  1.00 79.65  ? 139  LYS A CG  1 
ATOM   980  C  CD  . LYS A  1 142 ? 9.274   5.147   17.111  1.00 90.37  ? 139  LYS A CD  1 
ATOM   981  C  CE  . LYS A  1 142 ? 9.243   4.191   18.284  1.00 96.88  ? 139  LYS A CE  1 
ATOM   982  N  NZ  . LYS A  1 142 ? 8.427   4.717   19.415  1.00 104.39 ? 139  LYS A NZ  1 
ATOM   983  N  N   . ALA A  1 143 ? 10.655  10.088  14.540  1.00 65.57  ? 140  ALA A N   1 
ATOM   984  C  CA  . ALA A  1 143 ? 10.527  10.885  13.332  1.00 64.11  ? 140  ALA A CA  1 
ATOM   985  C  C   . ALA A  1 143 ? 11.910  11.182  12.742  1.00 68.68  ? 140  ALA A C   1 
ATOM   986  O  O   . ALA A  1 143 ? 12.078  11.071  11.521  1.00 68.50  ? 140  ALA A O   1 
ATOM   987  C  CB  . ALA A  1 143 ? 9.781   12.176  13.628  1.00 64.25  ? 140  ALA A CB  1 
ATOM   988  N  N   . ARG A  1 144 ? 12.906  11.510  13.618  1.00 64.64  ? 141  ARG A N   1 
ATOM   989  C  CA  . ARG A  1 144 ? 14.286  11.833  13.242  1.00 64.01  ? 141  ARG A CA  1 
ATOM   990  C  C   . ARG A  1 144 ? 15.004  10.666  12.604  1.00 71.43  ? 141  ARG A C   1 
ATOM   991  O  O   . ARG A  1 144 ? 15.681  10.863  11.602  1.00 71.79  ? 141  ARG A O   1 
ATOM   992  C  CB  . ARG A  1 144 ? 15.081  12.390  14.422  1.00 60.66  ? 141  ARG A CB  1 
ATOM   993  C  CG  . ARG A  1 144 ? 14.907  13.893  14.617  1.00 70.96  ? 141  ARG A CG  1 
ATOM   994  C  CD  . ARG A  1 144 ? 15.807  14.466  15.710  1.00 79.54  ? 141  ARG A CD  1 
ATOM   995  N  NE  . ARG A  1 144 ? 15.412  14.015  17.047  1.00 89.32  ? 141  ARG A NE  1 
ATOM   996  C  CZ  . ARG A  1 144 ? 14.569  14.663  17.846  1.00 101.39 ? 141  ARG A CZ  1 
ATOM   997  N  NH1 . ARG A  1 144 ? 14.030  15.813  17.461  1.00 90.05  ? 141  ARG A NH1 1 
ATOM   998  N  NH2 . ARG A  1 144 ? 14.264  14.169  19.037  1.00 83.53  ? 141  ARG A NH2 1 
ATOM   999  N  N   . PHE A  1 145 ? 14.859  9.455   13.161  1.00 69.90  ? 142  PHE A N   1 
ATOM   1000 C  CA  . PHE A  1 145 ? 15.481  8.244   12.618  1.00 70.33  ? 142  PHE A CA  1 
ATOM   1001 C  C   . PHE A  1 145 ? 14.916  7.863   11.233  1.00 69.85  ? 142  PHE A C   1 
ATOM   1002 O  O   . PHE A  1 145 ? 15.684  7.447   10.361  1.00 68.92  ? 142  PHE A O   1 
ATOM   1003 C  CB  . PHE A  1 145 ? 15.330  7.079   13.613  1.00 73.69  ? 142  PHE A CB  1 
ATOM   1004 C  CG  . PHE A  1 145 ? 15.886  5.769   13.112  1.00 77.02  ? 142  PHE A CG  1 
ATOM   1005 C  CD1 . PHE A  1 145 ? 17.260  5.538   13.094  1.00 81.22  ? 142  PHE A CD1 1 
ATOM   1006 C  CD2 . PHE A  1 145 ? 15.038  4.767   12.652  1.00 80.42  ? 142  PHE A CD2 1 
ATOM   1007 C  CE1 . PHE A  1 145 ? 17.775  4.331   12.615  1.00 82.45  ? 142  PHE A CE1 1 
ATOM   1008 C  CE2 . PHE A  1 145 ? 15.553  3.558   12.180  1.00 84.14  ? 142  PHE A CE2 1 
ATOM   1009 C  CZ  . PHE A  1 145 ? 16.919  3.347   12.169  1.00 82.40  ? 142  PHE A CZ  1 
ATOM   1010 N  N   . VAL A  1 146 ? 13.568  7.991   11.053  1.00 63.28  ? 143  VAL A N   1 
ATOM   1011 C  CA  . VAL A  1 146 ? 12.838  7.694   9.808   1.00 60.75  ? 143  VAL A CA  1 
ATOM   1012 C  C   . VAL A  1 146 ? 13.338  8.630   8.683   1.00 62.70  ? 143  VAL A C   1 
ATOM   1013 O  O   . VAL A  1 146 ? 13.672  8.148   7.600   1.00 62.18  ? 143  VAL A O   1 
ATOM   1014 C  CB  . VAL A  1 146 ? 11.302  7.771   10.026  1.00 63.81  ? 143  VAL A CB  1 
ATOM   1015 C  CG1 . VAL A  1 146 ? 10.531  7.754   8.712   1.00 63.35  ? 143  VAL A CG1 1 
ATOM   1016 C  CG2 . VAL A  1 146 ? 10.830  6.645   10.925  1.00 63.69  ? 143  VAL A CG2 1 
ATOM   1017 N  N   . CYS A  1 147 ? 13.454  9.953   8.967   1.00 57.47  ? 144  CYS A N   1 
ATOM   1018 C  CA  . CYS A  1 147 ? 13.913  10.954  8.005   1.00 56.12  ? 144  CYS A CA  1 
ATOM   1019 C  C   . CYS A  1 147 ? 15.316  10.701  7.497   1.00 59.23  ? 144  CYS A C   1 
ATOM   1020 O  O   . CYS A  1 147 ? 15.537  10.799  6.296   1.00 59.19  ? 144  CYS A O   1 
ATOM   1021 C  CB  . CYS A  1 147 ? 13.758  12.359  8.560   1.00 56.44  ? 144  CYS A CB  1 
ATOM   1022 S  SG  . CYS A  1 147 ? 12.038  12.906  8.679   1.00 60.45  ? 144  CYS A SG  1 
ATOM   1023 N  N   . VAL A  1 148 ? 16.249  10.322  8.387   1.00 56.12  ? 145  VAL A N   1 
ATOM   1024 C  CA  . VAL A  1 148 ? 17.637  9.959   8.033   1.00 55.24  ? 145  VAL A CA  1 
ATOM   1025 C  C   . VAL A  1 148 ? 17.591  8.777   7.050   1.00 58.76  ? 145  VAL A C   1 
ATOM   1026 O  O   . VAL A  1 148 ? 18.210  8.856   5.981   1.00 56.72  ? 145  VAL A O   1 
ATOM   1027 C  CB  . VAL A  1 148 ? 18.525  9.638   9.278   1.00 57.50  ? 145  VAL A CB  1 
ATOM   1028 C  CG1 . VAL A  1 148 ? 19.885  9.075   8.866   1.00 57.16  ? 145  VAL A CG1 1 
ATOM   1029 C  CG2 . VAL A  1 148 ? 18.693  10.857  10.163  1.00 56.96  ? 145  VAL A CG2 1 
ATOM   1030 N  N   . GLY A  1 149 ? 16.798  7.750   7.404   1.00 55.91  ? 146  GLY A N   1 
ATOM   1031 C  CA  . GLY A  1 149 ? 16.560  6.555   6.596   1.00 56.25  ? 146  GLY A CA  1 
ATOM   1032 C  C   . GLY A  1 149 ? 16.036  6.899   5.213   1.00 60.78  ? 146  GLY A C   1 
ATOM   1033 O  O   . GLY A  1 149 ? 16.526  6.351   4.219   1.00 61.33  ? 146  GLY A O   1 
ATOM   1034 N  N   . ILE A  1 150 ? 15.072  7.866   5.145   1.00 54.90  ? 147  ILE A N   1 
ATOM   1035 C  CA  . ILE A  1 150 ? 14.479  8.367   3.907   1.00 53.17  ? 147  ILE A CA  1 
ATOM   1036 C  C   . ILE A  1 150 ? 15.535  9.061   3.034   1.00 59.24  ? 147  ILE A C   1 
ATOM   1037 O  O   . ILE A  1 150 ? 15.604  8.760   1.845   1.00 60.02  ? 147  ILE A O   1 
ATOM   1038 C  CB  . ILE A  1 150 ? 13.229  9.238   4.161   1.00 54.43  ? 147  ILE A CB  1 
ATOM   1039 C  CG1 . ILE A  1 150 ? 12.042  8.342   4.578   1.00 53.18  ? 147  ILE A CG1 1 
ATOM   1040 C  CG2 . ILE A  1 150 ? 12.894  10.082  2.923   1.00 53.71  ? 147  ILE A CG2 1 
ATOM   1041 C  CD1 . ILE A  1 150 ? 10.812  9.040   5.165   1.00 48.54  ? 147  ILE A CD1 1 
ATOM   1042 N  N   . TRP A  1 151 ? 16.360  9.962   3.624   1.00 54.99  ? 148  TRP A N   1 
ATOM   1043 C  CA  . TRP A  1 151 ? 17.438  10.666  2.921   1.00 53.21  ? 148  TRP A CA  1 
ATOM   1044 C  C   . TRP A  1 151 ? 18.457  9.687   2.324   1.00 60.58  ? 148  TRP A C   1 
ATOM   1045 O  O   . TRP A  1 151 ? 18.770  9.804   1.138   1.00 62.19  ? 148  TRP A O   1 
ATOM   1046 C  CB  . TRP A  1 151 ? 18.155  11.666  3.832   1.00 49.73  ? 148  TRP A CB  1 
ATOM   1047 C  CG  . TRP A  1 151 ? 17.453  12.982  4.001   1.00 48.96  ? 148  TRP A CG  1 
ATOM   1048 C  CD1 . TRP A  1 151 ? 16.826  13.430  5.123   1.00 51.38  ? 148  TRP A CD1 1 
ATOM   1049 C  CD2 . TRP A  1 151 ? 17.398  14.061  3.052   1.00 48.19  ? 148  TRP A CD2 1 
ATOM   1050 N  NE1 . TRP A  1 151 ? 16.335  14.698  4.919   1.00 50.15  ? 148  TRP A NE1 1 
ATOM   1051 C  CE2 . TRP A  1 151 ? 16.662  15.108  3.652   1.00 51.23  ? 148  TRP A CE2 1 
ATOM   1052 C  CE3 . TRP A  1 151 ? 17.815  14.213  1.715   1.00 48.81  ? 148  TRP A CE3 1 
ATOM   1053 C  CZ2 . TRP A  1 151 ? 16.364  16.301  2.978   1.00 49.76  ? 148  TRP A CZ2 1 
ATOM   1054 C  CZ3 . TRP A  1 151 ? 17.520  15.397  1.050   1.00 49.44  ? 148  TRP A CZ3 1 
ATOM   1055 C  CH2 . TRP A  1 151 ? 16.810  16.427  1.682   1.00 49.89  ? 148  TRP A CH2 1 
ATOM   1056 N  N   . ILE A  1 152 ? 18.955  8.717   3.122   1.00 56.78  ? 149  ILE A N   1 
ATOM   1057 C  CA  . ILE A  1 152 ? 19.934  7.727   2.650   1.00 57.02  ? 149  ILE A CA  1 
ATOM   1058 C  C   . ILE A  1 152 ? 19.356  6.897   1.488   1.00 60.11  ? 149  ILE A C   1 
ATOM   1059 O  O   . ILE A  1 152 ? 19.981  6.821   0.433   1.00 60.89  ? 149  ILE A O   1 
ATOM   1060 C  CB  . ILE A  1 152 ? 20.525  6.836   3.812   1.00 60.11  ? 149  ILE A CB  1 
ATOM   1061 C  CG1 . ILE A  1 152 ? 21.093  7.702   4.993   1.00 60.56  ? 149  ILE A CG1 1 
ATOM   1062 C  CG2 . ILE A  1 152 ? 21.538  5.790   3.311   1.00 58.72  ? 149  ILE A CG2 1 
ATOM   1063 C  CD1 . ILE A  1 152 ? 22.544  8.055   5.108   1.00 72.90  ? 149  ILE A CD1 1 
ATOM   1064 N  N   . PHE A  1 153 ? 18.152  6.334   1.666   1.00 55.41  ? 150  PHE A N   1 
ATOM   1065 C  CA  . PHE A  1 153 ? 17.467  5.529   0.648   1.00 55.53  ? 150  PHE A CA  1 
ATOM   1066 C  C   . PHE A  1 153 ? 17.307  6.264   -0.705  1.00 59.39  ? 150  PHE A C   1 
ATOM   1067 O  O   . PHE A  1 153 ? 17.793  5.755   -1.709  1.00 60.91  ? 150  PHE A O   1 
ATOM   1068 C  CB  . PHE A  1 153 ? 16.121  5.001   1.181   1.00 57.43  ? 150  PHE A CB  1 
ATOM   1069 C  CG  . PHE A  1 153 ? 15.379  4.091   0.231   1.00 60.55  ? 150  PHE A CG  1 
ATOM   1070 C  CD1 . PHE A  1 153 ? 15.838  2.801   -0.028  1.00 63.66  ? 150  PHE A CD1 1 
ATOM   1071 C  CD2 . PHE A  1 153 ? 14.205  4.514   -0.392  1.00 64.35  ? 150  PHE A CD2 1 
ATOM   1072 C  CE1 . PHE A  1 153 ? 15.152  1.964   -0.918  1.00 64.64  ? 150  PHE A CE1 1 
ATOM   1073 C  CE2 . PHE A  1 153 ? 13.512  3.666   -1.273  1.00 66.84  ? 150  PHE A CE2 1 
ATOM   1074 C  CZ  . PHE A  1 153 ? 13.991  2.399   -1.527  1.00 64.17  ? 150  PHE A CZ  1 
ATOM   1075 N  N   . VAL A  1 154 ? 16.710  7.483   -0.704  1.00 53.63  ? 151  VAL A N   1 
ATOM   1076 C  CA  . VAL A  1 154 ? 16.471  8.335   -1.880  1.00 51.78  ? 151  VAL A CA  1 
ATOM   1077 C  C   . VAL A  1 154 ? 17.788  8.789   -2.553  1.00 54.82  ? 151  VAL A C   1 
ATOM   1078 O  O   . VAL A  1 154 ? 17.905  8.623   -3.763  1.00 53.74  ? 151  VAL A O   1 
ATOM   1079 C  CB  . VAL A  1 154 ? 15.515  9.520   -1.584  1.00 54.28  ? 151  VAL A CB  1 
ATOM   1080 C  CG1 . VAL A  1 154 ? 15.338  10.425  -2.810  1.00 53.12  ? 151  VAL A CG1 1 
ATOM   1081 C  CG2 . VAL A  1 154 ? 14.158  9.011   -1.082  1.00 53.68  ? 151  VAL A CG2 1 
ATOM   1082 N  N   . ILE A  1 155 ? 18.764  9.328   -1.783  1.00 52.07  ? 152  ILE A N   1 
ATOM   1083 C  CA  . ILE A  1 155 ? 20.088  9.754   -2.278  1.00 52.27  ? 152  ILE A CA  1 
ATOM   1084 C  C   . ILE A  1 155 ? 20.811  8.607   -3.020  1.00 55.59  ? 152  ILE A C   1 
ATOM   1085 O  O   . ILE A  1 155 ? 21.383  8.856   -4.081  1.00 55.27  ? 152  ILE A O   1 
ATOM   1086 C  CB  . ILE A  1 155 ? 20.968  10.397  -1.146  1.00 55.63  ? 152  ILE A CB  1 
ATOM   1087 C  CG1 . ILE A  1 155 ? 20.576  11.865  -0.908  1.00 55.15  ? 152  ILE A CG1 1 
ATOM   1088 C  CG2 . ILE A  1 155 ? 22.499  10.262  -1.389  1.00 56.47  ? 152  ILE A CG2 1 
ATOM   1089 C  CD1 . ILE A  1 155 ? 20.841  12.351  0.512   1.00 61.16  ? 152  ILE A CD1 1 
ATOM   1090 N  N   . LEU A  1 156 ? 20.739  7.359   -2.495  1.00 51.17  ? 153  LEU A N   1 
ATOM   1091 C  CA  . LEU A  1 156 ? 21.387  6.206   -3.114  1.00 51.43  ? 153  LEU A CA  1 
ATOM   1092 C  C   . LEU A  1 156 ? 20.666  5.646   -4.346  1.00 56.68  ? 153  LEU A C   1 
ATOM   1093 O  O   . LEU A  1 156 ? 21.308  5.448   -5.379  1.00 55.41  ? 153  LEU A O   1 
ATOM   1094 C  CB  . LEU A  1 156 ? 21.648  5.094   -2.099  1.00 51.38  ? 153  LEU A CB  1 
ATOM   1095 C  CG  . LEU A  1 156 ? 22.690  5.403   -1.029  1.00 56.58  ? 153  LEU A CG  1 
ATOM   1096 C  CD1 . LEU A  1 156 ? 22.709  4.320   0.016   1.00 57.21  ? 153  LEU A CD1 1 
ATOM   1097 C  CD2 . LEU A  1 156 ? 24.086  5.632   -1.626  1.00 58.04  ? 153  LEU A CD2 1 
ATOM   1098 N  N   . THR A  1 157 ? 19.343  5.383   -4.241  1.00 53.66  ? 154  THR A N   1 
ATOM   1099 C  CA  . THR A  1 157 ? 18.549  4.807   -5.330  1.00 53.02  ? 154  THR A CA  1 
ATOM   1100 C  C   . THR A  1 157 ? 18.403  5.758   -6.552  1.00 57.35  ? 154  THR A C   1 
ATOM   1101 O  O   . THR A  1 157 ? 18.177  5.273   -7.668  1.00 57.24  ? 154  THR A O   1 
ATOM   1102 C  CB  . THR A  1 157 ? 17.212  4.296   -4.815  1.00 56.57  ? 154  THR A CB  1 
ATOM   1103 O  OG1 . THR A  1 157 ? 16.600  5.338   -4.068  1.00 67.96  ? 154  THR A OG1 1 
ATOM   1104 C  CG2 . THR A  1 157 ? 17.343  3.057   -3.953  1.00 47.46  ? 154  THR A CG2 1 
ATOM   1105 N  N   . SER A  1 158 ? 18.553  7.085   -6.354  1.00 53.40  ? 155  SER A N   1 
ATOM   1106 C  CA  . SER A  1 158 ? 18.473  8.099   -7.408  1.00 52.68  ? 155  SER A CA  1 
ATOM   1107 C  C   . SER A  1 158 ? 19.829  8.396   -8.067  1.00 59.63  ? 155  SER A C   1 
ATOM   1108 O  O   . SER A  1 158 ? 19.852  9.055   -9.106  1.00 59.95  ? 155  SER A O   1 
ATOM   1109 C  CB  . SER A  1 158 ? 17.894  9.396   -6.862  1.00 54.33  ? 155  SER A CB  1 
ATOM   1110 O  OG  . SER A  1 158 ? 16.530  9.236   -6.532  1.00 64.94  ? 155  SER A OG  1 
ATOM   1111 N  N   . SER A  1 159 ? 20.946  7.907   -7.485  1.00 58.12  ? 156  SER A N   1 
ATOM   1112 C  CA  . SER A  1 159 ? 22.320  8.146   -7.974  1.00 58.44  ? 156  SER A CA  1 
ATOM   1113 C  C   . SER A  1 159 ? 22.549  7.831   -9.480  1.00 63.53  ? 156  SER A C   1 
ATOM   1114 O  O   . SER A  1 159 ? 23.276  8.618   -10.080 1.00 63.84  ? 156  SER A O   1 
ATOM   1115 C  CB  . SER A  1 159 ? 23.363  7.442   -7.111  1.00 60.65  ? 156  SER A CB  1 
ATOM   1116 O  OG  . SER A  1 159 ? 23.239  6.034   -7.174  1.00 72.38  ? 156  SER A OG  1 
ATOM   1117 N  N   . PRO A  1 160 ? 21.916  6.828   -10.164 1.00 59.68  ? 157  PRO A N   1 
ATOM   1118 C  CA  . PRO A  1 160 ? 22.168  6.675   -11.612 1.00 59.76  ? 157  PRO A CA  1 
ATOM   1119 C  C   . PRO A  1 160 ? 21.974  7.938   -12.464 1.00 65.66  ? 157  PRO A C   1 
ATOM   1120 O  O   . PRO A  1 160 ? 22.545  8.013   -13.540 1.00 65.82  ? 157  PRO A O   1 
ATOM   1121 C  CB  . PRO A  1 160 ? 21.196  5.569   -12.021 1.00 61.56  ? 157  PRO A CB  1 
ATOM   1122 C  CG  . PRO A  1 160 ? 21.012  4.765   -10.801 1.00 65.37  ? 157  PRO A CG  1 
ATOM   1123 C  CD  . PRO A  1 160 ? 21.021  5.752   -9.676  1.00 60.85  ? 157  PRO A CD  1 
ATOM   1124 N  N   . PHE A  1 161 ? 21.206  8.936   -11.977 1.00 63.70  ? 158  PHE A N   1 
ATOM   1125 C  CA  . PHE A  1 161 ? 20.966  10.213  -12.667 1.00 64.35  ? 158  PHE A CA  1 
ATOM   1126 C  C   . PHE A  1 161 ? 22.186  11.149  -12.621 1.00 73.83  ? 158  PHE A C   1 
ATOM   1127 O  O   . PHE A  1 161 ? 22.268  12.090  -13.419 1.00 74.85  ? 158  PHE A O   1 
ATOM   1128 C  CB  . PHE A  1 161 ? 19.671  10.904  -12.149 1.00 65.29  ? 158  PHE A CB  1 
ATOM   1129 C  CG  . PHE A  1 161 ? 18.434  10.149  -12.579 1.00 65.23  ? 158  PHE A CG  1 
ATOM   1130 C  CD1 . PHE A  1 161 ? 17.900  10.327  -13.849 1.00 66.94  ? 158  PHE A CD1 1 
ATOM   1131 C  CD2 . PHE A  1 161 ? 17.876  9.178   -11.763 1.00 65.69  ? 158  PHE A CD2 1 
ATOM   1132 C  CE1 . PHE A  1 161 ? 16.818  9.564   -14.281 1.00 66.89  ? 158  PHE A CE1 1 
ATOM   1133 C  CE2 . PHE A  1 161 ? 16.788  8.418   -12.196 1.00 67.49  ? 158  PHE A CE2 1 
ATOM   1134 C  CZ  . PHE A  1 161 ? 16.271  8.612   -13.452 1.00 65.22  ? 158  PHE A CZ  1 
ATOM   1135 N  N   . LEU A  1 162 ? 23.127  10.876  -11.696 1.00 73.42  ? 159  LEU A N   1 
ATOM   1136 C  CA  . LEU A  1 162 ? 24.385  11.602  -11.511 1.00 74.89  ? 159  LEU A CA  1 
ATOM   1137 C  C   . LEU A  1 162 ? 25.488  11.032  -12.411 1.00 83.37  ? 159  LEU A C   1 
ATOM   1138 O  O   . LEU A  1 162 ? 26.434  11.750  -12.722 1.00 83.19  ? 159  LEU A O   1 
ATOM   1139 C  CB  . LEU A  1 162 ? 24.862  11.507  -10.046 1.00 74.48  ? 159  LEU A CB  1 
ATOM   1140 C  CG  . LEU A  1 162 ? 24.421  12.572  -9.053  1.00 77.82  ? 159  LEU A CG  1 
ATOM   1141 C  CD1 . LEU A  1 162 ? 25.043  12.308  -7.702  1.00 77.42  ? 159  LEU A CD1 1 
ATOM   1142 C  CD2 . LEU A  1 162 ? 24.820  13.963  -9.508  1.00 78.26  ? 159  LEU A CD2 1 
ATOM   1143 N  N   . MET A  1 163 ? 25.387  9.739   -12.783 1.00 83.31  ? 160  MET A N   1 
ATOM   1144 C  CA  . MET A  1 163 ? 26.377  9.048   -13.603 1.00 84.97  ? 160  MET A CA  1 
ATOM   1145 C  C   . MET A  1 163 ? 25.858  8.712   -15.016 1.00 88.04  ? 160  MET A C   1 
ATOM   1146 O  O   . MET A  1 163 ? 26.291  7.729   -15.620 1.00 87.53  ? 160  MET A O   1 
ATOM   1147 C  CB  . MET A  1 163 ? 26.944  7.817   -12.868 1.00 88.83  ? 160  MET A CB  1 
ATOM   1148 C  CG  . MET A  1 163 ? 25.924  6.772   -12.477 1.00 95.13  ? 160  MET A CG  1 
ATOM   1149 S  SD  . MET A  1 163 ? 26.615  5.561   -11.305 1.00 102.63 ? 160  MET A SD  1 
ATOM   1150 C  CE  . MET A  1 163 ? 26.365  6.435   -9.718  1.00 99.44  ? 160  MET A CE  1 
ATOM   1151 N  N   . ALA A  1 164 ? 24.975  9.568   -15.560 1.00 85.14  ? 161  ALA A N   1 
ATOM   1152 C  CA  . ALA A  1 164 ? 24.408  9.409   -16.903 1.00 85.53  ? 161  ALA A CA  1 
ATOM   1153 C  C   . ALA A  1 164 ? 25.249  10.103  -17.963 1.00 92.07  ? 161  ALA A C   1 
ATOM   1154 O  O   . ALA A  1 164 ? 25.859  11.135  -17.686 1.00 91.48  ? 161  ALA A O   1 
ATOM   1155 C  CB  . ALA A  1 164 ? 22.984  9.930   -16.942 1.00 86.20  ? 161  ALA A CB  1 
ATOM   1156 N  N   . LYS A  1 165 ? 25.277  9.525   -19.178 1.00 91.54  ? 162  LYS A N   1 
ATOM   1157 C  CA  . LYS A  1 165 ? 26.031  10.018  -20.338 1.00 92.36  ? 162  LYS A CA  1 
ATOM   1158 C  C   . LYS A  1 165 ? 25.623  11.440  -20.754 1.00 97.41  ? 162  LYS A C   1 
ATOM   1159 O  O   . LYS A  1 165 ? 24.423  11.739  -20.780 1.00 96.85  ? 162  LYS A O   1 
ATOM   1160 C  CB  . LYS A  1 165 ? 25.874  9.052   -21.530 1.00 95.02  ? 162  LYS A CB  1 
ATOM   1161 N  N   . PRO A  1 166 ? 26.596  12.327  -21.085 1.00 95.00  ? 163  PRO A N   1 
ATOM   1162 C  CA  . PRO A  1 166 ? 26.226  13.692  -21.510 1.00 95.45  ? 163  PRO A CA  1 
ATOM   1163 C  C   . PRO A  1 166 ? 25.418  13.729  -22.815 1.00 100.71 ? 163  PRO A C   1 
ATOM   1164 O  O   . PRO A  1 166 ? 25.610  12.878  -23.686 1.00 100.87 ? 163  PRO A O   1 
ATOM   1165 C  CB  . PRO A  1 166 ? 27.575  14.403  -21.648 1.00 97.09  ? 163  PRO A CB  1 
ATOM   1166 C  CG  . PRO A  1 166 ? 28.569  13.316  -21.848 1.00 101.22 ? 163  PRO A CG  1 
ATOM   1167 C  CD  . PRO A  1 166 ? 28.064  12.141  -21.082 1.00 96.65  ? 163  PRO A CD  1 
ATOM   1168 N  N   . GLN A  1 167 ? 24.501  14.701  -22.937 1.00 97.02  ? 164  GLN A N   1 
ATOM   1169 C  CA  . GLN A  1 167 ? 23.641  14.855  -24.110 1.00 96.76  ? 164  GLN A CA  1 
ATOM   1170 C  C   . GLN A  1 167 ? 24.175  15.979  -25.006 1.00 102.77 ? 164  GLN A C   1 
ATOM   1171 O  O   . GLN A  1 167 ? 24.427  17.083  -24.522 1.00 102.48 ? 164  GLN A O   1 
ATOM   1172 C  CB  . GLN A  1 167 ? 22.196  15.155  -23.676 1.00 97.66  ? 164  GLN A CB  1 
ATOM   1173 C  CG  . GLN A  1 167 ? 21.635  14.203  -22.619 1.00 94.40  ? 164  GLN A CG  1 
ATOM   1174 C  CD  . GLN A  1 167 ? 20.518  14.803  -21.801 1.00 100.62 ? 164  GLN A CD  1 
ATOM   1175 O  OE1 . GLN A  1 167 ? 19.982  15.868  -22.102 1.00 93.88  ? 164  GLN A OE1 1 
ATOM   1176 N  NE2 . GLN A  1 167 ? 20.136  14.122  -20.738 1.00 94.37  ? 164  GLN A NE2 1 
ATOM   1177 N  N   . LYS A  1 168 ? 24.378  15.690  -26.298 1.00 100.94 ? 165  LYS A N   1 
ATOM   1178 C  CA  . LYS A  1 168 ? 24.888  16.655  -27.280 1.00 101.60 ? 165  LYS A CA  1 
ATOM   1179 C  C   . LYS A  1 168 ? 23.995  16.628  -28.519 1.00 109.03 ? 165  LYS A C   1 
ATOM   1180 O  O   . LYS A  1 168 ? 23.611  15.537  -28.955 1.00 109.80 ? 165  LYS A O   1 
ATOM   1181 C  CB  . LYS A  1 168 ? 26.352  16.343  -27.666 1.00 103.36 ? 165  LYS A CB  1 
ATOM   1182 C  CG  . LYS A  1 168 ? 27.391  16.656  -26.589 1.00 112.32 ? 165  LYS A CG  1 
ATOM   1183 C  CD  . LYS A  1 168 ? 27.979  18.052  -26.729 1.00 120.10 ? 165  LYS A CD  1 
ATOM   1184 N  N   . ASP A  1 169 ? 23.653  17.818  -29.077 1.00 106.60 ? 166  ASP A N   1 
ATOM   1185 C  CA  . ASP A  1 169 ? 22.818  17.915  -30.285 1.00 106.92 ? 166  ASP A CA  1 
ATOM   1186 C  C   . ASP A  1 169 ? 23.635  17.777  -31.584 1.00 112.40 ? 166  ASP A C   1 
ATOM   1187 O  O   . ASP A  1 169 ? 24.871  17.717  -31.530 1.00 111.88 ? 166  ASP A O   1 
ATOM   1188 C  CB  . ASP A  1 169 ? 21.937  19.190  -30.294 1.00 108.57 ? 166  ASP A CB  1 
ATOM   1189 C  CG  . ASP A  1 169 ? 22.604  20.548  -30.522 1.00 115.72 ? 166  ASP A CG  1 
ATOM   1190 O  OD1 . ASP A  1 169 ? 23.753  20.580  -31.024 1.00 115.31 ? 166  ASP A OD1 1 
ATOM   1191 O  OD2 . ASP A  1 169 ? 21.965  21.577  -30.220 1.00 120.37 ? 166  ASP A OD2 1 
ATOM   1192 N  N   . GLU A  1 170 ? 22.933  17.754  -32.751 1.00 109.62 ? 167  GLU A N   1 
ATOM   1193 C  CA  . GLU A  1 170 ? 23.508  17.649  -34.103 1.00 109.37 ? 167  GLU A CA  1 
ATOM   1194 C  C   . GLU A  1 170 ? 24.669  18.635  -34.306 1.00 112.73 ? 167  GLU A C   1 
ATOM   1195 O  O   . GLU A  1 170 ? 25.701  18.271  -34.879 1.00 111.91 ? 167  GLU A O   1 
ATOM   1196 C  CB  . GLU A  1 170 ? 22.417  17.877  -35.168 1.00 110.68 ? 167  GLU A CB  1 
ATOM   1197 N  N   . LYS A  1 171 ? 24.500  19.869  -33.780 1.00 108.83 ? 168  LYS A N   1 
ATOM   1198 C  CA  . LYS A  1 171 ? 25.466  20.965  -33.843 1.00 108.20 ? 168  LYS A CA  1 
ATOM   1199 C  C   . LYS A  1 171 ? 26.484  20.947  -32.677 1.00 110.88 ? 168  LYS A C   1 
ATOM   1200 O  O   . LYS A  1 171 ? 27.077  21.986  -32.374 1.00 111.05 ? 168  LYS A O   1 
ATOM   1201 C  CB  . LYS A  1 171 ? 24.728  22.316  -33.926 1.00 110.69 ? 168  LYS A CB  1 
ATOM   1202 N  N   . ASN A  1 172 ? 26.696  19.766  -32.042 1.00 105.55 ? 169  ASN A N   1 
ATOM   1203 C  CA  . ASN A  1 172 ? 27.646  19.519  -30.942 1.00 104.55 ? 169  ASN A CA  1 
ATOM   1204 C  C   . ASN A  1 172 ? 27.467  20.443  -29.689 1.00 106.24 ? 169  ASN A C   1 
ATOM   1205 O  O   . ASN A  1 172 ? 28.428  20.651  -28.935 1.00 105.94 ? 169  ASN A O   1 
ATOM   1206 C  CB  . ASN A  1 172 ? 29.100  19.553  -31.455 1.00 105.12 ? 169  ASN A CB  1 
ATOM   1207 N  N   . ASN A  1 173 ? 26.233  20.955  -29.453 1.00 100.16 ? 170  ASN A N   1 
ATOM   1208 C  CA  . ASN A  1 173 ? 25.892  21.791  -28.288 1.00 98.05  ? 170  ASN A CA  1 
ATOM   1209 C  C   . ASN A  1 173 ? 25.497  20.889  -27.117 1.00 98.64  ? 170  ASN A C   1 
ATOM   1210 O  O   . ASN A  1 173 ? 24.834  19.873  -27.330 1.00 98.03  ? 170  ASN A O   1 
ATOM   1211 C  CB  . ASN A  1 173 ? 24.709  22.715  -28.598 1.00 94.22  ? 170  ASN A CB  1 
ATOM   1212 C  CG  . ASN A  1 173 ? 25.035  23.878  -29.481 1.00 106.48 ? 170  ASN A CG  1 
ATOM   1213 O  OD1 . ASN A  1 173 ? 25.099  23.763  -30.700 1.00 104.40 ? 170  ASN A OD1 1 
ATOM   1214 N  ND2 . ASN A  1 173 ? 25.228  25.036  -28.885 1.00 94.46  ? 170  ASN A ND2 1 
ATOM   1215 N  N   . THR A  1 174 ? 25.867  21.271  -25.884 1.00 92.33  ? 171  THR A N   1 
ATOM   1216 C  CA  . THR A  1 174 ? 25.505  20.500  -24.692 1.00 90.68  ? 171  THR A CA  1 
ATOM   1217 C  C   . THR A  1 174 ? 24.029  20.724  -24.339 1.00 91.37  ? 171  THR A C   1 
ATOM   1218 O  O   . THR A  1 174 ? 23.557  21.866  -24.235 1.00 91.36  ? 171  THR A O   1 
ATOM   1219 C  CB  . THR A  1 174 ? 26.473  20.749  -23.515 1.00 96.96  ? 171  THR A CB  1 
ATOM   1220 O  OG1 . THR A  1 174 ? 27.818  20.555  -23.953 1.00 100.55 ? 171  THR A OG1 1 
ATOM   1221 C  CG2 . THR A  1 174 ? 26.198  19.829  -22.320 1.00 91.58  ? 171  THR A CG2 1 
ATOM   1222 N  N   . LYS A  1 175 ? 23.313  19.610  -24.169 1.00 84.49  ? 172  LYS A N   1 
ATOM   1223 C  CA  . LYS A  1 175 ? 21.895  19.556  -23.823 1.00 82.24  ? 172  LYS A CA  1 
ATOM   1224 C  C   . LYS A  1 175 ? 21.750  19.042  -22.390 1.00 81.53  ? 172  LYS A C   1 
ATOM   1225 O  O   . LYS A  1 175 ? 22.697  18.512  -21.801 1.00 80.90  ? 172  LYS A O   1 
ATOM   1226 C  CB  . LYS A  1 175 ? 21.129  18.636  -24.797 1.00 84.17  ? 172  LYS A CB  1 
ATOM   1227 C  CG  . LYS A  1 175 ? 21.429  18.896  -26.271 1.00 93.13  ? 172  LYS A CG  1 
ATOM   1228 C  CD  . LYS A  1 175 ? 20.185  19.167  -27.080 1.00 99.12  ? 172  LYS A CD  1 
ATOM   1229 C  CE  . LYS A  1 175 ? 19.872  20.632  -27.192 1.00 101.72 ? 172  LYS A CE  1 
ATOM   1230 N  NZ  . LYS A  1 175 ? 18.795  21.007  -26.243 1.00 113.40 ? 172  LYS A NZ  1 
ATOM   1231 N  N   . CYS A  1 176 ? 20.565  19.222  -21.832 1.00 74.31  ? 173  CYS A N   1 
ATOM   1232 C  CA  . CYS A  1 176 ? 20.220  18.780  -20.496 1.00 72.42  ? 173  CYS A CA  1 
ATOM   1233 C  C   . CYS A  1 176 ? 18.721  18.561  -20.460 1.00 79.32  ? 173  CYS A C   1 
ATOM   1234 O  O   . CYS A  1 176 ? 17.997  19.195  -21.232 1.00 80.60  ? 173  CYS A O   1 
ATOM   1235 C  CB  . CYS A  1 176 ? 20.658  19.809  -19.461 1.00 71.46  ? 173  CYS A CB  1 
ATOM   1236 S  SG  . CYS A  1 176 ? 20.901  19.130  -17.799 1.00 74.63  ? 173  CYS A SG  1 
ATOM   1237 N  N   . PHE A  1 177 ? 18.251  17.673  -19.564 1.00 76.85  ? 174  PHE A N   1 
ATOM   1238 C  CA  . PHE A  1 177 ? 16.832  17.353  -19.323 1.00 77.31  ? 174  PHE A CA  1 
ATOM   1239 C  C   . PHE A  1 177 ? 16.090  16.792  -20.572 1.00 88.49  ? 174  PHE A C   1 
ATOM   1240 O  O   . PHE A  1 177 ? 14.886  17.008  -20.717 1.00 88.34  ? 174  PHE A O   1 
ATOM   1241 C  CB  . PHE A  1 177 ? 16.079  18.567  -18.704 1.00 77.45  ? 174  PHE A CB  1 
ATOM   1242 C  CG  . PHE A  1 177 ? 16.914  19.452  -17.802 1.00 77.39  ? 174  PHE A CG  1 
ATOM   1243 C  CD1 . PHE A  1 177 ? 17.370  18.991  -16.570 1.00 78.80  ? 174  PHE A CD1 1 
ATOM   1244 C  CD2 . PHE A  1 177 ? 17.255  20.740  -18.191 1.00 78.54  ? 174  PHE A CD2 1 
ATOM   1245 C  CE1 . PHE A  1 177 ? 18.144  19.808  -15.743 1.00 79.15  ? 174  PHE A CE1 1 
ATOM   1246 C  CE2 . PHE A  1 177 ? 18.039  21.551  -17.369 1.00 80.77  ? 174  PHE A CE2 1 
ATOM   1247 C  CZ  . PHE A  1 177 ? 18.478  21.081  -16.150 1.00 78.46  ? 174  PHE A CZ  1 
ATOM   1248 N  N   . GLU A  1 178 ? 16.801  16.034  -21.437 1.00 90.74  ? 175  GLU A N   1 
ATOM   1249 C  CA  . GLU A  1 178 ? 16.210  15.449  -22.644 1.00 93.28  ? 175  GLU A CA  1 
ATOM   1250 C  C   . GLU A  1 178 ? 15.379  14.187  -22.379 1.00 104.17 ? 175  GLU A C   1 
ATOM   1251 O  O   . GLU A  1 178 ? 15.868  13.261  -21.725 1.00 103.45 ? 175  GLU A O   1 
ATOM   1252 C  CB  . GLU A  1 178 ? 17.267  15.185  -23.736 1.00 94.64  ? 175  GLU A CB  1 
ATOM   1253 C  CG  . GLU A  1 178 ? 17.654  16.415  -24.545 1.00 105.82 ? 175  GLU A CG  1 
ATOM   1254 C  CD  . GLU A  1 178 ? 16.521  17.166  -25.226 1.00 125.17 ? 175  GLU A CD  1 
ATOM   1255 O  OE1 . GLU A  1 178 ? 15.654  16.515  -25.855 1.00 101.03 ? 175  GLU A OE1 1 
ATOM   1256 O  OE2 . GLU A  1 178 ? 16.506  18.414  -25.129 1.00 124.81 ? 175  GLU A OE2 1 
ATOM   1257 N  N   . PRO A  1 179 ? 14.127  14.123  -22.896 1.00 106.84 ? 176  PRO A N   1 
ATOM   1258 C  CA  . PRO A  1 179 ? 13.321  12.909  -22.706 1.00 109.02 ? 176  PRO A CA  1 
ATOM   1259 C  C   . PRO A  1 179 ? 13.587  11.881  -23.809 1.00 119.88 ? 176  PRO A C   1 
ATOM   1260 O  O   . PRO A  1 179 ? 14.031  12.293  -24.890 1.00 120.08 ? 176  PRO A O   1 
ATOM   1261 C  CB  . PRO A  1 179 ? 11.881  13.434  -22.811 1.00 110.36 ? 176  PRO A CB  1 
ATOM   1262 C  CG  . PRO A  1 179 ? 11.961  14.650  -23.678 1.00 114.02 ? 176  PRO A CG  1 
ATOM   1263 C  CD  . PRO A  1 179 ? 13.396  15.132  -23.698 1.00 109.24 ? 176  PRO A CD  1 
ATOM   1264 N  N   . PRO A  1 180 ? 13.279  10.565  -23.627 1.00 120.66 ? 177  PRO A N   1 
ATOM   1265 C  CA  . PRO A  1 180 ? 13.414  9.626   -24.766 1.00 121.99 ? 177  PRO A CA  1 
ATOM   1266 C  C   . PRO A  1 180 ? 12.291  9.989   -25.768 1.00 129.32 ? 177  PRO A C   1 
ATOM   1267 O  O   . PRO A  1 180 ? 11.128  9.653   -25.542 1.00 129.27 ? 177  PRO A O   1 
ATOM   1268 C  CB  . PRO A  1 180 ? 13.243  8.241   -24.111 1.00 123.45 ? 177  PRO A CB  1 
ATOM   1269 C  CG  . PRO A  1 180 ? 13.240  8.495   -22.603 1.00 127.10 ? 177  PRO A CG  1 
ATOM   1270 C  CD  . PRO A  1 180 ? 12.725  9.883   -22.439 1.00 122.20 ? 177  PRO A CD  1 
ATOM   1271 N  N   . GLN A  1 181 ? 12.628  10.803  -26.800 1.00 127.71 ? 178  GLN A N   1 
ATOM   1272 C  CA  . GLN A  1 181 ? 11.681  11.400  -27.754 1.00 128.41 ? 178  GLN A CA  1 
ATOM   1273 C  C   . GLN A  1 181 ? 10.969  10.416  -28.696 1.00 134.19 ? 178  GLN A C   1 
ATOM   1274 O  O   . GLN A  1 181 ? 9.737   10.340  -28.652 1.00 133.88 ? 178  GLN A O   1 
ATOM   1275 C  CB  . GLN A  1 181 ? 12.356  12.516  -28.563 1.00 129.84 ? 178  GLN A CB  1 
ATOM   1276 N  N   . ASP A  1 182 ? 11.724  9.716   -29.575 1.00 131.77 ? 179  ASP A N   1 
ATOM   1277 C  CA  . ASP A  1 182 ? 11.198  8.750   -30.551 1.00 131.94 ? 179  ASP A CA  1 
ATOM   1278 C  C   . ASP A  1 182 ? 12.240  7.676   -30.854 1.00 137.12 ? 179  ASP A C   1 
ATOM   1279 O  O   . ASP A  1 182 ? 13.412  8.005   -31.068 1.00 137.43 ? 179  ASP A O   1 
ATOM   1280 C  CB  . ASP A  1 182 ? 10.773  9.456   -31.849 1.00 133.60 ? 179  ASP A CB  1 
ATOM   1281 N  N   . ASN A  1 183 ? 11.813  6.388   -30.848 1.00 133.66 ? 180  ASN A N   1 
ATOM   1282 C  CA  . ASN A  1 183 ? 12.635  5.186   -31.101 1.00 133.40 ? 180  ASN A CA  1 
ATOM   1283 C  C   . ASN A  1 183 ? 13.760  4.967   -30.054 1.00 136.18 ? 180  ASN A C   1 
ATOM   1284 O  O   . ASN A  1 183 ? 14.505  3.983   -30.149 1.00 135.83 ? 180  ASN A O   1 
ATOM   1285 C  CB  . ASN A  1 183 ? 13.189  5.153   -32.539 1.00 135.01 ? 180  ASN A CB  1 
ATOM   1286 N  N   . GLN A  1 184 ? 13.854  5.860   -29.044 1.00 131.66 ? 181  GLN A N   1 
ATOM   1287 C  CA  . GLN A  1 184 ? 14.807  5.759   -27.937 1.00 130.89 ? 181  GLN A CA  1 
ATOM   1288 C  C   . GLN A  1 184 ? 14.123  4.887   -26.863 1.00 133.27 ? 181  GLN A C   1 
ATOM   1289 O  O   . GLN A  1 184 ? 13.819  5.349   -25.757 1.00 133.23 ? 181  GLN A O   1 
ATOM   1290 C  CB  . GLN A  1 184 ? 15.181  7.160   -27.409 1.00 132.23 ? 181  GLN A CB  1 
ATOM   1291 N  N   . THR A  1 185 ? 13.831  3.622   -27.248 1.00 127.60 ? 182  THR A N   1 
ATOM   1292 C  CA  . THR A  1 185 ? 13.139  2.594   -26.461 1.00 125.96 ? 182  THR A CA  1 
ATOM   1293 C  C   . THR A  1 185 ? 14.124  1.583   -25.882 1.00 124.83 ? 182  THR A C   1 
ATOM   1294 O  O   . THR A  1 185 ? 15.000  1.113   -26.610 1.00 125.11 ? 182  THR A O   1 
ATOM   1295 C  CB  . THR A  1 185 ? 12.003  1.921   -27.296 1.00 136.71 ? 182  THR A CB  1 
ATOM   1296 O  OG1 . THR A  1 185 ? 11.753  0.604   -26.801 1.00 136.63 ? 182  THR A OG1 1 
ATOM   1297 C  CG2 . THR A  1 185 ? 12.322  1.823   -28.793 1.00 135.70 ? 182  THR A CG2 1 
ATOM   1298 N  N   . LYS A  1 186 ? 13.984  1.258   -24.577 1.00 116.66 ? 183  LYS A N   1 
ATOM   1299 C  CA  . LYS A  1 186 ? 14.825  0.285   -23.862 1.00 114.29 ? 183  LYS A CA  1 
ATOM   1300 C  C   . LYS A  1 186 ? 13.964  -0.528  -22.900 1.00 113.50 ? 183  LYS A C   1 
ATOM   1301 O  O   . LYS A  1 186 ? 13.057  0.028   -22.277 1.00 112.57 ? 183  LYS A O   1 
ATOM   1302 C  CB  . LYS A  1 186 ? 15.982  0.964   -23.095 1.00 116.49 ? 183  LYS A CB  1 
ATOM   1303 C  CG  . LYS A  1 186 ? 16.958  1.829   -23.922 1.00 124.59 ? 183  LYS A CG  1 
ATOM   1304 C  CD  . LYS A  1 186 ? 17.823  1.035   -24.907 1.00 131.13 ? 183  LYS A CD  1 
ATOM   1305 C  CE  . LYS A  1 186 ? 19.138  0.586   -24.333 1.00 137.66 ? 183  LYS A CE  1 
ATOM   1306 N  NZ  . LYS A  1 186 ? 19.727  -0.523  -25.128 1.00 144.18 ? 183  LYS A NZ  1 
ATOM   1307 N  N   . ASN A  1 187 ? 14.243  -1.838  -22.778 1.00 107.22 ? 184  ASN A N   1 
ATOM   1308 C  CA  . ASN A  1 187 ? 13.463  -2.725  -21.909 1.00 105.63 ? 184  ASN A CA  1 
ATOM   1309 C  C   . ASN A  1 187 ? 13.826  -2.609  -20.421 1.00 104.61 ? 184  ASN A C   1 
ATOM   1310 O  O   . ASN A  1 187 ? 12.927  -2.747  -19.581 1.00 105.49 ? 184  ASN A O   1 
ATOM   1311 C  CB  . ASN A  1 187 ? 13.516  -4.187  -22.389 1.00 108.17 ? 184  ASN A CB  1 
ATOM   1312 C  CG  . ASN A  1 187 ? 12.937  -5.205  -21.421 1.00 137.31 ? 184  ASN A CG  1 
ATOM   1313 O  OD1 . ASN A  1 187 ? 13.656  -5.784  -20.601 1.00 132.20 ? 184  ASN A OD1 1 
ATOM   1314 N  ND2 . ASN A  1 187 ? 11.630  -5.437  -21.482 1.00 130.19 ? 184  ASN A ND2 1 
ATOM   1315 N  N   A HIS A  1 188 ? 15.110  -2.372  -20.080 0.75 98.49  ? 185  HIS A N   1 
ATOM   1316 N  N   B HIS A  1 188 ? 15.099  -2.363  -20.082 0.25 97.64  ? 185  HIS A N   1 
ATOM   1317 C  CA  A HIS A  1 188 ? 15.496  -2.257  -18.670 0.75 97.16  ? 185  HIS A CA  1 
ATOM   1318 C  CA  B HIS A  1 188 ? 15.466  -2.281  -18.670 0.25 95.76  ? 185  HIS A CA  1 
ATOM   1319 C  C   A HIS A  1 188 ? 15.200  -0.871  -18.077 0.75 96.12  ? 185  HIS A C   1 
ATOM   1320 C  C   B HIS A  1 188 ? 15.253  -0.869  -18.085 0.25 94.98  ? 185  HIS A C   1 
ATOM   1321 O  O   A HIS A  1 188 ? 15.188  -0.719  -16.850 0.75 96.43  ? 185  HIS A O   1 
ATOM   1322 O  O   B HIS A  1 188 ? 15.325  -0.705  -16.865 0.25 94.78  ? 185  HIS A O   1 
ATOM   1323 C  CB  A HIS A  1 188 ? 16.945  -2.684  -18.436 0.75 98.54  ? 185  HIS A CB  1 
ATOM   1324 C  CB  B HIS A  1 188 ? 16.868  -2.844  -18.417 0.25 96.64  ? 185  HIS A CB  1 
ATOM   1325 C  CG  A HIS A  1 188 ? 17.141  -4.164  -18.500 0.75 102.42 ? 185  HIS A CG  1 
ATOM   1326 C  CG  B HIS A  1 188 ? 17.021  -4.257  -18.903 0.25 100.08 ? 185  HIS A CG  1 
ATOM   1327 N  ND1 A HIS A  1 188 ? 17.721  -4.768  -19.602 0.75 104.32 ? 185  HIS A ND1 1 
ATOM   1328 N  ND1 B HIS A  1 188 ? 16.106  -5.244  -18.566 0.25 101.84 ? 185  HIS A ND1 1 
ATOM   1329 C  CD2 A HIS A  1 188 ? 16.811  -5.119  -17.599 0.75 104.50 ? 185  HIS A CD2 1 
ATOM   1330 C  CD2 B HIS A  1 188 ? 17.961  -4.797  -19.712 0.25 101.83 ? 185  HIS A CD2 1 
ATOM   1331 C  CE1 A HIS A  1 188 ? 17.729  -6.065  -19.336 0.75 103.92 ? 185  HIS A CE1 1 
ATOM   1332 C  CE1 B HIS A  1 188 ? 16.527  -6.345  -19.165 0.25 101.25 ? 185  HIS A CE1 1 
ATOM   1333 N  NE2 A HIS A  1 188 ? 17.194  -6.324  -18.141 0.75 104.33 ? 185  HIS A NE2 1 
ATOM   1334 N  NE2 B HIS A  1 188 ? 17.641  -6.127  -19.863 0.25 101.58 ? 185  HIS A NE2 1 
ATOM   1335 N  N   . VAL A  1 189 ? 14.894  0.120   -18.936 1.00 87.37  ? 186  VAL A N   1 
ATOM   1336 C  CA  . VAL A  1 189 ? 14.522  1.468   -18.493 1.00 82.68  ? 186  VAL A CA  1 
ATOM   1337 C  C   . VAL A  1 189 ? 13.035  1.327   -18.057 1.00 79.08  ? 186  VAL A C   1 
ATOM   1338 O  O   . VAL A  1 189 ? 12.593  1.939   -17.082 1.00 78.28  ? 186  VAL A O   1 
ATOM   1339 C  CB  . VAL A  1 189 ? 14.749  2.534   -19.594 1.00 85.06  ? 186  VAL A CB  1 
ATOM   1340 C  CG1 . VAL A  1 189 ? 14.079  3.864   -19.243 1.00 84.03  ? 186  VAL A CG1 1 
ATOM   1341 C  CG2 . VAL A  1 189 ? 16.240  2.745   -19.829 1.00 84.81  ? 186  VAL A CG2 1 
ATOM   1342 N  N   . LEU A  1 190 ? 12.312  0.428   -18.745 1.00 69.97  ? 187  LEU A N   1 
ATOM   1343 C  CA  . LEU A  1 190 ? 10.924  0.098   -18.486 1.00 66.90  ? 187  LEU A CA  1 
ATOM   1344 C  C   . LEU A  1 190 ? 10.776  -0.715  -17.182 1.00 67.05  ? 187  LEU A C   1 
ATOM   1345 O  O   . LEU A  1 190 ? 9.780   -0.570  -16.478 1.00 66.74  ? 187  LEU A O   1 
ATOM   1346 C  CB  . LEU A  1 190 ? 10.350  -0.644  -19.707 1.00 66.29  ? 187  LEU A CB  1 
ATOM   1347 C  CG  . LEU A  1 190 ? 8.831   -0.621  -19.916 1.00 70.86  ? 187  LEU A CG  1 
ATOM   1348 C  CD1 . LEU A  1 190 ? 8.273   0.801   -19.919 1.00 71.18  ? 187  LEU A CD1 1 
ATOM   1349 C  CD2 . LEU A  1 190 ? 8.457   -1.315  -21.203 1.00 72.50  ? 187  LEU A CD2 1 
ATOM   1350 N  N   . VAL A  1 191 ? 11.774  -1.541  -16.849 1.00 60.30  ? 188  VAL A N   1 
ATOM   1351 C  CA  . VAL A  1 191 ? 11.775  -2.340  -15.621 1.00 58.83  ? 188  VAL A CA  1 
ATOM   1352 C  C   . VAL A  1 191 ? 12.105  -1.420  -14.438 1.00 61.89  ? 188  VAL A C   1 
ATOM   1353 O  O   . VAL A  1 191 ? 11.501  -1.562  -13.384 1.00 61.88  ? 188  VAL A O   1 
ATOM   1354 C  CB  . VAL A  1 191 ? 12.703  -3.586  -15.717 1.00 61.66  ? 188  VAL A CB  1 
ATOM   1355 C  CG1 . VAL A  1 191 ? 12.745  -4.356  -14.397 1.00 61.15  ? 188  VAL A CG1 1 
ATOM   1356 C  CG2 . VAL A  1 191 ? 12.264  -4.512  -16.849 1.00 61.09  ? 188  VAL A CG2 1 
ATOM   1357 N  N   . LEU A  1 192 ? 13.010  -0.439  -14.634 1.00 57.37  ? 189  LEU A N   1 
ATOM   1358 C  CA  . LEU A  1 192 ? 13.359  0.546   -13.603 1.00 55.56  ? 189  LEU A CA  1 
ATOM   1359 C  C   . LEU A  1 192 ? 12.206  1.519   -13.358 1.00 56.76  ? 189  LEU A C   1 
ATOM   1360 O  O   . LEU A  1 192 ? 11.985  1.930   -12.221 1.00 56.07  ? 189  LEU A O   1 
ATOM   1361 C  CB  . LEU A  1 192 ? 14.635  1.316   -13.975 1.00 55.28  ? 189  LEU A CB  1 
ATOM   1362 C  CG  . LEU A  1 192 ? 15.932  0.576   -13.829 1.00 59.40  ? 189  LEU A CG  1 
ATOM   1363 C  CD1 . LEU A  1 192 ? 17.037  1.347   -14.480 1.00 58.85  ? 189  LEU A CD1 1 
ATOM   1364 C  CD2 . LEU A  1 192 ? 16.270  0.342   -12.363 1.00 63.58  ? 189  LEU A CD2 1 
ATOM   1365 N  N   . HIS A  1 193 ? 11.464  1.868   -14.429 1.00 51.92  ? 190  HIS A N   1 
ATOM   1366 C  CA  . HIS A  1 193 ? 10.279  2.712   -14.361 1.00 50.97  ? 190  HIS A CA  1 
ATOM   1367 C  C   . HIS A  1 193 ? 9.250   2.053   -13.469 1.00 56.24  ? 190  HIS A C   1 
ATOM   1368 O  O   . HIS A  1 193 ? 8.700   2.745   -12.629 1.00 59.36  ? 190  HIS A O   1 
ATOM   1369 C  CB  . HIS A  1 193 ? 9.669   2.935   -15.754 1.00 50.98  ? 190  HIS A CB  1 
ATOM   1370 C  CG  . HIS A  1 193 ? 8.218   3.313   -15.714 1.00 54.06  ? 190  HIS A CG  1 
ATOM   1371 N  ND1 . HIS A  1 193 ? 7.809   4.546   -15.273 1.00 55.88  ? 190  HIS A ND1 1 
ATOM   1372 C  CD2 . HIS A  1 193 ? 7.123   2.579   -16.013 1.00 56.26  ? 190  HIS A CD2 1 
ATOM   1373 C  CE1 . HIS A  1 193 ? 6.490   4.529   -15.311 1.00 55.26  ? 190  HIS A CE1 1 
ATOM   1374 N  NE2 . HIS A  1 193 ? 6.030   3.367   -15.743 1.00 55.66  ? 190  HIS A NE2 1 
ATOM   1375 N  N   . TYR A  1 194 ? 8.989   0.740   -13.641 1.00 50.62  ? 191  TYR A N   1 
ATOM   1376 C  CA  . TYR A  1 194 ? 7.987   0.022   -12.866 1.00 50.59  ? 191  TYR A CA  1 
ATOM   1377 C  C   . TYR A  1 194 ? 8.347   -0.167  -11.401 1.00 56.37  ? 191  TYR A C   1 
ATOM   1378 O  O   . TYR A  1 194 ? 7.455   -0.007  -10.566 1.00 57.78  ? 191  TYR A O   1 
ATOM   1379 C  CB  . TYR A  1 194 ? 7.588   -1.315  -13.520 1.00 51.70  ? 191  TYR A CB  1 
ATOM   1380 C  CG  . TYR A  1 194 ? 6.535   -1.110  -14.588 1.00 53.43  ? 191  TYR A CG  1 
ATOM   1381 C  CD1 . TYR A  1 194 ? 5.259   -0.650  -14.260 1.00 55.01  ? 191  TYR A CD1 1 
ATOM   1382 C  CD2 . TYR A  1 194 ? 6.837   -1.283  -15.937 1.00 54.15  ? 191  TYR A CD2 1 
ATOM   1383 C  CE1 . TYR A  1 194 ? 4.313   -0.376  -15.242 1.00 54.88  ? 191  TYR A CE1 1 
ATOM   1384 C  CE2 . TYR A  1 194 ? 5.896   -1.009  -16.930 1.00 54.79  ? 191  TYR A CE2 1 
ATOM   1385 C  CZ  . TYR A  1 194 ? 4.629   -0.572  -16.573 1.00 59.27  ? 191  TYR A CZ  1 
ATOM   1386 O  OH  . TYR A  1 194 ? 3.660   -0.348  -17.512 1.00 56.62  ? 191  TYR A OH  1 
ATOM   1387 N  N   . VAL A  1 195 ? 9.614   -0.471  -11.072 1.00 52.36  ? 192  VAL A N   1 
ATOM   1388 C  CA  . VAL A  1 195 ? 10.049  -0.642  -9.673  1.00 52.27  ? 192  VAL A CA  1 
ATOM   1389 C  C   . VAL A  1 195 ? 9.886   0.705   -8.951  1.00 56.07  ? 192  VAL A C   1 
ATOM   1390 O  O   . VAL A  1 195 ? 9.347   0.735   -7.837  1.00 53.92  ? 192  VAL A O   1 
ATOM   1391 C  CB  . VAL A  1 195 ? 11.498  -1.219  -9.519  1.00 56.14  ? 192  VAL A CB  1 
ATOM   1392 C  CG1 . VAL A  1 195 ? 11.817  -1.534  -8.059  1.00 55.63  ? 192  VAL A CG1 1 
ATOM   1393 C  CG2 . VAL A  1 195 ? 11.689  -2.468  -10.373 1.00 56.10  ? 192  VAL A CG2 1 
ATOM   1394 N  N   . SER A  1 196 ? 10.322  1.818   -9.626  1.00 52.06  ? 193  SER A N   1 
ATOM   1395 C  CA  . SER A  1 196 ? 10.245  3.210   -9.163  1.00 50.72  ? 193  SER A CA  1 
ATOM   1396 C  C   . SER A  1 196 ? 8.760   3.644   -8.935  1.00 54.62  ? 193  SER A C   1 
ATOM   1397 O  O   . SER A  1 196 ? 8.443   4.262   -7.911  1.00 53.30  ? 193  SER A O   1 
ATOM   1398 C  CB  . SER A  1 196 ? 10.938  4.134   -10.162 1.00 50.54  ? 193  SER A CB  1 
ATOM   1399 O  OG  . SER A  1 196 ? 10.624  5.496   -9.931  1.00 56.19  ? 193  SER A OG  1 
ATOM   1400 N  N   . LEU A  1 197 ? 7.870   3.305   -9.897  1.00 49.79  ? 194  LEU A N   1 
ATOM   1401 C  CA  . LEU A  1 197 ? 6.443   3.582   -9.857  1.00 48.64  ? 194  LEU A CA  1 
ATOM   1402 C  C   . LEU A  1 197 ? 5.801   2.929   -8.643  1.00 52.65  ? 194  LEU A C   1 
ATOM   1403 O  O   . LEU A  1 197 ? 4.991   3.569   -7.979  1.00 54.09  ? 194  LEU A O   1 
ATOM   1404 C  CB  . LEU A  1 197 ? 5.764   3.053   -11.137 1.00 48.33  ? 194  LEU A CB  1 
ATOM   1405 C  CG  . LEU A  1 197 ? 4.260   3.300   -11.289 1.00 51.29  ? 194  LEU A CG  1 
ATOM   1406 C  CD1 . LEU A  1 197 ? 3.974   4.771   -11.354 1.00 51.15  ? 194  LEU A CD1 1 
ATOM   1407 C  CD2 . LEU A  1 197 ? 3.706   2.593   -12.505 1.00 50.08  ? 194  LEU A CD2 1 
ATOM   1408 N  N   . PHE A  1 198 ? 6.144   1.665   -8.367  1.00 47.47  ? 195  PHE A N   1 
ATOM   1409 C  CA  . PHE A  1 198 ? 5.547   0.927   -7.271  1.00 47.93  ? 195  PHE A CA  1 
ATOM   1410 C  C   . PHE A  1 198 ? 6.098   1.327   -5.894  1.00 49.57  ? 195  PHE A C   1 
ATOM   1411 O  O   . PHE A  1 198 ? 5.318   1.646   -5.005  1.00 48.33  ? 195  PHE A O   1 
ATOM   1412 C  CB  . PHE A  1 198 ? 5.633   -0.597  -7.525  1.00 50.86  ? 195  PHE A CB  1 
ATOM   1413 C  CG  . PHE A  1 198 ? 4.488   -1.077  -8.391  1.00 54.89  ? 195  PHE A CG  1 
ATOM   1414 C  CD1 . PHE A  1 198 ? 3.239   -1.347  -7.839  1.00 60.25  ? 195  PHE A CD1 1 
ATOM   1415 C  CD2 . PHE A  1 198 ? 4.629   -1.176  -9.770  1.00 58.79  ? 195  PHE A CD2 1 
ATOM   1416 C  CE1 . PHE A  1 198 ? 2.169   -1.759  -8.648  1.00 62.10  ? 195  PHE A CE1 1 
ATOM   1417 C  CE2 . PHE A  1 198 ? 3.554   -1.583  -10.578 1.00 62.28  ? 195  PHE A CE2 1 
ATOM   1418 C  CZ  . PHE A  1 198 ? 2.332   -1.868  -10.012 1.00 60.79  ? 195  PHE A CZ  1 
ATOM   1419 N  N   . VAL A  1 199 ? 7.428   1.306   -5.728  1.00 45.53  ? 196  VAL A N   1 
ATOM   1420 C  CA  . VAL A  1 199 ? 8.142   1.602   -4.491  1.00 44.41  ? 196  VAL A CA  1 
ATOM   1421 C  C   . VAL A  1 199 ? 8.050   3.092   -4.136  1.00 49.09  ? 196  VAL A C   1 
ATOM   1422 O  O   . VAL A  1 199 ? 7.858   3.416   -2.957  1.00 49.58  ? 196  VAL A O   1 
ATOM   1423 C  CB  . VAL A  1 199 ? 9.618   1.098   -4.585  1.00 47.98  ? 196  VAL A CB  1 
ATOM   1424 C  CG1 . VAL A  1 199 ? 10.459  1.558   -3.402  1.00 47.92  ? 196  VAL A CG1 1 
ATOM   1425 C  CG2 . VAL A  1 199 ? 9.681   -0.424  -4.721  1.00 47.68  ? 196  VAL A CG2 1 
ATOM   1426 N  N   . GLY A  1 200 ? 8.169   3.963   -5.150  1.00 44.29  ? 197  GLY A N   1 
ATOM   1427 C  CA  . GLY A  1 200 ? 8.193   5.409   -4.990  1.00 44.66  ? 197  GLY A CA  1 
ATOM   1428 C  C   . GLY A  1 200 ? 6.901   6.190   -5.100  1.00 49.91  ? 197  GLY A C   1 
ATOM   1429 O  O   . GLY A  1 200 ? 6.891   7.366   -4.713  1.00 49.75  ? 197  GLY A O   1 
ATOM   1430 N  N   . PHE A  1 201 ? 5.814   5.571   -5.630  1.00 46.60  ? 198  PHE A N   1 
ATOM   1431 C  CA  . PHE A  1 201 ? 4.522   6.243   -5.787  1.00 46.85  ? 198  PHE A CA  1 
ATOM   1432 C  C   . PHE A  1 201 ? 3.302   5.415   -5.391  1.00 51.81  ? 198  PHE A C   1 
ATOM   1433 O  O   . PHE A  1 201 ? 2.494   5.921   -4.605  1.00 51.08  ? 198  PHE A O   1 
ATOM   1434 C  CB  . PHE A  1 201 ? 4.311   6.828   -7.199  1.00 48.59  ? 198  PHE A CB  1 
ATOM   1435 C  CG  . PHE A  1 201 ? 2.983   7.551   -7.327  1.00 49.25  ? 198  PHE A CG  1 
ATOM   1436 C  CD1 . PHE A  1 201 ? 2.718   8.696   -6.579  1.00 50.45  ? 198  PHE A CD1 1 
ATOM   1437 C  CD2 . PHE A  1 201 ? 1.979   7.057   -8.154  1.00 49.98  ? 198  PHE A CD2 1 
ATOM   1438 C  CE1 . PHE A  1 201 ? 1.479   9.330   -6.660  1.00 50.38  ? 198  PHE A CE1 1 
ATOM   1439 C  CE2 . PHE A  1 201 ? 0.741   7.698   -8.232  1.00 51.73  ? 198  PHE A CE2 1 
ATOM   1440 C  CZ  . PHE A  1 201 ? 0.498   8.820   -7.473  1.00 49.34  ? 198  PHE A CZ  1 
ATOM   1441 N  N   . ILE A  1 202 ? 3.116   4.203   -5.958  1.00 49.08  ? 199  ILE A N   1 
ATOM   1442 C  CA  . ILE A  1 202 ? 1.926   3.375   -5.676  1.00 48.89  ? 199  ILE A CA  1 
ATOM   1443 C  C   . ILE A  1 202 ? 1.882   2.891   -4.202  1.00 53.06  ? 199  ILE A C   1 
ATOM   1444 O  O   . ILE A  1 202 ? 0.833   3.046   -3.585  1.00 54.93  ? 199  ILE A O   1 
ATOM   1445 C  CB  . ILE A  1 202 ? 1.695   2.223   -6.694  1.00 52.14  ? 199  ILE A CB  1 
ATOM   1446 C  CG1 . ILE A  1 202 ? 1.559   2.794   -8.136  1.00 52.27  ? 199  ILE A CG1 1 
ATOM   1447 C  CG2 . ILE A  1 202 ? 0.443   1.417   -6.321  1.00 54.28  ? 199  ILE A CG2 1 
ATOM   1448 C  CD1 . ILE A  1 202 ? 1.570   1.804   -9.250  1.00 58.42  ? 199  ILE A CD1 1 
ATOM   1449 N  N   . ILE A  1 203 ? 2.965   2.329   -3.641  1.00 47.52  ? 200  ILE A N   1 
ATOM   1450 C  CA  . ILE A  1 203 ? 2.940   1.881   -2.240  1.00 47.02  ? 200  ILE A CA  1 
ATOM   1451 C  C   . ILE A  1 203 ? 2.728   3.090   -1.318  1.00 51.88  ? 200  ILE A C   1 
ATOM   1452 O  O   . ILE A  1 203 ? 1.779   3.018   -0.540  1.00 50.94  ? 200  ILE A O   1 
ATOM   1453 C  CB  . ILE A  1 203 ? 4.115   0.945   -1.802  1.00 49.65  ? 200  ILE A CB  1 
ATOM   1454 C  CG1 . ILE A  1 203 ? 4.001   -0.434  -2.498  1.00 48.58  ? 200  ILE A CG1 1 
ATOM   1455 C  CG2 . ILE A  1 203 ? 4.130   0.755   -0.266  1.00 51.46  ? 200  ILE A CG2 1 
ATOM   1456 C  CD1 . ILE A  1 203 ? 5.220   -1.357  -2.365  1.00 48.34  ? 200  ILE A CD1 1 
ATOM   1457 N  N   . PRO A  1 204 ? 3.504   4.225   -1.413  1.00 50.43  ? 201  PRO A N   1 
ATOM   1458 C  CA  . PRO A  1 204 ? 3.211   5.388   -0.550  1.00 49.49  ? 201  PRO A CA  1 
ATOM   1459 C  C   . PRO A  1 204 ? 1.783   5.920   -0.676  1.00 52.71  ? 201  PRO A C   1 
ATOM   1460 O  O   . PRO A  1 204 ? 1.164   6.175   0.352   1.00 53.03  ? 201  PRO A O   1 
ATOM   1461 C  CB  . PRO A  1 204 ? 4.250   6.413   -0.987  1.00 51.31  ? 201  PRO A CB  1 
ATOM   1462 C  CG  . PRO A  1 204 ? 5.352   5.609   -1.567  1.00 55.49  ? 201  PRO A CG  1 
ATOM   1463 C  CD  . PRO A  1 204 ? 4.678   4.507   -2.275  1.00 51.37  ? 201  PRO A CD  1 
ATOM   1464 N  N   . PHE A  1 205 ? 1.231   6.025   -1.908  1.00 49.40  ? 202  PHE A N   1 
ATOM   1465 C  CA  . PHE A  1 205 ? -0.156  6.451   -2.113  1.00 49.85  ? 202  PHE A CA  1 
ATOM   1466 C  C   . PHE A  1 205 ? -1.205  5.522   -1.444  1.00 54.75  ? 202  PHE A C   1 
ATOM   1467 O  O   . PHE A  1 205 ? -2.154  6.033   -0.841  1.00 54.54  ? 202  PHE A O   1 
ATOM   1468 C  CB  . PHE A  1 205 ? -0.484  6.642   -3.594  1.00 52.33  ? 202  PHE A CB  1 
ATOM   1469 C  CG  . PHE A  1 205 ? -1.689  7.531   -3.886  1.00 55.21  ? 202  PHE A CG  1 
ATOM   1470 C  CD1 . PHE A  1 205 ? -2.181  8.418   -2.924  1.00 58.63  ? 202  PHE A CD1 1 
ATOM   1471 C  CD2 . PHE A  1 205 ? -2.273  7.544   -5.145  1.00 57.58  ? 202  PHE A CD2 1 
ATOM   1472 C  CE1 . PHE A  1 205 ? -3.263  9.260   -3.209  1.00 59.60  ? 202  PHE A CE1 1 
ATOM   1473 C  CE2 . PHE A  1 205 ? -3.364  8.367   -5.420  1.00 60.30  ? 202  PHE A CE2 1 
ATOM   1474 C  CZ  . PHE A  1 205 ? -3.840  9.235   -4.460  1.00 58.69  ? 202  PHE A CZ  1 
ATOM   1475 N  N   . VAL A  1 206 ? -1.034  4.178   -1.534  1.00 50.60  ? 203  VAL A N   1 
ATOM   1476 C  CA  . VAL A  1 206 ? -1.960  3.213   -0.920  1.00 50.81  ? 203  VAL A CA  1 
ATOM   1477 C  C   . VAL A  1 206 ? -1.974  3.377   0.610   1.00 57.26  ? 203  VAL A C   1 
ATOM   1478 O  O   . VAL A  1 206 ? -3.064  3.443   1.189   1.00 57.79  ? 203  VAL A O   1 
ATOM   1479 C  CB  . VAL A  1 206 ? -1.752  1.742   -1.379  1.00 54.35  ? 203  VAL A CB  1 
ATOM   1480 C  CG1 . VAL A  1 206 ? -2.590  0.775   -0.541  1.00 54.15  ? 203  VAL A CG1 1 
ATOM   1481 C  CG2 . VAL A  1 206 ? -2.090  1.579   -2.859  1.00 53.61  ? 203  VAL A CG2 1 
ATOM   1482 N  N   . ILE A  1 207 ? -0.780  3.510   1.247   1.00 54.67  ? 204  ILE A N   1 
ATOM   1483 C  CA  . ILE A  1 207 ? -0.608  3.751   2.699   1.00 54.62  ? 204  ILE A CA  1 
ATOM   1484 C  C   . ILE A  1 207 ? -1.390  5.021   3.119   1.00 60.20  ? 204  ILE A C   1 
ATOM   1485 O  O   . ILE A  1 207 ? -2.097  4.988   4.128   1.00 61.46  ? 204  ILE A O   1 
ATOM   1486 C  CB  . ILE A  1 207 ? 0.898   3.795   3.108   1.00 57.45  ? 204  ILE A CB  1 
ATOM   1487 C  CG1 . ILE A  1 207 ? 1.581   2.423   2.861   1.00 57.38  ? 204  ILE A CG1 1 
ATOM   1488 C  CG2 . ILE A  1 207 ? 1.095   4.284   4.565   1.00 57.76  ? 204  ILE A CG2 1 
ATOM   1489 C  CD1 . ILE A  1 207 ? 3.116   2.463   2.866   1.00 62.67  ? 204  ILE A CD1 1 
ATOM   1490 N  N   . ILE A  1 208 ? -1.292  6.117   2.318   1.00 55.36  ? 205  ILE A N   1 
ATOM   1491 C  CA  . ILE A  1 208 ? -2.038  7.367   2.537   1.00 53.53  ? 205  ILE A CA  1 
ATOM   1492 C  C   . ILE A  1 208 ? -3.560  7.120   2.386   1.00 57.10  ? 205  ILE A C   1 
ATOM   1493 O  O   . ILE A  1 208 ? -4.276  7.508   3.301   1.00 59.36  ? 205  ILE A O   1 
ATOM   1494 C  CB  . ILE A  1 208 ? -1.472  8.543   1.683   1.00 55.15  ? 205  ILE A CB  1 
ATOM   1495 C  CG1 . ILE A  1 208 ? -0.286  9.173   2.410   1.00 54.61  ? 205  ILE A CG1 1 
ATOM   1496 C  CG2 . ILE A  1 208 ? -2.507  9.617   1.297   1.00 52.81  ? 205  ILE A CG2 1 
ATOM   1497 C  CD1 . ILE A  1 208 ? 0.858   9.197   1.597   1.00 58.27  ? 205  ILE A CD1 1 
ATOM   1498 N  N   . ILE A  1 209 ? -4.050  6.450   1.303   1.00 51.75  ? 206  ILE A N   1 
ATOM   1499 C  CA  . ILE A  1 209 ? -5.479  6.131   1.139   1.00 51.98  ? 206  ILE A CA  1 
ATOM   1500 C  C   . ILE A  1 209 ? -6.012  5.421   2.418   1.00 57.06  ? 206  ILE A C   1 
ATOM   1501 O  O   . ILE A  1 209 ? -6.972  5.897   3.011   1.00 57.36  ? 206  ILE A O   1 
ATOM   1502 C  CB  . ILE A  1 209 ? -5.802  5.278   -0.138  1.00 55.61  ? 206  ILE A CB  1 
ATOM   1503 C  CG1 . ILE A  1 209 ? -5.245  5.874   -1.449  1.00 56.14  ? 206  ILE A CG1 1 
ATOM   1504 C  CG2 . ILE A  1 209 ? -7.306  4.995   -0.267  1.00 56.59  ? 206  ILE A CG2 1 
ATOM   1505 C  CD1 . ILE A  1 209 ? -5.876  7.130   -1.956  1.00 68.68  ? 206  ILE A CD1 1 
ATOM   1506 N  N   . VAL A  1 210 ? -5.351  4.330   2.859   1.00 54.38  ? 207  VAL A N   1 
ATOM   1507 C  CA  . VAL A  1 210 ? -5.722  3.533   4.040   1.00 54.52  ? 207  VAL A CA  1 
ATOM   1508 C  C   . VAL A  1 210 ? -5.702  4.364   5.329   1.00 60.04  ? 207  VAL A C   1 
ATOM   1509 O  O   . VAL A  1 210 ? -6.720  4.393   6.018   1.00 59.17  ? 207  VAL A O   1 
ATOM   1510 C  CB  . VAL A  1 210 ? -4.895  2.218   4.164   1.00 57.57  ? 207  VAL A CB  1 
ATOM   1511 C  CG1 . VAL A  1 210 ? -5.215  1.472   5.458   1.00 57.39  ? 207  VAL A CG1 1 
ATOM   1512 C  CG2 . VAL A  1 210 ? -5.127  1.314   2.959   1.00 56.71  ? 207  VAL A CG2 1 
ATOM   1513 N  N   . CYS A  1 211 ? -4.565  5.040   5.644   1.00 59.00  ? 208  CYS A N   1 
ATOM   1514 C  CA  . CYS A  1 211 ? -4.419  5.909   6.824   1.00 59.58  ? 208  CYS A CA  1 
ATOM   1515 C  C   . CYS A  1 211 ? -5.502  6.983   6.886   1.00 62.69  ? 208  CYS A C   1 
ATOM   1516 O  O   . CYS A  1 211 ? -6.093  7.184   7.946   1.00 63.81  ? 208  CYS A O   1 
ATOM   1517 C  CB  . CYS A  1 211 ? -3.027  6.528   6.892   1.00 60.33  ? 208  CYS A CB  1 
ATOM   1518 S  SG  . CYS A  1 211 ? -1.728  5.363   7.371   1.00 64.76  ? 208  CYS A SG  1 
ATOM   1519 N  N   . TYR A  1 212 ? -5.772  7.655   5.761   1.00 56.40  ? 209  TYR A N   1 
ATOM   1520 C  CA  . TYR A  1 212 ? -6.779  8.706   5.725   1.00 55.96  ? 209  TYR A CA  1 
ATOM   1521 C  C   . TYR A  1 212 ? -8.188  8.162   5.884   1.00 64.93  ? 209  TYR A C   1 
ATOM   1522 O  O   . TYR A  1 212 ? -9.022  8.856   6.463   1.00 66.89  ? 209  TYR A O   1 
ATOM   1523 C  CB  . TYR A  1 212 ? -6.634  9.604   4.486   1.00 54.66  ? 209  TYR A CB  1 
ATOM   1524 C  CG  . TYR A  1 212 ? -5.410  10.502  4.507   1.00 53.16  ? 209  TYR A CG  1 
ATOM   1525 C  CD1 . TYR A  1 212 ? -4.597  10.585  5.636   1.00 53.68  ? 209  TYR A CD1 1 
ATOM   1526 C  CD2 . TYR A  1 212 ? -5.069  11.273  3.401   1.00 53.37  ? 209  TYR A CD2 1 
ATOM   1527 C  CE1 . TYR A  1 212 ? -3.466  11.392  5.654   1.00 52.38  ? 209  TYR A CE1 1 
ATOM   1528 C  CE2 . TYR A  1 212 ? -3.943  12.097  3.414   1.00 53.94  ? 209  TYR A CE2 1 
ATOM   1529 C  CZ  . TYR A  1 212 ? -3.148  12.153  4.543   1.00 58.11  ? 209  TYR A CZ  1 
ATOM   1530 O  OH  . TYR A  1 212 ? -2.048  12.962  4.562   1.00 60.32  ? 209  TYR A OH  1 
ATOM   1531 N  N   . THR A  1 213 ? -8.446  6.911   5.434   1.00 61.84  ? 210  THR A N   1 
ATOM   1532 C  CA  . THR A  1 213 ? -9.743  6.266   5.611   1.00 61.48  ? 210  THR A CA  1 
ATOM   1533 C  C   . THR A  1 213 ? -9.976  6.048   7.117   1.00 66.94  ? 210  THR A C   1 
ATOM   1534 O  O   . THR A  1 213 ? -11.033 6.415   7.626   1.00 66.90  ? 210  THR A O   1 
ATOM   1535 C  CB  . THR A  1 213 ? -9.852  4.985   4.764   1.00 65.76  ? 210  THR A CB  1 
ATOM   1536 O  OG1 . THR A  1 213 ? -9.700  5.323   3.378   1.00 59.00  ? 210  THR A OG1 1 
ATOM   1537 C  CG2 . THR A  1 213 ? -11.200 4.267   4.968   1.00 65.24  ? 210  THR A CG2 1 
ATOM   1538 N  N   . MET A  1 214 ? -8.958  5.520   7.824   1.00 64.36  ? 211  MET A N   1 
ATOM   1539 C  CA  . MET A  1 214 ? -8.985  5.260   9.265   1.00 64.55  ? 211  MET A CA  1 
ATOM   1540 C  C   . MET A  1 214 ? -9.178  6.525   10.100  1.00 67.42  ? 211  MET A C   1 
ATOM   1541 O  O   . MET A  1 214 ? -9.933  6.484   11.069  1.00 66.30  ? 211  MET A O   1 
ATOM   1542 C  CB  . MET A  1 214 ? -7.719  4.531   9.705   1.00 67.57  ? 211  MET A CB  1 
ATOM   1543 C  CG  . MET A  1 214 ? -7.771  3.063   9.455   1.00 72.66  ? 211  MET A CG  1 
ATOM   1544 S  SD  . MET A  1 214 ? -6.207  2.312   9.933   1.00 78.26  ? 211  MET A SD  1 
ATOM   1545 C  CE  . MET A  1 214 ? -6.258  0.930   8.949   1.00 75.21  ? 211  MET A CE  1 
ATOM   1546 N  N   . ILE A  1 215 ? -8.494  7.641   9.729   1.00 63.12  ? 212  ILE A N   1 
ATOM   1547 C  CA  . ILE A  1 215 ? -8.580  8.938   10.404  1.00 61.56  ? 212  ILE A CA  1 
ATOM   1548 C  C   . ILE A  1 215 ? -9.987  9.499   10.249  1.00 66.41  ? 212  ILE A C   1 
ATOM   1549 O  O   . ILE A  1 215 ? -10.584 9.868   11.254  1.00 67.15  ? 212  ILE A O   1 
ATOM   1550 C  CB  . ILE A  1 215 ? -7.466  9.953   9.964   1.00 63.42  ? 212  ILE A CB  1 
ATOM   1551 C  CG1 . ILE A  1 215 ? -6.059  9.468   10.386  1.00 63.38  ? 212  ILE A CG1 1 
ATOM   1552 C  CG2 . ILE A  1 215 ? -7.725  11.379  10.494  1.00 61.50  ? 212  ILE A CG2 1 
ATOM   1553 C  CD1 . ILE A  1 215 ? -4.882  10.184  9.655   1.00 68.83  ? 212  ILE A CD1 1 
ATOM   1554 N  N   . ILE A  1 216 ? -10.527 9.538   9.020   1.00 62.81  ? 213  ILE A N   1 
ATOM   1555 C  CA  . ILE A  1 216 ? -11.867 10.074  8.751   1.00 63.87  ? 213  ILE A CA  1 
ATOM   1556 C  C   . ILE A  1 216 ? -12.978 9.308   9.522   1.00 70.46  ? 213  ILE A C   1 
ATOM   1557 O  O   . ILE A  1 216 ? -13.846 9.955   10.108  1.00 70.99  ? 213  ILE A O   1 
ATOM   1558 C  CB  . ILE A  1 216 ? -12.138 10.189  7.229   1.00 67.09  ? 213  ILE A CB  1 
ATOM   1559 C  CG1 . ILE A  1 216 ? -11.312 11.365  6.646   1.00 67.82  ? 213  ILE A CG1 1 
ATOM   1560 C  CG2 . ILE A  1 216 ? -13.643 10.364  6.926   1.00 67.14  ? 213  ILE A CG2 1 
ATOM   1561 C  CD1 . ILE A  1 216 ? -10.992 11.267  5.165   1.00 76.86  ? 213  ILE A CD1 1 
ATOM   1562 N  N   . LEU A  1 217 ? -12.915 7.960   9.567   1.00 67.96  ? 214  LEU A N   1 
ATOM   1563 C  CA  . LEU A  1 217 ? -13.885 7.126   10.297  1.00 67.23  ? 214  LEU A CA  1 
ATOM   1564 C  C   . LEU A  1 217 ? -13.803 7.353   11.805  1.00 70.72  ? 214  LEU A C   1 
ATOM   1565 O  O   . LEU A  1 217 ? -14.840 7.439   12.466  1.00 69.97  ? 214  LEU A O   1 
ATOM   1566 C  CB  . LEU A  1 217 ? -13.718 5.632   9.951   1.00 66.91  ? 214  LEU A CB  1 
ATOM   1567 C  CG  . LEU A  1 217 ? -13.987 5.248   8.498   1.00 71.22  ? 214  LEU A CG  1 
ATOM   1568 C  CD1 . LEU A  1 217 ? -13.539 3.828   8.213   1.00 70.87  ? 214  LEU A CD1 1 
ATOM   1569 C  CD2 . LEU A  1 217 ? -15.447 5.485   8.106   1.00 73.56  ? 214  LEU A CD2 1 
ATOM   1570 N  N   . THR A  1 218 ? -12.571 7.501   12.331  1.00 67.92  ? 215  THR A N   1 
ATOM   1571 C  CA  . THR A  1 218 ? -12.292 7.794   13.741  1.00 68.09  ? 215  THR A CA  1 
ATOM   1572 C  C   . THR A  1 218 ? -12.834 9.179   14.089  1.00 73.05  ? 215  THR A C   1 
ATOM   1573 O  O   . THR A  1 218 ? -13.451 9.335   15.139  1.00 73.65  ? 215  THR A O   1 
ATOM   1574 C  CB  . THR A  1 218 ? -10.790 7.700   14.033  1.00 72.45  ? 215  THR A CB  1 
ATOM   1575 O  OG1 . THR A  1 218 ? -10.340 6.381   13.724  1.00 73.89  ? 215  THR A OG1 1 
ATOM   1576 C  CG2 . THR A  1 218 ? -10.449 8.019   15.474  1.00 67.91  ? 215  THR A CG2 1 
ATOM   1577 N  N   . LEU A  1 219 ? -12.609 10.174  13.208  1.00 69.07  ? 216  LEU A N   1 
ATOM   1578 C  CA  . LEU A  1 219 ? -13.062 11.552  13.402  1.00 68.50  ? 216  LEU A CA  1 
ATOM   1579 C  C   . LEU A  1 219 ? -14.580 11.683  13.436  1.00 73.66  ? 216  LEU A C   1 
ATOM   1580 O  O   . LEU A  1 219 ? -15.073 12.567  14.132  1.00 73.28  ? 216  LEU A O   1 
ATOM   1581 C  CB  . LEU A  1 219 ? -12.442 12.526  12.379  1.00 67.86  ? 216  LEU A CB  1 
ATOM   1582 C  CG  . LEU A  1 219 ? -10.982 12.883  12.593  1.00 71.13  ? 216  LEU A CG  1 
ATOM   1583 C  CD1 . LEU A  1 219 ? -10.544 13.901  11.598  1.00 71.13  ? 216  LEU A CD1 1 
ATOM   1584 C  CD2 . LEU A  1 219 ? -10.748 13.423  13.968  1.00 72.72  ? 216  LEU A CD2 1 
ATOM   1585 N  N   . LEU A  1 220 ? -15.314 10.802  12.710  1.00 71.40  ? 217  LEU A N   1 
ATOM   1586 C  CA  . LEU A  1 220 ? -16.784 10.777  12.696  1.00 71.36  ? 217  LEU A CA  1 
ATOM   1587 C  C   . LEU A  1 220 ? -17.307 10.214  14.012  1.00 76.26  ? 217  LEU A C   1 
ATOM   1588 O  O   . LEU A  1 220 ? -18.222 10.803  14.596  1.00 75.12  ? 217  LEU A O   1 
ATOM   1589 C  CB  . LEU A  1 220 ? -17.323 9.945   11.521  1.00 70.99  ? 217  LEU A CB  1 
ATOM   1590 C  CG  . LEU A  1 220 ? -17.349 10.633  10.177  1.00 75.00  ? 217  LEU A CG  1 
ATOM   1591 C  CD1 . LEU A  1 220 ? -17.462 9.614   9.065   1.00 74.69  ? 217  LEU A CD1 1 
ATOM   1592 C  CD2 . LEU A  1 220 ? -18.480 11.655  10.111  1.00 77.61  ? 217  LEU A CD2 1 
ATOM   1593 N  N   . LYS A  1 221 ? -16.705 9.078   14.480  1.00 73.37  ? 218  LYS A N   1 
ATOM   1594 C  CA  . LYS A  1 221 ? -17.041 8.405   15.738  1.00 73.36  ? 218  LYS A CA  1 
ATOM   1595 C  C   . LYS A  1 221 ? -16.906 9.376   16.915  1.00 78.68  ? 218  LYS A C   1 
ATOM   1596 O  O   . LYS A  1 221 ? -17.803 9.445   17.749  1.00 78.21  ? 218  LYS A O   1 
ATOM   1597 C  CB  . LYS A  1 221 ? -16.143 7.181   15.957  1.00 75.40  ? 218  LYS A CB  1 
ATOM   1598 C  CG  . LYS A  1 221 ? -16.730 6.140   16.918  1.00 84.09  ? 218  LYS A CG  1 
ATOM   1599 C  CD  . LYS A  1 221 ? -15.662 5.261   17.566  1.00 93.09  ? 218  LYS A CD  1 
ATOM   1600 C  CE  . LYS A  1 221 ? -14.931 4.359   16.594  1.00 106.66 ? 218  LYS A CE  1 
ATOM   1601 N  NZ  . LYS A  1 221 ? -13.500 4.194   16.969  1.00 117.84 ? 218  LYS A NZ  1 
ATOM   1602 N  N   . LYS A  1 222 ? -15.797 10.144  16.955  1.00 76.73  ? 219  LYS A N   1 
ATOM   1603 C  CA  . LYS A  1 222 ? -15.504 11.140  17.985  1.00 76.89  ? 219  LYS A CA  1 
ATOM   1604 C  C   . LYS A  1 222 ? -16.374 12.386  17.845  1.00 82.62  ? 219  LYS A C   1 
ATOM   1605 O  O   . LYS A  1 222 ? -16.688 13.008  18.859  1.00 84.00  ? 219  LYS A O   1 
ATOM   1606 C  CB  . LYS A  1 222 ? -14.016 11.506  17.999  1.00 78.95  ? 219  LYS A CB  1 
ATOM   1607 C  CG  . LYS A  1 222 ? -13.134 10.385  18.555  1.00 91.80  ? 219  LYS A CG  1 
ATOM   1608 N  N   . SER A  1 223 ? -16.779 12.742  16.605  1.00 78.15  ? 220  SER A N   1 
ATOM   1609 C  CA  . SER A  1 223 ? -17.627 13.901  16.312  1.00 77.19  ? 220  SER A CA  1 
ATOM   1610 C  C   . SER A  1 223 ? -19.077 13.651  16.719  1.00 80.20  ? 220  SER A C   1 
ATOM   1611 O  O   . SER A  1 223 ? -19.755 14.586  17.143  1.00 79.37  ? 220  SER A O   1 
ATOM   1612 C  CB  . SER A  1 223 ? -17.555 14.260  14.835  1.00 81.10  ? 220  SER A CB  1 
ATOM   1613 O  OG  . SER A  1 223 ? -18.346 15.399  14.541  1.00 95.16  ? 220  SER A OG  1 
ATOM   1614 N  N   . MET A  1 224 ? -19.554 12.399  16.569  1.00 76.68  ? 221  MET A N   1 
ATOM   1615 C  CA  . MET A  1 224 ? -20.906 11.983  16.936  1.00 76.44  ? 221  MET A CA  1 
ATOM   1616 C  C   . MET A  1 224 ? -21.060 11.862  18.447  1.00 80.67  ? 221  MET A C   1 
ATOM   1617 O  O   . MET A  1 224 ? -22.082 12.282  18.982  1.00 81.49  ? 221  MET A O   1 
ATOM   1618 C  CB  . MET A  1 224 ? -21.276 10.671  16.247  1.00 78.97  ? 221  MET A CB  1 
ATOM   1619 C  CG  . MET A  1 224 ? -21.815 10.869  14.863  1.00 83.24  ? 221  MET A CG  1 
ATOM   1620 S  SD  . MET A  1 224 ? -22.178 9.292   14.072  1.00 88.11  ? 221  MET A SD  1 
ATOM   1621 C  CE  . MET A  1 224 ? -20.635 9.005   13.220  1.00 84.98  ? 221  MET A CE  1 
ATOM   1622 N  N   . LYS A  1 225 ? -20.044 11.313  19.132  1.00 76.54  ? 222  LYS A N   1 
ATOM   1623 C  CA  . LYS A  1 225 ? -20.010 11.165  20.582  1.00 76.86  ? 222  LYS A CA  1 
ATOM   1624 C  C   . LYS A  1 225 ? -20.017 12.537  21.282  1.00 84.30  ? 222  LYS A C   1 
ATOM   1625 O  O   . LYS A  1 225 ? -20.677 12.695  22.313  1.00 85.21  ? 222  LYS A O   1 
ATOM   1626 C  CB  . LYS A  1 225 ? -18.793 10.333  21.017  1.00 78.97  ? 222  LYS A CB  1 
ATOM   1627 C  CG  . LYS A  1 225 ? -19.006 8.822   20.883  1.00 93.12  ? 222  LYS A CG  1 
ATOM   1628 C  CD  . LYS A  1 225 ? -17.818 8.007   21.417  1.00 105.06 ? 222  LYS A CD  1 
ATOM   1629 C  CE  . LYS A  1 225 ? -16.785 7.681   20.353  1.00 118.34 ? 222  LYS A CE  1 
ATOM   1630 N  NZ  . LYS A  1 225 ? -15.486 7.207   20.916  1.00 127.23 ? 222  LYS A NZ  1 
ATOM   1631 N  N   . SER A  1 226 ? -19.320 13.537  20.701  1.00 81.55  ? 1000 SER A N   1 
ATOM   1632 C  CA  . SER A  1 226 ? -19.252 14.896  21.234  1.00 81.29  ? 1000 SER A CA  1 
ATOM   1633 C  C   . SER A  1 226 ? -20.543 15.675  20.982  1.00 87.17  ? 1000 SER A C   1 
ATOM   1634 O  O   . SER A  1 226 ? -20.742 16.718  21.598  1.00 87.92  ? 1000 SER A O   1 
ATOM   1635 C  CB  . SER A  1 226 ? -18.041 15.643  20.681  1.00 84.12  ? 1000 SER A CB  1 
ATOM   1636 O  OG  . SER A  1 226 ? -18.308 16.272  19.439  1.00 93.57  ? 1000 SER A OG  1 
ATOM   1637 N  N   . ALA A  1 227 ? -21.407 15.187  20.073  1.00 84.75  ? 1001 ALA A N   1 
ATOM   1638 C  CA  . ALA A  1 227 ? -22.702 15.807  19.777  1.00 85.30  ? 1001 ALA A CA  1 
ATOM   1639 C  C   . ALA A  1 227 ? -23.700 15.391  20.846  1.00 89.87  ? 1001 ALA A C   1 
ATOM   1640 O  O   . ALA A  1 227 ? -24.570 16.182  21.204  1.00 89.17  ? 1001 ALA A O   1 
ATOM   1641 C  CB  . ALA A  1 227 ? -23.200 15.392  18.402  1.00 86.13  ? 1001 ALA A CB  1 
ATOM   1642 N  N   . ASP A  1 228 ? -23.564 14.147  21.362  1.00 86.92  ? 1002 ASP A N   1 
ATOM   1643 C  CA  . ASP A  1 228 ? -24.397 13.587  22.426  1.00 86.75  ? 1002 ASP A CA  1 
ATOM   1644 C  C   . ASP A  1 228 ? -24.074 14.303  23.745  1.00 92.04  ? 1002 ASP A C   1 
ATOM   1645 O  O   . ASP A  1 228 ? -24.990 14.647  24.491  1.00 91.77  ? 1002 ASP A O   1 
ATOM   1646 C  CB  . ASP A  1 228 ? -24.167 12.068  22.540  1.00 88.16  ? 1002 ASP A CB  1 
ATOM   1647 C  CG  . ASP A  1 228 ? -24.398 11.281  21.259  1.00 97.82  ? 1002 ASP A CG  1 
ATOM   1648 O  OD1 . ASP A  1 228 ? -24.935 11.866  20.282  1.00 97.59  ? 1002 ASP A OD1 1 
ATOM   1649 O  OD2 . ASP A  1 228 ? -24.038 10.079  21.228  1.00 105.20 ? 1002 ASP A OD2 1 
ATOM   1650 N  N   . LEU A  1 229 ? -22.768 14.571  23.999  1.00 89.29  ? 1003 LEU A N   1 
ATOM   1651 C  CA  . LEU A  1 229 ? -22.253 15.301  25.163  1.00 88.94  ? 1003 LEU A CA  1 
ATOM   1652 C  C   . LEU A  1 229 ? -22.731 16.762  25.111  1.00 93.69  ? 1003 LEU A C   1 
ATOM   1653 O  O   . LEU A  1 229 ? -22.952 17.379  26.153  1.00 94.17  ? 1003 LEU A O   1 
ATOM   1654 C  CB  . LEU A  1 229 ? -20.728 15.230  25.160  1.00 88.89  ? 1003 LEU A CB  1 
ATOM   1655 C  CG  . LEU A  1 229 ? -19.997 15.797  26.359  1.00 94.05  ? 1003 LEU A CG  1 
ATOM   1656 C  CD1 . LEU A  1 229 ? -19.233 14.714  27.094  1.00 94.28  ? 1003 LEU A CD1 1 
ATOM   1657 C  CD2 . LEU A  1 229 ? -19.027 16.879  25.919  1.00 97.57  ? 1003 LEU A CD2 1 
ATOM   1658 N  N   . GLU A  1 230 ? -22.902 17.295  23.895  1.00 90.67  ? 1004 GLU A N   1 
ATOM   1659 C  CA  . GLU A  1 230 ? -23.407 18.639  23.602  1.00 90.85  ? 1004 GLU A CA  1 
ATOM   1660 C  C   . GLU A  1 230 ? -24.944 18.639  23.743  1.00 92.61  ? 1004 GLU A C   1 
ATOM   1661 O  O   . GLU A  1 230 ? -25.521 19.681  24.034  1.00 91.22  ? 1004 GLU A O   1 
ATOM   1662 C  CB  . GLU A  1 230 ? -23.018 19.027  22.169  1.00 92.89  ? 1004 GLU A CB  1 
ATOM   1663 C  CG  . GLU A  1 230 ? -22.925 20.513  21.877  1.00 109.42 ? 1004 GLU A CG  1 
ATOM   1664 C  CD  . GLU A  1 230 ? -22.652 20.811  20.411  1.00 143.08 ? 1004 GLU A CD  1 
ATOM   1665 O  OE1 . GLU A  1 230 ? -23.589 21.277  19.723  1.00 137.67 ? 1004 GLU A OE1 1 
ATOM   1666 O  OE2 . GLU A  1 230 ? -21.517 20.553  19.942  1.00 141.92 ? 1004 GLU A OE2 1 
ATOM   1667 N  N   . ASP A  1 231 ? -25.593 17.469  23.526  1.00 88.87  ? 1005 ASP A N   1 
ATOM   1668 C  CA  . ASP A  1 231 ? -27.041 17.271  23.628  1.00 88.84  ? 1005 ASP A CA  1 
ATOM   1669 C  C   . ASP A  1 231 ? -27.493 17.131  25.081  1.00 93.73  ? 1005 ASP A C   1 
ATOM   1670 O  O   . ASP A  1 231 ? -28.570 17.620  25.430  1.00 93.17  ? 1005 ASP A O   1 
ATOM   1671 C  CB  . ASP A  1 231 ? -27.489 16.047  22.805  1.00 90.71  ? 1005 ASP A CB  1 
ATOM   1672 C  CG  . ASP A  1 231 ? -28.131 16.343  21.457  1.00 102.16 ? 1005 ASP A CG  1 
ATOM   1673 O  OD1 . ASP A  1 231 ? -27.896 17.448  20.908  1.00 103.23 ? 1005 ASP A OD1 1 
ATOM   1674 O  OD2 . ASP A  1 231 ? -28.859 15.468  20.945  1.00 108.26 ? 1005 ASP A OD2 1 
ATOM   1675 N  N   . ASN A  1 232 ? -26.693 16.447  25.923  1.00 91.27  ? 1006 ASN A N   1 
ATOM   1676 C  CA  . ASN A  1 232 ? -26.989 16.271  27.348  1.00 91.21  ? 1006 ASN A CA  1 
ATOM   1677 C  C   . ASN A  1 232 ? -26.745 17.578  28.106  1.00 97.98  ? 1006 ASN A C   1 
ATOM   1678 O  O   . ASN A  1 232 ? -27.506 17.896  29.020  1.00 97.58  ? 1006 ASN A O   1 
ATOM   1679 C  CB  . ASN A  1 232 ? -26.176 15.129  27.940  1.00 88.77  ? 1006 ASN A CB  1 
ATOM   1680 C  CG  . ASN A  1 232 ? -26.531 13.763  27.411  1.00 106.84 ? 1006 ASN A CG  1 
ATOM   1681 O  OD1 . ASN A  1 232 ? -27.663 13.492  26.975  1.00 97.28  ? 1006 ASN A OD1 1 
ATOM   1682 N  ND2 . ASN A  1 232 ? -25.561 12.858  27.458  1.00 100.42 ? 1006 ASN A ND2 1 
ATOM   1683 N  N   . TRP A  1 233 ? -25.713 18.355  27.696  1.00 97.23  ? 1007 TRP A N   1 
ATOM   1684 C  CA  . TRP A  1 233 ? -25.389 19.659  28.280  1.00 98.81  ? 1007 TRP A CA  1 
ATOM   1685 C  C   . TRP A  1 233 ? -26.479 20.679  27.909  1.00 104.61 ? 1007 TRP A C   1 
ATOM   1686 O  O   . TRP A  1 233 ? -26.755 21.595  28.687  1.00 104.20 ? 1007 TRP A O   1 
ATOM   1687 C  CB  . TRP A  1 233 ? -24.015 20.142  27.799  1.00 98.52  ? 1007 TRP A CB  1 
ATOM   1688 C  CG  . TRP A  1 233 ? -23.544 21.403  28.462  1.00 100.53 ? 1007 TRP A CG  1 
ATOM   1689 C  CD1 . TRP A  1 233 ? -23.770 22.683  28.047  1.00 103.68 ? 1007 TRP A CD1 1 
ATOM   1690 C  CD2 . TRP A  1 233 ? -22.765 21.503  29.663  1.00 100.84 ? 1007 TRP A CD2 1 
ATOM   1691 N  NE1 . TRP A  1 233 ? -23.182 23.575  28.916  1.00 103.40 ? 1007 TRP A NE1 1 
ATOM   1692 C  CE2 . TRP A  1 233 ? -22.548 22.878  29.910  1.00 105.04 ? 1007 TRP A CE2 1 
ATOM   1693 C  CE3 . TRP A  1 233 ? -22.215 20.561  30.550  1.00 102.56 ? 1007 TRP A CE3 1 
ATOM   1694 C  CZ2 . TRP A  1 233 ? -21.803 23.336  31.007  1.00 104.63 ? 1007 TRP A CZ2 1 
ATOM   1695 C  CZ3 . TRP A  1 233 ? -21.483 21.015  31.639  1.00 104.29 ? 1007 TRP A CZ3 1 
ATOM   1696 C  CH2 . TRP A  1 233 ? -21.281 22.387  31.857  1.00 104.88 ? 1007 TRP A CH2 1 
ATOM   1697 N  N   . GLU A  1 234 ? -27.095 20.508  26.720  1.00 102.71 ? 1008 GLU A N   1 
ATOM   1698 C  CA  . GLU A  1 234 ? -28.176 21.356  26.219  1.00 102.99 ? 1008 GLU A CA  1 
ATOM   1699 C  C   . GLU A  1 234 ? -29.470 21.128  27.012  1.00 108.04 ? 1008 GLU A C   1 
ATOM   1700 O  O   . GLU A  1 234 ? -30.140 22.106  27.333  1.00 108.25 ? 1008 GLU A O   1 
ATOM   1701 C  CB  . GLU A  1 234 ? -28.403 21.132  24.718  1.00 104.19 ? 1008 GLU A CB  1 
ATOM   1702 N  N   . THR A  1 235 ? -29.806 19.853  27.342  1.00 104.55 ? 1009 THR A N   1 
ATOM   1703 C  CA  . THR A  1 235 ? -30.996 19.493  28.121  1.00 104.65 ? 1009 THR A CA  1 
ATOM   1704 C  C   . THR A  1 235 ? -30.903 19.975  29.570  1.00 110.84 ? 1009 THR A C   1 
ATOM   1705 O  O   . THR A  1 235 ? -31.895 20.477  30.095  1.00 110.00 ? 1009 THR A O   1 
ATOM   1706 C  CB  . THR A  1 235 ? -31.340 18.003  28.028  1.00 110.24 ? 1009 THR A CB  1 
ATOM   1707 O  OG1 . THR A  1 235 ? -30.193 17.255  27.655  1.00 111.46 ? 1009 THR A OG1 1 
ATOM   1708 C  CG2 . THR A  1 235 ? -32.462 17.728  27.056  1.00 107.80 ? 1009 THR A CG2 1 
ATOM   1709 N  N   . LEU A  1 236 ? -29.720 19.848  30.207  1.00 109.78 ? 1010 LEU A N   1 
ATOM   1710 C  CA  . LEU A  1 236 ? -29.488 20.316  31.582  1.00 110.52 ? 1010 LEU A CA  1 
ATOM   1711 C  C   . LEU A  1 236 ? -29.779 21.820  31.705  1.00 117.06 ? 1010 LEU A C   1 
ATOM   1712 O  O   . LEU A  1 236 ? -30.528 22.220  32.596  1.00 116.77 ? 1010 LEU A O   1 
ATOM   1713 C  CB  . LEU A  1 236 ? -28.046 20.021  32.047  1.00 110.35 ? 1010 LEU A CB  1 
ATOM   1714 C  CG  . LEU A  1 236 ? -27.747 18.638  32.627  1.00 114.95 ? 1010 LEU A CG  1 
ATOM   1715 C  CD1 . LEU A  1 236 ? -26.260 18.464  32.840  1.00 114.95 ? 1010 LEU A CD1 1 
ATOM   1716 C  CD2 . LEU A  1 236 ? -28.474 18.406  33.949  1.00 117.27 ? 1010 LEU A CD2 1 
ATOM   1717 N  N   . ASN A  1 237 ? -29.230 22.633  30.777  1.00 115.90 ? 1011 ASN A N   1 
ATOM   1718 C  CA  . ASN A  1 237 ? -29.413 24.087  30.726  1.00 116.90 ? 1011 ASN A CA  1 
ATOM   1719 C  C   . ASN A  1 237 ? -30.864 24.481  30.397  1.00 124.42 ? 1011 ASN A C   1 
ATOM   1720 O  O   . ASN A  1 237 ? -31.383 25.433  30.987  1.00 124.58 ? 1011 ASN A O   1 
ATOM   1721 C  CB  . ASN A  1 237 ? -28.433 24.726  29.725  1.00 116.53 ? 1011 ASN A CB  1 
ATOM   1722 C  CG  . ASN A  1 237 ? -26.954 24.558  30.041  1.00 130.19 ? 1011 ASN A CG  1 
ATOM   1723 O  OD1 . ASN A  1 237 ? -26.551 24.047  31.090  1.00 120.64 ? 1011 ASN A OD1 1 
ATOM   1724 N  ND2 . ASN A  1 237 ? -26.103 24.994  29.126  1.00 119.76 ? 1011 ASN A ND2 1 
ATOM   1725 N  N   . ASP A  1 238 ? -31.516 23.748  29.467  1.00 123.07 ? 1012 ASP A N   1 
ATOM   1726 C  CA  . ASP A  1 238 ? -32.900 24.014  29.056  1.00 123.97 ? 1012 ASP A CA  1 
ATOM   1727 C  C   . ASP A  1 238 ? -33.914 23.721  30.153  1.00 130.81 ? 1012 ASP A C   1 
ATOM   1728 O  O   . ASP A  1 238 ? -34.815 24.535  30.352  1.00 130.92 ? 1012 ASP A O   1 
ATOM   1729 C  CB  . ASP A  1 238 ? -33.268 23.275  27.757  1.00 125.78 ? 1012 ASP A CB  1 
ATOM   1730 C  CG  . ASP A  1 238 ? -32.563 23.763  26.506  1.00 133.89 ? 1012 ASP A CG  1 
ATOM   1731 O  OD1 . ASP A  1 238 ? -32.180 24.955  26.461  1.00 134.45 ? 1012 ASP A OD1 1 
ATOM   1732 O  OD2 . ASP A  1 238 ? -32.393 22.955  25.574  1.00 138.52 ? 1012 ASP A OD2 1 
ATOM   1733 N  N   . ASN A  1 239 ? -33.778 22.576  30.868  1.00 128.89 ? 1013 ASN A N   1 
ATOM   1734 C  CA  . ASN A  1 239 ? -34.689 22.214  31.962  1.00 129.33 ? 1013 ASN A CA  1 
ATOM   1735 C  C   . ASN A  1 239 ? -34.506 23.106  33.195  1.00 134.57 ? 1013 ASN A C   1 
ATOM   1736 O  O   . ASN A  1 239 ? -35.443 23.228  33.990  1.00 134.42 ? 1013 ASN A O   1 
ATOM   1737 C  CB  . ASN A  1 239 ? -34.617 20.735  32.334  1.00 129.80 ? 1013 ASN A CB  1 
ATOM   1738 C  CG  . ASN A  1 239 ? -34.982 19.763  31.239  1.00 147.46 ? 1013 ASN A CG  1 
ATOM   1739 O  OD1 . ASN A  1 239 ? -36.101 19.735  30.705  1.00 136.01 ? 1013 ASN A OD1 1 
ATOM   1740 N  ND2 . ASN A  1 239 ? -34.033 18.923  30.899  1.00 141.54 ? 1013 ASN A ND2 1 
ATOM   1741 N  N   . LEU A  1 240 ? -33.319 23.751  33.334  1.00 131.88 ? 1014 LEU A N   1 
ATOM   1742 C  CA  . LEU A  1 240 ? -33.010 24.707  34.403  1.00 132.19 ? 1014 LEU A CA  1 
ATOM   1743 C  C   . LEU A  1 240 ? -33.873 25.961  34.184  1.00 137.35 ? 1014 LEU A C   1 
ATOM   1744 O  O   . LEU A  1 240 ? -34.355 26.557  35.150  1.00 136.97 ? 1014 LEU A O   1 
ATOM   1745 C  CB  . LEU A  1 240 ? -31.518 25.070  34.399  1.00 132.20 ? 1014 LEU A CB  1 
ATOM   1746 N  N   . LYS A  1 241 ? -34.096 26.322  32.899  1.00 134.81 ? 1015 LYS A N   1 
ATOM   1747 C  CA  . LYS A  1 241 ? -34.945 27.434  32.472  1.00 135.14 ? 1015 LYS A CA  1 
ATOM   1748 C  C   . LYS A  1 241 ? -36.437 27.028  32.533  1.00 140.37 ? 1015 LYS A C   1 
ATOM   1749 O  O   . LYS A  1 241 ? -37.299 27.902  32.653  1.00 139.93 ? 1015 LYS A O   1 
ATOM   1750 C  CB  . LYS A  1 241 ? -34.553 27.904  31.060  1.00 137.54 ? 1015 LYS A CB  1 
ATOM   1751 N  N   . VAL A  1 242 ? -36.733 25.704  32.469  1.00 137.90 ? 1016 VAL A N   1 
ATOM   1752 C  CA  . VAL A  1 242 ? -38.093 25.142  32.559  1.00 138.15 ? 1016 VAL A CA  1 
ATOM   1753 C  C   . VAL A  1 242 ? -38.602 25.234  34.013  1.00 143.03 ? 1016 VAL A C   1 
ATOM   1754 O  O   . VAL A  1 242 ? -39.812 25.299  34.228  1.00 143.01 ? 1016 VAL A O   1 
ATOM   1755 C  CB  . VAL A  1 242 ? -38.203 23.707  31.953  1.00 142.01 ? 1016 VAL A CB  1 
ATOM   1756 C  CG1 . VAL A  1 242 ? -39.567 23.067  32.211  1.00 141.72 ? 1016 VAL A CG1 1 
ATOM   1757 C  CG2 . VAL A  1 242 ? -37.921 23.717  30.453  1.00 141.84 ? 1016 VAL A CG2 1 
ATOM   1758 N  N   . ILE A  1 243 ? -37.678 25.274  34.997  1.00 139.92 ? 1017 ILE A N   1 
ATOM   1759 C  CA  . ILE A  1 243 ? -37.990 25.413  36.425  1.00 139.85 ? 1017 ILE A CA  1 
ATOM   1760 C  C   . ILE A  1 243 ? -38.534 26.833  36.713  1.00 144.73 ? 1017 ILE A C   1 
ATOM   1761 O  O   . ILE A  1 243 ? -39.610 26.962  37.303  1.00 144.48 ? 1017 ILE A O   1 
ATOM   1762 C  CB  . ILE A  1 243 ? -36.762 25.021  37.313  1.00 142.64 ? 1017 ILE A CB  1 
ATOM   1763 C  CG1 . ILE A  1 243 ? -36.658 23.481  37.447  1.00 142.82 ? 1017 ILE A CG1 1 
ATOM   1764 C  CG2 . ILE A  1 243 ? -36.783 25.703  38.702  1.00 142.90 ? 1017 ILE A CG2 1 
ATOM   1765 C  CD1 . ILE A  1 243 ? -35.326 22.932  38.001  1.00 147.50 ? 1017 ILE A CD1 1 
ATOM   1766 N  N   . GLU A  1 244 ? -37.796 27.882  36.275  1.00 141.39 ? 1018 GLU A N   1 
ATOM   1767 C  CA  . GLU A  1 244 ? -38.162 29.287  36.469  1.00 163.04 ? 1018 GLU A CA  1 
ATOM   1768 C  C   . GLU A  1 244 ? -39.282 29.701  35.523  1.00 167.37 ? 1018 GLU A C   1 
ATOM   1769 O  O   . GLU A  1 244 ? -40.441 29.368  35.759  1.00 122.44 ? 1018 GLU A O   1 
ATOM   1770 C  CB  . GLU A  1 244 ? -36.938 30.193  36.279  1.00 164.43 ? 1018 GLU A CB  1 
ATOM   1771 N  N   . VAL A  1 252 ? -42.319 21.126  37.730  1.00 146.33 ? 1026 VAL A N   1 
ATOM   1772 C  CA  . VAL A  1 252 ? -40.993 21.090  38.363  1.00 146.04 ? 1026 VAL A CA  1 
ATOM   1773 C  C   . VAL A  1 252 ? -40.502 19.653  38.551  1.00 149.22 ? 1026 VAL A C   1 
ATOM   1774 O  O   . VAL A  1 252 ? -39.294 19.432  38.684  1.00 148.24 ? 1026 VAL A O   1 
ATOM   1775 C  CB  . VAL A  1 252 ? -40.862 21.923  39.671  1.00 149.78 ? 1026 VAL A CB  1 
ATOM   1776 C  CG1 . VAL A  1 252 ? -40.625 23.397  39.367  1.00 149.52 ? 1026 VAL A CG1 1 
ATOM   1777 C  CG2 . VAL A  1 252 ? -42.059 21.731  40.602  1.00 149.52 ? 1026 VAL A CG2 1 
ATOM   1778 N  N   . LYS A  1 253 ? -41.444 18.685  38.566  1.00 145.51 ? 1027 LYS A N   1 
ATOM   1779 C  CA  . LYS A  1 253 ? -41.154 17.257  38.701  1.00 145.15 ? 1027 LYS A CA  1 
ATOM   1780 C  C   . LYS A  1 253 ? -40.735 16.685  37.347  1.00 148.96 ? 1027 LYS A C   1 
ATOM   1781 O  O   . LYS A  1 253 ? -39.909 15.768  37.296  1.00 148.88 ? 1027 LYS A O   1 
ATOM   1782 C  CB  . LYS A  1 253 ? -42.374 16.501  39.250  1.00 147.47 ? 1027 LYS A CB  1 
ATOM   1783 N  N   . ASP A  1 254 ? -41.304 17.235  36.251  1.00 144.71 ? 1028 ASP A N   1 
ATOM   1784 C  CA  . ASP A  1 254 ? -41.016 16.828  34.872  1.00 143.88 ? 1028 ASP A CA  1 
ATOM   1785 C  C   . ASP A  1 254 ? -39.596 17.229  34.450  1.00 145.32 ? 1028 ASP A C   1 
ATOM   1786 O  O   . ASP A  1 254 ? -38.889 16.417  33.847  1.00 145.07 ? 1028 ASP A O   1 
ATOM   1787 C  CB  . ASP A  1 254 ? -42.064 17.405  33.904  1.00 145.80 ? 1028 ASP A CB  1 
ATOM   1788 N  N   . ALA A  1 255 ? -39.178 18.470  34.790  1.00 139.70 ? 1029 ALA A N   1 
ATOM   1789 C  CA  . ALA A  1 255 ? -37.854 19.012  34.493  1.00 138.55 ? 1029 ALA A CA  1 
ATOM   1790 C  C   . ALA A  1 255 ? -36.762 18.254  35.249  1.00 141.48 ? 1029 ALA A C   1 
ATOM   1791 O  O   . ALA A  1 255 ? -35.661 18.103  34.722  1.00 141.01 ? 1029 ALA A O   1 
ATOM   1792 C  CB  . ALA A  1 255 ? -37.803 20.499  34.829  1.00 138.99 ? 1029 ALA A CB  1 
ATOM   1793 N  N   . LEU A  1 256 ? -37.071 17.757  36.464  1.00 137.48 ? 1030 LEU A N   1 
ATOM   1794 C  CA  . LEU A  1 256 ? -36.129 16.990  37.279  1.00 136.89 ? 1030 LEU A CA  1 
ATOM   1795 C  C   . LEU A  1 256 ? -35.888 15.602  36.679  1.00 139.37 ? 1030 LEU A C   1 
ATOM   1796 O  O   . LEU A  1 256 ? -34.733 15.261  36.421  1.00 138.79 ? 1030 LEU A O   1 
ATOM   1797 C  CB  . LEU A  1 256 ? -36.601 16.890  38.737  1.00 136.87 ? 1030 LEU A CB  1 
ATOM   1798 N  N   . THR A  1 257 ? -36.968 14.826  36.402  1.00 135.08 ? 1031 THR A N   1 
ATOM   1799 C  CA  . THR A  1 257 ? -36.868 13.475  35.819  1.00 134.78 ? 1031 THR A CA  1 
ATOM   1800 C  C   . THR A  1 257 ? -36.098 13.456  34.483  1.00 138.09 ? 1031 THR A C   1 
ATOM   1801 O  O   . THR A  1 257 ? -35.494 12.435  34.142  1.00 138.21 ? 1031 THR A O   1 
ATOM   1802 C  CB  . THR A  1 257 ? -38.250 12.799  35.702  1.00 144.63 ? 1031 THR A CB  1 
ATOM   1803 O  OG1 . THR A  1 257 ? -39.228 13.754  35.282  1.00 144.93 ? 1031 THR A OG1 1 
ATOM   1804 C  CG2 . THR A  1 257 ? -38.696 12.142  37.003  1.00 143.71 ? 1031 THR A CG2 1 
ATOM   1805 N  N   . LYS A  1 258 ? -36.108 14.595  33.753  1.00 133.25 ? 1032 LYS A N   1 
ATOM   1806 C  CA  . LYS A  1 258 ? -35.424 14.795  32.472  1.00 131.84 ? 1032 LYS A CA  1 
ATOM   1807 C  C   . LYS A  1 258 ? -33.919 15.094  32.657  1.00 132.05 ? 1032 LYS A C   1 
ATOM   1808 O  O   . LYS A  1 258 ? -33.103 14.542  31.919  1.00 131.32 ? 1032 LYS A O   1 
ATOM   1809 C  CB  . LYS A  1 258 ? -36.122 15.902  31.660  1.00 134.34 ? 1032 LYS A CB  1 
ATOM   1810 N  N   . MET A  1 259 ? -33.552 15.946  33.639  1.00 126.14 ? 1033 MET A N   1 
ATOM   1811 C  CA  . MET A  1 259 ? -32.156 16.314  33.925  1.00 124.83 ? 1033 MET A CA  1 
ATOM   1812 C  C   . MET A  1 259 ? -31.346 15.176  34.526  1.00 127.00 ? 1033 MET A C   1 
ATOM   1813 O  O   . MET A  1 259 ? -30.134 15.119  34.311  1.00 125.79 ? 1033 MET A O   1 
ATOM   1814 C  CB  . MET A  1 259 ? -32.088 17.510  34.872  1.00 127.07 ? 1033 MET A CB  1 
ATOM   1815 C  CG  . MET A  1 259 ? -32.235 18.826  34.186  1.00 130.55 ? 1033 MET A CG  1 
ATOM   1816 S  SD  . MET A  1 259 ? -32.003 20.221  35.310  1.00 134.50 ? 1033 MET A SD  1 
ATOM   1817 C  CE  . MET A  1 259 ? -33.505 20.129  36.266  1.00 131.30 ? 1033 MET A CE  1 
ATOM   1818 N  N   . ARG A  1 260 ? -32.002 14.311  35.326  1.00 123.30 ? 1034 ARG A N   1 
ATOM   1819 C  CA  . ARG A  1 260 ? -31.365 13.172  35.993  1.00 122.80 ? 1034 ARG A CA  1 
ATOM   1820 C  C   . ARG A  1 260 ? -30.954 12.082  35.015  1.00 124.94 ? 1034 ARG A C   1 
ATOM   1821 O  O   . ARG A  1 260 ? -29.855 11.541  35.159  1.00 124.78 ? 1034 ARG A O   1 
ATOM   1822 C  CB  . ARG A  1 260 ? -32.252 12.600  37.109  1.00 123.27 ? 1034 ARG A CB  1 
ATOM   1823 N  N   . ALA A  1 261 ? -31.816 11.752  34.036  1.00 119.36 ? 1035 ALA A N   1 
ATOM   1824 C  CA  . ALA A  1 261 ? -31.520 10.745  33.015  1.00 118.26 ? 1035 ALA A CA  1 
ATOM   1825 C  C   . ALA A  1 261 ? -30.371 11.211  32.096  1.00 118.84 ? 1035 ALA A C   1 
ATOM   1826 O  O   . ALA A  1 261 ? -29.589 10.383  31.619  1.00 117.24 ? 1035 ALA A O   1 
ATOM   1827 C  CB  . ALA A  1 261 ? -32.768 10.457  32.197  1.00 119.14 ? 1035 ALA A CB  1 
ATOM   1828 N  N   . ALA A  1 262 ? -30.263 12.543  31.886  1.00 114.20 ? 1036 ALA A N   1 
ATOM   1829 C  CA  . ALA A  1 262 ? -29.241 13.189  31.064  1.00 113.61 ? 1036 ALA A CA  1 
ATOM   1830 C  C   . ALA A  1 262 ? -27.907 13.347  31.789  1.00 116.41 ? 1036 ALA A C   1 
ATOM   1831 O  O   . ALA A  1 262 ? -26.868 13.200  31.153  1.00 115.19 ? 1036 ALA A O   1 
ATOM   1832 C  CB  . ALA A  1 262 ? -29.737 14.539  30.578  1.00 114.44 ? 1036 ALA A CB  1 
ATOM   1833 N  N   . ALA A  1 263 ? -27.931 13.649  33.106  1.00 113.68 ? 1037 ALA A N   1 
ATOM   1834 C  CA  . ALA A  1 263 ? -26.724 13.800  33.934  1.00 113.78 ? 1037 ALA A CA  1 
ATOM   1835 C  C   . ALA A  1 263 ? -25.954 12.475  34.091  1.00 117.14 ? 1037 ALA A C   1 
ATOM   1836 O  O   . ALA A  1 263 ? -24.724 12.500  34.177  1.00 116.12 ? 1037 ALA A O   1 
ATOM   1837 C  CB  . ALA A  1 263 ? -27.080 14.369  35.297  1.00 114.60 ? 1037 ALA A CB  1 
ATOM   1838 N  N   . LEU A  1 264 ? -26.681 11.326  34.116  1.00 113.84 ? 1038 LEU A N   1 
ATOM   1839 C  CA  . LEU A  1 264 ? -26.106 9.974   34.188  1.00 113.54 ? 1038 LEU A CA  1 
ATOM   1840 C  C   . LEU A  1 264 ? -25.512 9.612   32.824  1.00 117.86 ? 1038 LEU A C   1 
ATOM   1841 O  O   . LEU A  1 264 ? -24.451 8.987   32.756  1.00 116.83 ? 1038 LEU A O   1 
ATOM   1842 C  CB  . LEU A  1 264 ? -27.173 8.930   34.571  1.00 113.40 ? 1038 LEU A CB  1 
ATOM   1843 C  CG  . LEU A  1 264 ? -27.767 9.008   35.974  1.00 118.21 ? 1038 LEU A CG  1 
ATOM   1844 C  CD1 . LEU A  1 264 ? -29.107 8.307   36.029  1.00 118.44 ? 1038 LEU A CD1 1 
ATOM   1845 C  CD2 . LEU A  1 264 ? -26.826 8.420   37.013  1.00 121.02 ? 1038 LEU A CD2 1 
ATOM   1846 N  N   . ASP A  1 265 ? -26.219 10.012  31.741  1.00 115.58 ? 1039 ASP A N   1 
ATOM   1847 C  CA  . ASP A  1 265 ? -25.852 9.804   30.338  1.00 115.90 ? 1039 ASP A CA  1 
ATOM   1848 C  C   . ASP A  1 265 ? -24.582 10.583  30.020  1.00 120.18 ? 1039 ASP A C   1 
ATOM   1849 O  O   . ASP A  1 265 ? -23.668 10.022  29.416  1.00 119.99 ? 1039 ASP A O   1 
ATOM   1850 C  CB  . ASP A  1 265 ? -27.006 10.245  29.414  1.00 118.01 ? 1039 ASP A CB  1 
ATOM   1851 C  CG  . ASP A  1 265 ? -26.966 9.668   28.012  1.00 129.27 ? 1039 ASP A CG  1 
ATOM   1852 O  OD1 . ASP A  1 265 ? -26.028 10.007  27.255  1.00 130.32 ? 1039 ASP A OD1 1 
ATOM   1853 O  OD2 . ASP A  1 265 ? -27.889 8.899   27.660  1.00 134.78 ? 1039 ASP A OD2 1 
ATOM   1854 N  N   . ALA A  1 266 ? -24.515 11.861  30.454  1.00 117.05 ? 1040 ALA A N   1 
ATOM   1855 C  CA  . ALA A  1 266 ? -23.363 12.744  30.262  1.00 117.06 ? 1040 ALA A CA  1 
ATOM   1856 C  C   . ALA A  1 266 ? -22.144 12.219  31.017  1.00 121.68 ? 1040 ALA A C   1 
ATOM   1857 O  O   . ALA A  1 266 ? -21.024 12.329  30.511  1.00 120.91 ? 1040 ALA A O   1 
ATOM   1858 C  CB  . ALA A  1 266 ? -23.698 14.155  30.716  1.00 117.62 ? 1040 ALA A CB  1 
ATOM   1859 N  N   . GLN A  1 267 ? -22.370 11.624  32.214  1.00 119.47 ? 1041 GLN A N   1 
ATOM   1860 C  CA  . GLN A  1 267 ? -21.330 11.028  33.060  1.00 119.74 ? 1041 GLN A CA  1 
ATOM   1861 C  C   . GLN A  1 267 ? -20.610 9.885   32.333  1.00 125.05 ? 1041 GLN A C   1 
ATOM   1862 O  O   . GLN A  1 267 ? -19.390 9.773   32.443  1.00 124.98 ? 1041 GLN A O   1 
ATOM   1863 C  CB  . GLN A  1 267 ? -21.921 10.539  34.391  1.00 120.95 ? 1041 GLN A CB  1 
ATOM   1864 N  N   . LYS A  1 268 ? -21.365 9.062   31.575  1.00 122.55 ? 1042 LYS A N   1 
ATOM   1865 C  CA  . LYS A  1 268 ? -20.847 7.935   30.793  1.00 122.97 ? 1042 LYS A CA  1 
ATOM   1866 C  C   . LYS A  1 268 ? -19.974 8.414   29.627  1.00 127.94 ? 1042 LYS A C   1 
ATOM   1867 O  O   . LYS A  1 268 ? -19.005 7.740   29.272  1.00 127.28 ? 1042 LYS A O   1 
ATOM   1868 C  CB  . LYS A  1 268 ? -22.004 7.064   30.270  1.00 125.61 ? 1042 LYS A CB  1 
ATOM   1869 N  N   . ALA A  1 269 ? -20.320 9.580   29.044  1.00 125.65 ? 1043 ALA A N   1 
ATOM   1870 C  CA  . ALA A  1 269 ? -19.615 10.186  27.914  1.00 126.09 ? 1043 ALA A CA  1 
ATOM   1871 C  C   . ALA A  1 269 ? -18.274 10.801  28.316  1.00 131.34 ? 1043 ALA A C   1 
ATOM   1872 O  O   . ALA A  1 269 ? -18.115 11.248  29.452  1.00 131.01 ? 1043 ALA A O   1 
ATOM   1873 C  CB  . ALA A  1 269 ? -20.501 11.232  27.237  1.00 126.90 ? 1043 ALA A CB  1 
ATOM   1874 N  N   . THR A  1 270 ? -17.315 10.821  27.372  1.00 129.27 ? 1044 THR A N   1 
ATOM   1875 C  CA  . THR A  1 270 ? -15.969 11.385  27.538  1.00 129.53 ? 1044 THR A CA  1 
ATOM   1876 C  C   . THR A  1 270 ? -15.909 12.771  26.857  1.00 135.14 ? 1044 THR A C   1 
ATOM   1877 O  O   . THR A  1 270 ? -16.265 12.885  25.671  1.00 134.95 ? 1044 THR A O   1 
ATOM   1878 C  CB  . THR A  1 270 ? -14.905 10.409  26.990  1.00 135.72 ? 1044 THR A CB  1 
ATOM   1879 O  OG1 . THR A  1 270 ? -15.094 9.122   27.580  1.00 135.23 ? 1044 THR A OG1 1 
ATOM   1880 C  CG2 . THR A  1 270 ? -13.469 10.885  27.235  1.00 133.25 ? 1044 THR A CG2 1 
ATOM   1881 N  N   . PRO A  1 271 ? -15.478 13.833  27.584  1.00 132.77 ? 1045 PRO A N   1 
ATOM   1882 C  CA  . PRO A  1 271 ? -15.422 15.170  26.965  1.00 133.01 ? 1045 PRO A CA  1 
ATOM   1883 C  C   . PRO A  1 271 ? -14.240 15.350  26.004  1.00 137.87 ? 1045 PRO A C   1 
ATOM   1884 O  O   . PRO A  1 271 ? -13.261 14.605  26.125  1.00 136.70 ? 1045 PRO A O   1 
ATOM   1885 C  CB  . PRO A  1 271 ? -15.360 16.118  28.167  1.00 134.61 ? 1045 PRO A CB  1 
ATOM   1886 C  CG  . PRO A  1 271 ? -14.731 15.329  29.233  1.00 138.88 ? 1045 PRO A CG  1 
ATOM   1887 C  CD  . PRO A  1 271 ? -15.033 13.875  28.992  1.00 134.34 ? 1045 PRO A CD  1 
ATOM   1888 N  N   . PRO A  1 272 ? -14.299 16.321  25.048  1.00 136.12 ? 1046 PRO A N   1 
ATOM   1889 C  CA  . PRO A  1 272 ? -13.173 16.500  24.117  1.00 136.65 ? 1046 PRO A CA  1 
ATOM   1890 C  C   . PRO A  1 272 ? -11.861 16.925  24.769  1.00 142.58 ? 1046 PRO A C   1 
ATOM   1891 O  O   . PRO A  1 272 ? -10.802 16.520  24.288  1.00 142.30 ? 1046 PRO A O   1 
ATOM   1892 C  CB  . PRO A  1 272 ? -13.685 17.562  23.143  1.00 138.33 ? 1046 PRO A CB  1 
ATOM   1893 C  CG  . PRO A  1 272 ? -14.722 18.306  23.885  1.00 142.55 ? 1046 PRO A CG  1 
ATOM   1894 C  CD  . PRO A  1 272 ? -15.389 17.276  24.745  1.00 137.85 ? 1046 PRO A CD  1 
ATOM   1895 N  N   . LYS A  1 273 ? -11.931 17.735  25.853  1.00 140.57 ? 1047 LYS A N   1 
ATOM   1896 C  CA  . LYS A  1 273 ? -10.768 18.226  26.599  1.00 140.99 ? 1047 LYS A CA  1 
ATOM   1897 C  C   . LYS A  1 273 ? -9.920  17.071  27.164  1.00 146.58 ? 1047 LYS A C   1 
ATOM   1898 O  O   . LYS A  1 273 ? -8.698  17.076  27.004  1.00 146.09 ? 1047 LYS A O   1 
ATOM   1899 C  CB  . LYS A  1 273 ? -11.210 19.189  27.713  1.00 143.33 ? 1047 LYS A CB  1 
ATOM   1900 N  N   . LEU A  1 274 ? -10.583 16.065  27.773  1.00 144.51 ? 1048 LEU A N   1 
ATOM   1901 C  CA  . LEU A  1 274 ? -9.953  14.883  28.363  1.00 144.94 ? 1048 LEU A CA  1 
ATOM   1902 C  C   . LEU A  1 274 ? -10.168 13.635  27.480  1.00 150.86 ? 1048 LEU A C   1 
ATOM   1903 O  O   . LEU A  1 274 ? -10.635 12.599  27.963  1.00 150.49 ? 1048 LEU A O   1 
ATOM   1904 C  CB  . LEU A  1 274 ? -10.492 14.666  29.790  1.00 144.92 ? 1048 LEU A CB  1 
ATOM   1905 N  N   . GLU A  1 275 ? -9.814  13.740  26.181  1.00 148.99 ? 1049 GLU A N   1 
ATOM   1906 C  CA  . GLU A  1 275 ? -9.966  12.653  25.206  1.00 149.51 ? 1049 GLU A CA  1 
ATOM   1907 C  C   . GLU A  1 275 ? -8.738  11.740  25.099  1.00 155.17 ? 1049 GLU A C   1 
ATOM   1908 O  O   . GLU A  1 275 ? -8.898  10.539  24.863  1.00 154.58 ? 1049 GLU A O   1 
ATOM   1909 C  CB  . GLU A  1 275 ? -10.353 13.204  23.826  1.00 150.83 ? 1049 GLU A CB  1 
ATOM   1910 N  N   . ASP A  1 276 ? -7.522  12.309  25.262  1.00 153.26 ? 1050 ASP A N   1 
ATOM   1911 C  CA  . ASP A  1 276 ? -6.239  11.594  25.175  1.00 153.70 ? 1050 ASP A CA  1 
ATOM   1912 C  C   . ASP A  1 276 ? -5.855  10.848  26.456  1.00 158.53 ? 1050 ASP A C   1 
ATOM   1913 O  O   . ASP A  1 276 ? -5.186  9.815   26.376  1.00 157.92 ? 1050 ASP A O   1 
ATOM   1914 C  CB  . ASP A  1 276 ? -5.111  12.547  24.755  1.00 155.59 ? 1050 ASP A CB  1 
ATOM   1915 N  N   . LYS A  1 277 ? -6.264  11.378  27.628  1.00 156.06 ? 1051 LYS A N   1 
ATOM   1916 C  CA  . LYS A  1 277 ? -5.990  10.801  28.947  1.00 156.35 ? 1051 LYS A CA  1 
ATOM   1917 C  C   . LYS A  1 277 ? -6.712  9.460   29.178  1.00 161.96 ? 1051 LYS A C   1 
ATOM   1918 O  O   . LYS A  1 277 ? -7.693  9.154   28.493  1.00 161.59 ? 1051 LYS A O   1 
ATOM   1919 C  CB  . LYS A  1 277 ? -6.325  11.809  30.059  1.00 158.64 ? 1051 LYS A CB  1 
ATOM   1920 N  N   . SER A  1 278 ? -6.204  8.665   30.144  1.00 159.80 ? 1052 SER A N   1 
ATOM   1921 C  CA  . SER A  1 278 ? -6.706  7.341   30.537  1.00 160.13 ? 1052 SER A CA  1 
ATOM   1922 C  C   . SER A  1 278 ? -8.130  7.381   31.149  1.00 165.05 ? 1052 SER A C   1 
ATOM   1923 O  O   . SER A  1 278 ? -8.508  8.421   31.693  1.00 164.85 ? 1052 SER A O   1 
ATOM   1924 C  CB  . SER A  1 278 ? -5.733  6.692   31.519  1.00 163.81 ? 1052 SER A CB  1 
ATOM   1925 N  N   . PRO A  1 279 ? -8.929  6.277   31.102  1.00 162.14 ? 1053 PRO A N   1 
ATOM   1926 C  CA  . PRO A  1 279 ? -10.280 6.324   31.702  1.00 162.12 ? 1053 PRO A CA  1 
ATOM   1927 C  C   . PRO A  1 279 ? -10.283 6.388   33.231  1.00 166.38 ? 1053 PRO A C   1 
ATOM   1928 O  O   . PRO A  1 279 ? -11.236 6.906   33.817  1.00 165.98 ? 1053 PRO A O   1 
ATOM   1929 C  CB  . PRO A  1 279 ? -10.947 5.033   31.204  1.00 163.89 ? 1053 PRO A CB  1 
ATOM   1930 C  CG  . PRO A  1 279 ? -10.036 4.483   30.144  1.00 168.37 ? 1053 PRO A CG  1 
ATOM   1931 C  CD  . PRO A  1 279 ? -8.670  4.954   30.500  1.00 163.81 ? 1053 PRO A CD  1 
ATOM   1932 N  N   . ASP A  1 280 ? -9.218  5.865   33.869  1.00 163.15 ? 1054 ASP A N   1 
ATOM   1933 C  CA  . ASP A  1 280 ? -9.051  5.836   35.324  1.00 162.92 ? 1054 ASP A CA  1 
ATOM   1934 C  C   . ASP A  1 280 ? -8.160  6.973   35.846  1.00 166.46 ? 1054 ASP A C   1 
ATOM   1935 O  O   . ASP A  1 280 ? -7.772  6.962   37.017  1.00 166.05 ? 1054 ASP A O   1 
ATOM   1936 C  CB  . ASP A  1 280 ? -8.531  4.462   35.779  1.00 164.77 ? 1054 ASP A CB  1 
ATOM   1937 C  CG  . ASP A  1 280 ? -9.634  3.485   36.126  1.00 175.51 ? 1054 ASP A CG  1 
ATOM   1938 O  OD1 . ASP A  1 280 ? -10.139 3.537   37.272  1.00 175.83 ? 1054 ASP A OD1 1 
ATOM   1939 O  OD2 . ASP A  1 280 ? -9.991  2.660   35.255  1.00 181.91 ? 1054 ASP A OD2 1 
ATOM   1940 N  N   . SER A  1 281 ? -7.863  7.968   34.985  1.00 162.98 ? 1055 SER A N   1 
ATOM   1941 C  CA  . SER A  1 281 ? -7.034  9.136   35.312  1.00 162.96 ? 1055 SER A CA  1 
ATOM   1942 C  C   . SER A  1 281 ? -7.704  10.047  36.355  1.00 167.35 ? 1055 SER A C   1 
ATOM   1943 O  O   . SER A  1 281 ? -8.934  10.136  36.347  1.00 166.92 ? 1055 SER A O   1 
ATOM   1944 C  CB  . SER A  1 281 ? -6.727  9.943   34.054  1.00 166.43 ? 1055 SER A CB  1 
ATOM   1945 N  N   . PRO A  1 282 ? -6.934  10.754  37.236  1.00 164.35 ? 1056 PRO A N   1 
ATOM   1946 C  CA  . PRO A  1 282 ? -7.573  11.645  38.230  1.00 164.08 ? 1056 PRO A CA  1 
ATOM   1947 C  C   . PRO A  1 282 ? -8.295  12.839  37.605  1.00 167.18 ? 1056 PRO A C   1 
ATOM   1948 O  O   . PRO A  1 282 ? -9.138  13.449  38.263  1.00 166.77 ? 1056 PRO A O   1 
ATOM   1949 C  CB  . PRO A  1 282 ? -6.410  12.081  39.135  1.00 165.94 ? 1056 PRO A CB  1 
ATOM   1950 C  CG  . PRO A  1 282 ? -5.296  11.129  38.838  1.00 170.58 ? 1056 PRO A CG  1 
ATOM   1951 C  CD  . PRO A  1 282 ? -5.467  10.769  37.394  1.00 166.12 ? 1056 PRO A CD  1 
ATOM   1952 N  N   . GLU A  1 283 ? -7.978  13.155  36.332  1.00 163.00 ? 1057 GLU A N   1 
ATOM   1953 C  CA  . GLU A  1 283 ? -8.640  14.203  35.559  1.00 162.48 ? 1057 GLU A CA  1 
ATOM   1954 C  C   . GLU A  1 283 ? -10.035 13.695  35.138  1.00 165.84 ? 1057 GLU A C   1 
ATOM   1955 O  O   . GLU A  1 283 ? -10.997 14.469  35.133  1.00 165.60 ? 1057 GLU A O   1 
ATOM   1956 C  CB  . GLU A  1 283 ? -7.813  14.542  34.312  1.00 163.73 ? 1057 GLU A CB  1 
ATOM   1957 C  CG  . GLU A  1 283 ? -7.194  15.923  34.325  1.00 172.28 ? 1057 GLU A CG  1 
ATOM   1958 C  CD  . GLU A  1 283 ? -6.096  16.088  33.293  1.00 188.89 ? 1057 GLU A CD  1 
ATOM   1959 O  OE1 . GLU A  1 283 ? -6.401  16.370  32.110  1.00 177.42 ? 1057 GLU A OE1 1 
ATOM   1960 O  OE2 . GLU A  1 283 ? -4.917  15.919  33.674  1.00 183.29 ? 1057 GLU A OE2 1 
ATOM   1961 N  N   . MET A  1 284 ? -10.128 12.395  34.768  1.00 161.66 ? 1058 MET A N   1 
ATOM   1962 C  CA  . MET A  1 284 ? -11.375 11.745  34.357  1.00 161.11 ? 1058 MET A CA  1 
ATOM   1963 C  C   . MET A  1 284 ? -12.276 11.499  35.569  1.00 164.07 ? 1058 MET A C   1 
ATOM   1964 O  O   . MET A  1 284 ? -13.497 11.630  35.460  1.00 163.75 ? 1058 MET A O   1 
ATOM   1965 C  CB  . MET A  1 284 ? -11.094 10.427  33.618  1.00 163.41 ? 1058 MET A CB  1 
ATOM   1966 N  N   . LYS A  1 285 ? -11.662 11.155  36.724  1.00 159.41 ? 1059 LYS A N   1 
ATOM   1967 C  CA  . LYS A  1 285 ? -12.342 10.898  37.995  1.00 158.32 ? 1059 LYS A CA  1 
ATOM   1968 C  C   . LYS A  1 285 ? -13.086 12.139  38.483  1.00 159.77 ? 1059 LYS A C   1 
ATOM   1969 O  O   . LYS A  1 285 ? -14.221 12.015  38.935  1.00 159.03 ? 1059 LYS A O   1 
ATOM   1970 C  CB  . LYS A  1 285 ? -11.340 10.415  39.053  1.00 160.84 ? 1059 LYS A CB  1 
ATOM   1971 N  N   . ASP A  1 286 ? -12.455 13.331  38.353  1.00 154.80 ? 1060 ASP A N   1 
ATOM   1972 C  CA  . ASP A  1 286 ? -13.003 14.635  38.744  1.00 153.80 ? 1060 ASP A CA  1 
ATOM   1973 C  C   . ASP A  1 286 ? -14.277 14.971  37.973  1.00 155.35 ? 1060 ASP A C   1 
ATOM   1974 O  O   . ASP A  1 286 ? -15.259 15.400  38.582  1.00 154.68 ? 1060 ASP A O   1 
ATOM   1975 C  CB  . ASP A  1 286 ? -11.945 15.747  38.572  1.00 155.67 ? 1060 ASP A CB  1 
ATOM   1976 C  CG  . ASP A  1 286 ? -12.466 17.170  38.719  1.00 165.83 ? 1060 ASP A CG  1 
ATOM   1977 O  OD1 . ASP A  1 286 ? -13.143 17.456  39.734  1.00 166.61 ? 1060 ASP A OD1 1 
ATOM   1978 O  OD2 . ASP A  1 286 ? -12.185 17.998  37.829  1.00 170.85 ? 1060 ASP A OD2 1 
ATOM   1979 N  N   . PHE A  1 287 ? -14.257 14.779  36.640  1.00 150.40 ? 1061 PHE A N   1 
ATOM   1980 C  CA  . PHE A  1 287 ? -15.407 15.035  35.777  1.00 149.48 ? 1061 PHE A CA  1 
ATOM   1981 C  C   . PHE A  1 287 ? -16.541 14.069  36.108  1.00 151.24 ? 1061 PHE A C   1 
ATOM   1982 O  O   . PHE A  1 287 ? -17.679 14.510  36.234  1.00 150.88 ? 1061 PHE A O   1 
ATOM   1983 C  CB  . PHE A  1 287 ? -15.018 14.944  34.296  1.00 151.33 ? 1061 PHE A CB  1 
ATOM   1984 N  N   . ARG A  1 288 ? -16.219 12.772  36.305  1.00 146.39 ? 1062 ARG A N   1 
ATOM   1985 C  CA  . ARG A  1 288 ? -17.179 11.716  36.653  1.00 145.68 ? 1062 ARG A CA  1 
ATOM   1986 C  C   . ARG A  1 288 ? -17.775 11.911  38.054  1.00 148.76 ? 1062 ARG A C   1 
ATOM   1987 O  O   . ARG A  1 288 ? -18.932 11.547  38.274  1.00 147.80 ? 1062 ARG A O   1 
ATOM   1988 C  CB  . ARG A  1 288 ? -16.536 10.326  36.532  1.00 145.77 ? 1062 ARG A CB  1 
ATOM   1989 C  CG  . ARG A  1 288 ? -16.346 9.853   35.100  1.00 155.38 ? 1062 ARG A CG  1 
ATOM   1990 C  CD  . ARG A  1 288 ? -15.415 8.660   35.026  1.00 165.79 ? 1062 ARG A CD  1 
ATOM   1991 N  NE  . ARG A  1 288 ? -16.108 7.404   35.312  1.00 176.56 ? 1062 ARG A NE  1 
ATOM   1992 C  CZ  . ARG A  1 288 ? -15.546 6.202   35.236  1.00 193.26 ? 1062 ARG A CZ  1 
ATOM   1993 N  NH1 . ARG A  1 288 ? -14.272 6.076   34.883  1.00 181.17 ? 1062 ARG A NH1 1 
ATOM   1994 N  NH2 . ARG A  1 288 ? -16.255 5.115   35.508  1.00 181.74 ? 1062 ARG A NH2 1 
ATOM   1995 N  N   . HIS A  1 289 ? -16.981 12.474  38.996  1.00 145.20 ? 1063 HIS A N   1 
ATOM   1996 C  CA  . HIS A  1 289 ? -17.404 12.766  40.370  1.00 144.80 ? 1063 HIS A CA  1 
ATOM   1997 C  C   . HIS A  1 289 ? -18.277 14.020  40.400  1.00 148.34 ? 1063 HIS A C   1 
ATOM   1998 O  O   . HIS A  1 289 ? -19.186 14.112  41.225  1.00 147.34 ? 1063 HIS A O   1 
ATOM   1999 C  CB  . HIS A  1 289 ? -16.192 12.942  41.295  1.00 145.51 ? 1063 HIS A CB  1 
ATOM   2000 N  N   . GLY A  1 290 ? -17.979 14.969  39.507  1.00 145.42 ? 1064 GLY A N   1 
ATOM   2001 C  CA  . GLY A  1 290 ? -18.717 16.218  39.347  1.00 145.35 ? 1064 GLY A CA  1 
ATOM   2002 C  C   . GLY A  1 290 ? -20.164 15.974  38.964  1.00 149.25 ? 1064 GLY A C   1 
ATOM   2003 O  O   . GLY A  1 290 ? -21.063 16.657  39.460  1.00 149.00 ? 1064 GLY A O   1 
ATOM   2004 N  N   . PHE A  1 291 ? -20.393 14.968  38.097  1.00 145.71 ? 1065 PHE A N   1 
ATOM   2005 C  CA  . PHE A  1 291 ? -21.724 14.544  37.671  1.00 145.62 ? 1065 PHE A CA  1 
ATOM   2006 C  C   . PHE A  1 291 ? -22.371 13.711  38.791  1.00 149.86 ? 1065 PHE A C   1 
ATOM   2007 O  O   . PHE A  1 291 ? -23.599 13.682  38.892  1.00 149.43 ? 1065 PHE A O   1 
ATOM   2008 C  CB  . PHE A  1 291 ? -21.658 13.759  36.350  1.00 147.34 ? 1065 PHE A CB  1 
ATOM   2009 N  N   . ASP A  1 292 ? -21.540 13.059  39.646  1.00 146.63 ? 1066 ASP A N   1 
ATOM   2010 C  CA  . ASP A  1 292 ? -22.000 12.265  40.792  1.00 146.43 ? 1066 ASP A CA  1 
ATOM   2011 C  C   . ASP A  1 292 ? -22.558 13.189  41.883  1.00 150.39 ? 1066 ASP A C   1 
ATOM   2012 O  O   . ASP A  1 292 ? -23.599 12.874  42.466  1.00 150.28 ? 1066 ASP A O   1 
ATOM   2013 C  CB  . ASP A  1 292 ? -20.872 11.371  41.342  1.00 148.11 ? 1066 ASP A CB  1 
ATOM   2014 C  CG  . ASP A  1 292 ? -21.303 9.957   41.693  1.00 157.46 ? 1066 ASP A CG  1 
ATOM   2015 O  OD1 . ASP A  1 292 ? -21.760 9.229   40.781  1.00 158.15 ? 1066 ASP A OD1 1 
ATOM   2016 O  OD2 . ASP A  1 292 ? -21.166 9.571   42.872  1.00 162.67 ? 1066 ASP A OD2 1 
ATOM   2017 N  N   . ILE A  1 293 ? -21.885 14.341  42.129  1.00 146.24 ? 1067 ILE A N   1 
ATOM   2018 C  CA  . ILE A  1 293 ? -22.310 15.362  43.096  1.00 145.51 ? 1067 ILE A CA  1 
ATOM   2019 C  C   . ILE A  1 293 ? -23.567 16.077  42.595  1.00 148.72 ? 1067 ILE A C   1 
ATOM   2020 O  O   . ILE A  1 293 ? -24.439 16.414  43.396  1.00 148.43 ? 1067 ILE A O   1 
ATOM   2021 C  CB  . ILE A  1 293 ? -21.171 16.365  43.371  1.00 148.50 ? 1067 ILE A CB  1 
ATOM   2022 N  N   . LEU A  1 294 ? -23.652 16.291  41.264  1.00 144.71 ? 1068 LEU A N   1 
ATOM   2023 C  CA  . LEU A  1 294 ? -24.775 16.934  40.582  1.00 144.29 ? 1068 LEU A CA  1 
ATOM   2024 C  C   . LEU A  1 294 ? -26.024 16.030  40.574  1.00 148.95 ? 1068 LEU A C   1 
ATOM   2025 O  O   . LEU A  1 294 ? -27.139 16.545  40.703  1.00 148.72 ? 1068 LEU A O   1 
ATOM   2026 C  CB  . LEU A  1 294 ? -24.362 17.355  39.154  1.00 144.05 ? 1068 LEU A CB  1 
ATOM   2027 C  CG  . LEU A  1 294 ? -25.316 18.257  38.351  1.00 148.07 ? 1068 LEU A CG  1 
ATOM   2028 C  CD1 . LEU A  1 294 ? -25.480 19.618  38.994  1.00 148.09 ? 1068 LEU A CD1 1 
ATOM   2029 C  CD2 . LEU A  1 294 ? -24.820 18.436  36.933  1.00 149.63 ? 1068 LEU A CD2 1 
ATOM   2030 N  N   . VAL A  1 295 ? -25.837 14.691  40.445  1.00 145.72 ? 1069 VAL A N   1 
ATOM   2031 C  CA  . VAL A  1 295 ? -26.931 13.707  40.460  1.00 145.54 ? 1069 VAL A CA  1 
ATOM   2032 C  C   . VAL A  1 295 ? -27.599 13.665  41.843  1.00 150.00 ? 1069 VAL A C   1 
ATOM   2033 O  O   . VAL A  1 295 ? -28.826 13.576  41.928  1.00 149.01 ? 1069 VAL A O   1 
ATOM   2034 C  CB  . VAL A  1 295 ? -26.469 12.308  39.996  1.00 149.22 ? 1069 VAL A CB  1 
ATOM   2035 N  N   . GLY A  1 296 ? -26.779 13.765  42.897  1.00 147.73 ? 1070 GLY A N   1 
ATOM   2036 C  CA  . GLY A  1 296 ? -27.210 13.810  44.292  1.00 147.89 ? 1070 GLY A CA  1 
ATOM   2037 C  C   . GLY A  1 296 ? -28.026 15.056  44.586  1.00 152.01 ? 1070 GLY A C   1 
ATOM   2038 O  O   . GLY A  1 296 ? -29.065 14.972  45.250  1.00 151.49 ? 1070 GLY A O   1 
ATOM   2039 N  N   . GLN A  1 297 ? -27.574 16.219  44.049  1.00 148.39 ? 1071 GLN A N   1 
ATOM   2040 C  CA  . GLN A  1 297 ? -28.236 17.526  44.158  1.00 147.94 ? 1071 GLN A CA  1 
ATOM   2041 C  C   . GLN A  1 297 ? -29.560 17.526  43.397  1.00 151.97 ? 1071 GLN A C   1 
ATOM   2042 O  O   . GLN A  1 297 ? -30.482 18.247  43.785  1.00 151.80 ? 1071 GLN A O   1 
ATOM   2043 C  CB  . GLN A  1 297 ? -27.332 18.647  43.621  1.00 149.08 ? 1071 GLN A CB  1 
ATOM   2044 C  CG  . GLN A  1 297 ? -26.246 19.073  44.584  1.00 162.38 ? 1071 GLN A CG  1 
ATOM   2045 C  CD  . GLN A  1 297 ? -25.199 19.879  43.871  1.00 182.40 ? 1071 GLN A CD  1 
ATOM   2046 O  OE1 . GLN A  1 297 ? -24.233 19.337  43.321  1.00 177.50 ? 1071 GLN A OE1 1 
ATOM   2047 N  NE2 . GLN A  1 297 ? -25.369 21.192  43.858  1.00 175.31 ? 1071 GLN A NE2 1 
ATOM   2048 N  N   . ILE A  1 298 ? -29.651 16.720  42.313  1.00 148.28 ? 1072 ILE A N   1 
ATOM   2049 C  CA  . ILE A  1 298 ? -30.852 16.582  41.488  1.00 148.01 ? 1072 ILE A CA  1 
ATOM   2050 C  C   . ILE A  1 298 ? -31.956 15.854  42.261  1.00 151.43 ? 1072 ILE A C   1 
ATOM   2051 O  O   . ILE A  1 298 ? -33.087 16.343  42.303  1.00 151.16 ? 1072 ILE A O   1 
ATOM   2052 C  CB  . ILE A  1 298 ? -30.532 15.901  40.140  1.00 151.16 ? 1072 ILE A CB  1 
ATOM   2053 N  N   . ASP A  1 299 ? -31.614 14.712  42.903  1.00 147.40 ? 1073 ASP A N   1 
ATOM   2054 C  CA  . ASP A  1 299 ? -32.531 13.898  43.709  1.00 146.95 ? 1073 ASP A CA  1 
ATOM   2055 C  C   . ASP A  1 299 ? -33.050 14.656  44.939  1.00 150.38 ? 1073 ASP A C   1 
ATOM   2056 O  O   . ASP A  1 299 ? -34.188 14.422  45.363  1.00 149.69 ? 1073 ASP A O   1 
ATOM   2057 C  CB  . ASP A  1 299 ? -31.857 12.583  44.132  1.00 148.64 ? 1073 ASP A CB  1 
ATOM   2058 C  CG  . ASP A  1 299 ? -31.913 11.495  43.082  1.00 156.56 ? 1073 ASP A CG  1 
ATOM   2059 O  OD1 . ASP A  1 299 ? -32.980 10.862  42.941  1.00 156.51 ? 1073 ASP A OD1 1 
ATOM   2060 O  OD2 . ASP A  1 299 ? -30.882 11.261  42.416  1.00 162.26 ? 1073 ASP A OD2 1 
ATOM   2061 N  N   . ASP A  1 300 ? -32.211 15.561  45.503  1.00 146.65 ? 1074 ASP A N   1 
ATOM   2062 C  CA  . ASP A  1 300 ? -32.535 16.407  46.658  1.00 146.12 ? 1074 ASP A CA  1 
ATOM   2063 C  C   . ASP A  1 300 ? -33.634 17.410  46.288  1.00 148.87 ? 1074 ASP A C   1 
ATOM   2064 O  O   . ASP A  1 300 ? -34.548 17.640  47.083  1.00 148.34 ? 1074 ASP A O   1 
ATOM   2065 C  CB  . ASP A  1 300 ? -31.281 17.139  47.171  1.00 147.83 ? 1074 ASP A CB  1 
ATOM   2066 N  N   . ALA A  1 301 ? -33.549 17.983  45.069  1.00 144.47 ? 1075 ALA A N   1 
ATOM   2067 C  CA  . ALA A  1 301 ? -34.515 18.938  44.538  1.00 160.09 ? 1075 ALA A CA  1 
ATOM   2068 C  C   . ALA A  1 301 ? -35.787 18.211  44.118  1.00 154.92 ? 1075 ALA A C   1 
ATOM   2069 O  O   . ALA A  1 301 ? -36.859 18.806  44.119  1.00 103.53 ? 1075 ALA A O   1 
ATOM   2070 C  CB  . ALA A  1 301 ? -33.920 19.672  43.349  1.00 160.88 ? 1075 ALA A CB  1 
ATOM   2071 N  N   . ALA A  1 317 ? -32.475 25.030  42.811  1.00 168.18 ? 1091 ALA A N   1 
ATOM   2072 C  CA  . ALA A  1 317 ? -32.048 25.193  41.423  1.00 167.80 ? 1091 ALA A CA  1 
ATOM   2073 C  C   . ALA A  1 317 ? -30.754 26.000  41.319  1.00 171.25 ? 1091 ALA A C   1 
ATOM   2074 O  O   . ALA A  1 317 ? -29.933 25.715  40.447  1.00 170.95 ? 1091 ALA A O   1 
ATOM   2075 C  CB  . ALA A  1 317 ? -33.149 25.855  40.608  1.00 168.64 ? 1091 ALA A CB  1 
ATOM   2076 N  N   . GLU A  1 318 ? -30.572 27.002  42.204  1.00 167.50 ? 1092 GLU A N   1 
ATOM   2077 C  CA  . GLU A  1 318 ? -29.367 27.836  42.244  1.00 167.37 ? 1092 GLU A CA  1 
ATOM   2078 C  C   . GLU A  1 318 ? -28.184 27.101  42.906  1.00 170.72 ? 1092 GLU A C   1 
ATOM   2079 O  O   . GLU A  1 318 ? -27.042 27.546  42.766  1.00 170.38 ? 1092 GLU A O   1 
ATOM   2080 C  CB  . GLU A  1 318 ? -29.645 29.187  42.927  1.00 168.88 ? 1092 GLU A CB  1 
ATOM   2081 N  N   . GLN A  1 319 ? -28.460 25.975  43.614  1.00 166.42 ? 1093 GLN A N   1 
ATOM   2082 C  CA  . GLN A  1 319 ? -27.458 25.127  44.273  1.00 165.51 ? 1093 GLN A CA  1 
ATOM   2083 C  C   . GLN A  1 319 ? -26.816 24.171  43.259  1.00 167.39 ? 1093 GLN A C   1 
ATOM   2084 O  O   . GLN A  1 319 ? -25.600 23.972  43.302  1.00 166.70 ? 1093 GLN A O   1 
ATOM   2085 C  CB  . GLN A  1 319 ? -28.080 24.346  45.441  1.00 166.85 ? 1093 GLN A CB  1 
ATOM   2086 N  N   . LEU A  1 320 ? -27.634 23.591  42.342  1.00 162.60 ? 1094 LEU A N   1 
ATOM   2087 C  CA  . LEU A  1 320 ? -27.169 22.689  41.280  1.00 161.49 ? 1094 LEU A CA  1 
ATOM   2088 C  C   . LEU A  1 320 ? -26.545 23.466  40.113  1.00 163.30 ? 1094 LEU A C   1 
ATOM   2089 O  O   . LEU A  1 320 ? -25.749 22.899  39.367  1.00 163.10 ? 1094 LEU A O   1 
ATOM   2090 C  CB  . LEU A  1 320 ? -28.273 21.735  40.798  1.00 161.50 ? 1094 LEU A CB  1 
ATOM   2091 N  N   . LYS A  1 321 ? -26.870 24.771  39.982  1.00 158.19 ? 1095 LYS A N   1 
ATOM   2092 C  CA  . LYS A  1 321 ? -26.307 25.665  38.963  1.00 157.34 ? 1095 LYS A CA  1 
ATOM   2093 C  C   . LYS A  1 321 ? -24.851 26.028  39.308  1.00 159.85 ? 1095 LYS A C   1 
ATOM   2094 O  O   . LYS A  1 321 ? -24.088 26.413  38.420  1.00 159.38 ? 1095 LYS A O   1 
ATOM   2095 C  CB  . LYS A  1 321 ? -27.164 26.931  38.813  1.00 159.87 ? 1095 LYS A CB  1 
ATOM   2096 N  N   . THR A  1 322 ? -24.475 25.896  40.599  1.00 155.40 ? 1096 THR A N   1 
ATOM   2097 C  CA  . THR A  1 322 ? -23.127 26.150  41.104  1.00 154.84 ? 1096 THR A CA  1 
ATOM   2098 C  C   . THR A  1 322 ? -22.175 25.008  40.725  1.00 158.03 ? 1096 THR A C   1 
ATOM   2099 O  O   . THR A  1 322 ? -21.012 25.272  40.415  1.00 157.30 ? 1096 THR A O   1 
ATOM   2100 C  CB  . THR A  1 322 ? -23.161 26.371  42.617  1.00 162.42 ? 1096 THR A CB  1 
ATOM   2101 N  N   . THR A  1 323 ? -22.658 23.746  40.762  1.00 154.36 ? 1097 THR A N   1 
ATOM   2102 C  CA  . THR A  1 323 ? -21.885 22.538  40.429  1.00 154.00 ? 1097 THR A CA  1 
ATOM   2103 C  C   . THR A  1 323 ? -21.567 22.485  38.928  1.00 158.39 ? 1097 THR A C   1 
ATOM   2104 O  O   . THR A  1 323 ? -20.440 22.148  38.554  1.00 157.86 ? 1097 THR A O   1 
ATOM   2105 C  CB  . THR A  1 323 ? -22.613 21.280  40.948  1.00 158.92 ? 1097 THR A CB  1 
ATOM   2106 O  OG1 . THR A  1 323 ? -22.907 21.465  42.329  1.00 157.96 ? 1097 THR A OG1 1 
ATOM   2107 C  CG2 . THR A  1 323 ? -21.799 20.001  40.777  1.00 156.36 ? 1097 THR A CG2 1 
ATOM   2108 N  N   . ARG A  1 324 ? -22.556 22.847  38.079  1.00 155.32 ? 1098 ARG A N   1 
ATOM   2109 C  CA  . ARG A  1 324 ? -22.428 22.879  36.616  1.00 155.17 ? 1098 ARG A CA  1 
ATOM   2110 C  C   . ARG A  1 324 ? -21.528 24.031  36.143  1.00 159.21 ? 1098 ARG A C   1 
ATOM   2111 O  O   . ARG A  1 324 ? -21.187 24.091  34.959  1.00 159.06 ? 1098 ARG A O   1 
ATOM   2112 C  CB  . ARG A  1 324 ? -23.814 22.962  35.951  1.00 155.02 ? 1098 ARG A CB  1 
ATOM   2113 N  N   . ASN A  1 325 ? -21.140 24.932  37.072  1.00 155.49 ? 1099 ASN A N   1 
ATOM   2114 C  CA  . ASN A  1 325 ? -20.288 26.096  36.820  1.00 155.12 ? 1099 ASN A CA  1 
ATOM   2115 C  C   . ASN A  1 325 ? -18.912 26.005  37.519  1.00 158.24 ? 1099 ASN A C   1 
ATOM   2116 O  O   . ASN A  1 325 ? -18.145 26.972  37.479  1.00 157.67 ? 1099 ASN A O   1 
ATOM   2117 C  CB  . ASN A  1 325 ? -21.027 27.373  37.245  1.00 155.75 ? 1099 ASN A CB  1 
ATOM   2118 N  N   . ALA A  1 326 ? -18.589 24.840  38.131  1.00 154.05 ? 1100 ALA A N   1 
ATOM   2119 C  CA  . ALA A  1 326 ? -17.354 24.630  38.896  1.00 153.18 ? 1100 ALA A CA  1 
ATOM   2120 C  C   . ALA A  1 326 ? -16.765 23.228  38.761  1.00 155.12 ? 1100 ALA A C   1 
ATOM   2121 O  O   . ALA A  1 326 ? -15.541 23.089  38.826  1.00 154.41 ? 1100 ALA A O   1 
ATOM   2122 C  CB  . ALA A  1 326 ? -17.598 24.948  40.366  1.00 153.94 ? 1100 ALA A CB  1 
ATOM   2123 N  N   . TYR A  1 327 ? -17.623 22.193  38.600  1.00 150.53 ? 1101 TYR A N   1 
ATOM   2124 C  CA  . TYR A  1 327 ? -17.204 20.789  38.472  1.00 149.77 ? 1101 TYR A CA  1 
ATOM   2125 C  C   . TYR A  1 327 ? -17.357 20.213  37.052  1.00 152.41 ? 1101 TYR A C   1 
ATOM   2126 O  O   . TYR A  1 327 ? -16.858 19.113  36.787  1.00 151.53 ? 1101 TYR A O   1 
ATOM   2127 C  CB  . TYR A  1 327 ? -17.960 19.910  39.481  1.00 150.85 ? 1101 TYR A CB  1 
ATOM   2128 N  N   . ILE A  1 328 ? -18.047 20.942  36.148  1.00 148.55 ? 1102 ILE A N   1 
ATOM   2129 C  CA  . ILE A  1 328 ? -18.296 20.472  34.785  1.00 148.02 ? 1102 ILE A CA  1 
ATOM   2130 C  C   . ILE A  1 328 ? -18.088 21.531  33.678  1.00 151.26 ? 1102 ILE A C   1 
ATOM   2131 O  O   . ILE A  1 328 ? -17.890 21.145  32.527  1.00 150.97 ? 1102 ILE A O   1 
ATOM   2132 C  CB  . ILE A  1 328 ? -19.710 19.849  34.701  1.00 151.04 ? 1102 ILE A CB  1 
ATOM   2133 N  N   . GLN A  1 329 ? -18.140 22.838  34.007  1.00 147.27 ? 1103 GLN A N   1 
ATOM   2134 C  CA  . GLN A  1 329 ? -17.991 23.933  33.037  1.00 146.89 ? 1103 GLN A CA  1 
ATOM   2135 C  C   . GLN A  1 329 ? -16.649 23.947  32.293  1.00 150.93 ? 1103 GLN A C   1 
ATOM   2136 O  O   . GLN A  1 329 ? -16.614 24.311  31.114  1.00 150.60 ? 1103 GLN A O   1 
ATOM   2137 C  CB  . GLN A  1 329 ? -18.253 25.293  33.697  1.00 148.18 ? 1103 GLN A CB  1 
ATOM   2138 N  N   . LYS A  1 330 ? -15.553 23.553  32.977  1.00 147.59 ? 1104 LYS A N   1 
ATOM   2139 C  CA  . LYS A  1 330 ? -14.204 23.521  32.398  1.00 147.47 ? 1104 LYS A CA  1 
ATOM   2140 C  C   . LYS A  1 330 ? -14.042 22.438  31.320  1.00 151.60 ? 1104 LYS A C   1 
ATOM   2141 O  O   . LYS A  1 330 ? -13.468 22.717  30.265  1.00 151.31 ? 1104 LYS A O   1 
ATOM   2142 C  CB  . LYS A  1 330 ? -13.127 23.393  33.492  1.00 149.72 ? 1104 LYS A CB  1 
ATOM   2143 N  N   . TYR A  1 331 ? -14.567 21.220  31.578  1.00 148.02 ? 1105 TYR A N   1 
ATOM   2144 C  CA  . TYR A  1 331 ? -14.502 20.064  30.672  1.00 147.72 ? 1105 TYR A CA  1 
ATOM   2145 C  C   . TYR A  1 331 ? -15.361 20.229  29.411  1.00 151.15 ? 1105 TYR A C   1 
ATOM   2146 O  O   . TYR A  1 331 ? -15.049 19.618  28.387  1.00 150.76 ? 1105 TYR A O   1 
ATOM   2147 C  CB  . TYR A  1 331 ? -14.883 18.768  31.414  1.00 149.05 ? 1105 TYR A CB  1 
ATOM   2148 C  CG  . TYR A  1 331 ? -13.890 18.344  32.475  1.00 151.11 ? 1105 TYR A CG  1 
ATOM   2149 C  CD1 . TYR A  1 331 ? -12.888 17.424  32.189  1.00 153.19 ? 1105 TYR A CD1 1 
ATOM   2150 C  CD2 . TYR A  1 331 ? -13.971 18.839  33.773  1.00 152.01 ? 1105 TYR A CD2 1 
ATOM   2151 C  CE1 . TYR A  1 331 ? -11.978 17.024  33.162  1.00 154.41 ? 1105 TYR A CE1 1 
ATOM   2152 C  CE2 . TYR A  1 331 ? -13.058 18.455  34.753  1.00 153.02 ? 1105 TYR A CE2 1 
ATOM   2153 C  CZ  . TYR A  1 331 ? -12.063 17.542  34.443  1.00 161.10 ? 1105 TYR A CZ  1 
ATOM   2154 O  OH  . TYR A  1 331 ? -11.150 17.161  35.399  1.00 162.59 ? 1105 TYR A OH  1 
ATOM   2155 N  N   . LEU A  1 332 ? -16.447 21.031  29.494  1.00 147.25 ? 1106 LEU A N   1 
ATOM   2156 C  CA  . LEU A  1 332 ? -17.369 21.291  28.385  1.00 163.02 ? 1106 LEU A CA  1 
ATOM   2157 C  C   . LEU A  1 332 ? -17.616 22.786  28.222  1.00 168.85 ? 1106 LEU A C   1 
ATOM   2158 O  O   . LEU A  1 332 ? -17.878 23.249  27.114  1.00 120.80 ? 1106 LEU A O   1 
ATOM   2159 C  CB  . LEU A  1 332 ? -18.698 20.555  28.602  1.00 162.99 ? 1106 LEU A CB  1 
ATOM   2160 N  N   . LEU A  1 337 ? -12.294 20.846  19.343  1.00 123.83 ? 225  LEU A N   1 
ATOM   2161 C  CA  . LEU A  1 337 ? -10.975 20.222  19.423  1.00 123.34 ? 225  LEU A CA  1 
ATOM   2162 C  C   . LEU A  1 337 ? -10.091 20.583  18.216  1.00 126.01 ? 225  LEU A C   1 
ATOM   2163 O  O   . LEU A  1 337 ? -10.519 20.459  17.066  1.00 125.60 ? 225  LEU A O   1 
ATOM   2164 C  CB  . LEU A  1 337 ? -11.114 18.702  19.586  1.00 123.37 ? 225  LEU A CB  1 
ATOM   2165 N  N   . SER A  1 338 ? -8.857  21.044  18.498  1.00 121.25 ? 226  SER A N   1 
ATOM   2166 C  CA  . SER A  1 338 ? -7.867  21.477  17.505  1.00 120.11 ? 226  SER A CA  1 
ATOM   2167 C  C   . SER A  1 338 ? -7.144  20.332  16.794  1.00 120.46 ? 226  SER A C   1 
ATOM   2168 O  O   . SER A  1 338 ? -6.870  20.457  15.600  1.00 119.38 ? 226  SER A O   1 
ATOM   2169 C  CB  . SER A  1 338 ? -6.856  22.428  18.138  1.00 124.38 ? 226  SER A CB  1 
ATOM   2170 O  OG  . SER A  1 338 ? -6.169  21.809  19.214  1.00 134.64 ? 226  SER A OG  1 
ATOM   2171 N  N   . SER A  1 339 ? -6.845  19.219  17.518  1.00 115.22 ? 227  SER A N   1 
ATOM   2172 C  CA  . SER A  1 339 ? -6.172  18.008  17.005  1.00 114.40 ? 227  SER A CA  1 
ATOM   2173 C  C   . SER A  1 339 ? -6.897  17.422  15.787  1.00 114.63 ? 227  SER A C   1 
ATOM   2174 O  O   . SER A  1 339 ? -6.286  16.746  14.956  1.00 113.90 ? 227  SER A O   1 
ATOM   2175 C  CB  . SER A  1 339 ? -6.065  16.947  18.101  1.00 119.09 ? 227  SER A CB  1 
ATOM   2176 O  OG  . SER A  1 339 ? -5.279  17.384  19.200  1.00 129.56 ? 227  SER A OG  1 
ATOM   2177 N  N   . HIS A  1 340 ? -8.202  17.721  15.703  1.00 108.28 ? 228  HIS A N   1 
ATOM   2178 C  CA  . HIS A  1 340 ? -9.172  17.359  14.680  1.00 106.64 ? 228  HIS A CA  1 
ATOM   2179 C  C   . HIS A  1 340 ? -9.054  18.273  13.448  1.00 103.51 ? 228  HIS A C   1 
ATOM   2180 O  O   . HIS A  1 340 ? -9.257  17.807  12.327  1.00 102.21 ? 228  HIS A O   1 
ATOM   2181 C  CB  . HIS A  1 340 ? -10.573 17.559  15.268  1.00 108.25 ? 228  HIS A CB  1 
ATOM   2182 C  CG  . HIS A  1 340 ? -11.147 16.445  16.088  1.00 112.18 ? 228  HIS A CG  1 
ATOM   2183 N  ND1 . HIS A  1 340 ? -10.396 15.669  16.981  1.00 114.07 ? 228  HIS A ND1 1 
ATOM   2184 C  CD2 . HIS A  1 340 ? -12.438 16.076  16.179  1.00 114.35 ? 228  HIS A CD2 1 
ATOM   2185 C  CE1 . HIS A  1 340 ? -11.262 14.835  17.535  1.00 113.75 ? 228  HIS A CE1 1 
ATOM   2186 N  NE2 . HIS A  1 340 ? -12.500 15.053  17.093  1.00 114.18 ? 228  HIS A NE2 1 
ATOM   2187 N  N   . LYS A  1 341 ? -8.785  19.578  13.670  1.00 96.02  ? 229  LYS A N   1 
ATOM   2188 C  CA  . LYS A  1 341 ? -8.634  20.598  12.625  1.00 93.95  ? 229  LYS A CA  1 
ATOM   2189 C  C   . LYS A  1 341 ? -7.290  20.489  11.892  1.00 92.70  ? 229  LYS A C   1 
ATOM   2190 O  O   . LYS A  1 341 ? -7.243  20.742  10.684  1.00 91.56  ? 229  LYS A O   1 
ATOM   2191 C  CB  . LYS A  1 341 ? -8.811  22.006  13.217  1.00 96.87  ? 229  LYS A CB  1 
ATOM   2192 N  N   . LYS A  1 342 ? -6.201  20.121  12.624  1.00 86.06  ? 230  LYS A N   1 
ATOM   2193 C  CA  . LYS A  1 342 ? -4.848  19.939  12.071  1.00 84.38  ? 230  LYS A CA  1 
ATOM   2194 C  C   . LYS A  1 342 ? -4.755  18.643  11.230  1.00 84.05  ? 230  LYS A C   1 
ATOM   2195 O  O   . LYS A  1 342 ? -3.974  18.581  10.275  1.00 84.22  ? 230  LYS A O   1 
ATOM   2196 C  CB  . LYS A  1 342 ? -3.787  19.961  13.184  1.00 87.40  ? 230  LYS A CB  1 
ATOM   2197 N  N   . ALA A  1 343 ? -5.564  17.619  11.580  1.00 76.01  ? 231  ALA A N   1 
ATOM   2198 C  CA  . ALA A  1 343 ? -5.640  16.356  10.856  1.00 73.01  ? 231  ALA A CA  1 
ATOM   2199 C  C   . ALA A  1 343 ? -6.380  16.570  9.542   1.00 73.67  ? 231  ALA A C   1 
ATOM   2200 O  O   . ALA A  1 343 ? -5.924  16.049  8.527   1.00 74.56  ? 231  ALA A O   1 
ATOM   2201 C  CB  . ALA A  1 343 ? -6.343  15.317  11.695  1.00 73.46  ? 231  ALA A CB  1 
ATOM   2202 N  N   . ILE A  1 344 ? -7.503  17.348  9.547   1.00 67.21  ? 232  ILE A N   1 
ATOM   2203 C  CA  . ILE A  1 344 ? -8.281  17.684  8.349   1.00 66.27  ? 232  ILE A CA  1 
ATOM   2204 C  C   . ILE A  1 344 ? -7.449  18.539  7.389   1.00 67.81  ? 232  ILE A C   1 
ATOM   2205 O  O   . ILE A  1 344 ? -7.504  18.312  6.179   1.00 66.93  ? 232  ILE A O   1 
ATOM   2206 C  CB  . ILE A  1 344 ? -9.675  18.310  8.671   1.00 70.16  ? 232  ILE A CB  1 
ATOM   2207 C  CG1 . ILE A  1 344 ? -10.628 17.280  9.343   1.00 72.06  ? 232  ILE A CG1 1 
ATOM   2208 C  CG2 . ILE A  1 344 ? -10.333 18.968  7.435   1.00 70.14  ? 232  ILE A CG2 1 
ATOM   2209 C  CD1 . ILE A  1 344 ? -11.689 16.411  8.419   1.00 81.45  ? 232  ILE A CD1 1 
ATOM   2210 N  N   . GLY A  1 345 ? -6.679  19.485  7.937   1.00 62.96  ? 233  GLY A N   1 
ATOM   2211 C  CA  . GLY A  1 345 ? -5.805  20.366  7.163   1.00 61.98  ? 233  GLY A CA  1 
ATOM   2212 C  C   . GLY A  1 345 ? -4.760  19.604  6.370   1.00 63.91  ? 233  GLY A C   1 
ATOM   2213 O  O   . GLY A  1 345 ? -4.589  19.863  5.173   1.00 64.27  ? 233  GLY A O   1 
ATOM   2214 N  N   . MET A  1 346 ? -4.085  18.625  7.039   1.00 57.22  ? 234  MET A N   1 
ATOM   2215 C  CA  . MET A  1 346 ? -3.073  17.724  6.483   1.00 56.28  ? 234  MET A CA  1 
ATOM   2216 C  C   . MET A  1 346 ? -3.662  16.886  5.356   1.00 62.27  ? 234  MET A C   1 
ATOM   2217 O  O   . MET A  1 346 ? -3.061  16.850  4.271   1.00 61.16  ? 234  MET A O   1 
ATOM   2218 C  CB  . MET A  1 346 ? -2.493  16.830  7.579   1.00 58.40  ? 234  MET A CB  1 
ATOM   2219 C  CG  . MET A  1 346 ? -1.441  15.850  7.095   1.00 62.01  ? 234  MET A CG  1 
ATOM   2220 S  SD  . MET A  1 346 ? -1.001  14.593  8.325   1.00 66.15  ? 234  MET A SD  1 
ATOM   2221 C  CE  . MET A  1 346 ? -2.506  13.641  8.373   1.00 62.71  ? 234  MET A CE  1 
ATOM   2222 N  N   . ILE A  1 347 ? -4.852  16.235  5.604   1.00 59.45  ? 235  ILE A N   1 
ATOM   2223 C  CA  . ILE A  1 347 ? -5.581  15.405  4.641   1.00 58.38  ? 235  ILE A CA  1 
ATOM   2224 C  C   . ILE A  1 347 ? -5.816  16.172  3.337   1.00 64.59  ? 235  ILE A C   1 
ATOM   2225 O  O   . ILE A  1 347 ? -5.486  15.661  2.277   1.00 64.94  ? 235  ILE A O   1 
ATOM   2226 C  CB  . ILE A  1 347 ? -6.883  14.781  5.243   1.00 60.83  ? 235  ILE A CB  1 
ATOM   2227 C  CG1 . ILE A  1 347 ? -6.546  13.690  6.280   1.00 61.10  ? 235  ILE A CG1 1 
ATOM   2228 C  CG2 . ILE A  1 347 ? -7.831  14.225  4.147   1.00 60.04  ? 235  ILE A CG2 1 
ATOM   2229 C  CD1 . ILE A  1 347 ? -7.739  13.115  7.059   1.00 65.45  ? 235  ILE A CD1 1 
ATOM   2230 N  N   . MET A  1 348 ? -6.324  17.400  3.421   1.00 63.20  ? 236  MET A N   1 
ATOM   2231 C  CA  . MET A  1 348 ? -6.637  18.214  2.251   1.00 65.25  ? 236  MET A CA  1 
ATOM   2232 C  C   . MET A  1 348 ? -5.419  18.627  1.436   1.00 65.47  ? 236  MET A C   1 
ATOM   2233 O  O   . MET A  1 348 ? -5.479  18.538  0.208   1.00 65.70  ? 236  MET A O   1 
ATOM   2234 C  CB  . MET A  1 348 ? -7.460  19.458  2.638   1.00 69.75  ? 236  MET A CB  1 
ATOM   2235 C  CG  . MET A  1 348 ? -8.671  19.157  3.478   1.00 76.43  ? 236  MET A CG  1 
ATOM   2236 S  SD  . MET A  1 348 ? -10.203 19.040  2.539   1.00 84.19  ? 236  MET A SD  1 
ATOM   2237 C  CE  . MET A  1 348 ? -10.638 20.749  2.451   1.00 81.42  ? 236  MET A CE  1 
ATOM   2238 N  N   . VAL A  1 349 ? -4.336  19.112  2.093   1.00 57.56  ? 237  VAL A N   1 
ATOM   2239 C  CA  . VAL A  1 349 ? -3.135  19.566  1.382   1.00 55.02  ? 237  VAL A CA  1 
ATOM   2240 C  C   . VAL A  1 349 ? -2.361  18.376  0.733   1.00 55.40  ? 237  VAL A C   1 
ATOM   2241 O  O   . VAL A  1 349 ? -2.033  18.452  -0.453  1.00 54.07  ? 237  VAL A O   1 
ATOM   2242 C  CB  . VAL A  1 349 ? -2.233  20.474  2.250   1.00 57.82  ? 237  VAL A CB  1 
ATOM   2243 C  CG1 . VAL A  1 349 ? -1.009  20.934  1.467   1.00 57.23  ? 237  VAL A CG1 1 
ATOM   2244 C  CG2 . VAL A  1 349 ? -3.011  21.681  2.782   1.00 57.52  ? 237  VAL A CG2 1 
ATOM   2245 N  N   . VAL A  1 350 ? -2.106  17.287  1.498   1.00 49.36  ? 238  VAL A N   1 
ATOM   2246 C  CA  . VAL A  1 350 ? -1.394  16.073  1.039   1.00 47.31  ? 238  VAL A CA  1 
ATOM   2247 C  C   . VAL A  1 350 ? -2.126  15.352  -0.121  1.00 50.88  ? 238  VAL A C   1 
ATOM   2248 O  O   . VAL A  1 350 ? -1.468  14.925  -1.079  1.00 51.40  ? 238  VAL A O   1 
ATOM   2249 C  CB  . VAL A  1 350 ? -1.094  15.139  2.225   1.00 50.10  ? 238  VAL A CB  1 
ATOM   2250 C  CG1 . VAL A  1 350 ? -0.513  13.806  1.770   1.00 49.87  ? 238  VAL A CG1 1 
ATOM   2251 C  CG2 . VAL A  1 350 ? -0.157  15.823  3.209   1.00 50.00  ? 238  VAL A CG2 1 
ATOM   2252 N  N   . THR A  1 351 ? -3.482  15.244  -0.044  1.00 45.47  ? 239  THR A N   1 
ATOM   2253 C  CA  . THR A  1 351 ? -4.315  14.622  -1.066  1.00 45.48  ? 239  THR A CA  1 
ATOM   2254 C  C   . THR A  1 351 ? -4.214  15.394  -2.372  1.00 51.49  ? 239  THR A C   1 
ATOM   2255 O  O   . THR A  1 351 ? -4.100  14.761  -3.429  1.00 52.26  ? 239  THR A O   1 
ATOM   2256 C  CB  . THR A  1 351 ? -5.745  14.435  -0.553  1.00 54.78  ? 239  THR A CB  1 
ATOM   2257 O  OG1 . THR A  1 351 ? -5.684  13.560  0.566   1.00 55.69  ? 239  THR A OG1 1 
ATOM   2258 C  CG2 . THR A  1 351 ? -6.672  13.815  -1.589  1.00 53.23  ? 239  THR A CG2 1 
ATOM   2259 N  N   . ALA A  1 352 ? -4.238  16.759  -2.289  1.00 46.80  ? 240  ALA A N   1 
ATOM   2260 C  CA  . ALA A  1 352 ? -4.100  17.677  -3.416  1.00 46.58  ? 240  ALA A CA  1 
ATOM   2261 C  C   . ALA A  1 352 ? -2.693  17.564  -4.006  1.00 51.80  ? 240  ALA A C   1 
ATOM   2262 O  O   . ALA A  1 352 ? -2.553  17.437  -5.223  1.00 52.32  ? 240  ALA A O   1 
ATOM   2263 C  CB  . ALA A  1 352 ? -4.389  19.104  -2.979  1.00 47.45  ? 240  ALA A CB  1 
ATOM   2264 N  N   . ALA A  1 353 ? -1.663  17.533  -3.146  1.00 48.54  ? 241  ALA A N   1 
ATOM   2265 C  CA  . ALA A  1 353 ? -0.278  17.346  -3.558  1.00 48.73  ? 241  ALA A CA  1 
ATOM   2266 C  C   . ALA A  1 353 ? -0.163  16.029  -4.352  1.00 53.11  ? 241  ALA A C   1 
ATOM   2267 O  O   . ALA A  1 353 ? 0.429   16.057  -5.426  1.00 55.43  ? 241  ALA A O   1 
ATOM   2268 C  CB  . ALA A  1 353 ? 0.636   17.322  -2.340  1.00 49.50  ? 241  ALA A CB  1 
ATOM   2269 N  N   . PHE A  1 354 ? -0.806  14.917  -3.901  1.00 45.71  ? 242  PHE A N   1 
ATOM   2270 C  CA  . PHE A  1 354 ? -0.743  13.653  -4.643  1.00 44.89  ? 242  PHE A CA  1 
ATOM   2271 C  C   . PHE A  1 354 ? -1.524  13.663  -5.967  1.00 52.36  ? 242  PHE A C   1 
ATOM   2272 O  O   . PHE A  1 354 ? -1.018  13.150  -6.970  1.00 53.90  ? 242  PHE A O   1 
ATOM   2273 C  CB  . PHE A  1 354 ? -1.148  12.452  -3.784  1.00 45.58  ? 242  PHE A CB  1 
ATOM   2274 C  CG  . PHE A  1 354 ? -0.022  11.817  -2.998  1.00 47.11  ? 242  PHE A CG  1 
ATOM   2275 C  CD1 . PHE A  1 354 ? 0.434   12.388  -1.812  1.00 50.60  ? 242  PHE A CD1 1 
ATOM   2276 C  CD2 . PHE A  1 354 ? 0.541   10.611  -3.405  1.00 48.92  ? 242  PHE A CD2 1 
ATOM   2277 C  CE1 . PHE A  1 354 ? 1.462   11.780  -1.069  1.00 50.71  ? 242  PHE A CE1 1 
ATOM   2278 C  CE2 . PHE A  1 354 ? 1.558   10.005  -2.654  1.00 51.07  ? 242  PHE A CE2 1 
ATOM   2279 C  CZ  . PHE A  1 354 ? 2.000   10.588  -1.488  1.00 48.22  ? 242  PHE A CZ  1 
ATOM   2280 N  N   . LEU A  1 355 ? -2.741  14.242  -5.988  1.00 48.56  ? 243  LEU A N   1 
ATOM   2281 C  CA  . LEU A  1 355 ? -3.558  14.260  -7.197  1.00 47.70  ? 243  LEU A CA  1 
ATOM   2282 C  C   . LEU A  1 355 ? -3.028  15.226  -8.260  1.00 51.72  ? 243  LEU A C   1 
ATOM   2283 O  O   . LEU A  1 355 ? -2.948  14.869  -9.430  1.00 50.32  ? 243  LEU A O   1 
ATOM   2284 C  CB  . LEU A  1 355 ? -5.037  14.525  -6.863  1.00 47.95  ? 243  LEU A CB  1 
ATOM   2285 C  CG  . LEU A  1 355 ? -5.746  13.483  -5.958  1.00 53.14  ? 243  LEU A CG  1 
ATOM   2286 C  CD1 . LEU A  1 355 ? -6.988  14.049  -5.352  1.00 53.35  ? 243  LEU A CD1 1 
ATOM   2287 C  CD2 . LEU A  1 355 ? -6.071  12.209  -6.694  1.00 54.66  ? 243  LEU A CD2 1 
ATOM   2288 N  N   . VAL A  1 356 ? -2.596  16.420  -7.836  1.00 50.71  ? 244  VAL A N   1 
ATOM   2289 C  CA  . VAL A  1 356 ? -2.120  17.502  -8.713  1.00 50.22  ? 244  VAL A CA  1 
ATOM   2290 C  C   . VAL A  1 356 ? -0.650  17.389  -9.112  1.00 53.91  ? 244  VAL A C   1 
ATOM   2291 O  O   . VAL A  1 356 ? -0.339  17.569  -10.282 1.00 54.89  ? 244  VAL A O   1 
ATOM   2292 C  CB  . VAL A  1 356 ? -2.429  18.883  -8.082  1.00 53.12  ? 244  VAL A CB  1 
ATOM   2293 C  CG1 . VAL A  1 356 ? -1.951  20.033  -8.965  1.00 52.53  ? 244  VAL A CG1 1 
ATOM   2294 C  CG2 . VAL A  1 356 ? -3.920  19.019  -7.769  1.00 52.80  ? 244  VAL A CG2 1 
ATOM   2295 N  N   . SER A  1 357 ? 0.248   17.116  -8.170  1.00 49.45  ? 245  SER A N   1 
ATOM   2296 C  CA  . SER A  1 357 ? 1.685   17.135  -8.436  1.00 49.21  ? 245  SER A CA  1 
ATOM   2297 C  C   . SER A  1 357 ? 2.321   15.764  -8.812  1.00 55.16  ? 245  SER A C   1 
ATOM   2298 O  O   . SER A  1 357 ? 2.812   15.595  -9.948  1.00 55.68  ? 245  SER A O   1 
ATOM   2299 C  CB  . SER A  1 357 ? 2.409   17.776  -7.254  1.00 50.95  ? 245  SER A CB  1 
ATOM   2300 O  OG  . SER A  1 357 ? 3.784   17.968  -7.512  1.00 61.29  ? 245  SER A OG  1 
ATOM   2301 N  N   . PHE A  1 358 ? 2.282   14.796  -7.875  1.00 50.92  ? 246  PHE A N   1 
ATOM   2302 C  CA  . PHE A  1 358 ? 2.886   13.472  -8.014  1.00 49.77  ? 246  PHE A CA  1 
ATOM   2303 C  C   . PHE A  1 358 ? 2.207   12.542  -9.012  1.00 55.48  ? 246  PHE A C   1 
ATOM   2304 O  O   . PHE A  1 358 ? 2.929   11.865  -9.757  1.00 56.58  ? 246  PHE A O   1 
ATOM   2305 C  CB  . PHE A  1 358 ? 3.004   12.767  -6.648  1.00 50.37  ? 246  PHE A CB  1 
ATOM   2306 C  CG  . PHE A  1 358 ? 3.542   13.611  -5.516  1.00 50.75  ? 246  PHE A CG  1 
ATOM   2307 C  CD1 . PHE A  1 358 ? 4.700   14.378  -5.680  1.00 51.85  ? 246  PHE A CD1 1 
ATOM   2308 C  CD2 . PHE A  1 358 ? 2.913   13.618  -4.275  1.00 51.88  ? 246  PHE A CD2 1 
ATOM   2309 C  CE1 . PHE A  1 358 ? 5.192   15.166  -4.640  1.00 51.76  ? 246  PHE A CE1 1 
ATOM   2310 C  CE2 . PHE A  1 358 ? 3.400   14.421  -3.236  1.00 54.40  ? 246  PHE A CE2 1 
ATOM   2311 C  CZ  . PHE A  1 358 ? 4.549   15.175  -3.421  1.00 51.76  ? 246  PHE A CZ  1 
ATOM   2312 N  N   . MET A  1 359 ? 0.850   12.465  -9.020  1.00 50.56  ? 247  MET A N   1 
ATOM   2313 C  CA  . MET A  1 359 ? 0.159   11.503  -9.883  1.00 50.31  ? 247  MET A CA  1 
ATOM   2314 C  C   . MET A  1 359 ? 0.241   11.774  -11.411 1.00 52.78  ? 247  MET A C   1 
ATOM   2315 O  O   . MET A  1 359 ? 0.483   10.808  -12.125 1.00 52.92  ? 247  MET A O   1 
ATOM   2316 C  CB  . MET A  1 359 ? -1.285  11.302  -9.470  1.00 53.20  ? 247  MET A CB  1 
ATOM   2317 C  CG  . MET A  1 359 ? -1.831  9.998   -9.952  1.00 58.58  ? 247  MET A CG  1 
ATOM   2318 S  SD  . MET A  1 359 ? -3.610  9.890   -9.875  1.00 65.35  ? 247  MET A SD  1 
ATOM   2319 C  CE  . MET A  1 359 ? -3.843  9.832   -8.210  1.00 62.43  ? 247  MET A CE  1 
ATOM   2320 N  N   . PRO A  1 360 ? -0.015  12.977  -11.976 1.00 48.16  ? 248  PRO A N   1 
ATOM   2321 C  CA  . PRO A  1 360 ? 0.074   13.118  -13.440 1.00 47.78  ? 248  PRO A CA  1 
ATOM   2322 C  C   . PRO A  1 360 ? 1.423   12.701  -14.034 1.00 52.40  ? 248  PRO A C   1 
ATOM   2323 O  O   . PRO A  1 360 ? 1.422   12.008  -15.059 1.00 51.82  ? 248  PRO A O   1 
ATOM   2324 C  CB  . PRO A  1 360 ? -0.225  14.599  -13.668 1.00 49.60  ? 248  PRO A CB  1 
ATOM   2325 C  CG  . PRO A  1 360 ? -1.040  15.008  -12.455 1.00 54.00  ? 248  PRO A CG  1 
ATOM   2326 C  CD  . PRO A  1 360 ? -0.407  14.257  -11.346 1.00 49.86  ? 248  PRO A CD  1 
ATOM   2327 N  N   . TYR A  1 361 ? 2.566   13.064  -13.370 1.00 49.17  ? 249  TYR A N   1 
ATOM   2328 C  CA  . TYR A  1 361 ? 3.918   12.696  -13.806 1.00 48.15  ? 249  TYR A CA  1 
ATOM   2329 C  C   . TYR A  1 361 ? 4.080   11.181  -13.918 1.00 53.35  ? 249  TYR A C   1 
ATOM   2330 O  O   . TYR A  1 361 ? 4.553   10.704  -14.953 1.00 55.41  ? 249  TYR A O   1 
ATOM   2331 C  CB  . TYR A  1 361 ? 4.994   13.308  -12.896 1.00 48.79  ? 249  TYR A CB  1 
ATOM   2332 C  CG  . TYR A  1 361 ? 6.365   12.659  -12.988 1.00 49.82  ? 249  TYR A CG  1 
ATOM   2333 C  CD1 . TYR A  1 361 ? 7.172   12.837  -14.109 1.00 51.56  ? 249  TYR A CD1 1 
ATOM   2334 C  CD2 . TYR A  1 361 ? 6.874   11.903  -11.935 1.00 49.41  ? 249  TYR A CD2 1 
ATOM   2335 C  CE1 . TYR A  1 361 ? 8.446   12.266  -14.185 1.00 51.64  ? 249  TYR A CE1 1 
ATOM   2336 C  CE2 . TYR A  1 361 ? 8.142   11.320  -12.005 1.00 49.40  ? 249  TYR A CE2 1 
ATOM   2337 C  CZ  . TYR A  1 361 ? 8.929   11.508  -13.129 1.00 53.40  ? 249  TYR A CZ  1 
ATOM   2338 O  OH  . TYR A  1 361 ? 10.193  10.953  -13.187 1.00 48.64  ? 249  TYR A OH  1 
ATOM   2339 N  N   . HIS A  1 362 ? 3.660   10.428  -12.885 1.00 47.17  ? 250  HIS A N   1 
ATOM   2340 C  CA  . HIS A  1 362 ? 3.751   8.969   -12.859 1.00 45.88  ? 250  HIS A CA  1 
ATOM   2341 C  C   . HIS A  1 362 ? 2.844   8.262   -13.871 1.00 51.74  ? 250  HIS A C   1 
ATOM   2342 O  O   . HIS A  1 362 ? 3.190   7.166   -14.309 1.00 53.49  ? 250  HIS A O   1 
ATOM   2343 C  CB  . HIS A  1 362 ? 3.517   8.444   -11.444 1.00 45.60  ? 250  HIS A CB  1 
ATOM   2344 C  CG  . HIS A  1 362 ? 4.689   8.677   -10.550 1.00 47.56  ? 250  HIS A CG  1 
ATOM   2345 N  ND1 . HIS A  1 362 ? 4.783   9.803   -9.773  1.00 48.64  ? 250  HIS A ND1 1 
ATOM   2346 C  CD2 . HIS A  1 362 ? 5.791   7.925   -10.362 1.00 47.68  ? 250  HIS A CD2 1 
ATOM   2347 C  CE1 . HIS A  1 362 ? 5.925   9.697   -9.126  1.00 47.19  ? 250  HIS A CE1 1 
ATOM   2348 N  NE2 . HIS A  1 362 ? 6.564   8.585   -9.454  1.00 47.44  ? 250  HIS A NE2 1 
ATOM   2349 N  N   . ILE A  1 363 ? 1.684   8.858   -14.230 1.00 46.47  ? 251  ILE A N   1 
ATOM   2350 C  CA  . ILE A  1 363 ? 0.789   8.284   -15.236 1.00 45.52  ? 251  ILE A CA  1 
ATOM   2351 C  C   . ILE A  1 363 ? 1.400   8.572   -16.619 1.00 52.32  ? 251  ILE A C   1 
ATOM   2352 O  O   . ILE A  1 363 ? 1.493   7.666   -17.451 1.00 53.85  ? 251  ILE A O   1 
ATOM   2353 C  CB  . ILE A  1 363 ? -0.647  8.820   -15.120 1.00 48.01  ? 251  ILE A CB  1 
ATOM   2354 C  CG1 . ILE A  1 363 ? -1.308  8.395   -13.789 1.00 48.25  ? 251  ILE A CG1 1 
ATOM   2355 C  CG2 . ILE A  1 363 ? -1.479  8.363   -16.308 1.00 47.64  ? 251  ILE A CG2 1 
ATOM   2356 C  CD1 . ILE A  1 363 ? -2.715  9.027   -13.510 1.00 46.50  ? 251  ILE A CD1 1 
ATOM   2357 N  N   . GLN A  1 364 ? 1.873   9.813   -16.825 1.00 49.25  ? 252  GLN A N   1 
ATOM   2358 C  CA  . GLN A  1 364 ? 2.484   10.262  -18.072 1.00 50.02  ? 252  GLN A CA  1 
ATOM   2359 C  C   . GLN A  1 364 ? 3.766   9.492   -18.450 1.00 55.41  ? 252  GLN A C   1 
ATOM   2360 O  O   . GLN A  1 364 ? 3.934   9.150   -19.622 1.00 54.25  ? 252  GLN A O   1 
ATOM   2361 C  CB  . GLN A  1 364 ? 2.719   11.782  -18.048 1.00 51.29  ? 252  GLN A CB  1 
ATOM   2362 C  CG  . GLN A  1 364 ? 2.954   12.432  -19.421 1.00 66.11  ? 252  GLN A CG  1 
ATOM   2363 C  CD  . GLN A  1 364 ? 2.041   11.934  -20.529 1.00 84.41  ? 252  GLN A CD  1 
ATOM   2364 O  OE1 . GLN A  1 364 ? 0.814   11.814  -20.375 1.00 77.93  ? 252  GLN A OE1 1 
ATOM   2365 N  NE2 . GLN A  1 364 ? 2.634   11.648  -21.683 1.00 78.37  ? 252  GLN A NE2 1 
ATOM   2366 N  N   . ARG A  1 365 ? 4.633   9.203   -17.453 1.00 52.68  ? 253  ARG A N   1 
ATOM   2367 C  CA  . ARG A  1 365 ? 5.880   8.452   -17.602 1.00 51.59  ? 253  ARG A CA  1 
ATOM   2368 C  C   . ARG A  1 365 ? 5.581   7.031   -18.057 1.00 57.61  ? 253  ARG A C   1 
ATOM   2369 O  O   . ARG A  1 365 ? 6.339   6.499   -18.858 1.00 59.25  ? 253  ARG A O   1 
ATOM   2370 C  CB  . ARG A  1 365 ? 6.634   8.443   -16.273 1.00 47.30  ? 253  ARG A CB  1 
ATOM   2371 C  CG  . ARG A  1 365 ? 8.115   8.227   -16.414 1.00 46.54  ? 253  ARG A CG  1 
ATOM   2372 C  CD  . ARG A  1 365 ? 8.775   8.344   -15.066 1.00 48.43  ? 253  ARG A CD  1 
ATOM   2373 N  NE  . ARG A  1 365 ? 8.598   7.141   -14.253 1.00 52.72  ? 253  ARG A NE  1 
ATOM   2374 C  CZ  . ARG A  1 365 ? 9.038   7.010   -13.001 1.00 59.84  ? 253  ARG A CZ  1 
ATOM   2375 N  NH1 . ARG A  1 365 ? 9.657   8.020   -12.394 1.00 44.17  ? 253  ARG A NH1 1 
ATOM   2376 N  NH2 . ARG A  1 365 ? 8.862   5.876   -12.348 1.00 41.99  ? 253  ARG A NH2 1 
ATOM   2377 N  N   . THR A  1 366 ? 4.489   6.409   -17.553 1.00 54.95  ? 254  THR A N   1 
ATOM   2378 C  CA  . THR A  1 366 ? 4.063   5.057   -17.955 1.00 55.40  ? 254  THR A CA  1 
ATOM   2379 C  C   . THR A  1 366 ? 3.650   5.103   -19.435 1.00 62.31  ? 254  THR A C   1 
ATOM   2380 O  O   . THR A  1 366 ? 4.198   4.346   -20.235 1.00 62.87  ? 254  THR A O   1 
ATOM   2381 C  CB  . THR A  1 366 ? 2.931   4.522   -17.047 1.00 57.18  ? 254  THR A CB  1 
ATOM   2382 O  OG1 . THR A  1 366 ? 3.340   4.557   -15.681 1.00 56.90  ? 254  THR A OG1 1 
ATOM   2383 C  CG2 . THR A  1 366 ? 2.539   3.101   -17.393 1.00 54.66  ? 254  THR A CG2 1 
ATOM   2384 N  N   . ILE A  1 367 ? 2.719   6.024   -19.788 1.00 60.22  ? 255  ILE A N   1 
ATOM   2385 C  CA  . ILE A  1 367 ? 2.218   6.255   -21.149 1.00 60.95  ? 255  ILE A CA  1 
ATOM   2386 C  C   . ILE A  1 367 ? 3.376   6.539   -22.120 1.00 68.38  ? 255  ILE A C   1 
ATOM   2387 O  O   . ILE A  1 367 ? 3.470   5.869   -23.145 1.00 68.37  ? 255  ILE A O   1 
ATOM   2388 C  CB  . ILE A  1 367 ? 1.115   7.358   -21.184 1.00 63.60  ? 255  ILE A CB  1 
ATOM   2389 C  CG1 . ILE A  1 367 ? -0.165  6.896   -20.474 1.00 63.42  ? 255  ILE A CG1 1 
ATOM   2390 C  CG2 . ILE A  1 367 ? 0.792   7.810   -22.608 1.00 65.09  ? 255  ILE A CG2 1 
ATOM   2391 C  CD1 . ILE A  1 367 ? -0.976  8.035   -19.928 1.00 69.42  ? 255  ILE A CD1 1 
ATOM   2392 N  N   . HIS A  1 368 ? 4.254   7.513   -21.783 1.00 66.89  ? 256  HIS A N   1 
ATOM   2393 C  CA  . HIS A  1 368 ? 5.395   7.943   -22.595 1.00 66.90  ? 256  HIS A CA  1 
ATOM   2394 C  C   . HIS A  1 368 ? 6.373   6.824   -22.935 1.00 68.43  ? 256  HIS A C   1 
ATOM   2395 O  O   . HIS A  1 368 ? 6.710   6.660   -24.104 1.00 67.99  ? 256  HIS A O   1 
ATOM   2396 C  CB  . HIS A  1 368 ? 6.137   9.100   -21.931 1.00 68.41  ? 256  HIS A CB  1 
ATOM   2397 C  CG  . HIS A  1 368 ? 7.137   9.746   -22.833 1.00 72.52  ? 256  HIS A CG  1 
ATOM   2398 N  ND1 . HIS A  1 368 ? 6.806   10.845  -23.601 1.00 74.75  ? 256  HIS A ND1 1 
ATOM   2399 C  CD2 . HIS A  1 368 ? 8.426   9.412   -23.077 1.00 74.64  ? 256  HIS A CD2 1 
ATOM   2400 C  CE1 . HIS A  1 368 ? 7.902   11.148  -24.281 1.00 74.38  ? 256  HIS A CE1 1 
ATOM   2401 N  NE2 . HIS A  1 368 ? 8.900   10.311  -24.001 1.00 74.61  ? 256  HIS A NE2 1 
ATOM   2402 N  N   . LEU A  1 369 ? 6.845   6.081   -21.924 1.00 63.11  ? 257  LEU A N   1 
ATOM   2403 C  CA  . LEU A  1 369 ? 7.798   4.994   -22.105 1.00 62.41  ? 257  LEU A CA  1 
ATOM   2404 C  C   . LEU A  1 369 ? 7.263   3.859   -22.979 1.00 70.06  ? 257  LEU A C   1 
ATOM   2405 O  O   . LEU A  1 369 ? 8.030   3.313   -23.774 1.00 71.08  ? 257  LEU A O   1 
ATOM   2406 C  CB  . LEU A  1 369 ? 8.315   4.474   -20.757 1.00 61.87  ? 257  LEU A CB  1 
ATOM   2407 C  CG  . LEU A  1 369 ? 9.222   5.414   -19.955 1.00 65.48  ? 257  LEU A CG  1 
ATOM   2408 C  CD1 . LEU A  1 369 ? 9.686   4.759   -18.703 1.00 65.57  ? 257  LEU A CD1 1 
ATOM   2409 C  CD2 . LEU A  1 369 ? 10.428  5.858   -20.751 1.00 64.91  ? 257  LEU A CD2 1 
ATOM   2410 N  N   . HIS A  1 370 ? 5.952   3.529   -22.868 1.00 67.15  ? 258  HIS A N   1 
ATOM   2411 C  CA  . HIS A  1 370 ? 5.313   2.512   -23.703 1.00 67.30  ? 258  HIS A CA  1 
ATOM   2412 C  C   . HIS A  1 370 ? 5.079   3.015   -25.132 1.00 78.45  ? 258  HIS A C   1 
ATOM   2413 O  O   . HIS A  1 370 ? 5.142   2.212   -26.058 1.00 78.62  ? 258  HIS A O   1 
ATOM   2414 C  CB  . HIS A  1 370 ? 3.993   2.029   -23.093 1.00 66.57  ? 258  HIS A CB  1 
ATOM   2415 C  CG  . HIS A  1 370 ? 4.171   1.012   -22.016 1.00 68.16  ? 258  HIS A CG  1 
ATOM   2416 N  ND1 . HIS A  1 370 ? 4.567   -0.270  -22.305 1.00 68.69  ? 258  HIS A ND1 1 
ATOM   2417 C  CD2 . HIS A  1 370 ? 4.007   1.131   -20.679 1.00 68.43  ? 258  HIS A CD2 1 
ATOM   2418 C  CE1 . HIS A  1 370 ? 4.634   -0.894  -21.141 1.00 67.56  ? 258  HIS A CE1 1 
ATOM   2419 N  NE2 . HIS A  1 370 ? 4.308   -0.092  -20.137 1.00 67.74  ? 258  HIS A NE2 1 
ATOM   2420 N  N   . PHE A  1 371 ? 4.805   4.332   -25.312 1.00 80.60  ? 259  PHE A N   1 
ATOM   2421 C  CA  . PHE A  1 371 ? 4.573   4.994   -26.605 1.00 83.33  ? 259  PHE A CA  1 
ATOM   2422 C  C   . PHE A  1 371 ? 5.798   4.859   -27.500 1.00 93.66  ? 259  PHE A C   1 
ATOM   2423 O  O   . PHE A  1 371 ? 5.659   4.772   -28.714 1.00 93.84  ? 259  PHE A O   1 
ATOM   2424 C  CB  . PHE A  1 371 ? 4.239   6.484   -26.395 1.00 85.87  ? 259  PHE A CB  1 
ATOM   2425 C  CG  . PHE A  1 371 ? 3.940   7.291   -27.643 1.00 88.67  ? 259  PHE A CG  1 
ATOM   2426 C  CD1 . PHE A  1 371 ? 2.649   7.357   -28.156 1.00 92.70  ? 259  PHE A CD1 1 
ATOM   2427 C  CD2 . PHE A  1 371 ? 4.937   8.034   -28.270 1.00 91.75  ? 259  PHE A CD2 1 
ATOM   2428 C  CE1 . PHE A  1 371 ? 2.371   8.118   -29.303 1.00 93.97  ? 259  PHE A CE1 1 
ATOM   2429 C  CE2 . PHE A  1 371 ? 4.659   8.790   -29.417 1.00 94.72  ? 259  PHE A CE2 1 
ATOM   2430 C  CZ  . PHE A  1 371 ? 3.380   8.828   -29.924 1.00 92.87  ? 259  PHE A CZ  1 
ATOM   2431 N  N   . LEU A  1 372 ? 6.989   4.842   -26.889 1.00 95.20  ? 260  LEU A N   1 
ATOM   2432 C  CA  . LEU A  1 372 ? 8.289   4.729   -27.541 1.00 97.40  ? 260  LEU A CA  1 
ATOM   2433 C  C   . LEU A  1 372 ? 8.489   3.347   -28.189 1.00 108.53 ? 260  LEU A C   1 
ATOM   2434 O  O   . LEU A  1 372 ? 9.192   3.240   -29.195 1.00 108.59 ? 260  LEU A O   1 
ATOM   2435 C  CB  . LEU A  1 372 ? 9.394   5.019   -26.500 1.00 97.18  ? 260  LEU A CB  1 
ATOM   2436 C  CG  . LEU A  1 372 ? 9.887   6.471   -26.298 1.00 101.30 ? 260  LEU A CG  1 
ATOM   2437 C  CD1 . LEU A  1 372 ? 11.032  6.793   -27.220 1.00 101.96 ? 260  LEU A CD1 1 
ATOM   2438 C  CD2 . LEU A  1 372 ? 8.776   7.512   -26.396 1.00 101.26 ? 260  LEU A CD2 1 
ATOM   2439 N  N   . HIS A  1 373 ? 7.862   2.301   -27.611 1.00 110.30 ? 261  HIS A N   1 
ATOM   2440 C  CA  . HIS A  1 373 ? 7.924   0.905   -28.067 1.00 112.56 ? 261  HIS A CA  1 
ATOM   2441 C  C   . HIS A  1 373 ? 6.941   0.625   -29.229 1.00 119.43 ? 261  HIS A C   1 
ATOM   2442 O  O   . HIS A  1 373 ? 7.088   -0.393  -29.912 1.00 119.57 ? 261  HIS A O   1 
ATOM   2443 C  CB  . HIS A  1 373 ? 7.645   -0.052  -26.891 1.00 113.92 ? 261  HIS A CB  1 
ATOM   2444 C  CG  . HIS A  1 373 ? 8.743   -0.129  -25.876 1.00 117.73 ? 261  HIS A CG  1 
ATOM   2445 N  ND1 . HIS A  1 373 ? 9.320   -1.338  -25.534 1.00 119.85 ? 261  HIS A ND1 1 
ATOM   2446 C  CD2 . HIS A  1 373 ? 9.304   0.850   -25.128 1.00 119.90 ? 261  HIS A CD2 1 
ATOM   2447 C  CE1 . HIS A  1 373 ? 10.220  -1.056  -24.605 1.00 119.54 ? 261  HIS A CE1 1 
ATOM   2448 N  NE2 . HIS A  1 373 ? 10.255  0.252   -24.341 1.00 119.89 ? 261  HIS A NE2 1 
ATOM   2449 N  N   . ASN A  1 374 ? 5.944   1.520   -29.441 1.00 117.46 ? 262  ASN A N   1 
ATOM   2450 C  CA  . ASN A  1 374 ? 4.931   1.421   -30.502 1.00 118.05 ? 262  ASN A CA  1 
ATOM   2451 C  C   . ASN A  1 374 ? 5.539   1.684   -31.886 1.00 124.82 ? 262  ASN A C   1 
ATOM   2452 O  O   . ASN A  1 374 ? 6.293   2.647   -32.048 1.00 124.64 ? 262  ASN A O   1 
ATOM   2453 C  CB  . ASN A  1 374 ? 3.767   2.382   -30.239 1.00 116.55 ? 262  ASN A CB  1 
ATOM   2454 N  N   . GLU A  1 375 ? 5.203   0.822   -32.878 1.00 123.28 ? 263  GLU A N   1 
ATOM   2455 C  CA  . GLU A  1 375 ? 5.690   0.880   -34.263 1.00 124.05 ? 263  GLU A CA  1 
ATOM   2456 C  C   . GLU A  1 375 ? 5.379   2.210   -34.984 1.00 130.50 ? 263  GLU A C   1 
ATOM   2457 O  O   . GLU A  1 375 ? 6.306   2.858   -35.483 1.00 130.64 ? 263  GLU A O   1 
ATOM   2458 C  CB  . GLU A  1 375 ? 5.176   -0.324  -35.071 1.00 125.37 ? 263  GLU A CB  1 
ATOM   2459 N  N   . THR A  1 376 ? 4.087   2.615   -35.030 1.00 127.91 ? 264  THR A N   1 
ATOM   2460 C  CA  . THR A  1 376 ? 3.642   3.860   -35.676 1.00 127.77 ? 264  THR A CA  1 
ATOM   2461 C  C   . THR A  1 376 ? 3.781   5.058   -34.732 1.00 131.33 ? 264  THR A C   1 
ATOM   2462 O  O   . THR A  1 376 ? 3.381   4.973   -33.564 1.00 130.81 ? 264  THR A O   1 
ATOM   2463 C  CB  . THR A  1 376 ? 2.188   3.761   -36.171 1.00 136.26 ? 264  THR A CB  1 
ATOM   2464 O  OG1 . THR A  1 376 ? 1.698   2.419   -36.084 1.00 135.61 ? 264  THR A OG1 1 
ATOM   2465 C  CG2 . THR A  1 376 ? 2.017   4.318   -37.570 1.00 135.04 ? 264  THR A CG2 1 
ATOM   2466 N  N   . LYS A  1 377 ? 4.337   6.179   -35.243 1.00 127.31 ? 265  LYS A N   1 
ATOM   2467 C  CA  . LYS A  1 377 ? 4.507   7.412   -34.468 1.00 126.43 ? 265  LYS A CA  1 
ATOM   2468 C  C   . LYS A  1 377 ? 4.176   8.688   -35.293 1.00 130.69 ? 265  LYS A C   1 
ATOM   2469 O  O   . LYS A  1 377 ? 5.088   9.341   -35.813 1.00 130.34 ? 265  LYS A O   1 
ATOM   2470 C  CB  . LYS A  1 377 ? 5.902   7.488   -33.806 1.00 127.49 ? 265  LYS A CB  1 
ATOM   2471 C  CG  . LYS A  1 377 ? 6.102   6.531   -32.631 1.00 118.97 ? 265  LYS A CG  1 
ATOM   2472 C  CD  . LYS A  1 377 ? 7.320   6.893   -31.819 1.00 115.23 ? 265  LYS A CD  1 
ATOM   2473 C  CE  . LYS A  1 377 ? 7.902   5.701   -31.114 1.00 114.11 ? 265  LYS A CE  1 
ATOM   2474 N  NZ  . LYS A  1 377 ? 8.839   4.933   -31.977 1.00 118.77 ? 265  LYS A NZ  1 
ATOM   2475 N  N   . PRO A  1 378 ? 2.878   9.066   -35.417 1.00 127.59 ? 266  PRO A N   1 
ATOM   2476 C  CA  . PRO A  1 378 ? 2.541   10.289  -36.175 1.00 127.92 ? 266  PRO A CA  1 
ATOM   2477 C  C   . PRO A  1 378 ? 2.887   11.569  -35.413 1.00 133.31 ? 266  PRO A C   1 
ATOM   2478 O  O   . PRO A  1 378 ? 2.874   11.560  -34.182 1.00 133.18 ? 266  PRO A O   1 
ATOM   2479 C  CB  . PRO A  1 378 ? 1.032   10.161  -36.405 1.00 129.64 ? 266  PRO A CB  1 
ATOM   2480 C  CG  . PRO A  1 378 ? 0.542   9.323   -35.282 1.00 133.77 ? 266  PRO A CG  1 
ATOM   2481 C  CD  . PRO A  1 378 ? 1.667   8.410   -34.876 1.00 129.12 ? 266  PRO A CD  1 
ATOM   2482 N  N   . CYS A  1 379 ? 3.176   12.668  -36.140 1.00 130.86 ? 267  CYS A N   1 
ATOM   2483 C  CA  . CYS A  1 379 ? 3.540   13.967  -35.562 1.00 131.32 ? 267  CYS A CA  1 
ATOM   2484 C  C   . CYS A  1 379 ? 2.469   14.557  -34.653 1.00 132.80 ? 267  CYS A C   1 
ATOM   2485 O  O   . CYS A  1 379 ? 2.812   15.200  -33.662 1.00 131.83 ? 267  CYS A O   1 
ATOM   2486 C  CB  . CYS A  1 379 ? 3.949   14.952  -36.649 1.00 132.78 ? 267  CYS A CB  1 
ATOM   2487 S  SG  . CYS A  1 379 ? 5.422   14.455  -37.573 1.00 137.38 ? 267  CYS A SG  1 
ATOM   2488 N  N   . ASP A  1 380 ? 1.182   14.334  -34.982 1.00 128.42 ? 268  ASP A N   1 
ATOM   2489 C  CA  . ASP A  1 380 ? 0.029   14.817  -34.207 1.00 127.72 ? 268  ASP A CA  1 
ATOM   2490 C  C   . ASP A  1 380 ? -0.103  14.134  -32.833 1.00 129.84 ? 268  ASP A C   1 
ATOM   2491 O  O   . ASP A  1 380 ? -0.782  14.664  -31.944 1.00 129.82 ? 268  ASP A O   1 
ATOM   2492 C  CB  . ASP A  1 380 ? -1.261  14.690  -35.021 1.00 129.67 ? 268  ASP A CB  1 
ATOM   2493 C  CG  . ASP A  1 380 ? -1.250  15.589  -36.232 1.00 142.00 ? 268  ASP A CG  1 
ATOM   2494 O  OD1 . ASP A  1 380 ? -1.773  16.720  -36.133 1.00 143.25 ? 268  ASP A OD1 1 
ATOM   2495 O  OD2 . ASP A  1 380 ? -0.692  15.173  -37.277 1.00 147.89 ? 268  ASP A OD2 1 
ATOM   2496 N  N   . SER A  1 381 ? 0.557   12.964  -32.665 1.00 123.81 ? 269  SER A N   1 
ATOM   2497 C  CA  . SER A  1 381 ? 0.596   12.207  -31.416 1.00 122.03 ? 269  SER A CA  1 
ATOM   2498 C  C   . SER A  1 381 ? 1.889   12.533  -30.663 1.00 121.16 ? 269  SER A C   1 
ATOM   2499 O  O   . SER A  1 381 ? 1.839   12.730  -29.456 1.00 120.25 ? 269  SER A O   1 
ATOM   2500 C  CB  . SER A  1 381 ? 0.487   10.708  -31.681 1.00 126.04 ? 269  SER A CB  1 
ATOM   2501 O  OG  . SER A  1 381 ? 1.704   10.175  -32.173 1.00 135.12 ? 269  SER A OG  1 
ATOM   2502 N  N   . VAL A  1 382 ? 3.032   12.622  -31.381 1.00 114.91 ? 270  VAL A N   1 
ATOM   2503 C  CA  . VAL A  1 382 ? 4.352   12.948  -30.818 1.00 113.73 ? 270  VAL A CA  1 
ATOM   2504 C  C   . VAL A  1 382 ? 4.364   14.384  -30.225 1.00 116.30 ? 270  VAL A C   1 
ATOM   2505 O  O   . VAL A  1 382 ? 5.035   14.617  -29.217 1.00 115.93 ? 270  VAL A O   1 
ATOM   2506 C  CB  . VAL A  1 382 ? 5.504   12.679  -31.831 1.00 117.17 ? 270  VAL A CB  1 
ATOM   2507 C  CG1 . VAL A  1 382 ? 6.859   13.130  -31.297 1.00 116.84 ? 270  VAL A CG1 1 
ATOM   2508 C  CG2 . VAL A  1 382 ? 5.565   11.203  -32.208 1.00 116.96 ? 270  VAL A CG2 1 
ATOM   2509 N  N   . LEU A  1 383 ? 3.586   15.321  -30.814 1.00 111.71 ? 271  LEU A N   1 
ATOM   2510 C  CA  . LEU A  1 383 ? 3.467   16.701  -30.326 1.00 110.78 ? 271  LEU A CA  1 
ATOM   2511 C  C   . LEU A  1 383 ? 2.725   16.740  -28.974 1.00 112.10 ? 271  LEU A C   1 
ATOM   2512 O  O   . LEU A  1 383 ? 3.263   17.279  -28.004 1.00 111.76 ? 271  LEU A O   1 
ATOM   2513 C  CB  . LEU A  1 383 ? 2.784   17.610  -31.367 1.00 110.79 ? 271  LEU A CB  1 
ATOM   2514 N  N   . ARG A  1 384 ? 1.521   16.126  -28.905 1.00 106.27 ? 272  ARG A N   1 
ATOM   2515 C  CA  . ARG A  1 384 ? 0.688   16.038  -27.699 1.00 104.95 ? 272  ARG A CA  1 
ATOM   2516 C  C   . ARG A  1 384 ? 1.372   15.254  -26.555 1.00 106.44 ? 272  ARG A C   1 
ATOM   2517 O  O   . ARG A  1 384 ? 1.062   15.502  -25.388 1.00 106.37 ? 272  ARG A O   1 
ATOM   2518 C  CB  . ARG A  1 384 ? -0.685  15.440  -28.036 1.00 104.80 ? 272  ARG A CB  1 
ATOM   2519 N  N   . MET A  1 385 ? 2.301   14.320  -26.896 1.00 100.43 ? 273  MET A N   1 
ATOM   2520 C  CA  . MET A  1 385 ? 3.090   13.515  -25.953 1.00 98.83  ? 273  MET A CA  1 
ATOM   2521 C  C   . MET A  1 385 ? 4.160   14.392  -25.318 1.00 99.95  ? 273  MET A C   1 
ATOM   2522 O  O   . MET A  1 385 ? 4.356   14.337  -24.103 1.00 99.70  ? 273  MET A O   1 
ATOM   2523 C  CB  . MET A  1 385 ? 3.773   12.323  -26.664 1.00 101.00 ? 273  MET A CB  1 
ATOM   2524 C  CG  . MET A  1 385 ? 2.888   11.108  -26.854 1.00 104.56 ? 273  MET A CG  1 
ATOM   2525 S  SD  . MET A  1 385 ? 2.485   10.229  -25.329 1.00 108.81 ? 273  MET A SD  1 
ATOM   2526 C  CE  . MET A  1 385 ? 0.745   10.691  -25.143 1.00 105.41 ? 273  MET A CE  1 
ATOM   2527 N  N   . GLN A  1 386 ? 4.860   15.188  -26.151 1.00 94.23  ? 274  GLN A N   1 
ATOM   2528 C  CA  . GLN A  1 386 ? 5.929   16.092  -25.731 1.00 92.73  ? 274  GLN A CA  1 
ATOM   2529 C  C   . GLN A  1 386 ? 5.403   17.288  -24.937 1.00 91.37  ? 274  GLN A C   1 
ATOM   2530 O  O   . GLN A  1 386 ? 6.079   17.742  -24.018 1.00 90.60  ? 274  GLN A O   1 
ATOM   2531 C  CB  . GLN A  1 386 ? 6.802   16.524  -26.924 1.00 94.32  ? 274  GLN A CB  1 
ATOM   2532 C  CG  . GLN A  1 386 ? 7.797   15.452  -27.393 1.00 114.30 ? 274  GLN A CG  1 
ATOM   2533 C  CD  . GLN A  1 386 ? 8.926   15.145  -26.419 1.00 139.14 ? 274  GLN A CD  1 
ATOM   2534 O  OE1 . GLN A  1 386 ? 9.327   15.966  -25.578 1.00 134.50 ? 274  GLN A OE1 1 
ATOM   2535 N  NE2 . GLN A  1 386 ? 9.478   13.942  -26.526 1.00 133.12 ? 274  GLN A NE2 1 
ATOM   2536 N  N   . LYS A  1 387 ? 4.194   17.773  -25.260 1.00 84.71  ? 275  LYS A N   1 
ATOM   2537 C  CA  . LYS A  1 387 ? 3.568   18.869  -24.521 1.00 83.51  ? 275  LYS A CA  1 
ATOM   2538 C  C   . LYS A  1 387 ? 3.216   18.373  -23.111 1.00 85.10  ? 275  LYS A C   1 
ATOM   2539 O  O   . LYS A  1 387 ? 3.404   19.111  -22.141 1.00 84.81  ? 275  LYS A O   1 
ATOM   2540 C  CB  . LYS A  1 387 ? 2.309   19.388  -25.241 1.00 85.46  ? 275  LYS A CB  1 
ATOM   2541 N  N   . SER A  1 388 ? 2.745   17.107  -23.003 1.00 78.77  ? 276  SER A N   1 
ATOM   2542 C  CA  . SER A  1 388 ? 2.392   16.474  -21.735 1.00 77.02  ? 276  SER A CA  1 
ATOM   2543 C  C   . SER A  1 388 ? 3.597   16.268  -20.805 1.00 78.08  ? 276  SER A C   1 
ATOM   2544 O  O   . SER A  1 388 ? 3.437   16.421  -19.593 1.00 78.16  ? 276  SER A O   1 
ATOM   2545 C  CB  . SER A  1 388 ? 1.628   15.182  -21.965 1.00 79.56  ? 276  SER A CB  1 
ATOM   2546 O  OG  . SER A  1 388 ? 0.284   15.501  -22.276 1.00 87.13  ? 276  SER A OG  1 
ATOM   2547 N  N   . VAL A  1 389 ? 4.803   15.986  -21.368 1.00 71.42  ? 277  VAL A N   1 
ATOM   2548 C  CA  . VAL A  1 389 ? 6.057   15.839  -20.616 1.00 70.42  ? 277  VAL A CA  1 
ATOM   2549 C  C   . VAL A  1 389 ? 6.375   17.185  -19.950 1.00 76.71  ? 277  VAL A C   1 
ATOM   2550 O  O   . VAL A  1 389 ? 6.728   17.197  -18.772 1.00 78.42  ? 277  VAL A O   1 
ATOM   2551 C  CB  . VAL A  1 389 ? 7.234   15.342  -21.501 1.00 73.40  ? 277  VAL A CB  1 
ATOM   2552 C  CG1 . VAL A  1 389 ? 8.572   15.356  -20.750 1.00 72.58  ? 277  VAL A CG1 1 
ATOM   2553 C  CG2 . VAL A  1 389 ? 6.952   13.960  -22.067 1.00 73.22  ? 277  VAL A CG2 1 
ATOM   2554 N  N   . VAL A  1 390 ? 6.211   18.309  -20.696 1.00 72.08  ? 278  VAL A N   1 
ATOM   2555 C  CA  . VAL A  1 390 ? 6.449   19.678  -20.235 1.00 70.99  ? 278  VAL A CA  1 
ATOM   2556 C  C   . VAL A  1 390 ? 5.524   20.023  -19.064 1.00 74.34  ? 278  VAL A C   1 
ATOM   2557 O  O   . VAL A  1 390 ? 6.011   20.516  -18.047 1.00 76.03  ? 278  VAL A O   1 
ATOM   2558 C  CB  . VAL A  1 390 ? 6.372   20.723  -21.391 1.00 74.88  ? 278  VAL A CB  1 
ATOM   2559 C  CG1 . VAL A  1 390 ? 6.474   22.164  -20.877 1.00 74.94  ? 278  VAL A CG1 1 
ATOM   2560 C  CG2 . VAL A  1 390 ? 7.445   20.465  -22.442 1.00 74.38  ? 278  VAL A CG2 1 
ATOM   2561 N  N   . ILE A  1 391 ? 4.214   19.740  -19.196 1.00 67.60  ? 279  ILE A N   1 
ATOM   2562 C  CA  . ILE A  1 391 ? 3.192   20.035  -18.196 1.00 66.15  ? 279  ILE A CA  1 
ATOM   2563 C  C   . ILE A  1 391 ? 3.309   19.138  -16.959 1.00 67.94  ? 279  ILE A C   1 
ATOM   2564 O  O   . ILE A  1 391 ? 3.283   19.671  -15.850 1.00 65.69  ? 279  ILE A O   1 
ATOM   2565 C  CB  . ILE A  1 391 ? 1.769   20.009  -18.837 1.00 69.68  ? 279  ILE A CB  1 
ATOM   2566 C  CG1 . ILE A  1 391 ? 1.662   21.071  -19.963 1.00 70.77  ? 279  ILE A CG1 1 
ATOM   2567 C  CG2 . ILE A  1 391 ? 0.655   20.229  -17.792 1.00 71.21  ? 279  ILE A CG2 1 
ATOM   2568 C  CD1 . ILE A  1 391 ? 0.490   20.870  -20.985 1.00 84.50  ? 279  ILE A CD1 1 
ATOM   2569 N  N   . THR A  1 392 ? 3.439   17.788  -17.135 1.00 65.37  ? 280  THR A N   1 
ATOM   2570 C  CA  . THR A  1 392 ? 3.471   16.841  -15.998 1.00 64.11  ? 280  THR A CA  1 
ATOM   2571 C  C   . THR A  1 392 ? 4.757   16.988  -15.155 1.00 66.46  ? 280  THR A C   1 
ATOM   2572 O  O   . THR A  1 392 ? 4.686   16.809  -13.937 1.00 66.60  ? 280  THR A O   1 
ATOM   2573 C  CB  . THR A  1 392 ? 3.167   15.389  -16.404 1.00 64.38  ? 280  THR A CB  1 
ATOM   2574 O  OG1 . THR A  1 392 ? 4.196   14.874  -17.252 1.00 66.91  ? 280  THR A OG1 1 
ATOM   2575 C  CG2 . THR A  1 392 ? 1.785   15.232  -17.046 1.00 56.81  ? 280  THR A CG2 1 
ATOM   2576 N  N   . LEU A  1 393 ? 5.890   17.383  -15.774 1.00 60.91  ? 281  LEU A N   1 
ATOM   2577 C  CA  . LEU A  1 393 ? 7.161   17.632  -15.076 1.00 59.09  ? 281  LEU A CA  1 
ATOM   2578 C  C   . LEU A  1 393 ? 7.127   18.952  -14.286 1.00 63.84  ? 281  LEU A C   1 
ATOM   2579 O  O   . LEU A  1 393 ? 7.731   19.029  -13.208 1.00 65.47  ? 281  LEU A O   1 
ATOM   2580 C  CB  . LEU A  1 393 ? 8.329   17.641  -16.062 1.00 57.92  ? 281  LEU A CB  1 
ATOM   2581 C  CG  . LEU A  1 393 ? 9.712   17.577  -15.464 1.00 60.75  ? 281  LEU A CG  1 
ATOM   2582 C  CD1 . LEU A  1 393 ? 9.927   16.282  -14.686 1.00 60.54  ? 281  LEU A CD1 1 
ATOM   2583 C  CD2 . LEU A  1 393 ? 10.748  17.760  -16.536 1.00 61.97  ? 281  LEU A CD2 1 
ATOM   2584 N  N   . SER A  1 394 ? 6.444   19.989  -14.832 1.00 58.20  ? 282  SER A N   1 
ATOM   2585 C  CA  . SER A  1 394 ? 6.238   21.302  -14.197 1.00 56.53  ? 282  SER A CA  1 
ATOM   2586 C  C   . SER A  1 394 ? 5.354   21.105  -12.963 1.00 58.23  ? 282  SER A C   1 
ATOM   2587 O  O   . SER A  1 394 ? 5.606   21.731  -11.927 1.00 57.87  ? 282  SER A O   1 
ATOM   2588 C  CB  . SER A  1 394 ? 5.531   22.260  -15.150 1.00 58.12  ? 282  SER A CB  1 
ATOM   2589 O  OG  . SER A  1 394 ? 6.323   22.575  -16.280 1.00 66.87  ? 282  SER A OG  1 
ATOM   2590 N  N   . LEU A  1 395 ? 4.307   20.235  -13.091 1.00 52.06  ? 283  LEU A N   1 
ATOM   2591 C  CA  . LEU A  1 395 ? 3.392   19.886  -12.009 1.00 50.80  ? 283  LEU A CA  1 
ATOM   2592 C  C   . LEU A  1 395 ? 4.113   19.134  -10.907 1.00 53.03  ? 283  LEU A C   1 
ATOM   2593 O  O   . LEU A  1 395 ? 3.882   19.441  -9.740  1.00 52.20  ? 283  LEU A O   1 
ATOM   2594 C  CB  . LEU A  1 395 ? 2.186   19.089  -12.502 1.00 50.46  ? 283  LEU A CB  1 
ATOM   2595 C  CG  . LEU A  1 395 ? 1.052   19.860  -13.172 1.00 54.97  ? 283  LEU A CG  1 
ATOM   2596 C  CD1 . LEU A  1 395 ? -0.090  18.920  -13.487 1.00 54.99  ? 283  LEU A CD1 1 
ATOM   2597 C  CD2 . LEU A  1 395 ? 0.546   21.000  -12.291 1.00 54.82  ? 283  LEU A CD2 1 
ATOM   2598 N  N   . ALA A  1 396 ? 5.018   18.193  -11.278 1.00 48.87  ? 284  ALA A N   1 
ATOM   2599 C  CA  . ALA A  1 396 ? 5.850   17.422  -10.354 1.00 48.04  ? 284  ALA A CA  1 
ATOM   2600 C  C   . ALA A  1 396 ? 6.774   18.380  -9.587  1.00 52.29  ? 284  ALA A C   1 
ATOM   2601 O  O   . ALA A  1 396 ? 6.760   18.353  -8.357  1.00 51.73  ? 284  ALA A O   1 
ATOM   2602 C  CB  . ALA A  1 396 ? 6.662   16.380  -11.109 1.00 48.46  ? 284  ALA A CB  1 
ATOM   2603 N  N   . ALA A  1 397 ? 7.475   19.295  -10.299 1.00 48.96  ? 285  ALA A N   1 
ATOM   2604 C  CA  . ALA A  1 397 ? 8.362   20.310  -9.708  1.00 49.37  ? 285  ALA A CA  1 
ATOM   2605 C  C   . ALA A  1 397 ? 7.636   21.339  -8.794  1.00 55.45  ? 285  ALA A C   1 
ATOM   2606 O  O   . ALA A  1 397 ? 8.250   21.852  -7.852  1.00 55.71  ? 285  ALA A O   1 
ATOM   2607 C  CB  . ALA A  1 397 ? 9.141   21.022  -10.799 1.00 50.04  ? 285  ALA A CB  1 
ATOM   2608 N  N   . SER A  1 398 ? 6.324   21.590  -9.030  1.00 53.61  ? 286  SER A N   1 
ATOM   2609 C  CA  . SER A  1 398 ? 5.484   22.518  -8.235  1.00 53.44  ? 286  SER A CA  1 
ATOM   2610 C  C   . SER A  1 398 ? 5.114   21.957  -6.836  1.00 59.44  ? 286  SER A C   1 
ATOM   2611 O  O   . SER A  1 398 ? 4.377   22.610  -6.092  1.00 60.02  ? 286  SER A O   1 
ATOM   2612 C  CB  . SER A  1 398 ? 4.229   22.933  -9.012  1.00 54.49  ? 286  SER A CB  1 
ATOM   2613 O  OG  . SER A  1 398 ? 3.182   21.978  -8.926  1.00 59.44  ? 286  SER A OG  1 
ATOM   2614 N  N   . ASN A  1 399 ? 5.623   20.757  -6.476  1.00 55.66  ? 287  ASN A N   1 
ATOM   2615 C  CA  . ASN A  1 399 ? 5.341   20.119  -5.189  1.00 55.43  ? 287  ASN A CA  1 
ATOM   2616 C  C   . ASN A  1 399 ? 5.789   20.984  -3.991  1.00 60.55  ? 287  ASN A C   1 
ATOM   2617 O  O   . ASN A  1 399 ? 5.156   20.933  -2.938  1.00 60.40  ? 287  ASN A O   1 
ATOM   2618 C  CB  . ASN A  1 399 ? 5.935   18.698  -5.135  1.00 49.17  ? 287  ASN A CB  1 
ATOM   2619 C  CG  . ASN A  1 399 ? 7.432   18.651  -4.936  1.00 61.95  ? 287  ASN A CG  1 
ATOM   2620 O  OD1 . ASN A  1 399 ? 7.946   18.801  -3.826  1.00 50.44  ? 287  ASN A OD1 1 
ATOM   2621 N  ND2 . ASN A  1 399 ? 8.176   18.433  -6.002  1.00 55.97  ? 287  ASN A ND2 1 
ATOM   2622 N  N   . CYS A  1 400 ? 6.888   21.759  -4.164  1.00 57.89  ? 288  CYS A N   1 
ATOM   2623 C  CA  . CYS A  1 400 ? 7.471   22.648  -3.151  1.00 58.22  ? 288  CYS A CA  1 
ATOM   2624 C  C   . CYS A  1 400 ? 6.514   23.800  -2.745  1.00 62.68  ? 288  CYS A C   1 
ATOM   2625 O  O   . CYS A  1 400 ? 6.659   24.357  -1.655  1.00 63.04  ? 288  CYS A O   1 
ATOM   2626 C  CB  . CYS A  1 400 ? 8.825   23.177  -3.612  1.00 58.53  ? 288  CYS A CB  1 
ATOM   2627 S  SG  . CYS A  1 400 ? 8.733   24.351  -4.984  1.00 62.51  ? 288  CYS A SG  1 
ATOM   2628 N  N   . CYS A  1 401 ? 5.541   24.138  -3.619  1.00 57.30  ? 289  CYS A N   1 
ATOM   2629 C  CA  . CYS A  1 401 ? 4.529   25.163  -3.379  1.00 56.06  ? 289  CYS A CA  1 
ATOM   2630 C  C   . CYS A  1 401 ? 3.440   24.702  -2.399  1.00 58.52  ? 289  CYS A C   1 
ATOM   2631 O  O   . CYS A  1 401 ? 2.810   25.531  -1.758  1.00 58.93  ? 289  CYS A O   1 
ATOM   2632 C  CB  . CYS A  1 401 ? 3.936   25.641  -4.698  1.00 56.47  ? 289  CYS A CB  1 
ATOM   2633 S  SG  . CYS A  1 401 ? 5.148   26.423  -5.799  1.00 60.82  ? 289  CYS A SG  1 
ATOM   2634 N  N   . PHE A  1 402 ? 3.227   23.387  -2.274  1.00 53.50  ? 290  PHE A N   1 
ATOM   2635 C  CA  . PHE A  1 402 ? 2.223   22.810  -1.383  1.00 52.00  ? 290  PHE A CA  1 
ATOM   2636 C  C   . PHE A  1 402 ? 2.686   22.745  0.077   1.00 56.93  ? 290  PHE A C   1 
ATOM   2637 O  O   . PHE A  1 402 ? 1.845   22.766  0.975   1.00 56.86  ? 290  PHE A O   1 
ATOM   2638 C  CB  . PHE A  1 402 ? 1.817   21.392  -1.854  1.00 53.03  ? 290  PHE A CB  1 
ATOM   2639 C  CG  . PHE A  1 402 ? 0.961   21.299  -3.096  1.00 53.81  ? 290  PHE A CG  1 
ATOM   2640 C  CD1 . PHE A  1 402 ? 1.537   21.324  -4.366  1.00 55.51  ? 290  PHE A CD1 1 
ATOM   2641 C  CD2 . PHE A  1 402 ? -0.412  21.135  -3.000  1.00 55.73  ? 290  PHE A CD2 1 
ATOM   2642 C  CE1 . PHE A  1 402 ? 0.747   21.229  -5.515  1.00 55.58  ? 290  PHE A CE1 1 
ATOM   2643 C  CE2 . PHE A  1 402 ? -1.204  21.052  -4.151  1.00 58.29  ? 290  PHE A CE2 1 
ATOM   2644 C  CZ  . PHE A  1 402 ? -0.616  21.095  -5.402  1.00 55.33  ? 290  PHE A CZ  1 
ATOM   2645 N  N   . ASP A  1 403 ? 4.003   22.634  0.323   1.00 54.05  ? 291  ASP A N   1 
ATOM   2646 C  CA  . ASP A  1 403 ? 4.530   22.445  1.679   1.00 54.79  ? 291  ASP A CA  1 
ATOM   2647 C  C   . ASP A  1 403 ? 4.355   23.673  2.583   1.00 60.42  ? 291  ASP A C   1 
ATOM   2648 O  O   . ASP A  1 403 ? 3.933   23.454  3.717   1.00 59.71  ? 291  ASP A O   1 
ATOM   2649 C  CB  . ASP A  1 403 ? 5.967   21.909  1.663   1.00 57.26  ? 291  ASP A CB  1 
ATOM   2650 C  CG  . ASP A  1 403 ? 6.038   20.555  0.982   1.00 65.69  ? 291  ASP A CG  1 
ATOM   2651 O  OD1 . ASP A  1 403 ? 5.184   19.699  1.277   1.00 65.47  ? 291  ASP A OD1 1 
ATOM   2652 O  OD2 . ASP A  1 403 ? 6.918   20.367  0.133   1.00 71.85  ? 291  ASP A OD2 1 
ATOM   2653 N  N   . PRO A  1 404 ? 4.522   24.952  2.146   1.00 59.97  ? 292  PRO A N   1 
ATOM   2654 C  CA  . PRO A  1 404 ? 4.154   26.075  3.042   1.00 60.15  ? 292  PRO A CA  1 
ATOM   2655 C  C   . PRO A  1 404 ? 2.651   26.037  3.424   1.00 63.38  ? 292  PRO A C   1 
ATOM   2656 O  O   . PRO A  1 404 ? 2.329   26.323  4.576   1.00 62.96  ? 292  PRO A O   1 
ATOM   2657 C  CB  . PRO A  1 404 ? 4.493   27.321  2.217   1.00 61.84  ? 292  PRO A CB  1 
ATOM   2658 C  CG  . PRO A  1 404 ? 5.444   26.841  1.183   1.00 66.25  ? 292  PRO A CG  1 
ATOM   2659 C  CD  . PRO A  1 404 ? 5.005   25.461  0.847   1.00 61.68  ? 292  PRO A CD  1 
ATOM   2660 N  N   . LEU A  1 405 ? 1.751   25.601  2.498   1.00 59.79  ? 293  LEU A N   1 
ATOM   2661 C  CA  . LEU A  1 405 ? 0.308   25.459  2.764   1.00 59.81  ? 293  LEU A CA  1 
ATOM   2662 C  C   . LEU A  1 405 ? 0.018   24.376  3.781   1.00 63.16  ? 293  LEU A C   1 
ATOM   2663 O  O   . LEU A  1 405 ? -0.945  24.493  4.518   1.00 62.32  ? 293  LEU A O   1 
ATOM   2664 C  CB  . LEU A  1 405 ? -0.493  25.174  1.487   1.00 59.88  ? 293  LEU A CB  1 
ATOM   2665 C  CG  . LEU A  1 405 ? -0.972  26.345  0.612   1.00 63.94  ? 293  LEU A CG  1 
ATOM   2666 C  CD1 . LEU A  1 405 ? -0.339  27.671  0.982   1.00 62.65  ? 293  LEU A CD1 1 
ATOM   2667 C  CD2 . LEU A  1 405 ? -0.789  26.006  -0.850  1.00 67.19  ? 293  LEU A CD2 1 
ATOM   2668 N  N   . LEU A  1 406 ? 0.833   23.318  3.814   1.00 60.81  ? 294  LEU A N   1 
ATOM   2669 C  CA  . LEU A  1 406 ? 0.714   22.235  4.784   1.00 61.48  ? 294  LEU A CA  1 
ATOM   2670 C  C   . LEU A  1 406 ? 1.018   22.782  6.179   1.00 70.28  ? 294  LEU A C   1 
ATOM   2671 O  O   . LEU A  1 406 ? 0.332   22.423  7.120   1.00 70.15  ? 294  LEU A O   1 
ATOM   2672 C  CB  . LEU A  1 406 ? 1.668   21.086  4.400   1.00 61.04  ? 294  LEU A CB  1 
ATOM   2673 C  CG  . LEU A  1 406 ? 1.796   19.863  5.307   1.00 64.82  ? 294  LEU A CG  1 
ATOM   2674 C  CD1 . LEU A  1 406 ? 0.507   19.085  5.393   1.00 63.71  ? 294  LEU A CD1 1 
ATOM   2675 C  CD2 . LEU A  1 406 ? 2.892   18.952  4.798   1.00 68.69  ? 294  LEU A CD2 1 
ATOM   2676 N  N   . TYR A  1 407 ? 1.996   23.695  6.298   1.00 71.80  ? 295  TYR A N   1 
ATOM   2677 C  CA  . TYR A  1 407 ? 2.353   24.336  7.567   1.00 73.79  ? 295  TYR A CA  1 
ATOM   2678 C  C   . TYR A  1 407 ? 1.262   25.306  8.085   1.00 75.99  ? 295  TYR A C   1 
ATOM   2679 O  O   . TYR A  1 407 ? 1.046   25.341  9.295   1.00 74.54  ? 295  TYR A O   1 
ATOM   2680 C  CB  . TYR A  1 407 ? 3.734   25.016  7.490   1.00 77.30  ? 295  TYR A CB  1 
ATOM   2681 C  CG  . TYR A  1 407 ? 4.187   25.581  8.820   1.00 82.59  ? 295  TYR A CG  1 
ATOM   2682 C  CD1 . TYR A  1 407 ? 4.771   24.764  9.785   1.00 85.88  ? 295  TYR A CD1 1 
ATOM   2683 C  CD2 . TYR A  1 407 ? 3.986   26.923  9.135   1.00 84.39  ? 295  TYR A CD2 1 
ATOM   2684 C  CE1 . TYR A  1 407 ? 5.163   25.271  11.026  1.00 88.32  ? 295  TYR A CE1 1 
ATOM   2685 C  CE2 . TYR A  1 407 ? 4.351   27.436  10.384  1.00 86.15  ? 295  TYR A CE2 1 
ATOM   2686 C  CZ  . TYR A  1 407 ? 4.946   26.607  11.323  1.00 97.29  ? 295  TYR A CZ  1 
ATOM   2687 O  OH  . TYR A  1 407 ? 5.329   27.095  12.553  1.00 102.88 ? 295  TYR A OH  1 
ATOM   2688 N  N   . PHE A  1 408 ? 0.593   26.094  7.199   1.00 73.38  ? 296  PHE A N   1 
ATOM   2689 C  CA  . PHE A  1 408 ? -0.490  27.005  7.628   1.00 74.56  ? 296  PHE A CA  1 
ATOM   2690 C  C   . PHE A  1 408 ? -1.709  26.225  8.163   1.00 77.23  ? 296  PHE A C   1 
ATOM   2691 O  O   . PHE A  1 408 ? -2.264  26.616  9.189   1.00 76.10  ? 296  PHE A O   1 
ATOM   2692 C  CB  . PHE A  1 408 ? -1.009  27.944  6.495   1.00 77.67  ? 296  PHE A CB  1 
ATOM   2693 C  CG  . PHE A  1 408 ? -0.077  28.826  5.679   1.00 81.76  ? 296  PHE A CG  1 
ATOM   2694 C  CD1 . PHE A  1 408 ? 1.136   29.278  6.208   1.00 87.01  ? 296  PHE A CD1 1 
ATOM   2695 C  CD2 . PHE A  1 408 ? -0.444  29.265  4.405   1.00 85.28  ? 296  PHE A CD2 1 
ATOM   2696 C  CE1 . PHE A  1 408 ? 1.996   30.094  5.448   1.00 88.15  ? 296  PHE A CE1 1 
ATOM   2697 C  CE2 . PHE A  1 408 ? 0.407   30.095  3.653   1.00 88.48  ? 296  PHE A CE2 1 
ATOM   2698 C  CZ  . PHE A  1 408 ? 1.622   30.499  4.177   1.00 86.89  ? 296  PHE A CZ  1 
ATOM   2699 N  N   . PHE A  1 409 ? -2.123  25.130  7.463   1.00 73.40  ? 297  PHE A N   1 
ATOM   2700 C  CA  . PHE A  1 409 ? -3.351  24.377  7.760   1.00 73.05  ? 297  PHE A CA  1 
ATOM   2701 C  C   . PHE A  1 409 ? -3.203  23.241  8.764   1.00 77.49  ? 297  PHE A C   1 
ATOM   2702 O  O   . PHE A  1 409 ? -4.206  22.866  9.371   1.00 77.19  ? 297  PHE A O   1 
ATOM   2703 C  CB  . PHE A  1 409 ? -4.033  23.865  6.466   1.00 74.68  ? 297  PHE A CB  1 
ATOM   2704 C  CG  . PHE A  1 409 ? -4.500  24.974  5.545   1.00 76.42  ? 297  PHE A CG  1 
ATOM   2705 C  CD1 . PHE A  1 409 ? -5.514  25.850  5.933   1.00 80.65  ? 297  PHE A CD1 1 
ATOM   2706 C  CD2 . PHE A  1 409 ? -3.902  25.172  4.311   1.00 79.43  ? 297  PHE A CD2 1 
ATOM   2707 C  CE1 . PHE A  1 409 ? -5.894  26.928  5.108   1.00 82.35  ? 297  PHE A CE1 1 
ATOM   2708 C  CE2 . PHE A  1 409 ? -4.295  26.238  3.479   1.00 82.88  ? 297  PHE A CE2 1 
ATOM   2709 C  CZ  . PHE A  1 409 ? -5.289  27.109  3.882   1.00 81.01  ? 297  PHE A CZ  1 
ATOM   2710 N  N   . SER A  1 410 ? -1.975  22.732  8.980   1.00 74.81  ? 298  SER A N   1 
ATOM   2711 C  CA  . SER A  1 410 ? -1.730  21.595  9.877   1.00 74.95  ? 298  SER A CA  1 
ATOM   2712 C  C   . SER A  1 410 ? -0.663  21.845  10.979  1.00 81.49  ? 298  SER A C   1 
ATOM   2713 O  O   . SER A  1 410 ? -0.333  20.920  11.736  1.00 81.70  ? 298  SER A O   1 
ATOM   2714 C  CB  . SER A  1 410 ? -1.386  20.352  9.055   1.00 76.61  ? 298  SER A CB  1 
ATOM   2715 O  OG  . SER A  1 410 ? -1.365  19.180  9.850   1.00 82.60  ? 298  SER A OG  1 
ATOM   2716 N  N   . GLY A  1 411 ? -0.172  23.084  11.080  1.00 78.80  ? 299  GLY A N   1 
ATOM   2717 C  CA  . GLY A  1 411 ? 0.842   23.473  12.058  1.00 105.66 ? 299  GLY A CA  1 
ATOM   2718 C  C   . GLY A  1 411 ? 0.276   24.127  13.299  1.00 136.53 ? 299  GLY A C   1 
ATOM   2719 O  O   . GLY A  1 411 ? 0.974   24.881  13.980  1.00 101.54 ? 299  GLY A O   1 
ATOM   2720 N  N   . CYS B  1 17  ? -6.089  -16.222 -36.517 1.00 147.01 ? 14   CYS B N   1 
ATOM   2721 C  CA  . CYS B  1 17  ? -5.302  -16.674 -37.662 1.00 147.16 ? 14   CYS B CA  1 
ATOM   2722 C  C   . CYS B  1 17  ? -5.069  -18.203 -37.633 1.00 151.47 ? 14   CYS B C   1 
ATOM   2723 O  O   . CYS B  1 17  ? -5.987  -18.952 -37.982 1.00 151.44 ? 14   CYS B O   1 
ATOM   2724 C  CB  . CYS B  1 17  ? -4.000  -15.880 -37.791 1.00 147.57 ? 14   CYS B CB  1 
ATOM   2725 S  SG  . CYS B  1 17  ? -2.973  -15.851 -36.292 1.00 151.63 ? 14   CYS B SG  1 
ATOM   2726 N  N   . HIS B  1 18  ? -3.864  -18.664 -37.224 1.00 147.40 ? 15   HIS B N   1 
ATOM   2727 C  CA  . HIS B  1 18  ? -3.535  -20.082 -37.089 1.00 146.68 ? 15   HIS B CA  1 
ATOM   2728 C  C   . HIS B  1 18  ? -3.584  -20.444 -35.606 1.00 148.52 ? 15   HIS B C   1 
ATOM   2729 O  O   . HIS B  1 18  ? -2.797  -19.920 -34.806 1.00 148.04 ? 15   HIS B O   1 
ATOM   2730 C  CB  . HIS B  1 18  ? -2.158  -20.421 -37.702 1.00 147.52 ? 15   HIS B CB  1 
ATOM   2731 C  CG  . HIS B  1 18  ? -1.816  -21.881 -37.619 1.00 150.85 ? 15   HIS B CG  1 
ATOM   2732 N  ND1 . HIS B  1 18  ? -1.070  -22.390 -36.571 1.00 152.56 ? 15   HIS B ND1 1 
ATOM   2733 C  CD2 . HIS B  1 18  ? -2.163  -22.898 -38.441 1.00 152.52 ? 15   HIS B CD2 1 
ATOM   2734 C  CE1 . HIS B  1 18  ? -0.980  -23.691 -36.794 1.00 151.87 ? 15   HIS B CE1 1 
ATOM   2735 N  NE2 . HIS B  1 18  ? -1.627  -24.043 -37.903 1.00 152.15 ? 15   HIS B NE2 1 
ATOM   2736 N  N   . ASP B  1 19  ? -4.531  -21.320 -35.241 1.00 143.38 ? 16   ASP B N   1 
ATOM   2737 C  CA  . ASP B  1 19  ? -4.699  -21.748 -33.859 1.00 142.42 ? 16   ASP B CA  1 
ATOM   2738 C  C   . ASP B  1 19  ? -4.128  -23.147 -33.594 1.00 143.28 ? 16   ASP B C   1 
ATOM   2739 O  O   . ASP B  1 19  ? -4.605  -24.151 -34.134 1.00 142.69 ? 16   ASP B O   1 
ATOM   2740 C  CB  . ASP B  1 19  ? -6.161  -21.622 -33.392 1.00 144.45 ? 16   ASP B CB  1 
ATOM   2741 C  CG  . ASP B  1 19  ? -7.172  -22.218 -34.346 1.00 156.61 ? 16   ASP B CG  1 
ATOM   2742 O  OD1 . ASP B  1 19  ? -7.447  -21.584 -35.389 1.00 157.71 ? 16   ASP B OD1 1 
ATOM   2743 O  OD2 . ASP B  1 19  ? -7.690  -23.317 -34.051 1.00 163.13 ? 16   ASP B OD2 1 
ATOM   2744 N  N   . THR B  1 20  ? -3.069  -23.177 -32.774 1.00 137.35 ? 17   THR B N   1 
ATOM   2745 C  CA  . THR B  1 20  ? -2.377  -24.372 -32.287 1.00 135.89 ? 17   THR B CA  1 
ATOM   2746 C  C   . THR B  1 20  ? -2.658  -24.476 -30.770 1.00 137.19 ? 17   THR B C   1 
ATOM   2747 O  O   . THR B  1 20  ? -2.200  -25.418 -30.113 1.00 137.03 ? 17   THR B O   1 
ATOM   2748 C  CB  . THR B  1 20  ? -0.854  -24.378 -32.677 1.00 140.85 ? 17   THR B CB  1 
ATOM   2749 O  OG1 . THR B  1 20  ? -0.029  -24.627 -31.534 1.00 138.03 ? 17   THR B OG1 1 
ATOM   2750 C  CG2 . THR B  1 20  ? -0.390  -23.099 -33.369 1.00 138.41 ? 17   THR B CG2 1 
ATOM   2751 N  N   . ILE B  1 21  ? -3.442  -23.511 -30.232 1.00 131.30 ? 18   ILE B N   1 
ATOM   2752 C  CA  . ILE B  1 21  ? -3.752  -23.424 -28.807 1.00 130.09 ? 18   ILE B CA  1 
ATOM   2753 C  C   . ILE B  1 21  ? -4.928  -24.302 -28.380 1.00 131.70 ? 18   ILE B C   1 
ATOM   2754 O  O   . ILE B  1 21  ? -4.897  -24.814 -27.263 1.00 131.48 ? 18   ILE B O   1 
ATOM   2755 C  CB  . ILE B  1 21  ? -3.946  -21.955 -28.356 1.00 133.08 ? 18   ILE B CB  1 
ATOM   2756 N  N   . ASP B  1 22  ? -5.953  -24.471 -29.250 1.00 126.20 ? 19   ASP B N   1 
ATOM   2757 C  CA  . ASP B  1 22  ? -7.193  -25.227 -28.989 1.00 124.97 ? 19   ASP B CA  1 
ATOM   2758 C  C   . ASP B  1 22  ? -6.995  -26.608 -28.321 1.00 125.01 ? 19   ASP B C   1 
ATOM   2759 O  O   . ASP B  1 22  ? -7.703  -26.908 -27.357 1.00 124.60 ? 19   ASP B O   1 
ATOM   2760 C  CB  . ASP B  1 22  ? -8.037  -25.356 -30.269 1.00 127.19 ? 19   ASP B CB  1 
ATOM   2761 C  CG  . ASP B  1 22  ? -8.693  -24.056 -30.728 1.00 141.64 ? 19   ASP B CG  1 
ATOM   2762 O  OD1 . ASP B  1 22  ? -8.161  -22.968 -30.403 1.00 142.73 ? 19   ASP B OD1 1 
ATOM   2763 O  OD2 . ASP B  1 22  ? -9.734  -24.128 -31.419 1.00 149.42 ? 19   ASP B OD2 1 
ATOM   2764 N  N   . ASP B  1 23  ? -6.032  -27.421 -28.794 1.00 118.47 ? 20   ASP B N   1 
ATOM   2765 C  CA  . ASP B  1 23  ? -5.771  -28.728 -28.180 1.00 117.16 ? 20   ASP B CA  1 
ATOM   2766 C  C   . ASP B  1 23  ? -4.992  -28.604 -26.866 1.00 115.70 ? 20   ASP B C   1 
ATOM   2767 O  O   . ASP B  1 23  ? -5.224  -29.389 -25.946 1.00 114.48 ? 20   ASP B O   1 
ATOM   2768 C  CB  . ASP B  1 23  ? -5.109  -29.711 -29.161 1.00 120.01 ? 20   ASP B CB  1 
ATOM   2769 C  CG  . ASP B  1 23  ? -3.828  -29.206 -29.787 1.00 138.44 ? 20   ASP B CG  1 
ATOM   2770 O  OD1 . ASP B  1 23  ? -3.911  -28.393 -30.736 1.00 140.15 ? 20   ASP B OD1 1 
ATOM   2771 O  OD2 . ASP B  1 23  ? -2.739  -29.635 -29.338 1.00 147.33 ? 20   ASP B OD2 1 
ATOM   2772 N  N   . PHE B  1 24  ? -4.089  -27.606 -26.774 1.00 109.31 ? 21   PHE B N   1 
ATOM   2773 C  CA  . PHE B  1 24  ? -3.298  -27.309 -25.573 1.00 107.54 ? 21   PHE B CA  1 
ATOM   2774 C  C   . PHE B  1 24  ? -4.228  -26.846 -24.423 1.00 106.85 ? 21   PHE B C   1 
ATOM   2775 O  O   . PHE B  1 24  ? -4.080  -27.342 -23.301 1.00 106.89 ? 21   PHE B O   1 
ATOM   2776 C  CB  . PHE B  1 24  ? -2.205  -26.256 -25.882 1.00 109.22 ? 21   PHE B CB  1 
ATOM   2777 C  CG  . PHE B  1 24  ? -1.634  -25.529 -24.685 1.00 110.60 ? 21   PHE B CG  1 
ATOM   2778 C  CD1 . PHE B  1 24  ? -0.551  -26.047 -23.989 1.00 113.25 ? 21   PHE B CD1 1 
ATOM   2779 C  CD2 . PHE B  1 24  ? -2.179  -24.321 -24.256 1.00 112.71 ? 21   PHE B CD2 1 
ATOM   2780 C  CE1 . PHE B  1 24  ? -0.022  -25.373 -22.885 1.00 114.10 ? 21   PHE B CE1 1 
ATOM   2781 C  CE2 . PHE B  1 24  ? -1.667  -23.663 -23.132 1.00 115.26 ? 21   PHE B CE2 1 
ATOM   2782 C  CZ  . PHE B  1 24  ? -0.587  -24.189 -22.460 1.00 113.16 ? 21   PHE B CZ  1 
ATOM   2783 N  N   . ARG B  1 25  ? -5.148  -25.868 -24.709 1.00 98.42  ? 22   ARG B N   1 
ATOM   2784 C  CA  . ARG B  1 25  ? -6.155  -25.316 -23.788 1.00 96.21  ? 22   ARG B CA  1 
ATOM   2785 C  C   . ARG B  1 25  ? -6.939  -26.473 -23.166 1.00 96.87  ? 22   ARG B C   1 
ATOM   2786 O  O   . ARG B  1 25  ? -6.968  -26.603 -21.947 1.00 95.16  ? 22   ARG B O   1 
ATOM   2787 C  CB  . ARG B  1 25  ? -7.157  -24.409 -24.542 1.00 95.32  ? 22   ARG B CB  1 
ATOM   2788 C  CG  . ARG B  1 25  ? -6.644  -23.036 -24.948 1.00 103.61 ? 22   ARG B CG  1 
ATOM   2789 C  CD  . ARG B  1 25  ? -7.571  -22.342 -25.929 1.00 109.98 ? 22   ARG B CD  1 
ATOM   2790 N  NE  . ARG B  1 25  ? -8.790  -21.850 -25.286 1.00 123.02 ? 22   ARG B NE  1 
ATOM   2791 C  CZ  . ARG B  1 25  ? -9.563  -20.882 -25.773 1.00 140.51 ? 22   ARG B CZ  1 
ATOM   2792 N  NH1 . ARG B  1 25  ? -10.647 -20.495 -25.114 1.00 124.95 ? 22   ARG B NH1 1 
ATOM   2793 N  NH2 . ARG B  1 25  ? -9.252  -20.286 -26.919 1.00 131.53 ? 22   ARG B NH2 1 
ATOM   2794 N  N   . ASN B  1 26  ? -7.520  -27.347 -24.029 1.00 92.53  ? 23   ASN B N   1 
ATOM   2795 C  CA  . ASN B  1 26  ? -8.326  -28.515 -23.663 1.00 91.64  ? 23   ASN B CA  1 
ATOM   2796 C  C   . ASN B  1 26  ? -7.557  -29.583 -22.853 1.00 93.60  ? 23   ASN B C   1 
ATOM   2797 O  O   . ASN B  1 26  ? -8.184  -30.260 -22.029 1.00 92.14  ? 23   ASN B O   1 
ATOM   2798 C  CB  . ASN B  1 26  ? -8.982  -29.129 -24.908 1.00 92.81  ? 23   ASN B CB  1 
ATOM   2799 C  CG  . ASN B  1 26  ? -10.063 -28.286 -25.562 1.00 122.89 ? 23   ASN B CG  1 
ATOM   2800 O  OD1 . ASN B  1 26  ? -10.890 -27.656 -24.904 1.00 119.13 ? 23   ASN B OD1 1 
ATOM   2801 N  ND2 . ASN B  1 26  ? -10.106 -28.282 -26.887 1.00 118.30 ? 23   ASN B ND2 1 
ATOM   2802 N  N   . GLN B  1 27  ? -6.208  -29.716 -23.073 1.00 88.96  ? 24   GLN B N   1 
ATOM   2803 C  CA  . GLN B  1 27  ? -5.355  -30.693 -22.379 1.00 88.27  ? 24   GLN B CA  1 
ATOM   2804 C  C   . GLN B  1 27  ? -4.909  -30.226 -20.986 1.00 90.93  ? 24   GLN B C   1 
ATOM   2805 O  O   . GLN B  1 27  ? -5.048  -30.974 -20.008 1.00 90.63  ? 24   GLN B O   1 
ATOM   2806 C  CB  . GLN B  1 27  ? -4.143  -31.089 -23.243 1.00 89.55  ? 24   GLN B CB  1 
ATOM   2807 N  N   . VAL B  1 28  ? -4.371  -28.990 -20.906 1.00 85.80  ? 25   VAL B N   1 
ATOM   2808 C  CA  . VAL B  1 28  ? -3.881  -28.367 -19.670 1.00 84.27  ? 25   VAL B CA  1 
ATOM   2809 C  C   . VAL B  1 28  ? -5.062  -28.054 -18.743 1.00 84.38  ? 25   VAL B C   1 
ATOM   2810 O  O   . VAL B  1 28  ? -5.004  -28.391 -17.557 1.00 84.30  ? 25   VAL B O   1 
ATOM   2811 C  CB  . VAL B  1 28  ? -2.970  -27.133 -19.960 1.00 87.98  ? 25   VAL B CB  1 
ATOM   2812 C  CG1 . VAL B  1 28  ? -2.562  -26.406 -18.678 1.00 87.74  ? 25   VAL B CG1 1 
ATOM   2813 C  CG2 . VAL B  1 28  ? -1.730  -27.546 -20.746 1.00 87.60  ? 25   VAL B CG2 1 
ATOM   2814 N  N   . TYR B  1 29  ? -6.142  -27.467 -19.301 1.00 77.91  ? 26   TYR B N   1 
ATOM   2815 C  CA  . TYR B  1 29  ? -7.348  -27.140 -18.547 1.00 77.31  ? 26   TYR B CA  1 
ATOM   2816 C  C   . TYR B  1 29  ? -7.979  -28.351 -17.876 1.00 80.10  ? 26   TYR B C   1 
ATOM   2817 O  O   . TYR B  1 29  ? -8.227  -28.286 -16.678 1.00 79.88  ? 26   TYR B O   1 
ATOM   2818 C  CB  . TYR B  1 29  ? -8.378  -26.367 -19.386 1.00 78.85  ? 26   TYR B CB  1 
ATOM   2819 C  CG  . TYR B  1 29  ? -8.210  -24.854 -19.404 1.00 80.70  ? 26   TYR B CG  1 
ATOM   2820 C  CD1 . TYR B  1 29  ? -7.929  -24.147 -18.237 1.00 82.40  ? 26   TYR B CD1 1 
ATOM   2821 C  CD2 . TYR B  1 29  ? -8.402  -24.126 -20.574 1.00 81.75  ? 26   TYR B CD2 1 
ATOM   2822 C  CE1 . TYR B  1 29  ? -7.814  -22.756 -18.242 1.00 83.33  ? 26   TYR B CE1 1 
ATOM   2823 C  CE2 . TYR B  1 29  ? -8.296  -22.735 -20.589 1.00 82.70  ? 26   TYR B CE2 1 
ATOM   2824 C  CZ  . TYR B  1 29  ? -8.009  -22.055 -19.419 1.00 89.26  ? 26   TYR B CZ  1 
ATOM   2825 O  OH  . TYR B  1 29  ? -7.946  -20.687 -19.427 1.00 90.18  ? 26   TYR B OH  1 
ATOM   2826 N  N   . SER B  1 30  ? -8.161  -29.471 -18.608 1.00 76.50  ? 27   SER B N   1 
ATOM   2827 C  CA  . SER B  1 30  ? -8.712  -30.726 -18.077 1.00 75.81  ? 27   SER B CA  1 
ATOM   2828 C  C   . SER B  1 30  ? -7.883  -31.312 -16.920 1.00 76.41  ? 27   SER B C   1 
ATOM   2829 O  O   . SER B  1 30  ? -8.457  -31.717 -15.903 1.00 75.85  ? 27   SER B O   1 
ATOM   2830 C  CB  . SER B  1 30  ? -8.860  -31.763 -19.188 1.00 81.18  ? 27   SER B CB  1 
ATOM   2831 O  OG  . SER B  1 30  ? -9.959  -31.456 -20.030 1.00 95.28  ? 27   SER B OG  1 
ATOM   2832 N  N   . THR B  1 31  ? -6.543  -31.334 -17.067 1.00 70.25  ? 28   THR B N   1 
ATOM   2833 C  CA  . THR B  1 31  ? -5.632  -31.873 -16.060 1.00 69.58  ? 28   THR B CA  1 
ATOM   2834 C  C   . THR B  1 31  ? -5.661  -31.054 -14.755 1.00 72.08  ? 28   THR B C   1 
ATOM   2835 O  O   . THR B  1 31  ? -6.017  -31.584 -13.693 1.00 69.80  ? 28   THR B O   1 
ATOM   2836 C  CB  . THR B  1 31  ? -4.221  -32.032 -16.654 1.00 77.10  ? 28   THR B CB  1 
ATOM   2837 O  OG1 . THR B  1 31  ? -4.311  -32.914 -17.771 1.00 77.30  ? 28   THR B OG1 1 
ATOM   2838 C  CG2 . THR B  1 31  ? -3.204  -32.582 -15.645 1.00 71.73  ? 28   THR B CG2 1 
ATOM   2839 N  N   . LEU B  1 32  ? -5.307  -29.758 -14.854 1.00 69.19  ? 29   LEU B N   1 
ATOM   2840 C  CA  . LEU B  1 32  ? -5.219  -28.852 -13.714 1.00 68.79  ? 29   LEU B CA  1 
ATOM   2841 C  C   . LEU B  1 32  ? -6.545  -28.668 -12.964 1.00 69.68  ? 29   LEU B C   1 
ATOM   2842 O  O   . LEU B  1 32  ? -6.534  -28.773 -11.733 1.00 68.45  ? 29   LEU B O   1 
ATOM   2843 C  CB  . LEU B  1 32  ? -4.603  -27.506 -14.114 1.00 69.50  ? 29   LEU B CB  1 
ATOM   2844 C  CG  . LEU B  1 32  ? -3.192  -27.547 -14.723 1.00 75.08  ? 29   LEU B CG  1 
ATOM   2845 C  CD1 . LEU B  1 32  ? -2.718  -26.155 -15.049 1.00 76.07  ? 29   LEU B CD1 1 
ATOM   2846 C  CD2 . LEU B  1 32  ? -2.186  -28.219 -13.799 1.00 76.45  ? 29   LEU B CD2 1 
ATOM   2847 N  N   . TYR B  1 33  ? -7.680  -28.456 -13.677 1.00 64.67  ? 30   TYR B N   1 
ATOM   2848 C  CA  . TYR B  1 33  ? -8.977  -28.334 -13.008 1.00 65.18  ? 30   TYR B CA  1 
ATOM   2849 C  C   . TYR B  1 33  ? -9.353  -29.622 -12.280 1.00 73.87  ? 30   TYR B C   1 
ATOM   2850 O  O   . TYR B  1 33  ? -9.839  -29.545 -11.151 1.00 75.07  ? 30   TYR B O   1 
ATOM   2851 C  CB  . TYR B  1 33  ? -10.106 -27.896 -13.955 1.00 66.02  ? 30   TYR B CB  1 
ATOM   2852 C  CG  . TYR B  1 33  ? -10.049 -26.457 -14.428 1.00 66.54  ? 30   TYR B CG  1 
ATOM   2853 C  CD1 . TYR B  1 33  ? -9.731  -25.424 -13.549 1.00 68.24  ? 30   TYR B CD1 1 
ATOM   2854 C  CD2 . TYR B  1 33  ? -10.392 -26.118 -15.733 1.00 66.74  ? 30   TYR B CD2 1 
ATOM   2855 C  CE1 . TYR B  1 33  ? -9.689  -24.097 -13.975 1.00 66.96  ? 30   TYR B CE1 1 
ATOM   2856 C  CE2 . TYR B  1 33  ? -10.373 -24.793 -16.163 1.00 67.28  ? 30   TYR B CE2 1 
ATOM   2857 C  CZ  . TYR B  1 33  ? -10.012 -23.787 -15.283 1.00 67.80  ? 30   TYR B CZ  1 
ATOM   2858 O  OH  . TYR B  1 33  ? -9.990  -22.484 -15.703 1.00 62.46  ? 30   TYR B OH  1 
ATOM   2859 N  N   . SER B  1 34  ? -9.074  -30.806 -12.891 1.00 71.87  ? 31   SER B N   1 
ATOM   2860 C  CA  . SER B  1 34  ? -9.316  -32.114 -12.267 1.00 71.55  ? 31   SER B CA  1 
ATOM   2861 C  C   . SER B  1 34  ? -8.523  -32.251 -10.964 1.00 73.75  ? 31   SER B C   1 
ATOM   2862 O  O   . SER B  1 34  ? -9.092  -32.608 -9.939  1.00 72.99  ? 31   SER B O   1 
ATOM   2863 C  CB  . SER B  1 34  ? -8.971  -33.250 -13.224 1.00 75.56  ? 31   SER B CB  1 
ATOM   2864 O  OG  . SER B  1 34  ? -9.988  -33.417 -14.199 1.00 83.81  ? 31   SER B OG  1 
ATOM   2865 N  N   . MET B  1 35  ? -7.235  -31.898 -10.997 1.00 70.80  ? 32   MET B N   1 
ATOM   2866 C  CA  . MET B  1 35  ? -6.359  -31.915 -9.820  1.00 71.34  ? 32   MET B CA  1 
ATOM   2867 C  C   . MET B  1 35  ? -6.832  -30.961 -8.708  1.00 73.35  ? 32   MET B C   1 
ATOM   2868 O  O   . MET B  1 35  ? -6.920  -31.394 -7.554  1.00 72.76  ? 32   MET B O   1 
ATOM   2869 C  CB  . MET B  1 35  ? -4.928  -31.549 -10.209 1.00 74.16  ? 32   MET B CB  1 
ATOM   2870 C  CG  . MET B  1 35  ? -4.180  -32.661 -10.848 1.00 78.41  ? 32   MET B CG  1 
ATOM   2871 S  SD  . MET B  1 35  ? -2.522  -32.066 -11.181 1.00 83.77  ? 32   MET B SD  1 
ATOM   2872 C  CE  . MET B  1 35  ? -1.998  -33.280 -12.173 1.00 80.88  ? 32   MET B CE  1 
ATOM   2873 N  N   . ILE B  1 36  ? -7.129  -29.668 -9.063  1.00 67.47  ? 33   ILE B N   1 
ATOM   2874 C  CA  . ILE B  1 36  ? -7.603  -28.635 -8.130  1.00 66.25  ? 33   ILE B CA  1 
ATOM   2875 C  C   . ILE B  1 36  ? -8.947  -29.071 -7.473  1.00 72.00  ? 33   ILE B C   1 
ATOM   2876 O  O   . ILE B  1 36  ? -9.101  -28.926 -6.253  1.00 73.13  ? 33   ILE B O   1 
ATOM   2877 C  CB  . ILE B  1 36  ? -7.645  -27.206 -8.776  1.00 67.96  ? 33   ILE B CB  1 
ATOM   2878 C  CG1 . ILE B  1 36  ? -6.257  -26.751 -9.255  1.00 66.69  ? 33   ILE B CG1 1 
ATOM   2879 C  CG2 . ILE B  1 36  ? -8.214  -26.163 -7.808  1.00 67.45  ? 33   ILE B CG2 1 
ATOM   2880 C  CD1 . ILE B  1 36  ? -6.292  -25.726 -10.415 1.00 60.03  ? 33   ILE B CD1 1 
ATOM   2881 N  N   . SER B  1 37  ? -9.881  -29.647 -8.263  1.00 67.14  ? 34   SER B N   1 
ATOM   2882 C  CA  . SER B  1 37  ? -11.167 -30.125 -7.746  1.00 66.88  ? 34   SER B CA  1 
ATOM   2883 C  C   . SER B  1 37  ? -11.002 -31.223 -6.679  1.00 71.94  ? 34   SER B C   1 
ATOM   2884 O  O   . SER B  1 37  ? -11.679 -31.156 -5.649  1.00 72.56  ? 34   SER B O   1 
ATOM   2885 C  CB  . SER B  1 37  ? -12.039 -30.666 -8.875  1.00 69.81  ? 34   SER B CB  1 
ATOM   2886 O  OG  . SER B  1 37  ? -12.251 -29.699 -9.885  1.00 79.13  ? 34   SER B OG  1 
ATOM   2887 N  N   . VAL B  1 38  ? -10.106 -32.225 -6.920  1.00 66.28  ? 35   VAL B N   1 
ATOM   2888 C  CA  . VAL B  1 38  ? -9.922  -33.338 -5.988  1.00 65.59  ? 35   VAL B CA  1 
ATOM   2889 C  C   . VAL B  1 38  ? -9.189  -32.866 -4.715  1.00 66.04  ? 35   VAL B C   1 
ATOM   2890 O  O   . VAL B  1 38  ? -9.726  -33.050 -3.623  1.00 64.01  ? 35   VAL B O   1 
ATOM   2891 C  CB  . VAL B  1 38  ? -9.302  -34.621 -6.635  1.00 70.33  ? 35   VAL B CB  1 
ATOM   2892 C  CG1 . VAL B  1 38  ? -9.213  -35.766 -5.624  1.00 70.17  ? 35   VAL B CG1 1 
ATOM   2893 C  CG2 . VAL B  1 38  ? -10.110 -35.079 -7.857  1.00 69.75  ? 35   VAL B CG2 1 
ATOM   2894 N  N   . VAL B  1 39  ? -8.019  -32.215 -4.853  1.00 62.34  ? 36   VAL B N   1 
ATOM   2895 C  CA  . VAL B  1 39  ? -7.226  -31.679 -3.723  1.00 62.24  ? 36   VAL B CA  1 
ATOM   2896 C  C   . VAL B  1 39  ? -8.008  -30.601 -2.903  1.00 68.47  ? 36   VAL B C   1 
ATOM   2897 O  O   . VAL B  1 39  ? -7.949  -30.594 -1.658  1.00 68.37  ? 36   VAL B O   1 
ATOM   2898 C  CB  . VAL B  1 39  ? -5.831  -31.171 -4.192  1.00 65.57  ? 36   VAL B CB  1 
ATOM   2899 C  CG1 . VAL B  1 39  ? -5.056  -30.515 -3.052  1.00 65.15  ? 36   VAL B CG1 1 
ATOM   2900 C  CG2 . VAL B  1 39  ? -5.012  -32.303 -4.811  1.00 65.37  ? 36   VAL B CG2 1 
ATOM   2901 N  N   . GLY B  1 40  ? -8.722  -29.724 -3.619  1.00 64.79  ? 37   GLY B N   1 
ATOM   2902 C  CA  . GLY B  1 40  ? -9.519  -28.652 -3.038  1.00 65.41  ? 37   GLY B CA  1 
ATOM   2903 C  C   . GLY B  1 40  ? -10.728 -29.128 -2.259  1.00 71.37  ? 37   GLY B C   1 
ATOM   2904 O  O   . GLY B  1 40  ? -10.948 -28.680 -1.129  1.00 71.00  ? 37   GLY B O   1 
ATOM   2905 N  N   . PHE B  1 41  ? -11.524 -30.038 -2.854  1.00 69.47  ? 38   PHE B N   1 
ATOM   2906 C  CA  . PHE B  1 41  ? -12.707 -30.596 -2.203  1.00 69.76  ? 38   PHE B CA  1 
ATOM   2907 C  C   . PHE B  1 41  ? -12.361 -31.369 -0.920  1.00 73.02  ? 38   PHE B C   1 
ATOM   2908 O  O   . PHE B  1 41  ? -12.933 -31.054 0.127   1.00 72.80  ? 38   PHE B O   1 
ATOM   2909 C  CB  . PHE B  1 41  ? -13.547 -31.440 -3.179  1.00 72.44  ? 38   PHE B CB  1 
ATOM   2910 C  CG  . PHE B  1 41  ? -14.743 -32.115 -2.544  1.00 74.89  ? 38   PHE B CG  1 
ATOM   2911 C  CD1 . PHE B  1 41  ? -15.919 -31.409 -2.310  1.00 77.74  ? 38   PHE B CD1 1 
ATOM   2912 C  CD2 . PHE B  1 41  ? -14.680 -33.443 -2.149  1.00 77.68  ? 38   PHE B CD2 1 
ATOM   2913 C  CE1 . PHE B  1 41  ? -17.006 -32.019 -1.682  1.00 78.61  ? 38   PHE B CE1 1 
ATOM   2914 C  CE2 . PHE B  1 41  ? -15.771 -34.053 -1.523  1.00 80.81  ? 38   PHE B CE2 1 
ATOM   2915 C  CZ  . PHE B  1 41  ? -16.928 -33.339 -1.303  1.00 78.50  ? 38   PHE B CZ  1 
ATOM   2916 N  N   . PHE B  1 42  ? -11.414 -32.346 -0.988  1.00 68.17  ? 39   PHE B N   1 
ATOM   2917 C  CA  . PHE B  1 42  ? -11.017 -33.137 0.179   1.00 67.46  ? 39   PHE B CA  1 
ATOM   2918 C  C   . PHE B  1 42  ? -10.230 -32.365 1.245   1.00 70.17  ? 39   PHE B C   1 
ATOM   2919 O  O   . PHE B  1 42  ? -10.484 -32.575 2.435   1.00 69.05  ? 39   PHE B O   1 
ATOM   2920 C  CB  . PHE B  1 42  ? -10.260 -34.414 -0.220  1.00 69.59  ? 39   PHE B CB  1 
ATOM   2921 C  CG  . PHE B  1 42  ? -11.133 -35.441 -0.904  1.00 71.00  ? 39   PHE B CG  1 
ATOM   2922 C  CD1 . PHE B  1 42  ? -12.062 -36.185 -0.179  1.00 73.90  ? 39   PHE B CD1 1 
ATOM   2923 C  CD2 . PHE B  1 42  ? -11.040 -35.650 -2.276  1.00 72.96  ? 39   PHE B CD2 1 
ATOM   2924 C  CE1 . PHE B  1 42  ? -12.899 -37.106 -0.821  1.00 74.79  ? 39   PHE B CE1 1 
ATOM   2925 C  CE2 . PHE B  1 42  ? -11.877 -36.561 -2.919  1.00 75.98  ? 39   PHE B CE2 1 
ATOM   2926 C  CZ  . PHE B  1 42  ? -12.796 -37.294 -2.187  1.00 74.15  ? 39   PHE B CZ  1 
ATOM   2927 N  N   . GLY B  1 43  ? -9.257  -31.538 0.831   1.00 66.33  ? 40   GLY B N   1 
ATOM   2928 C  CA  . GLY B  1 43  ? -8.446  -30.738 1.744   1.00 65.68  ? 40   GLY B CA  1 
ATOM   2929 C  C   . GLY B  1 43  ? -9.261  -29.705 2.510   1.00 70.33  ? 40   GLY B C   1 
ATOM   2930 O  O   . GLY B  1 43  ? -9.105  -29.552 3.724   1.00 69.80  ? 40   GLY B O   1 
ATOM   2931 N  N   . ASN B  1 44  ? -10.162 -28.998 1.807   1.00 67.30  ? 41   ASN B N   1 
ATOM   2932 C  CA  . ASN B  1 44  ? -10.994 -27.995 2.450   1.00 67.03  ? 41   ASN B CA  1 
ATOM   2933 C  C   . ASN B  1 44  ? -12.119 -28.634 3.225   1.00 73.99  ? 41   ASN B C   1 
ATOM   2934 O  O   . ASN B  1 44  ? -12.310 -28.263 4.377   1.00 74.04  ? 41   ASN B O   1 
ATOM   2935 C  CB  . ASN B  1 44  ? -11.452 -26.930 1.472   1.00 61.17  ? 41   ASN B CB  1 
ATOM   2936 C  CG  . ASN B  1 44  ? -10.307 -26.017 1.115   1.00 66.40  ? 41   ASN B CG  1 
ATOM   2937 O  OD1 . ASN B  1 44  ? -9.675  -25.401 1.983   1.00 63.79  ? 41   ASN B OD1 1 
ATOM   2938 N  ND2 . ASN B  1 44  ? -9.992  -25.926 -0.161  1.00 51.64  ? 41   ASN B ND2 1 
ATOM   2939 N  N   . GLY B  1 45  ? -12.761 -29.656 2.638   1.00 72.76  ? 42   GLY B N   1 
ATOM   2940 C  CA  . GLY B  1 45  ? -13.813 -30.463 3.257   1.00 73.31  ? 42   GLY B CA  1 
ATOM   2941 C  C   . GLY B  1 45  ? -13.372 -31.017 4.600   1.00 79.61  ? 42   GLY B C   1 
ATOM   2942 O  O   . GLY B  1 45  ? -14.116 -30.960 5.581   1.00 79.82  ? 42   GLY B O   1 
ATOM   2943 N  N   . PHE B  1 46  ? -12.115 -31.471 4.672   1.00 78.32  ? 43   PHE B N   1 
ATOM   2944 C  CA  . PHE B  1 46  ? -11.501 -31.966 5.901   1.00 78.85  ? 43   PHE B CA  1 
ATOM   2945 C  C   . PHE B  1 46  ? -11.327 -30.842 6.931   1.00 84.66  ? 43   PHE B C   1 
ATOM   2946 O  O   . PHE B  1 46  ? -11.666 -31.042 8.101   1.00 84.11  ? 43   PHE B O   1 
ATOM   2947 C  CB  . PHE B  1 46  ? -10.155 -32.659 5.613   1.00 80.26  ? 43   PHE B CB  1 
ATOM   2948 C  CG  . PHE B  1 46  ? -9.451  -33.131 6.863   1.00 81.79  ? 43   PHE B CG  1 
ATOM   2949 C  CD1 . PHE B  1 46  ? -9.903  -34.251 7.556   1.00 84.94  ? 43   PHE B CD1 1 
ATOM   2950 C  CD2 . PHE B  1 46  ? -8.358  -32.440 7.365   1.00 83.81  ? 43   PHE B CD2 1 
ATOM   2951 C  CE1 . PHE B  1 46  ? -9.259  -34.680 8.720   1.00 85.85  ? 43   PHE B CE1 1 
ATOM   2952 C  CE2 . PHE B  1 46  ? -7.722  -32.864 8.532   1.00 86.92  ? 43   PHE B CE2 1 
ATOM   2953 C  CZ  . PHE B  1 46  ? -8.168  -33.990 9.195   1.00 85.09  ? 43   PHE B CZ  1 
ATOM   2954 N  N   . VAL B  1 47  ? -10.788 -29.674 6.490   1.00 82.35  ? 44   VAL B N   1 
ATOM   2955 C  CA  . VAL B  1 47  ? -10.553 -28.483 7.328   1.00 82.07  ? 44   VAL B CA  1 
ATOM   2956 C  C   . VAL B  1 47  ? -11.887 -27.966 7.896   1.00 84.05  ? 44   VAL B C   1 
ATOM   2957 O  O   . VAL B  1 47  ? -11.967 -27.638 9.084   1.00 82.93  ? 44   VAL B O   1 
ATOM   2958 C  CB  . VAL B  1 47  ? -9.716  -27.405 6.583   1.00 86.25  ? 44   VAL B CB  1 
ATOM   2959 C  CG1 . VAL B  1 47  ? -9.734  -26.056 7.307   1.00 86.23  ? 44   VAL B CG1 1 
ATOM   2960 C  CG2 . VAL B  1 47  ? -8.278  -27.883 6.386   1.00 85.83  ? 44   VAL B CG2 1 
ATOM   2961 N  N   . LEU B  1 48  ? -12.939 -27.980 7.071   1.00 80.76  ? 45   LEU B N   1 
ATOM   2962 C  CA  . LEU B  1 48  ? -14.274 -27.574 7.484   1.00 81.07  ? 45   LEU B CA  1 
ATOM   2963 C  C   . LEU B  1 48  ? -14.826 -28.539 8.534   1.00 88.53  ? 45   LEU B C   1 
ATOM   2964 O  O   . LEU B  1 48  ? -15.350 -28.075 9.546   1.00 88.84  ? 45   LEU B O   1 
ATOM   2965 C  CB  . LEU B  1 48  ? -15.194 -27.464 6.268   1.00 80.81  ? 45   LEU B CB  1 
ATOM   2966 C  CG  . LEU B  1 48  ? -16.358 -26.490 6.362   1.00 85.18  ? 45   LEU B CG  1 
ATOM   2967 C  CD1 . LEU B  1 48  ? -15.959 -25.181 7.016   1.00 84.90  ? 45   LEU B CD1 1 
ATOM   2968 C  CD2 . LEU B  1 48  ? -16.927 -26.225 5.001   1.00 87.13  ? 45   LEU B CD2 1 
ATOM   2969 N  N   . TYR B  1 49  ? -14.636 -29.874 8.327   1.00 86.56  ? 46   TYR B N   1 
ATOM   2970 C  CA  . TYR B  1 49  ? -15.054 -30.936 9.247   1.00 86.62  ? 46   TYR B CA  1 
ATOM   2971 C  C   . TYR B  1 49  ? -14.393 -30.732 10.614  1.00 91.26  ? 46   TYR B C   1 
ATOM   2972 O  O   . TYR B  1 49  ? -15.108 -30.623 11.607  1.00 91.10  ? 46   TYR B O   1 
ATOM   2973 C  CB  . TYR B  1 49  ? -14.750 -32.334 8.664   1.00 88.18  ? 46   TYR B CB  1 
ATOM   2974 C  CG  . TYR B  1 49  ? -14.925 -33.469 9.654   1.00 90.07  ? 46   TYR B CG  1 
ATOM   2975 C  CD1 . TYR B  1 49  ? -16.189 -33.960 9.966   1.00 92.46  ? 46   TYR B CD1 1 
ATOM   2976 C  CD2 . TYR B  1 49  ? -13.830 -34.037 10.295  1.00 90.92  ? 46   TYR B CD2 1 
ATOM   2977 C  CE1 . TYR B  1 49  ? -16.359 -34.974 10.908  1.00 93.93  ? 46   TYR B CE1 1 
ATOM   2978 C  CE2 . TYR B  1 49  ? -13.986 -35.050 11.236  1.00 92.13  ? 46   TYR B CE2 1 
ATOM   2979 C  CZ  . TYR B  1 49  ? -15.252 -35.519 11.538  1.00 103.23 ? 46   TYR B CZ  1 
ATOM   2980 O  OH  . TYR B  1 49  ? -15.398 -36.532 12.458  1.00 109.68 ? 46   TYR B OH  1 
ATOM   2981 N  N   . VAL B  1 50  ? -13.045 -30.631 10.649  1.00 88.37  ? 47   VAL B N   1 
ATOM   2982 C  CA  . VAL B  1 50  ? -12.229 -30.409 11.853  1.00 88.82  ? 47   VAL B CA  1 
ATOM   2983 C  C   . VAL B  1 50  ? -12.629 -29.112 12.603  1.00 97.55  ? 47   VAL B C   1 
ATOM   2984 O  O   . VAL B  1 50  ? -12.683 -29.141 13.832  1.00 97.92  ? 47   VAL B O   1 
ATOM   2985 C  CB  . VAL B  1 50  ? -10.717 -30.478 11.526  1.00 91.63  ? 47   VAL B CB  1 
ATOM   2986 C  CG1 . VAL B  1 50  ? -9.853  -29.993 12.685  1.00 91.14  ? 47   VAL B CG1 1 
ATOM   2987 C  CG2 . VAL B  1 50  ? -10.327 -31.893 11.139  1.00 91.43  ? 47   VAL B CG2 1 
ATOM   2988 N  N   . LEU B  1 51  ? -12.944 -28.010 11.876  1.00 96.31  ? 48   LEU B N   1 
ATOM   2989 C  CA  . LEU B  1 51  ? -13.352 -26.727 12.480  1.00 97.02  ? 48   LEU B CA  1 
ATOM   2990 C  C   . LEU B  1 51  ? -14.790 -26.715 13.028  1.00 105.53 ? 48   LEU B C   1 
ATOM   2991 O  O   . LEU B  1 51  ? -15.051 -26.049 14.036  1.00 105.21 ? 48   LEU B O   1 
ATOM   2992 C  CB  . LEU B  1 51  ? -13.147 -25.548 11.513  1.00 96.39  ? 48   LEU B CB  1 
ATOM   2993 C  CG  . LEU B  1 51  ? -11.734 -25.046 11.343  1.00 99.11  ? 48   LEU B CG  1 
ATOM   2994 C  CD1 . LEU B  1 51  ? -11.608 -24.313 10.058  1.00 98.50  ? 48   LEU B CD1 1 
ATOM   2995 C  CD2 . LEU B  1 51  ? -11.332 -24.142 12.488  1.00 99.92  ? 48   LEU B CD2 1 
ATOM   2996 N  N   . ILE B  1 52  ? -15.718 -27.417 12.349  1.00 105.46 ? 49   ILE B N   1 
ATOM   2997 C  CA  . ILE B  1 52  ? -17.122 -27.516 12.756  1.00 106.83 ? 49   ILE B CA  1 
ATOM   2998 C  C   . ILE B  1 52  ? -17.227 -28.337 14.053  1.00 115.53 ? 49   ILE B C   1 
ATOM   2999 O  O   . ILE B  1 52  ? -17.907 -27.909 14.986  1.00 115.47 ? 49   ILE B O   1 
ATOM   3000 C  CB  . ILE B  1 52  ? -18.000 -28.049 11.576  1.00 109.67 ? 49   ILE B CB  1 
ATOM   3001 C  CG1 . ILE B  1 52  ? -18.320 -26.931 10.534  1.00 109.95 ? 49   ILE B CG1 1 
ATOM   3002 C  CG2 . ILE B  1 52  ? -19.262 -28.787 12.027  1.00 110.58 ? 49   ILE B CG2 1 
ATOM   3003 C  CD1 . ILE B  1 52  ? -19.051 -25.630 11.027  1.00 116.61 ? 49   ILE B CD1 1 
ATOM   3004 N  N   . LYS B  1 53  ? -16.498 -29.475 14.124  1.00 115.54 ? 50   LYS B N   1 
ATOM   3005 C  CA  . LYS B  1 53  ? -16.463 -30.390 15.274  1.00 116.96 ? 50   LYS B CA  1 
ATOM   3006 C  C   . LYS B  1 53  ? -15.464 -29.972 16.386  1.00 124.84 ? 50   LYS B C   1 
ATOM   3007 O  O   . LYS B  1 53  ? -15.051 -30.810 17.190  1.00 123.84 ? 50   LYS B O   1 
ATOM   3008 C  CB  . LYS B  1 53  ? -16.213 -31.829 14.808  1.00 119.24 ? 50   LYS B CB  1 
ATOM   3009 N  N   . THR B  1 54  ? -15.071 -28.678 16.405  1.00 125.40 ? 51   THR B N   1 
ATOM   3010 C  CA  . THR B  1 54  ? -14.229 -28.005 17.412  1.00 127.09 ? 51   THR B CA  1 
ATOM   3011 C  C   . THR B  1 54  ? -14.784 -26.567 17.600  1.00 134.50 ? 51   THR B C   1 
ATOM   3012 O  O   . THR B  1 54  ? -14.022 -25.596 17.695  1.00 133.70 ? 51   THR B O   1 
ATOM   3013 C  CB  . THR B  1 54  ? -12.716 -28.019 17.071  1.00 137.27 ? 51   THR B CB  1 
ATOM   3014 O  OG1 . THR B  1 54  ? -12.487 -27.358 15.828  1.00 138.41 ? 51   THR B OG1 1 
ATOM   3015 C  CG2 . THR B  1 54  ? -12.085 -29.413 17.109  1.00 135.57 ? 51   THR B CG2 1 
ATOM   3016 N  N   . TYR B  1 55  ? -16.131 -26.454 17.640  1.00 133.97 ? 52   TYR B N   1 
ATOM   3017 C  CA  . TYR B  1 55  ? -16.880 -25.202 17.793  1.00 135.13 ? 52   TYR B CA  1 
ATOM   3018 C  C   . TYR B  1 55  ? -16.832 -24.629 19.227  1.00 141.14 ? 52   TYR B C   1 
ATOM   3019 O  O   . TYR B  1 55  ? -17.156 -23.447 19.420  1.00 140.30 ? 52   TYR B O   1 
ATOM   3020 C  CB  . TYR B  1 55  ? -18.335 -25.398 17.331  1.00 136.51 ? 52   TYR B CB  1 
ATOM   3021 N  N   . HIS B  1 56  ? -16.417 -25.476 20.217  1.00 139.06 ? 53   HIS B N   1 
ATOM   3022 C  CA  . HIS B  1 56  ? -16.274 -25.185 21.656  1.00 139.12 ? 53   HIS B CA  1 
ATOM   3023 C  C   . HIS B  1 56  ? -15.551 -23.853 21.939  1.00 140.60 ? 53   HIS B C   1 
ATOM   3024 O  O   . HIS B  1 56  ? -16.016 -23.073 22.777  1.00 140.19 ? 53   HIS B O   1 
ATOM   3025 C  CB  . HIS B  1 56  ? -15.568 -26.360 22.369  1.00 140.53 ? 53   HIS B CB  1 
ATOM   3026 C  CG  . HIS B  1 56  ? -15.268 -26.119 23.820  1.00 144.58 ? 53   HIS B CG  1 
ATOM   3027 N  ND1 . HIS B  1 56  ? -14.023 -25.668 24.236  1.00 146.70 ? 53   HIS B ND1 1 
ATOM   3028 C  CD2 . HIS B  1 56  ? -16.062 -26.273 24.906  1.00 146.73 ? 53   HIS B CD2 1 
ATOM   3029 C  CE1 . HIS B  1 56  ? -14.101 -25.565 25.554  1.00 146.31 ? 53   HIS B CE1 1 
ATOM   3030 N  NE2 . HIS B  1 56  ? -15.310 -25.917 26.003  1.00 146.61 ? 53   HIS B NE2 1 
ATOM   3031 N  N   . LYS B  1 57  ? -14.425 -23.606 21.230  1.00 134.75 ? 54   LYS B N   1 
ATOM   3032 C  CA  . LYS B  1 57  ? -13.606 -22.395 21.341  1.00 133.04 ? 54   LYS B CA  1 
ATOM   3033 C  C   . LYS B  1 57  ? -13.267 -21.852 19.925  1.00 132.74 ? 54   LYS B C   1 
ATOM   3034 O  O   . LYS B  1 57  ? -12.358 -22.376 19.264  1.00 132.97 ? 54   LYS B O   1 
ATOM   3035 C  CB  . LYS B  1 57  ? -12.346 -22.684 22.208  1.00 135.07 ? 54   LYS B CB  1 
ATOM   3036 C  CG  . LYS B  1 57  ? -11.282 -21.579 22.268  1.00 140.57 ? 54   LYS B CG  1 
ATOM   3037 C  CD  . LYS B  1 57  ? -11.698 -20.342 23.062  1.00 142.33 ? 54   LYS B CD  1 
ATOM   3038 C  CE  . LYS B  1 57  ? -10.625 -19.281 23.028  1.00 144.36 ? 54   LYS B CE  1 
ATOM   3039 N  NZ  . LYS B  1 57  ? -10.468 -18.676 21.677  1.00 149.82 ? 54   LYS B NZ  1 
ATOM   3040 N  N   . LYS B  1 58  ? -14.030 -20.835 19.450  1.00 124.44 ? 55   LYS B N   1 
ATOM   3041 C  CA  . LYS B  1 58  ? -13.804 -20.250 18.124  1.00 122.00 ? 55   LYS B CA  1 
ATOM   3042 C  C   . LYS B  1 58  ? -13.004 -18.946 18.179  1.00 121.06 ? 55   LYS B C   1 
ATOM   3043 O  O   . LYS B  1 58  ? -13.395 -18.005 18.874  1.00 120.96 ? 55   LYS B O   1 
ATOM   3044 C  CB  . LYS B  1 58  ? -15.114 -20.063 17.341  1.00 124.10 ? 55   LYS B CB  1 
ATOM   3045 N  N   . SER B  1 59  ? -11.872 -18.910 17.451  1.00 112.85 ? 56   SER B N   1 
ATOM   3046 C  CA  . SER B  1 59  ? -10.977 -17.755 17.349  1.00 109.77 ? 56   SER B CA  1 
ATOM   3047 C  C   . SER B  1 59  ? -11.392 -16.904 16.151  1.00 106.69 ? 56   SER B C   1 
ATOM   3048 O  O   . SER B  1 59  ? -12.192 -17.362 15.334  1.00 106.02 ? 56   SER B O   1 
ATOM   3049 C  CB  . SER B  1 59  ? -9.542  -18.233 17.129  1.00 113.34 ? 56   SER B CB  1 
ATOM   3050 O  OG  . SER B  1 59  ? -9.064  -19.019 18.205  1.00 124.05 ? 56   SER B OG  1 
ATOM   3051 N  N   . ALA B  1 60  ? -10.809 -15.688 16.011  1.00 97.91  ? 57   ALA B N   1 
ATOM   3052 C  CA  . ALA B  1 60  ? -11.042 -14.825 14.849  1.00 94.75  ? 57   ALA B CA  1 
ATOM   3053 C  C   . ALA B  1 60  ? -10.443 -15.522 13.610  1.00 91.91  ? 57   ALA B C   1 
ATOM   3054 O  O   . ALA B  1 60  ? -11.079 -15.543 12.557  1.00 90.23  ? 57   ALA B O   1 
ATOM   3055 C  CB  . ALA B  1 60  ? -10.393 -13.470 15.059  1.00 95.29  ? 57   ALA B CB  1 
ATOM   3056 N  N   . PHE B  1 61  ? -9.262  -16.168 13.777  1.00 85.25  ? 58   PHE B N   1 
ATOM   3057 C  CA  . PHE B  1 61  ? -8.581  -16.945 12.732  1.00 83.63  ? 58   PHE B CA  1 
ATOM   3058 C  C   . PHE B  1 61  ? -9.469  -18.085 12.232  1.00 83.67  ? 58   PHE B C   1 
ATOM   3059 O  O   . PHE B  1 61  ? -9.506  -18.321 11.028  1.00 83.11  ? 58   PHE B O   1 
ATOM   3060 C  CB  . PHE B  1 61  ? -7.209  -17.474 13.213  1.00 85.24  ? 58   PHE B CB  1 
ATOM   3061 C  CG  . PHE B  1 61  ? -6.577  -18.527 12.326  1.00 86.64  ? 58   PHE B CG  1 
ATOM   3062 C  CD1 . PHE B  1 61  ? -5.838  -18.166 11.204  1.00 90.00  ? 58   PHE B CD1 1 
ATOM   3063 C  CD2 . PHE B  1 61  ? -6.737  -19.883 12.603  1.00 88.49  ? 58   PHE B CD2 1 
ATOM   3064 C  CE1 . PHE B  1 61  ? -5.267  -19.146 10.373  1.00 91.33  ? 58   PHE B CE1 1 
ATOM   3065 C  CE2 . PHE B  1 61  ? -6.169  -20.859 11.774  1.00 91.28  ? 58   PHE B CE2 1 
ATOM   3066 C  CZ  . PHE B  1 61  ? -5.429  -20.485 10.669  1.00 89.80  ? 58   PHE B CZ  1 
ATOM   3067 N  N   . GLN B  1 62  ? -10.178 -18.776 13.150  1.00 78.05  ? 59   GLN B N   1 
ATOM   3068 C  CA  . GLN B  1 62  ? -11.090 -19.880 12.830  1.00 76.90  ? 59   GLN B CA  1 
ATOM   3069 C  C   . GLN B  1 62  ? -12.290 -19.402 12.013  1.00 79.51  ? 59   GLN B C   1 
ATOM   3070 O  O   . GLN B  1 62  ? -12.695 -20.112 11.091  1.00 78.53  ? 59   GLN B O   1 
ATOM   3071 C  CB  . GLN B  1 62  ? -11.541 -20.615 14.104  1.00 78.01  ? 59   GLN B CB  1 
ATOM   3072 N  N   . VAL B  1 63  ? -12.827 -18.177 12.325  1.00 75.15  ? 60   VAL B N   1 
ATOM   3073 C  CA  . VAL B  1 63  ? -13.953 -17.532 11.616  1.00 73.94  ? 60   VAL B CA  1 
ATOM   3074 C  C   . VAL B  1 63  ? -13.523 -17.327 10.153  1.00 76.07  ? 60   VAL B C   1 
ATOM   3075 O  O   . VAL B  1 63  ? -14.215 -17.784 9.239   1.00 75.22  ? 60   VAL B O   1 
ATOM   3076 C  CB  . VAL B  1 63  ? -14.411 -16.201 12.291  1.00 77.54  ? 60   VAL B CB  1 
ATOM   3077 C  CG1 . VAL B  1 63  ? -15.439 -15.466 11.440  1.00 77.46  ? 60   VAL B CG1 1 
ATOM   3078 C  CG2 . VAL B  1 63  ? -14.964 -16.440 13.696  1.00 77.28  ? 60   VAL B CG2 1 
ATOM   3079 N  N   . TYR B  1 64  ? -12.337 -16.703 9.951   1.00 71.30  ? 61   TYR B N   1 
ATOM   3080 C  CA  . TYR B  1 64  ? -11.736 -16.486 8.632   1.00 69.51  ? 61   TYR B CA  1 
ATOM   3081 C  C   . TYR B  1 64  ? -11.458 -17.815 7.934   1.00 71.92  ? 61   TYR B C   1 
ATOM   3082 O  O   . TYR B  1 64  ? -11.725 -17.927 6.740   1.00 72.04  ? 61   TYR B O   1 
ATOM   3083 C  CB  . TYR B  1 64  ? -10.460 -15.648 8.740   1.00 69.31  ? 61   TYR B CB  1 
ATOM   3084 C  CG  . TYR B  1 64  ? -10.696 -14.228 9.195   1.00 69.36  ? 61   TYR B CG  1 
ATOM   3085 C  CD1 . TYR B  1 64  ? -11.570 -13.392 8.509   1.00 71.18  ? 61   TYR B CD1 1 
ATOM   3086 C  CD2 . TYR B  1 64  ? -9.984  -13.691 10.263  1.00 70.00  ? 61   TYR B CD2 1 
ATOM   3087 C  CE1 . TYR B  1 64  ? -11.783 -12.073 8.917   1.00 71.56  ? 61   TYR B CE1 1 
ATOM   3088 C  CE2 . TYR B  1 64  ? -10.171 -12.367 10.668  1.00 70.80  ? 61   TYR B CE2 1 
ATOM   3089 C  CZ  . TYR B  1 64  ? -11.068 -11.558 9.987   1.00 77.57  ? 61   TYR B CZ  1 
ATOM   3090 O  OH  . TYR B  1 64  ? -11.257 -10.252 10.373  1.00 76.45  ? 61   TYR B OH  1 
ATOM   3091 N  N   . MET B  1 65  ? -10.988 -18.833 8.685   1.00 67.61  ? 62   MET B N   1 
ATOM   3092 C  CA  . MET B  1 65  ? -10.730 -20.179 8.160   1.00 67.40  ? 62   MET B CA  1 
ATOM   3093 C  C   . MET B  1 65  ? -11.995 -20.860 7.620   1.00 71.81  ? 62   MET B C   1 
ATOM   3094 O  O   . MET B  1 65  ? -11.946 -21.397 6.512   1.00 72.95  ? 62   MET B O   1 
ATOM   3095 C  CB  . MET B  1 65  ? -10.047 -21.091 9.202   1.00 69.43  ? 62   MET B CB  1 
ATOM   3096 C  CG  . MET B  1 65  ? -8.519  -21.231 9.062   1.00 72.38  ? 62   MET B CG  1 
ATOM   3097 S  SD  . MET B  1 65  ? -7.726  -21.132 7.427   1.00 75.77  ? 62   MET B SD  1 
ATOM   3098 C  CE  . MET B  1 65  ? -8.490  -22.508 6.550   1.00 71.79  ? 62   MET B CE  1 
ATOM   3099 N  N   . ILE B  1 66  ? -13.114 -20.850 8.388   1.00 67.09  ? 63   ILE B N   1 
ATOM   3100 C  CA  . ILE B  1 66  ? -14.399 -21.453 7.977   1.00 66.94  ? 63   ILE B CA  1 
ATOM   3101 C  C   . ILE B  1 66  ? -14.889 -20.789 6.672   1.00 71.26  ? 63   ILE B C   1 
ATOM   3102 O  O   . ILE B  1 66  ? -15.310 -21.482 5.744   1.00 70.46  ? 63   ILE B O   1 
ATOM   3103 C  CB  . ILE B  1 66  ? -15.486 -21.376 9.117   1.00 69.98  ? 63   ILE B CB  1 
ATOM   3104 C  CG1 . ILE B  1 66  ? -15.057 -22.162 10.375  1.00 70.96  ? 63   ILE B CG1 1 
ATOM   3105 C  CG2 . ILE B  1 66  ? -16.884 -21.841 8.643   1.00 69.61  ? 63   ILE B CG2 1 
ATOM   3106 C  CD1 . ILE B  1 66  ? -15.622 -21.596 11.653  1.00 81.33  ? 63   ILE B CD1 1 
ATOM   3107 N  N   . ASN B  1 67  ? -14.801 -19.441 6.610   1.00 67.92  ? 64   ASN B N   1 
ATOM   3108 C  CA  . ASN B  1 67  ? -15.222 -18.633 5.466   1.00 66.90  ? 64   ASN B CA  1 
ATOM   3109 C  C   . ASN B  1 67  ? -14.408 -18.894 4.205   1.00 68.51  ? 64   ASN B C   1 
ATOM   3110 O  O   . ASN B  1 67  ? -14.994 -18.941 3.117   1.00 68.46  ? 64   ASN B O   1 
ATOM   3111 C  CB  . ASN B  1 67  ? -15.245 -17.173 5.838   1.00 64.58  ? 64   ASN B CB  1 
ATOM   3112 C  CG  . ASN B  1 67  ? -16.504 -16.881 6.559   1.00 74.02  ? 64   ASN B CG  1 
ATOM   3113 O  OD1 . ASN B  1 67  ? -17.515 -16.567 5.943   1.00 74.77  ? 64   ASN B OD1 1 
ATOM   3114 N  ND2 . ASN B  1 67  ? -16.489 -17.040 7.866   1.00 59.77  ? 64   ASN B ND2 1 
ATOM   3115 N  N   . LEU B  1 68  ? -13.074 -19.095 4.357   1.00 62.42  ? 65   LEU B N   1 
ATOM   3116 C  CA  . LEU B  1 68  ? -12.166 -19.454 3.262   1.00 61.30  ? 65   LEU B CA  1 
ATOM   3117 C  C   . LEU B  1 68  ? -12.544 -20.843 2.711   1.00 64.65  ? 65   LEU B C   1 
ATOM   3118 O  O   . LEU B  1 68  ? -12.684 -20.985 1.494   1.00 63.49  ? 65   LEU B O   1 
ATOM   3119 C  CB  . LEU B  1 68  ? -10.699 -19.460 3.733   1.00 60.58  ? 65   LEU B CB  1 
ATOM   3120 C  CG  . LEU B  1 68  ? -10.003 -18.115 3.755   1.00 64.14  ? 65   LEU B CG  1 
ATOM   3121 C  CD1 . LEU B  1 68  ? -8.768  -18.180 4.598   1.00 63.85  ? 65   LEU B CD1 1 
ATOM   3122 C  CD2 . LEU B  1 68  ? -9.672  -17.633 2.345   1.00 64.18  ? 65   LEU B CD2 1 
ATOM   3123 N  N   . ALA B  1 69  ? -12.750 -21.850 3.607   1.00 60.96  ? 66   ALA B N   1 
ATOM   3124 C  CA  . ALA B  1 69  ? -13.133 -23.216 3.239   1.00 61.09  ? 66   ALA B CA  1 
ATOM   3125 C  C   . ALA B  1 69  ? -14.455 -23.245 2.450   1.00 66.89  ? 66   ALA B C   1 
ATOM   3126 O  O   . ALA B  1 69  ? -14.529 -23.952 1.436   1.00 67.62  ? 66   ALA B O   1 
ATOM   3127 C  CB  . ALA B  1 69  ? -13.236 -24.093 4.480   1.00 61.61  ? 66   ALA B CB  1 
ATOM   3128 N  N   . VAL B  1 70  ? -15.480 -22.455 2.897   1.00 61.94  ? 67   VAL B N   1 
ATOM   3129 C  CA  . VAL B  1 70  ? -16.791 -22.362 2.248   1.00 60.88  ? 67   VAL B CA  1 
ATOM   3130 C  C   . VAL B  1 70  ? -16.671 -21.706 0.860   1.00 67.79  ? 67   VAL B C   1 
ATOM   3131 O  O   . VAL B  1 70  ? -17.274 -22.196 -0.099  1.00 67.07  ? 67   VAL B O   1 
ATOM   3132 C  CB  . VAL B  1 70  ? -17.838 -21.679 3.157   1.00 63.39  ? 67   VAL B CB  1 
ATOM   3133 C  CG1 . VAL B  1 70  ? -19.148 -21.433 2.415   1.00 62.82  ? 67   VAL B CG1 1 
ATOM   3134 C  CG2 . VAL B  1 70  ? -18.097 -22.510 4.403   1.00 63.25  ? 67   VAL B CG2 1 
ATOM   3135 N  N   . ALA B  1 71  ? -15.876 -20.615 0.752   1.00 66.91  ? 68   ALA B N   1 
ATOM   3136 C  CA  . ALA B  1 71  ? -15.640 -19.907 -0.518  1.00 67.76  ? 68   ALA B CA  1 
ATOM   3137 C  C   . ALA B  1 71  ? -14.895 -20.810 -1.512  1.00 71.92  ? 68   ALA B C   1 
ATOM   3138 O  O   . ALA B  1 71  ? -15.181 -20.764 -2.718  1.00 72.09  ? 68   ALA B O   1 
ATOM   3139 C  CB  . ALA B  1 71  ? -14.863 -18.613 -0.280  1.00 68.64  ? 68   ALA B CB  1 
ATOM   3140 N  N   . ASP B  1 72  ? -13.979 -21.660 -0.992  1.00 67.14  ? 69   ASP B N   1 
ATOM   3141 C  CA  . ASP B  1 72  ? -13.227 -22.631 -1.781  1.00 66.22  ? 69   ASP B CA  1 
ATOM   3142 C  C   . ASP B  1 72  ? -14.133 -23.751 -2.264  1.00 70.31  ? 69   ASP B C   1 
ATOM   3143 O  O   . ASP B  1 72  ? -14.065 -24.120 -3.442  1.00 70.10  ? 69   ASP B O   1 
ATOM   3144 C  CB  . ASP B  1 72  ? -12.071 -23.217 -0.959  1.00 67.48  ? 69   ASP B CB  1 
ATOM   3145 C  CG  . ASP B  1 72  ? -10.923 -22.275 -0.642  1.00 68.99  ? 69   ASP B CG  1 
ATOM   3146 O  OD1 . ASP B  1 72  ? -10.923 -21.131 -1.159  1.00 67.26  ? 69   ASP B OD1 1 
ATOM   3147 O  OD2 . ASP B  1 72  ? -10.024 -22.682 0.121   1.00 69.13  ? 69   ASP B OD2 1 
ATOM   3148 N  N   . LEU B  1 73  ? -14.989 -24.270 -1.359  1.00 67.71  ? 70   LEU B N   1 
ATOM   3149 C  CA  . LEU B  1 73  ? -15.907 -25.370 -1.638  1.00 68.59  ? 70   LEU B CA  1 
ATOM   3150 C  C   . LEU B  1 73  ? -16.960 -25.053 -2.692  1.00 75.10  ? 70   LEU B C   1 
ATOM   3151 O  O   . LEU B  1 73  ? -17.211 -25.908 -3.547  1.00 75.44  ? 70   LEU B O   1 
ATOM   3152 C  CB  . LEU B  1 73  ? -16.549 -25.927 -0.363  1.00 68.52  ? 70   LEU B CB  1 
ATOM   3153 C  CG  . LEU B  1 73  ? -15.660 -26.934 0.375   1.00 73.01  ? 70   LEU B CG  1 
ATOM   3154 C  CD1 . LEU B  1 73  ? -16.214 -27.268 1.724   1.00 72.82  ? 70   LEU B CD1 1 
ATOM   3155 C  CD2 . LEU B  1 73  ? -15.438 -28.193 -0.450  1.00 74.83  ? 70   LEU B CD2 1 
ATOM   3156 N  N   . LEU B  1 74  ? -17.534 -23.831 -2.671  1.00 72.77  ? 71   LEU B N   1 
ATOM   3157 C  CA  . LEU B  1 74  ? -18.531 -23.387 -3.651  1.00 73.47  ? 71   LEU B CA  1 
ATOM   3158 C  C   . LEU B  1 74  ? -17.936 -23.309 -5.075  1.00 75.58  ? 71   LEU B C   1 
ATOM   3159 O  O   . LEU B  1 74  ? -18.652 -23.561 -6.044  1.00 74.65  ? 71   LEU B O   1 
ATOM   3160 C  CB  . LEU B  1 74  ? -19.160 -22.037 -3.234  1.00 74.54  ? 71   LEU B CB  1 
ATOM   3161 C  CG  . LEU B  1 74  ? -20.074 -22.045 -1.985  1.00 80.31  ? 71   LEU B CG  1 
ATOM   3162 C  CD1 . LEU B  1 74  ? -20.061 -20.700 -1.286  1.00 80.94  ? 71   LEU B CD1 1 
ATOM   3163 C  CD2 . LEU B  1 74  ? -21.507 -22.441 -2.335  1.00 83.19  ? 71   LEU B CD2 1 
ATOM   3164 N  N   . CYS B  1 75  ? -16.633 -22.972 -5.192  1.00 71.93  ? 72   CYS B N   1 
ATOM   3165 C  CA  . CYS B  1 75  ? -15.934 -22.916 -6.475  1.00 71.59  ? 72   CYS B CA  1 
ATOM   3166 C  C   . CYS B  1 75  ? -15.480 -24.317 -6.975  1.00 77.06  ? 72   CYS B C   1 
ATOM   3167 O  O   . CYS B  1 75  ? -15.583 -24.587 -8.182  1.00 75.87  ? 72   CYS B O   1 
ATOM   3168 C  CB  . CYS B  1 75  ? -14.767 -21.940 -6.402  1.00 71.13  ? 72   CYS B CB  1 
ATOM   3169 S  SG  . CYS B  1 75  ? -13.613 -22.060 -7.794  1.00 74.72  ? 72   CYS B SG  1 
ATOM   3170 N  N   . VAL B  1 76  ? -14.971 -25.201 -6.057  1.00 74.67  ? 73   VAL B N   1 
ATOM   3171 C  CA  . VAL B  1 76  ? -14.522 -26.558 -6.452  1.00 75.11  ? 73   VAL B CA  1 
ATOM   3172 C  C   . VAL B  1 76  ? -15.700 -27.410 -6.969  1.00 79.02  ? 73   VAL B C   1 
ATOM   3173 O  O   . VAL B  1 76  ? -15.470 -28.342 -7.734  1.00 80.12  ? 73   VAL B O   1 
ATOM   3174 C  CB  . VAL B  1 76  ? -13.642 -27.351 -5.435  1.00 78.98  ? 73   VAL B CB  1 
ATOM   3175 C  CG1 . VAL B  1 76  ? -12.399 -26.565 -5.036  1.00 78.49  ? 73   VAL B CG1 1 
ATOM   3176 C  CG2 . VAL B  1 76  ? -14.435 -27.788 -4.212  1.00 78.97  ? 73   VAL B CG2 1 
ATOM   3177 N  N   . CYS B  1 77  ? -16.935 -27.087 -6.565  1.00 74.51  ? 74   CYS B N   1 
ATOM   3178 C  CA  . CYS B  1 77  ? -18.127 -27.801 -7.013  1.00 75.19  ? 74   CYS B CA  1 
ATOM   3179 C  C   . CYS B  1 77  ? -18.550 -27.406 -8.437  1.00 77.25  ? 74   CYS B C   1 
ATOM   3180 O  O   . CYS B  1 77  ? -19.342 -28.117 -9.052  1.00 77.20  ? 74   CYS B O   1 
ATOM   3181 C  CB  . CYS B  1 77  ? -19.266 -27.648 -6.007  1.00 76.61  ? 74   CYS B CB  1 
ATOM   3182 S  SG  . CYS B  1 77  ? -18.927 -28.403 -4.393  1.00 81.13  ? 74   CYS B SG  1 
ATOM   3183 N  N   . THR B  1 78  ? -17.997 -26.298 -8.971  1.00 71.66  ? 75   THR B N   1 
ATOM   3184 C  CA  . THR B  1 78  ? -18.268 -25.824 -10.333 1.00 70.31  ? 75   THR B CA  1 
ATOM   3185 C  C   . THR B  1 78  ? -17.155 -26.236 -11.309 1.00 73.11  ? 75   THR B C   1 
ATOM   3186 O  O   . THR B  1 78  ? -17.433 -26.456 -12.488 1.00 72.05  ? 75   THR B O   1 
ATOM   3187 C  CB  . THR B  1 78  ? -18.572 -24.311 -10.375 1.00 73.14  ? 75   THR B CB  1 
ATOM   3188 O  OG1 . THR B  1 78  ? -17.470 -23.575 -9.846  1.00 76.77  ? 75   THR B OG1 1 
ATOM   3189 C  CG2 . THR B  1 78  ? -19.860 -23.947 -9.641  1.00 63.28  ? 75   THR B CG2 1 
ATOM   3190 N  N   . LEU B  1 79  ? -15.908 -26.378 -10.815 1.00 70.37  ? 76   LEU B N   1 
ATOM   3191 C  CA  . LEU B  1 79  ? -14.752 -26.792 -11.624 1.00 70.22  ? 76   LEU B CA  1 
ATOM   3192 C  C   . LEU B  1 79  ? -14.976 -28.110 -12.404 1.00 75.72  ? 76   LEU B C   1 
ATOM   3193 O  O   . LEU B  1 79  ? -14.558 -28.126 -13.565 1.00 75.49  ? 76   LEU B O   1 
ATOM   3194 C  CB  . LEU B  1 79  ? -13.439 -26.846 -10.823 1.00 69.56  ? 76   LEU B CB  1 
ATOM   3195 C  CG  . LEU B  1 79  ? -12.855 -25.537 -10.285 1.00 71.55  ? 76   LEU B CG  1 
ATOM   3196 C  CD1 . LEU B  1 79  ? -11.561 -25.816 -9.547  1.00 71.07  ? 76   LEU B CD1 1 
ATOM   3197 C  CD2 . LEU B  1 79  ? -12.611 -24.525 -11.398 1.00 69.60  ? 76   LEU B CD2 1 
ATOM   3198 N  N   . PRO B  1 80  ? -15.674 -29.178 -11.872 1.00 73.31  ? 77   PRO B N   1 
ATOM   3199 C  CA  . PRO B  1 80  ? -15.949 -30.373 -12.703 1.00 72.90  ? 77   PRO B CA  1 
ATOM   3200 C  C   . PRO B  1 80  ? -16.696 -30.069 -14.012 1.00 76.52  ? 77   PRO B C   1 
ATOM   3201 O  O   . PRO B  1 80  ? -16.478 -30.787 -14.989 1.00 76.59  ? 77   PRO B O   1 
ATOM   3202 C  CB  . PRO B  1 80  ? -16.792 -31.259 -11.775 1.00 74.53  ? 77   PRO B CB  1 
ATOM   3203 C  CG  . PRO B  1 80  ? -16.376 -30.858 -10.403 1.00 79.16  ? 77   PRO B CG  1 
ATOM   3204 C  CD  . PRO B  1 80  ? -16.242 -29.368 -10.518 1.00 74.88  ? 77   PRO B CD  1 
ATOM   3205 N  N   . LEU B  1 81  ? -17.544 -28.998 -14.050 1.00 72.48  ? 78   LEU B N   1 
ATOM   3206 C  CA  . LEU B  1 81  ? -18.255 -28.580 -15.268 1.00 71.72  ? 78   LEU B CA  1 
ATOM   3207 C  C   . LEU B  1 81  ? -17.259 -28.037 -16.298 1.00 77.09  ? 78   LEU B C   1 
ATOM   3208 O  O   . LEU B  1 81  ? -17.378 -28.359 -17.484 1.00 75.99  ? 78   LEU B O   1 
ATOM   3209 C  CB  . LEU B  1 81  ? -19.347 -27.536 -14.992 1.00 71.35  ? 78   LEU B CB  1 
ATOM   3210 C  CG  . LEU B  1 81  ? -20.545 -27.928 -14.120 1.00 75.12  ? 78   LEU B CG  1 
ATOM   3211 C  CD1 . LEU B  1 81  ? -21.530 -26.766 -14.024 1.00 74.60  ? 78   LEU B CD1 1 
ATOM   3212 C  CD2 . LEU B  1 81  ? -21.242 -29.196 -14.631 1.00 74.13  ? 78   LEU B CD2 1 
ATOM   3213 N  N   . ARG B  1 82  ? -16.262 -27.233 -15.833 1.00 75.04  ? 79   ARG B N   1 
ATOM   3214 C  CA  . ARG B  1 82  ? -15.180 -26.697 -16.666 1.00 75.13  ? 79   ARG B CA  1 
ATOM   3215 C  C   . ARG B  1 82  ? -14.402 -27.861 -17.292 1.00 80.82  ? 79   ARG B C   1 
ATOM   3216 O  O   . ARG B  1 82  ? -14.065 -27.774 -18.468 1.00 81.03  ? 79   ARG B O   1 
ATOM   3217 C  CB  . ARG B  1 82  ? -14.218 -25.793 -15.864 1.00 73.39  ? 79   ARG B CB  1 
ATOM   3218 C  CG  . ARG B  1 82  ? -14.801 -24.460 -15.421 1.00 74.49  ? 79   ARG B CG  1 
ATOM   3219 C  CD  . ARG B  1 82  ? -13.737 -23.556 -14.829 1.00 74.89  ? 79   ARG B CD  1 
ATOM   3220 N  NE  . ARG B  1 82  ? -14.286 -22.272 -14.384 1.00 70.48  ? 79   ARG B NE  1 
ATOM   3221 C  CZ  . ARG B  1 82  ? -14.050 -21.103 -14.974 1.00 76.48  ? 79   ARG B CZ  1 
ATOM   3222 N  NH1 . ARG B  1 82  ? -13.252 -21.032 -16.036 1.00 55.15  ? 79   ARG B NH1 1 
ATOM   3223 N  NH2 . ARG B  1 82  ? -14.599 -19.998 -14.503 1.00 69.90  ? 79   ARG B NH2 1 
ATOM   3224 N  N   . VAL B  1 83  ? -14.163 -28.958 -16.522 1.00 78.57  ? 80   VAL B N   1 
ATOM   3225 C  CA  . VAL B  1 83  ? -13.483 -30.201 -16.959 1.00 79.23  ? 80   VAL B CA  1 
ATOM   3226 C  C   . VAL B  1 83  ? -14.256 -30.868 -18.131 1.00 84.24  ? 80   VAL B C   1 
ATOM   3227 O  O   . VAL B  1 83  ? -13.654 -31.157 -19.167 1.00 83.51  ? 80   VAL B O   1 
ATOM   3228 C  CB  . VAL B  1 83  ? -13.213 -31.204 -15.784 1.00 82.68  ? 80   VAL B CB  1 
ATOM   3229 C  CG1 . VAL B  1 83  ? -12.466 -32.441 -16.267 1.00 82.51  ? 80   VAL B CG1 1 
ATOM   3230 C  CG2 . VAL B  1 83  ? -12.456 -30.542 -14.636 1.00 82.32  ? 80   VAL B CG2 1 
ATOM   3231 N  N   . VAL B  1 84  ? -15.590 -31.067 -17.964 1.00 81.78  ? 81   VAL B N   1 
ATOM   3232 C  CA  . VAL B  1 84  ? -16.515 -31.668 -18.949 1.00 81.66  ? 81   VAL B CA  1 
ATOM   3233 C  C   . VAL B  1 84  ? -16.536 -30.874 -20.276 1.00 86.16  ? 81   VAL B C   1 
ATOM   3234 O  O   . VAL B  1 84  ? -16.651 -31.472 -21.349 1.00 86.19  ? 81   VAL B O   1 
ATOM   3235 C  CB  . VAL B  1 84  ? -17.939 -31.872 -18.342 1.00 85.32  ? 81   VAL B CB  1 
ATOM   3236 C  CG1 . VAL B  1 84  ? -18.961 -32.263 -19.408 1.00 85.19  ? 81   VAL B CG1 1 
ATOM   3237 C  CG2 . VAL B  1 84  ? -17.920 -32.906 -17.213 1.00 84.97  ? 81   VAL B CG2 1 
ATOM   3238 N  N   . TYR B  1 85  ? -16.401 -29.539 -20.189 1.00 82.93  ? 82   TYR B N   1 
ATOM   3239 C  CA  . TYR B  1 85  ? -16.376 -28.615 -21.327 1.00 82.84  ? 82   TYR B CA  1 
ATOM   3240 C  C   . TYR B  1 85  ? -15.121 -28.812 -22.208 1.00 88.46  ? 82   TYR B C   1 
ATOM   3241 O  O   . TYR B  1 85  ? -15.243 -28.860 -23.434 1.00 87.89  ? 82   TYR B O   1 
ATOM   3242 C  CB  . TYR B  1 85  ? -16.499 -27.155 -20.822 1.00 83.33  ? 82   TYR B CB  1 
ATOM   3243 C  CG  . TYR B  1 85  ? -16.272 -26.082 -21.868 1.00 83.69  ? 82   TYR B CG  1 
ATOM   3244 C  CD1 . TYR B  1 85  ? -17.272 -25.739 -22.771 1.00 84.92  ? 82   TYR B CD1 1 
ATOM   3245 C  CD2 . TYR B  1 85  ? -15.083 -25.362 -21.908 1.00 84.33  ? 82   TYR B CD2 1 
ATOM   3246 C  CE1 . TYR B  1 85  ? -17.078 -24.741 -23.724 1.00 85.13  ? 82   TYR B CE1 1 
ATOM   3247 C  CE2 . TYR B  1 85  ? -14.872 -24.366 -22.862 1.00 85.25  ? 82   TYR B CE2 1 
ATOM   3248 C  CZ  . TYR B  1 85  ? -15.872 -24.062 -23.774 1.00 91.76  ? 82   TYR B CZ  1 
ATOM   3249 O  OH  . TYR B  1 85  ? -15.677 -23.078 -24.717 1.00 90.40  ? 82   TYR B OH  1 
ATOM   3250 N  N   . TYR B  1 86  ? -13.922 -28.927 -21.586 1.00 85.72  ? 83   TYR B N   1 
ATOM   3251 C  CA  . TYR B  1 86  ? -12.640 -29.080 -22.292 1.00 85.04  ? 83   TYR B CA  1 
ATOM   3252 C  C   . TYR B  1 86  ? -12.387 -30.509 -22.739 1.00 90.04  ? 83   TYR B C   1 
ATOM   3253 O  O   . TYR B  1 86  ? -11.617 -30.735 -23.672 1.00 89.27  ? 83   TYR B O   1 
ATOM   3254 C  CB  . TYR B  1 86  ? -11.473 -28.512 -21.468 1.00 84.99  ? 83   TYR B CB  1 
ATOM   3255 C  CG  . TYR B  1 86  ? -11.598 -27.025 -21.243 1.00 85.58  ? 83   TYR B CG  1 
ATOM   3256 C  CD1 . TYR B  1 86  ? -11.398 -26.124 -22.284 1.00 87.56  ? 83   TYR B CD1 1 
ATOM   3257 C  CD2 . TYR B  1 86  ? -11.942 -26.515 -19.996 1.00 86.18  ? 83   TYR B CD2 1 
ATOM   3258 C  CE1 . TYR B  1 86  ? -11.527 -24.752 -22.087 1.00 89.12  ? 83   TYR B CE1 1 
ATOM   3259 C  CE2 . TYR B  1 86  ? -12.087 -25.144 -19.787 1.00 86.95  ? 83   TYR B CE2 1 
ATOM   3260 C  CZ  . TYR B  1 86  ? -11.877 -24.266 -20.837 1.00 93.86  ? 83   TYR B CZ  1 
ATOM   3261 O  OH  . TYR B  1 86  ? -12.003 -22.913 -20.646 1.00 93.05  ? 83   TYR B OH  1 
ATOM   3262 N  N   . VAL B  1 87  ? -13.059 -31.468 -22.089 1.00 88.23  ? 84   VAL B N   1 
ATOM   3263 C  CA  . VAL B  1 87  ? -13.034 -32.884 -22.453 1.00 88.84  ? 84   VAL B CA  1 
ATOM   3264 C  C   . VAL B  1 87  ? -13.871 -33.032 -23.760 1.00 94.86  ? 84   VAL B C   1 
ATOM   3265 O  O   . VAL B  1 87  ? -13.533 -33.848 -24.622 1.00 94.81  ? 84   VAL B O   1 
ATOM   3266 C  CB  . VAL B  1 87  ? -13.515 -33.769 -21.260 1.00 92.22  ? 84   VAL B CB  1 
ATOM   3267 C  CG1 . VAL B  1 87  ? -14.249 -35.034 -21.711 1.00 91.91  ? 84   VAL B CG1 1 
ATOM   3268 C  CG2 . VAL B  1 87  ? -12.351 -34.110 -20.329 1.00 91.79  ? 84   VAL B CG2 1 
ATOM   3269 N  N   . HIS B  1 88  ? -14.895 -32.165 -23.929 1.00 92.16  ? 85   HIS B N   1 
ATOM   3270 C  CA  . HIS B  1 88  ? -15.781 -32.110 -25.092 1.00 92.51  ? 85   HIS B CA  1 
ATOM   3271 C  C   . HIS B  1 88  ? -15.289 -31.189 -26.216 1.00 96.25  ? 85   HIS B C   1 
ATOM   3272 O  O   . HIS B  1 88  ? -16.081 -30.778 -27.077 1.00 95.10  ? 85   HIS B O   1 
ATOM   3273 C  CB  . HIS B  1 88  ? -17.196 -31.740 -24.648 1.00 94.02  ? 85   HIS B CB  1 
ATOM   3274 C  CG  . HIS B  1 88  ? -18.003 -32.949 -24.360 1.00 98.28  ? 85   HIS B CG  1 
ATOM   3275 N  ND1 . HIS B  1 88  ? -19.034 -33.329 -25.186 1.00 100.53 ? 85   HIS B ND1 1 
ATOM   3276 C  CD2 . HIS B  1 88  ? -17.818 -33.901 -23.414 1.00 100.71 ? 85   HIS B CD2 1 
ATOM   3277 C  CE1 . HIS B  1 88  ? -19.478 -34.474 -24.693 1.00 100.34 ? 85   HIS B CE1 1 
ATOM   3278 N  NE2 . HIS B  1 88  ? -18.771 -34.860 -23.630 1.00 100.59 ? 85   HIS B NE2 1 
ATOM   3279 N  N   . LYS B  1 89  ? -13.969 -30.895 -26.221 1.00 93.80  ? 86   LYS B N   1 
ATOM   3280 C  CA  . LYS B  1 89  ? -13.284 -30.041 -27.203 1.00 93.52  ? 86   LYS B CA  1 
ATOM   3281 C  C   . LYS B  1 89  ? -13.930 -28.633 -27.318 1.00 95.68  ? 86   LYS B C   1 
ATOM   3282 O  O   . LYS B  1 89  ? -14.155 -28.125 -28.423 1.00 95.76  ? 86   LYS B O   1 
ATOM   3283 C  CB  . LYS B  1 89  ? -13.154 -30.758 -28.571 1.00 96.04  ? 86   LYS B CB  1 
ATOM   3284 C  CG  . LYS B  1 89  ? -12.169 -31.931 -28.567 1.00 105.56 ? 86   LYS B CG  1 
ATOM   3285 N  N   . GLY B  1 90  ? -14.229 -28.044 -26.158 1.00 89.79  ? 87   GLY B N   1 
ATOM   3286 C  CA  . GLY B  1 90  ? -14.809 -26.712 -26.037 1.00 88.62  ? 87   GLY B CA  1 
ATOM   3287 C  C   . GLY B  1 90  ? -16.248 -26.541 -26.484 1.00 90.82  ? 87   GLY B C   1 
ATOM   3288 O  O   . GLY B  1 90  ? -16.565 -25.564 -27.164 1.00 90.74  ? 87   GLY B O   1 
ATOM   3289 N  N   . ILE B  1 91  ? -17.140 -27.452 -26.072 1.00 85.95  ? 88   ILE B N   1 
ATOM   3290 C  CA  . ILE B  1 91  ? -18.575 -27.354 -26.377 1.00 85.12  ? 88   ILE B CA  1 
ATOM   3291 C  C   . ILE B  1 91  ? -19.338 -27.336 -25.042 1.00 85.03  ? 88   ILE B C   1 
ATOM   3292 O  O   . ILE B  1 91  ? -19.208 -28.287 -24.258 1.00 83.29  ? 88   ILE B O   1 
ATOM   3293 C  CB  . ILE B  1 91  ? -19.081 -28.484 -27.341 1.00 88.71  ? 88   ILE B CB  1 
ATOM   3294 C  CG1 . ILE B  1 91  ? -18.296 -28.536 -28.692 1.00 89.61  ? 88   ILE B CG1 1 
ATOM   3295 C  CG2 . ILE B  1 91  ? -20.598 -28.402 -27.572 1.00 88.70  ? 88   ILE B CG2 1 
ATOM   3296 C  CD1 . ILE B  1 91  ? -18.257 -27.245 -29.592 1.00 95.93  ? 88   ILE B CD1 1 
ATOM   3297 N  N   . TRP B  1 92  ? -20.085 -26.236 -24.759 1.00 79.24  ? 89   TRP B N   1 
ATOM   3298 C  CA  . TRP B  1 92  ? -20.861 -26.143 -23.514 1.00 77.91  ? 89   TRP B CA  1 
ATOM   3299 C  C   . TRP B  1 92  ? -22.192 -26.853 -23.686 1.00 84.76  ? 89   TRP B C   1 
ATOM   3300 O  O   . TRP B  1 92  ? -22.891 -26.596 -24.672 1.00 85.99  ? 89   TRP B O   1 
ATOM   3301 C  CB  . TRP B  1 92  ? -21.044 -24.699 -23.044 1.00 75.12  ? 89   TRP B CB  1 
ATOM   3302 C  CG  . TRP B  1 92  ? -21.606 -24.600 -21.654 1.00 74.91  ? 89   TRP B CG  1 
ATOM   3303 C  CD1 . TRP B  1 92  ? -22.886 -24.282 -21.310 1.00 77.62  ? 89   TRP B CD1 1 
ATOM   3304 C  CD2 . TRP B  1 92  ? -20.908 -24.846 -20.421 1.00 74.01  ? 89   TRP B CD2 1 
ATOM   3305 N  NE1 . TRP B  1 92  ? -23.034 -24.321 -19.941 1.00 76.77  ? 89   TRP B NE1 1 
ATOM   3306 C  CE2 . TRP B  1 92  ? -21.829 -24.644 -19.369 1.00 78.04  ? 89   TRP B CE2 1 
ATOM   3307 C  CE3 . TRP B  1 92  ? -19.591 -25.214 -20.100 1.00 74.42  ? 89   TRP B CE3 1 
ATOM   3308 C  CZ2 . TRP B  1 92  ? -21.475 -24.805 -18.017 1.00 76.86  ? 89   TRP B CZ2 1 
ATOM   3309 C  CZ3 . TRP B  1 92  ? -19.250 -25.390 -18.765 1.00 75.32  ? 89   TRP B CZ3 1 
ATOM   3310 C  CH2 . TRP B  1 92  ? -20.184 -25.187 -17.741 1.00 75.78  ? 89   TRP B CH2 1 
ATOM   3311 N  N   . LEU B  1 93  ? -22.536 -27.764 -22.757 1.00 81.69  ? 90   LEU B N   1 
ATOM   3312 C  CA  . LEU B  1 93  ? -23.777 -28.530 -22.879 1.00 81.78  ? 90   LEU B CA  1 
ATOM   3313 C  C   . LEU B  1 93  ? -24.698 -28.474 -21.642 1.00 84.85  ? 90   LEU B C   1 
ATOM   3314 O  O   . LEU B  1 93  ? -25.544 -29.354 -21.489 1.00 85.73  ? 90   LEU B O   1 
ATOM   3315 C  CB  . LEU B  1 93  ? -23.478 -29.990 -23.291 1.00 82.05  ? 90   LEU B CB  1 
ATOM   3316 C  CG  . LEU B  1 93  ? -22.378 -30.719 -22.545 1.00 87.78  ? 90   LEU B CG  1 
ATOM   3317 C  CD1 . LEU B  1 93  ? -22.950 -31.587 -21.447 1.00 88.37  ? 90   LEU B CD1 1 
ATOM   3318 C  CD2 . LEU B  1 93  ? -21.557 -31.577 -23.503 1.00 90.85  ? 90   LEU B CD2 1 
ATOM   3319 N  N   . PHE B  1 94  ? -24.595 -27.416 -20.814 1.00 79.52  ? 91   PHE B N   1 
ATOM   3320 C  CA  . PHE B  1 94  ? -25.413 -27.270 -19.597 1.00 78.37  ? 91   PHE B CA  1 
ATOM   3321 C  C   . PHE B  1 94  ? -26.334 -26.029 -19.578 1.00 81.38  ? 91   PHE B C   1 
ATOM   3322 O  O   . PHE B  1 94  ? -27.007 -25.772 -18.573 1.00 80.57  ? 91   PHE B O   1 
ATOM   3323 C  CB  . PHE B  1 94  ? -24.523 -27.299 -18.339 1.00 79.80  ? 91   PHE B CB  1 
ATOM   3324 C  CG  . PHE B  1 94  ? -23.550 -28.451 -18.253 1.00 80.45  ? 91   PHE B CG  1 
ATOM   3325 C  CD1 . PHE B  1 94  ? -23.991 -29.732 -17.944 1.00 83.13  ? 91   PHE B CD1 1 
ATOM   3326 C  CD2 . PHE B  1 94  ? -22.188 -28.248 -18.442 1.00 81.11  ? 91   PHE B CD2 1 
ATOM   3327 C  CE1 . PHE B  1 94  ? -23.090 -30.791 -17.849 1.00 83.62  ? 91   PHE B CE1 1 
ATOM   3328 C  CE2 . PHE B  1 94  ? -21.290 -29.305 -18.344 1.00 83.52  ? 91   PHE B CE2 1 
ATOM   3329 C  CZ  . PHE B  1 94  ? -21.746 -30.569 -18.048 1.00 82.03  ? 91   PHE B CZ  1 
ATOM   3330 N  N   . GLY B  1 95  ? -26.383 -25.295 -20.684 1.00 77.96  ? 92   GLY B N   1 
ATOM   3331 C  CA  . GLY B  1 95  ? -27.213 -24.101 -20.772 1.00 78.54  ? 92   GLY B CA  1 
ATOM   3332 C  C   . GLY B  1 95  ? -26.503 -22.804 -20.404 1.00 85.74  ? 92   GLY B C   1 
ATOM   3333 O  O   . GLY B  1 95  ? -25.365 -22.809 -19.921 1.00 86.43  ? 92   GLY B O   1 
ATOM   3334 N  N   . ASP B  1 96  ? -27.177 -21.676 -20.641 1.00 83.45  ? 93   ASP B N   1 
ATOM   3335 C  CA  . ASP B  1 96  ? -26.656 -20.343 -20.360 1.00 84.20  ? 93   ASP B CA  1 
ATOM   3336 C  C   . ASP B  1 96  ? -26.429 -20.107 -18.874 1.00 87.15  ? 93   ASP B C   1 
ATOM   3337 O  O   . ASP B  1 96  ? -25.347 -19.645 -18.514 1.00 87.27  ? 93   ASP B O   1 
ATOM   3338 C  CB  . ASP B  1 96  ? -27.597 -19.256 -20.920 1.00 87.08  ? 93   ASP B CB  1 
ATOM   3339 C  CG  . ASP B  1 96  ? -27.478 -18.950 -22.406 1.00 104.11 ? 93   ASP B CG  1 
ATOM   3340 O  OD1 . ASP B  1 96  ? -26.561 -19.524 -23.073 1.00 104.48 ? 93   ASP B OD1 1 
ATOM   3341 O  OD2 . ASP B  1 96  ? -28.288 -18.126 -22.907 1.00 113.43 ? 93   ASP B OD2 1 
ATOM   3342 N  N   . PHE B  1 97  ? -27.452 -20.396 -18.016 1.00 81.96  ? 94   PHE B N   1 
ATOM   3343 C  CA  . PHE B  1 97  ? -27.389 -20.164 -16.567 1.00 79.88  ? 94   PHE B CA  1 
ATOM   3344 C  C   . PHE B  1 97  ? -26.164 -20.758 -15.936 1.00 81.37  ? 94   PHE B C   1 
ATOM   3345 O  O   . PHE B  1 97  ? -25.433 -20.022 -15.255 1.00 80.56  ? 94   PHE B O   1 
ATOM   3346 C  CB  . PHE B  1 97  ? -28.657 -20.604 -15.814 1.00 80.94  ? 94   PHE B CB  1 
ATOM   3347 C  CG  . PHE B  1 97  ? -28.615 -20.248 -14.342 1.00 81.85  ? 94   PHE B CG  1 
ATOM   3348 C  CD1 . PHE B  1 97  ? -28.692 -18.919 -13.926 1.00 84.57  ? 94   PHE B CD1 1 
ATOM   3349 C  CD2 . PHE B  1 97  ? -28.471 -21.236 -13.375 1.00 83.24  ? 94   PHE B CD2 1 
ATOM   3350 C  CE1 . PHE B  1 97  ? -28.630 -18.587 -12.569 1.00 85.08  ? 94   PHE B CE1 1 
ATOM   3351 C  CE2 . PHE B  1 97  ? -28.422 -20.903 -12.017 1.00 86.16  ? 94   PHE B CE2 1 
ATOM   3352 C  CZ  . PHE B  1 97  ? -28.505 -19.580 -11.625 1.00 84.16  ? 94   PHE B CZ  1 
ATOM   3353 N  N   . LEU B  1 98  ? -25.914 -22.065 -16.192 1.00 76.82  ? 95   LEU B N   1 
ATOM   3354 C  CA  . LEU B  1 98  ? -24.755 -22.762 -15.643 1.00 76.53  ? 95   LEU B CA  1 
ATOM   3355 C  C   . LEU B  1 98  ? -23.433 -22.242 -16.198 1.00 79.99  ? 95   LEU B C   1 
ATOM   3356 O  O   . LEU B  1 98  ? -22.426 -22.344 -15.501 1.00 79.31  ? 95   LEU B O   1 
ATOM   3357 C  CB  . LEU B  1 98  ? -24.858 -24.281 -15.756 1.00 76.53  ? 95   LEU B CB  1 
ATOM   3358 C  CG  . LEU B  1 98  ? -25.771 -24.925 -14.711 1.00 81.69  ? 95   LEU B CG  1 
ATOM   3359 C  CD1 . LEU B  1 98  ? -26.001 -26.403 -15.019 1.00 82.13  ? 95   LEU B CD1 1 
ATOM   3360 C  CD2 . LEU B  1 98  ? -25.237 -24.731 -13.279 1.00 83.46  ? 95   LEU B CD2 1 
ATOM   3361 N  N   . CYS B  1 99  ? -23.433 -21.634 -17.397 1.00 76.84  ? 96   CYS B N   1 
ATOM   3362 C  CA  . CYS B  1 99  ? -22.206 -21.034 -17.919 1.00 77.31  ? 96   CYS B CA  1 
ATOM   3363 C  C   . CYS B  1 99  ? -21.862 -19.768 -17.123 1.00 78.84  ? 96   CYS B C   1 
ATOM   3364 O  O   . CYS B  1 99  ? -20.711 -19.591 -16.712 1.00 77.39  ? 96   CYS B O   1 
ATOM   3365 C  CB  . CYS B  1 99  ? -22.299 -20.745 -19.415 1.00 78.24  ? 96   CYS B CB  1 
ATOM   3366 S  SG  . CYS B  1 99  ? -20.889 -19.807 -20.064 1.00 82.37  ? 96   CYS B SG  1 
ATOM   3367 N  N   A ARG B  1 100 ? -22.869 -18.903 -16.911 0.50 75.46  ? 97   ARG B N   1 
ATOM   3368 N  N   B ARG B  1 100 ? -22.866 -18.907 -16.907 0.50 75.49  ? 97   ARG B N   1 
ATOM   3369 C  CA  A ARG B  1 100 ? -22.758 -17.654 -16.158 0.50 75.32  ? 97   ARG B CA  1 
ATOM   3370 C  CA  B ARG B  1 100 ? -22.734 -17.655 -16.167 0.50 75.38  ? 97   ARG B CA  1 
ATOM   3371 C  C   A ARG B  1 100 ? -22.407 -17.949 -14.705 0.50 78.34  ? 97   ARG B C   1 
ATOM   3372 C  C   B ARG B  1 100 ? -22.428 -17.927 -14.695 0.50 78.40  ? 97   ARG B C   1 
ATOM   3373 O  O   A ARG B  1 100 ? -21.518 -17.302 -14.148 0.50 78.29  ? 97   ARG B O   1 
ATOM   3374 O  O   B ARG B  1 100 ? -21.578 -17.249 -14.118 0.50 78.39  ? 97   ARG B O   1 
ATOM   3375 C  CB  A ARG B  1 100 ? -24.067 -16.855 -16.243 0.50 75.97  ? 97   ARG B CB  1 
ATOM   3376 C  CB  B ARG B  1 100 ? -23.982 -16.778 -16.347 0.50 76.09  ? 97   ARG B CB  1 
ATOM   3377 C  CG  A ARG B  1 100 ? -24.314 -16.255 -17.615 0.50 89.29  ? 97   ARG B CG  1 
ATOM   3378 C  CG  B ARG B  1 100 ? -24.293 -16.492 -17.813 0.50 89.57  ? 97   ARG B CG  1 
ATOM   3379 C  CD  A ARG B  1 100 ? -25.789 -16.024 -17.857 0.50 102.44 ? 97   ARG B CD  1 
ATOM   3380 C  CD  B ARG B  1 100 ? -25.257 -15.342 -17.982 0.50 103.55 ? 97   ARG B CD  1 
ATOM   3381 N  NE  A ARG B  1 100 ? -26.050 -15.638 -19.242 0.50 110.75 ? 97   ARG B NE  1 
ATOM   3382 N  NE  B ARG B  1 100 ? -26.198 -15.564 -19.077 0.50 112.88 ? 97   ARG B NE  1 
ATOM   3383 C  CZ  A ARG B  1 100 ? -27.261 -15.493 -19.764 0.50 124.42 ? 97   ARG B CZ  1 
ATOM   3384 C  CZ  B ARG B  1 100 ? -27.501 -15.763 -18.913 0.50 128.00 ? 97   ARG B CZ  1 
ATOM   3385 N  NH1 A ARG B  1 100 ? -28.341 -15.701 -19.020 0.50 116.61 ? 97   ARG B NH1 1 
ATOM   3386 N  NH1 B ARG B  1 100 ? -28.034 -15.754 -17.696 0.50 111.82 ? 97   ARG B NH1 1 
ATOM   3387 N  NH2 A ARG B  1 100 ? -27.404 -15.142 -21.033 0.50 107.08 ? 97   ARG B NH2 1 
ATOM   3388 N  NH2 B ARG B  1 100 ? -28.284 -15.964 -19.965 0.50 119.52 ? 97   ARG B NH2 1 
ATOM   3389 N  N   . LEU B  1 101 ? -23.075 -18.952 -14.112 1.00 73.56  ? 98   LEU B N   1 
ATOM   3390 C  CA  . LEU B  1 101 ? -22.857 -19.359 -12.729 1.00 72.42  ? 98   LEU B CA  1 
ATOM   3391 C  C   . LEU B  1 101 ? -21.445 -19.929 -12.504 1.00 75.15  ? 98   LEU B C   1 
ATOM   3392 O  O   . LEU B  1 101 ? -20.863 -19.662 -11.453 1.00 75.18  ? 98   LEU B O   1 
ATOM   3393 C  CB  . LEU B  1 101 ? -23.923 -20.356 -12.267 1.00 72.20  ? 98   LEU B CB  1 
ATOM   3394 C  CG  . LEU B  1 101 ? -24.012 -20.545 -10.752 1.00 77.44  ? 98   LEU B CG  1 
ATOM   3395 C  CD1 . LEU B  1 101 ? -24.590 -19.310 -10.057 1.00 77.61  ? 98   LEU B CD1 1 
ATOM   3396 C  CD2 . LEU B  1 101 ? -24.787 -21.793 -10.406 1.00 81.23  ? 98   LEU B CD2 1 
ATOM   3397 N  N   . SER B  1 102 ? -20.891 -20.687 -13.480 1.00 69.61  ? 99   SER B N   1 
ATOM   3398 C  CA  . SER B  1 102 ? -19.537 -21.242 -13.370 1.00 68.51  ? 99   SER B CA  1 
ATOM   3399 C  C   . SER B  1 102 ? -18.475 -20.151 -13.461 1.00 71.90  ? 99   SER B C   1 
ATOM   3400 O  O   . SER B  1 102 ? -17.463 -20.236 -12.762 1.00 72.56  ? 99   SER B O   1 
ATOM   3401 C  CB  . SER B  1 102 ? -19.293 -22.322 -14.415 1.00 71.53  ? 99   SER B CB  1 
ATOM   3402 O  OG  . SER B  1 102 ? -19.939 -23.524 -14.035 1.00 79.32  ? 99   SER B OG  1 
ATOM   3403 N  N   . THR B  1 103 ? -18.719 -19.111 -14.292 1.00 66.68  ? 100  THR B N   1 
ATOM   3404 C  CA  . THR B  1 103 ? -17.811 -17.979 -14.453 1.00 65.41  ? 100  THR B CA  1 
ATOM   3405 C  C   . THR B  1 103 ? -17.779 -17.135 -13.165 1.00 69.32  ? 100  THR B C   1 
ATOM   3406 O  O   . THR B  1 103 ? -16.699 -16.841 -12.643 1.00 71.53  ? 100  THR B O   1 
ATOM   3407 C  CB  . THR B  1 103 ? -18.199 -17.138 -15.675 1.00 65.71  ? 100  THR B CB  1 
ATOM   3408 O  OG1 . THR B  1 103 ? -18.199 -17.954 -16.847 1.00 61.34  ? 100  THR B OG1 1 
ATOM   3409 C  CG2 . THR B  1 103 ? -17.260 -15.962 -15.883 1.00 61.65  ? 100  THR B CG2 1 
ATOM   3410 N  N   . TYR B  1 104 ? -18.969 -16.758 -12.673 1.00 61.80  ? 101  TYR B N   1 
ATOM   3411 C  CA  . TYR B  1 104 ? -19.203 -15.964 -11.467 1.00 59.94  ? 101  TYR B CA  1 
ATOM   3412 C  C   . TYR B  1 104 ? -18.544 -16.601 -10.242 1.00 63.44  ? 101  TYR B C   1 
ATOM   3413 O  O   . TYR B  1 104 ? -17.837 -15.907 -9.513  1.00 64.30  ? 101  TYR B O   1 
ATOM   3414 C  CB  . TYR B  1 104 ? -20.715 -15.828 -11.259 1.00 59.65  ? 101  TYR B CB  1 
ATOM   3415 C  CG  . TYR B  1 104 ? -21.149 -15.060 -10.035 1.00 59.72  ? 101  TYR B CG  1 
ATOM   3416 C  CD1 . TYR B  1 104 ? -21.018 -13.670 -9.975  1.00 60.99  ? 101  TYR B CD1 1 
ATOM   3417 C  CD2 . TYR B  1 104 ? -21.794 -15.701 -8.982  1.00 59.71  ? 101  TYR B CD2 1 
ATOM   3418 C  CE1 . TYR B  1 104 ? -21.476 -12.945 -8.874  1.00 59.34  ? 101  TYR B CE1 1 
ATOM   3419 C  CE2 . TYR B  1 104 ? -22.263 -14.985 -7.879  1.00 60.15  ? 101  TYR B CE2 1 
ATOM   3420 C  CZ  . TYR B  1 104 ? -22.109 -13.605 -7.835  1.00 64.97  ? 101  TYR B CZ  1 
ATOM   3421 O  OH  . TYR B  1 104 ? -22.567 -12.897 -6.748  1.00 63.29  ? 101  TYR B OH  1 
ATOM   3422 N  N   . ALA B  1 105 ? -18.746 -17.924 -10.046 1.00 58.47  ? 102  ALA B N   1 
ATOM   3423 C  CA  . ALA B  1 105 ? -18.202 -18.709 -8.935  1.00 57.25  ? 102  ALA B CA  1 
ATOM   3424 C  C   . ALA B  1 105 ? -16.711 -18.534 -8.804  1.00 59.81  ? 102  ALA B C   1 
ATOM   3425 O  O   . ALA B  1 105 ? -16.248 -18.343 -7.691  1.00 59.84  ? 102  ALA B O   1 
ATOM   3426 C  CB  . ALA B  1 105 ? -18.540 -20.186 -9.099  1.00 57.60  ? 102  ALA B CB  1 
ATOM   3427 N  N   . LEU B  1 106 ? -15.958 -18.532 -9.919  1.00 55.67  ? 103  LEU B N   1 
ATOM   3428 C  CA  . LEU B  1 106 ? -14.510 -18.412 -9.805  1.00 55.34  ? 103  LEU B CA  1 
ATOM   3429 C  C   . LEU B  1 106 ? -14.070 -17.051 -9.322  1.00 57.95  ? 103  LEU B C   1 
ATOM   3430 O  O   . LEU B  1 106 ? -13.200 -16.989 -8.451  1.00 57.54  ? 103  LEU B O   1 
ATOM   3431 C  CB  . LEU B  1 106 ? -13.773 -18.824 -11.087 1.00 56.05  ? 103  LEU B CB  1 
ATOM   3432 C  CG  . LEU B  1 106 ? -12.225 -18.703 -11.094 1.00 61.42  ? 103  LEU B CG  1 
ATOM   3433 C  CD1 . LEU B  1 106 ? -11.581 -19.561 -10.020 1.00 61.90  ? 103  LEU B CD1 1 
ATOM   3434 C  CD2 . LEU B  1 106 ? -11.660 -19.101 -12.439 1.00 63.07  ? 103  LEU B CD2 1 
ATOM   3435 N  N   . TYR B  1 107 ? -14.692 -15.969 -9.840  1.00 54.01  ? 104  TYR B N   1 
ATOM   3436 C  CA  . TYR B  1 107 ? -14.345 -14.589 -9.460  1.00 52.94  ? 104  TYR B CA  1 
ATOM   3437 C  C   . TYR B  1 107 ? -14.745 -14.257 -8.012  1.00 56.96  ? 104  TYR B C   1 
ATOM   3438 O  O   . TYR B  1 107 ? -13.995 -13.569 -7.308  1.00 56.40  ? 104  TYR B O   1 
ATOM   3439 C  CB  . TYR B  1 107 ? -14.879 -13.577 -10.481 1.00 53.49  ? 104  TYR B CB  1 
ATOM   3440 C  CG  . TYR B  1 107 ? -14.277 -13.780 -11.862 1.00 55.14  ? 104  TYR B CG  1 
ATOM   3441 C  CD1 . TYR B  1 107 ? -12.901 -13.876 -12.040 1.00 56.36  ? 104  TYR B CD1 1 
ATOM   3442 C  CD2 . TYR B  1 107 ? -15.087 -13.889 -12.991 1.00 56.31  ? 104  TYR B CD2 1 
ATOM   3443 C  CE1 . TYR B  1 107 ? -12.348 -14.112 -13.298 1.00 56.08  ? 104  TYR B CE1 1 
ATOM   3444 C  CE2 . TYR B  1 107 ? -14.541 -14.104 -14.258 1.00 56.61  ? 104  TYR B CE2 1 
ATOM   3445 C  CZ  . TYR B  1 107 ? -13.171 -14.211 -14.407 1.00 62.44  ? 104  TYR B CZ  1 
ATOM   3446 O  OH  . TYR B  1 107 ? -12.627 -14.413 -15.655 1.00 62.92  ? 104  TYR B OH  1 
ATOM   3447 N  N   . VAL B  1 108 ? -15.865 -14.822 -7.544  1.00 54.72  ? 105  VAL B N   1 
ATOM   3448 C  CA  . VAL B  1 108 ? -16.332 -14.661 -6.162  1.00 54.93  ? 105  VAL B CA  1 
ATOM   3449 C  C   . VAL B  1 108 ? -15.309 -15.335 -5.202  1.00 58.64  ? 105  VAL B C   1 
ATOM   3450 O  O   . VAL B  1 108 ? -14.818 -14.671 -4.285  1.00 59.01  ? 105  VAL B O   1 
ATOM   3451 C  CB  . VAL B  1 108 ? -17.813 -15.128 -5.957  1.00 58.71  ? 105  VAL B CB  1 
ATOM   3452 C  CG1 . VAL B  1 108 ? -18.185 -15.184 -4.475  1.00 57.99  ? 105  VAL B CG1 1 
ATOM   3453 C  CG2 . VAL B  1 108 ? -18.776 -14.210 -6.709  1.00 58.67  ? 105  VAL B CG2 1 
ATOM   3454 N  N   . ASN B  1 109 ? -14.934 -16.603 -5.473  1.00 53.32  ? 106  ASN B N   1 
ATOM   3455 C  CA  . ASN B  1 109 ? -13.952 -17.352 -4.689  1.00 53.17  ? 106  ASN B CA  1 
ATOM   3456 C  C   . ASN B  1 109 ? -12.607 -16.622 -4.648  1.00 58.33  ? 106  ASN B C   1 
ATOM   3457 O  O   . ASN B  1 109 ? -12.010 -16.513 -3.569  1.00 59.45  ? 106  ASN B O   1 
ATOM   3458 C  CB  . ASN B  1 109 ? -13.764 -18.758 -5.287  1.00 52.89  ? 106  ASN B CB  1 
ATOM   3459 C  CG  . ASN B  1 109 ? -12.465 -19.438 -4.935  1.00 68.22  ? 106  ASN B CG  1 
ATOM   3460 O  OD1 . ASN B  1 109 ? -11.570 -19.602 -5.770  1.00 68.81  ? 106  ASN B OD1 1 
ATOM   3461 N  ND2 . ASN B  1 109 ? -12.321 -19.819 -3.684  1.00 54.90  ? 106  ASN B ND2 1 
ATOM   3462 N  N   . LEU B  1 110 ? -12.127 -16.135 -5.822  1.00 52.83  ? 107  LEU B N   1 
ATOM   3463 C  CA  . LEU B  1 110 ? -10.844 -15.445 -5.939  1.00 52.12  ? 107  LEU B CA  1 
ATOM   3464 C  C   . LEU B  1 110 ? -10.770 -14.148 -5.133  1.00 55.52  ? 107  LEU B C   1 
ATOM   3465 O  O   . LEU B  1 110 ? -9.819  -13.968 -4.378  1.00 54.08  ? 107  LEU B O   1 
ATOM   3466 C  CB  . LEU B  1 110 ? -10.499 -15.201 -7.412  1.00 52.29  ? 107  LEU B CB  1 
ATOM   3467 C  CG  . LEU B  1 110 ? -9.135  -14.607 -7.723  1.00 57.40  ? 107  LEU B CG  1 
ATOM   3468 C  CD1 . LEU B  1 110 ? -8.029  -15.692 -7.671  1.00 57.57  ? 107  LEU B CD1 1 
ATOM   3469 C  CD2 . LEU B  1 110 ? -9.165  -13.949 -9.074  1.00 60.24  ? 107  LEU B CD2 1 
ATOM   3470 N  N   . TYR B  1 111 ? -11.780 -13.254 -5.267  1.00 52.71  ? 108  TYR B N   1 
ATOM   3471 C  CA  . TYR B  1 111 ? -11.775 -11.985 -4.537  1.00 51.35  ? 108  TYR B CA  1 
ATOM   3472 C  C   . TYR B  1 111 ? -12.196 -12.135 -3.062  1.00 56.67  ? 108  TYR B C   1 
ATOM   3473 O  O   . TYR B  1 111 ? -11.706 -11.373 -2.236  1.00 56.81  ? 108  TYR B O   1 
ATOM   3474 C  CB  . TYR B  1 111 ? -12.558 -10.914 -5.295  1.00 50.28  ? 108  TYR B CB  1 
ATOM   3475 C  CG  . TYR B  1 111 ? -11.805 -10.499 -6.542  1.00 48.43  ? 108  TYR B CG  1 
ATOM   3476 C  CD1 . TYR B  1 111 ? -10.612 -9.775  -6.454  1.00 48.68  ? 108  TYR B CD1 1 
ATOM   3477 C  CD2 . TYR B  1 111 ? -12.217 -10.923 -7.801  1.00 48.84  ? 108  TYR B CD2 1 
ATOM   3478 C  CE1 . TYR B  1 111 ? -9.876  -9.448  -7.592  1.00 45.86  ? 108  TYR B CE1 1 
ATOM   3479 C  CE2 . TYR B  1 111 ? -11.511 -10.568 -8.951  1.00 49.30  ? 108  TYR B CE2 1 
ATOM   3480 C  CZ  . TYR B  1 111 ? -10.341 -9.831  -8.839  1.00 52.74  ? 108  TYR B CZ  1 
ATOM   3481 O  OH  . TYR B  1 111 ? -9.664  -9.451  -9.968  1.00 53.98  ? 108  TYR B OH  1 
ATOM   3482 N  N   . CYS B  1 112 ? -13.017 -13.147 -2.722  1.00 55.35  ? 109  CYS B N   1 
ATOM   3483 C  CA  . CYS B  1 112 ? -13.356 -13.463 -1.329  1.00 56.69  ? 109  CYS B CA  1 
ATOM   3484 C  C   . CYS B  1 112 ? -12.068 -13.919 -0.602  1.00 61.03  ? 109  CYS B C   1 
ATOM   3485 O  O   . CYS B  1 112 ? -11.787 -13.401 0.477   1.00 60.77  ? 109  CYS B O   1 
ATOM   3486 C  CB  . CYS B  1 112 ? -14.448 -14.529 -1.232  1.00 57.39  ? 109  CYS B CB  1 
ATOM   3487 S  SG  . CYS B  1 112 ? -16.123 -13.866 -1.175  1.00 62.01  ? 109  CYS B SG  1 
ATOM   3488 N  N   . SER B  1 113 ? -11.285 -14.864 -1.205  1.00 56.50  ? 110  SER B N   1 
ATOM   3489 C  CA  . SER B  1 113 ? -10.040 -15.395 -0.621  1.00 55.68  ? 110  SER B CA  1 
ATOM   3490 C  C   . SER B  1 113 ? -8.995  -14.317 -0.361  1.00 57.31  ? 110  SER B C   1 
ATOM   3491 O  O   . SER B  1 113 ? -8.388  -14.310 0.710   1.00 56.01  ? 110  SER B O   1 
ATOM   3492 C  CB  . SER B  1 113 ? -9.468  -16.537 -1.459  1.00 59.60  ? 110  SER B CB  1 
ATOM   3493 O  OG  . SER B  1 113 ? -10.380 -17.619 -1.560  1.00 67.39  ? 110  SER B OG  1 
ATOM   3494 N  N   . ILE B  1 114 ? -8.837  -13.371 -1.312  1.00 54.66  ? 111  ILE B N   1 
ATOM   3495 C  CA  . ILE B  1 114 ? -7.923  -12.217 -1.197  1.00 54.01  ? 111  ILE B CA  1 
ATOM   3496 C  C   . ILE B  1 114 ? -8.354  -11.359 0.004   1.00 59.23  ? 111  ILE B C   1 
ATOM   3497 O  O   . ILE B  1 114 ? -7.509  -11.036 0.832   1.00 61.37  ? 111  ILE B O   1 
ATOM   3498 C  CB  . ILE B  1 114 ? -7.797  -11.393 -2.535  1.00 56.31  ? 111  ILE B CB  1 
ATOM   3499 C  CG1 . ILE B  1 114 ? -7.081  -12.210 -3.628  1.00 55.59  ? 111  ILE B CG1 1 
ATOM   3500 C  CG2 . ILE B  1 114 ? -7.075  -10.060 -2.327  1.00 57.41  ? 111  ILE B CG2 1 
ATOM   3501 C  CD1 . ILE B  1 114 ? -7.218  -11.671 -5.027  1.00 54.86  ? 111  ILE B CD1 1 
ATOM   3502 N  N   . PHE B  1 115 ? -9.658  -11.056 0.139   1.00 55.02  ? 112  PHE B N   1 
ATOM   3503 C  CA  . PHE B  1 115 ? -10.161 -10.233 1.242   1.00 55.52  ? 112  PHE B CA  1 
ATOM   3504 C  C   . PHE B  1 115 ? -10.109 -10.912 2.627   1.00 60.21  ? 112  PHE B C   1 
ATOM   3505 O  O   . PHE B  1 115 ? -9.799  -10.227 3.606   1.00 59.87  ? 112  PHE B O   1 
ATOM   3506 C  CB  . PHE B  1 115 ? -11.553 -9.701  0.937   1.00 57.52  ? 112  PHE B CB  1 
ATOM   3507 C  CG  . PHE B  1 115 ? -11.608 -8.659  -0.163  1.00 60.30  ? 112  PHE B CG  1 
ATOM   3508 C  CD1 . PHE B  1 115 ? -10.531 -7.824  -0.411  1.00 64.00  ? 112  PHE B CD1 1 
ATOM   3509 C  CD2 . PHE B  1 115 ? -12.776 -8.451  -0.889  1.00 64.46  ? 112  PHE B CD2 1 
ATOM   3510 C  CE1 . PHE B  1 115 ? -10.607 -6.830  -1.396  1.00 65.73  ? 112  PHE B CE1 1 
ATOM   3511 C  CE2 . PHE B  1 115 ? -12.855 -7.440  -1.861  1.00 67.40  ? 112  PHE B CE2 1 
ATOM   3512 C  CZ  . PHE B  1 115 ? -11.767 -6.648  -2.119  1.00 64.82  ? 112  PHE B CZ  1 
ATOM   3513 N  N   . PHE B  1 116 ? -10.379 -12.242 2.711   1.00 57.55  ? 113  PHE B N   1 
ATOM   3514 C  CA  . PHE B  1 116 ? -10.332 -12.998 3.973   1.00 57.52  ? 113  PHE B CA  1 
ATOM   3515 C  C   . PHE B  1 116 ? -8.895  -13.116 4.460   1.00 63.52  ? 113  PHE B C   1 
ATOM   3516 O  O   . PHE B  1 116 ? -8.663  -12.948 5.659   1.00 63.37  ? 113  PHE B O   1 
ATOM   3517 C  CB  . PHE B  1 116 ? -10.990 -14.395 3.867   1.00 59.10  ? 113  PHE B CB  1 
ATOM   3518 C  CG  . PHE B  1 116 ? -12.487 -14.466 3.624   1.00 60.72  ? 113  PHE B CG  1 
ATOM   3519 C  CD1 . PHE B  1 116 ? -13.363 -13.619 4.300   1.00 64.34  ? 113  PHE B CD1 1 
ATOM   3520 C  CD2 . PHE B  1 116 ? -13.022 -15.409 2.751   1.00 62.54  ? 113  PHE B CD2 1 
ATOM   3521 C  CE1 . PHE B  1 116 ? -14.738 -13.688 4.077   1.00 65.22  ? 113  PHE B CE1 1 
ATOM   3522 C  CE2 . PHE B  1 116 ? -14.397 -15.471 2.517   1.00 65.50  ? 113  PHE B CE2 1 
ATOM   3523 C  CZ  . PHE B  1 116 ? -15.245 -14.607 3.177   1.00 64.21  ? 113  PHE B CZ  1 
ATOM   3524 N  N   . MET B  1 117 ? -7.924  -13.373 3.533   1.00 60.39  ? 114  MET B N   1 
ATOM   3525 C  CA  . MET B  1 117 ? -6.491  -13.450 3.867   1.00 59.43  ? 114  MET B CA  1 
ATOM   3526 C  C   . MET B  1 117 ? -5.976  -12.099 4.394   1.00 63.49  ? 114  MET B C   1 
ATOM   3527 O  O   . MET B  1 117 ? -5.234  -12.090 5.375   1.00 63.08  ? 114  MET B O   1 
ATOM   3528 C  CB  . MET B  1 117 ? -5.645  -13.948 2.679   1.00 61.33  ? 114  MET B CB  1 
ATOM   3529 C  CG  . MET B  1 117 ? -5.739  -15.453 2.448   1.00 64.48  ? 114  MET B CG  1 
ATOM   3530 S  SD  . MET B  1 117 ? -4.679  -16.046 1.091   1.00 68.10  ? 114  MET B SD  1 
ATOM   3531 C  CE  . MET B  1 117 ? -4.631  -17.757 1.432   1.00 64.77  ? 114  MET B CE  1 
ATOM   3532 N  N   . THR B  1 118 ? -6.423  -10.964 3.778   1.00 61.07  ? 115  THR B N   1 
ATOM   3533 C  CA  . THR B  1 118 ? -6.068  -9.589  4.179   1.00 61.35  ? 115  THR B CA  1 
ATOM   3534 C  C   . THR B  1 118 ? -6.586  -9.292  5.609   1.00 65.72  ? 115  THR B C   1 
ATOM   3535 O  O   . THR B  1 118 ? -5.828  -8.796  6.457   1.00 64.82  ? 115  THR B O   1 
ATOM   3536 C  CB  . THR B  1 118 ? -6.569  -8.545  3.141   1.00 67.40  ? 115  THR B CB  1 
ATOM   3537 O  OG1 . THR B  1 118 ? -6.158  -8.918  1.824   1.00 62.33  ? 115  THR B OG1 1 
ATOM   3538 C  CG2 . THR B  1 118 ? -6.071  -7.125  3.444   1.00 66.97  ? 115  THR B CG2 1 
ATOM   3539 N  N   . ALA B  1 119 ? -7.877  -9.606  5.854   1.00 62.55  ? 116  ALA B N   1 
ATOM   3540 C  CA  . ALA B  1 119 ? -8.557  -9.409  7.129   1.00 62.51  ? 116  ALA B CA  1 
ATOM   3541 C  C   . ALA B  1 119 ? -7.913  -10.232 8.246   1.00 67.43  ? 116  ALA B C   1 
ATOM   3542 O  O   . ALA B  1 119 ? -7.761  -9.736  9.354   1.00 66.34  ? 116  ALA B O   1 
ATOM   3543 C  CB  . ALA B  1 119 ? -10.028 -9.748  6.981   1.00 63.11  ? 116  ALA B CB  1 
ATOM   3544 N  N   . MET B  1 120 ? -7.486  -11.462 7.932   1.00 67.00  ? 117  MET B N   1 
ATOM   3545 C  CA  . MET B  1 120 ? -6.810  -12.394 8.841   1.00 68.03  ? 117  MET B CA  1 
ATOM   3546 C  C   . MET B  1 120 ? -5.442  -11.828 9.244   1.00 73.24  ? 117  MET B C   1 
ATOM   3547 O  O   . MET B  1 120 ? -5.112  -11.815 10.436  1.00 73.44  ? 117  MET B O   1 
ATOM   3548 C  CB  . MET B  1 120 ? -6.658  -13.756 8.147   1.00 70.82  ? 117  MET B CB  1 
ATOM   3549 C  CG  . MET B  1 120 ? -5.939  -14.817 8.962   1.00 75.46  ? 117  MET B CG  1 
ATOM   3550 S  SD  . MET B  1 120 ? -5.580  -16.278 7.952   1.00 79.93  ? 117  MET B SD  1 
ATOM   3551 C  CE  . MET B  1 120 ? -7.190  -16.997 7.858   1.00 76.37  ? 117  MET B CE  1 
ATOM   3552 N  N   . SER B  1 121 ? -4.660  -11.353 8.246   1.00 69.67  ? 118  SER B N   1 
ATOM   3553 C  CA  . SER B  1 121 ? -3.333  -10.760 8.435   1.00 68.87  ? 118  SER B CA  1 
ATOM   3554 C  C   . SER B  1 121 ? -3.421  -9.502  9.279   1.00 74.83  ? 118  SER B C   1 
ATOM   3555 O  O   . SER B  1 121 ? -2.629  -9.348  10.208  1.00 74.59  ? 118  SER B O   1 
ATOM   3556 C  CB  . SER B  1 121 ? -2.698  -10.437 7.091   1.00 70.79  ? 118  SER B CB  1 
ATOM   3557 O  OG  . SER B  1 121 ? -2.614  -11.596 6.283   1.00 77.29  ? 118  SER B OG  1 
ATOM   3558 N  N   . PHE B  1 122 ? -4.402  -8.617  8.978   1.00 73.22  ? 119  PHE B N   1 
ATOM   3559 C  CA  . PHE B  1 122 ? -4.623  -7.371  9.712   1.00 74.16  ? 119  PHE B CA  1 
ATOM   3560 C  C   . PHE B  1 122 ? -4.903  -7.625  11.196  1.00 79.37  ? 119  PHE B C   1 
ATOM   3561 O  O   . PHE B  1 122 ? -4.337  -6.947  12.054  1.00 78.41  ? 119  PHE B O   1 
ATOM   3562 C  CB  . PHE B  1 122 ? -5.752  -6.543  9.081   1.00 76.45  ? 119  PHE B CB  1 
ATOM   3563 C  CG  . PHE B  1 122 ? -5.811  -5.133  9.618   1.00 78.97  ? 119  PHE B CG  1 
ATOM   3564 C  CD1 . PHE B  1 122 ? -5.003  -4.131  9.083   1.00 83.86  ? 119  PHE B CD1 1 
ATOM   3565 C  CD2 . PHE B  1 122 ? -6.657  -4.807  10.670  1.00 81.71  ? 119  PHE B CD2 1 
ATOM   3566 C  CE1 . PHE B  1 122 ? -5.049  -2.823  9.587   1.00 85.20  ? 119  PHE B CE1 1 
ATOM   3567 C  CE2 . PHE B  1 122 ? -6.704  -3.499  11.176  1.00 85.51  ? 119  PHE B CE2 1 
ATOM   3568 C  CZ  . PHE B  1 122 ? -5.899  -2.515  10.633  1.00 83.95  ? 119  PHE B CZ  1 
ATOM   3569 N  N   . PHE B  1 123 ? -5.762  -8.619  11.485  1.00 77.94  ? 120  PHE B N   1 
ATOM   3570 C  CA  . PHE B  1 123 ? -6.147  -9.017  12.839  1.00 78.26  ? 120  PHE B CA  1 
ATOM   3571 C  C   . PHE B  1 123 ? -4.961  -9.573  13.627  1.00 84.97  ? 120  PHE B C   1 
ATOM   3572 O  O   . PHE B  1 123 ? -4.706  -9.119  14.749  1.00 84.84  ? 120  PHE B O   1 
ATOM   3573 C  CB  . PHE B  1 123 ? -7.343  -9.989  12.801  1.00 79.28  ? 120  PHE B CB  1 
ATOM   3574 C  CG  . PHE B  1 123 ? -8.709  -9.331  12.854  1.00 80.14  ? 120  PHE B CG  1 
ATOM   3575 C  CD1 . PHE B  1 123 ? -8.953  -8.132  12.186  1.00 82.52  ? 120  PHE B CD1 1 
ATOM   3576 C  CD2 . PHE B  1 123 ? -9.760  -9.930  13.537  1.00 81.33  ? 120  PHE B CD2 1 
ATOM   3577 C  CE1 . PHE B  1 123 ? -10.212 -7.536  12.224  1.00 83.01  ? 120  PHE B CE1 1 
ATOM   3578 C  CE2 . PHE B  1 123 ? -11.021 -9.332  13.573  1.00 83.71  ? 120  PHE B CE2 1 
ATOM   3579 C  CZ  . PHE B  1 123 ? -11.236 -8.137  12.923  1.00 81.95  ? 120  PHE B CZ  1 
ATOM   3580 N  N   . ARG B  1 124 ? -4.197  -10.496 13.010  1.00 83.04  ? 121  ARG B N   1 
ATOM   3581 C  CA  . ARG B  1 124 ? -3.002  -11.093 13.608  1.00 83.70  ? 121  ARG B CA  1 
ATOM   3582 C  C   . ARG B  1 124 ? -1.912  -10.040 13.891  1.00 89.85  ? 121  ARG B C   1 
ATOM   3583 O  O   . ARG B  1 124 ? -1.204  -10.156 14.890  1.00 89.87  ? 121  ARG B O   1 
ATOM   3584 C  CB  . ARG B  1 124 ? -2.471  -12.244 12.730  1.00 84.56  ? 121  ARG B CB  1 
ATOM   3585 C  CG  . ARG B  1 124 ? -1.510  -13.206 13.438  1.00 97.43  ? 121  ARG B CG  1 
ATOM   3586 C  CD  . ARG B  1 124 ? -2.178  -14.078 14.500  1.00 109.56 ? 121  ARG B CD  1 
ATOM   3587 N  NE  . ARG B  1 124 ? -2.946  -15.195 13.937  1.00 117.05 ? 121  ARG B NE  1 
ATOM   3588 C  CZ  . ARG B  1 124 ? -2.430  -16.384 13.637  1.00 130.84 ? 121  ARG B CZ  1 
ATOM   3589 N  NH1 . ARG B  1 124 ? -3.203  -17.344 13.150  1.00 114.26 ? 121  ARG B NH1 1 
ATOM   3590 N  NH2 . ARG B  1 124 ? -1.138  -16.621 13.821  1.00 122.97 ? 121  ARG B NH2 1 
ATOM   3591 N  N   . CYS B  1 125 ? -1.816  -8.996  13.036  1.00 87.51  ? 122  CYS B N   1 
ATOM   3592 C  CA  . CYS B  1 125 ? -0.878  -7.879  13.180  1.00 86.84  ? 122  CYS B CA  1 
ATOM   3593 C  C   . CYS B  1 125 ? -1.157  -7.114  14.472  1.00 93.09  ? 122  CYS B C   1 
ATOM   3594 O  O   . CYS B  1 125 ? -0.256  -6.991  15.300  1.00 92.13  ? 122  CYS B O   1 
ATOM   3595 C  CB  . CYS B  1 125 ? -0.934  -6.964  11.957  1.00 86.04  ? 122  CYS B CB  1 
ATOM   3596 S  SG  . CYS B  1 125 ? 0.141   -5.507  12.058  1.00 89.11  ? 122  CYS B SG  1 
ATOM   3597 N  N   . ILE B  1 126 ? -2.417  -6.656  14.662  1.00 92.39  ? 123  ILE B N   1 
ATOM   3598 C  CA  . ILE B  1 126 ? -2.871  -5.913  15.840  1.00 93.50  ? 123  ILE B CA  1 
ATOM   3599 C  C   . ILE B  1 126 ? -2.687  -6.763  17.113  1.00 100.77 ? 123  ILE B C   1 
ATOM   3600 O  O   . ILE B  1 126 ? -2.278  -6.227  18.139  1.00 100.36 ? 123  ILE B O   1 
ATOM   3601 C  CB  . ILE B  1 126 ? -4.305  -5.343  15.618  1.00 96.81  ? 123  ILE B CB  1 
ATOM   3602 C  CG1 . ILE B  1 126 ? -4.243  -3.958  14.933  1.00 97.26  ? 123  ILE B CG1 1 
ATOM   3603 C  CG2 . ILE B  1 126 ? -5.091  -5.214  16.914  1.00 97.80  ? 123  ILE B CG2 1 
ATOM   3604 C  CD1 . ILE B  1 126 ? -3.887  -3.908  13.443  1.00 102.82 ? 123  ILE B CD1 1 
ATOM   3605 N  N   . ALA B  1 127 ? -2.870  -8.088  17.010  1.00 100.80 ? 124  ALA B N   1 
ATOM   3606 C  CA  . ALA B  1 127 ? -2.634  -9.025  18.110  1.00 102.17 ? 124  ALA B CA  1 
ATOM   3607 C  C   . ALA B  1 127 ? -1.136  -9.061  18.511  1.00 109.68 ? 124  ALA B C   1 
ATOM   3608 O  O   . ALA B  1 127 ? -0.840  -8.893  19.694  1.00 109.65 ? 124  ALA B O   1 
ATOM   3609 C  CB  . ALA B  1 127 ? -3.118  -10.419 17.730  1.00 102.76 ? 124  ALA B CB  1 
ATOM   3610 N  N   . ILE B  1 128 ? -0.203  -9.234  17.530  1.00 108.22 ? 125  ILE B N   1 
ATOM   3611 C  CA  . ILE B  1 128 ? 1.258   -9.310  17.755  1.00 108.83 ? 125  ILE B CA  1 
ATOM   3612 C  C   . ILE B  1 128 ? 1.869   -7.956  18.172  1.00 114.68 ? 125  ILE B C   1 
ATOM   3613 O  O   . ILE B  1 128 ? 2.531   -7.886  19.207  1.00 114.43 ? 125  ILE B O   1 
ATOM   3614 C  CB  . ILE B  1 128 ? 2.030   -9.941  16.539  1.00 111.95 ? 125  ILE B CB  1 
ATOM   3615 C  CG1 . ILE B  1 128 ? 1.493   -11.360 16.145  1.00 112.63 ? 125  ILE B CG1 1 
ATOM   3616 C  CG2 . ILE B  1 128 ? 3.565   -9.950  16.746  1.00 112.40 ? 125  ILE B CG2 1 
ATOM   3617 C  CD1 . ILE B  1 128 ? 1.691   -12.539 17.145  1.00 121.99 ? 125  ILE B CD1 1 
ATOM   3618 N  N   . VAL B  1 129 ? 1.674   -6.909  17.351  1.00 112.69 ? 126  VAL B N   1 
ATOM   3619 C  CA  . VAL B  1 129 ? 2.228   -5.566  17.546  1.00 113.35 ? 126  VAL B CA  1 
ATOM   3620 C  C   . VAL B  1 129 ? 1.701   -4.874  18.820  1.00 120.89 ? 126  VAL B C   1 
ATOM   3621 O  O   . VAL B  1 129 ? 2.493   -4.266  19.546  1.00 120.29 ? 126  VAL B O   1 
ATOM   3622 C  CB  . VAL B  1 129 ? 2.031   -4.698  16.277  1.00 116.83 ? 126  VAL B CB  1 
ATOM   3623 C  CG1 . VAL B  1 129 ? 2.510   -3.269  16.492  1.00 116.70 ? 126  VAL B CG1 1 
ATOM   3624 C  CG2 . VAL B  1 129 ? 2.739   -5.317  15.079  1.00 116.59 ? 126  VAL B CG2 1 
ATOM   3625 N  N   . PHE B  1 130 ? 0.380   -4.961  19.084  1.00 120.10 ? 127  PHE B N   1 
ATOM   3626 C  CA  . PHE B  1 130 ? -0.253  -4.336  20.255  1.00 120.95 ? 127  PHE B CA  1 
ATOM   3627 C  C   . PHE B  1 130 ? -0.873  -5.403  21.202  1.00 128.52 ? 127  PHE B C   1 
ATOM   3628 O  O   . PHE B  1 130 ? -2.103  -5.548  21.212  1.00 127.87 ? 127  PHE B O   1 
ATOM   3629 C  CB  . PHE B  1 130 ? -1.304  -3.276  19.820  1.00 122.45 ? 127  PHE B CB  1 
ATOM   3630 C  CG  . PHE B  1 130 ? -0.874  -2.313  18.731  1.00 123.65 ? 127  PHE B CG  1 
ATOM   3631 C  CD1 . PHE B  1 130 ? -0.149  -1.166  19.038  1.00 126.66 ? 127  PHE B CD1 1 
ATOM   3632 C  CD2 . PHE B  1 130 ? -1.216  -2.542  17.402  1.00 125.46 ? 127  PHE B CD2 1 
ATOM   3633 C  CE1 . PHE B  1 130 ? 0.248   -0.277  18.030  1.00 127.59 ? 127  PHE B CE1 1 
ATOM   3634 C  CE2 . PHE B  1 130 ? -0.818  -1.654  16.394  1.00 128.26 ? 127  PHE B CE2 1 
ATOM   3635 C  CZ  . PHE B  1 130 ? -0.086  -0.529  16.714  1.00 126.47 ? 127  PHE B CZ  1 
ATOM   3636 N  N   . PRO B  1 131 ? -0.065  -6.148  22.020  1.00 128.14 ? 128  PRO B N   1 
ATOM   3637 C  CA  . PRO B  1 131 ? -0.656  -7.174  22.914  1.00 128.92 ? 128  PRO B CA  1 
ATOM   3638 C  C   . PRO B  1 131 ? -1.468  -6.619  24.098  1.00 135.76 ? 128  PRO B C   1 
ATOM   3639 O  O   . PRO B  1 131 ? -2.134  -7.391  24.800  1.00 135.00 ? 128  PRO B O   1 
ATOM   3640 C  CB  . PRO B  1 131 ? 0.554   -8.011  23.366  1.00 130.40 ? 128  PRO B CB  1 
ATOM   3641 C  CG  . PRO B  1 131 ? 1.713   -7.547  22.525  1.00 134.55 ? 128  PRO B CG  1 
ATOM   3642 C  CD  . PRO B  1 131 ? 1.404   -6.130  22.155  1.00 130.00 ? 128  PRO B CD  1 
ATOM   3643 N  N   . VAL B  1 132 ? -1.425  -5.281  24.301  1.00 134.77 ? 129  VAL B N   1 
ATOM   3644 C  CA  . VAL B  1 132 ? -2.173  -4.559  25.327  1.00 135.60 ? 129  VAL B CA  1 
ATOM   3645 C  C   . VAL B  1 132 ? -3.550  -4.262  24.739  1.00 142.08 ? 129  VAL B C   1 
ATOM   3646 O  O   . VAL B  1 132 ? -3.651  -3.497  23.771  1.00 141.45 ? 129  VAL B O   1 
ATOM   3647 C  CB  . VAL B  1 132 ? -1.442  -3.267  25.765  1.00 139.48 ? 129  VAL B CB  1 
ATOM   3648 N  N   . GLN B  1 133 ? -4.601  -4.925  25.289  1.00 140.83 ? 130  GLN B N   1 
ATOM   3649 C  CA  . GLN B  1 133 ? -6.015  -4.840  24.873  1.00 141.47 ? 130  GLN B CA  1 
ATOM   3650 C  C   . GLN B  1 133 ? -6.210  -5.504  23.471  1.00 146.70 ? 130  GLN B C   1 
ATOM   3651 O  O   . GLN B  1 133 ? -7.143  -5.180  22.737  1.00 146.34 ? 130  GLN B O   1 
ATOM   3652 C  CB  . GLN B  1 133 ? -6.545  -3.378  25.000  1.00 142.98 ? 130  GLN B CB  1 
ATOM   3653 C  CG  . GLN B  1 133 ? -7.916  -3.036  24.406  1.00 158.42 ? 130  GLN B CG  1 
ATOM   3654 C  CD  . GLN B  1 133 ? -7.833  -2.293  23.079  1.00 177.53 ? 130  GLN B CD  1 
ATOM   3655 O  OE1 . GLN B  1 133 ? -8.836  -1.786  22.571  1.00 173.44 ? 130  GLN B OE1 1 
ATOM   3656 N  NE2 . GLN B  1 133 ? -6.650  -2.222  22.468  1.00 169.27 ? 130  GLN B NE2 1 
ATOM   3657 N  N   . ASN B  1 134 ? -5.340  -6.491  23.152  1.00 143.88 ? 131  ASN B N   1 
ATOM   3658 C  CA  . ASN B  1 134 ? -5.358  -7.266  21.902  1.00 143.67 ? 131  ASN B CA  1 
ATOM   3659 C  C   . ASN B  1 134 ? -6.587  -8.172  21.824  1.00 146.66 ? 131  ASN B C   1 
ATOM   3660 O  O   . ASN B  1 134 ? -7.214  -8.259  20.764  1.00 146.59 ? 131  ASN B O   1 
ATOM   3661 C  CB  . ASN B  1 134 ? -4.090  -8.114  21.774  1.00 144.83 ? 131  ASN B CB  1 
ATOM   3662 N  N   . ILE B  1 135 ? -6.929  -8.835  22.952  1.00 141.82 ? 132  ILE B N   1 
ATOM   3663 C  CA  . ILE B  1 135 ? -8.073  -9.746  23.085  1.00 140.85 ? 132  ILE B CA  1 
ATOM   3664 C  C   . ILE B  1 135 ? -9.437  -9.028  23.043  1.00 142.69 ? 132  ILE B C   1 
ATOM   3665 O  O   . ILE B  1 135 ? -10.459 -9.698  22.869  1.00 142.23 ? 132  ILE B O   1 
ATOM   3666 C  CB  . ILE B  1 135 ? -7.925  -10.621 24.351  1.00 143.95 ? 132  ILE B CB  1 
ATOM   3667 N  N   . ASN B  1 136 ? -9.451  -7.678  23.204  1.00 137.46 ? 133  ASN B N   1 
ATOM   3668 C  CA  . ASN B  1 136 ? -10.658 -6.840  23.183  1.00 136.31 ? 133  ASN B CA  1 
ATOM   3669 C  C   . ASN B  1 136 ? -10.828 -6.075  21.856  1.00 138.05 ? 133  ASN B C   1 
ATOM   3670 O  O   . ASN B  1 136 ? -11.963 -5.750  21.481  1.00 137.39 ? 133  ASN B O   1 
ATOM   3671 C  CB  . ASN B  1 136 ? -10.664 -5.874  24.370  1.00 136.39 ? 133  ASN B CB  1 
ATOM   3672 N  N   . LEU B  1 137 ? -9.701  -5.789  21.154  1.00 132.80 ? 134  LEU B N   1 
ATOM   3673 C  CA  . LEU B  1 137 ? -9.671  -5.065  19.874  1.00 131.32 ? 134  LEU B CA  1 
ATOM   3674 C  C   . LEU B  1 137 ? -9.887  -5.984  18.667  1.00 131.37 ? 134  LEU B C   1 
ATOM   3675 O  O   . LEU B  1 137 ? -10.587 -5.596  17.734  1.00 130.95 ? 134  LEU B O   1 
ATOM   3676 C  CB  . LEU B  1 137 ? -8.360  -4.282  19.718  1.00 131.40 ? 134  LEU B CB  1 
ATOM   3677 N  N   . VAL B  1 138 ? -9.266  -7.183  18.677  1.00 124.70 ? 135  VAL B N   1 
ATOM   3678 C  CA  . VAL B  1 138 ? -9.375  -8.180  17.608  1.00 122.85 ? 135  VAL B CA  1 
ATOM   3679 C  C   . VAL B  1 138 ? -10.155 -9.399  18.138  1.00 122.86 ? 135  VAL B C   1 
ATOM   3680 O  O   . VAL B  1 138 ? -9.568  -10.415 18.527  1.00 122.33 ? 135  VAL B O   1 
ATOM   3681 C  CB  . VAL B  1 138 ? -7.984  -8.538  17.019  1.00 126.57 ? 135  VAL B CB  1 
ATOM   3682 N  N   . THR B  1 139 ? -11.491 -9.262  18.175  1.00 116.28 ? 136  THR B N   1 
ATOM   3683 C  CA  . THR B  1 139 ? -12.425 -10.264 18.695  1.00 114.56 ? 136  THR B CA  1 
ATOM   3684 C  C   . THR B  1 139 ? -13.093 -11.111 17.612  1.00 114.39 ? 136  THR B C   1 
ATOM   3685 O  O   . THR B  1 139 ? -13.143 -10.703 16.450  1.00 113.67 ? 136  THR B O   1 
ATOM   3686 C  CB  . THR B  1 139 ? -13.491 -9.587  19.583  1.00 123.79 ? 136  THR B CB  1 
ATOM   3687 O  OG1 . THR B  1 139 ? -14.200 -8.604  18.829  1.00 123.18 ? 136  THR B OG1 1 
ATOM   3688 C  CG2 . THR B  1 139 ? -12.906 -8.962  20.834  1.00 123.38 ? 136  THR B CG2 1 
ATOM   3689 N  N   . GLN B  1 140 ? -13.640 -12.283 18.020  1.00 108.17 ? 137  GLN B N   1 
ATOM   3690 C  CA  . GLN B  1 140 ? -14.374 -13.217 17.165  1.00 106.62 ? 137  GLN B CA  1 
ATOM   3691 C  C   . GLN B  1 140 ? -15.652 -12.567 16.636  1.00 107.87 ? 137  GLN B C   1 
ATOM   3692 O  O   . GLN B  1 140 ? -16.111 -12.936 15.554  1.00 107.88 ? 137  GLN B O   1 
ATOM   3693 C  CB  . GLN B  1 140 ? -14.722 -14.504 17.928  1.00 107.78 ? 137  GLN B CB  1 
ATOM   3694 N  N   . LYS B  1 141 ? -16.229 -11.612 17.408  1.00 102.25 ? 138  LYS B N   1 
ATOM   3695 C  CA  . LYS B  1 141 ? -17.435 -10.844 17.058  1.00 100.59 ? 138  LYS B CA  1 
ATOM   3696 C  C   . LYS B  1 141 ? -17.129 -9.910  15.878  1.00 101.67 ? 138  LYS B C   1 
ATOM   3697 O  O   . LYS B  1 141 ? -17.940 -9.791  14.962  1.00 100.92 ? 138  LYS B O   1 
ATOM   3698 C  CB  . LYS B  1 141 ? -17.920 -10.026 18.269  1.00 102.43 ? 138  LYS B CB  1 
ATOM   3699 C  CG  . LYS B  1 141 ? -19.304 -9.414  18.083  1.00 111.27 ? 138  LYS B CG  1 
ATOM   3700 C  CD  . LYS B  1 141 ? -19.384 -8.010  18.649  1.00 117.26 ? 138  LYS B CD  1 
ATOM   3701 N  N   . LYS B  1 142 ? -15.964 -9.240  15.918  1.00 96.67  ? 139  LYS B N   1 
ATOM   3702 C  CA  . LYS B  1 142 ? -15.485 -8.339  14.873  1.00 95.59  ? 139  LYS B CA  1 
ATOM   3703 C  C   . LYS B  1 142 ? -15.119 -9.105  13.602  1.00 98.48  ? 139  LYS B C   1 
ATOM   3704 O  O   . LYS B  1 142 ? -15.372 -8.594  12.517  1.00 99.26  ? 139  LYS B O   1 
ATOM   3705 C  CB  . LYS B  1 142 ? -14.307 -7.489  15.374  1.00 97.53  ? 139  LYS B CB  1 
ATOM   3706 C  CG  . LYS B  1 142 ? -14.758 -6.303  16.215  1.00 107.87 ? 139  LYS B CG  1 
ATOM   3707 C  CD  . LYS B  1 142 ? -13.636 -5.749  17.059  1.00 115.33 ? 139  LYS B CD  1 
ATOM   3708 C  CE  . LYS B  1 142 ? -14.127 -4.833  18.156  1.00 121.62 ? 139  LYS B CE  1 
ATOM   3709 N  NZ  . LYS B  1 142 ? -13.084 -4.611  19.194  1.00 125.84 ? 139  LYS B NZ  1 
ATOM   3710 N  N   . ALA B  1 143 ? -14.553 -10.329 13.725  1.00 93.08  ? 140  ALA B N   1 
ATOM   3711 C  CA  . ALA B  1 143 ? -14.199 -11.173 12.581  1.00 92.02  ? 140  ALA B CA  1 
ATOM   3712 C  C   . ALA B  1 143 ? -15.455 -11.565 11.797  1.00 94.27  ? 140  ALA B C   1 
ATOM   3713 O  O   . ALA B  1 143 ? -15.447 -11.507 10.563  1.00 93.53  ? 140  ALA B O   1 
ATOM   3714 C  CB  . ALA B  1 143 ? -13.461 -12.418 13.050  1.00 92.78  ? 140  ALA B CB  1 
ATOM   3715 N  N   . ARG B  1 144 ? -16.544 -11.917 12.518  1.00 90.57  ? 141  ARG B N   1 
ATOM   3716 C  CA  . ARG B  1 144 ? -17.836 -12.306 11.941  1.00 90.50  ? 141  ARG B CA  1 
ATOM   3717 C  C   . ARG B  1 144 ? -18.500 -11.174 11.159  1.00 93.52  ? 141  ARG B C   1 
ATOM   3718 O  O   . ARG B  1 144 ? -19.041 -11.428 10.081  1.00 93.40  ? 141  ARG B O   1 
ATOM   3719 C  CB  . ARG B  1 144 ? -18.793 -12.844 13.015  1.00 91.67  ? 141  ARG B CB  1 
ATOM   3720 C  CG  . ARG B  1 144 ? -18.595 -14.323 13.316  1.00 102.75 ? 141  ARG B CG  1 
ATOM   3721 C  CD  . ARG B  1 144 ? -19.639 -14.875 14.280  1.00 116.72 ? 141  ARG B CD  1 
ATOM   3722 N  NE  . ARG B  1 144 ? -19.476 -14.352 15.637  1.00 134.80 ? 141  ARG B NE  1 
ATOM   3723 C  CZ  . ARG B  1 144 ? -18.743 -14.929 16.587  1.00 156.20 ? 141  ARG B CZ  1 
ATOM   3724 N  NH1 . ARG B  1 144 ? -18.103 -16.068 16.344  1.00 145.37 ? 141  ARG B NH1 1 
ATOM   3725 N  NH2 . ARG B  1 144 ? -18.652 -14.376 17.790  1.00 146.24 ? 141  ARG B NH2 1 
ATOM   3726 N  N   . PHE B  1 145 ? -18.419 -9.921  11.668  1.00 88.96  ? 142  PHE B N   1 
ATOM   3727 C  CA  . PHE B  1 145 ? -19.047 -8.779  11.002  1.00 88.56  ? 142  PHE B CA  1 
ATOM   3728 C  C   . PHE B  1 145 ? -18.235 -8.263  9.799   1.00 89.67  ? 142  PHE B C   1 
ATOM   3729 O  O   . PHE B  1 145 ? -18.822 -7.679  8.889   1.00 90.65  ? 142  PHE B O   1 
ATOM   3730 C  CB  . PHE B  1 145 ? -19.438 -7.664  11.991  1.00 90.81  ? 142  PHE B CB  1 
ATOM   3731 C  CG  . PHE B  1 145 ? -20.732 -8.040  12.686  1.00 92.86  ? 142  PHE B CG  1 
ATOM   3732 C  CD1 . PHE B  1 145 ? -20.718 -8.781  13.865  1.00 96.16  ? 142  PHE B CD1 1 
ATOM   3733 C  CD2 . PHE B  1 145 ? -21.961 -7.767  12.099  1.00 95.43  ? 142  PHE B CD2 1 
ATOM   3734 C  CE1 . PHE B  1 145 ? -21.907 -9.200  14.465  1.00 96.72  ? 142  PHE B CE1 1 
ATOM   3735 C  CE2 . PHE B  1 145 ? -23.150 -8.180  12.706  1.00 98.24  ? 142  PHE B CE2 1 
ATOM   3736 C  CZ  . PHE B  1 145 ? -23.112 -8.897  13.882  1.00 96.06  ? 142  PHE B CZ  1 
ATOM   3737 N  N   . VAL B  1 146 ? -16.928 -8.541  9.752   1.00 81.86  ? 143  VAL B N   1 
ATOM   3738 C  CA  . VAL B  1 146 ? -16.056 -8.215  8.625   1.00 79.72  ? 143  VAL B CA  1 
ATOM   3739 C  C   . VAL B  1 146 ? -16.370 -9.210  7.470   1.00 80.60  ? 143  VAL B C   1 
ATOM   3740 O  O   . VAL B  1 146 ? -16.557 -8.779  6.326   1.00 80.23  ? 143  VAL B O   1 
ATOM   3741 C  CB  . VAL B  1 146 ? -14.560 -8.223  9.071   1.00 83.05  ? 143  VAL B CB  1 
ATOM   3742 C  CG1 . VAL B  1 146 ? -13.602 -8.227  7.887   1.00 82.69  ? 143  VAL B CG1 1 
ATOM   3743 C  CG2 . VAL B  1 146 ? -14.256 -7.044  9.980   1.00 82.84  ? 143  VAL B CG2 1 
ATOM   3744 N  N   . CYS B  1 147 ? -16.465 -10.526 7.786   1.00 74.15  ? 144  CYS B N   1 
ATOM   3745 C  CA  . CYS B  1 147 ? -16.717 -11.579 6.805   1.00 72.68  ? 144  CYS B CA  1 
ATOM   3746 C  C   . CYS B  1 147 ? -18.030 -11.420 6.076   1.00 76.15  ? 144  CYS B C   1 
ATOM   3747 O  O   . CYS B  1 147 ? -18.057 -11.578 4.859   1.00 75.63  ? 144  CYS B O   1 
ATOM   3748 C  CB  . CYS B  1 147 ? -16.581 -12.958 7.433   1.00 72.59  ? 144  CYS B CB  1 
ATOM   3749 S  SG  . CYS B  1 147 ? -14.876 -13.418 7.827   1.00 75.91  ? 144  CYS B SG  1 
ATOM   3750 N  N   . VAL B  1 148 ? -19.098 -11.054 6.794   1.00 73.92  ? 145  VAL B N   1 
ATOM   3751 C  CA  . VAL B  1 148 ? -20.415 -10.815 6.193   1.00 73.81  ? 145  VAL B CA  1 
ATOM   3752 C  C   . VAL B  1 148 ? -20.319 -9.645  5.200   1.00 74.28  ? 145  VAL B C   1 
ATOM   3753 O  O   . VAL B  1 148 ? -20.753 -9.781  4.050   1.00 73.31  ? 145  VAL B O   1 
ATOM   3754 C  CB  . VAL B  1 148 ? -21.568 -10.689 7.220   1.00 78.89  ? 145  VAL B CB  1 
ATOM   3755 C  CG1 . VAL B  1 148 ? -21.770 -12.007 7.974   1.00 78.52  ? 145  VAL B CG1 1 
ATOM   3756 C  CG2 . VAL B  1 148 ? -21.353 -9.546  8.196   1.00 79.10  ? 145  VAL B CG2 1 
ATOM   3757 N  N   . GLY B  1 149 ? -19.638 -8.577  5.629   1.00 69.43  ? 146  GLY B N   1 
ATOM   3758 C  CA  . GLY B  1 149 ? -19.344 -7.396  4.819   1.00 68.52  ? 146  GLY B CA  1 
ATOM   3759 C  C   . GLY B  1 149 ? -18.583 -7.746  3.550   1.00 71.11  ? 146  GLY B C   1 
ATOM   3760 O  O   . GLY B  1 149 ? -18.935 -7.261  2.469   1.00 71.26  ? 146  GLY B O   1 
ATOM   3761 N  N   . ILE B  1 150 ? -17.571 -8.664  3.670   1.00 65.02  ? 147  ILE B N   1 
ATOM   3762 C  CA  . ILE B  1 150 ? -16.767 -9.172  2.560   1.00 62.76  ? 147  ILE B CA  1 
ATOM   3763 C  C   . ILE B  1 150 ? -17.637 -9.935  1.562   1.00 65.26  ? 147  ILE B C   1 
ATOM   3764 O  O   . ILE B  1 150 ? -17.536 -9.675  0.361   1.00 65.40  ? 147  ILE B O   1 
ATOM   3765 C  CB  . ILE B  1 150 ? -15.535 -9.974  3.044   1.00 65.03  ? 147  ILE B CB  1 
ATOM   3766 C  CG1 . ILE B  1 150 ? -14.466 -9.007  3.603   1.00 64.97  ? 147  ILE B CG1 1 
ATOM   3767 C  CG2 . ILE B  1 150 ? -14.961 -10.841 1.912   1.00 65.83  ? 147  ILE B CG2 1 
ATOM   3768 C  CD1 . ILE B  1 150 ? -13.302 -9.652  4.397   1.00 71.16  ? 147  ILE B CD1 1 
ATOM   3769 N  N   . TRP B  1 151 ? -18.503 -10.852 2.053   1.00 60.25  ? 148  TRP B N   1 
ATOM   3770 C  CA  . TRP B  1 151 ? -19.418 -11.640 1.211   1.00 58.74  ? 148  TRP B CA  1 
ATOM   3771 C  C   . TRP B  1 151 ? -20.375 -10.743 0.417   1.00 65.52  ? 148  TRP B C   1 
ATOM   3772 O  O   . TRP B  1 151 ? -20.486 -10.922 -0.801  1.00 65.47  ? 148  TRP B O   1 
ATOM   3773 C  CB  . TRP B  1 151 ? -20.217 -12.651 2.043   1.00 55.73  ? 148  TRP B CB  1 
ATOM   3774 C  CG  . TRP B  1 151 ? -19.493 -13.917 2.377   1.00 55.02  ? 148  TRP B CG  1 
ATOM   3775 C  CD1 . TRP B  1 151 ? -19.024 -14.290 3.597   1.00 57.43  ? 148  TRP B CD1 1 
ATOM   3776 C  CD2 . TRP B  1 151 ? -19.249 -15.019 1.498   1.00 54.58  ? 148  TRP B CD2 1 
ATOM   3777 N  NE1 . TRP B  1 151 ? -18.464 -15.538 3.526   1.00 56.68  ? 148  TRP B NE1 1 
ATOM   3778 C  CE2 . TRP B  1 151 ? -18.565 -16.002 2.243   1.00 58.17  ? 148  TRP B CE2 1 
ATOM   3779 C  CE3 . TRP B  1 151 ? -19.458 -15.236 0.123   1.00 55.86  ? 148  TRP B CE3 1 
ATOM   3780 C  CZ2 . TRP B  1 151 ? -18.141 -17.214 1.677   1.00 57.63  ? 148  TRP B CZ2 1 
ATOM   3781 C  CZ3 . TRP B  1 151 ? -19.017 -16.425 -0.442  1.00 57.11  ? 148  TRP B CZ3 1 
ATOM   3782 C  CH2 . TRP B  1 151 ? -18.380 -17.404 0.333   1.00 57.56  ? 148  TRP B CH2 1 
ATOM   3783 N  N   . ILE B  1 152 ? -21.037 -9.765  1.089   1.00 62.96  ? 149  ILE B N   1 
ATOM   3784 C  CA  . ILE B  1 152 ? -21.985 -8.852  0.433   1.00 62.63  ? 149  ILE B CA  1 
ATOM   3785 C  C   . ILE B  1 152 ? -21.274 -8.025  -0.663  1.00 63.30  ? 149  ILE B C   1 
ATOM   3786 O  O   . ILE B  1 152 ? -21.731 -8.009  -1.807  1.00 62.63  ? 149  ILE B O   1 
ATOM   3787 C  CB  . ILE B  1 152 ? -22.787 -7.981  1.452   1.00 66.61  ? 149  ILE B CB  1 
ATOM   3788 C  CG1 . ILE B  1 152 ? -23.496 -8.847  2.525   1.00 67.21  ? 149  ILE B CG1 1 
ATOM   3789 C  CG2 . ILE B  1 152 ? -23.792 -7.047  0.747   1.00 67.35  ? 149  ILE B CG2 1 
ATOM   3790 C  CD1 . ILE B  1 152 ? -23.709 -8.121  3.734   1.00 72.29  ? 149  ILE B CD1 1 
ATOM   3791 N  N   . PHE B  1 153 ? -20.140 -7.388  -0.323  1.00 57.54  ? 150  PHE B N   1 
ATOM   3792 C  CA  . PHE B  1 153 ? -19.352 -6.580  -1.254  1.00 56.77  ? 150  PHE B CA  1 
ATOM   3793 C  C   . PHE B  1 153 ? -18.945 -7.347  -2.534  1.00 60.03  ? 150  PHE B C   1 
ATOM   3794 O  O   . PHE B  1 153 ? -19.264 -6.895  -3.630  1.00 57.95  ? 150  PHE B O   1 
ATOM   3795 C  CB  . PHE B  1 153 ? -18.127 -5.976  -0.540  1.00 59.05  ? 150  PHE B CB  1 
ATOM   3796 C  CG  . PHE B  1 153 ? -17.277 -5.058  -1.391  1.00 61.11  ? 150  PHE B CG  1 
ATOM   3797 C  CD1 . PHE B  1 153 ? -17.741 -3.798  -1.762  1.00 64.12  ? 150  PHE B CD1 1 
ATOM   3798 C  CD2 . PHE B  1 153 ? -16.006 -5.444  -1.803  1.00 63.68  ? 150  PHE B CD2 1 
ATOM   3799 C  CE1 . PHE B  1 153 ? -16.962 -2.953  -2.555  1.00 65.29  ? 150  PHE B CE1 1 
ATOM   3800 C  CE2 . PHE B  1 153 ? -15.223 -4.595  -2.591  1.00 66.84  ? 150  PHE B CE2 1 
ATOM   3801 C  CZ  . PHE B  1 153 ? -15.703 -3.349  -2.953  1.00 64.75  ? 150  PHE B CZ  1 
ATOM   3802 N  N   . VAL B  1 154 ? -18.312 -8.541  -2.377  1.00 57.64  ? 151  VAL B N   1 
ATOM   3803 C  CA  . VAL B  1 154 ? -17.838 -9.414  -3.467  1.00 57.69  ? 151  VAL B CA  1 
ATOM   3804 C  C   . VAL B  1 154 ? -19.009 -9.941  -4.337  1.00 61.25  ? 151  VAL B C   1 
ATOM   3805 O  O   . VAL B  1 154 ? -18.927 -9.817  -5.560  1.00 60.03  ? 151  VAL B O   1 
ATOM   3806 C  CB  . VAL B  1 154 ? -16.891 -10.553 -2.963  1.00 60.15  ? 151  VAL B CB  1 
ATOM   3807 C  CG1 . VAL B  1 154 ? -16.490 -11.491 -4.100  1.00 59.13  ? 151  VAL B CG1 1 
ATOM   3808 C  CG2 . VAL B  1 154 ? -15.653 -9.968  -2.284  1.00 60.05  ? 151  VAL B CG2 1 
ATOM   3809 N  N   . ILE B  1 155 ? -20.079 -10.499 -3.709  1.00 58.00  ? 152  ILE B N   1 
ATOM   3810 C  CA  . ILE B  1 155 ? -21.286 -11.002 -4.392  1.00 58.52  ? 152  ILE B CA  1 
ATOM   3811 C  C   . ILE B  1 155 ? -21.912 -9.918  -5.299  1.00 64.22  ? 152  ILE B C   1 
ATOM   3812 O  O   . ILE B  1 155 ? -22.279 -10.222 -6.433  1.00 64.47  ? 152  ILE B O   1 
ATOM   3813 C  CB  . ILE B  1 155 ? -22.316 -11.649 -3.393  1.00 61.11  ? 152  ILE B CB  1 
ATOM   3814 C  CG1 . ILE B  1 155 ? -21.910 -13.098 -3.035  1.00 60.92  ? 152  ILE B CG1 1 
ATOM   3815 C  CG2 . ILE B  1 155 ? -23.769 -11.609 -3.903  1.00 60.03  ? 152  ILE B CG2 1 
ATOM   3816 C  CD1 . ILE B  1 155 ? -22.345 -13.542 -1.637  1.00 68.32  ? 152  ILE B CD1 1 
ATOM   3817 N  N   . LEU B  1 156 ? -21.981 -8.663  -4.823  1.00 62.31  ? 153  LEU B N   1 
ATOM   3818 C  CA  . LEU B  1 156 ? -22.567 -7.557  -5.585  1.00 62.80  ? 153  LEU B CA  1 
ATOM   3819 C  C   . LEU B  1 156 ? -21.674 -7.003  -6.703  1.00 66.18  ? 153  LEU B C   1 
ATOM   3820 O  O   . LEU B  1 156 ? -22.139 -6.877  -7.833  1.00 68.00  ? 153  LEU B O   1 
ATOM   3821 C  CB  . LEU B  1 156 ? -23.035 -6.428  -4.656  1.00 63.10  ? 153  LEU B CB  1 
ATOM   3822 C  CG  . LEU B  1 156 ? -24.223 -6.767  -3.748  1.00 68.41  ? 153  LEU B CG  1 
ATOM   3823 C  CD1 . LEU B  1 156 ? -24.459 -5.673  -2.740  1.00 68.83  ? 153  LEU B CD1 1 
ATOM   3824 C  CD2 . LEU B  1 156 ? -25.489 -7.079  -4.555  1.00 70.18  ? 153  LEU B CD2 1 
ATOM   3825 N  N   . THR B  1 157 ? -20.417 -6.667  -6.401  1.00 59.93  ? 154  THR B N   1 
ATOM   3826 C  CA  . THR B  1 157 ? -19.477 -6.097  -7.376  1.00 58.68  ? 154  THR B CA  1 
ATOM   3827 C  C   . THR B  1 157 ? -19.081 -7.077  -8.513  1.00 62.83  ? 154  THR B C   1 
ATOM   3828 O  O   . THR B  1 157 ? -18.696 -6.617  -9.587  1.00 61.97  ? 154  THR B O   1 
ATOM   3829 C  CB  . THR B  1 157 ? -18.249 -5.517  -6.658  1.00 59.12  ? 154  THR B CB  1 
ATOM   3830 O  OG1 . THR B  1 157 ? -17.716 -6.509  -5.780  1.00 59.99  ? 154  THR B OG1 1 
ATOM   3831 C  CG2 . THR B  1 157 ? -18.574 -4.247  -5.878  1.00 52.66  ? 154  THR B CG2 1 
ATOM   3832 N  N   . SER B  1 158 ? -19.207 -8.411  -8.287  1.00 59.97  ? 155  SER B N   1 
ATOM   3833 C  CA  . SER B  1 158 ? -18.909 -9.463  -9.278  1.00 59.60  ? 155  SER B CA  1 
ATOM   3834 C  C   . SER B  1 158 ? -20.113 -9.854  -10.139 1.00 63.62  ? 155  SER B C   1 
ATOM   3835 O  O   . SER B  1 158 ? -19.934 -10.562 -11.135 1.00 62.39  ? 155  SER B O   1 
ATOM   3836 C  CB  . SER B  1 158 ? -18.387 -10.715 -8.586  1.00 62.16  ? 155  SER B CB  1 
ATOM   3837 O  OG  . SER B  1 158 ? -17.108 -10.469 -8.037  1.00 71.20  ? 155  SER B OG  1 
ATOM   3838 N  N   . SER B  1 159 ? -21.337 -9.392  -9.763  1.00 60.76  ? 156  SER B N   1 
ATOM   3839 C  CA  . SER B  1 159 ? -22.608 -9.703  -10.455 1.00 59.79  ? 156  SER B CA  1 
ATOM   3840 C  C   . SER B  1 159 ? -22.593 -9.476  -11.986 1.00 62.25  ? 156  SER B C   1 
ATOM   3841 O  O   . SER B  1 159 ? -23.188 -10.318 -12.652 1.00 58.51  ? 156  SER B O   1 
ATOM   3842 C  CB  . SER B  1 159 ? -23.793 -8.985  -9.818  1.00 61.39  ? 156  SER B CB  1 
ATOM   3843 O  OG  . SER B  1 159 ? -23.700 -7.575  -9.938  1.00 62.30  ? 156  SER B OG  1 
ATOM   3844 N  N   . PRO B  1 160 ? -21.887 -8.474  -12.608 1.00 61.19  ? 157  PRO B N   1 
ATOM   3845 C  CA  . PRO B  1 160 ? -21.905 -8.390  -14.084 1.00 61.85  ? 157  PRO B CA  1 
ATOM   3846 C  C   . PRO B  1 160 ? -21.561 -9.694  -14.833 1.00 67.95  ? 157  PRO B C   1 
ATOM   3847 O  O   . PRO B  1 160 ? -21.960 -9.838  -15.992 1.00 68.54  ? 157  PRO B O   1 
ATOM   3848 C  CB  . PRO B  1 160 ? -20.914 -7.258  -14.389 1.00 62.41  ? 157  PRO B CB  1 
ATOM   3849 C  CG  . PRO B  1 160 ? -20.977 -6.415  -13.221 1.00 65.66  ? 157  PRO B CG  1 
ATOM   3850 C  CD  . PRO B  1 160 ? -21.126 -7.337  -12.049 1.00 61.81  ? 157  PRO B CD  1 
ATOM   3851 N  N   . PHE B  1 161 ? -20.856 -10.643 -14.174 1.00 64.67  ? 158  PHE B N   1 
ATOM   3852 C  CA  . PHE B  1 161 ? -20.472 -11.936 -14.757 1.00 64.74  ? 158  PHE B CA  1 
ATOM   3853 C  C   . PHE B  1 161 ? -21.664 -12.920 -14.857 1.00 71.87  ? 158  PHE B C   1 
ATOM   3854 O  O   . PHE B  1 161 ? -21.601 -13.893 -15.622 1.00 72.12  ? 158  PHE B O   1 
ATOM   3855 C  CB  . PHE B  1 161 ? -19.251 -12.547 -14.025 1.00 65.46  ? 158  PHE B CB  1 
ATOM   3856 C  CG  . PHE B  1 161 ? -17.989 -11.758 -14.306 1.00 65.88  ? 158  PHE B CG  1 
ATOM   3857 C  CD1 . PHE B  1 161 ? -17.258 -11.973 -15.470 1.00 67.66  ? 158  PHE B CD1 1 
ATOM   3858 C  CD2 . PHE B  1 161 ? -17.591 -10.721 -13.462 1.00 66.74  ? 158  PHE B CD2 1 
ATOM   3859 C  CE1 . PHE B  1 161 ? -16.139 -11.191 -15.767 1.00 67.95  ? 158  PHE B CE1 1 
ATOM   3860 C  CE2 . PHE B  1 161 ? -16.475 -9.939  -13.765 1.00 68.48  ? 158  PHE B CE2 1 
ATOM   3861 C  CZ  . PHE B  1 161 ? -15.764 -10.173 -14.920 1.00 66.54  ? 158  PHE B CZ  1 
ATOM   3862 N  N   . LEU B  1 162 ? -22.744 -12.638 -14.103 1.00 69.38  ? 159  LEU B N   1 
ATOM   3863 C  CA  . LEU B  1 162 ? -24.004 -13.385 -14.089 1.00 70.05  ? 159  LEU B CA  1 
ATOM   3864 C  C   . LEU B  1 162 ? -24.986 -12.886 -15.159 1.00 77.60  ? 159  LEU B C   1 
ATOM   3865 O  O   . LEU B  1 162 ? -25.864 -13.643 -15.563 1.00 78.95  ? 159  LEU B O   1 
ATOM   3866 C  CB  . LEU B  1 162 ? -24.703 -13.255 -12.721 1.00 69.89  ? 159  LEU B CB  1 
ATOM   3867 C  CG  . LEU B  1 162 ? -24.392 -14.267 -11.633 1.00 74.27  ? 159  LEU B CG  1 
ATOM   3868 C  CD1 . LEU B  1 162 ? -25.223 -13.961 -10.398 1.00 74.03  ? 159  LEU B CD1 1 
ATOM   3869 C  CD2 . LEU B  1 162 ? -24.641 -15.710 -12.101 1.00 75.01  ? 159  LEU B CD2 1 
ATOM   3870 N  N   A MET B  1 163 ? -24.865 -11.610 -15.568 0.50 74.34  ? 160  MET B N   1 
ATOM   3871 N  N   B MET B  1 163 ? -24.864 -11.623 -15.594 0.50 74.95  ? 160  MET B N   1 
ATOM   3872 C  CA  A MET B  1 163 ? -25.734 -10.976 -16.563 0.50 74.19  ? 160  MET B CA  1 
ATOM   3873 C  CA  B MET B  1 163 ? -25.757 -11.007 -16.584 0.50 75.09  ? 160  MET B CA  1 
ATOM   3874 C  C   A MET B  1 163 ? -25.018 -10.714 -17.918 0.50 80.80  ? 160  MET B C   1 
ATOM   3875 C  C   B MET B  1 163 ? -25.123 -10.846 -17.995 0.50 81.23  ? 160  MET B C   1 
ATOM   3876 O  O   A MET B  1 163 ? -25.397 -9.809  -18.670 0.50 79.98  ? 160  MET B O   1 
ATOM   3877 O  O   B MET B  1 163 ? -25.646 -10.114 -18.843 0.50 80.49  ? 160  MET B O   1 
ATOM   3878 C  CB  A MET B  1 163 ? -26.406 -9.706  -15.990 0.50 75.94  ? 160  MET B CB  1 
ATOM   3879 C  CB  B MET B  1 163 ? -26.278 -9.663  -16.034 0.50 77.09  ? 160  MET B CB  1 
ATOM   3880 C  CG  A MET B  1 163 ? -25.485 -8.793  -15.208 0.50 78.51  ? 160  MET B CG  1 
ATOM   3881 C  CG  B MET B  1 163 ? -25.200 -8.626  -15.848 0.50 80.13  ? 160  MET B CG  1 
ATOM   3882 S  SD  A MET B  1 163 ? -26.375 -7.767  -14.010 0.50 81.53  ? 160  MET B SD  1 
ATOM   3883 S  SD  B MET B  1 163 ? -25.721 -7.233  -14.841 0.50 83.73  ? 160  MET B SD  1 
ATOM   3884 C  CE  A MET B  1 163 ? -26.571 -8.924  -12.652 0.50 78.01  ? 160  MET B CE  1 
ATOM   3885 C  CE  B MET B  1 163 ? -24.571 -6.024  -15.409 0.50 80.27  ? 160  MET B CE  1 
ATOM   3886 N  N   . ALA B  1 164 ? -24.011 -11.547 -18.241 1.00 80.05  ? 161  ALA B N   1 
ATOM   3887 C  CA  . ALA B  1 164 ? -23.268 -11.456 -19.494 1.00 81.66  ? 161  ALA B CA  1 
ATOM   3888 C  C   . ALA B  1 164 ? -23.966 -12.205 -20.630 1.00 91.16  ? 161  ALA B C   1 
ATOM   3889 O  O   . ALA B  1 164 ? -24.605 -13.235 -20.410 1.00 90.48  ? 161  ALA B O   1 
ATOM   3890 C  CB  . ALA B  1 164 ? -21.844 -11.954 -19.306 1.00 82.01  ? 161  ALA B CB  1 
ATOM   3891 N  N   . LYS B  1 165 ? -23.843 -11.662 -21.852 1.00 91.88  ? 162  LYS B N   1 
ATOM   3892 C  CA  . LYS B  1 165 ? -24.415 -12.214 -23.080 1.00 92.87  ? 162  LYS B CA  1 
ATOM   3893 C  C   . LYS B  1 165 ? -23.860 -13.621 -23.382 1.00 98.35  ? 162  LYS B C   1 
ATOM   3894 O  O   . LYS B  1 165 ? -22.661 -13.857 -23.193 1.00 97.65  ? 162  LYS B O   1 
ATOM   3895 C  CB  . LYS B  1 165 ? -24.150 -11.259 -24.261 1.00 96.05  ? 162  LYS B CB  1 
ATOM   3896 N  N   . PRO B  1 166 ? -24.706 -14.569 -23.850 1.00 96.71  ? 163  PRO B N   1 
ATOM   3897 C  CA  . PRO B  1 166 ? -24.194 -15.923 -24.140 1.00 96.85  ? 163  PRO B CA  1 
ATOM   3898 C  C   . PRO B  1 166 ? -23.132 -15.955 -25.235 1.00 101.15 ? 163  PRO B C   1 
ATOM   3899 O  O   . PRO B  1 166 ? -23.152 -15.123 -26.145 1.00 100.49 ? 163  PRO B O   1 
ATOM   3900 C  CB  . PRO B  1 166 ? -25.450 -16.705 -24.535 1.00 98.37  ? 163  PRO B CB  1 
ATOM   3901 C  CG  . PRO B  1 166 ? -26.436 -15.672 -24.950 1.00 102.52 ? 163  PRO B CG  1 
ATOM   3902 C  CD  . PRO B  1 166 ? -26.155 -14.466 -24.127 1.00 98.07  ? 163  PRO B CD  1 
ATOM   3903 N  N   . GLN B  1 167 ? -22.190 -16.900 -25.120 1.00 98.56  ? 164  GLN B N   1 
ATOM   3904 C  CA  . GLN B  1 167 ? -21.109 -17.097 -26.085 1.00 98.77  ? 164  GLN B CA  1 
ATOM   3905 C  C   . GLN B  1 167 ? -21.500 -18.178 -27.104 1.00 105.01 ? 164  GLN B C   1 
ATOM   3906 O  O   . GLN B  1 167 ? -21.979 -19.246 -26.723 1.00 104.32 ? 164  GLN B O   1 
ATOM   3907 C  CB  . GLN B  1 167 ? -19.796 -17.486 -25.373 1.00 99.65  ? 164  GLN B CB  1 
ATOM   3908 C  CG  . GLN B  1 167 ? -19.109 -16.354 -24.637 1.00 108.72 ? 164  GLN B CG  1 
ATOM   3909 C  CD  . GLN B  1 167 ? -18.712 -16.763 -23.242 1.00 129.19 ? 164  GLN B CD  1 
ATOM   3910 O  OE1 . GLN B  1 167 ? -17.579 -17.188 -22.985 1.00 124.85 ? 164  GLN B OE1 1 
ATOM   3911 N  NE2 . GLN B  1 167 ? -19.640 -16.639 -22.304 1.00 122.35 ? 164  GLN B NE2 1 
ATOM   3912 N  N   . LYS B  1 168 ? -21.321 -17.885 -28.395 1.00 104.31 ? 165  LYS B N   1 
ATOM   3913 C  CA  . LYS B  1 168 ? -21.589 -18.821 -29.492 1.00 105.53 ? 165  LYS B CA  1 
ATOM   3914 C  C   . LYS B  1 168 ? -20.453 -18.719 -30.503 1.00 112.78 ? 165  LYS B C   1 
ATOM   3915 O  O   . LYS B  1 168 ? -20.021 -17.606 -30.809 1.00 112.93 ? 165  LYS B O   1 
ATOM   3916 C  CB  . LYS B  1 168 ? -22.947 -18.540 -30.170 1.00 107.87 ? 165  LYS B CB  1 
ATOM   3917 C  CG  . LYS B  1 168 ? -24.177 -18.917 -29.340 1.00 121.19 ? 165  LYS B CG  1 
ATOM   3918 C  CD  . LYS B  1 168 ? -24.674 -20.332 -29.636 1.00 133.09 ? 165  LYS B CD  1 
ATOM   3919 C  CE  . LYS B  1 168 ? -26.169 -20.390 -29.862 1.00 141.48 ? 165  LYS B CE  1 
ATOM   3920 N  NZ  . LYS B  1 168 ? -26.615 -21.741 -30.302 1.00 145.14 ? 165  LYS B NZ  1 
ATOM   3921 N  N   . ASP B  1 169 ? -19.947 -19.854 -31.009 1.00 111.51 ? 166  ASP B N   1 
ATOM   3922 C  CA  . ASP B  1 169 ? -18.855 -19.814 -31.988 1.00 112.27 ? 166  ASP B CA  1 
ATOM   3923 C  C   . ASP B  1 169 ? -19.379 -19.659 -33.430 1.00 118.46 ? 166  ASP B C   1 
ATOM   3924 O  O   . ASP B  1 169 ? -20.600 -19.569 -33.629 1.00 118.37 ? 166  ASP B O   1 
ATOM   3925 C  CB  . ASP B  1 169 ? -17.911 -21.032 -31.828 1.00 113.92 ? 166  ASP B CB  1 
ATOM   3926 C  CG  . ASP B  1 169 ? -18.428 -22.370 -32.338 1.00 121.75 ? 166  ASP B CG  1 
ATOM   3927 O  OD1 . ASP B  1 169 ? -19.653 -22.509 -32.509 1.00 121.73 ? 166  ASP B OD1 1 
ATOM   3928 O  OD2 . ASP B  1 169 ? -17.600 -23.279 -32.561 1.00 127.01 ? 166  ASP B OD2 1 
ATOM   3929 N  N   . GLU B  1 170 ? -18.450 -19.649 -34.428 1.00 115.97 ? 167  GLU B N   1 
ATOM   3930 C  CA  . GLU B  1 170 ? -18.717 -19.568 -35.875 1.00 115.79 ? 167  GLU B CA  1 
ATOM   3931 C  C   . GLU B  1 170 ? -19.728 -20.648 -36.325 1.00 117.94 ? 167  GLU B C   1 
ATOM   3932 O  O   . GLU B  1 170 ? -20.618 -20.358 -37.134 1.00 117.03 ? 167  GLU B O   1 
ATOM   3933 C  CB  . GLU B  1 170 ? -17.401 -19.725 -36.659 1.00 117.34 ? 167  GLU B CB  1 
ATOM   3934 C  CG  . GLU B  1 170 ? -17.204 -18.696 -37.762 1.00 130.69 ? 167  GLU B CG  1 
ATOM   3935 C  CD  . GLU B  1 170 ? -16.097 -19.008 -38.757 1.00 159.55 ? 167  GLU B CD  1 
ATOM   3936 O  OE1 . GLU B  1 170 ? -14.962 -19.319 -38.323 1.00 156.23 ? 167  GLU B OE1 1 
ATOM   3937 O  OE2 . GLU B  1 170 ? -16.365 -18.931 -39.978 1.00 154.96 ? 167  GLU B OE2 1 
ATOM   3938 N  N   . LYS B  1 171 ? -19.608 -21.873 -35.746 1.00 113.35 ? 168  LYS B N   1 
ATOM   3939 C  CA  . LYS B  1 171 ? -20.462 -23.028 -36.009 1.00 112.69 ? 168  LYS B CA  1 
ATOM   3940 C  C   . LYS B  1 171 ? -21.739 -23.064 -35.128 1.00 116.16 ? 168  LYS B C   1 
ATOM   3941 O  O   . LYS B  1 171 ? -22.362 -24.121 -35.000 1.00 116.21 ? 168  LYS B O   1 
ATOM   3942 C  CB  . LYS B  1 171 ? -19.642 -24.325 -35.888 1.00 114.94 ? 168  LYS B CB  1 
ATOM   3943 N  N   . ASN B  1 172 ? -22.136 -21.901 -34.550 1.00 111.73 ? 169  ASN B N   1 
ATOM   3944 C  CA  . ASN B  1 172 ? -23.326 -21.694 -33.700 1.00 110.77 ? 169  ASN B CA  1 
ATOM   3945 C  C   . ASN B  1 172 ? -23.417 -22.631 -32.449 1.00 111.41 ? 169  ASN B C   1 
ATOM   3946 O  O   . ASN B  1 172 ? -24.520 -22.856 -31.936 1.00 111.10 ? 169  ASN B O   1 
ATOM   3947 C  CB  . ASN B  1 172 ? -24.626 -21.753 -34.533 1.00 113.13 ? 169  ASN B CB  1 
ATOM   3948 C  CG  . ASN B  1 172 ? -24.856 -20.575 -35.462 1.00 143.77 ? 169  ASN B CG  1 
ATOM   3949 O  OD1 . ASN B  1 172 ? -24.237 -19.505 -35.342 1.00 140.66 ? 169  ASN B OD1 1 
ATOM   3950 N  ND2 . ASN B  1 172 ? -25.773 -20.745 -36.411 1.00 135.51 ? 169  ASN B ND2 1 
ATOM   3951 N  N   . ASN B  1 173 ? -22.260 -23.121 -31.935 1.00 104.71 ? 170  ASN B N   1 
ATOM   3952 C  CA  . ASN B  1 173 ? -22.179 -23.963 -30.735 1.00 102.85 ? 170  ASN B CA  1 
ATOM   3953 C  C   . ASN B  1 173 ? -22.079 -23.083 -29.504 1.00 103.04 ? 170  ASN B C   1 
ATOM   3954 O  O   . ASN B  1 173 ? -21.416 -22.049 -29.568 1.00 102.05 ? 170  ASN B O   1 
ATOM   3955 C  CB  . ASN B  1 173 ? -20.957 -24.881 -30.778 1.00 104.25 ? 170  ASN B CB  1 
ATOM   3956 C  CG  . ASN B  1 173 ? -21.074 -26.052 -31.716 1.00 129.53 ? 170  ASN B CG  1 
ATOM   3957 O  OD1 . ASN B  1 173 ? -20.881 -25.932 -32.936 1.00 121.09 ? 170  ASN B OD1 1 
ATOM   3958 N  ND2 . ASN B  1 173 ? -21.369 -27.219 -31.157 1.00 123.27 ? 170  ASN B ND2 1 
ATOM   3959 N  N   . THR B  1 174 ? -22.701 -23.500 -28.375 1.00 97.91  ? 171  THR B N   1 
ATOM   3960 C  CA  . THR B  1 174 ? -22.635 -22.736 -27.124 1.00 96.72  ? 171  THR B CA  1 
ATOM   3961 C  C   . THR B  1 174 ? -21.242 -22.879 -26.494 1.00 96.98  ? 171  THR B C   1 
ATOM   3962 O  O   . THR B  1 174 ? -20.739 -23.986 -26.273 1.00 96.68  ? 171  THR B O   1 
ATOM   3963 C  CB  . THR B  1 174 ? -23.805 -23.042 -26.166 1.00 107.29 ? 171  THR B CB  1 
ATOM   3964 O  OG1 . THR B  1 174 ? -25.030 -22.893 -26.889 1.00 104.86 ? 171  THR B OG1 1 
ATOM   3965 C  CG2 . THR B  1 174 ? -23.831 -22.100 -24.939 1.00 107.77 ? 171  THR B CG2 1 
ATOM   3966 N  N   . LYS B  1 175 ? -20.614 -21.728 -26.279 1.00 89.92  ? 172  LYS B N   1 
ATOM   3967 C  CA  . LYS B  1 175 ? -19.286 -21.590 -25.720 1.00 87.46  ? 172  LYS B CA  1 
ATOM   3968 C  C   . LYS B  1 175 ? -19.381 -21.023 -24.305 1.00 86.80  ? 172  LYS B C   1 
ATOM   3969 O  O   . LYS B  1 175 ? -20.440 -20.549 -23.905 1.00 86.10  ? 172  LYS B O   1 
ATOM   3970 C  CB  . LYS B  1 175 ? -18.434 -20.702 -26.646 1.00 89.14  ? 172  LYS B CB  1 
ATOM   3971 C  CG  . LYS B  1 175 ? -17.994 -21.395 -27.939 1.00 96.01  ? 172  LYS B CG  1 
ATOM   3972 C  CD  . LYS B  1 175 ? -16.651 -22.103 -27.762 1.00 105.12 ? 172  LYS B CD  1 
ATOM   3973 C  CE  . LYS B  1 175 ? -16.138 -22.715 -29.033 1.00 116.05 ? 172  LYS B CE  1 
ATOM   3974 N  NZ  . LYS B  1 175 ? -14.675 -22.949 -28.967 1.00 128.12 ? 172  LYS B NZ  1 
ATOM   3975 N  N   . CYS B  1 176 ? -18.295 -21.129 -23.533 1.00 80.95  ? 173  CYS B N   1 
ATOM   3976 C  CA  . CYS B  1 176 ? -18.191 -20.633 -22.163 1.00 79.57  ? 173  CYS B CA  1 
ATOM   3977 C  C   . CYS B  1 176 ? -16.725 -20.336 -21.885 1.00 83.37  ? 173  CYS B C   1 
ATOM   3978 O  O   . CYS B  1 176 ? -15.850 -20.954 -22.499 1.00 83.64  ? 173  CYS B O   1 
ATOM   3979 C  CB  . CYS B  1 176 ? -18.751 -21.651 -21.171 1.00 78.98  ? 173  CYS B CB  1 
ATOM   3980 S  SG  . CYS B  1 176 ? -19.273 -20.943 -19.585 1.00 82.37  ? 173  CYS B SG  1 
ATOM   3981 N  N   . PHE B  1 177 ? -16.457 -19.401 -20.949 1.00 78.48  ? 174  PHE B N   1 
ATOM   3982 C  CA  . PHE B  1 177 ? -15.122 -18.998 -20.488 1.00 77.23  ? 174  PHE B CA  1 
ATOM   3983 C  C   . PHE B  1 177 ? -14.217 -18.430 -21.610 1.00 84.82  ? 174  PHE B C   1 
ATOM   3984 O  O   . PHE B  1 177 ? -12.992 -18.566 -21.530 1.00 85.08  ? 174  PHE B O   1 
ATOM   3985 C  CB  . PHE B  1 177 ? -14.425 -20.152 -19.718 1.00 77.52  ? 174  PHE B CB  1 
ATOM   3986 C  CG  . PHE B  1 177 ? -15.349 -21.057 -18.936 1.00 77.34  ? 174  PHE B CG  1 
ATOM   3987 C  CD1 . PHE B  1 177 ? -16.012 -20.592 -17.806 1.00 79.26  ? 174  PHE B CD1 1 
ATOM   3988 C  CD2 . PHE B  1 177 ? -15.565 -22.370 -19.336 1.00 78.44  ? 174  PHE B CD2 1 
ATOM   3989 C  CE1 . PHE B  1 177 ? -16.866 -21.424 -17.085 1.00 79.90  ? 174  PHE B CE1 1 
ATOM   3990 C  CE2 . PHE B  1 177 ? -16.429 -23.201 -18.619 1.00 80.82  ? 174  PHE B CE2 1 
ATOM   3991 C  CZ  . PHE B  1 177 ? -17.076 -22.722 -17.498 1.00 78.68  ? 174  PHE B CZ  1 
ATOM   3992 N  N   . GLU B  1 178 ? -14.811 -17.743 -22.621 1.00 84.06  ? 175  GLU B N   1 
ATOM   3993 C  CA  . GLU B  1 178 ? -14.050 -17.144 -23.727 1.00 85.11  ? 175  GLU B CA  1 
ATOM   3994 C  C   . GLU B  1 178 ? -13.344 -15.821 -23.355 1.00 92.08  ? 175  GLU B C   1 
ATOM   3995 O  O   . GLU B  1 178 ? -13.986 -14.935 -22.778 1.00 90.33  ? 175  GLU B O   1 
ATOM   3996 C  CB  . GLU B  1 178 ? -14.908 -16.973 -24.986 1.00 86.40  ? 175  GLU B CB  1 
ATOM   3997 C  CG  . GLU B  1 178 ? -15.076 -18.249 -25.794 1.00 97.76  ? 175  GLU B CG  1 
ATOM   3998 C  CD  . GLU B  1 178 ? -13.804 -18.953 -26.233 1.00 120.12 ? 175  GLU B CD  1 
ATOM   3999 O  OE1 . GLU B  1 178 ? -12.869 -18.273 -26.718 1.00 111.73 ? 175  GLU B OE1 1 
ATOM   4000 O  OE2 . GLU B  1 178 ? -13.747 -20.196 -26.093 1.00 117.35 ? 175  GLU B OE2 1 
ATOM   4001 N  N   . PRO B  1 179 ? -12.026 -15.663 -23.680 1.00 92.68  ? 176  PRO B N   1 
ATOM   4002 C  CA  . PRO B  1 179 ? -11.323 -14.415 -23.322 1.00 93.76  ? 176  PRO B CA  1 
ATOM   4003 C  C   . PRO B  1 179 ? -11.753 -13.222 -24.176 1.00 101.57 ? 176  PRO B C   1 
ATOM   4004 O  O   . PRO B  1 179 ? -12.182 -13.447 -25.314 1.00 101.43 ? 176  PRO B O   1 
ATOM   4005 C  CB  . PRO B  1 179 ? -9.834  -14.755 -23.521 1.00 95.17  ? 176  PRO B CB  1 
ATOM   4006 C  CG  . PRO B  1 179 ? -9.775  -16.229 -23.795 1.00 99.43  ? 176  PRO B CG  1 
ATOM   4007 C  CD  . PRO B  1 179 ? -11.111 -16.599 -24.362 1.00 94.89  ? 176  PRO B CD  1 
ATOM   4008 N  N   . PRO B  1 180 ? -11.666 -11.961 -23.662 1.00 100.32 ? 177  PRO B N   1 
ATOM   4009 C  CA  . PRO B  1 180 ? -12.076 -10.805 -24.477 1.00 101.16 ? 177  PRO B CA  1 
ATOM   4010 C  C   . PRO B  1 180 ? -11.379 -10.771 -25.841 1.00 108.89 ? 177  PRO B C   1 
ATOM   4011 O  O   . PRO B  1 180 ? -10.164 -10.918 -25.930 1.00 108.29 ? 177  PRO B O   1 
ATOM   4012 C  CB  . PRO B  1 180 ? -11.760 -9.612  -23.573 1.00 102.57 ? 177  PRO B CB  1 
ATOM   4013 C  CG  . PRO B  1 180 ? -11.821 -10.167 -22.195 1.00 106.39 ? 177  PRO B CG  1 
ATOM   4014 C  CD  . PRO B  1 180 ? -11.206 -11.523 -22.328 1.00 101.76 ? 177  PRO B CD  1 
ATOM   4015 N  N   . GLN B  1 181 ? -12.193 -10.708 -26.902 1.00 109.00 ? 178  GLN B N   1 
ATOM   4016 C  CA  . GLN B  1 181 ? -11.818 -10.770 -28.318 1.00 110.64 ? 178  GLN B CA  1 
ATOM   4017 C  C   . GLN B  1 181 ? -11.553 -9.388  -28.934 1.00 118.74 ? 178  GLN B C   1 
ATOM   4018 O  O   . GLN B  1 181 ? -11.286 -8.447  -28.189 1.00 118.57 ? 178  GLN B O   1 
ATOM   4019 C  CB  . GLN B  1 181 ? -12.889 -11.574 -29.115 1.00 112.08 ? 178  GLN B CB  1 
ATOM   4020 C  CG  . GLN B  1 181 ? -14.348 -11.061 -29.019 1.00 118.36 ? 178  GLN B CG  1 
ATOM   4021 C  CD  . GLN B  1 181 ? -15.049 -11.399 -27.714 1.00 127.01 ? 178  GLN B CD  1 
ATOM   4022 O  OE1 . GLN B  1 181 ? -15.305 -10.532 -26.873 1.00 116.11 ? 178  GLN B OE1 1 
ATOM   4023 N  NE2 . GLN B  1 181 ? -15.372 -12.667 -27.508 1.00 121.68 ? 178  GLN B NE2 1 
ATOM   4024 N  N   . ASP B  1 182 ? -11.601 -9.269  -30.289 1.00 118.12 ? 179  ASP B N   1 
ATOM   4025 C  CA  . ASP B  1 182 ? -11.410 -8.004  -31.016 1.00 119.10 ? 179  ASP B CA  1 
ATOM   4026 C  C   . ASP B  1 182 ? -12.479 -6.992  -30.554 1.00 124.33 ? 179  ASP B C   1 
ATOM   4027 O  O   . ASP B  1 182 ? -12.127 -5.899  -30.096 1.00 124.28 ? 179  ASP B O   1 
ATOM   4028 C  CB  . ASP B  1 182 ? -11.463 -8.231  -32.537 1.00 121.18 ? 179  ASP B CB  1 
ATOM   4029 N  N   . ASN B  1 183 ? -13.772 -7.401  -30.604 1.00 120.82 ? 180  ASN B N   1 
ATOM   4030 C  CA  . ASN B  1 183 ? -14.914 -6.633  -30.102 1.00 120.58 ? 180  ASN B CA  1 
ATOM   4031 C  C   . ASN B  1 183 ? -15.084 -6.999  -28.604 1.00 124.42 ? 180  ASN B C   1 
ATOM   4032 O  O   . ASN B  1 183 ? -14.431 -7.941  -28.140 1.00 124.08 ? 180  ASN B O   1 
ATOM   4033 C  CB  . ASN B  1 183 ? -16.178 -6.966  -30.901 1.00 120.69 ? 180  ASN B CB  1 
ATOM   4034 N  N   . GLN B  1 184 ? -15.939 -6.256  -27.851 1.00 120.38 ? 181  GLN B N   1 
ATOM   4035 C  CA  . GLN B  1 184 ? -16.190 -6.453  -26.406 1.00 119.71 ? 181  GLN B CA  1 
ATOM   4036 C  C   . GLN B  1 184 ? -14.874 -6.446  -25.581 1.00 121.78 ? 181  GLN B C   1 
ATOM   4037 O  O   . GLN B  1 184 ? -14.601 -7.364  -24.798 1.00 120.88 ? 181  GLN B O   1 
ATOM   4038 C  CB  . GLN B  1 184 ? -17.059 -7.701  -26.134 1.00 121.07 ? 181  GLN B CB  1 
ATOM   4039 N  N   . THR B  1 185 ? -14.058 -5.394  -25.812 1.00 117.15 ? 182  THR B N   1 
ATOM   4040 C  CA  . THR B  1 185 ? -12.750 -5.119  -25.202 1.00 116.09 ? 182  THR B CA  1 
ATOM   4041 C  C   . THR B  1 185 ? -12.536 -3.621  -25.086 1.00 118.36 ? 182  THR B C   1 
ATOM   4042 O  O   . THR B  1 185 ? -11.397 -3.154  -24.940 1.00 117.81 ? 182  THR B O   1 
ATOM   4043 C  CB  . THR B  1 185 ? -11.626 -5.703  -26.050 1.00 123.74 ? 182  THR B CB  1 
ATOM   4044 O  OG1 . THR B  1 185 ? -12.071 -5.975  -27.384 1.00 120.11 ? 182  THR B OG1 1 
ATOM   4045 C  CG2 . THR B  1 185 ? -11.010 -6.897  -25.412 1.00 123.44 ? 182  THR B CG2 1 
ATOM   4046 N  N   . LYS B  1 186 ? -13.656 -2.878  -25.147 1.00 113.51 ? 183  LYS B N   1 
ATOM   4047 C  CA  . LYS B  1 186 ? -13.798 -1.423  -25.098 1.00 112.44 ? 183  LYS B CA  1 
ATOM   4048 C  C   . LYS B  1 186 ? -12.963 -0.706  -24.002 1.00 112.78 ? 183  LYS B C   1 
ATOM   4049 O  O   . LYS B  1 186 ? -12.342 -1.342  -23.144 1.00 112.64 ? 183  LYS B O   1 
ATOM   4050 C  CB  . LYS B  1 186 ? -15.302 -1.055  -24.978 1.00 115.49 ? 183  LYS B CB  1 
ATOM   4051 C  CG  . LYS B  1 186 ? -16.001 -1.458  -23.661 1.00 128.09 ? 183  LYS B CG  1 
ATOM   4052 C  CD  . LYS B  1 186 ? -17.543 -1.470  -23.758 1.00 136.66 ? 183  LYS B CD  1 
ATOM   4053 C  CE  . LYS B  1 186 ? -18.216 -0.109  -23.798 1.00 143.73 ? 183  LYS B CE  1 
ATOM   4054 N  NZ  . LYS B  1 186 ? -18.463 0.356   -25.189 1.00 151.33 ? 183  LYS B NZ  1 
ATOM   4055 N  N   . ASN B  1 187 ? -12.958 0.630   -24.054 1.00 106.24 ? 184  ASN B N   1 
ATOM   4056 C  CA  . ASN B  1 187 ? -12.263 1.468   -23.086 1.00 104.92 ? 184  ASN B CA  1 
ATOM   4057 C  C   . ASN B  1 187 ? -12.901 1.345   -21.693 1.00 104.05 ? 184  ASN B C   1 
ATOM   4058 O  O   . ASN B  1 187 ? -12.198 1.440   -20.691 1.00 104.16 ? 184  ASN B O   1 
ATOM   4059 C  CB  . ASN B  1 187 ? -12.212 2.930   -23.569 1.00 108.05 ? 184  ASN B CB  1 
ATOM   4060 C  CG  . ASN B  1 187 ? -11.745 3.943   -22.538 1.00 131.73 ? 184  ASN B CG  1 
ATOM   4061 O  OD1 . ASN B  1 187 ? -10.636 3.874   -21.990 1.00 121.03 ? 184  ASN B OD1 1 
ATOM   4062 N  ND2 . ASN B  1 187 ? -12.593 4.915   -22.260 1.00 126.51 ? 184  ASN B ND2 1 
ATOM   4063 N  N   . HIS B  1 188 ? -14.234 1.131   -21.655 1.00 95.83  ? 185  HIS B N   1 
ATOM   4064 C  CA  . HIS B  1 188 ? -15.041 0.974   -20.443 1.00 93.23  ? 185  HIS B CA  1 
ATOM   4065 C  C   . HIS B  1 188 ? -14.694 -0.295  -19.662 1.00 89.09  ? 185  HIS B C   1 
ATOM   4066 O  O   . HIS B  1 188 ? -14.787 -0.282  -18.433 1.00 88.23  ? 185  HIS B O   1 
ATOM   4067 C  CB  . HIS B  1 188 ? -16.536 1.004   -20.784 1.00 94.26  ? 185  HIS B CB  1 
ATOM   4068 N  N   . VAL B  1 189 ? -14.313 -1.387  -20.370 1.00 79.91  ? 186  VAL B N   1 
ATOM   4069 C  CA  . VAL B  1 189 ? -13.892 -2.652  -19.751 1.00 77.05  ? 186  VAL B CA  1 
ATOM   4070 C  C   . VAL B  1 189 ? -12.513 -2.461  -19.072 1.00 78.18  ? 186  VAL B C   1 
ATOM   4071 O  O   . VAL B  1 189 ? -12.306 -2.939  -17.952 1.00 79.01  ? 186  VAL B O   1 
ATOM   4072 C  CB  . VAL B  1 189 ? -13.982 -3.861  -20.729 1.00 79.11  ? 186  VAL B CB  1 
ATOM   4073 C  CG1 . VAL B  1 189 ? -12.762 -4.774  -20.664 1.00 78.37  ? 186  VAL B CG1 1 
ATOM   4074 C  CG2 . VAL B  1 189 ? -15.249 -4.653  -20.468 1.00 78.57  ? 186  VAL B CG2 1 
ATOM   4075 N  N   . LEU B  1 190 ? -11.618 -1.701  -19.729 1.00 70.35  ? 187  LEU B N   1 
ATOM   4076 C  CA  . LEU B  1 190 ? -10.280 -1.348  -19.271 1.00 68.22  ? 187  LEU B CA  1 
ATOM   4077 C  C   . LEU B  1 190 ? -10.331 -0.500  -17.985 1.00 70.88  ? 187  LEU B C   1 
ATOM   4078 O  O   . LEU B  1 190 ? -9.444  -0.611  -17.148 1.00 71.74  ? 187  LEU B O   1 
ATOM   4079 C  CB  . LEU B  1 190 ? -9.554  -0.612  -20.412 1.00 67.86  ? 187  LEU B CB  1 
ATOM   4080 C  CG  . LEU B  1 190 ? -8.021  -0.597  -20.402 1.00 72.22  ? 187  LEU B CG  1 
ATOM   4081 C  CD1 . LEU B  1 190 ? -7.421  -2.011  -20.279 1.00 71.50  ? 187  LEU B CD1 1 
ATOM   4082 C  CD2 . LEU B  1 190 ? -7.498  0.062   -21.652 1.00 75.29  ? 187  LEU B CD2 1 
ATOM   4083 N  N   . VAL B  1 191 ? -11.374 0.317   -17.815 1.00 65.55  ? 188  VAL B N   1 
ATOM   4084 C  CA  . VAL B  1 191 ? -11.570 1.143   -16.623 1.00 64.44  ? 188  VAL B CA  1 
ATOM   4085 C  C   . VAL B  1 191 ? -12.043 0.234   -15.482 1.00 66.17  ? 188  VAL B C   1 
ATOM   4086 O  O   . VAL B  1 191 ? -11.594 0.425   -14.360 1.00 66.23  ? 188  VAL B O   1 
ATOM   4087 C  CB  . VAL B  1 191 ? -12.510 2.355   -16.889 1.00 68.74  ? 188  VAL B CB  1 
ATOM   4088 C  CG1 . VAL B  1 191 ? -12.821 3.136   -15.610 1.00 68.49  ? 188  VAL B CG1 1 
ATOM   4089 C  CG2 . VAL B  1 191 ? -11.908 3.282   -17.937 1.00 68.51  ? 188  VAL B CG2 1 
ATOM   4090 N  N   . LEU B  1 192 ? -12.885 -0.787  -15.775 1.00 60.84  ? 189  LEU B N   1 
ATOM   4091 C  CA  . LEU B  1 192 ? -13.342 -1.757  -14.771 1.00 59.76  ? 189  LEU B CA  1 
ATOM   4092 C  C   . LEU B  1 192 ? -12.220 -2.691  -14.335 1.00 58.65  ? 189  LEU B C   1 
ATOM   4093 O  O   . LEU B  1 192 ? -12.160 -3.073  -13.169 1.00 55.76  ? 189  LEU B O   1 
ATOM   4094 C  CB  . LEU B  1 192 ? -14.573 -2.534  -15.229 1.00 60.37  ? 189  LEU B CB  1 
ATOM   4095 C  CG  . LEU B  1 192 ? -15.883 -1.731  -15.135 1.00 66.56  ? 189  LEU B CG  1 
ATOM   4096 C  CD1 . LEU B  1 192 ? -16.967 -2.397  -15.897 1.00 67.99  ? 189  LEU B CD1 1 
ATOM   4097 C  CD2 . LEU B  1 192 ? -16.333 -1.497  -13.675 1.00 67.69  ? 189  LEU B CD2 1 
ATOM   4098 N  N   . HIS B  1 193 ? -11.310 -3.019  -15.267 1.00 54.67  ? 190  HIS B N   1 
ATOM   4099 C  CA  . HIS B  1 193 ? -10.128 -3.828  -15.010 1.00 53.51  ? 190  HIS B CA  1 
ATOM   4100 C  C   . HIS B  1 193 ? -9.264  -3.114  -14.004 1.00 57.31  ? 190  HIS B C   1 
ATOM   4101 O  O   . HIS B  1 193 ? -8.809  -3.764  -13.070 1.00 57.37  ? 190  HIS B O   1 
ATOM   4102 C  CB  . HIS B  1 193 ? -9.315  -4.064  -16.289 1.00 54.32  ? 190  HIS B CB  1 
ATOM   4103 C  CG  . HIS B  1 193 ? -7.866  -4.383  -16.029 1.00 57.29  ? 190  HIS B CG  1 
ATOM   4104 N  ND1 . HIS B  1 193 ? -7.479  -5.604  -15.495 1.00 58.66  ? 190  HIS B ND1 1 
ATOM   4105 C  CD2 . HIS B  1 193 ? -6.767  -3.613  -16.195 1.00 57.90  ? 190  HIS B CD2 1 
ATOM   4106 C  CE1 . HIS B  1 193 ? -6.169  -5.525  -15.349 1.00 57.59  ? 190  HIS B CE1 1 
ATOM   4107 N  NE2 . HIS B  1 193 ? -5.696  -4.348  -15.755 1.00 57.47  ? 190  HIS B NE2 1 
ATOM   4108 N  N   . TYR B  1 194 ? -9.029  -1.786  -14.180 1.00 53.51  ? 191  TYR B N   1 
ATOM   4109 C  CA  . TYR B  1 194 ? -8.170  -1.007  -13.284 1.00 52.67  ? 191  TYR B CA  1 
ATOM   4110 C  C   . TYR B  1 194 ? -8.754  -0.794  -11.899 1.00 56.89  ? 191  TYR B C   1 
ATOM   4111 O  O   . TYR B  1 194 ? -7.995  -0.895  -10.938 1.00 59.08  ? 191  TYR B O   1 
ATOM   4112 C  CB  . TYR B  1 194 ? -7.722  0.318   -13.908 1.00 53.79  ? 191  TYR B CB  1 
ATOM   4113 C  CG  . TYR B  1 194 ? -6.521  0.132   -14.810 1.00 55.13  ? 191  TYR B CG  1 
ATOM   4114 C  CD1 . TYR B  1 194 ? -5.294  -0.260  -14.293 1.00 57.29  ? 191  TYR B CD1 1 
ATOM   4115 C  CD2 . TYR B  1 194 ? -6.633  0.274   -16.196 1.00 54.74  ? 191  TYR B CD2 1 
ATOM   4116 C  CE1 . TYR B  1 194 ? -4.210  -0.518  -15.126 1.00 58.47  ? 191  TYR B CE1 1 
ATOM   4117 C  CE2 . TYR B  1 194 ? -5.552  0.031   -17.037 1.00 54.16  ? 191  TYR B CE2 1 
ATOM   4118 C  CZ  . TYR B  1 194 ? -4.343  -0.360  -16.495 1.00 62.69  ? 191  TYR B CZ  1 
ATOM   4119 O  OH  . TYR B  1 194 ? -3.262  -0.598  -17.291 1.00 65.82  ? 191  TYR B OH  1 
ATOM   4120 N  N   . VAL B  1 195 ? -10.072 -0.547  -11.769 1.00 51.38  ? 192  VAL B N   1 
ATOM   4121 C  CA  . VAL B  1 195 ? -10.723 -0.363  -10.458 1.00 50.77  ? 192  VAL B CA  1 
ATOM   4122 C  C   . VAL B  1 195 ? -10.629 -1.679  -9.678  1.00 54.64  ? 192  VAL B C   1 
ATOM   4123 O  O   . VAL B  1 195 ? -10.261 -1.653  -8.504  1.00 55.16  ? 192  VAL B O   1 
ATOM   4124 C  CB  . VAL B  1 195 ? -12.187 0.185   -10.527 1.00 54.20  ? 192  VAL B CB  1 
ATOM   4125 C  CG1 . VAL B  1 195 ? -12.693 0.579   -9.136  1.00 53.76  ? 192  VAL B CG1 1 
ATOM   4126 C  CG2 . VAL B  1 195 ? -12.279 1.391   -11.445 1.00 53.67  ? 192  VAL B CG2 1 
ATOM   4127 N  N   . SER B  1 196 ? -10.898 -2.823  -10.367 1.00 49.74  ? 193  SER B N   1 
ATOM   4128 C  CA  . SER B  1 196 ? -10.827 -4.198  -9.854  1.00 48.04  ? 193  SER B CA  1 
ATOM   4129 C  C   . SER B  1 196 ? -9.397  -4.559  -9.402  1.00 52.91  ? 193  SER B C   1 
ATOM   4130 O  O   . SER B  1 196 ? -9.223  -5.137  -8.322  1.00 52.87  ? 193  SER B O   1 
ATOM   4131 C  CB  . SER B  1 196 ? -11.326 -5.186  -10.908 1.00 47.90  ? 193  SER B CB  1 
ATOM   4132 O  OG  . SER B  1 196 ? -10.970 -6.529  -10.609 1.00 48.21  ? 193  SER B OG  1 
ATOM   4133 N  N   . LEU B  1 197 ? -8.382  -4.198  -10.231 1.00 49.41  ? 194  LEU B N   1 
ATOM   4134 C  CA  . LEU B  1 197 ? -6.959  -4.415  -9.970  1.00 49.47  ? 194  LEU B CA  1 
ATOM   4135 C  C   . LEU B  1 197 ? -6.524  -3.707  -8.699  1.00 53.46  ? 194  LEU B C   1 
ATOM   4136 O  O   . LEU B  1 197 ? -5.800  -4.287  -7.899  1.00 51.80  ? 194  LEU B O   1 
ATOM   4137 C  CB  . LEU B  1 197 ? -6.125  -3.889  -11.151 1.00 49.90  ? 194  LEU B CB  1 
ATOM   4138 C  CG  . LEU B  1 197 ? -4.612  -4.081  -11.081 1.00 55.32  ? 194  LEU B CG  1 
ATOM   4139 C  CD1 . LEU B  1 197 ? -4.250  -5.547  -11.061 1.00 55.65  ? 194  LEU B CD1 1 
ATOM   4140 C  CD2 . LEU B  1 197 ? -3.916  -3.377  -12.236 1.00 58.56  ? 194  LEU B CD2 1 
ATOM   4141 N  N   . PHE B  1 198 ? -6.961  -2.454  -8.516  1.00 51.28  ? 195  PHE B N   1 
ATOM   4142 C  CA  . PHE B  1 198 ? -6.579  -1.660  -7.361  1.00 51.01  ? 195  PHE B CA  1 
ATOM   4143 C  C   . PHE B  1 198 ? -7.322  -2.062  -6.074  1.00 54.16  ? 195  PHE B C   1 
ATOM   4144 O  O   . PHE B  1 198 ? -6.685  -2.338  -5.063  1.00 53.36  ? 195  PHE B O   1 
ATOM   4145 C  CB  . PHE B  1 198 ? -6.695  -0.144  -7.676  1.00 52.81  ? 195  PHE B CB  1 
ATOM   4146 C  CG  . PHE B  1 198 ? -5.451  0.377   -8.364  1.00 54.56  ? 195  PHE B CG  1 
ATOM   4147 C  CD1 . PHE B  1 198 ? -4.322  0.729   -7.627  1.00 57.13  ? 195  PHE B CD1 1 
ATOM   4148 C  CD2 . PHE B  1 198 ? -5.369  0.421   -9.756  1.00 56.90  ? 195  PHE B CD2 1 
ATOM   4149 C  CE1 . PHE B  1 198 ? -3.151  1.151   -8.269  1.00 57.82  ? 195  PHE B CE1 1 
ATOM   4150 C  CE2 . PHE B  1 198 ? -4.190  0.835   -10.401 1.00 59.27  ? 195  PHE B CE2 1 
ATOM   4151 C  CZ  . PHE B  1 198 ? -3.092  1.198   -9.653  1.00 56.93  ? 195  PHE B CZ  1 
ATOM   4152 N  N   . VAL B  1 199 ? -8.643  -2.090  -6.118  1.00 51.83  ? 196  VAL B N   1 
ATOM   4153 C  CA  . VAL B  1 199 ? -9.518  -2.388  -4.986  1.00 52.71  ? 196  VAL B CA  1 
ATOM   4154 C  C   . VAL B  1 199 ? -9.418  -3.860  -4.570  1.00 56.90  ? 196  VAL B C   1 
ATOM   4155 O  O   . VAL B  1 199 ? -9.401  -4.143  -3.364  1.00 57.12  ? 196  VAL B O   1 
ATOM   4156 C  CB  . VAL B  1 199 ? -10.987 -1.952  -5.319  1.00 57.13  ? 196  VAL B CB  1 
ATOM   4157 C  CG1 . VAL B  1 199 ? -11.994 -2.461  -4.295  1.00 56.97  ? 196  VAL B CG1 1 
ATOM   4158 C  CG2 . VAL B  1 199 ? -11.097 -0.434  -5.492  1.00 56.83  ? 196  VAL B CG2 1 
ATOM   4159 N  N   . GLY B  1 200 ? -9.345  -4.763  -5.563  1.00 51.38  ? 197  GLY B N   1 
ATOM   4160 C  CA  . GLY B  1 200 ? -9.331  -6.209  -5.353  1.00 50.27  ? 197  GLY B CA  1 
ATOM   4161 C  C   . GLY B  1 200 ? -8.003  -6.921  -5.243  1.00 53.64  ? 197  GLY B C   1 
ATOM   4162 O  O   . GLY B  1 200 ? -7.980  -8.068  -4.809  1.00 55.18  ? 197  GLY B O   1 
ATOM   4163 N  N   . PHE B  1 201 ? -6.896  -6.281  -5.640  1.00 49.86  ? 198  PHE B N   1 
ATOM   4164 C  CA  . PHE B  1 201 ? -5.558  -6.887  -5.571  1.00 49.29  ? 198  PHE B CA  1 
ATOM   4165 C  C   . PHE B  1 201 ? -4.444  -5.969  -5.018  1.00 54.86  ? 198  PHE B C   1 
ATOM   4166 O  O   . PHE B  1 201 ? -3.761  -6.413  -4.100  1.00 55.91  ? 198  PHE B O   1 
ATOM   4167 C  CB  . PHE B  1 201 ? -5.112  -7.493  -6.915  1.00 50.32  ? 198  PHE B CB  1 
ATOM   4168 C  CG  . PHE B  1 201 ? -3.755  -8.161  -6.819  1.00 51.50  ? 198  PHE B CG  1 
ATOM   4169 C  CD1 . PHE B  1 201 ? -3.563  -9.279  -6.003  1.00 53.65  ? 198  PHE B CD1 1 
ATOM   4170 C  CD2 . PHE B  1 201 ? -2.663  -7.656  -7.512  1.00 52.94  ? 198  PHE B CD2 1 
ATOM   4171 C  CE1 . PHE B  1 201 ? -2.305  -9.867  -5.879  1.00 53.78  ? 198  PHE B CE1 1 
ATOM   4172 C  CE2 . PHE B  1 201 ? -1.405  -8.257  -7.392  1.00 55.15  ? 198  PHE B CE2 1 
ATOM   4173 C  CZ  . PHE B  1 201 ? -1.237  -9.342  -6.562  1.00 52.94  ? 198  PHE B CZ  1 
ATOM   4174 N  N   . ILE B  1 202 ? -4.226  -4.743  -5.581  1.00 50.88  ? 199  ILE B N   1 
ATOM   4175 C  CA  . ILE B  1 202 ? -3.152  -3.823  -5.148  1.00 50.38  ? 199  ILE B CA  1 
ATOM   4176 C  C   . ILE B  1 202 ? -3.341  -3.371  -3.693  1.00 54.10  ? 199  ILE B C   1 
ATOM   4177 O  O   . ILE B  1 202 ? -2.401  -3.494  -2.914  1.00 54.58  ? 199  ILE B O   1 
ATOM   4178 C  CB  . ILE B  1 202 ? -2.918  -2.601  -6.097  1.00 53.37  ? 199  ILE B CB  1 
ATOM   4179 C  CG1 . ILE B  1 202 ? -2.740  -3.007  -7.608  1.00 53.81  ? 199  ILE B CG1 1 
ATOM   4180 C  CG2 . ILE B  1 202 ? -1.768  -1.699  -5.609  1.00 53.71  ? 199  ILE B CG2 1 
ATOM   4181 C  CD1 . ILE B  1 202 ? -1.478  -3.664  -8.069  1.00 61.40  ? 199  ILE B CD1 1 
ATOM   4182 N  N   . ILE B  1 203 ? -4.522  -2.824  -3.328  1.00 48.95  ? 200  ILE B N   1 
ATOM   4183 C  CA  . ILE B  1 203 ? -4.738  -2.352  -1.954  1.00 48.04  ? 200  ILE B CA  1 
ATOM   4184 C  C   . ILE B  1 203 ? -4.611  -3.528  -0.972  1.00 53.64  ? 200  ILE B C   1 
ATOM   4185 O  O   . ILE B  1 203 ? -3.796  -3.399  -0.058  1.00 53.54  ? 200  ILE B O   1 
ATOM   4186 C  CB  . ILE B  1 203 ? -6.010  -1.465  -1.725  1.00 50.33  ? 200  ILE B CB  1 
ATOM   4187 C  CG1 . ILE B  1 203 ? -5.862  -0.103  -2.451  1.00 49.37  ? 200  ILE B CG1 1 
ATOM   4188 C  CG2 . ILE B  1 203 ? -6.268  -1.236  -0.209  1.00 50.64  ? 200  ILE B CG2 1 
ATOM   4189 C  CD1 . ILE B  1 203 ? -7.109  0.749   -2.519  1.00 48.59  ? 200  ILE B CD1 1 
ATOM   4190 N  N   . PRO B  1 204 ? -5.305  -4.694  -1.149  1.00 51.44  ? 201  PRO B N   1 
ATOM   4191 C  CA  . PRO B  1 204 ? -5.108  -5.806  -0.206  1.00 50.94  ? 201  PRO B CA  1 
ATOM   4192 C  C   . PRO B  1 204 ? -3.647  -6.278  -0.103  1.00 54.58  ? 201  PRO B C   1 
ATOM   4193 O  O   . PRO B  1 204 ? -3.176  -6.502  1.014   1.00 54.30  ? 201  PRO B O   1 
ATOM   4194 C  CB  . PRO B  1 204 ? -6.022  -6.890  -0.768  1.00 52.88  ? 201  PRO B CB  1 
ATOM   4195 C  CG  . PRO B  1 204 ? -7.044  -6.164  -1.530  1.00 56.57  ? 201  PRO B CG  1 
ATOM   4196 C  CD  . PRO B  1 204 ? -6.315  -5.058  -2.168  1.00 52.18  ? 201  PRO B CD  1 
ATOM   4197 N  N   . PHE B  1 205 ? -2.917  -6.389  -1.241  1.00 51.82  ? 202  PHE B N   1 
ATOM   4198 C  CA  . PHE B  1 205 ? -1.495  -6.765  -1.235  1.00 52.04  ? 202  PHE B CA  1 
ATOM   4199 C  C   . PHE B  1 205 ? -0.597  -5.766  -0.445  1.00 56.20  ? 202  PHE B C   1 
ATOM   4200 O  O   . PHE B  1 205 ? 0.254   -6.214  0.325   1.00 55.08  ? 202  PHE B O   1 
ATOM   4201 C  CB  . PHE B  1 205 ? -0.951  -6.982  -2.653  1.00 53.95  ? 202  PHE B CB  1 
ATOM   4202 C  CG  . PHE B  1 205 ? 0.311   -7.814  -2.736  1.00 57.02  ? 202  PHE B CG  1 
ATOM   4203 C  CD1 . PHE B  1 205 ? 0.685   -8.657  -1.688  1.00 61.52  ? 202  PHE B CD1 1 
ATOM   4204 C  CD2 . PHE B  1 205 ? 1.081   -7.823  -3.889  1.00 60.53  ? 202  PHE B CD2 1 
ATOM   4205 C  CE1 . PHE B  1 205 ? 1.822   -9.467  -1.784  1.00 62.90  ? 202  PHE B CE1 1 
ATOM   4206 C  CE2 . PHE B  1 205 ? 2.232   -8.618  -3.978  1.00 63.64  ? 202  PHE B CE2 1 
ATOM   4207 C  CZ  . PHE B  1 205 ? 2.592   -9.438  -2.926  1.00 61.85  ? 202  PHE B CZ  1 
ATOM   4208 N  N   . VAL B  1 206 ? -0.801  -4.436  -0.620  1.00 53.60  ? 203  VAL B N   1 
ATOM   4209 C  CA  . VAL B  1 206 ? -0.029  -3.413  0.091   1.00 54.38  ? 203  VAL B CA  1 
ATOM   4210 C  C   . VAL B  1 206 ? -0.246  -3.532  1.622   1.00 58.78  ? 203  VAL B C   1 
ATOM   4211 O  O   . VAL B  1 206 ? 0.743   -3.512  2.358   1.00 57.89  ? 203  VAL B O   1 
ATOM   4212 C  CB  . VAL B  1 206 ? -0.233  -1.973  -0.461  1.00 58.42  ? 203  VAL B CB  1 
ATOM   4213 C  CG1 . VAL B  1 206 ? 0.392   -0.925  0.457   1.00 58.45  ? 203  VAL B CG1 1 
ATOM   4214 C  CG2 . VAL B  1 206 ? 0.348   -1.846  -1.863  1.00 58.05  ? 203  VAL B CG2 1 
ATOM   4215 N  N   . ILE B  1 207 ? -1.516  -3.698  2.080   1.00 55.71  ? 204  ILE B N   1 
ATOM   4216 C  CA  . ILE B  1 207 ? -1.883  -3.896  3.498   1.00 56.57  ? 204  ILE B CA  1 
ATOM   4217 C  C   . ILE B  1 207 ? -1.109  -5.104  4.080   1.00 63.29  ? 204  ILE B C   1 
ATOM   4218 O  O   . ILE B  1 207 ? -0.565  -4.981  5.181   1.00 62.77  ? 204  ILE B O   1 
ATOM   4219 C  CB  . ILE B  1 207 ? -3.430  -4.014  3.699   1.00 59.65  ? 204  ILE B CB  1 
ATOM   4220 C  CG1 . ILE B  1 207 ? -4.132  -2.695  3.307   1.00 60.14  ? 204  ILE B CG1 1 
ATOM   4221 C  CG2 . ILE B  1 207 ? -3.806  -4.454  5.148   1.00 59.87  ? 204  ILE B CG2 1 
ATOM   4222 C  CD1 . ILE B  1 207 ? -5.634  -2.809  3.087   1.00 66.89  ? 204  ILE B CD1 1 
ATOM   4223 N  N   . ILE B  1 208 ? -1.004  -6.228  3.297   1.00 60.57  ? 205  ILE B N   1 
ATOM   4224 C  CA  . ILE B  1 208 ? -0.253  -7.445  3.639   1.00 60.14  ? 205  ILE B CA  1 
ATOM   4225 C  C   . ILE B  1 208 ? 1.241   -7.100  3.756   1.00 64.00  ? 205  ILE B C   1 
ATOM   4226 O  O   . ILE B  1 208 ? 1.821   -7.359  4.814   1.00 64.34  ? 205  ILE B O   1 
ATOM   4227 C  CB  . ILE B  1 208 ? -0.595  -8.647  2.679   1.00 62.88  ? 205  ILE B CB  1 
ATOM   4228 C  CG1 . ILE B  1 208 ? -1.768  -9.428  3.236   1.00 62.82  ? 205  ILE B CG1 1 
ATOM   4229 C  CG2 . ILE B  1 208 ? 0.589   -9.616  2.399   1.00 63.10  ? 205  ILE B CG2 1 
ATOM   4230 C  CD1 . ILE B  1 208 ? -2.755  -9.644  2.311   1.00 72.23  ? 205  ILE B CD1 1 
ATOM   4231 N  N   . ILE B  1 209 ? 1.844   -6.451  2.719   1.00 60.31  ? 206  ILE B N   1 
ATOM   4232 C  CA  . ILE B  1 209 ? 3.268   -6.047  2.763   1.00 60.28  ? 206  ILE B CA  1 
ATOM   4233 C  C   . ILE B  1 209 ? 3.566   -5.282  4.078   1.00 63.78  ? 206  ILE B C   1 
ATOM   4234 O  O   . ILE B  1 209 ? 4.437   -5.700  4.826   1.00 63.63  ? 206  ILE B O   1 
ATOM   4235 C  CB  . ILE B  1 209 ? 3.732   -5.236  1.506   1.00 63.10  ? 206  ILE B CB  1 
ATOM   4236 C  CG1 . ILE B  1 209 ? 3.394   -5.930  0.155   1.00 63.32  ? 206  ILE B CG1 1 
ATOM   4237 C  CG2 . ILE B  1 209 ? 5.206   -4.876  1.584   1.00 64.18  ? 206  ILE B CG2 1 
ATOM   4238 C  CD1 . ILE B  1 209 ? 4.129   -7.141  -0.217  1.00 78.71  ? 206  ILE B CD1 1 
ATOM   4239 N  N   . VAL B  1 210 ? 2.789   -4.221  4.379   1.00 60.86  ? 207  VAL B N   1 
ATOM   4240 C  CA  . VAL B  1 210 ? 2.937   -3.375  5.573   1.00 61.33  ? 207  VAL B CA  1 
ATOM   4241 C  C   . VAL B  1 210 ? 2.756   -4.173  6.880   1.00 67.56  ? 207  VAL B C   1 
ATOM   4242 O  O   . VAL B  1 210 ? 3.660   -4.133  7.714   1.00 67.71  ? 207  VAL B O   1 
ATOM   4243 C  CB  . VAL B  1 210 ? 2.066   -2.092  5.536   1.00 64.51  ? 207  VAL B CB  1 
ATOM   4244 C  CG1 . VAL B  1 210 ? 2.217   -1.286  6.826   1.00 63.91  ? 207  VAL B CG1 1 
ATOM   4245 C  CG2 . VAL B  1 210 ? 2.431   -1.224  4.336   1.00 64.29  ? 207  VAL B CG2 1 
ATOM   4246 N  N   . CYS B  1 211 ? 1.622   -4.896  7.050   1.00 65.27  ? 208  CYS B N   1 
ATOM   4247 C  CA  . CYS B  1 211 ? 1.350   -5.735  8.234   1.00 64.96  ? 208  CYS B CA  1 
ATOM   4248 C  C   . CYS B  1 211 ? 2.455   -6.744  8.495   1.00 68.08  ? 208  CYS B C   1 
ATOM   4249 O  O   . CYS B  1 211 ? 2.887   -6.882  9.640   1.00 67.86  ? 208  CYS B O   1 
ATOM   4250 C  CB  . CYS B  1 211 ? 0.003   -6.432  8.127   1.00 65.43  ? 208  CYS B CB  1 
ATOM   4251 S  SG  . CYS B  1 211 ? -1.400  -5.341  8.391   1.00 69.97  ? 208  CYS B SG  1 
ATOM   4252 N  N   . TYR B  1 212 ? 2.925   -7.432  7.441   1.00 63.12  ? 209  TYR B N   1 
ATOM   4253 C  CA  . TYR B  1 212 ? 3.977   -8.431  7.590   1.00 62.55  ? 209  TYR B CA  1 
ATOM   4254 C  C   . TYR B  1 212 ? 5.318   -7.811  7.927   1.00 69.74  ? 209  TYR B C   1 
ATOM   4255 O  O   . TYR B  1 212 ? 6.095   -8.436  8.637   1.00 69.81  ? 209  TYR B O   1 
ATOM   4256 C  CB  . TYR B  1 212 ? 4.057   -9.374  6.377   1.00 61.99  ? 209  TYR B CB  1 
ATOM   4257 C  CG  . TYR B  1 212 ? 2.881   -10.326 6.250   1.00 60.21  ? 209  TYR B CG  1 
ATOM   4258 C  CD1 . TYR B  1 212 ? 1.917   -10.420 7.257   1.00 60.79  ? 209  TYR B CD1 1 
ATOM   4259 C  CD2 . TYR B  1 212 ? 2.733   -11.136 5.127   1.00 59.90  ? 209  TYR B CD2 1 
ATOM   4260 C  CE1 . TYR B  1 212 ? 0.833   -11.285 7.140   1.00 59.02  ? 209  TYR B CE1 1 
ATOM   4261 C  CE2 . TYR B  1 212 ? 1.662   -12.019 5.011   1.00 60.07  ? 209  TYR B CE2 1 
ATOM   4262 C  CZ  . TYR B  1 212 ? 0.713   -12.082 6.018   1.00 64.21  ? 209  TYR B CZ  1 
ATOM   4263 O  OH  . TYR B  1 212 ? -0.347  -12.932 5.907   1.00 65.89  ? 209  TYR B OH  1 
ATOM   4264 N  N   . THR B  1 213 ? 5.567   -6.568  7.476   1.00 69.52  ? 210  THR B N   1 
ATOM   4265 C  CA  . THR B  1 213 ? 6.790   -5.834  7.816   1.00 70.86  ? 210  THR B CA  1 
ATOM   4266 C  C   . THR B  1 213 ? 6.778   -5.557  9.334   1.00 79.18  ? 210  THR B C   1 
ATOM   4267 O  O   . THR B  1 213 ? 7.767   -5.849  10.001  1.00 79.21  ? 210  THR B O   1 
ATOM   4268 C  CB  . THR B  1 213 ? 6.958   -4.573  6.940   1.00 67.59  ? 210  THR B CB  1 
ATOM   4269 O  OG1 . THR B  1 213 ? 7.060   -4.976  5.570   1.00 58.67  ? 210  THR B OG1 1 
ATOM   4270 C  CG2 . THR B  1 213 ? 8.194   -3.767  7.305   1.00 65.43  ? 210  THR B CG2 1 
ATOM   4271 N  N   . MET B  1 214 ? 5.638   -5.074  9.872   1.00 77.86  ? 211  MET B N   1 
ATOM   4272 C  CA  . MET B  1 214 ? 5.447   -4.778  11.288  1.00 79.29  ? 211  MET B CA  1 
ATOM   4273 C  C   . MET B  1 214 ? 5.577   -5.993  12.185  1.00 85.09  ? 211  MET B C   1 
ATOM   4274 O  O   . MET B  1 214 ? 6.184   -5.875  13.248  1.00 86.21  ? 211  MET B O   1 
ATOM   4275 C  CB  . MET B  1 214 ? 4.107   -4.105  11.522  1.00 82.38  ? 211  MET B CB  1 
ATOM   4276 C  CG  . MET B  1 214 ? 4.130   -2.633  11.242  1.00 87.28  ? 211  MET B CG  1 
ATOM   4277 S  SD  . MET B  1 214 ? 2.484   -1.923  11.454  1.00 93.21  ? 211  MET B SD  1 
ATOM   4278 C  CE  . MET B  1 214 ? 2.751   -0.853  12.926  1.00 90.27  ? 211  MET B CE  1 
ATOM   4279 N  N   . ILE B  1 215 ? 5.017   -7.154  11.766  1.00 81.80  ? 212  ILE B N   1 
ATOM   4280 C  CA  . ILE B  1 215 ? 5.082   -8.433  12.499  1.00 81.38  ? 212  ILE B CA  1 
ATOM   4281 C  C   . ILE B  1 215 ? 6.532   -8.917  12.579  1.00 85.64  ? 212  ILE B C   1 
ATOM   4282 O  O   . ILE B  1 215 ? 7.001   -9.213  13.675  1.00 85.35  ? 212  ILE B O   1 
ATOM   4283 C  CB  . ILE B  1 215 ? 4.108   -9.527  11.937  1.00 83.83  ? 212  ILE B CB  1 
ATOM   4284 C  CG1 . ILE B  1 215 ? 2.621   -9.116  12.127  1.00 83.60  ? 212  ILE B CG1 1 
ATOM   4285 C  CG2 . ILE B  1 215 ? 4.383   -10.908 12.569  1.00 84.41  ? 212  ILE B CG2 1 
ATOM   4286 C  CD1 . ILE B  1 215 ? 1.598   -9.897  11.264  1.00 84.79  ? 212  ILE B CD1 1 
ATOM   4287 N  N   . ILE B  1 216 ? 7.243   -8.955  11.437  1.00 82.78  ? 213  ILE B N   1 
ATOM   4288 C  CA  . ILE B  1 216 ? 8.634   -9.413  11.370  1.00 82.88  ? 213  ILE B CA  1 
ATOM   4289 C  C   . ILE B  1 216 ? 9.565   -8.541  12.244  1.00 89.13  ? 213  ILE B C   1 
ATOM   4290 O  O   . ILE B  1 216 ? 10.385  -9.111  12.959  1.00 89.07  ? 213  ILE B O   1 
ATOM   4291 C  CB  . ILE B  1 216 ? 9.115   -9.570  9.901   1.00 85.35  ? 213  ILE B CB  1 
ATOM   4292 C  CG1 . ILE B  1 216 ? 8.455   -10.813 9.262   1.00 85.34  ? 213  ILE B CG1 1 
ATOM   4293 C  CG2 . ILE B  1 216 ? 10.647  -9.642  9.788   1.00 85.64  ? 213  ILE B CG2 1 
ATOM   4294 C  CD1 . ILE B  1 216 ? 8.337   -10.778 7.744   1.00 92.71  ? 213  ILE B CD1 1 
ATOM   4295 N  N   . LEU B  1 217 ? 9.412   -7.192  12.227  1.00 86.84  ? 214  LEU B N   1 
ATOM   4296 C  CA  . LEU B  1 217 ? 10.219  -6.272  13.037  1.00 86.80  ? 214  LEU B CA  1 
ATOM   4297 C  C   . LEU B  1 217 ? 9.946   -6.440  14.522  1.00 93.20  ? 214  LEU B C   1 
ATOM   4298 O  O   . LEU B  1 217 ? 10.891  -6.411  15.303  1.00 93.95  ? 214  LEU B O   1 
ATOM   4299 C  CB  . LEU B  1 217 ? 10.036  -4.824  12.617  1.00 86.87  ? 214  LEU B CB  1 
ATOM   4300 C  CG  . LEU B  1 217 ? 10.497  -4.469  11.196  1.00 92.11  ? 214  LEU B CG  1 
ATOM   4301 C  CD1 . LEU B  1 217 ? 10.018  -3.078  10.798  1.00 92.33  ? 214  LEU B CD1 1 
ATOM   4302 C  CD2 . LEU B  1 217 ? 12.007  -4.609  11.029  1.00 94.37  ? 214  LEU B CD2 1 
ATOM   4303 N  N   . THR B  1 218 ? 8.673   -6.672  14.905  1.00 90.55  ? 215  THR B N   1 
ATOM   4304 C  CA  . THR B  1 218 ? 8.244   -6.938  16.287  1.00 90.80  ? 215  THR B CA  1 
ATOM   4305 C  C   . THR B  1 218 ? 8.852   -8.259  16.765  1.00 98.16  ? 215  THR B C   1 
ATOM   4306 O  O   . THR B  1 218 ? 9.372   -8.323  17.883  1.00 98.73  ? 215  THR B O   1 
ATOM   4307 C  CB  . THR B  1 218 ? 6.703   -6.974  16.369  1.00 93.73  ? 215  THR B CB  1 
ATOM   4308 O  OG1 . THR B  1 218 ? 6.199   -5.712  15.950  1.00 95.20  ? 215  THR B OG1 1 
ATOM   4309 C  CG2 . THR B  1 218 ? 6.181   -7.312  17.763  1.00 88.59  ? 215  THR B CG2 1 
ATOM   4310 N  N   . LEU B  1 219 ? 8.801   -9.301  15.906  1.00 96.64  ? 216  LEU B N   1 
ATOM   4311 C  CA  . LEU B  1 219 ? 9.332   -10.629 16.210  1.00 97.15  ? 216  LEU B CA  1 
ATOM   4312 C  C   . LEU B  1 219 ? 10.856  -10.634 16.415  1.00 103.87 ? 216  LEU B C   1 
ATOM   4313 O  O   . LEU B  1 219 ? 11.346  -11.438 17.206  1.00 104.13 ? 216  LEU B O   1 
ATOM   4314 C  CB  . LEU B  1 219 ? 8.889   -11.679 15.167  1.00 96.87  ? 216  LEU B CB  1 
ATOM   4315 C  CG  . LEU B  1 219 ? 7.423   -12.126 15.202  1.00 101.32 ? 216  LEU B CG  1 
ATOM   4316 C  CD1 . LEU B  1 219 ? 7.160   -13.216 14.176  1.00 101.67 ? 216  LEU B CD1 1 
ATOM   4317 C  CD2 . LEU B  1 219 ? 7.028   -12.627 16.561  1.00 103.85 ? 216  LEU B CD2 1 
ATOM   4318 N  N   . LEU B  1 220 ? 11.589  -9.726  15.731  1.00 101.71 ? 217  LEU B N   1 
ATOM   4319 C  CA  . LEU B  1 220 ? 13.042  -9.574  15.859  1.00 102.52 ? 217  LEU B CA  1 
ATOM   4320 C  C   . LEU B  1 220 ? 13.383  -8.908  17.180  1.00 107.52 ? 217  LEU B C   1 
ATOM   4321 O  O   . LEU B  1 220 ? 14.288  -9.382  17.864  1.00 107.72 ? 217  LEU B O   1 
ATOM   4322 C  CB  . LEU B  1 220 ? 13.648  -8.761  14.707  1.00 102.88 ? 217  LEU B CB  1 
ATOM   4323 C  CG  . LEU B  1 220 ? 13.893  -9.514  13.415  1.00 108.40 ? 217  LEU B CG  1 
ATOM   4324 C  CD1 . LEU B  1 220 ? 14.070  -8.559  12.276  1.00 109.09 ? 217  LEU B CD1 1 
ATOM   4325 C  CD2 . LEU B  1 220 ? 15.103  -10.405 13.511  1.00 110.99 ? 217  LEU B CD2 1 
ATOM   4326 N  N   . LYS B  1 221 ? 12.651  -7.819  17.540  1.00 103.98 ? 218  LYS B N   1 
ATOM   4327 C  CA  . LYS B  1 221 ? 12.811  -7.063  18.786  1.00 103.83 ? 218  LYS B CA  1 
ATOM   4328 C  C   . LYS B  1 221 ? 12.661  -7.991  19.992  1.00 108.93 ? 218  LYS B C   1 
ATOM   4329 O  O   . LYS B  1 221 ? 13.492  -7.942  20.902  1.00 108.12 ? 218  LYS B O   1 
ATOM   4330 C  CB  . LYS B  1 221 ? 11.785  -5.914  18.870  1.00 105.87 ? 218  LYS B CB  1 
ATOM   4331 C  CG  . LYS B  1 221 ? 12.205  -4.787  19.814  1.00 116.33 ? 218  LYS B CG  1 
ATOM   4332 C  CD  . LYS B  1 221 ? 11.022  -3.967  20.283  1.00 124.39 ? 218  LYS B CD  1 
ATOM   4333 N  N   . LYS B  1 222 ? 11.622  -8.855  19.970  1.00 106.78 ? 219  LYS B N   1 
ATOM   4334 C  CA  . LYS B  1 222 ? 11.341  -9.828  21.022  1.00 107.36 ? 219  LYS B CA  1 
ATOM   4335 C  C   . LYS B  1 222 ? 12.357  -10.989 21.021  1.00 114.89 ? 219  LYS B C   1 
ATOM   4336 O  O   . LYS B  1 222 ? 12.658  -11.537 22.087  1.00 115.14 ? 219  LYS B O   1 
ATOM   4337 C  CB  . LYS B  1 222 ? 9.899   -10.351 20.902  1.00 109.44 ? 219  LYS B CB  1 
ATOM   4338 C  CG  . LYS B  1 222 ? 8.829   -9.335  21.273  1.00 121.26 ? 219  LYS B CG  1 
ATOM   4339 N  N   . SER B  1 223 ? 12.873  -11.364 19.828  1.00 113.47 ? 220  SER B N   1 
ATOM   4340 C  CA  . SER B  1 223 ? 13.847  -12.445 19.659  1.00 114.25 ? 220  SER B CA  1 
ATOM   4341 C  C   . SER B  1 223 ? 15.237  -12.041 20.150  1.00 119.52 ? 220  SER B C   1 
ATOM   4342 O  O   . SER B  1 223 ? 15.968  -12.889 20.670  1.00 119.77 ? 220  SER B O   1 
ATOM   4343 C  CB  . SER B  1 223 ? 13.916  -12.880 18.200  1.00 118.93 ? 220  SER B CB  1 
ATOM   4344 O  OG  . SER B  1 223 ? 14.818  -13.960 18.023  1.00 131.28 ? 220  SER B OG  1 
ATOM   4345 N  N   . MET B  1 224 ? 15.607  -10.760 19.963  1.00 116.33 ? 221  MET B N   1 
ATOM   4346 C  CA  . MET B  1 224 ? 16.890  -10.205 20.394  1.00 116.44 ? 221  MET B CA  1 
ATOM   4347 C  C   . MET B  1 224 ? 16.934  -9.996  21.901  1.00 120.61 ? 221  MET B C   1 
ATOM   4348 O  O   . MET B  1 224 ? 17.963  -10.269 22.518  1.00 120.21 ? 221  MET B O   1 
ATOM   4349 C  CB  . MET B  1 224 ? 17.197  -8.903  19.664  1.00 118.88 ? 221  MET B CB  1 
ATOM   4350 C  CG  . MET B  1 224 ? 17.848  -9.128  18.333  1.00 122.76 ? 221  MET B CG  1 
ATOM   4351 S  SD  . MET B  1 224 ? 18.179  -7.571  17.504  1.00 127.39 ? 221  MET B SD  1 
ATOM   4352 C  CE  . MET B  1 224 ? 16.633  -7.320  16.625  1.00 124.03 ? 221  MET B CE  1 
ATOM   4353 N  N   . LYS B  1 225 ? 15.818  -9.526  22.492  1.00 117.49 ? 222  LYS B N   1 
ATOM   4354 C  CA  . LYS B  1 225 ? 15.676  -9.315  23.929  1.00 117.69 ? 222  LYS B CA  1 
ATOM   4355 C  C   . LYS B  1 225 ? 15.781  -10.646 24.688  1.00 123.38 ? 222  LYS B C   1 
ATOM   4356 O  O   . LYS B  1 225 ? 16.396  -10.683 25.753  1.00 123.32 ? 222  LYS B O   1 
ATOM   4357 C  CB  . LYS B  1 225 ? 14.351  -8.608  24.245  1.00 119.98 ? 222  LYS B CB  1 
ATOM   4358 N  N   . SER B  1 226 ? 15.224  -11.740 24.115  1.00 120.93 ? 1000 SER B N   1 
ATOM   4359 C  CA  . SER B  1 226 ? 15.269  -13.086 24.698  1.00 121.19 ? 1000 SER B CA  1 
ATOM   4360 C  C   . SER B  1 226 ? 16.656  -13.736 24.573  1.00 126.78 ? 1000 SER B C   1 
ATOM   4361 O  O   . SER B  1 226 ? 16.927  -14.720 25.265  1.00 126.33 ? 1000 SER B O   1 
ATOM   4362 C  CB  . SER B  1 226 ? 14.182  -13.976 24.102  1.00 124.57 ? 1000 SER B CB  1 
ATOM   4363 N  N   . ALA B  1 227 ? 17.528  -13.191 23.698  1.00 124.82 ? 1001 ALA B N   1 
ATOM   4364 C  CA  . ALA B  1 227 ? 18.900  -13.677 23.521  1.00 125.48 ? 1001 ALA B CA  1 
ATOM   4365 C  C   . ALA B  1 227 ? 19.781  -13.100 24.635  1.00 131.86 ? 1001 ALA B C   1 
ATOM   4366 O  O   . ALA B  1 227 ? 20.701  -13.775 25.104  1.00 131.88 ? 1001 ALA B O   1 
ATOM   4367 C  CB  . ALA B  1 227 ? 19.434  -13.257 22.161  1.00 126.18 ? 1001 ALA B CB  1 
ATOM   4368 N  N   . ASP B  1 228 ? 19.476  -11.861 25.067  1.00 129.80 ? 1002 ASP B N   1 
ATOM   4369 C  CA  . ASP B  1 228 ? 20.163  -11.165 26.155  1.00 130.20 ? 1002 ASP B CA  1 
ATOM   4370 C  C   . ASP B  1 228 ? 19.817  -11.841 27.485  1.00 135.18 ? 1002 ASP B C   1 
ATOM   4371 O  O   . ASP B  1 228 ? 20.702  -12.033 28.316  1.00 134.96 ? 1002 ASP B O   1 
ATOM   4372 C  CB  . ASP B  1 228 ? 19.773  -9.673  26.174  1.00 132.04 ? 1002 ASP B CB  1 
ATOM   4373 C  CG  . ASP B  1 228 ? 20.014  -8.924  24.869  1.00 141.32 ? 1002 ASP B CG  1 
ATOM   4374 O  OD1 . ASP B  1 228 ? 20.673  -9.493  23.962  1.00 141.59 ? 1002 ASP B OD1 1 
ATOM   4375 O  OD2 . ASP B  1 228 ? 19.544  -7.772  24.754  1.00 146.31 ? 1002 ASP B OD2 1 
ATOM   4376 N  N   . LEU B  1 229 ? 18.537  -12.246 27.654  1.00 132.59 ? 1003 LEU B N   1 
ATOM   4377 C  CA  . LEU B  1 229 ? 18.010  -12.969 28.817  1.00 133.15 ? 1003 LEU B CA  1 
ATOM   4378 C  C   . LEU B  1 229 ? 18.647  -14.357 28.891  1.00 138.88 ? 1003 LEU B C   1 
ATOM   4379 O  O   . LEU B  1 229 ? 18.843  -14.878 29.986  1.00 139.08 ? 1003 LEU B O   1 
ATOM   4380 C  CB  . LEU B  1 229 ? 16.483  -13.101 28.715  1.00 133.20 ? 1003 LEU B CB  1 
ATOM   4381 N  N   . GLU B  1 230 ? 18.979  -14.937 27.720  1.00 136.01 ? 1004 GLU B N   1 
ATOM   4382 C  CA  . GLU B  1 230 ? 19.646  -16.224 27.558  1.00 136.12 ? 1004 GLU B CA  1 
ATOM   4383 C  C   . GLU B  1 230 ? 21.153  -16.045 27.827  1.00 140.89 ? 1004 GLU B C   1 
ATOM   4384 O  O   . GLU B  1 230 ? 21.813  -16.996 28.252  1.00 140.88 ? 1004 GLU B O   1 
ATOM   4385 C  CB  . GLU B  1 230 ? 19.421  -16.724 26.123  1.00 137.53 ? 1004 GLU B CB  1 
ATOM   4386 C  CG  . GLU B  1 230 ? 19.511  -18.225 25.943  1.00 148.25 ? 1004 GLU B CG  1 
ATOM   4387 C  CD  . GLU B  1 230 ? 19.338  -18.654 24.500  1.00 168.87 ? 1004 GLU B CD  1 
ATOM   4388 O  OE1 . GLU B  1 230 ? 18.228  -19.112 24.144  1.00 167.42 ? 1004 GLU B OE1 1 
ATOM   4389 O  OE2 . GLU B  1 230 ? 20.311  -18.532 23.724  1.00 159.91 ? 1004 GLU B OE2 1 
ATOM   4390 N  N   . ASP B  1 231 ? 21.688  -14.828 27.574  1.00 137.71 ? 1005 ASP B N   1 
ATOM   4391 C  CA  . ASP B  1 231 ? 23.096  -14.460 27.778  1.00 137.67 ? 1005 ASP B CA  1 
ATOM   4392 C  C   . ASP B  1 231 ? 23.407  -14.178 29.248  1.00 141.92 ? 1005 ASP B C   1 
ATOM   4393 O  O   . ASP B  1 231 ? 24.494  -14.517 29.720  1.00 141.33 ? 1005 ASP B O   1 
ATOM   4394 C  CB  . ASP B  1 231 ? 23.470  -13.236 26.919  1.00 139.49 ? 1005 ASP B CB  1 
ATOM   4395 C  CG  . ASP B  1 231 ? 24.246  -13.536 25.648  1.00 149.50 ? 1005 ASP B CG  1 
ATOM   4396 O  OD1 . ASP B  1 231 ? 24.186  -14.693 25.167  1.00 149.96 ? 1005 ASP B OD1 1 
ATOM   4397 O  OD2 . ASP B  1 231 ? 24.908  -12.612 25.129  1.00 155.32 ? 1005 ASP B OD2 1 
ATOM   4398 N  N   . ASN B  1 232 ? 22.453  -13.541 29.957  1.00 139.18 ? 1006 ASN B N   1 
ATOM   4399 C  CA  . ASN B  1 232 ? 22.557  -13.197 31.376  1.00 139.26 ? 1006 ASN B CA  1 
ATOM   4400 C  C   . ASN B  1 232 ? 22.326  -14.407 32.279  1.00 143.86 ? 1006 ASN B C   1 
ATOM   4401 O  O   . ASN B  1 232 ? 22.839  -14.439 33.398  1.00 143.76 ? 1006 ASN B O   1 
ATOM   4402 C  CB  . ASN B  1 232 ? 21.628  -12.041 31.732  1.00 139.93 ? 1006 ASN B CB  1 
ATOM   4403 C  CG  . ASN B  1 232 ? 22.058  -10.702 31.173  1.00 163.72 ? 1006 ASN B CG  1 
ATOM   4404 O  OD1 . ASN B  1 232 ? 23.231  -10.300 31.236  1.00 155.25 ? 1006 ASN B OD1 1 
ATOM   4405 N  ND2 . ASN B  1 232 ? 21.104  -9.967  30.625  1.00 157.75 ? 1006 ASN B ND2 1 
ATOM   4406 N  N   . TRP B  1 233 ? 21.565  -15.402 31.792  1.00 140.72 ? 1007 TRP B N   1 
ATOM   4407 C  CA  . TRP B  1 233 ? 21.321  -16.667 32.480  1.00 140.80 ? 1007 TRP B CA  1 
ATOM   4408 C  C   . TRP B  1 233 ? 22.542  -17.580 32.281  1.00 144.88 ? 1007 TRP B C   1 
ATOM   4409 O  O   . TRP B  1 233 ? 22.840  -18.396 33.155  1.00 144.64 ? 1007 TRP B O   1 
ATOM   4410 C  CB  . TRP B  1 233 ? 20.059  -17.341 31.935  1.00 139.69 ? 1007 TRP B CB  1 
ATOM   4411 C  CG  . TRP B  1 233 ? 19.669  -18.598 32.657  1.00 140.71 ? 1007 TRP B CG  1 
ATOM   4412 C  CD1 . TRP B  1 233 ? 20.069  -19.869 32.366  1.00 143.62 ? 1007 TRP B CD1 1 
ATOM   4413 C  CD2 . TRP B  1 233 ? 18.774  -18.703 33.770  1.00 140.56 ? 1007 TRP B CD2 1 
ATOM   4414 N  NE1 . TRP B  1 233 ? 19.490  -20.759 33.237  1.00 143.06 ? 1007 TRP B NE1 1 
ATOM   4415 C  CE2 . TRP B  1 233 ? 18.680  -20.072 34.103  1.00 144.49 ? 1007 TRP B CE2 1 
ATOM   4416 C  CE3 . TRP B  1 233 ? 18.029  -17.771 34.515  1.00 141.82 ? 1007 TRP B CE3 1 
ATOM   4417 C  CZ2 . TRP B  1 233 ? 17.868  -20.535 35.145  1.00 143.81 ? 1007 TRP B CZ2 1 
ATOM   4418 C  CZ3 . TRP B  1 233 ? 17.229  -18.230 35.550  1.00 143.27 ? 1007 TRP B CZ3 1 
ATOM   4419 C  CH2 . TRP B  1 233 ? 17.151  -19.597 35.855  1.00 143.93 ? 1007 TRP B CH2 1 
ATOM   4420 N  N   . GLU B  1 234 ? 23.239  -17.437 31.130  1.00 141.38 ? 1008 GLU B N   1 
ATOM   4421 C  CA  . GLU B  1 234 ? 24.440  -18.198 30.788  1.00 141.15 ? 1008 GLU B CA  1 
ATOM   4422 C  C   . GLU B  1 234 ? 25.631  -17.777 31.659  1.00 144.67 ? 1008 GLU B C   1 
ATOM   4423 O  O   . GLU B  1 234 ? 26.368  -18.648 32.122  1.00 144.16 ? 1008 GLU B O   1 
ATOM   4424 C  CB  . GLU B  1 234 ? 24.775  -18.057 29.295  1.00 142.57 ? 1008 GLU B CB  1 
ATOM   4425 N  N   . THR B  1 235 ? 25.808  -16.452 31.896  1.00 141.03 ? 1009 THR B N   1 
ATOM   4426 C  CA  . THR B  1 235 ? 26.894  -15.908 32.731  1.00 140.79 ? 1009 THR B CA  1 
ATOM   4427 C  C   . THR B  1 235 ? 26.735  -16.274 34.207  1.00 144.90 ? 1009 THR B C   1 
ATOM   4428 O  O   . THR B  1 235 ? 27.726  -16.629 34.846  1.00 144.01 ? 1009 THR B O   1 
ATOM   4429 C  CB  . THR B  1 235 ? 27.093  -14.398 32.530  1.00 146.53 ? 1009 THR B CB  1 
ATOM   4430 O  OG1 . THR B  1 235 ? 25.900  -13.806 32.015  1.00 145.34 ? 1009 THR B OG1 1 
ATOM   4431 C  CG2 . THR B  1 235 ? 28.259  -14.088 31.613  1.00 144.58 ? 1009 THR B CG2 1 
ATOM   4432 N  N   . LEU B  1 236 ? 25.494  -16.214 34.737  1.00 142.55 ? 1010 LEU B N   1 
ATOM   4433 C  CA  . LEU B  1 236 ? 25.188  -16.576 36.125  1.00 143.20 ? 1010 LEU B CA  1 
ATOM   4434 C  C   . LEU B  1 236 ? 25.599  -18.026 36.412  1.00 149.23 ? 1010 LEU B C   1 
ATOM   4435 O  O   . LEU B  1 236 ? 26.297  -18.273 37.398  1.00 148.96 ? 1010 LEU B O   1 
ATOM   4436 C  CB  . LEU B  1 236 ? 23.697  -16.369 36.434  1.00 143.31 ? 1010 LEU B CB  1 
ATOM   4437 N  N   . ASN B  1 237 ? 25.207  -18.967 35.522  1.00 147.14 ? 1011 ASN B N   1 
ATOM   4438 C  CA  . ASN B  1 237 ? 25.528  -20.393 35.623  1.00 147.43 ? 1011 ASN B CA  1 
ATOM   4439 C  C   . ASN B  1 237 ? 27.031  -20.668 35.442  1.00 152.61 ? 1011 ASN B C   1 
ATOM   4440 O  O   . ASN B  1 237 ? 27.571  -21.518 36.151  1.00 152.46 ? 1011 ASN B O   1 
ATOM   4441 C  CB  . ASN B  1 237 ? 24.710  -21.216 34.618  1.00 147.13 ? 1011 ASN B CB  1 
ATOM   4442 C  CG  . ASN B  1 237 ? 23.209  -21.184 34.805  1.00 167.13 ? 1011 ASN B CG  1 
ATOM   4443 O  OD1 . ASN B  1 237 ? 22.664  -20.626 35.772  1.00 158.49 ? 1011 ASN B OD1 1 
ATOM   4444 N  ND2 . ASN B  1 237 ? 22.505  -21.799 33.866  1.00 160.27 ? 1011 ASN B ND2 1 
ATOM   4445 N  N   . ASP B  1 238 ? 27.698  -19.954 34.502  1.00 149.60 ? 1012 ASP B N   1 
ATOM   4446 C  CA  . ASP B  1 238 ? 29.129  -20.121 34.227  1.00 149.69 ? 1012 ASP B CA  1 
ATOM   4447 C  C   . ASP B  1 238 ? 30.011  -19.648 35.384  1.00 154.42 ? 1012 ASP B C   1 
ATOM   4448 O  O   . ASP B  1 238 ? 30.957  -20.357 35.729  1.00 154.00 ? 1012 ASP B O   1 
ATOM   4449 C  CB  . ASP B  1 238 ? 29.539  -19.443 32.911  1.00 151.52 ? 1012 ASP B CB  1 
ATOM   4450 N  N   . ASN B  1 239 ? 29.711  -18.467 35.986  1.00 151.62 ? 1013 ASN B N   1 
ATOM   4451 C  CA  . ASN B  1 239 ? 30.484  -17.942 37.123  1.00 151.54 ? 1013 ASN B CA  1 
ATOM   4452 C  C   . ASN B  1 239 ? 30.264  -18.755 38.407  1.00 155.41 ? 1013 ASN B C   1 
ATOM   4453 O  O   . ASN B  1 239 ? 31.132  -18.741 39.285  1.00 155.18 ? 1013 ASN B O   1 
ATOM   4454 C  CB  . ASN B  1 239 ? 30.249  -16.451 37.365  1.00 152.01 ? 1013 ASN B CB  1 
ATOM   4455 C  CG  . ASN B  1 239 ? 30.617  -15.532 36.226  1.00 175.44 ? 1013 ASN B CG  1 
ATOM   4456 O  OD1 . ASN B  1 239 ? 29.755  -14.873 35.659  1.00 170.41 ? 1013 ASN B OD1 1 
ATOM   4457 N  ND2 . ASN B  1 239 ? 31.897  -15.403 35.897  1.00 167.56 ? 1013 ASN B ND2 1 
ATOM   4458 N  N   . LEU B  1 240 ? 29.126  -19.483 38.499  1.00 151.70 ? 1014 LEU B N   1 
ATOM   4459 C  CA  . LEU B  1 240 ? 28.802  -20.377 39.617  1.00 151.47 ? 1014 LEU B CA  1 
ATOM   4460 C  C   . LEU B  1 240 ? 29.772  -21.568 39.577  1.00 155.80 ? 1014 LEU B C   1 
ATOM   4461 O  O   . LEU B  1 240 ? 30.206  -22.044 40.627  1.00 155.51 ? 1014 LEU B O   1 
ATOM   4462 C  CB  . LEU B  1 240 ? 27.351  -20.866 39.524  1.00 151.43 ? 1014 LEU B CB  1 
ATOM   4463 N  N   . LYS B  1 241 ? 30.141  -22.008 38.351  1.00 152.46 ? 1015 LYS B N   1 
ATOM   4464 C  CA  . LYS B  1 241 ? 31.108  -23.076 38.091  1.00 152.16 ? 1015 LYS B CA  1 
ATOM   4465 C  C   . LYS B  1 241 ? 32.546  -22.544 38.243  1.00 155.93 ? 1015 LYS B C   1 
ATOM   4466 O  O   . LYS B  1 241 ? 33.455  -23.334 38.512  1.00 155.93 ? 1015 LYS B O   1 
ATOM   4467 C  CB  . LYS B  1 241 ? 30.893  -23.682 36.695  1.00 154.55 ? 1015 LYS B CB  1 
ATOM   4468 N  N   . VAL B  1 242 ? 32.743  -21.205 38.087  1.00 151.80 ? 1016 VAL B N   1 
ATOM   4469 C  CA  . VAL B  1 242 ? 34.041  -20.533 38.247  1.00 151.23 ? 1016 VAL B CA  1 
ATOM   4470 C  C   . VAL B  1 242 ? 34.427  -20.468 39.735  1.00 154.63 ? 1016 VAL B C   1 
ATOM   4471 O  O   . VAL B  1 242 ? 35.617  -20.416 40.051  1.00 154.41 ? 1016 VAL B O   1 
ATOM   4472 C  CB  . VAL B  1 242 ? 34.092  -19.146 37.561  1.00 154.98 ? 1016 VAL B CB  1 
ATOM   4473 N  N   . ILE B  1 243 ? 33.421  -20.511 40.641  1.00 150.52 ? 1017 ILE B N   1 
ATOM   4474 C  CA  . ILE B  1 243 ? 33.614  -20.511 42.092  1.00 150.03 ? 1017 ILE B CA  1 
ATOM   4475 C  C   . ILE B  1 243 ? 34.217  -21.845 42.561  1.00 153.59 ? 1017 ILE B C   1 
ATOM   4476 O  O   . ILE B  1 243 ? 35.238  -21.837 43.252  1.00 153.35 ? 1017 ILE B O   1 
ATOM   4477 C  CB  . ILE B  1 243 ? 32.304  -20.151 42.834  1.00 153.06 ? 1017 ILE B CB  1 
ATOM   4478 N  N   . GLU B  1 244 ? 33.608  -22.983 42.153  1.00 149.75 ? 1018 GLU B N   1 
ATOM   4479 C  CA  . GLU B  1 244 ? 34.059  -24.334 42.501  1.00 170.25 ? 1018 GLU B CA  1 
ATOM   4480 C  C   . GLU B  1 244 ? 35.296  -24.724 41.696  1.00 190.13 ? 1018 GLU B C   1 
ATOM   4481 O  O   . GLU B  1 244 ? 36.400  -24.282 42.010  1.00 148.94 ? 1018 GLU B O   1 
ATOM   4482 C  CB  . GLU B  1 244 ? 32.935  -25.354 42.276  1.00 171.58 ? 1018 GLU B CB  1 
ATOM   4483 N  N   . ASP B  1 247 ? 40.579  -21.544 43.468  1.00 142.10 ? 1021 ASP B N   1 
ATOM   4484 C  CA  . ASP B  1 247 ? 41.715  -21.732 44.368  1.00 141.88 ? 1021 ASP B CA  1 
ATOM   4485 C  C   . ASP B  1 247 ? 42.048  -20.452 45.135  1.00 145.51 ? 1021 ASP B C   1 
ATOM   4486 O  O   . ASP B  1 247 ? 42.255  -20.510 46.350  1.00 145.06 ? 1021 ASP B O   1 
ATOM   4487 C  CB  . ASP B  1 247 ? 42.948  -22.231 43.596  1.00 143.68 ? 1021 ASP B CB  1 
ATOM   4488 N  N   . ASN B  1 248 ? 42.102  -19.304 44.423  1.00 141.47 ? 1022 ASN B N   1 
ATOM   4489 C  CA  . ASN B  1 248 ? 42.413  -17.992 44.991  1.00 140.93 ? 1022 ASN B CA  1 
ATOM   4490 C  C   . ASN B  1 248 ? 41.173  -17.274 45.526  1.00 144.41 ? 1022 ASN B C   1 
ATOM   4491 O  O   . ASN B  1 248 ? 40.081  -17.420 44.970  1.00 144.07 ? 1022 ASN B O   1 
ATOM   4492 C  CB  . ASN B  1 248 ? 43.136  -17.117 43.966  1.00 140.80 ? 1022 ASN B CB  1 
ATOM   4493 N  N   . ALA B  1 249 ? 41.353  -16.491 46.605  1.00 140.69 ? 1023 ALA B N   1 
ATOM   4494 C  CA  . ALA B  1 249 ? 40.297  -15.703 47.247  1.00 140.19 ? 1023 ALA B CA  1 
ATOM   4495 C  C   . ALA B  1 249 ? 39.897  -14.516 46.375  1.00 142.97 ? 1023 ALA B C   1 
ATOM   4496 O  O   . ALA B  1 249 ? 38.734  -14.112 46.403  1.00 142.47 ? 1023 ALA B O   1 
ATOM   4497 C  CB  . ALA B  1 249 ? 40.760  -15.217 48.612  1.00 140.89 ? 1023 ALA B CB  1 
ATOM   4498 N  N   . ALA B  1 250 ? 40.858  -13.960 45.606  1.00 138.83 ? 1024 ALA B N   1 
ATOM   4499 C  CA  . ALA B  1 250 ? 40.628  -12.837 44.692  1.00 138.34 ? 1024 ALA B CA  1 
ATOM   4500 C  C   . ALA B  1 250 ? 39.885  -13.296 43.425  1.00 141.34 ? 1024 ALA B C   1 
ATOM   4501 O  O   . ALA B  1 250 ? 39.169  -12.501 42.811  1.00 140.79 ? 1024 ALA B O   1 
ATOM   4502 C  CB  . ALA B  1 250 ? 41.950  -12.178 44.327  1.00 139.09 ? 1024 ALA B CB  1 
ATOM   4503 N  N   . GLN B  1 251 ? 40.049  -14.579 43.047  1.00 137.62 ? 1025 GLN B N   1 
ATOM   4504 C  CA  . GLN B  1 251 ? 39.389  -15.197 41.893  1.00 137.27 ? 1025 GLN B CA  1 
ATOM   4505 C  C   . GLN B  1 251 ? 37.892  -15.435 42.189  1.00 140.12 ? 1025 GLN B C   1 
ATOM   4506 O  O   . GLN B  1 251 ? 37.068  -15.271 41.289  1.00 139.62 ? 1025 GLN B O   1 
ATOM   4507 C  CB  . GLN B  1 251 ? 40.112  -16.490 41.492  1.00 138.69 ? 1025 GLN B CB  1 
ATOM   4508 C  CG  . GLN B  1 251 ? 39.750  -17.006 40.110  1.00 151.63 ? 1025 GLN B CG  1 
ATOM   4509 C  CD  . GLN B  1 251 ? 39.028  -18.320 40.204  1.00 171.50 ? 1025 GLN B CD  1 
ATOM   4510 O  OE1 . GLN B  1 251 ? 37.944  -18.425 40.790  1.00 168.18 ? 1025 GLN B OE1 1 
ATOM   4511 N  NE2 . GLN B  1 251 ? 39.617  -19.355 39.626  1.00 163.28 ? 1025 GLN B NE2 1 
ATOM   4512 N  N   . VAL B  1 252 ? 37.545  -15.781 43.458  1.00 135.91 ? 1026 VAL B N   1 
ATOM   4513 C  CA  . VAL B  1 252 ? 36.162  -15.941 43.929  1.00 135.22 ? 1026 VAL B CA  1 
ATOM   4514 C  C   . VAL B  1 252 ? 35.458  -14.567 44.020  1.00 138.05 ? 1026 VAL B C   1 
ATOM   4515 O  O   . VAL B  1 252 ? 34.230  -14.503 44.004  1.00 137.50 ? 1026 VAL B O   1 
ATOM   4516 C  CB  . VAL B  1 252 ? 36.096  -16.704 45.271  1.00 139.07 ? 1026 VAL B CB  1 
ATOM   4517 N  N   . LYS B  1 253 ? 36.246  -13.475 44.113  1.00 134.02 ? 1027 LYS B N   1 
ATOM   4518 C  CA  . LYS B  1 253 ? 35.761  -12.095 44.149  1.00 133.48 ? 1027 LYS B CA  1 
ATOM   4519 C  C   . LYS B  1 253 ? 35.475  -11.616 42.725  1.00 136.14 ? 1027 LYS B C   1 
ATOM   4520 O  O   . LYS B  1 253 ? 34.586  -10.784 42.531  1.00 135.79 ? 1027 LYS B O   1 
ATOM   4521 C  CB  . LYS B  1 253 ? 36.792  -11.174 44.817  1.00 136.20 ? 1027 LYS B CB  1 
ATOM   4522 N  N   . ASP B  1 254 ? 36.230  -12.145 41.731  1.00 131.77 ? 1028 ASP B N   1 
ATOM   4523 C  CA  . ASP B  1 254 ? 36.083  -11.819 40.306  1.00 131.21 ? 1028 ASP B CA  1 
ATOM   4524 C  C   . ASP B  1 254 ? 34.775  -12.381 39.740  1.00 132.67 ? 1028 ASP B C   1 
ATOM   4525 O  O   . ASP B  1 254 ? 34.078  -11.667 39.013  1.00 131.73 ? 1028 ASP B O   1 
ATOM   4526 C  CB  . ASP B  1 254 ? 37.293  -12.323 39.500  1.00 133.22 ? 1028 ASP B CB  1 
ATOM   4527 C  CG  . ASP B  1 254 ? 37.408  -11.721 38.113  1.00 142.97 ? 1028 ASP B CG  1 
ATOM   4528 O  OD1 . ASP B  1 254 ? 37.678  -10.501 38.014  1.00 143.08 ? 1028 ASP B OD1 1 
ATOM   4529 O  OD2 . ASP B  1 254 ? 37.244  -12.472 37.127  1.00 148.85 ? 1028 ASP B OD2 1 
ATOM   4530 N  N   . ALA B  1 255 ? 34.436  -13.648 40.092  1.00 127.44 ? 1029 ALA B N   1 
ATOM   4531 C  CA  . ALA B  1 255 ? 33.204  -14.324 39.674  1.00 126.58 ? 1029 ALA B CA  1 
ATOM   4532 C  C   . ALA B  1 255 ? 31.977  -13.638 40.280  1.00 129.95 ? 1029 ALA B C   1 
ATOM   4533 O  O   . ALA B  1 255 ? 30.924  -13.611 39.649  1.00 129.41 ? 1029 ALA B O   1 
ATOM   4534 C  CB  . ALA B  1 255 ? 33.241  -15.783 40.084  1.00 127.23 ? 1029 ALA B CB  1 
ATOM   4535 N  N   . LEU B  1 256 ? 32.137  -13.054 41.489  1.00 126.77 ? 1030 LEU B N   1 
ATOM   4536 C  CA  . LEU B  1 256 ? 31.100  -12.328 42.232  1.00 126.79 ? 1030 LEU B CA  1 
ATOM   4537 C  C   . LEU B  1 256 ? 30.718  -11.002 41.557  1.00 130.24 ? 1030 LEU B C   1 
ATOM   4538 O  O   . LEU B  1 256 ? 29.533  -10.763 41.326  1.00 130.15 ? 1030 LEU B O   1 
ATOM   4539 C  CB  . LEU B  1 256 ? 31.543  -12.087 43.686  1.00 126.92 ? 1030 LEU B CB  1 
ATOM   4540 N  N   . THR B  1 257 ? 31.718  -10.157 41.231  1.00 126.06 ? 1031 THR B N   1 
ATOM   4541 C  CA  . THR B  1 257 ? 31.548  -8.854  40.567  1.00 125.75 ? 1031 THR B CA  1 
ATOM   4542 C  C   . THR B  1 257 ? 30.962  -8.979  39.141  1.00 130.00 ? 1031 THR B C   1 
ATOM   4543 O  O   . THR B  1 257 ? 30.321  -8.041  38.658  1.00 129.34 ? 1031 THR B O   1 
ATOM   4544 C  CB  . THR B  1 257 ? 32.863  -8.052  40.594  1.00 130.48 ? 1031 THR B CB  1 
ATOM   4545 O  OG1 . THR B  1 257 ? 33.975  -8.923  40.359  1.00 129.74 ? 1031 THR B OG1 1 
ATOM   4546 C  CG2 . THR B  1 257 ? 33.061  -7.303  41.901  1.00 127.21 ? 1031 THR B CG2 1 
ATOM   4547 N  N   . LYS B  1 258 ? 31.177  -10.143 38.485  1.00 126.92 ? 1032 LYS B N   1 
ATOM   4548 C  CA  . LYS B  1 258 ? 30.691  -10.473 37.138  1.00 126.76 ? 1032 LYS B CA  1 
ATOM   4549 C  C   . LYS B  1 258 ? 29.220  -10.919 37.174  1.00 130.92 ? 1032 LYS B C   1 
ATOM   4550 O  O   . LYS B  1 258 ? 28.435  -10.524 36.308  1.00 130.77 ? 1032 LYS B O   1 
ATOM   4551 C  CB  . LYS B  1 258 ? 31.572  -11.566 36.502  1.00 128.93 ? 1032 LYS B CB  1 
ATOM   4552 N  N   . MET B  1 259 ? 28.869  -11.748 38.185  1.00 126.95 ? 1033 MET B N   1 
ATOM   4553 C  CA  . MET B  1 259 ? 27.539  -12.294 38.453  1.00 126.39 ? 1033 MET B CA  1 
ATOM   4554 C  C   . MET B  1 259 ? 26.519  -11.201 38.742  1.00 130.70 ? 1033 MET B C   1 
ATOM   4555 O  O   . MET B  1 259 ? 25.405  -11.275 38.229  1.00 130.27 ? 1033 MET B O   1 
ATOM   4556 C  CB  . MET B  1 259 ? 27.598  -13.232 39.659  1.00 128.53 ? 1033 MET B CB  1 
ATOM   4557 C  CG  . MET B  1 259 ? 27.694  -14.675 39.294  1.00 131.86 ? 1033 MET B CG  1 
ATOM   4558 S  SD  . MET B  1 259 ? 27.482  -15.731 40.741  1.00 135.73 ? 1033 MET B SD  1 
ATOM   4559 C  CE  . MET B  1 259 ? 25.702  -15.749 40.864  1.00 132.33 ? 1033 MET B CE  1 
ATOM   4560 N  N   . ARG B  1 260 ? 26.896  -10.203 39.582  1.00 127.76 ? 1034 ARG B N   1 
ATOM   4561 C  CA  . ARG B  1 260 ? 26.055  -9.071  39.995  1.00 127.65 ? 1034 ARG B CA  1 
ATOM   4562 C  C   . ARG B  1 260 ? 25.709  -8.160  38.812  1.00 131.95 ? 1034 ARG B C   1 
ATOM   4563 O  O   . ARG B  1 260 ? 24.629  -7.562  38.780  1.00 131.40 ? 1034 ARG B O   1 
ATOM   4564 C  CB  . ARG B  1 260 ? 26.721  -8.277  41.126  1.00 127.09 ? 1034 ARG B CB  1 
ATOM   4565 C  CG  . ARG B  1 260 ? 25.714  -7.835  42.174  1.00 134.10 ? 1034 ARG B CG  1 
ATOM   4566 C  CD  . ARG B  1 260 ? 26.282  -6.780  43.094  1.00 140.37 ? 1034 ARG B CD  1 
ATOM   4567 N  NE  . ARG B  1 260 ? 25.238  -5.883  43.587  1.00 145.48 ? 1034 ARG B NE  1 
ATOM   4568 C  CZ  . ARG B  1 260 ? 24.849  -4.773  42.967  1.00 157.92 ? 1034 ARG B CZ  1 
ATOM   4569 N  NH1 . ARG B  1 260 ? 25.415  -4.409  41.822  1.00 143.76 ? 1034 ARG B NH1 1 
ATOM   4570 N  NH2 . ARG B  1 260 ? 23.891  -4.018  43.486  1.00 145.45 ? 1034 ARG B NH2 1 
ATOM   4571 N  N   . ALA B  1 261 ? 26.630  -8.097  37.825  1.00 128.91 ? 1035 ALA B N   1 
ATOM   4572 C  CA  . ALA B  1 261 ? 26.481  -7.346  36.579  1.00 128.85 ? 1035 ALA B CA  1 
ATOM   4573 C  C   . ALA B  1 261 ? 25.456  -8.049  35.682  1.00 132.84 ? 1035 ALA B C   1 
ATOM   4574 O  O   . ALA B  1 261 ? 24.576  -7.385  35.136  1.00 132.95 ? 1035 ALA B O   1 
ATOM   4575 C  CB  . ALA B  1 261 ? 27.822  -7.246  35.864  1.00 129.57 ? 1035 ALA B CB  1 
ATOM   4576 N  N   . ALA B  1 262 ? 25.559  -9.393  35.562  1.00 128.71 ? 1036 ALA B N   1 
ATOM   4577 C  CA  . ALA B  1 262 ? 24.665  -10.236 34.766  1.00 128.16 ? 1036 ALA B CA  1 
ATOM   4578 C  C   . ALA B  1 262 ? 23.265  -10.366 35.386  1.00 131.40 ? 1036 ALA B C   1 
ATOM   4579 O  O   . ALA B  1 262 ? 22.277  -10.347 34.653  1.00 130.91 ? 1036 ALA B O   1 
ATOM   4580 C  CB  . ALA B  1 262 ? 25.284  -11.613 34.573  1.00 128.83 ? 1036 ALA B CB  1 
ATOM   4581 N  N   . ALA B  1 263 ? 23.182  -10.497 36.722  1.00 127.78 ? 1037 ALA B N   1 
ATOM   4582 C  CA  . ALA B  1 263 ? 21.922  -10.648 37.454  1.00 127.79 ? 1037 ALA B CA  1 
ATOM   4583 C  C   . ALA B  1 263 ? 21.025  -9.416  37.386  1.00 132.10 ? 1037 ALA B C   1 
ATOM   4584 O  O   . ALA B  1 263 ? 19.804  -9.562  37.309  1.00 131.58 ? 1037 ALA B O   1 
ATOM   4585 C  CB  . ALA B  1 263 ? 22.193  -11.016 38.903  1.00 128.55 ? 1037 ALA B CB  1 
ATOM   4586 N  N   . LEU B  1 264 ? 21.624  -8.210  37.434  1.00 129.17 ? 1038 LEU B N   1 
ATOM   4587 C  CA  . LEU B  1 264 ? 20.891  -6.945  37.373  1.00 129.33 ? 1038 LEU B CA  1 
ATOM   4588 C  C   . LEU B  1 264 ? 20.357  -6.688  35.961  1.00 134.29 ? 1038 LEU B C   1 
ATOM   4589 O  O   . LEU B  1 264 ? 19.314  -6.048  35.805  1.00 134.00 ? 1038 LEU B O   1 
ATOM   4590 C  CB  . LEU B  1 264 ? 21.789  -5.785  37.823  1.00 129.37 ? 1038 LEU B CB  1 
ATOM   4591 N  N   . ASP B  1 265 ? 21.074  -7.198  34.939  1.00 131.42 ? 1039 ASP B N   1 
ATOM   4592 C  CA  . ASP B  1 265 ? 20.727  -7.051  33.526  1.00 131.45 ? 1039 ASP B CA  1 
ATOM   4593 C  C   . ASP B  1 265 ? 19.518  -7.906  33.125  1.00 135.52 ? 1039 ASP B C   1 
ATOM   4594 O  O   . ASP B  1 265 ? 18.657  -7.424  32.386  1.00 135.44 ? 1039 ASP B O   1 
ATOM   4595 C  CB  . ASP B  1 265 ? 21.944  -7.345  32.635  1.00 133.28 ? 1039 ASP B CB  1 
ATOM   4596 N  N   . ALA B  1 266 ? 19.439  -9.154  33.630  1.00 131.81 ? 1040 ALA B N   1 
ATOM   4597 C  CA  . ALA B  1 266 ? 18.346  -10.089 33.344  1.00 131.91 ? 1040 ALA B CA  1 
ATOM   4598 C  C   . ALA B  1 266 ? 17.000  -9.649  33.929  1.00 136.94 ? 1040 ALA B C   1 
ATOM   4599 O  O   . ALA B  1 266 ? 15.952  -10.108 33.468  1.00 136.65 ? 1040 ALA B O   1 
ATOM   4600 C  CB  . ALA B  1 266 ? 18.702  -11.476 33.848  1.00 132.66 ? 1040 ALA B CB  1 
ATOM   4601 N  N   . GLN B  1 267 ? 17.033  -8.773  34.942  1.00 134.68 ? 1041 GLN B N   1 
ATOM   4602 C  CA  . GLN B  1 267 ? 15.860  -8.247  35.642  1.00 135.17 ? 1041 GLN B CA  1 
ATOM   4603 C  C   . GLN B  1 267 ? 15.067  -7.271  34.761  1.00 140.84 ? 1041 GLN B C   1 
ATOM   4604 O  O   . GLN B  1 267 ? 13.834  -7.308  34.776  1.00 140.50 ? 1041 GLN B O   1 
ATOM   4605 C  CB  . GLN B  1 267 ? 16.295  -7.582  36.961  1.00 136.37 ? 1041 GLN B CB  1 
ATOM   4606 C  CG  . GLN B  1 267 ? 15.158  -7.261  37.927  1.00 144.42 ? 1041 GLN B CG  1 
ATOM   4607 C  CD  . GLN B  1 267 ? 15.654  -6.622  39.199  1.00 156.40 ? 1041 GLN B CD  1 
ATOM   4608 O  OE1 . GLN B  1 267 ? 15.373  -7.093  40.300  1.00 151.48 ? 1041 GLN B OE1 1 
ATOM   4609 N  NE2 . GLN B  1 267 ? 16.400  -5.531  39.083  1.00 146.09 ? 1041 GLN B NE2 1 
ATOM   4610 N  N   . LYS B  1 268 ? 15.777  -6.411  33.993  1.00 138.46 ? 1042 LYS B N   1 
ATOM   4611 C  CA  . LYS B  1 268 ? 15.192  -5.424  33.080  1.00 138.62 ? 1042 LYS B CA  1 
ATOM   4612 C  C   . LYS B  1 268 ? 14.478  -6.101  31.904  1.00 143.81 ? 1042 LYS B C   1 
ATOM   4613 O  O   . LYS B  1 268 ? 13.465  -5.589  31.424  1.00 143.09 ? 1042 LYS B O   1 
ATOM   4614 C  CB  . LYS B  1 268 ? 16.275  -4.462  32.567  1.00 140.88 ? 1042 LYS B CB  1 
ATOM   4615 N  N   . ALA B  1 269 ? 15.007  -7.256  31.454  1.00 141.79 ? 1043 ALA B N   1 
ATOM   4616 C  CA  . ALA B  1 269 ? 14.466  -8.032  30.339  1.00 142.30 ? 1043 ALA B CA  1 
ATOM   4617 C  C   . ALA B  1 269 ? 13.200  -8.808  30.701  1.00 147.93 ? 1043 ALA B C   1 
ATOM   4618 O  O   . ALA B  1 269 ? 13.011  -9.180  31.862  1.00 147.49 ? 1043 ALA B O   1 
ATOM   4619 C  CB  . ALA B  1 269 ? 15.524  -8.973  29.804  1.00 142.98 ? 1043 ALA B CB  1 
ATOM   4620 N  N   . THR B  1 270 ? 12.334  -9.041  29.691  1.00 145.78 ? 1044 THR B N   1 
ATOM   4621 C  CA  . THR B  1 270 ? 11.064  -9.758  29.817  1.00 145.98 ? 1044 THR B CA  1 
ATOM   4622 C  C   . THR B  1 270 ? 11.197  -11.205 29.307  1.00 149.92 ? 1044 THR B C   1 
ATOM   4623 O  O   . THR B  1 270 ? 11.650  -11.402 28.180  1.00 148.70 ? 1044 THR B O   1 
ATOM   4624 C  CB  . THR B  1 270 ? 9.940   -8.980  29.111  1.00 155.08 ? 1044 THR B CB  1 
ATOM   4625 N  N   . PRO B  1 271 ? 10.827  -12.230 30.115  1.00 147.45 ? 1045 PRO B N   1 
ATOM   4626 C  CA  . PRO B  1 271 ? 10.954  -13.619 29.635  1.00 147.73 ? 1045 PRO B CA  1 
ATOM   4627 C  C   . PRO B  1 271 ? 9.854   -14.026 28.636  1.00 152.73 ? 1045 PRO B C   1 
ATOM   4628 O  O   . PRO B  1 271 ? 8.801   -13.378 28.624  1.00 152.56 ? 1045 PRO B O   1 
ATOM   4629 C  CB  . PRO B  1 271 ? 10.907  -14.445 30.927  1.00 149.31 ? 1045 PRO B CB  1 
ATOM   4630 C  CG  . PRO B  1 271 ? 10.122  -13.626 31.875  1.00 153.54 ? 1045 PRO B CG  1 
ATOM   4631 C  CD  . PRO B  1 271 ? 10.278  -12.178 31.488  1.00 148.98 ? 1045 PRO B CD  1 
ATOM   4632 N  N   . PRO B  1 272 ? 10.058  -15.080 27.792  1.00 149.44 ? 1046 PRO B N   1 
ATOM   4633 C  CA  . PRO B  1 272 ? 8.997   -15.476 26.838  1.00 149.21 ? 1046 PRO B CA  1 
ATOM   4634 C  C   . PRO B  1 272 ? 7.726   -16.001 27.512  1.00 153.30 ? 1046 PRO B C   1 
ATOM   4635 O  O   . PRO B  1 272 ? 6.636   -15.755 27.002  1.00 153.44 ? 1046 PRO B O   1 
ATOM   4636 C  CB  . PRO B  1 272 ? 9.670   -16.541 25.967  1.00 150.93 ? 1046 PRO B CB  1 
ATOM   4637 C  CG  . PRO B  1 272 ? 10.757  -17.093 26.829  1.00 155.44 ? 1046 PRO B CG  1 
ATOM   4638 C  CD  . PRO B  1 272 ? 11.246  -15.950 27.663  1.00 151.02 ? 1046 PRO B CD  1 
ATOM   4639 N  N   . LYS B  1 273 ? 7.863   -16.697 28.665  1.00 149.45 ? 1047 LYS B N   1 
ATOM   4640 C  CA  . LYS B  1 273 ? 6.737   -17.227 29.443  1.00 149.11 ? 1047 LYS B CA  1 
ATOM   4641 C  C   . LYS B  1 273 ? 5.886   -16.088 30.016  1.00 152.94 ? 1047 LYS B C   1 
ATOM   4642 O  O   . LYS B  1 273 ? 4.660   -16.196 30.039  1.00 152.49 ? 1047 LYS B O   1 
ATOM   4643 C  CB  . LYS B  1 273 ? 7.234   -18.147 30.567  1.00 151.54 ? 1047 LYS B CB  1 
ATOM   4644 N  N   . LEU B  1 274 ? 6.540   -14.990 30.450  1.00 149.46 ? 1048 LEU B N   1 
ATOM   4645 C  CA  . LEU B  1 274 ? 5.875   -13.803 30.987  1.00 149.21 ? 1048 LEU B CA  1 
ATOM   4646 C  C   . LEU B  1 274 ? 5.960   -12.611 30.002  1.00 153.07 ? 1048 LEU B C   1 
ATOM   4647 O  O   . LEU B  1 274 ? 6.235   -11.475 30.404  1.00 152.49 ? 1048 LEU B O   1 
ATOM   4648 C  CB  . LEU B  1 274 ? 6.422   -13.450 32.381  1.00 149.20 ? 1048 LEU B CB  1 
ATOM   4649 N  N   . GLU B  1 275 ? 5.712   -12.888 28.703  1.00 149.81 ? 1049 GLU B N   1 
ATOM   4650 C  CA  . GLU B  1 275 ? 5.706   -11.883 27.631  1.00 149.70 ? 1049 GLU B CA  1 
ATOM   4651 C  C   . GLU B  1 275 ? 4.346   -11.170 27.573  1.00 153.40 ? 1049 GLU B C   1 
ATOM   4652 O  O   . GLU B  1 275 ? 4.256   -10.054 27.053  1.00 152.69 ? 1049 GLU B O   1 
ATOM   4653 C  CB  . GLU B  1 275 ? 6.041   -12.526 26.275  1.00 151.05 ? 1049 GLU B CB  1 
ATOM   4654 N  N   . ASP B  1 276 ? 3.298   -11.826 28.123  1.00 149.96 ? 1050 ASP B N   1 
ATOM   4655 C  CA  . ASP B  1 276 ? 1.924   -11.330 28.198  1.00 177.86 ? 1050 ASP B CA  1 
ATOM   4656 C  C   . ASP B  1 276 ? 1.628   -10.788 29.598  1.00 192.73 ? 1050 ASP B C   1 
ATOM   4657 O  O   . ASP B  1 276 ? 2.279   -9.848  30.053  1.00 146.61 ? 1050 ASP B O   1 
ATOM   4658 C  CB  . ASP B  1 276 ? 0.932   -12.450 27.845  1.00 179.66 ? 1050 ASP B CB  1 
ATOM   4659 N  N   . ASP B  1 280 ? 3.422   -4.524  35.292  1.00 154.16 ? 1054 ASP B N   1 
ATOM   4660 C  CA  . ASP B  1 280 ? 2.996   -4.290  36.670  1.00 154.17 ? 1054 ASP B CA  1 
ATOM   4661 C  C   . ASP B  1 280 ? 2.222   -5.484  37.269  1.00 158.55 ? 1054 ASP B C   1 
ATOM   4662 O  O   . ASP B  1 280 ? 1.759   -5.397  38.409  1.00 158.14 ? 1054 ASP B O   1 
ATOM   4663 C  CB  . ASP B  1 280 ? 2.171   -2.990  36.754  1.00 155.97 ? 1054 ASP B CB  1 
ATOM   4664 C  CG  . ASP B  1 280 ? 2.273   -2.275  38.084  1.00 163.54 ? 1054 ASP B CG  1 
ATOM   4665 O  OD1 . ASP B  1 280 ? 3.244   -1.515  38.274  1.00 163.72 ? 1054 ASP B OD1 1 
ATOM   4666 O  OD2 . ASP B  1 280 ? 1.384   -2.481  38.936  1.00 168.30 ? 1054 ASP B OD2 1 
ATOM   4667 N  N   . SER B  1 281 ? 2.107   -6.597  36.511  1.00 155.52 ? 1055 SER B N   1 
ATOM   4668 C  CA  . SER B  1 281 ? 1.393   -7.807  36.930  1.00 155.53 ? 1055 SER B CA  1 
ATOM   4669 C  C   . SER B  1 281 ? 2.095   -8.518  38.102  1.00 160.07 ? 1055 SER B C   1 
ATOM   4670 O  O   . SER B  1 281 ? 3.325   -8.470  38.159  1.00 159.86 ? 1055 SER B O   1 
ATOM   4671 C  CB  . SER B  1 281 ? 1.237   -8.764  35.750  1.00 158.73 ? 1055 SER B CB  1 
ATOM   4672 O  OG  . SER B  1 281 ? 2.444   -9.444  35.445  1.00 166.06 ? 1055 SER B OG  1 
ATOM   4673 N  N   . PRO B  1 282 ? 1.359   -9.213  39.019  1.00 156.78 ? 1056 PRO B N   1 
ATOM   4674 C  CA  . PRO B  1 282 ? 2.036   -9.924  40.123  1.00 156.47 ? 1056 PRO B CA  1 
ATOM   4675 C  C   . PRO B  1 282 ? 2.908   -11.094 39.647  1.00 160.05 ? 1056 PRO B C   1 
ATOM   4676 O  O   . PRO B  1 282 ? 3.772   -11.552 40.396  1.00 159.94 ? 1056 PRO B O   1 
ATOM   4677 C  CB  . PRO B  1 282 ? 0.880   -10.392 41.018  1.00 158.24 ? 1056 PRO B CB  1 
ATOM   4678 C  CG  . PRO B  1 282 ? -0.316  -9.611  40.571  1.00 162.79 ? 1056 PRO B CG  1 
ATOM   4679 C  CD  . PRO B  1 282 ? -0.104  -9.384  39.111  1.00 158.42 ? 1056 PRO B CD  1 
ATOM   4680 N  N   . GLU B  1 283 ? 2.694   -11.557 38.395  1.00 155.91 ? 1057 GLU B N   1 
ATOM   4681 C  CA  . GLU B  1 283 ? 3.486   -12.606 37.750  1.00 155.40 ? 1057 GLU B CA  1 
ATOM   4682 C  C   . GLU B  1 283 ? 4.846   -12.010 37.364  1.00 157.85 ? 1057 GLU B C   1 
ATOM   4683 O  O   . GLU B  1 283 ? 5.861   -12.700 37.447  1.00 157.00 ? 1057 GLU B O   1 
ATOM   4684 C  CB  . GLU B  1 283 ? 2.751   -13.154 36.517  1.00 156.85 ? 1057 GLU B CB  1 
ATOM   4685 C  CG  . GLU B  1 283 ? 2.229   -14.566 36.704  1.00 167.58 ? 1057 GLU B CG  1 
ATOM   4686 C  CD  . GLU B  1 283 ? 1.185   -14.978 35.689  1.00 189.70 ? 1057 GLU B CD  1 
ATOM   4687 O  OE1 . GLU B  1 283 ? 1.585   -15.444 34.600  1.00 184.68 ? 1057 GLU B OE1 1 
ATOM   4688 O  OE2 . GLU B  1 283 ? -0.026  -14.839 35.977  1.00 185.95 ? 1057 GLU B OE2 1 
ATOM   4689 N  N   . MET B  1 284 ? 4.863   -10.702 37.012  1.00 153.78 ? 1058 MET B N   1 
ATOM   4690 C  CA  . MET B  1 284 ? 6.061   -9.930  36.672  1.00 153.35 ? 1058 MET B CA  1 
ATOM   4691 C  C   . MET B  1 284 ? 6.796   -9.436  37.937  1.00 156.66 ? 1058 MET B C   1 
ATOM   4692 O  O   . MET B  1 284 ? 8.029   -9.415  37.951  1.00 156.09 ? 1058 MET B O   1 
ATOM   4693 C  CB  . MET B  1 284 ? 5.698   -8.748  35.761  1.00 155.64 ? 1058 MET B CB  1 
ATOM   4694 N  N   . LYS B  1 285 ? 6.040   -9.046  38.994  1.00 152.84 ? 1059 LYS B N   1 
ATOM   4695 C  CA  . LYS B  1 285 ? 6.576   -8.578  40.284  1.00 152.23 ? 1059 LYS B CA  1 
ATOM   4696 C  C   . LYS B  1 285 ? 7.232   -9.717  41.091  1.00 155.11 ? 1059 LYS B C   1 
ATOM   4697 O  O   . LYS B  1 285 ? 8.043   -9.442  41.978  1.00 154.58 ? 1059 LYS B O   1 
ATOM   4698 C  CB  . LYS B  1 285 ? 5.492   -7.867  41.113  1.00 154.60 ? 1059 LYS B CB  1 
ATOM   4699 N  N   . ASP B  1 286 ? 6.879   -10.985 40.777  1.00 150.95 ? 1060 ASP B N   1 
ATOM   4700 C  CA  . ASP B  1 286 ? 7.439   -12.195 41.383  1.00 150.50 ? 1060 ASP B CA  1 
ATOM   4701 C  C   . ASP B  1 286 ? 8.758   -12.547 40.688  1.00 154.13 ? 1060 ASP B C   1 
ATOM   4702 O  O   . ASP B  1 286 ? 9.689   -13.014 41.346  1.00 153.47 ? 1060 ASP B O   1 
ATOM   4703 C  CB  . ASP B  1 286 ? 6.453   -13.367 41.278  1.00 152.36 ? 1060 ASP B CB  1 
ATOM   4704 N  N   . PHE B  1 287 ? 8.832   -12.323 39.354  1.00 151.02 ? 1061 PHE B N   1 
ATOM   4705 C  CA  . PHE B  1 287 ? 10.032  -12.546 38.541  1.00 150.94 ? 1061 PHE B CA  1 
ATOM   4706 C  C   . PHE B  1 287 ? 11.083  -11.480 38.884  1.00 156.08 ? 1061 PHE B C   1 
ATOM   4707 O  O   . PHE B  1 287 ? 12.274  -11.796 38.955  1.00 155.67 ? 1061 PHE B O   1 
ATOM   4708 C  CB  . PHE B  1 287 ? 9.692   -12.524 37.035  1.00 152.37 ? 1061 PHE B CB  1 
ATOM   4709 C  CG  . PHE B  1 287 ? 10.884  -12.584 36.103  1.00 153.49 ? 1061 PHE B CG  1 
ATOM   4710 C  CD1 . PHE B  1 287 ? 11.581  -13.771 35.914  1.00 156.20 ? 1061 PHE B CD1 1 
ATOM   4711 C  CD2 . PHE B  1 287 ? 11.301  -11.455 35.406  1.00 155.25 ? 1061 PHE B CD2 1 
ATOM   4712 C  CE1 . PHE B  1 287 ? 12.676  -13.828 35.046  1.00 156.94 ? 1061 PHE B CE1 1 
ATOM   4713 C  CE2 . PHE B  1 287 ? 12.399  -11.511 34.542  1.00 157.86 ? 1061 PHE B CE2 1 
ATOM   4714 C  CZ  . PHE B  1 287 ? 13.079  -12.697 34.368  1.00 155.93 ? 1061 PHE B CZ  1 
ATOM   4715 N  N   . ARG B  1 288 ? 10.624  -10.221 39.106  1.00 153.27 ? 1062 ARG B N   1 
ATOM   4716 C  CA  . ARG B  1 288 ? 11.443  -9.067  39.494  1.00 153.21 ? 1062 ARG B CA  1 
ATOM   4717 C  C   . ARG B  1 288 ? 12.117  -9.330  40.846  1.00 157.06 ? 1062 ARG B C   1 
ATOM   4718 O  O   . ARG B  1 288 ? 13.283  -8.982  41.022  1.00 156.43 ? 1062 ARG B O   1 
ATOM   4719 C  CB  . ARG B  1 288 ? 10.585  -7.790  39.555  1.00 153.58 ? 1062 ARG B CB  1 
ATOM   4720 N  N   . HIS B  1 289 ? 11.390  -9.983  41.775  1.00 153.78 ? 1063 HIS B N   1 
ATOM   4721 C  CA  . HIS B  1 289 ? 11.883  -10.363 43.100  1.00 153.65 ? 1063 HIS B CA  1 
ATOM   4722 C  C   . HIS B  1 289 ? 12.854  -11.554 43.028  1.00 156.84 ? 1063 HIS B C   1 
ATOM   4723 O  O   . HIS B  1 289 ? 13.760  -11.645 43.856  1.00 156.25 ? 1063 HIS B O   1 
ATOM   4724 C  CB  . HIS B  1 289 ? 10.715  -10.675 44.046  1.00 154.48 ? 1063 HIS B CB  1 
ATOM   4725 N  N   . GLY B  1 290 ? 12.662  -12.433 42.038  1.00 152.85 ? 1064 GLY B N   1 
ATOM   4726 C  CA  . GLY B  1 290 ? 13.495  -13.612 41.799  1.00 152.26 ? 1064 GLY B CA  1 
ATOM   4727 C  C   . GLY B  1 290 ? 14.962  -13.300 41.568  1.00 154.64 ? 1064 GLY B C   1 
ATOM   4728 O  O   . GLY B  1 290 ? 15.831  -14.116 41.890  1.00 154.18 ? 1064 GLY B O   1 
ATOM   4729 N  N   . PHE B  1 291 ? 15.235  -12.103 41.005  1.00 149.89 ? 1065 PHE B N   1 
ATOM   4730 C  CA  . PHE B  1 291 ? 16.571  -11.568 40.737  1.00 148.81 ? 1065 PHE B CA  1 
ATOM   4731 C  C   . PHE B  1 291 ? 16.975  -10.626 41.876  1.00 149.88 ? 1065 PHE B C   1 
ATOM   4732 O  O   . PHE B  1 291 ? 18.127  -10.665 42.304  1.00 149.73 ? 1065 PHE B O   1 
ATOM   4733 C  CB  . PHE B  1 291 ? 16.611  -10.834 39.382  1.00 150.59 ? 1065 PHE B CB  1 
ATOM   4734 N  N   . ASP B  1 292 ? 16.016  -9.806  42.381  1.00 143.63 ? 1066 ASP B N   1 
ATOM   4735 C  CA  . ASP B  1 292 ? 16.192  -8.839  43.476  1.00 142.06 ? 1066 ASP B CA  1 
ATOM   4736 C  C   . ASP B  1 292 ? 16.677  -9.534  44.756  1.00 144.11 ? 1066 ASP B C   1 
ATOM   4737 O  O   . ASP B  1 292 ? 17.534  -8.993  45.459  1.00 143.90 ? 1066 ASP B O   1 
ATOM   4738 C  CB  . ASP B  1 292 ? 14.875  -8.082  43.734  1.00 143.30 ? 1066 ASP B CB  1 
ATOM   4739 C  CG  . ASP B  1 292 ? 15.021  -6.590  43.944  1.00 147.64 ? 1066 ASP B CG  1 
ATOM   4740 O  OD1 . ASP B  1 292 ? 15.510  -5.904  43.021  1.00 147.07 ? 1066 ASP B OD1 1 
ATOM   4741 O  OD2 . ASP B  1 292 ? 14.622  -6.103  45.020  1.00 151.53 ? 1066 ASP B OD2 1 
ATOM   4742 N  N   . ILE B  1 293 ? 16.150  -10.746 45.032  1.00 138.90 ? 1067 ILE B N   1 
ATOM   4743 C  CA  . ILE B  1 293 ? 16.540  -11.574 46.172  1.00 137.82 ? 1067 ILE B CA  1 
ATOM   4744 C  C   . ILE B  1 293 ? 17.952  -12.133 45.967  1.00 139.61 ? 1067 ILE B C   1 
ATOM   4745 O  O   . ILE B  1 293 ? 18.689  -12.253 46.943  1.00 139.32 ? 1067 ILE B O   1 
ATOM   4746 C  CB  . ILE B  1 293 ? 15.515  -12.697 46.444  1.00 140.93 ? 1067 ILE B CB  1 
ATOM   4747 N  N   . LEU B  1 294 ? 18.333  -12.453 44.708  1.00 134.36 ? 1068 LEU B N   1 
ATOM   4748 C  CA  . LEU B  1 294 ? 19.662  -12.974 44.360  1.00 133.28 ? 1068 LEU B CA  1 
ATOM   4749 C  C   . LEU B  1 294 ? 20.741  -11.883 44.401  1.00 135.89 ? 1068 LEU B C   1 
ATOM   4750 O  O   . LEU B  1 294 ? 21.895  -12.194 44.698  1.00 135.34 ? 1068 LEU B O   1 
ATOM   4751 C  CB  . LEU B  1 294 ? 19.653  -13.670 42.987  1.00 133.17 ? 1068 LEU B CB  1 
ATOM   4752 C  CG  . LEU B  1 294 ? 20.408  -15.001 42.902  1.00 137.42 ? 1068 LEU B CG  1 
ATOM   4753 C  CD1 . LEU B  1 294 ? 19.729  -15.944 41.942  1.00 137.34 ? 1068 LEU B CD1 1 
ATOM   4754 C  CD2 . LEU B  1 294 ? 21.858  -14.801 42.497  1.00 139.44 ? 1068 LEU B CD2 1 
ATOM   4755 N  N   . VAL B  1 295 ? 20.371  -10.615 44.092  1.00 131.68 ? 1069 VAL B N   1 
ATOM   4756 C  CA  . VAL B  1 295 ? 21.278  -9.451  44.121  1.00 131.17 ? 1069 VAL B CA  1 
ATOM   4757 C  C   . VAL B  1 295 ? 21.667  -9.160  45.585  1.00 134.97 ? 1069 VAL B C   1 
ATOM   4758 O  O   . VAL B  1 295 ? 22.827  -8.838  45.865  1.00 134.82 ? 1069 VAL B O   1 
ATOM   4759 C  CB  . VAL B  1 295 ? 20.704  -8.211  43.369  1.00 134.59 ? 1069 VAL B CB  1 
ATOM   4760 C  CG1 . VAL B  1 295 ? 21.539  -6.957  43.614  1.00 134.14 ? 1069 VAL B CG1 1 
ATOM   4761 C  CG2 . VAL B  1 295 ? 20.598  -8.480  41.873  1.00 134.44 ? 1069 VAL B CG2 1 
ATOM   4762 N  N   . GLY B  1 296 ? 20.704  -9.334  46.493  1.00 130.69 ? 1070 GLY B N   1 
ATOM   4763 C  CA  . GLY B  1 296 ? 20.909  -9.180  47.928  1.00 129.97 ? 1070 GLY B CA  1 
ATOM   4764 C  C   . GLY B  1 296 ? 21.823  -10.258 48.476  1.00 132.61 ? 1070 GLY B C   1 
ATOM   4765 O  O   . GLY B  1 296 ? 22.731  -9.963  49.258  1.00 132.46 ? 1070 GLY B O   1 
ATOM   4766 N  N   . GLN B  1 297 ? 21.608  -11.518 48.030  1.00 127.89 ? 1071 GLN B N   1 
ATOM   4767 C  CA  . GLN B  1 297 ? 22.404  -12.690 48.407  1.00 127.11 ? 1071 GLN B CA  1 
ATOM   4768 C  C   . GLN B  1 297 ? 23.817  -12.608 47.817  1.00 130.18 ? 1071 GLN B C   1 
ATOM   4769 O  O   . GLN B  1 297 ? 24.751  -13.162 48.401  1.00 129.86 ? 1071 GLN B O   1 
ATOM   4770 C  CB  . GLN B  1 297 ? 21.714  -13.983 47.961  1.00 128.32 ? 1071 GLN B CB  1 
ATOM   4771 N  N   . ILE B  1 298 ? 23.969  -11.911 46.668  1.00 126.05 ? 1072 ILE B N   1 
ATOM   4772 C  CA  . ILE B  1 298 ? 25.254  -11.698 45.997  1.00 125.54 ? 1072 ILE B CA  1 
ATOM   4773 C  C   . ILE B  1 298 ? 26.136  -10.751 46.820  1.00 128.15 ? 1072 ILE B C   1 
ATOM   4774 O  O   . ILE B  1 298 ? 27.296  -11.076 47.077  1.00 127.19 ? 1072 ILE B O   1 
ATOM   4775 C  CB  . ILE B  1 298 ? 25.061  -11.203 44.538  1.00 128.65 ? 1072 ILE B CB  1 
ATOM   4776 N  N   . ASP B  1 299 ? 25.566  -9.605  47.263  1.00 124.40 ? 1073 ASP B N   1 
ATOM   4777 C  CA  . ASP B  1 299 ? 26.237  -8.591  48.085  1.00 124.13 ? 1073 ASP B CA  1 
ATOM   4778 C  C   . ASP B  1 299 ? 26.646  -9.136  49.462  1.00 128.57 ? 1073 ASP B C   1 
ATOM   4779 O  O   . ASP B  1 299 ? 27.658  -8.697  50.014  1.00 128.36 ? 1073 ASP B O   1 
ATOM   4780 C  CB  . ASP B  1 299 ? 25.354  -7.342  48.243  1.00 125.65 ? 1073 ASP B CB  1 
ATOM   4781 C  CG  . ASP B  1 299 ? 25.435  -6.380  47.076  1.00 134.17 ? 1073 ASP B CG  1 
ATOM   4782 O  OD1 . ASP B  1 299 ? 26.438  -5.640  46.984  1.00 134.84 ? 1073 ASP B OD1 1 
ATOM   4783 O  OD2 . ASP B  1 299 ? 24.495  -6.358  46.261  1.00 139.87 ? 1073 ASP B OD2 1 
ATOM   4784 N  N   . ASP B  1 300 ? 25.854  -10.088 50.009  1.00 125.05 ? 1074 ASP B N   1 
ATOM   4785 C  CA  . ASP B  1 300 ? 26.102  -10.751 51.294  1.00 124.84 ? 1074 ASP B CA  1 
ATOM   4786 C  C   . ASP B  1 300 ? 27.359  -11.621 51.201  1.00 128.76 ? 1074 ASP B C   1 
ATOM   4787 O  O   . ASP B  1 300 ? 28.162  -11.633 52.134  1.00 128.42 ? 1074 ASP B O   1 
ATOM   4788 C  CB  . ASP B  1 300 ? 24.889  -11.613 51.711  1.00 126.60 ? 1074 ASP B CB  1 
ATOM   4789 C  CG  . ASP B  1 300 ? 23.663  -10.869 52.217  1.00 134.64 ? 1074 ASP B CG  1 
ATOM   4790 O  OD1 . ASP B  1 300 ? 23.612  -9.627  52.067  1.00 134.65 ? 1074 ASP B OD1 1 
ATOM   4791 O  OD2 . ASP B  1 300 ? 22.752  -11.532 52.759  1.00 140.26 ? 1074 ASP B OD2 1 
ATOM   4792 N  N   . ALA B  1 301 ? 27.530  -12.332 50.065  1.00 124.99 ? 1075 ALA B N   1 
ATOM   4793 C  CA  . ALA B  1 301 ? 28.682  -13.185 49.787  1.00 124.42 ? 1075 ALA B CA  1 
ATOM   4794 C  C   . ALA B  1 301 ? 29.908  -12.318 49.466  1.00 127.76 ? 1075 ALA B C   1 
ATOM   4795 O  O   . ALA B  1 301 ? 31.032  -12.766 49.685  1.00 128.91 ? 1075 ALA B O   1 
ATOM   4796 C  CB  . ALA B  1 301 ? 28.377  -14.120 48.628  1.00 125.11 ? 1075 ALA B CB  1 
ATOM   4797 N  N   . LEU B  1 302 ? 29.693  -11.077 48.969  1.00 121.63 ? 1076 LEU B N   1 
ATOM   4798 C  CA  . LEU B  1 302 ? 30.761  -10.119 48.649  1.00 120.40 ? 1076 LEU B CA  1 
ATOM   4799 C  C   . LEU B  1 302 ? 31.401  -9.575  49.940  1.00 121.58 ? 1076 LEU B C   1 
ATOM   4800 O  O   . LEU B  1 302 ? 32.631  -9.444  50.019  1.00 120.62 ? 1076 LEU B O   1 
ATOM   4801 C  CB  . LEU B  1 302 ? 30.224  -8.972  47.771  1.00 120.46 ? 1076 LEU B CB  1 
ATOM   4802 N  N   . LYS B  1 303 ? 30.557  -9.297  50.960  1.00 116.62 ? 1077 LYS B N   1 
ATOM   4803 C  CA  . LYS B  1 303 ? 30.970  -8.834  52.289  1.00 115.57 ? 1077 LYS B CA  1 
ATOM   4804 C  C   . LYS B  1 303 ? 31.847  -9.894  52.972  1.00 116.23 ? 1077 LYS B C   1 
ATOM   4805 O  O   . LYS B  1 303 ? 32.800  -9.536  53.656  1.00 115.02 ? 1077 LYS B O   1 
ATOM   4806 C  CB  . LYS B  1 303 ? 29.741  -8.515  53.155  1.00 118.33 ? 1077 LYS B CB  1 
ATOM   4807 N  N   . LEU B  1 304 ? 31.541  -11.191 52.746  1.00 111.52 ? 1078 LEU B N   1 
ATOM   4808 C  CA  . LEU B  1 304 ? 32.286  -12.334 53.287  1.00 111.10 ? 1078 LEU B CA  1 
ATOM   4809 C  C   . LEU B  1 304 ? 33.637  -12.548 52.583  1.00 114.37 ? 1078 LEU B C   1 
ATOM   4810 O  O   . LEU B  1 304 ? 34.620  -12.881 53.250  1.00 113.85 ? 1078 LEU B O   1 
ATOM   4811 C  CB  . LEU B  1 304 ? 31.443  -13.626 53.262  1.00 111.14 ? 1078 LEU B CB  1 
ATOM   4812 C  CG  . LEU B  1 304 ? 30.116  -13.614 54.032  1.00 115.88 ? 1078 LEU B CG  1 
ATOM   4813 C  CD1 . LEU B  1 304 ? 29.328  -14.882 53.774  1.00 115.92 ? 1078 LEU B CD1 1 
ATOM   4814 C  CD2 . LEU B  1 304 ? 30.327  -13.415 55.528  1.00 119.18 ? 1078 LEU B CD2 1 
ATOM   4815 N  N   . ALA B  1 305 ? 33.687  -12.351 51.250  1.00 110.43 ? 1079 ALA B N   1 
ATOM   4816 C  CA  . ALA B  1 305 ? 34.908  -12.473 50.449  1.00 110.42 ? 1079 ALA B CA  1 
ATOM   4817 C  C   . ALA B  1 305 ? 35.944  -11.407 50.877  1.00 115.71 ? 1079 ALA B C   1 
ATOM   4818 O  O   . ALA B  1 305 ? 37.135  -11.722 51.001  1.00 114.92 ? 1079 ALA B O   1 
ATOM   4819 C  CB  . ALA B  1 305 ? 34.575  -12.323 48.969  1.00 111.04 ? 1079 ALA B CB  1 
ATOM   4820 N  N   . ASN B  1 306 ? 35.461  -10.157 51.130  1.00 113.03 ? 1080 ASN B N   1 
ATOM   4821 C  CA  . ASN B  1 306 ? 36.234  -8.990  51.582  1.00 113.01 ? 1080 ASN B CA  1 
ATOM   4822 C  C   . ASN B  1 306 ? 36.868  -9.173  52.983  1.00 117.97 ? 1080 ASN B C   1 
ATOM   4823 O  O   . ASN B  1 306 ? 37.966  -8.676  53.231  1.00 117.17 ? 1080 ASN B O   1 
ATOM   4824 C  CB  . ASN B  1 306 ? 35.338  -7.753  51.594  1.00 111.46 ? 1080 ASN B CB  1 
ATOM   4825 C  CG  . ASN B  1 306 ? 34.995  -7.201  50.240  1.00 129.19 ? 1080 ASN B CG  1 
ATOM   4826 O  OD1 . ASN B  1 306 ? 35.765  -7.294  49.276  1.00 121.89 ? 1080 ASN B OD1 1 
ATOM   4827 N  ND2 . ASN B  1 306 ? 33.833  -6.575  50.150  1.00 121.14 ? 1080 ASN B ND2 1 
ATOM   4828 N  N   . GLU B  1 307 ? 36.161  -9.860  53.902  1.00 115.09 ? 1081 GLU B N   1 
ATOM   4829 C  CA  . GLU B  1 307 ? 36.638  -10.109 55.262  1.00 115.11 ? 1081 GLU B CA  1 
ATOM   4830 C  C   . GLU B  1 307 ? 37.464  -11.410 55.336  1.00 120.70 ? 1081 GLU B C   1 
ATOM   4831 O  O   . GLU B  1 307 ? 37.545  -12.038 56.398  1.00 120.94 ? 1081 GLU B O   1 
ATOM   4832 C  CB  . GLU B  1 307 ? 35.459  -10.109 56.254  1.00 116.32 ? 1081 GLU B CB  1 
ATOM   4833 N  N   . GLY B  1 308 ? 38.063  -11.795 54.204  1.00 117.79 ? 1082 GLY B N   1 
ATOM   4834 C  CA  . GLY B  1 308 ? 38.906  -12.980 54.063  1.00 117.90 ? 1082 GLY B CA  1 
ATOM   4835 C  C   . GLY B  1 308 ? 38.281  -14.308 54.435  1.00 122.40 ? 1082 GLY B C   1 
ATOM   4836 O  O   . GLY B  1 308 ? 39.002  -15.253 54.775  1.00 122.12 ? 1082 GLY B O   1 
ATOM   4837 N  N   . LYS B  1 309 ? 36.938  -14.385 54.386  1.00 119.42 ? 1083 LYS B N   1 
ATOM   4838 C  CA  . LYS B  1 309 ? 36.175  -15.606 54.650  1.00 119.45 ? 1083 LYS B CA  1 
ATOM   4839 C  C   . LYS B  1 309 ? 35.882  -16.183 53.247  1.00 124.96 ? 1083 LYS B C   1 
ATOM   4840 O  O   . LYS B  1 309 ? 34.805  -15.958 52.687  1.00 124.91 ? 1083 LYS B O   1 
ATOM   4841 C  CB  . LYS B  1 309 ? 34.874  -15.301 55.437  1.00 121.04 ? 1083 LYS B CB  1 
ATOM   4842 C  CG  . LYS B  1 309 ? 35.070  -14.515 56.731  1.00 126.42 ? 1083 LYS B CG  1 
ATOM   4843 C  CD  . LYS B  1 309 ? 33.931  -13.532 56.974  1.00 132.42 ? 1083 LYS B CD  1 
ATOM   4844 N  N   . VAL B  1 310 ? 36.897  -16.845 52.651  1.00 121.68 ? 1084 VAL B N   1 
ATOM   4845 C  CA  . VAL B  1 310 ? 36.838  -17.416 51.303  1.00 121.17 ? 1084 VAL B CA  1 
ATOM   4846 C  C   . VAL B  1 310 ? 35.873  -18.611 51.205  1.00 123.30 ? 1084 VAL B C   1 
ATOM   4847 O  O   . VAL B  1 310 ? 34.996  -18.599 50.339  1.00 122.75 ? 1084 VAL B O   1 
ATOM   4848 C  CB  . VAL B  1 310 ? 38.246  -17.758 50.766  1.00 125.18 ? 1084 VAL B CB  1 
ATOM   4849 N  N   . LYS B  1 311 ? 36.019  -19.620 52.096  1.00 118.17 ? 1085 LYS B N   1 
ATOM   4850 C  CA  . LYS B  1 311 ? 35.169  -20.822 52.126  1.00 117.04 ? 1085 LYS B CA  1 
ATOM   4851 C  C   . LYS B  1 311 ? 33.717  -20.528 52.548  1.00 119.30 ? 1085 LYS B C   1 
ATOM   4852 O  O   . LYS B  1 311 ? 32.810  -21.252 52.131  1.00 117.67 ? 1085 LYS B O   1 
ATOM   4853 C  CB  . LYS B  1 311 ? 35.798  -21.921 52.990  1.00 118.94 ? 1085 LYS B CB  1 
ATOM   4854 N  N   . GLU B  1 312 ? 33.507  -19.454 53.352  1.00 116.04 ? 1086 GLU B N   1 
ATOM   4855 C  CA  . GLU B  1 312 ? 32.195  -18.984 53.822  1.00 115.78 ? 1086 GLU B CA  1 
ATOM   4856 C  C   . GLU B  1 312 ? 31.524  -18.073 52.787  1.00 119.27 ? 1086 GLU B C   1 
ATOM   4857 O  O   . GLU B  1 312 ? 30.309  -17.899 52.834  1.00 119.00 ? 1086 GLU B O   1 
ATOM   4858 C  CB  . GLU B  1 312 ? 32.296  -18.291 55.191  1.00 117.15 ? 1086 GLU B CB  1 
ATOM   4859 N  N   . ALA B  1 313 ? 32.304  -17.494 51.857  1.00 115.59 ? 1087 ALA B N   1 
ATOM   4860 C  CA  . ALA B  1 313 ? 31.748  -16.702 50.764  1.00 115.82 ? 1087 ALA B CA  1 
ATOM   4861 C  C   . ALA B  1 313 ? 31.420  -17.679 49.625  1.00 121.20 ? 1087 ALA B C   1 
ATOM   4862 O  O   . ALA B  1 313 ? 30.513  -17.414 48.837  1.00 121.81 ? 1087 ALA B O   1 
ATOM   4863 C  CB  . ALA B  1 313 ? 32.744  -15.658 50.291  1.00 116.50 ? 1087 ALA B CB  1 
ATOM   4864 N  N   . GLN B  1 314 ? 32.163  -18.815 49.558  1.00 117.47 ? 1088 GLN B N   1 
ATOM   4865 C  CA  . GLN B  1 314 ? 32.002  -19.912 48.597  1.00 117.18 ? 1088 GLN B CA  1 
ATOM   4866 C  C   . GLN B  1 314 ? 30.769  -20.750 48.984  1.00 121.01 ? 1088 GLN B C   1 
ATOM   4867 O  O   . GLN B  1 314 ? 30.053  -21.206 48.099  1.00 120.08 ? 1088 GLN B O   1 
ATOM   4868 C  CB  . GLN B  1 314 ? 33.278  -20.784 48.569  1.00 118.63 ? 1088 GLN B CB  1 
ATOM   4869 C  CG  . GLN B  1 314 ? 33.249  -21.983 47.609  1.00 135.07 ? 1088 GLN B CG  1 
ATOM   4870 C  CD  . GLN B  1 314 ? 34.323  -23.018 47.888  1.00 153.80 ? 1088 GLN B CD  1 
ATOM   4871 O  OE1 . GLN B  1 314 ? 34.582  -23.415 49.038  1.00 150.19 ? 1088 GLN B OE1 1 
ATOM   4872 N  NE2 . GLN B  1 314 ? 34.957  -23.501 46.828  1.00 143.12 ? 1088 GLN B NE2 1 
ATOM   4873 N  N   . ALA B  1 315 ? 30.525  -20.949 50.303  1.00 118.40 ? 1089 ALA B N   1 
ATOM   4874 C  CA  . ALA B  1 315 ? 29.369  -21.692 50.826  1.00 118.56 ? 1089 ALA B CA  1 
ATOM   4875 C  C   . ALA B  1 315 ? 28.063  -20.908 50.615  1.00 123.24 ? 1089 ALA B C   1 
ATOM   4876 O  O   . ALA B  1 315 ? 26.976  -21.483 50.714  1.00 122.89 ? 1089 ALA B O   1 
ATOM   4877 C  CB  . ALA B  1 315 ? 29.563  -22.008 52.304  1.00 119.24 ? 1089 ALA B CB  1 
ATOM   4878 N  N   . ALA B  1 316 ? 28.174  -19.598 50.315  1.00 120.40 ? 1090 ALA B N   1 
ATOM   4879 C  CA  . ALA B  1 316 ? 27.038  -18.724 50.035  1.00 120.51 ? 1090 ALA B CA  1 
ATOM   4880 C  C   . ALA B  1 316 ? 26.578  -18.896 48.573  1.00 126.61 ? 1090 ALA B C   1 
ATOM   4881 O  O   . ALA B  1 316 ? 25.512  -18.396 48.213  1.00 126.32 ? 1090 ALA B O   1 
ATOM   4882 C  CB  . ALA B  1 316 ? 27.406  -17.276 50.323  1.00 121.00 ? 1090 ALA B CB  1 
ATOM   4883 N  N   . ALA B  1 317 ? 27.369  -19.633 47.745  1.00 124.73 ? 1091 ALA B N   1 
ATOM   4884 C  CA  . ALA B  1 317 ? 27.064  -19.927 46.337  1.00 125.08 ? 1091 ALA B CA  1 
ATOM   4885 C  C   . ALA B  1 317 ? 25.914  -20.921 46.196  1.00 129.49 ? 1091 ALA B C   1 
ATOM   4886 O  O   . ALA B  1 317 ? 25.114  -20.784 45.269  1.00 129.28 ? 1091 ALA B O   1 
ATOM   4887 C  CB  . ALA B  1 317 ? 28.293  -20.453 45.615  1.00 125.91 ? 1091 ALA B CB  1 
ATOM   4888 N  N   . GLU B  1 318 ? 25.826  -21.912 47.109  1.00 126.03 ? 1092 GLU B N   1 
ATOM   4889 C  CA  . GLU B  1 318 ? 24.748  -22.906 47.118  1.00 125.84 ? 1092 GLU B CA  1 
ATOM   4890 C  C   . GLU B  1 318 ? 23.435  -22.336 47.685  1.00 129.91 ? 1092 GLU B C   1 
ATOM   4891 O  O   . GLU B  1 318 ? 22.376  -22.942 47.496  1.00 129.77 ? 1092 GLU B O   1 
ATOM   4892 C  CB  . GLU B  1 318 ? 25.169  -24.216 47.816  1.00 127.24 ? 1092 GLU B CB  1 
ATOM   4893 C  CG  . GLU B  1 318 ? 25.749  -24.070 49.215  1.00 138.25 ? 1092 GLU B CG  1 
ATOM   4894 C  CD  . GLU B  1 318 ? 24.803  -24.354 50.366  1.00 159.68 ? 1092 GLU B CD  1 
ATOM   4895 O  OE1 . GLU B  1 318 ? 23.894  -23.528 50.611  1.00 154.80 ? 1092 GLU B OE1 1 
ATOM   4896 O  OE2 . GLU B  1 318 ? 24.986  -25.394 51.039  1.00 153.94 ? 1092 GLU B OE2 1 
ATOM   4897 N  N   . GLN B  1 319 ? 23.510  -21.168 48.369  1.00 126.27 ? 1093 GLN B N   1 
ATOM   4898 C  CA  . GLN B  1 319 ? 22.362  -20.456 48.942  1.00 126.07 ? 1093 GLN B CA  1 
ATOM   4899 C  C   . GLN B  1 319 ? 21.658  -19.622 47.868  1.00 130.81 ? 1093 GLN B C   1 
ATOM   4900 O  O   . GLN B  1 319 ? 20.428  -19.592 47.837  1.00 130.03 ? 1093 GLN B O   1 
ATOM   4901 C  CB  . GLN B  1 319 ? 22.791  -19.572 50.123  1.00 127.27 ? 1093 GLN B CB  1 
ATOM   4902 N  N   . LEU B  1 320 ? 22.440  -18.955 46.985  1.00 128.78 ? 1094 LEU B N   1 
ATOM   4903 C  CA  . LEU B  1 320 ? 21.927  -18.153 45.869  1.00 129.38 ? 1094 LEU B CA  1 
ATOM   4904 C  C   . LEU B  1 320 ? 21.472  -19.034 44.694  1.00 136.23 ? 1094 LEU B C   1 
ATOM   4905 O  O   . LEU B  1 320 ? 20.653  -18.593 43.888  1.00 136.02 ? 1094 LEU B O   1 
ATOM   4906 C  CB  . LEU B  1 320 ? 22.914  -17.049 45.420  1.00 129.24 ? 1094 LEU B CB  1 
ATOM   4907 C  CG  . LEU B  1 320 ? 24.375  -17.412 45.155  1.00 133.52 ? 1094 LEU B CG  1 
ATOM   4908 C  CD1 . LEU B  1 320 ? 24.595  -17.780 43.705  1.00 133.68 ? 1094 LEU B CD1 1 
ATOM   4909 C  CD2 . LEU B  1 320 ? 25.281  -16.254 45.505  1.00 134.96 ? 1094 LEU B CD2 1 
ATOM   4910 N  N   . LYS B  1 321 ? 21.982  -20.287 44.618  1.00 134.72 ? 1095 LYS B N   1 
ATOM   4911 C  CA  . LYS B  1 321 ? 21.611  -21.278 43.601  1.00 135.20 ? 1095 LYS B CA  1 
ATOM   4912 C  C   . LYS B  1 321 ? 20.204  -21.829 43.876  1.00 141.15 ? 1095 LYS B C   1 
ATOM   4913 O  O   . LYS B  1 321 ? 19.558  -22.332 42.957  1.00 140.71 ? 1095 LYS B O   1 
ATOM   4914 C  CB  . LYS B  1 321 ? 22.636  -22.419 43.543  1.00 137.61 ? 1095 LYS B CB  1 
ATOM   4915 N  N   . THR B  1 322 ? 19.736  -21.724 45.139  1.00 139.51 ? 1096 THR B N   1 
ATOM   4916 C  CA  . THR B  1 322 ? 18.401  -22.136 45.578  1.00 140.24 ? 1096 THR B CA  1 
ATOM   4917 C  C   . THR B  1 322 ? 17.340  -21.138 45.078  1.00 146.94 ? 1096 THR B C   1 
ATOM   4918 O  O   . THR B  1 322 ? 16.241  -21.554 44.718  1.00 146.67 ? 1096 THR B O   1 
ATOM   4919 C  CB  . THR B  1 322 ? 18.367  -22.297 47.099  1.00 147.20 ? 1096 THR B CB  1 
ATOM   4920 N  N   . THR B  1 323 ? 17.694  -19.823 45.044  1.00 145.58 ? 1097 THR B N   1 
ATOM   4921 C  CA  . THR B  1 323 ? 16.851  -18.716 44.560  1.00 146.38 ? 1097 THR B CA  1 
ATOM   4922 C  C   . THR B  1 323 ? 16.607  -18.875 43.050  1.00 153.23 ? 1097 THR B C   1 
ATOM   4923 O  O   . THR B  1 323 ? 15.494  -18.637 42.588  1.00 153.07 ? 1097 THR B O   1 
ATOM   4924 C  CB  . THR B  1 323 ? 17.496  -17.342 44.885  1.00 151.69 ? 1097 THR B CB  1 
ATOM   4925 O  OG1 . THR B  1 323 ? 17.924  -17.324 46.246  1.00 151.76 ? 1097 THR B OG1 1 
ATOM   4926 C  CG2 . THR B  1 323 ? 16.554  -16.162 44.633  1.00 147.78 ? 1097 THR B CG2 1 
ATOM   4927 N  N   . ARG B  1 324 ? 17.648  -19.286 42.295  1.00 151.73 ? 1098 ARG B N   1 
ATOM   4928 C  CA  . ARG B  1 324 ? 17.596  -19.490 40.843  1.00 152.39 ? 1098 ARG B CA  1 
ATOM   4929 C  C   . ARG B  1 324 ? 16.703  -20.666 40.445  1.00 157.69 ? 1098 ARG B C   1 
ATOM   4930 O  O   . ARG B  1 324 ? 15.919  -20.544 39.506  1.00 156.94 ? 1098 ARG B O   1 
ATOM   4931 C  CB  . ARG B  1 324 ? 19.013  -19.681 40.270  1.00 152.94 ? 1098 ARG B CB  1 
ATOM   4932 N  N   . ASN B  1 325 ? 16.857  -21.822 41.083  1.00 155.72 ? 1099 ASN B N   1 
ATOM   4933 C  CA  . ASN B  1 325 ? 15.937  -22.931 40.713  1.00 156.16 ? 1099 ASN B CA  1 
ATOM   4934 C  C   . ASN B  1 325 ? 14.503  -22.628 41.180  1.00 160.84 ? 1099 ASN B C   1 
ATOM   4935 O  O   . ASN B  1 325 ? 13.564  -22.869 40.400  1.00 160.23 ? 1099 ASN B O   1 
ATOM   4936 C  CB  . ASN B  1 325 ? 16.477  -24.293 41.156  1.00 157.31 ? 1099 ASN B CB  1 
ATOM   4937 C  CG  . ASN B  1 325 ? 17.664  -24.734 40.326  1.00 177.86 ? 1099 ASN B CG  1 
ATOM   4938 O  OD1 . ASN B  1 325 ? 18.199  -25.823 40.523  1.00 172.67 ? 1099 ASN B OD1 1 
ATOM   4939 N  ND2 . ASN B  1 325 ? 18.083  -23.893 39.395  1.00 167.28 ? 1099 ASN B ND2 1 
ATOM   4940 N  N   . ALA B  1 326 ? 14.353  -22.119 42.408  1.00 158.26 ? 1100 ALA B N   1 
ATOM   4941 C  CA  . ALA B  1 326 ? 13.032  -21.869 43.040  1.00 158.59 ? 1100 ALA B CA  1 
ATOM   4942 C  C   . ALA B  1 326 ? 12.178  -20.741 42.432  1.00 164.17 ? 1100 ALA B C   1 
ATOM   4943 O  O   . ALA B  1 326 ? 10.969  -20.987 42.253  1.00 163.68 ? 1100 ALA B O   1 
ATOM   4944 C  CB  . ALA B  1 326 ? 13.211  -21.673 44.526  1.00 159.28 ? 1100 ALA B CB  1 
ATOM   4945 N  N   . TYR B  1 327 ? 12.742  -19.563 42.128  1.00 162.08 ? 1101 TYR B N   1 
ATOM   4946 C  CA  . TYR B  1 327 ? 11.875  -18.440 41.663  1.00 162.38 ? 1101 TYR B CA  1 
ATOM   4947 C  C   . TYR B  1 327 ? 12.115  -18.024 40.206  1.00 166.09 ? 1101 TYR B C   1 
ATOM   4948 O  O   . TYR B  1 327 ? 11.193  -17.444 39.606  1.00 165.83 ? 1101 TYR B O   1 
ATOM   4949 C  CB  . TYR B  1 327 ? 12.094  -17.192 42.521  1.00 164.13 ? 1101 TYR B CB  1 
ATOM   4950 C  CG  . TYR B  1 327 ? 12.168  -17.415 44.010  1.00 166.82 ? 1101 TYR B CG  1 
ATOM   4951 C  CD1 . TYR B  1 327 ? 11.306  -16.757 44.871  1.00 169.02 ? 1101 TYR B CD1 1 
ATOM   4952 C  CD2 . TYR B  1 327 ? 13.113  -18.263 44.563  1.00 167.81 ? 1101 TYR B CD2 1 
ATOM   4953 C  CE1 . TYR B  1 327 ? 11.369  -16.944 46.242  1.00 170.08 ? 1101 TYR B CE1 1 
ATOM   4954 C  CE2 . TYR B  1 327 ? 13.189  -18.463 45.932  1.00 168.85 ? 1101 TYR B CE2 1 
ATOM   4955 C  CZ  . TYR B  1 327 ? 12.314  -17.801 46.775  1.00 176.79 ? 1101 TYR B CZ  1 
ATOM   4956 O  OH  . TYR B  1 327 ? 12.383  -17.992 48.125  1.00 178.07 ? 1101 TYR B OH  1 
ATOM   4957 N  N   . ILE B  1 328 ? 13.301  -18.297 39.664  1.00 162.35 ? 1102 ILE B N   1 
ATOM   4958 C  CA  . ILE B  1 328 ? 13.654  -17.883 38.301  1.00 162.04 ? 1102 ILE B CA  1 
ATOM   4959 C  C   . ILE B  1 328 ? 13.699  -19.018 37.260  1.00 165.45 ? 1102 ILE B C   1 
ATOM   4960 O  O   . ILE B  1 328 ? 13.593  -18.729 36.066  1.00 164.85 ? 1102 ILE B O   1 
ATOM   4961 C  CB  . ILE B  1 328 ? 14.989  -17.104 38.321  1.00 165.15 ? 1102 ILE B CB  1 
ATOM   4962 N  N   . GLN B  1 329 ? 13.859  -20.288 37.693  1.00 162.04 ? 1103 GLN B N   1 
ATOM   4963 C  CA  . GLN B  1 329 ? 13.944  -21.456 36.799  1.00 161.96 ? 1103 GLN B CA  1 
ATOM   4964 C  C   . GLN B  1 329 ? 12.694  -21.673 35.923  1.00 166.61 ? 1103 GLN B C   1 
ATOM   4965 O  O   . GLN B  1 329 ? 12.828  -22.113 34.778  1.00 166.42 ? 1103 GLN B O   1 
ATOM   4966 C  CB  . GLN B  1 329 ? 14.286  -22.733 37.590  1.00 163.07 ? 1103 GLN B CB  1 
ATOM   4967 C  CG  . GLN B  1 329 ? 14.707  -23.944 36.745  1.00 172.99 ? 1103 GLN B CG  1 
ATOM   4968 C  CD  . GLN B  1 329 ? 16.019  -23.748 36.028  1.00 188.41 ? 1103 GLN B CD  1 
ATOM   4969 O  OE1 . GLN B  1 329 ? 16.066  -23.322 34.869  1.00 182.62 ? 1103 GLN B OE1 1 
ATOM   4970 N  NE2 . GLN B  1 329 ? 17.113  -24.061 36.703  1.00 180.40 ? 1103 GLN B NE2 1 
ATOM   4971 N  N   . LYS B  1 330 ? 11.495  -21.362 36.457  1.00 163.02 ? 1104 LYS B N   1 
ATOM   4972 C  CA  . LYS B  1 330 ? 10.219  -21.510 35.752  1.00 162.59 ? 1104 LYS B CA  1 
ATOM   4973 C  C   . LYS B  1 330 ? 10.065  -20.531 34.581  1.00 167.12 ? 1104 LYS B C   1 
ATOM   4974 O  O   . LYS B  1 330 ? 9.651   -20.950 33.498  1.00 166.80 ? 1104 LYS B O   1 
ATOM   4975 C  CB  . LYS B  1 330 ? 9.019   -21.439 36.718  1.00 164.37 ? 1104 LYS B CB  1 
ATOM   4976 C  CG  . LYS B  1 330 ? 9.017   -20.267 37.691  1.00 171.23 ? 1104 LYS B CG  1 
ATOM   4977 C  CD  . LYS B  1 330 ? 7.993   -20.461 38.789  1.00 177.92 ? 1104 LYS B CD  1 
ATOM   4978 C  CE  . LYS B  1 330 ? 8.085   -19.374 39.827  1.00 187.40 ? 1104 LYS B CE  1 
ATOM   4979 N  NZ  . LYS B  1 330 ? 7.154   -19.619 40.956  1.00 196.73 ? 1104 LYS B NZ  1 
ATOM   4980 N  N   . TYR B  1 331 ? 10.426  -19.246 34.790  1.00 164.07 ? 1105 TYR B N   1 
ATOM   4981 C  CA  . TYR B  1 331 ? 10.341  -18.180 33.785  1.00 164.19 ? 1105 TYR B CA  1 
ATOM   4982 C  C   . TYR B  1 331 ? 11.352  -18.339 32.639  1.00 167.42 ? 1105 TYR B C   1 
ATOM   4983 O  O   . TYR B  1 331 ? 11.089  -17.861 31.532  1.00 166.96 ? 1105 TYR B O   1 
ATOM   4984 C  CB  . TYR B  1 331 ? 10.485  -16.792 34.436  1.00 165.97 ? 1105 TYR B CB  1 
ATOM   4985 C  CG  . TYR B  1 331 ? 9.343   -16.409 35.356  1.00 168.67 ? 1105 TYR B CG  1 
ATOM   4986 C  CD1 . TYR B  1 331 ? 8.273   -15.643 34.895  1.00 170.86 ? 1105 TYR B CD1 1 
ATOM   4987 C  CD2 . TYR B  1 331 ? 9.340   -16.794 36.694  1.00 169.66 ? 1105 TYR B CD2 1 
ATOM   4988 C  CE1 . TYR B  1 331 ? 7.213   -15.292 35.740  1.00 171.75 ? 1105 TYR B CE1 1 
ATOM   4989 C  CE2 . TYR B  1 331 ? 8.286   -16.456 37.544  1.00 170.65 ? 1105 TYR B CE2 1 
ATOM   4990 C  CZ  . TYR B  1 331 ? 7.231   -15.697 37.066  1.00 177.72 ? 1105 TYR B CZ  1 
ATOM   4991 O  OH  . TYR B  1 331 ? 6.210   -15.357 37.920  1.00 177.71 ? 1105 TYR B OH  1 
ATOM   4992 N  N   . LEU B  1 332 ? 12.500  -18.998 32.903  1.00 163.58 ? 1106 LEU B N   1 
ATOM   4993 C  CA  . LEU B  1 332 ? 13.561  -19.231 31.919  1.00 188.56 ? 1106 LEU B CA  1 
ATOM   4994 C  C   . LEU B  1 332 ? 13.988  -20.696 31.907  1.00 199.54 ? 1106 LEU B C   1 
ATOM   4995 O  O   . LEU B  1 332 ? 14.452  -21.194 30.883  1.00 154.70 ? 1106 LEU B O   1 
ATOM   4996 C  CB  . LEU B  1 332 ? 14.768  -18.330 32.208  1.00 188.64 ? 1106 LEU B CB  1 
ATOM   4997 N  N   . ASN B  1 336 ? 10.586  -20.599 23.169  1.00 123.89 ? 224  ASN B N   1 
ATOM   4998 C  CA  . ASN B  1 336 ? 9.711   -21.657 22.651  1.00 123.70 ? 224  ASN B CA  1 
ATOM   4999 C  C   . ASN B  1 336 ? 8.229   -21.211 22.505  1.00 126.88 ? 224  ASN B C   1 
ATOM   5000 O  O   . ASN B  1 336 ? 7.323   -22.054 22.561  1.00 126.81 ? 224  ASN B O   1 
ATOM   5001 C  CB  . ASN B  1 336 ? 9.840   -22.934 23.505  1.00 123.61 ? 224  ASN B CB  1 
ATOM   5002 N  N   . LEU B  1 337 ? 7.994   -19.892 22.292  1.00 121.86 ? 225  LEU B N   1 
ATOM   5003 C  CA  . LEU B  1 337 ? 6.652   -19.317 22.148  1.00 120.70 ? 225  LEU B CA  1 
ATOM   5004 C  C   . LEU B  1 337 ? 5.977   -19.739 20.836  1.00 122.36 ? 225  LEU B C   1 
ATOM   5005 O  O   . LEU B  1 337 ? 6.563   -19.592 19.761  1.00 121.69 ? 225  LEU B O   1 
ATOM   5006 C  CB  . LEU B  1 337 ? 6.669   -17.784 22.328  1.00 120.69 ? 225  LEU B CB  1 
ATOM   5007 C  CG  . LEU B  1 337 ? 5.307   -17.054 22.436  1.00 125.35 ? 225  LEU B CG  1 
ATOM   5008 C  CD1 . LEU B  1 337 ? 4.361   -17.720 23.438  1.00 125.33 ? 225  LEU B CD1 1 
ATOM   5009 C  CD2 . LEU B  1 337 ? 5.504   -15.615 22.829  1.00 128.29 ? 225  LEU B CD2 1 
ATOM   5010 N  N   . SER B  1 338 ? 4.748   -20.284 20.948  1.00 117.16 ? 226  SER B N   1 
ATOM   5011 C  CA  . SER B  1 338 ? 3.949   -20.799 19.829  1.00 115.77 ? 226  SER B CA  1 
ATOM   5012 C  C   . SER B  1 338 ? 3.257   -19.722 18.993  1.00 115.71 ? 226  SER B C   1 
ATOM   5013 O  O   . SER B  1 338 ? 3.170   -19.883 17.773  1.00 114.72 ? 226  SER B O   1 
ATOM   5014 C  CB  . SER B  1 338 ? 2.936   -21.827 20.320  1.00 119.71 ? 226  SER B CB  1 
ATOM   5015 O  OG  . SER B  1 338 ? 2.047   -21.257 21.266  1.00 130.44 ? 226  SER B OG  1 
ATOM   5016 N  N   . SER B  1 339 ? 2.771   -18.627 19.641  1.00 109.83 ? 227  SER B N   1 
ATOM   5017 C  CA  . SER B  1 339 ? 2.090   -17.481 18.994  1.00 108.11 ? 227  SER B CA  1 
ATOM   5018 C  C   . SER B  1 339 ? 2.949   -16.855 17.886  1.00 106.78 ? 227  SER B C   1 
ATOM   5019 O  O   . SER B  1 339 ? 2.420   -16.243 16.955  1.00 105.41 ? 227  SER B O   1 
ATOM   5020 C  CB  . SER B  1 339 ? 1.722   -16.417 20.025  1.00 112.19 ? 227  SER B CB  1 
ATOM   5021 O  OG  . SER B  1 339 ? 0.822   -16.916 21.003  1.00 123.38 ? 227  SER B OG  1 
ATOM   5022 N  N   . HIS B  1 340 ? 4.278   -17.052 18.008  1.00 100.64 ? 228  HIS B N   1 
ATOM   5023 C  CA  . HIS B  1 340 ? 5.370   -16.636 17.130  1.00 99.09  ? 228  HIS B CA  1 
ATOM   5024 C  C   . HIS B  1 340 ? 5.503   -17.569 15.919  1.00 99.28  ? 228  HIS B C   1 
ATOM   5025 O  O   . HIS B  1 340 ? 5.834   -17.100 14.830  1.00 99.32  ? 228  HIS B O   1 
ATOM   5026 C  CB  . HIS B  1 340 ? 6.669   -16.694 17.934  1.00 99.96  ? 228  HIS B CB  1 
ATOM   5027 C  CG  . HIS B  1 340 ? 6.919   -15.523 18.840  1.00 103.49 ? 228  HIS B CG  1 
ATOM   5028 N  ND1 . HIS B  1 340 ? 8.174   -15.266 19.298  1.00 105.37 ? 228  HIS B ND1 1 
ATOM   5029 C  CD2 . HIS B  1 340 ? 6.058   -14.619 19.384  1.00 105.26 ? 228  HIS B CD2 1 
ATOM   5030 C  CE1 . HIS B  1 340 ? 8.062   -14.210 20.089  1.00 104.81 ? 228  HIS B CE1 1 
ATOM   5031 N  NE2 . HIS B  1 340 ? 6.812   -13.774 20.157  1.00 105.10 ? 228  HIS B NE2 1 
ATOM   5032 N  N   . LYS B  1 341 ? 5.288   -18.890 16.128  1.00 92.26  ? 229  LYS B N   1 
ATOM   5033 C  CA  . LYS B  1 341 ? 5.358   -19.936 15.101  1.00 90.30  ? 229  LYS B CA  1 
ATOM   5034 C  C   . LYS B  1 341 ? 4.121   -19.935 14.174  1.00 89.44  ? 229  LYS B C   1 
ATOM   5035 O  O   . LYS B  1 341 ? 4.259   -20.224 12.984  1.00 88.30  ? 229  LYS B O   1 
ATOM   5036 C  CB  . LYS B  1 341 ? 5.551   -21.317 15.748  1.00 93.01  ? 229  LYS B CB  1 
ATOM   5037 N  N   . LYS B  1 342 ? 2.920   -19.620 14.724  1.00 83.21  ? 230  LYS B N   1 
ATOM   5038 C  CA  . LYS B  1 342 ? 1.653   -19.535 13.974  1.00 81.57  ? 230  LYS B CA  1 
ATOM   5039 C  C   . LYS B  1 342 ? 1.610   -18.257 13.088  1.00 82.34  ? 230  LYS B C   1 
ATOM   5040 O  O   . LYS B  1 342 ? 0.978   -18.261 12.027  1.00 81.30  ? 230  LYS B O   1 
ATOM   5041 C  CB  . LYS B  1 342 ? 0.438   -19.596 14.918  1.00 83.48  ? 230  LYS B CB  1 
ATOM   5042 C  CG  . LYS B  1 342 ? 0.197   -20.955 15.569  1.00 92.48  ? 230  LYS B CG  1 
ATOM   5043 N  N   . ALA B  1 343 ? 2.295   -17.180 13.526  1.00 76.18  ? 231  ALA B N   1 
ATOM   5044 C  CA  . ALA B  1 343 ? 2.420   -15.932 12.783  1.00 74.96  ? 231  ALA B CA  1 
ATOM   5045 C  C   . ALA B  1 343 ? 3.360   -16.145 11.585  1.00 77.13  ? 231  ALA B C   1 
ATOM   5046 O  O   . ALA B  1 343 ? 3.037   -15.680 10.486  1.00 78.31  ? 231  ALA B O   1 
ATOM   5047 C  CB  . ALA B  1 343 ? 2.967   -14.832 13.683  1.00 75.55  ? 231  ALA B CB  1 
ATOM   5048 N  N   . ILE B  1 344 ? 4.507   -16.858 11.788  1.00 68.29  ? 232  ILE B N   1 
ATOM   5049 C  CA  . ILE B  1 344 ? 5.480   -17.180 10.732  1.00 65.72  ? 232  ILE B CA  1 
ATOM   5050 C  C   . ILE B  1 344 ? 4.842   -18.106 9.691   1.00 69.27  ? 232  ILE B C   1 
ATOM   5051 O  O   . ILE B  1 344 ? 5.063   -17.906 8.495   1.00 69.29  ? 232  ILE B O   1 
ATOM   5052 C  CB  . ILE B  1 344 ? 6.832   -17.718 11.283  1.00 67.58  ? 232  ILE B CB  1 
ATOM   5053 C  CG1 . ILE B  1 344 ? 7.606   -16.606 12.013  1.00 68.34  ? 232  ILE B CG1 1 
ATOM   5054 C  CG2 . ILE B  1 344 ? 7.703   -18.327 10.183  1.00 66.37  ? 232  ILE B CG2 1 
ATOM   5055 C  CD1 . ILE B  1 344 ? 8.503   -17.075 13.011  1.00 77.88  ? 232  ILE B CD1 1 
ATOM   5056 N  N   . GLY B  1 345 ? 4.039   -19.078 10.149  1.00 64.70  ? 233  GLY B N   1 
ATOM   5057 C  CA  . GLY B  1 345 ? 3.338   -20.028 9.283   1.00 63.91  ? 233  GLY B CA  1 
ATOM   5058 C  C   . GLY B  1 345 ? 2.385   -19.354 8.315   1.00 66.79  ? 233  GLY B C   1 
ATOM   5059 O  O   . GLY B  1 345 ? 2.400   -19.651 7.118   1.00 66.14  ? 233  GLY B O   1 
ATOM   5060 N  N   . MET B  1 346 ? 1.576   -18.411 8.840   1.00 63.66  ? 234  MET B N   1 
ATOM   5061 C  CA  . MET B  1 346 ? 0.616   -17.579 8.112   1.00 63.56  ? 234  MET B CA  1 
ATOM   5062 C  C   . MET B  1 346 ? 1.333   -16.743 7.053   1.00 67.74  ? 234  MET B C   1 
ATOM   5063 O  O   . MET B  1 346 ? 0.903   -16.764 5.897   1.00 68.87  ? 234  MET B O   1 
ATOM   5064 C  CB  . MET B  1 346 ? -0.165  -16.676 9.091   1.00 65.75  ? 234  MET B CB  1 
ATOM   5065 C  CG  . MET B  1 346 ? -1.196  -15.791 8.426   1.00 69.50  ? 234  MET B CG  1 
ATOM   5066 S  SD  . MET B  1 346 ? -1.859  -14.530 9.544   1.00 73.78  ? 234  MET B SD  1 
ATOM   5067 C  CE  . MET B  1 346 ? -0.418  -13.492 9.773   1.00 69.85  ? 234  MET B CE  1 
ATOM   5068 N  N   . ILE B  1 347 ? 2.435   -16.030 7.448   1.00 62.06  ? 235  ILE B N   1 
ATOM   5069 C  CA  . ILE B  1 347 ? 3.260   -15.192 6.568   1.00 60.98  ? 235  ILE B CA  1 
ATOM   5070 C  C   . ILE B  1 347 ? 3.723   -15.981 5.337   1.00 67.80  ? 235  ILE B C   1 
ATOM   5071 O  O   . ILE B  1 347 ? 3.515   -15.520 4.221   1.00 67.36  ? 235  ILE B O   1 
ATOM   5072 C  CB  . ILE B  1 347 ? 4.437   -14.479 7.329   1.00 62.24  ? 235  ILE B CB  1 
ATOM   5073 C  CG1 . ILE B  1 347 ? 3.894   -13.373 8.270   1.00 62.04  ? 235  ILE B CG1 1 
ATOM   5074 C  CG2 . ILE B  1 347 ? 5.503   -13.913 6.369   1.00 59.40  ? 235  ILE B CG2 1 
ATOM   5075 C  CD1 . ILE B  1 347 ? 4.925   -12.724 9.207   1.00 71.29  ? 235  ILE B CD1 1 
ATOM   5076 N  N   . MET B  1 348 ? 4.278   -17.171 5.537   1.00 67.73  ? 236  MET B N   1 
ATOM   5077 C  CA  . MET B  1 348 ? 4.783   -18.012 4.458   1.00 70.06  ? 236  MET B CA  1 
ATOM   5078 C  C   . MET B  1 348 ? 3.713   -18.518 3.498   1.00 70.50  ? 236  MET B C   1 
ATOM   5079 O  O   . MET B  1 348 ? 3.940   -18.472 2.292   1.00 70.99  ? 236  MET B O   1 
ATOM   5080 C  CB  . MET B  1 348 ? 5.586   -19.192 5.018   1.00 75.05  ? 236  MET B CB  1 
ATOM   5081 C  CG  . MET B  1 348 ? 6.648   -18.776 6.014   1.00 82.30  ? 236  MET B CG  1 
ATOM   5082 S  SD  . MET B  1 348 ? 8.310   -18.912 5.368   1.00 90.52  ? 236  MET B SD  1 
ATOM   5083 C  CE  . MET B  1 348 ? 8.422   -17.397 4.278   1.00 87.98  ? 236  MET B CE  1 
ATOM   5084 N  N   . VAL B  1 349 ? 2.562   -19.017 4.008   1.00 63.15  ? 237  VAL B N   1 
ATOM   5085 C  CA  . VAL B  1 349 ? 1.493   -19.554 3.146   1.00 61.23  ? 237  VAL B CA  1 
ATOM   5086 C  C   . VAL B  1 349 ? 0.768   -18.434 2.349   1.00 62.47  ? 237  VAL B C   1 
ATOM   5087 O  O   . VAL B  1 349 ? 0.597   -18.576 1.137   1.00 62.14  ? 237  VAL B O   1 
ATOM   5088 C  CB  . VAL B  1 349 ? 0.509   -20.487 3.900   1.00 64.21  ? 237  VAL B CB  1 
ATOM   5089 C  CG1 . VAL B  1 349 ? -0.558  -21.046 2.959   1.00 63.58  ? 237  VAL B CG1 1 
ATOM   5090 C  CG2 . VAL B  1 349 ? 1.260   -21.633 4.569   1.00 63.94  ? 237  VAL B CG2 1 
ATOM   5091 N  N   . VAL B  1 350 ? 0.367   -17.335 3.023   1.00 57.36  ? 238  VAL B N   1 
ATOM   5092 C  CA  . VAL B  1 350 ? -0.334  -16.180 2.434   1.00 56.33  ? 238  VAL B CA  1 
ATOM   5093 C  C   . VAL B  1 350 ? 0.518   -15.464 1.360   1.00 62.77  ? 238  VAL B C   1 
ATOM   5094 O  O   . VAL B  1 350 ? -0.021  -15.109 0.304   1.00 63.29  ? 238  VAL B O   1 
ATOM   5095 C  CB  . VAL B  1 350 ? -0.848  -15.224 3.530   1.00 58.40  ? 238  VAL B CB  1 
ATOM   5096 C  CG1 . VAL B  1 350 ? -1.420  -13.945 2.941   1.00 57.53  ? 238  VAL B CG1 1 
ATOM   5097 C  CG2 . VAL B  1 350 ? -1.887  -15.923 4.399   1.00 58.07  ? 238  VAL B CG2 1 
ATOM   5098 N  N   . THR B  1 351 ? 1.842   -15.284 1.621   1.00 58.67  ? 239  THR B N   1 
ATOM   5099 C  CA  . THR B  1 351 ? 2.797   -14.663 0.698   1.00 57.50  ? 239  THR B CA  1 
ATOM   5100 C  C   . THR B  1 351 ? 2.910   -15.496 -0.578  1.00 59.07  ? 239  THR B C   1 
ATOM   5101 O  O   . THR B  1 351 ? 2.918   -14.928 -1.667  1.00 57.34  ? 239  THR B O   1 
ATOM   5102 C  CB  . THR B  1 351 ? 4.129   -14.399 1.416   1.00 63.97  ? 239  THR B CB  1 
ATOM   5103 O  OG1 . THR B  1 351 ? 3.866   -13.458 2.458   1.00 64.30  ? 239  THR B OG1 1 
ATOM   5104 C  CG2 . THR B  1 351 ? 5.219   -13.858 0.499   1.00 60.14  ? 239  THR B CG2 1 
ATOM   5105 N  N   . ALA B  1 352 ? 2.951   -16.843 -0.434  1.00 55.76  ? 240  ALA B N   1 
ATOM   5106 C  CA  . ALA B  1 352 ? 3.017   -17.814 -1.536  1.00 54.59  ? 240  ALA B CA  1 
ATOM   5107 C  C   . ALA B  1 352 ? 1.698   -17.776 -2.331  1.00 59.95  ? 240  ALA B C   1 
ATOM   5108 O  O   . ALA B  1 352 ? 1.746   -17.703 -3.558  1.00 61.12  ? 240  ALA B O   1 
ATOM   5109 C  CB  . ALA B  1 352 ? 3.296   -19.210 -1.000  1.00 54.48  ? 240  ALA B CB  1 
ATOM   5110 N  N   . ALA B  1 353 ? 0.522   -17.738 -1.641  1.00 55.00  ? 241  ALA B N   1 
ATOM   5111 C  CA  . ALA B  1 353 ? -0.793  -17.620 -2.284  1.00 53.73  ? 241  ALA B CA  1 
ATOM   5112 C  C   . ALA B  1 353 ? -0.844  -16.318 -3.117  1.00 57.39  ? 241  ALA B C   1 
ATOM   5113 O  O   . ALA B  1 353 ? -1.315  -16.355 -4.244  1.00 57.74  ? 241  ALA B O   1 
ATOM   5114 C  CB  . ALA B  1 353 ? -1.899  -17.627 -1.236  1.00 54.04  ? 241  ALA B CB  1 
ATOM   5115 N  N   . PHE B  1 354 ? -0.281  -15.195 -2.603  1.00 52.99  ? 242  PHE B N   1 
ATOM   5116 C  CA  . PHE B  1 354 ? -0.245  -13.926 -3.342  1.00 52.48  ? 242  PHE B CA  1 
ATOM   5117 C  C   . PHE B  1 354 ? 0.743   -13.909 -4.537  1.00 57.73  ? 242  PHE B C   1 
ATOM   5118 O  O   . PHE B  1 354 ? 0.386   -13.370 -5.592  1.00 57.97  ? 242  PHE B O   1 
ATOM   5119 C  CB  . PHE B  1 354 ? -0.011  -12.726 -2.421  1.00 53.23  ? 242  PHE B CB  1 
ATOM   5120 C  CG  . PHE B  1 354 ? -1.282  -12.153 -1.842  1.00 54.33  ? 242  PHE B CG  1 
ATOM   5121 C  CD1 . PHE B  1 354 ? -1.916  -12.767 -0.764  1.00 57.86  ? 242  PHE B CD1 1 
ATOM   5122 C  CD2 . PHE B  1 354 ? -1.833  -10.988 -2.353  1.00 56.31  ? 242  PHE B CD2 1 
ATOM   5123 C  CE1 . PHE B  1 354 ? -3.086  -12.228 -0.209  1.00 58.58  ? 242  PHE B CE1 1 
ATOM   5124 C  CE2 . PHE B  1 354 ? -2.994  -10.434 -1.786  1.00 59.82  ? 242  PHE B CE2 1 
ATOM   5125 C  CZ  . PHE B  1 354 ? -3.625  -11.071 -0.732  1.00 57.91  ? 242  PHE B CZ  1 
ATOM   5126 N  N   . LEU B  1 355 ? 1.943   -14.499 -4.394  1.00 53.21  ? 243  LEU B N   1 
ATOM   5127 C  CA  . LEU B  1 355 ? 2.928   -14.516 -5.474  1.00 53.38  ? 243  LEU B CA  1 
ATOM   5128 C  C   . LEU B  1 355 ? 2.626   -15.544 -6.574  1.00 56.97  ? 243  LEU B C   1 
ATOM   5129 O  O   . LEU B  1 355 ? 2.720   -15.224 -7.758  1.00 56.84  ? 243  LEU B O   1 
ATOM   5130 C  CB  . LEU B  1 355 ? 4.344   -14.697 -4.921  1.00 54.27  ? 243  LEU B CB  1 
ATOM   5131 C  CG  . LEU B  1 355 ? 4.849   -13.599 -3.947  1.00 60.82  ? 243  LEU B CG  1 
ATOM   5132 C  CD1 . LEU B  1 355 ? 6.032   -14.083 -3.145  1.00 61.88  ? 243  LEU B CD1 1 
ATOM   5133 C  CD2 . LEU B  1 355 ? 5.225   -12.331 -4.663  1.00 63.34  ? 243  LEU B CD2 1 
ATOM   5134 N  N   . VAL B  1 356 ? 2.203   -16.751 -6.182  1.00 53.18  ? 244  VAL B N   1 
ATOM   5135 C  CA  . VAL B  1 356 ? 1.922   -17.879 -7.071  1.00 51.82  ? 244  VAL B CA  1 
ATOM   5136 C  C   . VAL B  1 356 ? 0.530   -17.866 -7.672  1.00 53.49  ? 244  VAL B C   1 
ATOM   5137 O  O   . VAL B  1 356 ? 0.390   -18.097 -8.869  1.00 54.14  ? 244  VAL B O   1 
ATOM   5138 C  CB  . VAL B  1 356 ? 2.207   -19.224 -6.340  1.00 55.29  ? 244  VAL B CB  1 
ATOM   5139 C  CG1 . VAL B  1 356 ? 1.906   -20.446 -7.219  1.00 54.93  ? 244  VAL B CG1 1 
ATOM   5140 C  CG2 . VAL B  1 356 ? 3.640   -19.256 -5.804  1.00 54.66  ? 244  VAL B CG2 1 
ATOM   5141 N  N   . SER B  1 357 ? -0.492  -17.664 -6.841  1.00 48.63  ? 245  SER B N   1 
ATOM   5142 C  CA  . SER B  1 357 ? -1.877  -17.778 -7.269  1.00 48.25  ? 245  SER B CA  1 
ATOM   5143 C  C   . SER B  1 357 ? -2.561  -16.459 -7.701  1.00 53.46  ? 245  SER B C   1 
ATOM   5144 O  O   . SER B  1 357 ? -3.151  -16.397 -8.792  1.00 53.89  ? 245  SER B O   1 
ATOM   5145 C  CB  . SER B  1 357 ? -2.697  -18.483 -6.187  1.00 50.61  ? 245  SER B CB  1 
ATOM   5146 O  OG  . SER B  1 357 ? -4.022  -18.751 -6.613  1.00 57.54  ? 245  SER B OG  1 
ATOM   5147 N  N   . PHE B  1 358 ? -2.502  -15.424 -6.854  1.00 49.05  ? 246  PHE B N   1 
ATOM   5148 C  CA  . PHE B  1 358 ? -3.218  -14.167 -7.082  1.00 46.64  ? 246  PHE B CA  1 
ATOM   5149 C  C   . PHE B  1 358 ? -2.553  -13.236 -8.066  1.00 52.02  ? 246  PHE B C   1 
ATOM   5150 O  O   . PHE B  1 358 ? -3.261  -12.718 -8.913  1.00 52.85  ? 246  PHE B O   1 
ATOM   5151 C  CB  . PHE B  1 358 ? -3.493  -13.456 -5.737  1.00 47.21  ? 246  PHE B CB  1 
ATOM   5152 C  CG  . PHE B  1 358 ? -4.263  -14.273 -4.703  1.00 47.78  ? 246  PHE B CG  1 
ATOM   5153 C  CD1 . PHE B  1 358 ? -5.361  -15.066 -5.079  1.00 50.30  ? 246  PHE B CD1 1 
ATOM   5154 C  CD2 . PHE B  1 358 ? -3.930  -14.212 -3.351  1.00 47.07  ? 246  PHE B CD2 1 
ATOM   5155 C  CE1 . PHE B  1 358 ? -6.081  -15.806 -4.123  1.00 49.95  ? 246  PHE B CE1 1 
ATOM   5156 C  CE2 . PHE B  1 358 ? -4.646  -14.964 -2.396  1.00 49.09  ? 246  PHE B CE2 1 
ATOM   5157 C  CZ  . PHE B  1 358 ? -5.705  -15.763 -2.791  1.00 47.66  ? 246  PHE B CZ  1 
ATOM   5158 N  N   . MET B  1 359 ? -1.213  -13.030 -7.993  1.00 50.53  ? 247  MET B N   1 
ATOM   5159 C  CA  . MET B  1 359 ? -0.452  -12.060 -8.805  1.00 50.45  ? 247  MET B CA  1 
ATOM   5160 C  C   . MET B  1 359 ? -0.276  -12.379 -10.306 1.00 53.80  ? 247  MET B C   1 
ATOM   5161 O  O   . MET B  1 359 ? -0.443  -11.446 -11.080 1.00 53.28  ? 247  MET B O   1 
ATOM   5162 C  CB  . MET B  1 359 ? 0.909   -11.775 -8.193  1.00 52.90  ? 247  MET B CB  1 
ATOM   5163 C  CG  . MET B  1 359 ? 1.493   -10.456 -8.648  1.00 56.26  ? 247  MET B CG  1 
ATOM   5164 S  SD  . MET B  1 359 ? 3.240   -10.235 -8.247  1.00 59.53  ? 247  MET B SD  1 
ATOM   5165 C  CE  . MET B  1 359 ? 4.001   -11.718 -8.977  1.00 55.82  ? 247  MET B CE  1 
ATOM   5166 N  N   . PRO B  1 360 ? 0.096   -13.587 -10.781 1.00 52.09  ? 248  PRO B N   1 
ATOM   5167 C  CA  . PRO B  1 360 ? 0.251   -13.772 -12.235 1.00 52.37  ? 248  PRO B CA  1 
ATOM   5168 C  C   . PRO B  1 360 ? -1.005  -13.432 -13.043 1.00 57.92  ? 248  PRO B C   1 
ATOM   5169 O  O   . PRO B  1 360 ? -0.882  -12.767 -14.081 1.00 57.72  ? 248  PRO B O   1 
ATOM   5170 C  CB  . PRO B  1 360 ? 0.666   -15.243 -12.367 1.00 54.50  ? 248  PRO B CB  1 
ATOM   5171 C  CG  . PRO B  1 360 ? 1.309   -15.571 -11.035 1.00 59.65  ? 248  PRO B CG  1 
ATOM   5172 C  CD  . PRO B  1 360 ? 0.427   -14.834 -10.058 1.00 55.60  ? 248  PRO B CD  1 
ATOM   5173 N  N   . TYR B  1 361 ? -2.218  -13.834 -12.544 1.00 53.18  ? 249  TYR B N   1 
ATOM   5174 C  CA  . TYR B  1 361 ? -3.500  -13.543 -13.182 1.00 51.12  ? 249  TYR B CA  1 
ATOM   5175 C  C   . TYR B  1 361 ? -3.705  -12.040 -13.374 1.00 53.93  ? 249  TYR B C   1 
ATOM   5176 O  O   . TYR B  1 361 ? -4.041  -11.624 -14.477 1.00 54.51  ? 249  TYR B O   1 
ATOM   5177 C  CB  . TYR B  1 361 ? -4.668  -14.180 -12.412 1.00 51.97  ? 249  TYR B CB  1 
ATOM   5178 C  CG  . TYR B  1 361 ? -6.035  -13.600 -12.730 1.00 52.99  ? 249  TYR B CG  1 
ATOM   5179 C  CD1 . TYR B  1 361 ? -6.657  -13.853 -13.950 1.00 54.28  ? 249  TYR B CD1 1 
ATOM   5180 C  CD2 . TYR B  1 361 ? -6.726  -12.836 -11.793 1.00 53.70  ? 249  TYR B CD2 1 
ATOM   5181 C  CE1 . TYR B  1 361 ? -7.918  -13.333 -14.241 1.00 53.81  ? 249  TYR B CE1 1 
ATOM   5182 C  CE2 . TYR B  1 361 ? -7.984  -12.306 -12.075 1.00 54.27  ? 249  TYR B CE2 1 
ATOM   5183 C  CZ  . TYR B  1 361 ? -8.581  -12.571 -13.294 1.00 58.83  ? 249  TYR B CZ  1 
ATOM   5184 O  OH  . TYR B  1 361 ? -9.827  -12.073 -13.549 1.00 59.85  ? 249  TYR B OH  1 
ATOM   5185 N  N   . HIS B  1 362 ? -3.472  -11.232 -12.322 1.00 49.62  ? 250  HIS B N   1 
ATOM   5186 C  CA  . HIS B  1 362 ? -3.631  -9.772  -12.359 1.00 48.35  ? 250  HIS B CA  1 
ATOM   5187 C  C   . HIS B  1 362 ? -2.611  -9.048  -13.257 1.00 54.09  ? 250  HIS B C   1 
ATOM   5188 O  O   . HIS B  1 362 ? -2.928  -7.988  -13.786 1.00 54.37  ? 250  HIS B O   1 
ATOM   5189 C  CB  . HIS B  1 362 ? -3.628  -9.193  -10.947 1.00 47.39  ? 250  HIS B CB  1 
ATOM   5190 C  CG  . HIS B  1 362 ? -4.904  -9.448  -10.230 1.00 49.25  ? 250  HIS B CG  1 
ATOM   5191 N  ND1 . HIS B  1 362 ? -5.065  -10.556 -9.432  1.00 49.76  ? 250  HIS B ND1 1 
ATOM   5192 C  CD2 . HIS B  1 362 ? -6.052  -8.740  -10.238 1.00 50.32  ? 250  HIS B CD2 1 
ATOM   5193 C  CE1 . HIS B  1 362 ? -6.297  -10.488 -8.963  1.00 48.87  ? 250  HIS B CE1 1 
ATOM   5194 N  NE2 . HIS B  1 362 ? -6.931  -9.417  -9.424  1.00 49.63  ? 250  HIS B NE2 1 
ATOM   5195 N  N   . ILE B  1 363 ? -1.401  -9.599  -13.420 1.00 51.42  ? 251  ILE B N   1 
ATOM   5196 C  CA  . ILE B  1 363 ? -0.387  -9.027  -14.308 1.00 50.56  ? 251  ILE B CA  1 
ATOM   5197 C  C   . ILE B  1 363 ? -0.801  -9.373  -15.744 1.00 55.13  ? 251  ILE B C   1 
ATOM   5198 O  O   . ILE B  1 363 ? -0.816  -8.493  -16.603 1.00 54.96  ? 251  ILE B O   1 
ATOM   5199 C  CB  . ILE B  1 363 ? 1.044   -9.537  -13.963 1.00 53.26  ? 251  ILE B CB  1 
ATOM   5200 C  CG1 . ILE B  1 363 ? 1.501   -9.037  -12.575 1.00 53.45  ? 251  ILE B CG1 1 
ATOM   5201 C  CG2 . ILE B  1 363 ? 2.048   -9.145  -15.032 1.00 54.33  ? 251  ILE B CG2 1 
ATOM   5202 C  CD1 . ILE B  1 363 ? 2.875   -9.612  -12.080 1.00 57.44  ? 251  ILE B CD1 1 
ATOM   5203 N  N   . GLN B  1 364 ? -1.188  -10.644 -15.977 1.00 52.86  ? 252  GLN B N   1 
ATOM   5204 C  CA  . GLN B  1 364 ? -1.592  -11.166 -17.282 1.00 53.68  ? 252  GLN B CA  1 
ATOM   5205 C  C   . GLN B  1 364 ? -2.834  -10.468 -17.865 1.00 60.08  ? 252  GLN B C   1 
ATOM   5206 O  O   . GLN B  1 364 ? -2.846  -10.159 -19.056 1.00 60.69  ? 252  GLN B O   1 
ATOM   5207 C  CB  . GLN B  1 364 ? -1.766  -12.695 -17.234 1.00 55.35  ? 252  GLN B CB  1 
ATOM   5208 C  CG  . GLN B  1 364 ? -1.757  -13.397 -18.597 1.00 67.89  ? 252  GLN B CG  1 
ATOM   5209 C  CD  . GLN B  1 364 ? -0.705  -12.893 -19.567 1.00 83.00  ? 252  GLN B CD  1 
ATOM   5210 O  OE1 . GLN B  1 364 ? 0.484   -12.712 -19.230 1.00 73.31  ? 252  GLN B OE1 1 
ATOM   5211 N  NE2 . GLN B  1 364 ? -1.128  -12.668 -20.805 1.00 78.12  ? 252  GLN B NE2 1 
ATOM   5212 N  N   . ARG B  1 365 ? -3.853  -10.203 -17.025 1.00 55.49  ? 253  ARG B N   1 
ATOM   5213 C  CA  . ARG B  1 365 ? -5.079  -9.499  -17.376 1.00 53.76  ? 253  ARG B CA  1 
ATOM   5214 C  C   . ARG B  1 365 ? -4.776  -8.080  -17.834 1.00 58.24  ? 253  ARG B C   1 
ATOM   5215 O  O   . ARG B  1 365 ? -5.425  -7.615  -18.755 1.00 58.19  ? 253  ARG B O   1 
ATOM   5216 C  CB  . ARG B  1 365 ? -6.009  -9.472  -16.165 1.00 51.37  ? 253  ARG B CB  1 
ATOM   5217 C  CG  . ARG B  1 365 ? -7.467  -9.341  -16.532 1.00 54.84  ? 253  ARG B CG  1 
ATOM   5218 C  CD  . ARG B  1 365 ? -8.312  -9.441  -15.297 1.00 51.92  ? 253  ARG B CD  1 
ATOM   5219 N  NE  . ARG B  1 365 ? -8.305  -8.195  -14.526 1.00 48.84  ? 253  ARG B NE  1 
ATOM   5220 C  CZ  . ARG B  1 365 ? -8.913  -8.055  -13.355 1.00 58.30  ? 253  ARG B CZ  1 
ATOM   5221 N  NH1 . ARG B  1 365 ? -9.558  -9.077  -12.808 1.00 46.46  ? 253  ARG B NH1 1 
ATOM   5222 N  NH2 . ARG B  1 365 ? -8.893  -6.891  -12.728 1.00 48.92  ? 253  ARG B NH2 1 
ATOM   5223 N  N   . THR B  1 366 ? -3.800  -7.384  -17.195 1.00 57.02  ? 254  THR B N   1 
ATOM   5224 C  CA  . THR B  1 366 ? -3.369  -6.023  -17.583 1.00 56.82  ? 254  THR B CA  1 
ATOM   5225 C  C   . THR B  1 366 ? -2.734  -6.100  -18.987 1.00 63.07  ? 254  THR B C   1 
ATOM   5226 O  O   . THR B  1 366 ? -3.180  -5.392  -19.887 1.00 63.34  ? 254  THR B O   1 
ATOM   5227 C  CB  . THR B  1 366 ? -2.414  -5.411  -16.538 1.00 53.31  ? 254  THR B CB  1 
ATOM   5228 O  OG1 . THR B  1 366 ? -3.044  -5.424  -15.258 1.00 48.25  ? 254  THR B OG1 1 
ATOM   5229 C  CG2 . THR B  1 366 ? -2.002  -3.981  -16.881 1.00 47.17  ? 254  THR B CG2 1 
ATOM   5230 N  N   . ILE B  1 367 ? -1.728  -6.988  -19.162 1.00 59.87  ? 255  ILE B N   1 
ATOM   5231 C  CA  . ILE B  1 367 ? -1.027  -7.242  -20.422 1.00 59.61  ? 255  ILE B CA  1 
ATOM   5232 C  C   . ILE B  1 367 ? -2.016  -7.610  -21.540 1.00 65.56  ? 255  ILE B C   1 
ATOM   5233 O  O   . ILE B  1 367 ? -1.993  -6.973  -22.589 1.00 66.53  ? 255  ILE B O   1 
ATOM   5234 C  CB  . ILE B  1 367 ? 0.113   -8.308  -20.249 1.00 61.57  ? 255  ILE B CB  1 
ATOM   5235 C  CG1 . ILE B  1 367 ? 1.250   -7.784  -19.373 1.00 60.90  ? 255  ILE B CG1 1 
ATOM   5236 C  CG2 . ILE B  1 367 ? 0.659   -8.790  -21.595 1.00 61.17  ? 255  ILE B CG2 1 
ATOM   5237 C  CD1 . ILE B  1 367 ? 2.003   -8.871  -18.690 1.00 62.40  ? 255  ILE B CD1 1 
ATOM   5238 N  N   . HIS B  1 368 ? -2.885  -8.612  -21.302 1.00 63.29  ? 256  HIS B N   1 
ATOM   5239 C  CA  . HIS B  1 368 ? -3.877  -9.118  -22.257 1.00 63.86  ? 256  HIS B CA  1 
ATOM   5240 C  C   . HIS B  1 368 ? -4.836  -8.058  -22.778 1.00 67.56  ? 256  HIS B C   1 
ATOM   5241 O  O   . HIS B  1 368 ? -4.999  -7.950  -23.987 1.00 67.96  ? 256  HIS B O   1 
ATOM   5242 C  CB  . HIS B  1 368 ? -4.665  -10.291 -21.659 1.00 65.14  ? 256  HIS B CB  1 
ATOM   5243 C  CG  . HIS B  1 368 ? -5.488  -11.020 -22.668 1.00 68.62  ? 256  HIS B CG  1 
ATOM   5244 N  ND1 . HIS B  1 368 ? -5.001  -12.139 -23.314 1.00 70.55  ? 256  HIS B ND1 1 
ATOM   5245 C  CD2 . HIS B  1 368 ? -6.729  -10.748 -23.130 1.00 69.61  ? 256  HIS B CD2 1 
ATOM   5246 C  CE1 . HIS B  1 368 ? -5.964  -12.511 -24.143 1.00 69.52  ? 256  HIS B CE1 1 
ATOM   5247 N  NE2 . HIS B  1 368 ? -7.017  -11.698 -24.070 1.00 69.40  ? 256  HIS B NE2 1 
ATOM   5248 N  N   . LEU B  1 369 ? -5.480  -7.301  -21.871 1.00 63.85  ? 257  LEU B N   1 
ATOM   5249 C  CA  . LEU B  1 369 ? -6.448  -6.261  -22.218 1.00 63.59  ? 257  LEU B CA  1 
ATOM   5250 C  C   . LEU B  1 369 ? -5.841  -5.130  -23.047 1.00 71.77  ? 257  LEU B C   1 
ATOM   5251 O  O   . LEU B  1 369 ? -6.507  -4.644  -23.964 1.00 72.50  ? 257  LEU B O   1 
ATOM   5252 C  CB  . LEU B  1 369 ? -7.189  -5.723  -20.988 1.00 62.18  ? 257  LEU B CB  1 
ATOM   5253 C  CG  . LEU B  1 369 ? -8.155  -6.676  -20.290 1.00 64.19  ? 257  LEU B CG  1 
ATOM   5254 C  CD1 . LEU B  1 369 ? -8.826  -5.988  -19.147 1.00 63.81  ? 257  LEU B CD1 1 
ATOM   5255 C  CD2 . LEU B  1 369 ? -9.198  -7.247  -21.239 1.00 64.08  ? 257  LEU B CD2 1 
ATOM   5256 N  N   . HIS B  1 370 ? -4.583  -4.744  -22.764 1.00 70.29  ? 258  HIS B N   1 
ATOM   5257 C  CA  . HIS B  1 370 ? -3.868  -3.720  -23.530 1.00 71.60  ? 258  HIS B CA  1 
ATOM   5258 C  C   . HIS B  1 370 ? -3.407  -4.244  -24.893 1.00 83.27  ? 258  HIS B C   1 
ATOM   5259 O  O   . HIS B  1 370 ? -3.360  -3.464  -25.843 1.00 84.92  ? 258  HIS B O   1 
ATOM   5260 C  CB  . HIS B  1 370 ? -2.669  -3.158  -22.749 1.00 71.21  ? 258  HIS B CB  1 
ATOM   5261 C  CG  . HIS B  1 370 ? -3.054  -2.120  -21.750 1.00 73.58  ? 258  HIS B CG  1 
ATOM   5262 N  ND1 . HIS B  1 370 ? -3.452  -0.855  -22.143 1.00 74.72  ? 258  HIS B ND1 1 
ATOM   5263 C  CD2 . HIS B  1 370 ? -3.106  -2.196  -20.400 1.00 74.14  ? 258  HIS B CD2 1 
ATOM   5264 C  CE1 . HIS B  1 370 ? -3.717  -0.203  -21.022 1.00 73.43  ? 258  HIS B CE1 1 
ATOM   5265 N  NE2 . HIS B  1 370 ? -3.537  -0.971  -19.954 1.00 73.60  ? 258  HIS B NE2 1 
ATOM   5266 N  N   . PHE B  1 371 ? -3.056  -5.553  -24.985 1.00 83.09  ? 259  PHE B N   1 
ATOM   5267 C  CA  . PHE B  1 371 ? -2.616  -6.236  -26.210 1.00 84.32  ? 259  PHE B CA  1 
ATOM   5268 C  C   . PHE B  1 371 ? -3.697  -6.182  -27.280 1.00 93.66  ? 259  PHE B C   1 
ATOM   5269 O  O   . PHE B  1 371 ? -3.369  -6.108  -28.462 1.00 93.17  ? 259  PHE B O   1 
ATOM   5270 C  CB  . PHE B  1 371 ? -2.253  -7.703  -25.903 1.00 85.67  ? 259  PHE B CB  1 
ATOM   5271 C  CG  . PHE B  1 371 ? -1.728  -8.522  -27.061 1.00 86.85  ? 259  PHE B CG  1 
ATOM   5272 C  CD1 . PHE B  1 371 ? -0.372  -8.523  -27.375 1.00 89.83  ? 259  PHE B CD1 1 
ATOM   5273 C  CD2 . PHE B  1 371 ? -2.579  -9.330  -27.806 1.00 88.72  ? 259  PHE B CD2 1 
ATOM   5274 C  CE1 . PHE B  1 371 ? 0.119   -9.302  -28.429 1.00 90.66  ? 259  PHE B CE1 1 
ATOM   5275 C  CE2 . PHE B  1 371 ? -2.091  -10.097 -28.869 1.00 91.46  ? 259  PHE B CE2 1 
ATOM   5276 C  CZ  . PHE B  1 371 ? -0.745  -10.081 -29.171 1.00 89.64  ? 259  PHE B CZ  1 
ATOM   5277 N  N   . LEU B  1 372 ? -4.982  -6.221  -26.862 1.00 95.04  ? 260  LEU B N   1 
ATOM   5278 C  CA  . LEU B  1 372 ? -6.162  -6.175  -27.741 1.00 97.06  ? 260  LEU B CA  1 
ATOM   5279 C  C   . LEU B  1 372 ? -6.422  -4.784  -28.366 1.00 105.39 ? 260  LEU B C   1 
ATOM   5280 O  O   . LEU B  1 372 ? -7.113  -4.680  -29.390 1.00 105.34 ? 260  LEU B O   1 
ATOM   5281 C  CB  . LEU B  1 372 ? -7.409  -6.711  -27.020 1.00 96.94  ? 260  LEU B CB  1 
ATOM   5282 C  CG  . LEU B  1 372 ? -7.377  -8.204  -26.771 1.00 101.54 ? 260  LEU B CG  1 
ATOM   5283 C  CD1 . LEU B  1 372 ? -7.985  -8.542  -25.457 1.00 101.95 ? 260  LEU B CD1 1 
ATOM   5284 C  CD2 . LEU B  1 372 ? -8.015  -8.966  -27.901 1.00 104.28 ? 260  LEU B CD2 1 
ATOM   5285 N  N   . HIS B  1 373 ? -5.847  -3.736  -27.766 1.00 104.72 ? 261  HIS B N   1 
ATOM   5286 C  CA  . HIS B  1 373 ? -5.933  -2.365  -28.262 1.00 106.18 ? 261  HIS B CA  1 
ATOM   5287 C  C   . HIS B  1 373 ? -4.820  -2.064  -29.288 1.00 111.60 ? 261  HIS B C   1 
ATOM   5288 O  O   . HIS B  1 373 ? -4.945  -1.092  -30.033 1.00 111.91 ? 261  HIS B O   1 
ATOM   5289 C  CB  . HIS B  1 373 ? -5.863  -1.370  -27.093 1.00 107.69 ? 261  HIS B CB  1 
ATOM   5290 C  CG  . HIS B  1 373 ? -7.097  -1.320  -26.245 1.00 111.69 ? 261  HIS B CG  1 
ATOM   5291 N  ND1 . HIS B  1 373 ? -7.784  -0.133  -26.042 1.00 113.82 ? 261  HIS B ND1 1 
ATOM   5292 C  CD2 . HIS B  1 373 ? -7.717  -2.304  -25.552 1.00 113.86 ? 261  HIS B CD2 1 
ATOM   5293 C  CE1 . HIS B  1 373 ? -8.798  -0.433  -25.247 1.00 113.45 ? 261  HIS B CE1 1 
ATOM   5294 N  NE2 . HIS B  1 373 ? -8.804  -1.728  -24.927 1.00 113.81 ? 261  HIS B NE2 1 
ATOM   5295 N  N   . ASN B  1 374 ? -3.741  -2.891  -29.325 1.00 108.66 ? 262  ASN B N   1 
ATOM   5296 C  CA  . ASN B  1 374 ? -2.589  -2.751  -30.231 1.00 136.19 ? 262  ASN B CA  1 
ATOM   5297 C  C   . ASN B  1 374 ? -2.959  -3.087  -31.672 1.00 169.02 ? 262  ASN B C   1 
ATOM   5298 O  O   . ASN B  1 374 ? -3.612  -4.099  -31.921 1.00 136.76 ? 262  ASN B O   1 
ATOM   5299 C  CB  . ASN B  1 374 ? -1.420  -3.625  -29.765 1.00 136.65 ? 262  ASN B CB  1 
ATOM   5300 N  N   . LYS B  1 377 ? -1.015  -7.627  -34.693 1.00 139.89 ? 265  LYS B N   1 
ATOM   5301 C  CA  . LYS B  1 377 ? -1.221  -8.833  -33.890 1.00 139.59 ? 265  LYS B CA  1 
ATOM   5302 C  C   . LYS B  1 377 ? -0.713  -10.120 -34.607 1.00 144.98 ? 265  LYS B C   1 
ATOM   5303 O  O   . LYS B  1 377 ? -1.508  -10.833 -35.236 1.00 144.70 ? 265  LYS B O   1 
ATOM   5304 C  CB  . LYS B  1 377 ? -2.690  -8.964  -33.430 1.00 140.83 ? 265  LYS B CB  1 
ATOM   5305 C  CG  . LYS B  1 377 ? -3.104  -7.978  -32.346 1.00 141.33 ? 265  LYS B CG  1 
ATOM   5306 C  CD  . LYS B  1 377 ? -4.419  -8.390  -31.718 1.00 146.25 ? 265  LYS B CD  1 
ATOM   5307 C  CE  . LYS B  1 377 ? -5.170  -7.220  -31.143 1.00 153.09 ? 265  LYS B CE  1 
ATOM   5308 N  NZ  . LYS B  1 377 ? -6.008  -6.532  -32.160 1.00 160.18 ? 265  LYS B NZ  1 
ATOM   5309 N  N   . PRO B  1 378 ? 0.607   -10.433 -34.522 1.00 142.26 ? 266  PRO B N   1 
ATOM   5310 C  CA  . PRO B  1 378 ? 1.112   -11.657 -35.174 1.00 142.40 ? 266  PRO B CA  1 
ATOM   5311 C  C   . PRO B  1 378 ? 0.713   -12.934 -34.427 1.00 147.60 ? 266  PRO B C   1 
ATOM   5312 O  O   . PRO B  1 378 ? 0.533   -12.893 -33.209 1.00 147.21 ? 266  PRO B O   1 
ATOM   5313 C  CB  . PRO B  1 378 ? 2.627   -11.455 -35.185 1.00 144.08 ? 266  PRO B CB  1 
ATOM   5314 C  CG  . PRO B  1 378 ? 2.901   -10.564 -34.029 1.00 148.41 ? 266  PRO B CG  1 
ATOM   5315 C  CD  . PRO B  1 378 ? 1.688   -9.703  -33.823 1.00 143.85 ? 266  PRO B CD  1 
ATOM   5316 N  N   . CYS B  1 379 ? 0.590   -14.067 -35.155 1.00 145.05 ? 267  CYS B N   1 
ATOM   5317 C  CA  . CYS B  1 379 ? 0.202   -15.372 -34.595 1.00 145.19 ? 267  CYS B CA  1 
ATOM   5318 C  C   . CYS B  1 379 ? 1.153   -15.869 -33.509 1.00 145.94 ? 267  CYS B C   1 
ATOM   5319 O  O   . CYS B  1 379 ? 0.693   -16.502 -32.560 1.00 145.70 ? 267  CYS B O   1 
ATOM   5320 C  CB  . CYS B  1 379 ? 0.022   -16.424 -35.686 1.00 146.62 ? 267  CYS B CB  1 
ATOM   5321 S  SG  . CYS B  1 379 ? -1.081  -15.938 -37.039 1.00 151.47 ? 267  CYS B SG  1 
ATOM   5322 N  N   . ASP B  1 380 ? 2.470   -15.588 -33.648 1.00 139.79 ? 268  ASP B N   1 
ATOM   5323 C  CA  . ASP B  1 380 ? 3.515   -15.987 -32.696 1.00 138.13 ? 268  ASP B CA  1 
ATOM   5324 C  C   . ASP B  1 380 ? 3.394   -15.265 -31.343 1.00 138.41 ? 268  ASP B C   1 
ATOM   5325 O  O   . ASP B  1 380 ? 3.953   -15.736 -30.346 1.00 138.05 ? 268  ASP B O   1 
ATOM   5326 C  CB  . ASP B  1 380 ? 4.909   -15.793 -33.308 1.00 139.90 ? 268  ASP B CB  1 
ATOM   5327 N  N   . SER B  1 381 ? 2.660   -14.129 -31.316 1.00 131.86 ? 269  SER B N   1 
ATOM   5328 C  CA  . SER B  1 381 ? 2.392   -13.338 -30.113 1.00 130.04 ? 269  SER B CA  1 
ATOM   5329 C  C   . SER B  1 381 ? 1.019   -13.713 -29.547 1.00 129.26 ? 269  SER B C   1 
ATOM   5330 O  O   . SER B  1 381 ? 0.892   -13.873 -28.336 1.00 128.98 ? 269  SER B O   1 
ATOM   5331 C  CB  . SER B  1 381 ? 2.466   -11.842 -30.411 1.00 133.42 ? 269  SER B CB  1 
ATOM   5332 N  N   . VAL B  1 382 ? 0.008   -13.888 -30.424 1.00 122.11 ? 270  VAL B N   1 
ATOM   5333 C  CA  . VAL B  1 382 ? -1.360  -14.268 -30.050 1.00 120.51 ? 270  VAL B CA  1 
ATOM   5334 C  C   . VAL B  1 382 ? -1.386  -15.681 -29.408 1.00 122.00 ? 270  VAL B C   1 
ATOM   5335 O  O   . VAL B  1 382 ? -2.186  -15.919 -28.498 1.00 122.09 ? 270  VAL B O   1 
ATOM   5336 C  CB  . VAL B  1 382 ? -2.357  -14.092 -31.241 1.00 124.22 ? 270  VAL B CB  1 
ATOM   5337 C  CG1 . VAL B  1 382 ? -3.755  -14.603 -30.898 1.00 124.02 ? 270  VAL B CG1 1 
ATOM   5338 C  CG2 . VAL B  1 382 ? -2.434  -12.632 -31.685 1.00 124.01 ? 270  VAL B CG2 1 
ATOM   5339 N  N   . LEU B  1 383 ? -0.482  -16.591 -29.843 1.00 116.00 ? 271  LEU B N   1 
ATOM   5340 C  CA  . LEU B  1 383 ? -0.365  -17.950 -29.291 1.00 114.48 ? 271  LEU B CA  1 
ATOM   5341 C  C   . LEU B  1 383 ? 0.163   -17.911 -27.840 1.00 114.75 ? 271  LEU B C   1 
ATOM   5342 O  O   . LEU B  1 383 ? -0.482  -18.462 -26.946 1.00 114.37 ? 271  LEU B O   1 
ATOM   5343 C  CB  . LEU B  1 383 ? 0.513   -18.844 -30.197 1.00 114.61 ? 271  LEU B CB  1 
ATOM   5344 C  CG  . LEU B  1 383 ? 1.154   -20.077 -29.557 1.00 119.44 ? 271  LEU B CG  1 
ATOM   5345 C  CD1 . LEU B  1 383 ? 0.670   -21.345 -30.217 1.00 119.68 ? 271  LEU B CD1 1 
ATOM   5346 C  CD2 . LEU B  1 383 ? 2.677   -19.963 -29.546 1.00 121.22 ? 271  LEU B CD2 1 
ATOM   5347 N  N   . ARG B  1 384 ? 1.310   -17.233 -27.615 1.00 108.56 ? 272  ARG B N   1 
ATOM   5348 C  CA  . ARG B  1 384 ? 1.946   -17.067 -26.302 1.00 106.91 ? 272  ARG B CA  1 
ATOM   5349 C  C   . ARG B  1 384 ? 1.061   -16.295 -25.296 1.00 106.84 ? 272  ARG B C   1 
ATOM   5350 O  O   . ARG B  1 384 ? 1.203   -16.496 -24.085 1.00 105.81 ? 272  ARG B O   1 
ATOM   5351 C  CB  . ARG B  1 384 ? 3.316   -16.396 -26.459 1.00 107.70 ? 272  ARG B CB  1 
ATOM   5352 N  N   . MET B  1 385 ? 0.151   -15.422 -25.805 1.00 101.00 ? 273  MET B N   1 
ATOM   5353 C  CA  . MET B  1 385 ? -0.816  -14.638 -25.020 1.00 99.29  ? 273  MET B CA  1 
ATOM   5354 C  C   . MET B  1 385 ? -1.926  -15.562 -24.519 1.00 99.93  ? 273  MET B C   1 
ATOM   5355 O  O   . MET B  1 385 ? -2.306  -15.496 -23.348 1.00 99.98  ? 273  MET B O   1 
ATOM   5356 C  CB  . MET B  1 385 ? -1.444  -13.505 -25.871 1.00 101.50 ? 273  MET B CB  1 
ATOM   5357 C  CG  . MET B  1 385 ? -0.604  -12.250 -25.972 1.00 105.00 ? 273  MET B CG  1 
ATOM   5358 S  SD  . MET B  1 385 ? -0.487  -11.322 -24.431 1.00 109.08 ? 273  MET B SD  1 
ATOM   5359 C  CE  . MET B  1 385 ? 1.225   -11.670 -23.984 1.00 105.69 ? 273  MET B CE  1 
ATOM   5360 N  N   . GLN B  1 386 ? -2.451  -16.412 -25.424 1.00 93.14  ? 274  GLN B N   1 
ATOM   5361 C  CA  . GLN B  1 386 ? -3.520  -17.360 -25.139 1.00 91.60  ? 274  GLN B CA  1 
ATOM   5362 C  C   . GLN B  1 386 ? -3.066  -18.509 -24.234 1.00 90.95  ? 274  GLN B C   1 
ATOM   5363 O  O   . GLN B  1 386 ? -3.853  -18.970 -23.406 1.00 90.39  ? 274  GLN B O   1 
ATOM   5364 C  CB  . GLN B  1 386 ? -4.172  -17.862 -26.437 1.00 93.26  ? 274  GLN B CB  1 
ATOM   5365 C  CG  . GLN B  1 386 ? -5.140  -16.853 -27.079 1.00 109.22 ? 274  GLN B CG  1 
ATOM   5366 C  CD  . GLN B  1 386 ? -6.421  -16.601 -26.298 1.00 131.43 ? 274  GLN B CD  1 
ATOM   5367 O  OE1 . GLN B  1 386 ? -6.901  -17.436 -25.511 1.00 126.90 ? 274  GLN B OE1 1 
ATOM   5368 N  NE2 . GLN B  1 386 ? -7.014  -15.437 -26.516 1.00 125.58 ? 274  GLN B NE2 1 
ATOM   5369 N  N   . LYS B  1 387 ? -1.798  -18.945 -24.359 1.00 83.99  ? 275  LYS B N   1 
ATOM   5370 C  CA  . LYS B  1 387 ? -1.242  -19.988 -23.494 1.00 82.15  ? 275  LYS B CA  1 
ATOM   5371 C  C   . LYS B  1 387 ? -1.130  -19.437 -22.060 1.00 82.54  ? 275  LYS B C   1 
ATOM   5372 O  O   . LYS B  1 387 ? -1.421  -20.154 -21.099 1.00 82.38  ? 275  LYS B O   1 
ATOM   5373 C  CB  . LYS B  1 387 ? 0.132   -20.455 -23.995 1.00 84.16  ? 275  LYS B CB  1 
ATOM   5374 C  CG  . LYS B  1 387 ? 0.102   -21.368 -25.205 1.00 95.30  ? 275  LYS B CG  1 
ATOM   5375 C  CD  . LYS B  1 387 ? 1.522   -21.802 -25.548 1.00 104.82 ? 275  LYS B CD  1 
ATOM   5376 C  CE  . LYS B  1 387 ? 1.594   -22.729 -26.732 1.00 108.27 ? 275  LYS B CE  1 
ATOM   5377 N  NZ  . LYS B  1 387 ? 2.974   -23.230 -26.934 1.00 112.04 ? 275  LYS B NZ  1 
ATOM   5378 N  N   . SER B  1 388 ? -0.744  -18.148 -21.928 1.00 75.87  ? 276  SER B N   1 
ATOM   5379 C  CA  . SER B  1 388 ? -0.616  -17.468 -20.640 1.00 73.64  ? 276  SER B CA  1 
ATOM   5380 C  C   . SER B  1 388 ? -1.950  -17.311 -19.905 1.00 75.64  ? 276  SER B C   1 
ATOM   5381 O  O   . SER B  1 388 ? -1.957  -17.428 -18.676 1.00 75.91  ? 276  SER B O   1 
ATOM   5382 C  CB  . SER B  1 388 ? 0.099   -16.141 -20.800 1.00 74.32  ? 276  SER B CB  1 
ATOM   5383 O  OG  . SER B  1 388 ? 1.488   -16.397 -20.896 1.00 83.14  ? 276  SER B OG  1 
ATOM   5384 N  N   . VAL B  1 389 ? -3.080  -17.105 -20.652 1.00 68.75  ? 277  VAL B N   1 
ATOM   5385 C  CA  . VAL B  1 389 ? -4.440  -17.014 -20.101 1.00 67.13  ? 277  VAL B CA  1 
ATOM   5386 C  C   . VAL B  1 389 ? -4.781  -18.357 -19.436 1.00 70.36  ? 277  VAL B C   1 
ATOM   5387 O  O   . VAL B  1 389 ? -5.302  -18.349 -18.322 1.00 71.25  ? 277  VAL B O   1 
ATOM   5388 C  CB  . VAL B  1 389 ? -5.496  -16.604 -21.172 1.00 70.23  ? 277  VAL B CB  1 
ATOM   5389 C  CG1 . VAL B  1 389 ? -6.923  -16.665 -20.625 1.00 68.80  ? 277  VAL B CG1 1 
ATOM   5390 C  CG2 . VAL B  1 389 ? -5.201  -15.219 -21.735 1.00 70.43  ? 277  VAL B CG2 1 
ATOM   5391 N  N   . VAL B  1 390 ? -4.444  -19.496 -20.107 1.00 64.50  ? 278  VAL B N   1 
ATOM   5392 C  CA  . VAL B  1 390 ? -4.653  -20.875 -19.635 1.00 64.03  ? 278  VAL B CA  1 
ATOM   5393 C  C   . VAL B  1 390 ? -3.925  -21.098 -18.295 1.00 67.25  ? 278  VAL B C   1 
ATOM   5394 O  O   . VAL B  1 390 ? -4.540  -21.545 -17.317 1.00 68.56  ? 278  VAL B O   1 
ATOM   5395 C  CB  . VAL B  1 390 ? -4.225  -21.943 -20.709 1.00 67.81  ? 278  VAL B CB  1 
ATOM   5396 C  CG1 . VAL B  1 390 ? -4.324  -23.379 -20.188 1.00 66.82  ? 278  VAL B CG1 1 
ATOM   5397 C  CG2 . VAL B  1 390 ? -5.031  -21.793 -21.988 1.00 68.07  ? 278  VAL B CG2 1 
ATOM   5398 N  N   . ILE B  1 391 ? -2.628  -20.772 -18.265 1.00 60.19  ? 279  ILE B N   1 
ATOM   5399 C  CA  . ILE B  1 391 ? -1.764  -20.977 -17.118 1.00 59.18  ? 279  ILE B CA  1 
ATOM   5400 C  C   . ILE B  1 391 ? -2.115  -20.051 -15.944 1.00 64.02  ? 279  ILE B C   1 
ATOM   5401 O  O   . ILE B  1 391 ? -2.243  -20.553 -14.823 1.00 63.38  ? 279  ILE B O   1 
ATOM   5402 C  CB  . ILE B  1 391 ? -0.260  -20.892 -17.538 1.00 62.02  ? 279  ILE B CB  1 
ATOM   5403 C  CG1 . ILE B  1 391 ? 0.071   -21.973 -18.609 1.00 62.96  ? 279  ILE B CG1 1 
ATOM   5404 C  CG2 . ILE B  1 391 ? 0.682   -21.042 -16.323 1.00 61.32  ? 279  ILE B CG2 1 
ATOM   5405 C  CD1 . ILE B  1 391 ? 1.356   -21.735 -19.447 1.00 72.84  ? 279  ILE B CD1 1 
ATOM   5406 N  N   . THR B  1 392 ? -2.270  -18.712 -16.188 1.00 60.57  ? 280  THR B N   1 
ATOM   5407 C  CA  . THR B  1 392 ? -2.526  -17.737 -15.109 1.00 59.67  ? 280  THR B CA  1 
ATOM   5408 C  C   . THR B  1 392 ? -3.916  -17.925 -14.459 1.00 61.35  ? 280  THR B C   1 
ATOM   5409 O  O   . THR B  1 392 ? -4.034  -17.702 -13.247 1.00 60.94  ? 280  THR B O   1 
ATOM   5410 C  CB  . THR B  1 392 ? -2.242  -16.279 -15.527 1.00 65.45  ? 280  THR B CB  1 
ATOM   5411 O  OG1 . THR B  1 392 ? -3.154  -15.852 -16.533 1.00 70.83  ? 280  THR B OG1 1 
ATOM   5412 C  CG2 . THR B  1 392 ? -0.795  -16.058 -15.974 1.00 59.08  ? 280  THR B CG2 1 
ATOM   5413 N  N   . LEU B  1 393 ? -4.923  -18.395 -15.228 1.00 55.84  ? 281  LEU B N   1 
ATOM   5414 C  CA  . LEU B  1 393 ? -6.266  -18.682 -14.715 1.00 55.90  ? 281  LEU B CA  1 
ATOM   5415 C  C   . LEU B  1 393 ? -6.300  -19.975 -13.880 1.00 63.33  ? 281  LEU B C   1 
ATOM   5416 O  O   . LEU B  1 393 ? -7.060  -20.049 -12.910 1.00 64.69  ? 281  LEU B O   1 
ATOM   5417 C  CB  . LEU B  1 393 ? -7.272  -18.777 -15.858 1.00 55.62  ? 281  LEU B CB  1 
ATOM   5418 C  CG  . LEU B  1 393 ? -8.737  -18.772 -15.480 1.00 59.77  ? 281  LEU B CG  1 
ATOM   5419 C  CD1 . LEU B  1 393 ? -9.120  -17.495 -14.782 1.00 59.48  ? 281  LEU B CD1 1 
ATOM   5420 C  CD2 . LEU B  1 393 ? -9.582  -18.952 -16.692 1.00 63.32  ? 281  LEU B CD2 1 
ATOM   5421 N  N   . SER B  1 394 ? -5.494  -20.995 -14.275 1.00 59.77  ? 282  SER B N   1 
ATOM   5422 C  CA  . SER B  1 394 ? -5.333  -22.275 -13.570 1.00 59.03  ? 282  SER B CA  1 
ATOM   5423 C  C   . SER B  1 394 ? -4.668  -22.000 -12.228 1.00 60.81  ? 282  SER B C   1 
ATOM   5424 O  O   . SER B  1 394 ? -5.067  -22.593 -11.221 1.00 61.14  ? 282  SER B O   1 
ATOM   5425 C  CB  . SER B  1 394 ? -4.451  -23.230 -14.373 1.00 61.34  ? 282  SER B CB  1 
ATOM   5426 O  OG  . SER B  1 394 ? -5.056  -23.616 -15.597 1.00 69.96  ? 282  SER B OG  1 
ATOM   5427 N  N   . LEU B  1 395 ? -3.652  -21.095 -12.227 1.00 54.26  ? 283  LEU B N   1 
ATOM   5428 C  CA  . LEU B  1 395 ? -2.924  -20.679 -11.033 1.00 53.55  ? 283  LEU B CA  1 
ATOM   5429 C  C   . LEU B  1 395 ? -3.839  -19.917 -10.080 1.00 57.46  ? 283  LEU B C   1 
ATOM   5430 O  O   . LEU B  1 395 ? -3.775  -20.161 -8.875  1.00 56.79  ? 283  LEU B O   1 
ATOM   5431 C  CB  . LEU B  1 395 ? -1.689  -19.829 -11.379 1.00 53.56  ? 283  LEU B CB  1 
ATOM   5432 C  CG  . LEU B  1 395 ? -0.439  -20.561 -11.834 1.00 57.20  ? 283  LEU B CG  1 
ATOM   5433 C  CD1 . LEU B  1 395 ? 0.697   -19.579 -12.011 1.00 57.32  ? 283  LEU B CD1 1 
ATOM   5434 C  CD2 . LEU B  1 395 ? -0.036  -21.664 -10.840 1.00 56.75  ? 283  LEU B CD2 1 
ATOM   5435 N  N   . ALA B  1 396 ? -4.716  -19.030 -10.625 1.00 53.91  ? 284  ALA B N   1 
ATOM   5436 C  CA  . ALA B  1 396 ? -5.717  -18.269 -9.863  1.00 53.31  ? 284  ALA B CA  1 
ATOM   5437 C  C   . ALA B  1 396 ? -6.689  -19.235 -9.198  1.00 57.87  ? 284  ALA B C   1 
ATOM   5438 O  O   . ALA B  1 396 ? -6.858  -19.164 -7.985  1.00 56.94  ? 284  ALA B O   1 
ATOM   5439 C  CB  . ALA B  1 396 ? -6.457  -17.291 -10.770 1.00 53.65  ? 284  ALA B CB  1 
ATOM   5440 N  N   . ALA B  1 397 ? -7.233  -20.204 -9.966  1.00 57.01  ? 285  ALA B N   1 
ATOM   5441 C  CA  . ALA B  1 397 ? -8.161  -21.259 -9.486  1.00 56.85  ? 285  ALA B CA  1 
ATOM   5442 C  C   . ALA B  1 397 ? -7.539  -22.219 -8.439  1.00 58.63  ? 285  ALA B C   1 
ATOM   5443 O  O   . ALA B  1 397 ? -8.266  -22.718 -7.578  1.00 57.93  ? 285  ALA B O   1 
ATOM   5444 C  CB  . ALA B  1 397 ? -8.746  -22.044 -10.663 1.00 57.09  ? 285  ALA B CB  1 
ATOM   5445 N  N   . SER B  1 398 ? -6.205  -22.419 -8.476  1.00 54.59  ? 286  SER B N   1 
ATOM   5446 C  CA  . SER B  1 398 ? -5.466  -23.265 -7.520  1.00 55.83  ? 286  SER B CA  1 
ATOM   5447 C  C   . SER B  1 398 ? -5.341  -22.656 -6.099  1.00 63.16  ? 286  SER B C   1 
ATOM   5448 O  O   . SER B  1 398 ? -4.701  -23.256 -5.237  1.00 64.65  ? 286  SER B O   1 
ATOM   5449 C  CB  . SER B  1 398 ? -4.081  -23.640 -8.068  1.00 59.26  ? 286  SER B CB  1 
ATOM   5450 O  OG  . SER B  1 398 ? -3.095  -22.637 -7.861  1.00 63.98  ? 286  SER B OG  1 
ATOM   5451 N  N   . ASN B  1 399 ? -5.945  -21.477 -5.859  1.00 60.35  ? 287  ASN B N   1 
ATOM   5452 C  CA  . ASN B  1 399 ? -5.895  -20.787 -4.566  1.00 60.24  ? 287  ASN B CA  1 
ATOM   5453 C  C   . ASN B  1 399 ? -6.487  -21.626 -3.421  1.00 67.44  ? 287  ASN B C   1 
ATOM   5454 O  O   . ASN B  1 399 ? -6.027  -21.518 -2.288  1.00 65.81  ? 287  ASN B O   1 
ATOM   5455 C  CB  . ASN B  1 399 ? -6.549  -19.395 -4.657  1.00 53.57  ? 287  ASN B CB  1 
ATOM   5456 C  CG  . ASN B  1 399 ? -8.045  -19.401 -4.693  1.00 57.89  ? 287  ASN B CG  1 
ATOM   5457 O  OD1 . ASN B  1 399 ? -8.716  -19.542 -3.669  1.00 52.05  ? 287  ASN B OD1 1 
ATOM   5458 N  ND2 . ASN B  1 399 ? -8.610  -19.236 -5.863  1.00 52.19  ? 287  ASN B ND2 1 
ATOM   5459 N  N   . CYS B  1 400 ? -7.506  -22.463 -3.731  1.00 68.41  ? 288  CYS B N   1 
ATOM   5460 C  CA  . CYS B  1 400 ? -8.203  -23.350 -2.787  1.00 69.40  ? 288  CYS B CA  1 
ATOM   5461 C  C   . CYS B  1 400 ? -7.277  -24.440 -2.199  1.00 70.96  ? 288  CYS B C   1 
ATOM   5462 O  O   . CYS B  1 400 ? -7.566  -24.975 -1.122  1.00 70.23  ? 288  CYS B O   1 
ATOM   5463 C  CB  . CYS B  1 400 ? -9.445  -23.954 -3.436  1.00 70.79  ? 288  CYS B CB  1 
ATOM   5464 S  SG  . CYS B  1 400 ? -9.087  -25.190 -4.715  1.00 75.40  ? 288  CYS B SG  1 
ATOM   5465 N  N   . CYS B  1 401 ? -6.168  -24.748 -2.906  1.00 65.51  ? 289  CYS B N   1 
ATOM   5466 C  CA  . CYS B  1 401 ? -5.165  -25.723 -2.476  1.00 64.66  ? 289  CYS B CA  1 
ATOM   5467 C  C   . CYS B  1 401 ? -4.268  -25.173 -1.367  1.00 64.42  ? 289  CYS B C   1 
ATOM   5468 O  O   . CYS B  1 401 ? -3.710  -25.959 -0.611  1.00 65.80  ? 289  CYS B O   1 
ATOM   5469 C  CB  . CYS B  1 401 ? -4.348  -26.218 -3.666  1.00 65.37  ? 289  CYS B CB  1 
ATOM   5470 S  SG  . CYS B  1 401 ? -5.323  -27.101 -4.907  1.00 69.79  ? 289  CYS B SG  1 
ATOM   5471 N  N   . PHE B  1 402 ? -4.113  -23.842 -1.272  1.00 56.07  ? 290  PHE B N   1 
ATOM   5472 C  CA  . PHE B  1 402 ? -3.273  -23.189 -0.267  1.00 53.79  ? 290  PHE B CA  1 
ATOM   5473 C  C   . PHE B  1 402 ? -3.943  -23.097 1.114   1.00 60.01  ? 290  PHE B C   1 
ATOM   5474 O  O   . PHE B  1 402 ? -3.243  -23.040 2.122   1.00 59.13  ? 290  PHE B O   1 
ATOM   5475 C  CB  . PHE B  1 402 ? -2.863  -21.778 -0.731  1.00 53.61  ? 290  PHE B CB  1 
ATOM   5476 C  CG  . PHE B  1 402 ? -1.830  -21.695 -1.832  1.00 53.72  ? 290  PHE B CG  1 
ATOM   5477 C  CD1 . PHE B  1 402 ? -2.206  -21.784 -3.166  1.00 56.21  ? 290  PHE B CD1 1 
ATOM   5478 C  CD2 . PHE B  1 402 ? -0.486  -21.463 -1.535  1.00 55.77  ? 290  PHE B CD2 1 
ATOM   5479 C  CE1 . PHE B  1 402 ? -1.258  -21.660 -4.189  1.00 57.76  ? 290  PHE B CE1 1 
ATOM   5480 C  CE2 . PHE B  1 402 ? 0.474   -21.375 -2.557  1.00 58.65  ? 290  PHE B CE2 1 
ATOM   5481 C  CZ  . PHE B  1 402 ? 0.082   -21.464 -3.880  1.00 57.15  ? 290  PHE B CZ  1 
ATOM   5482 N  N   . ASP B  1 403 ? -5.279  -23.041 1.165   1.00 59.42  ? 291  ASP B N   1 
ATOM   5483 C  CA  . ASP B  1 403 ? -6.013  -22.837 2.418   1.00 60.23  ? 291  ASP B CA  1 
ATOM   5484 C  C   . ASP B  1 403 ? -5.903  -24.026 3.391   1.00 66.43  ? 291  ASP B C   1 
ATOM   5485 O  O   . ASP B  1 403 ? -5.654  -23.739 4.566   1.00 65.51  ? 291  ASP B O   1 
ATOM   5486 C  CB  . ASP B  1 403 ? -7.460  -22.389 2.169   1.00 61.66  ? 291  ASP B CB  1 
ATOM   5487 C  CG  . ASP B  1 403 ? -7.488  -21.065 1.435   1.00 70.13  ? 291  ASP B CG  1 
ATOM   5488 O  OD1 . ASP B  1 403 ? -6.722  -20.153 1.822   1.00 70.67  ? 291  ASP B OD1 1 
ATOM   5489 O  OD2 . ASP B  1 403 ? -8.239  -20.948 0.460   1.00 76.51  ? 291  ASP B OD2 1 
ATOM   5490 N  N   . PRO B  1 404 ? -5.945  -25.332 2.984   1.00 65.20  ? 292  PRO B N   1 
ATOM   5491 C  CA  . PRO B  1 404 ? -5.652  -26.402 3.962   1.00 65.09  ? 292  PRO B CA  1 
ATOM   5492 C  C   . PRO B  1 404 ? -4.240  -26.258 4.560   1.00 70.38  ? 292  PRO B C   1 
ATOM   5493 O  O   . PRO B  1 404 ? -4.080  -26.462 5.762   1.00 70.78  ? 292  PRO B O   1 
ATOM   5494 C  CB  . PRO B  1 404 ? -5.803  -27.688 3.143   1.00 66.42  ? 292  PRO B CB  1 
ATOM   5495 C  CG  . PRO B  1 404 ? -6.636  -27.305 1.975   1.00 70.73  ? 292  PRO B CG  1 
ATOM   5496 C  CD  . PRO B  1 404 ? -6.224  -25.908 1.652   1.00 66.77  ? 292  PRO B CD  1 
ATOM   5497 N  N   . LEU B  1 405 ? -3.237  -25.822 3.751   1.00 68.10  ? 293  LEU B N   1 
ATOM   5498 C  CA  . LEU B  1 405 ? -1.852  -25.597 4.215   1.00 69.03  ? 293  LEU B CA  1 
ATOM   5499 C  C   . LEU B  1 405 ? -1.759  -24.457 5.217   1.00 72.04  ? 293  LEU B C   1 
ATOM   5500 O  O   . LEU B  1 405 ? -0.902  -24.501 6.085   1.00 72.45  ? 293  LEU B O   1 
ATOM   5501 C  CB  . LEU B  1 405 ? -0.874  -25.319 3.062   1.00 69.94  ? 293  LEU B CB  1 
ATOM   5502 C  CG  . LEU B  1 405 ? -0.289  -26.503 2.275   1.00 76.08  ? 293  LEU B CG  1 
ATOM   5503 C  CD1 . LEU B  1 405 ? 0.576   -25.995 1.156   1.00 76.29  ? 293  LEU B CD1 1 
ATOM   5504 C  CD2 . LEU B  1 405 ? 0.544   -27.460 3.144   1.00 81.92  ? 293  LEU B CD2 1 
ATOM   5505 N  N   . LEU B  1 406 ? -2.618  -23.435 5.091   1.00 66.93  ? 294  LEU B N   1 
ATOM   5506 C  CA  . LEU B  1 406 ? -2.688  -22.312 6.023   1.00 66.46  ? 294  LEU B CA  1 
ATOM   5507 C  C   . LEU B  1 406 ? -3.159  -22.822 7.390   1.00 73.72  ? 294  LEU B C   1 
ATOM   5508 O  O   . LEU B  1 406 ? -2.635  -22.390 8.411   1.00 73.14  ? 294  LEU B O   1 
ATOM   5509 C  CB  . LEU B  1 406 ? -3.630  -21.222 5.463   1.00 65.79  ? 294  LEU B CB  1 
ATOM   5510 C  CG  . LEU B  1 406 ? -3.955  -19.985 6.303   1.00 68.62  ? 294  LEU B CG  1 
ATOM   5511 C  CD1 . LEU B  1 406 ? -2.729  -19.130 6.542   1.00 68.68  ? 294  LEU B CD1 1 
ATOM   5512 C  CD2 . LEU B  1 406 ? -4.997  -19.172 5.613   1.00 70.16  ? 294  LEU B CD2 1 
ATOM   5513 N  N   . TYR B  1 407 ? -4.101  -23.780 7.404   1.00 74.62  ? 295  TYR B N   1 
ATOM   5514 C  CA  . TYR B  1 407 ? -4.605  -24.380 8.636   1.00 76.39  ? 295  TYR B CA  1 
ATOM   5515 C  C   . TYR B  1 407 ? -3.544  -25.259 9.349   1.00 81.59  ? 295  TYR B C   1 
ATOM   5516 O  O   . TYR B  1 407 ? -3.492  -25.248 10.581  1.00 81.44  ? 295  TYR B O   1 
ATOM   5517 C  CB  . TYR B  1 407 ? -5.917  -25.156 8.385   1.00 78.59  ? 295  TYR B CB  1 
ATOM   5518 C  CG  . TYR B  1 407 ? -6.525  -25.710 9.652   1.00 82.02  ? 295  TYR B CG  1 
ATOM   5519 C  CD1 . TYR B  1 407 ? -7.282  -24.904 10.493  1.00 84.88  ? 295  TYR B CD1 1 
ATOM   5520 C  CD2 . TYR B  1 407 ? -6.294  -27.026 10.043  1.00 83.02  ? 295  TYR B CD2 1 
ATOM   5521 C  CE1 . TYR B  1 407 ? -7.809  -25.394 11.686  1.00 87.07  ? 295  TYR B CE1 1 
ATOM   5522 C  CE2 . TYR B  1 407 ? -6.807  -27.527 11.238  1.00 84.22  ? 295  TYR B CE2 1 
ATOM   5523 C  CZ  . TYR B  1 407 ? -7.565  -26.707 12.058  1.00 92.90  ? 295  TYR B CZ  1 
ATOM   5524 O  OH  . TYR B  1 407 ? -8.079  -27.185 13.240  1.00 94.14  ? 295  TYR B OH  1 
ATOM   5525 N  N   . PHE B  1 408 ? -2.706  -25.994 8.586   1.00 77.79  ? 296  PHE B N   1 
ATOM   5526 C  CA  . PHE B  1 408 ? -1.691  -26.881 9.151   1.00 78.10  ? 296  PHE B CA  1 
ATOM   5527 C  C   . PHE B  1 408 ? -0.429  -26.142 9.674   1.00 81.97  ? 296  PHE B C   1 
ATOM   5528 O  O   . PHE B  1 408 ? 0.214   -26.648 10.589  1.00 81.43  ? 296  PHE B O   1 
ATOM   5529 C  CB  . PHE B  1 408 ? -1.348  -28.022 8.164   1.00 80.80  ? 296  PHE B CB  1 
ATOM   5530 C  CG  . PHE B  1 408 ? -2.556  -28.879 7.790   1.00 84.18  ? 296  PHE B CG  1 
ATOM   5531 C  CD1 . PHE B  1 408 ? -3.470  -29.304 8.764   1.00 88.24  ? 296  PHE B CD1 1 
ATOM   5532 C  CD2 . PHE B  1 408 ? -2.785  -29.257 6.469   1.00 87.70  ? 296  PHE B CD2 1 
ATOM   5533 C  CE1 . PHE B  1 408 ? -4.611  -30.051 8.413   1.00 89.01  ? 296  PHE B CE1 1 
ATOM   5534 C  CE2 . PHE B  1 408 ? -3.929  -30.006 6.119   1.00 90.65  ? 296  PHE B CE2 1 
ATOM   5535 C  CZ  . PHE B  1 408 ? -4.826  -30.404 7.096   1.00 88.41  ? 296  PHE B CZ  1 
ATOM   5536 N  N   . PHE B  1 409 ? -0.112  -24.935 9.158   1.00 79.19  ? 297  PHE B N   1 
ATOM   5537 C  CA  . PHE B  1 409 ? 1.041   -24.144 9.593   1.00 79.33  ? 297  PHE B CA  1 
ATOM   5538 C  C   . PHE B  1 409 ? 0.696   -23.005 10.573  1.00 85.96  ? 297  PHE B C   1 
ATOM   5539 O  O   . PHE B  1 409 ? 1.587   -22.574 11.307  1.00 86.67  ? 297  PHE B O   1 
ATOM   5540 C  CB  . PHE B  1 409 ? 1.844   -23.614 8.395   1.00 80.97  ? 297  PHE B CB  1 
ATOM   5541 C  CG  . PHE B  1 409 ? 2.520   -24.690 7.580   1.00 82.91  ? 297  PHE B CG  1 
ATOM   5542 C  CD1 . PHE B  1 409 ? 3.620   -25.368 8.075   1.00 87.55  ? 297  PHE B CD1 1 
ATOM   5543 C  CD2 . PHE B  1 409 ? 2.076   -25.001 6.305   1.00 85.55  ? 297  PHE B CD2 1 
ATOM   5544 C  CE1 . PHE B  1 409 ? 4.240   -26.366 7.321   1.00 88.86  ? 297  PHE B CE1 1 
ATOM   5545 C  CE2 . PHE B  1 409 ? 2.683   -26.009 5.559   1.00 89.12  ? 297  PHE B CE2 1 
ATOM   5546 C  CZ  . PHE B  1 409 ? 3.767   -26.678 6.065   1.00 87.74  ? 297  PHE B CZ  1 
ATOM   5547 N  N   . SER B  1 410 ? -0.565  -22.513 10.594  1.00 82.96  ? 298  SER B N   1 
ATOM   5548 C  CA  . SER B  1 410 ? -1.015  -21.471 11.539  1.00 82.85  ? 298  SER B CA  1 
ATOM   5549 C  C   . SER B  1 410 ? -2.204  -21.960 12.355  1.00 89.02  ? 298  SER B C   1 
ATOM   5550 O  O   . SER B  1 410 ? -2.945  -22.835 11.899  1.00 89.50  ? 298  SER B O   1 
ATOM   5551 C  CB  . SER B  1 410 ? -1.382  -20.169 10.829  1.00 84.98  ? 298  SER B CB  1 
ATOM   5552 O  OG  . SER B  1 410 ? -1.353  -20.265 9.417   1.00 90.93  ? 298  SER B OG  1 
ATOM   5553 N  N   . GLY B  1 411 ? -2.371  -21.394 13.550  1.00 86.20  ? 299  GLY B N   1 
ATOM   5554 C  CA  . GLY B  1 411 ? -3.457  -21.715 14.479  1.00 116.32 ? 299  GLY B CA  1 
ATOM   5555 C  C   . GLY B  1 411 ? -3.577  -23.169 14.910  1.00 127.64 ? 299  GLY B C   1 
ATOM   5556 O  O   . GLY B  1 411 ? -2.643  -23.967 14.777  1.00 77.61  ? 299  GLY B O   1 
HETATM 5557 C  C11 . ZLK C  2 .   ? 15.266  5.140   -13.077 1.00 59.46  ? 2001 ZLK A C11 1 
HETATM 5558 C  C01 . ZLK C  2 .   ? 13.040  8.856   -11.732 1.00 46.84  ? 2001 ZLK A C01 1 
HETATM 5559 C  C03 . ZLK C  2 .   ? 12.771  7.884   -13.993 1.00 50.92  ? 2001 ZLK A C03 1 
HETATM 5560 C  C04 . ZLK C  2 .   ? 12.760  6.761   -14.913 1.00 54.57  ? 2001 ZLK A C04 1 
HETATM 5561 C  C05 . ZLK C  2 .   ? 13.070  5.299   -14.453 1.00 55.39  ? 2001 ZLK A C05 1 
HETATM 5562 C  C06 . ZLK C  2 .   ? 14.567  5.155   -14.309 1.00 59.41  ? 2001 ZLK A C06 1 
HETATM 5563 C  C07 . ZLK C  2 .   ? 15.486  4.989   -15.340 1.00 61.72  ? 2001 ZLK A C07 1 
HETATM 5564 C  C09 . ZLK C  2 .   ? 17.958  4.662   -15.532 1.00 64.39  ? 2001 ZLK A C09 1 
HETATM 5565 C  C10 . ZLK C  2 .   ? 16.606  4.944   -13.398 1.00 61.38  ? 2001 ZLK A C10 1 
HETATM 5566 C  C12 . ZLK C  2 .   ? 14.856  5.269   -11.714 1.00 55.42  ? 2001 ZLK A C12 1 
HETATM 5567 C  C13 . ZLK C  2 .   ? 15.821  5.234   -10.720 1.00 52.82  ? 2001 ZLK A C13 1 
HETATM 5568 C  C15 . ZLK C  2 .   ? 14.260  5.860   -8.716  1.00 52.61  ? 2001 ZLK A C15 1 
HETATM 5569 C  C18 . ZLK C  2 .   ? 13.290  6.642   -6.651  1.00 44.90  ? 2001 ZLK A C18 1 
HETATM 5570 C  C19 . ZLK C  2 .   ? 11.981  5.699   -6.243  1.00 42.40  ? 2001 ZLK A C19 1 
HETATM 5571 C  C20 . ZLK C  2 .   ? 12.337  5.099   -5.058  1.00 43.23  ? 2001 ZLK A C20 1 
HETATM 5572 C  C21 . ZLK C  2 .   ? 13.343  6.126   -4.345  1.00 42.34  ? 2001 ZLK A C21 1 
HETATM 5573 C  C22 . ZLK C  2 .   ? 13.838  7.134   -5.492  1.00 41.65  ? 2001 ZLK A C22 1 
HETATM 5574 C  C23 . ZLK C  2 .   ? 17.187  5.012   -11.034 1.00 55.76  ? 2001 ZLK A C23 1 
HETATM 5575 C  C24 . ZLK C  2 .   ? 17.585  4.871   -12.366 1.00 58.49  ? 2001 ZLK A C24 1 
HETATM 5576 C  C25 . ZLK C  2 .   ? 12.415  6.911   -16.286 1.00 53.49  ? 2001 ZLK A C25 1 
HETATM 5577 C  C26 . ZLK C  2 .   ? 12.057  8.212   -16.756 1.00 51.47  ? 2001 ZLK A C26 1 
HETATM 5578 C  C27 . ZLK C  2 .   ? 12.102  9.320   -15.862 1.00 53.81  ? 2001 ZLK A C27 1 
HETATM 5579 C  C28 . ZLK C  2 .   ? 12.431  9.169   -14.503 1.00 51.55  ? 2001 ZLK A C28 1 
HETATM 5580 C  C29 . ZLK C  2 .   ? 11.655  10.728  -16.365 1.00 59.23  ? 2001 ZLK A C29 1 
HETATM 5581 C  C35 . ZLK C  2 .   ? 9.566   12.633  -18.244 1.00 60.78  ? 2001 ZLK A C35 1 
HETATM 5582 C  C36 . ZLK C  2 .   ? 8.996   13.698  -17.531 1.00 56.75  ? 2001 ZLK A C36 1 
HETATM 5583 C  C37 . ZLK C  2 .   ? 7.600   13.787  -17.449 1.00 56.70  ? 2001 ZLK A C37 1 
HETATM 5584 C  C38 . ZLK C  2 .   ? 6.795   12.817  -18.050 1.00 57.73  ? 2001 ZLK A C38 1 
HETATM 5585 C  C39 . ZLK C  2 .   ? 7.358   11.756  -18.754 1.00 57.52  ? 2001 ZLK A C39 1 
HETATM 5586 C  C40 . ZLK C  2 .   ? 8.769   11.666  -18.859 1.00 58.83  ? 2001 ZLK A C40 1 
HETATM 5587 C  C41 . ZLK C  2 .   ? 9.387   10.469  -19.661 1.00 57.60  ? 2001 ZLK A C41 1 
HETATM 5588 N  N08 . ZLK C  2 .   ? 16.700  4.856   -14.774 1.00 63.86  ? 2001 ZLK A N08 1 
HETATM 5589 N  N14 . ZLK C  2 .   ? 15.470  5.286   -9.311  1.00 51.85  ? 2001 ZLK A N14 1 
HETATM 5590 N  N31 . ZLK C  2 .   ? 11.876  11.044  -17.756 1.00 65.94  ? 2001 ZLK A N31 1 
HETATM 5591 O  O02 . ZLK C  2 .   ? 13.099  7.746   -12.628 1.00 50.62  ? 2001 ZLK A O02 1 
HETATM 5592 O  O16 . ZLK C  2 .   ? 13.401  6.335   -9.389  1.00 56.08  ? 2001 ZLK A O16 1 
HETATM 5593 O  O17 . ZLK C  2 .   ? 14.202  5.785   -7.302  1.00 47.44  ? 2001 ZLK A O17 1 
HETATM 5594 O  O30 . ZLK C  2 .   ? 11.105  11.486  -15.657 1.00 56.06  ? 2001 ZLK A O30 1 
HETATM 5595 O  O33 . ZLK C  2 .   ? 11.815  12.689  -19.731 1.00 69.81  ? 2001 ZLK A O33 1 
HETATM 5596 O  O34 . ZLK C  2 .   ? 12.056  13.619  -17.662 1.00 67.15  ? 2001 ZLK A O34 1 
HETATM 5597 S  S32 . ZLK C  2 .   ? 11.361  12.542  -18.355 1.00 66.62  ? 2001 ZLK A S32 1 
HETATM 5598 C  C10 . OLC D  3 .   ? 13.555  3.937   5.500   1.00 82.54  ? 2002 OLC A C10 1 
HETATM 5599 C  C9  . OLC D  3 .   ? 13.584  3.718   6.805   1.00 81.99  ? 2002 OLC A C9  1 
HETATM 5600 C  C11 . OLC D  3 .   ? 12.294  3.893   4.637   1.00 83.00  ? 2002 OLC A C11 1 
HETATM 5601 C  C8  . OLC D  3 .   ? 12.361  3.373   7.660   1.00 81.43  ? 2002 OLC A C8  1 
HETATM 5602 C  C12 . OLC D  3 .   ? 12.697  4.075   3.174   1.00 84.12  ? 2002 OLC A C12 1 
HETATM 5603 C  C7  . OLC D  3 .   ? 12.823  3.121   9.097   1.00 80.97  ? 2002 OLC A C7  1 
HETATM 5604 C  C13 . OLC D  3 .   ? 12.710  2.715   2.468   1.00 84.20  ? 2002 OLC A C13 1 
HETATM 5605 C  C6  . OLC D  3 .   ? 12.230  1.810   9.620   1.00 80.46  ? 2002 OLC A C6  1 
HETATM 5606 C  C5  . OLC D  3 .   ? 12.632  1.634   11.084  1.00 80.51  ? 2002 OLC A C5  1 
HETATM 5607 C  C10 . OLC E  3 .   ? 20.330  -0.909  -1.349  1.00 98.47  ? 2003 OLC A C10 1 
HETATM 5608 C  C9  . OLC E  3 .   ? 20.022  -2.052  -1.953  1.00 96.99  ? 2003 OLC A C9  1 
HETATM 5609 C  C17 . OLC E  3 .   ? 17.581  2.507   5.062   1.00 98.96  ? 2003 OLC A C17 1 
HETATM 5610 C  C11 . OLC E  3 .   ? 19.504  0.392   -1.345  1.00 98.96  ? 2003 OLC A C11 1 
HETATM 5611 C  C8  . OLC E  3 .   ? 18.765  -2.285  -2.794  1.00 96.11  ? 2003 OLC A C8  1 
HETATM 5612 C  C16 . OLC E  3 .   ? 18.857  2.262   4.253   1.00 99.74  ? 2003 OLC A C16 1 
HETATM 5613 C  C12 . OLC E  3 .   ? 20.186  1.489   -0.506  1.00 98.76  ? 2003 OLC A C12 1 
HETATM 5614 C  C7  . OLC E  3 .   ? 19.167  -2.513  -4.250  1.00 94.38  ? 2003 OLC A C7  1 
HETATM 5615 C  C15 . OLC E  3 .   ? 18.552  1.492   2.964   1.00 100.55 ? 2003 OLC A C15 1 
HETATM 5616 C  C13 . OLC E  3 .   ? 20.122  1.188   1.001   1.00 99.45  ? 2003 OLC A C13 1 
HETATM 5617 C  C6  . OLC E  3 .   ? 17.910  -2.749  -5.081  1.00 91.99  ? 2003 OLC A C6  1 
HETATM 5618 C  C14 . OLC E  3 .   ? 19.207  2.168   1.749   1.00 100.26 ? 2003 OLC A C14 1 
HETATM 5619 C  C5  . OLC E  3 .   ? 18.088  -2.170  -6.488  1.00 89.20  ? 2003 OLC A C5  1 
HETATM 5620 C  C4  . OLC E  3 .   ? 17.932  -3.280  -7.532  1.00 85.98  ? 2003 OLC A C4  1 
HETATM 5621 C  C3  . OLC E  3 .   ? 16.562  -3.218  -8.218  1.00 81.70  ? 2003 OLC A C3  1 
HETATM 5622 C  C2  . OLC E  3 .   ? 16.107  -4.626  -8.603  1.00 77.06  ? 2003 OLC A C2  1 
HETATM 5623 C  C1  . OLC E  3 .   ? 14.982  -4.518  -9.623  1.00 73.54  ? 2003 OLC A C1  1 
HETATM 5624 C  C10 . OLC F  3 .   ? 2.702   28.673  -1.159  1.00 67.28  ? 2004 OLC A C10 1 
HETATM 5625 C  C9  . OLC F  3 .   ? 3.494   29.559  -0.563  1.00 65.87  ? 2004 OLC A C9  1 
HETATM 5626 C  C11 . OLC F  3 .   ? 1.453   29.025  -1.980  1.00 69.96  ? 2004 OLC A C11 1 
HETATM 5627 C  C8  . OLC F  3 .   ? 3.263   31.074  -0.591  1.00 63.80  ? 2004 OLC A C8  1 
HETATM 5628 C  C12 . OLC F  3 .   ? 1.467   28.188  -3.257  1.00 72.67  ? 2004 OLC A C12 1 
HETATM 5629 C  C7  . OLC F  3 .   ? 4.591   31.798  -0.789  1.00 60.33  ? 2004 OLC A C7  1 
HETATM 5630 C  C13 . OLC F  3 .   ? 0.511   28.751  -4.310  1.00 74.49  ? 2004 OLC A C13 1 
HETATM 5631 C  C6  . OLC F  3 .   ? 4.509   33.237  -0.286  1.00 55.77  ? 2004 OLC A C6  1 
HETATM 5632 C  C14 . OLC F  3 .   ? -0.008  27.651  -5.245  1.00 74.29  ? 2004 OLC A C14 1 
HETATM 5633 C  C5  . OLC F  3 .   ? 5.325   33.351  1.005   1.00 57.12  ? 2004 OLC A C5  1 
HETATM 5634 C  C4  . OLC F  3 .   ? 5.260   34.774  1.564   1.00 59.27  ? 2004 OLC A C4  1 
HETATM 5635 C  C10 . OLC G  3 .   ? 12.027  38.291  -11.104 1.00 77.98  ? 2005 OLC A C10 1 
HETATM 5636 C  C9  . OLC G  3 .   ? 11.912  38.056  -12.403 1.00 77.07  ? 2005 OLC A C9  1 
HETATM 5637 C  C11 . OLC G  3 .   ? 12.656  37.379  -10.043 1.00 78.78  ? 2005 OLC A C11 1 
HETATM 5638 C  C8  . OLC G  3 .   ? 12.375  36.792  -13.128 1.00 77.33  ? 2005 OLC A C8  1 
HETATM 5639 C  C12 . OLC G  3 .   ? 13.090  38.255  -8.854  1.00 78.34  ? 2005 OLC A C12 1 
HETATM 5640 C  C7  . OLC G  3 .   ? 11.272  36.316  -14.075 1.00 77.29  ? 2005 OLC A C7  1 
HETATM 5641 C  C13 . OLC G  3 .   ? 13.651  37.411  -7.706  1.00 77.49  ? 2005 OLC A C13 1 
HETATM 5642 C  C6  . OLC G  3 .   ? 11.470  36.886  -15.480 1.00 77.15  ? 2005 OLC A C6  1 
HETATM 5643 C  C18 . OLC H  3 .   ? -8.432  18.743  -7.426  1.00 91.03  ? 2006 OLC A C18 1 
HETATM 5644 C  C10 . OLC H  3 .   ? -10.915 14.949  0.862   1.00 97.76  ? 2006 OLC A C10 1 
HETATM 5645 C  C9  . OLC H  3 .   ? -11.272 14.774  2.135   1.00 96.36  ? 2006 OLC A C9  1 
HETATM 5646 C  C17 . OLC H  3 .   ? -8.479  19.493  -6.095  1.00 92.61  ? 2006 OLC A C17 1 
HETATM 5647 C  C11 . OLC H  3 .   ? -10.603 16.298  0.193   1.00 97.33  ? 2006 OLC A C11 1 
HETATM 5648 C  C8  . OLC H  3 .   ? -11.432 15.890  3.173   1.00 94.36  ? 2006 OLC A C8  1 
HETATM 5649 C  C16 . OLC H  3 .   ? -9.320  18.694  -5.098  1.00 94.74  ? 2006 OLC A C16 1 
HETATM 5650 C  C12 . OLC H  3 .   ? -9.641  16.099  -0.980  1.00 96.19  ? 2006 OLC A C12 1 
HETATM 5651 C  C7  . OLC H  3 .   ? -12.544 15.529  4.156   1.00 93.51  ? 2006 OLC A C7  1 
HETATM 5652 C  C15 . OLC H  3 .   ? -8.620  18.596  -3.738  1.00 96.44  ? 2006 OLC A C15 1 
HETATM 5653 C  C13 . OLC H  3 .   ? -9.317  17.454  -1.609  1.00 96.21  ? 2006 OLC A C13 1 
HETATM 5654 C  C14 . OLC H  3 .   ? -8.920  17.247  -3.073  1.00 97.00  ? 2006 OLC A C14 1 
HETATM 5655 C  C9  . OLC I  3 .   ? -0.087  -0.812  -12.604 1.00 89.26  ? 2007 OLC A C9  1 
HETATM 5656 C  C8  . OLC I  3 .   ? -0.386  0.122   -13.776 1.00 88.73  ? 2007 OLC A C8  1 
HETATM 5657 C  C24 . OLC I  3 .   ? 2.579   -1.408  -25.235 1.00 118.92 ? 2007 OLC A C24 1 
HETATM 5658 C  C7  . OLC I  3 .   ? -0.470  -0.688  -15.074 1.00 87.50  ? 2007 OLC A C7  1 
HETATM 5659 C  C6  . OLC I  3 .   ? 0.584   -0.233  -16.088 1.00 84.95  ? 2007 OLC A C6  1 
HETATM 5660 C  C5  . OLC I  3 .   ? -0.079  0.124   -17.420 1.00 84.17  ? 2007 OLC A C5  1 
HETATM 5661 C  C4  . OLC I  3 .   ? 0.177   -0.967  -18.458 1.00 86.24  ? 2007 OLC A C4  1 
HETATM 5662 C  C3  . OLC I  3 .   ? 0.906   -0.358  -19.648 1.00 90.63  ? 2007 OLC A C3  1 
HETATM 5663 C  C2  . OLC I  3 .   ? 0.203   -0.744  -20.944 1.00 96.51  ? 2007 OLC A C2  1 
HETATM 5664 C  C21 . OLC I  3 .   ? 0.448   -0.725  -24.085 1.00 113.74 ? 2007 OLC A C21 1 
HETATM 5665 C  C1  . OLC I  3 .   ? 0.232   0.407   -21.966 1.00 103.22 ? 2007 OLC A C1  1 
HETATM 5666 C  C22 . OLC I  3 .   ? 1.248   -0.664  -25.391 1.00 117.33 ? 2007 OLC A C22 1 
HETATM 5667 O  O19 . OLC I  3 .   ? -0.326  1.439   -21.737 1.00 102.04 ? 2007 OLC A O19 1 
HETATM 5668 O  O25 . OLC I  3 .   ? 3.584   -0.798  -26.005 1.00 119.56 ? 2007 OLC A O25 1 
HETATM 5669 O  O23 . OLC I  3 .   ? 0.498   -1.249  -26.424 1.00 118.10 ? 2007 OLC A O23 1 
HETATM 5670 O  O20 . OLC I  3 .   ? 0.919   0.263   -23.157 1.00 109.74 ? 2007 OLC A O20 1 
HETATM 5671 C  C10 . OLC J  3 .   ? 2.798   25.012  -12.334 1.00 81.26  ? 2008 OLC A C10 1 
HETATM 5672 C  C9  . OLC J  3 .   ? 2.175   24.294  -13.270 1.00 81.09  ? 2008 OLC A C9  1 
HETATM 5673 C  C11 . OLC J  3 .   ? 2.208   26.191  -11.551 1.00 80.00  ? 2008 OLC A C11 1 
HETATM 5674 C  C8  . OLC J  3 .   ? 0.739   24.497  -13.773 1.00 80.02  ? 2008 OLC A C8  1 
HETATM 5675 C  C12 . OLC J  3 .   ? 3.110   26.506  -10.358 1.00 79.51  ? 2008 OLC A C12 1 
HETATM 5676 C  C7  . OLC J  3 .   ? 0.521   23.671  -15.046 1.00 78.16  ? 2008 OLC A C7  1 
HETATM 5677 C  C13 . OLC J  3 .   ? 2.488   27.591  -9.478  1.00 78.92  ? 2008 OLC A C13 1 
HETATM 5678 C  C6  . OLC J  3 .   ? -0.537  24.346  -15.916 1.00 75.29  ? 2008 OLC A C6  1 
HETATM 5679 C  C14 . OLC J  3 .   ? 3.554   28.276  -8.626  1.00 76.62  ? 2008 OLC A C14 1 
HETATM 5680 C  C8  . OLC K  3 .   ? -1.184  -0.204  3.923   1.00 70.21  ? 2009 OLC A C8  1 
HETATM 5681 C  C7  . OLC K  3 .   ? -1.442  0.797   5.047   1.00 70.47  ? 2009 OLC A C7  1 
HETATM 5682 C  C6  . OLC K  3 .   ? -1.194  0.111   6.387   1.00 71.23  ? 2009 OLC A C6  1 
HETATM 5683 C  C5  . OLC K  3 .   ? -2.239  0.546   7.406   1.00 73.02  ? 2009 OLC A C5  1 
HETATM 5684 C  C4  . OLC K  3 .   ? -1.707  1.733   8.206   1.00 75.62  ? 2009 OLC A C4  1 
HETATM 5685 C  C3  . OLC K  3 .   ? -2.376  1.767   9.578   1.00 78.72  ? 2009 OLC A C3  1 
HETATM 5686 C  C2  . OLC K  3 .   ? -1.380  1.336   10.657  1.00 80.19  ? 2009 OLC A C2  1 
HETATM 5687 C  C1  . OLA L  4 .   ? -7.129  26.818  9.632   1.00 109.39 ? 2010 OLA A C1  1 
HETATM 5688 O  O1  . OLA L  4 .   ? -7.040  28.003  9.230   1.00 110.03 ? 2010 OLA A O1  1 
HETATM 5689 O  O2  . OLA L  4 .   ? -6.128  26.086  9.826   1.00 109.80 ? 2010 OLA A O2  1 
HETATM 5690 C  C2  . OLA L  4 .   ? -8.507  26.246  9.913   1.00 106.64 ? 2010 OLA A C2  1 
HETATM 5691 C  C3  . OLA L  4 .   ? -9.082  25.539  8.687   1.00 103.10 ? 2010 OLA A C3  1 
HETATM 5692 C  C4  . OLA L  4 .   ? -8.599  24.090  8.541   1.00 99.55  ? 2010 OLA A C4  1 
HETATM 5693 C  C5  . OLA L  4 .   ? -9.422  23.286  7.531   1.00 96.47  ? 2010 OLA A C5  1 
HETATM 5694 C  C6  . OLA L  4 .   ? -9.266  23.744  6.076   1.00 95.70  ? 2010 OLA A C6  1 
HETATM 5695 C  C7  . OLA L  4 .   ? -8.000  23.189  5.418   1.00 95.80  ? 2010 OLA A C7  1 
HETATM 5696 C  C8  . OLA L  4 .   ? -8.105  23.095  3.897   1.00 94.71  ? 2010 OLA A C8  1 
HETATM 5697 C  C9  . OLA L  4 .   ? -7.260  24.158  3.234   1.00 93.54  ? 2010 OLA A C9  1 
HETATM 5698 C  C1  . OLA M  4 .   ? 21.057  34.666  -18.405 1.00 120.51 ? 2011 OLA A C1  1 
HETATM 5699 O  O1  . OLA M  4 .   ? 20.640  33.667  -19.034 1.00 121.48 ? 2011 OLA A O1  1 
HETATM 5700 O  O2  . OLA M  4 .   ? 22.218  35.110  -18.559 1.00 120.06 ? 2011 OLA A O2  1 
HETATM 5701 C  C2  . OLA M  4 .   ? 20.151  35.356  -17.400 1.00 119.47 ? 2011 OLA A C2  1 
HETATM 5702 C  C3  . OLA M  4 .   ? 18.736  35.587  -17.936 1.00 118.19 ? 2011 OLA A C3  1 
HETATM 5703 C  C4  . OLA M  4 .   ? 17.733  35.868  -16.816 1.00 116.45 ? 2011 OLA A C4  1 
HETATM 5704 C  C5  . OLA M  4 .   ? 16.960  34.621  -16.383 1.00 114.33 ? 2011 OLA A C5  1 
HETATM 5705 C  C6  . OLA M  4 .   ? 17.405  34.172  -14.994 1.00 112.65 ? 2011 OLA A C6  1 
HETATM 5706 C  C7  . OLA M  4 .   ? 16.296  33.430  -14.260 1.00 110.28 ? 2011 OLA A C7  1 
HETATM 5707 C  C8  . OLA M  4 .   ? 16.022  34.023  -12.881 1.00 107.88 ? 2011 OLA A C8  1 
HETATM 5708 C  C9  . OLA M  4 .   ? 14.695  33.502  -12.361 1.00 105.50 ? 2011 OLA A C9  1 
HETATM 5709 C  C10 . OLA M  4 .   ? 14.423  33.248  -11.075 1.00 103.38 ? 2011 OLA A C10 1 
HETATM 5710 C  C11 . OLA M  4 .   ? 15.399  33.438  -9.933  1.00 102.14 ? 2011 OLA A C11 1 
HETATM 5711 C  C1  . OLA N  4 .   ? -15.373 16.254  12.378  1.00 98.49  ? 2012 OLA A C1  1 
HETATM 5712 O  O1  . OLA N  4 .   ? -15.925 17.328  12.738  1.00 97.81  ? 2012 OLA A O1  1 
HETATM 5713 O  O2  . OLA N  4 .   ? -14.243 15.887  12.795  1.00 100.73 ? 2012 OLA A O2  1 
HETATM 5714 C  C2  . OLA N  4 .   ? -16.113 15.344  11.414  1.00 93.86  ? 2012 OLA A C2  1 
HETATM 5715 C  C3  . OLA N  4 .   ? -15.663 15.577  9.978   1.00 88.60  ? 2012 OLA A C3  1 
HETATM 5716 C  C4  . OLA N  4 .   ? -14.697 14.486  9.557   1.00 85.99  ? 2012 OLA A C4  1 
HETATM 5717 C  C5  . OLA N  4 .   ? -15.226 13.752  8.335   1.00 86.33  ? 2012 OLA A C5  1 
HETATM 5718 C  C6  . OLA N  4 .   ? -14.434 14.106  7.081   1.00 85.92  ? 2012 OLA A C6  1 
HETATM 5719 C  C1  . OLA O  4 .   ? 16.250  15.890  10.894  1.00 98.33  ? 2013 OLA A C1  1 
HETATM 5720 O  O1  . OLA O  4 .   ? 16.416  14.832  10.219  1.00 97.33  ? 2013 OLA A O1  1 
HETATM 5721 O  O2  . OLA O  4 .   ? 15.220  16.107  11.574  1.00 99.64  ? 2013 OLA A O2  1 
HETATM 5722 C  C2  . OLA O  4 .   ? 17.340  16.952  10.920  1.00 95.08  ? 2013 OLA A C2  1 
HETATM 5723 C  C3  . OLA O  4 .   ? 16.902  18.254  10.246  1.00 90.70  ? 2013 OLA A C3  1 
HETATM 5724 C  C4  . OLA O  4 .   ? 17.910  18.767  9.221   1.00 87.48  ? 2013 OLA A C4  1 
HETATM 5725 C  C5  . OLA O  4 .   ? 17.474  18.412  7.802   1.00 86.61  ? 2013 OLA A C5  1 
HETATM 5726 C  C6  . OLA O  4 .   ? 18.582  18.604  6.774   1.00 86.61  ? 2013 OLA A C6  1 
HETATM 5727 C  C7  . OLA O  4 .   ? 19.233  17.269  6.421   1.00 87.70  ? 2013 OLA A C7  1 
HETATM 5728 C  C8  . OLA O  4 .   ? 19.432  17.105  4.917   1.00 90.07  ? 2013 OLA A C8  1 
HETATM 5729 C  C9  . OLA O  4 .   ? 20.824  17.560  4.544   1.00 93.27  ? 2013 OLA A C9  1 
HETATM 5730 C  C10 . OLA O  4 .   ? 21.582  17.063  3.561   1.00 95.41  ? 2013 OLA A C10 1 
HETATM 5731 C  C11 . OLA O  4 .   ? 21.193  15.956  2.611   1.00 97.69  ? 2013 OLA A C11 1 
HETATM 5732 C  C12 . OLA O  4 .   ? 21.230  16.527  1.197   1.00 100.00 ? 2013 OLA A C12 1 
HETATM 5733 C  C13 . OLA O  4 .   ? 22.297  15.841  0.349   1.00 101.08 ? 2013 OLA A C13 1 
HETATM 5734 C  C14 . OLA O  4 .   ? 22.478  16.567  -0.979  1.00 101.55 ? 2013 OLA A C14 1 
HETATM 5735 C  C15 . OLA O  4 .   ? 22.286  15.630  -2.168  1.00 101.74 ? 2013 OLA A C15 1 
HETATM 5736 C  C16 . OLA O  4 .   ? 21.409  16.263  -3.242  1.00 101.99 ? 2013 OLA A C16 1 
HETATM 5737 C  C17 . OLA O  4 .   ? 22.230  17.014  -4.285  1.00 101.61 ? 2013 OLA A C17 1 
HETATM 5738 C  C1  . OLA P  4 .   ? 18.560  -3.116  -22.662 1.00 105.48 ? 2014 OLA A C1  1 
HETATM 5739 O  O1  . OLA P  4 .   ? 17.497  -2.586  -23.056 1.00 108.16 ? 2014 OLA A O1  1 
HETATM 5740 O  O2  . OLA P  4 .   ? 18.756  -4.351  -22.725 1.00 105.32 ? 2014 OLA A O2  1 
HETATM 5741 C  C2  . OLA P  4 .   ? 19.663  -2.228  -22.121 1.00 101.63 ? 2014 OLA A C2  1 
HETATM 5742 C  C3  . OLA P  4 .   ? 19.341  -1.703  -20.728 1.00 96.95  ? 2014 OLA A C3  1 
HETATM 5743 C  C4  . OLA P  4 .   ? 19.348  -0.184  -20.637 1.00 93.65  ? 2014 OLA A C4  1 
HETATM 5744 C  C5  . OLA P  4 .   ? 19.088  0.265   -19.205 1.00 92.34  ? 2014 OLA A C5  1 
HETATM 5745 C  C1  . OLA Q  4 .   ? 20.898  3.133   -17.525 1.00 92.50  ? 2015 OLA A C1  1 
HETATM 5746 O  O1  . OLA Q  4 .   ? 21.488  2.328   -18.271 1.00 94.08  ? 2015 OLA A O1  1 
HETATM 5747 O  O2  . OLA Q  4 .   ? 20.006  3.887   -17.975 1.00 94.44  ? 2015 OLA A O2  1 
HETATM 5748 C  C2  . OLA Q  4 .   ? 21.308  3.221   -16.061 1.00 88.32  ? 2015 OLA A C2  1 
HETATM 5749 C  C3  . OLA Q  4 .   ? 20.820  2.025   -15.241 1.00 83.72  ? 2015 OLA A C3  1 
HETATM 5750 C  C4  . OLA Q  4 .   ? 21.500  1.938   -13.876 1.00 79.31  ? 2015 OLA A C4  1 
HETATM 5751 C  C5  . OLA Q  4 .   ? 20.627  1.224   -12.852 1.00 76.86  ? 2015 OLA A C5  1 
HETATM 5752 C  C1  . OLA R  4 .   ? 8.854   -4.804  -19.488 1.00 109.36 ? 2016 OLA A C1  1 
HETATM 5753 O  O1  . OLA R  4 .   ? 8.155   -4.588  -20.505 1.00 110.32 ? 2016 OLA A O1  1 
HETATM 5754 O  O2  . OLA R  4 .   ? 9.773   -5.658  -19.460 1.00 110.37 ? 2016 OLA A O2  1 
HETATM 5755 C  C2  . OLA R  4 .   ? 8.574   -3.994  -18.241 1.00 105.92 ? 2016 OLA A C2  1 
HETATM 5756 C  C3  . OLA R  4 .   ? 7.678   -4.778  -17.294 1.00 102.35 ? 2016 OLA A C3  1 
HETATM 5757 C  C4  . OLA R  4 .   ? 8.502   -5.312  -16.133 1.00 100.32 ? 2016 OLA A C4  1 
HETATM 5758 C  C5  . OLA R  4 .   ? 7.645   -6.176  -15.217 1.00 99.14  ? 2016 OLA A C5  1 
HETATM 5759 C  C6  . OLA R  4 .   ? 7.538   -5.573  -13.822 1.00 97.11  ? 2016 OLA A C6  1 
HETATM 5760 C  C7  . OLA R  4 .   ? 6.096   -5.649  -13.345 1.00 94.95  ? 2016 OLA A C7  1 
HETATM 5761 C  C8  . OLA R  4 .   ? 5.905   -4.806  -12.094 1.00 93.97  ? 2016 OLA A C8  1 
HETATM 5762 C  C9  . OLA R  4 .   ? 5.534   -5.725  -10.950 1.00 93.71  ? 2016 OLA A C9  1 
HETATM 5763 C  C10 . OLA R  4 .   ? 5.977   -5.577  -9.694  1.00 93.06  ? 2016 OLA A C10 1 
HETATM 5764 C  C11 . OLA R  4 .   ? 6.915   -4.474  -9.230  1.00 91.62  ? 2016 OLA A C11 1 
HETATM 5765 C  C12 . OLA R  4 .   ? 6.641   -4.210  -7.754  1.00 91.09  ? 2016 OLA A C12 1 
HETATM 5766 C  C13 . OLA R  4 .   ? 7.848   -3.645  -7.019  1.00 88.98  ? 2016 OLA A C13 1 
HETATM 5767 C  C14 . OLA R  4 .   ? 7.835   -4.099  -5.564  1.00 88.58  ? 2016 OLA A C14 1 
HETATM 5768 C  C15 . OLA R  4 .   ? 8.952   -5.110  -5.322  1.00 90.85  ? 2016 OLA A C15 1 
HETATM 5769 C  C16 . OLA R  4 .   ? 10.174  -4.473  -4.654  1.00 90.70  ? 2016 OLA A C16 1 
HETATM 5770 C  C17 . OLA R  4 .   ? 11.463  -5.184  -5.043  1.00 89.15  ? 2016 OLA A C17 1 
HETATM 5771 C  C18 . OLA R  4 .   ? 12.597  -4.185  -5.058  1.00 88.81  ? 2016 OLA A C18 1 
HETATM 5772 C  C1  . OLA S  4 .   ? -10.873 1.397   10.950  1.00 113.49 ? 2017 OLA A C1  1 
HETATM 5773 O  O1  . OLA S  4 .   ? -11.005 2.632   10.788  1.00 114.54 ? 2017 OLA A O1  1 
HETATM 5774 O  O2  . OLA S  4 .   ? -10.536 0.893   12.046  1.00 114.39 ? 2017 OLA A O2  1 
HETATM 5775 C  C2  . OLA S  4 .   ? -11.152 0.482   9.778   1.00 111.10 ? 2017 OLA A C2  1 
HETATM 5776 C  C3  . OLA S  4 .   ? -9.855  -0.039  9.163   1.00 109.97 ? 2017 OLA A C3  1 
HETATM 5777 C  C4  . OLA S  4 .   ? -9.730  0.393   7.706   1.00 108.98 ? 2017 OLA A C4  1 
HETATM 5778 C  C5  . OLA S  4 .   ? -8.972  -0.613  6.843   1.00 107.45 ? 2017 OLA A C5  1 
HETATM 5779 C  C6  . OLA S  4 .   ? -9.702  -0.806  5.512   1.00 106.34 ? 2017 OLA A C6  1 
HETATM 5780 C  C7  . OLA S  4 .   ? -8.954  -0.204  4.323   1.00 103.71 ? 2017 OLA A C7  1 
HETATM 5781 C  C8  . OLA S  4 .   ? -9.919  0.250   3.234   1.00 101.26 ? 2017 OLA A C8  1 
HETATM 5782 C  C9  . OLA S  4 .   ? -9.127  0.753   2.045   1.00 100.12 ? 2017 OLA A C9  1 
HETATM 5783 C  C10 . OLA S  4 .   ? -9.525  1.715   1.203   1.00 99.44  ? 2017 OLA A C10 1 
HETATM 5784 C  C11 . OLA S  4 .   ? -10.841 2.458   1.302   1.00 99.20  ? 2017 OLA A C11 1 
HETATM 5785 C  C7  . OLA T  4 .   ? 6.665   4.571   8.783   1.00 72.27  ? 2018 OLA A C7  1 
HETATM 5786 C  C8  . OLA T  4 .   ? 6.549   4.542   7.259   1.00 72.83  ? 2018 OLA A C8  1 
HETATM 5787 C  C9  . OLA T  4 .   ? 7.668   5.368   6.648   1.00 72.59  ? 2018 OLA A C9  1 
HETATM 5788 C  C10 . OLA T  4 .   ? 7.821   5.605   5.339   1.00 70.51  ? 2018 OLA A C10 1 
HETATM 5789 C  C11 . OLA T  4 .   ? 6.890   5.081   4.269   1.00 69.17  ? 2018 OLA A C11 1 
HETATM 5790 C  C12 . OLA T  4 .   ? 7.707   4.824   3.012   1.00 69.16  ? 2018 OLA A C12 1 
HETATM 5791 C  C1  . OLA U  4 .   ? -6.850  8.432   -17.593 1.00 120.07 ? 2019 OLA A C1  1 
HETATM 5792 O  O1  . OLA U  4 .   ? -5.892  8.024   -18.290 1.00 120.18 ? 2019 OLA A O1  1 
HETATM 5793 O  O2  . OLA U  4 .   ? -7.893  8.924   -18.096 1.00 121.18 ? 2019 OLA A O2  1 
HETATM 5794 C  C2  . OLA U  4 .   ? -6.747  8.287   -16.086 1.00 117.17 ? 2019 OLA A C2  1 
HETATM 5795 C  C3  . OLA U  4 .   ? -6.697  9.627   -15.351 1.00 114.43 ? 2019 OLA A C3  1 
HETATM 5796 C  C4  . OLA U  4 .   ? -7.622  9.645   -14.132 1.00 111.28 ? 2019 OLA A C4  1 
HETATM 5797 C  C5  . OLA U  4 .   ? -6.921  9.200   -12.848 1.00 107.93 ? 2019 OLA A C5  1 
HETATM 5798 C  C6  . OLA U  4 .   ? -7.881  9.166   -11.660 1.00 104.57 ? 2019 OLA A C6  1 
HETATM 5799 C  C7  . OLA U  4 .   ? -7.321  8.342   -10.503 1.00 100.75 ? 2019 OLA A C7  1 
HETATM 5800 C  C8  . OLA U  4 .   ? -7.772  8.862   -9.140  1.00 98.38  ? 2019 OLA A C8  1 
HETATM 5801 C  C9  . OLA U  4 .   ? -7.178  7.966   -8.068  1.00 97.87  ? 2019 OLA A C9  1 
HETATM 5802 C  C10 . OLA U  4 .   ? -7.386  8.059   -6.746  1.00 97.50  ? 2019 OLA A C10 1 
HETATM 5803 C  C11 . OLA U  4 .   ? -8.259  9.092   -6.070  1.00 97.72  ? 2019 OLA A C11 1 
HETATM 5804 C  C12 . OLA U  4 .   ? -8.511  8.674   -4.626  1.00 98.65  ? 2019 OLA A C12 1 
HETATM 5805 C  C13 . OLA U  4 .   ? -8.409  9.863   -3.675  1.00 101.02 ? 2019 OLA A C13 1 
HETATM 5806 C  C14 . OLA U  4 .   ? -9.782  10.426  -3.297  1.00 103.67 ? 2019 OLA A C14 1 
HETATM 5807 C  C15 . OLA U  4 .   ? -9.682  11.532  -2.244  1.00 104.34 ? 2019 OLA A C15 1 
HETATM 5808 C  C16 . OLA U  4 .   ? -10.168 11.082  -0.864  1.00 104.62 ? 2019 OLA A C16 1 
HETATM 5809 C  C17 . OLA U  4 .   ? -9.015  10.684  0.060   1.00 104.10 ? 2019 OLA A C17 1 
HETATM 5810 C  C18 . OLA U  4 .   ? -9.427  9.631   1.067   1.00 103.29 ? 2019 OLA A C18 1 
HETATM 5811 C  C1  . OLA V  4 .   ? -21.153 14.877  11.043  1.00 91.55  ? 2020 OLA A C1  1 
HETATM 5812 O  O1  . OLA V  4 .   ? -20.112 15.579  11.134  1.00 91.00  ? 2020 OLA A O1  1 
HETATM 5813 O  O2  . OLA V  4 .   ? -21.872 14.621  12.046  1.00 93.89  ? 2020 OLA A O2  1 
HETATM 5814 C  C2  . OLA V  4 .   ? -21.609 14.317  9.697   1.00 86.61  ? 2020 OLA A C2  1 
HETATM 5815 C  C3  . OLA V  4 .   ? -20.591 14.426  8.561   1.00 81.10  ? 2020 OLA A C3  1 
HETATM 5816 C  C4  . OLA V  4 .   ? -21.096 13.754  7.292   1.00 77.04  ? 2020 OLA A C4  1 
HETATM 5817 C  C5  . OLA V  4 .   ? -20.102 13.968  6.154   1.00 75.07  ? 2020 OLA A C5  1 
HETATM 5818 C  C6  . OLA V  4 .   ? -19.768 12.679  5.410   1.00 73.37  ? 2020 OLA A C6  1 
HETATM 5819 C  C7  . OLA V  4 .   ? -18.440 12.817  4.666   1.00 75.65  ? 2020 OLA A C7  1 
HETATM 5820 C  C8  . OLA V  4 .   ? -17.810 11.468  4.308   1.00 77.21  ? 2020 OLA A C8  1 
HETATM 5821 C  C9  . OLA V  4 .   ? -16.667 11.646  3.317   1.00 77.96  ? 2020 OLA A C9  1 
HETATM 5822 C  C10 . OLA V  4 .   ? -16.003 10.653  2.696   1.00 78.09  ? 2020 OLA A C10 1 
HETATM 5823 C  C11 . OLA V  4 .   ? -16.289 9.173   2.873   1.00 79.55  ? 2020 OLA A C11 1 
HETATM 5824 C  C12 . OLA V  4 .   ? -15.024 8.337   2.665   1.00 81.15  ? 2020 OLA A C12 1 
HETATM 5825 O  OH2 . 1PE W  5 .   ? -21.524 7.618   18.494  1.00 111.78 ? 2021 1PE A OH2 1 
HETATM 5826 C  C12 . 1PE W  5 .   ? -20.690 6.616   17.899  1.00 111.77 ? 2021 1PE A C12 1 
HETATM 5827 C  C22 . 1PE W  5 .   ? -21.323 6.089   16.615  1.00 111.64 ? 2021 1PE A C22 1 
HETATM 5828 O  OH3 . 1PE W  5 .   ? -20.436 6.320   15.523  1.00 111.91 ? 2021 1PE A OH3 1 
HETATM 5829 C  C13 . 1PE W  5 .   ? -19.550 5.395   13.471  1.00 114.55 ? 2021 1PE A C13 1 
HETATM 5830 C  C23 . 1PE W  5 .   ? -20.762 5.506   14.397  1.00 113.16 ? 2021 1PE A C23 1 
HETATM 5831 O  OH4 . 1PE W  5 .   ? -19.899 5.746   12.129  1.00 114.74 ? 2021 1PE A OH4 1 
HETATM 5832 C  C14 . 1PE W  5 .   ? -20.278 5.013   9.843   1.00 112.74 ? 2021 1PE A C14 1 
HETATM 5833 C  C24 . 1PE W  5 .   ? -19.772 4.639   11.232  1.00 113.87 ? 2021 1PE A C24 1 
HETATM 5834 O  OH5 . 1PE W  5 .   ? -21.674 4.739   9.736   1.00 112.47 ? 2021 1PE A OH5 1 
HETATM 5835 NA NA  . NA  X  6 .   ? 7.979   18.932  -1.502  1.00 54.98  1 2022 NA  A NA  1 
HETATM 5836 C  C11 . ZLK Y  2 .   ? -15.101 -6.394  -14.353 1.00 57.85  ? 2001 ZLK B C11 1 
HETATM 5837 C  C01 . ZLK Y  2 .   ? -12.912 -10.077 -12.602 1.00 48.42  ? 2001 ZLK B C01 1 
HETATM 5838 C  C03 . ZLK Y  2 .   ? -12.395 -9.125  -14.785 1.00 49.96  ? 2001 ZLK B C03 1 
HETATM 5839 C  C04 . ZLK Y  2 .   ? -12.277 -8.015  -15.694 1.00 53.15  ? 2001 ZLK B C04 1 
HETATM 5840 C  C05 . ZLK Y  2 .   ? -12.654 -6.576  -15.249 1.00 55.44  ? 2001 ZLK B C05 1 
HETATM 5841 C  C06 . ZLK Y  2 .   ? -14.152 -6.401  -15.410 1.00 58.15  ? 2001 ZLK B C06 1 
HETATM 5842 C  C07 . ZLK Y  2 .   ? -14.811 -6.123  -16.605 1.00 60.79  ? 2001 ZLK B C07 1 
HETATM 5843 C  C09 . ZLK Y  2 .   ? -17.135 -5.672  -17.338 1.00 60.32  ? 2001 ZLK B C09 1 
HETATM 5844 C  C10 . ZLK Y  2 .   ? -16.325 -6.115  -14.958 1.00 60.54  ? 2001 ZLK B C10 1 
HETATM 5845 C  C12 . ZLK Y  2 .   ? -14.997 -6.542  -12.929 1.00 55.32  ? 2001 ZLK B C12 1 
HETATM 5846 C  C13 . ZLK Y  2 .   ? -16.140 -6.448  -12.142 1.00 55.51  ? 2001 ZLK B C13 1 
HETATM 5847 C  C15 . ZLK Y  2 .   ? -15.015 -7.093  -9.848  1.00 54.76  ? 2001 ZLK B C15 1 
HETATM 5848 C  C18 . ZLK Y  2 .   ? -14.276 -7.746  -7.585  1.00 52.39  ? 2001 ZLK B C18 1 
HETATM 5849 C  C19 . ZLK Y  2 .   ? -13.034 -6.750  -7.104  1.00 49.00  ? 2001 ZLK B C19 1 
HETATM 5850 C  C20 . ZLK Y  2 .   ? -13.414 -6.236  -5.894  1.00 50.49  ? 2001 ZLK B C20 1 
HETATM 5851 C  C21 . ZLK Y  2 .   ? -14.271 -7.406  -5.229  1.00 52.94  ? 2001 ZLK B C21 1 
HETATM 5852 C  C22 . ZLK Y  2 .   ? -14.926 -8.187  -6.458  1.00 51.66  ? 2001 ZLK B C22 1 
HETATM 5853 C  C23 . ZLK Y  2 .   ? -17.387 -6.182  -12.767 1.00 57.57  ? 2001 ZLK B C23 1 
HETATM 5854 C  C24 . ZLK Y  2 .   ? -17.487 -6.001  -14.152 1.00 59.37  ? 2001 ZLK B C24 1 
HETATM 5855 C  C25 . ZLK Y  2 .   ? -11.795 -8.158  -17.023 1.00 54.21  ? 2001 ZLK B C25 1 
HETATM 5856 C  C26 . ZLK Y  2 .   ? -11.422 -9.468  -17.468 1.00 55.63  ? 2001 ZLK B C26 1 
HETATM 5857 C  C27 . ZLK Y  2 .   ? -11.600 -10.586 -16.594 1.00 54.48  ? 2001 ZLK B C27 1 
HETATM 5858 C  C28 . ZLK Y  2 .   ? -12.021 -10.418 -15.258 1.00 50.26  ? 2001 ZLK B C28 1 
HETATM 5859 C  C29 . ZLK Y  2 .   ? -11.043 -11.973 -17.030 1.00 60.36  ? 2001 ZLK B C29 1 
HETATM 5860 C  C35 . ZLK Y  2 .   ? -8.462  -13.708 -18.416 1.00 61.52  ? 2001 ZLK B C35 1 
HETATM 5861 C  C36 . ZLK Y  2 .   ? -7.934  -14.699 -17.572 1.00 61.44  ? 2001 ZLK B C36 1 
HETATM 5862 C  C37 . ZLK Y  2 .   ? -6.569  -14.716 -17.247 1.00 60.20  ? 2001 ZLK B C37 1 
HETATM 5863 C  C38 . ZLK Y  2 .   ? -5.736  -13.719 -17.729 1.00 60.23  ? 2001 ZLK B C38 1 
HETATM 5864 C  C39 . ZLK Y  2 .   ? -6.245  -12.731 -18.562 1.00 60.30  ? 2001 ZLK B C39 1 
HETATM 5865 C  C40 . ZLK Y  2 .   ? -7.617  -12.712 -18.908 1.00 60.73  ? 2001 ZLK B C40 1 
HETATM 5866 C  C41 . ZLK Y  2 .   ? -8.109  -11.560 -19.850 1.00 59.83  ? 2001 ZLK B C41 1 
HETATM 5867 N  N08 . ZLK Y  2 .   ? -16.117 -5.987  -16.321 1.00 61.45  ? 2001 ZLK B N08 1 
HETATM 5868 N  N14 . ZLK Y  2 .   ? -16.141 -6.644  -10.678 1.00 54.37  ? 2001 ZLK B N14 1 
HETATM 5869 N  N31 . ZLK Y  2 .   ? -10.969 -12.310 -18.443 1.00 62.06  ? 2001 ZLK B N31 1 
HETATM 5870 O  O02 . ZLK Y  2 .   ? -12.832 -8.947  -13.459 1.00 49.47  ? 2001 ZLK B O02 1 
HETATM 5871 O  O16 . ZLK Y  2 .   ? -14.006 -7.442  -10.356 1.00 54.74  ? 2001 ZLK B O16 1 
HETATM 5872 O  O17 . ZLK Y  2 .   ? -15.189 -7.053  -8.434  1.00 56.39  ? 2001 ZLK B O17 1 
HETATM 5873 O  O30 . ZLK Y  2 .   ? -10.572 -12.685 -16.211 1.00 63.16  ? 2001 ZLK B O30 1 
HETATM 5874 O  O33 . ZLK Y  2 .   ? -10.414 -14.143 -20.225 1.00 63.53  ? 2001 ZLK B O33 1 
HETATM 5875 O  O34 . ZLK Y  2 .   ? -10.887 -14.856 -18.081 1.00 60.38  ? 2001 ZLK B O34 1 
HETATM 5876 S  S32 . ZLK Y  2 .   ? -10.229 -13.793 -18.821 1.00 61.96  ? 2001 ZLK B S32 1 
HETATM 5877 C  C9  . OLC Z  3 .   ? -15.094 -4.155  2.071   1.00 79.38  ? 2002 OLC B C9  1 
HETATM 5878 C  C8  . OLC Z  3 .   ? -15.485 -5.116  3.195   1.00 80.34  ? 2002 OLC B C8  1 
HETATM 5879 C  C7  . OLC Z  3 .   ? -15.363 -4.445  4.564   1.00 81.12  ? 2002 OLC B C7  1 
HETATM 5880 C  C6  . OLC Z  3 .   ? -16.625 -4.716  5.390   1.00 82.63  ? 2002 OLC B C6  1 
HETATM 5881 C  C5  . OLC Z  3 .   ? -16.451 -4.177  6.816   1.00 82.89  ? 2002 OLC B C5  1 
HETATM 5882 C  C4  . OLC Z  3 .   ? -17.612 -4.644  7.699   1.00 81.61  ? 2002 OLC B C4  1 
HETATM 5883 C  C3  . OLC Z  3 .   ? -17.651 -3.858  9.014   1.00 80.98  ? 2002 OLC B C3  1 
HETATM 5884 C  C2  . OLC Z  3 .   ? -18.935 -4.181  9.782   1.00 80.22  ? 2002 OLC B C2  1 
HETATM 5885 C  C10 . OLC AA 3 .   ? -22.736 -18.291 -0.453  1.00 97.25  ? 2003 OLC B C10 1 
HETATM 5886 C  C9  . OLC AA 3 .   ? -22.271 -18.548 0.763   1.00 97.63  ? 2003 OLC B C9  1 
HETATM 5887 C  C11 . OLC AA 3 .   ? -23.882 -17.314 -0.753  1.00 96.33  ? 2003 OLC B C11 1 
HETATM 5888 C  C8  . OLC AA 3 .   ? -22.818 -17.905 2.045   1.00 97.62  ? 2003 OLC B C8  1 
HETATM 5889 C  C7  . OLC AA 3 .   ? -21.679 -17.556 3.004   1.00 96.08  ? 2003 OLC B C7  1 
HETATM 5890 C  C6  . OLC AA 3 .   ? -21.782 -18.415 4.266   1.00 95.44  ? 2003 OLC B C6  1 
HETATM 5891 C  C5  . OLC AA 3 .   ? -20.846 -17.883 5.352   1.00 95.54  ? 2003 OLC B C5  1 
HETATM 5892 C  C4  . OLC AA 3 .   ? -19.831 -18.963 5.739   1.00 95.44  ? 2003 OLC B C4  1 
HETATM 5893 C  C3  . OLC AA 3 .   ? -19.545 -18.936 7.243   1.00 95.05  ? 2003 OLC B C3  1 
HETATM 5894 C  C10 . OLC BA 3 .   ? -2.733  -27.722 -9.394  1.00 90.68  ? 2004 OLC B C10 1 
HETATM 5895 C  C9  . OLC BA 3 .   ? -2.251  -26.952 -10.364 1.00 91.51  ? 2004 OLC B C9  1 
HETATM 5896 C  C11 . OLC BA 3 .   ? -1.950  -28.324 -8.222  1.00 88.98  ? 2004 OLC B C11 1 
HETATM 5897 C  C8  . OLC BA 3 .   ? -0.792  -26.511 -10.527 1.00 91.31  ? 2004 OLC B C8  1 
HETATM 5898 C  C12 . OLC BA 3 .   ? -2.874  -29.316 -7.514  1.00 88.37  ? 2004 OLC B C12 1 
HETATM 5899 C  C7  . OLC BA 3 .   ? -0.708  -25.478 -11.653 1.00 90.95  ? 2004 OLC B C7  1 
HETATM 5900 C  C13 . OLC BA 3 .   ? -2.528  -29.408 -6.028  1.00 87.57  ? 2004 OLC B C13 1 
HETATM 5901 C  C6  . OLC BA 3 .   ? 0.716   -25.458 -12.205 1.00 90.78  ? 2004 OLC B C6  1 
HETATM 5902 C  C5  . OLC BA 3 .   ? 0.713   -25.088 -13.688 1.00 89.40  ? 2004 OLC B C5  1 
HETATM 5903 C  C4  . OLC BA 3 .   ? 1.888   -25.795 -14.360 1.00 88.10  ? 2004 OLC B C4  1 
HETATM 5904 C  C10 . OLC CA 3 .   ? 4.705   -22.160 1.172   1.00 92.71  ? 2005 OLC B C10 1 
HETATM 5905 C  C9  . OLC CA 3 .   ? 5.397   -22.507 2.253   1.00 95.19  ? 2005 OLC B C9  1 
HETATM 5906 C  C11 . OLC CA 3 .   ? 3.408   -22.839 0.706   1.00 91.65  ? 2005 OLC B C11 1 
HETATM 5907 C  C8  . OLC CA 3 .   ? 5.018   -23.659 3.201   1.00 97.61  ? 2005 OLC B C8  1 
HETATM 5908 C  C12 . OLC CA 3 .   ? 3.702   -23.945 -0.307  1.00 90.72  ? 2005 OLC B C12 1 
HETATM 5909 C  C7  . OLC CA 3 .   ? 6.081   -23.838 4.288   1.00 97.95  ? 2005 OLC B C7  1 
HETATM 5910 C  C13 . OLC CA 3 .   ? 3.483   -23.438 -1.733  1.00 90.54  ? 2005 OLC B C13 1 
HETATM 5911 C  C6  . OLC CA 3 .   ? 5.497   -23.424 5.634   1.00 97.43  ? 2005 OLC B C6  1 
HETATM 5912 C  C5  . OLC CA 3 .   ? 6.571   -23.540 6.710   1.00 97.57  ? 2005 OLC B C5  1 
HETATM 5913 C  C4  . OLC CA 3 .   ? 6.771   -22.176 7.366   1.00 96.96  ? 2005 OLC B C4  1 
HETATM 5914 C  C10 . OLC DA 3 .   ? 4.839   -24.574 -12.292 1.00 114.70 ? 2006 OLC B C10 1 
HETATM 5915 C  C9  . OLC DA 3 .   ? 5.251   -24.425 -13.547 1.00 115.05 ? 2006 OLC B C9  1 
HETATM 5916 C  C11 . OLC DA 3 .   ? 3.853   -23.631 -11.582 1.00 113.03 ? 2006 OLC B C11 1 
HETATM 5917 C  C8  . OLC DA 3 .   ? 4.806   -23.284 -14.474 1.00 114.14 ? 2006 OLC B C8  1 
HETATM 5918 C  C12 . OLC DA 3 .   ? 4.271   -23.345 -10.134 1.00 112.23 ? 2006 OLC B C12 1 
HETATM 5919 C  C7  . OLC DA 3 .   ? 5.377   -23.475 -15.880 1.00 112.65 ? 2006 OLC B C7  1 
HETATM 5920 C  C13 . OLC DA 3 .   ? 3.873   -24.479 -9.182  1.00 111.95 ? 2006 OLC B C13 1 
HETATM 5921 C  C6  . OLC DA 3 .   ? 5.281   -22.159 -16.651 1.00 111.88 ? 2006 OLC B C6  1 
HETATM 5922 C  C14 . OLC DA 3 .   ? 2.509   -24.227 -8.530  1.00 111.81 ? 2006 OLC B C14 1 
HETATM 5923 C  C5  . OLC DA 3 .   ? 4.787   -22.433 -18.069 1.00 111.87 ? 2006 OLC B C5  1 
HETATM 5924 C  C10 . OLC EA 3 .   ? -9.483  -4.560  1.498   1.00 76.15  ? 2007 OLC B C10 1 
HETATM 5925 C  C9  . OLC EA 3 .   ? -9.629  -5.687  2.197   1.00 76.30  ? 2007 OLC B C9  1 
HETATM 5926 C  C11 . OLC EA 3 .   ? -10.276 -3.258  1.702   1.00 76.70  ? 2007 OLC B C11 1 
HETATM 5927 C  C8  . OLC EA 3 .   ? -10.640 -5.940  3.330   1.00 75.97  ? 2007 OLC B C8  1 
HETATM 5928 C  C12 . OLC EA 3 .   ? -10.628 -2.621  0.354   1.00 76.80  ? 2007 OLC B C12 1 
HETATM 5929 C  C7  . OLC EA 3 .   ? -9.899  -6.344  4.603   1.00 77.30  ? 2007 OLC B C7  1 
HETATM 5930 C  C13 . OLC EA 3 .   ? -12.129 -2.784  0.092   1.00 76.25  ? 2007 OLC B C13 1 
HETATM 5931 C  C6  . OLC EA 3 .   ? -9.748  -5.131  5.524   1.00 79.45  ? 2007 OLC B C6  1 
HETATM 5932 C  C5  . OLC EA 3 .   ? -9.748  -5.561  6.995   1.00 79.72  ? 2007 OLC B C5  1 
HETATM 5933 C  C4  . OLC EA 3 .   ? -10.816 -4.794  7.781   1.00 78.44  ? 2007 OLC B C4  1 
HETATM 5934 C  C9  . OLC FA 3 .   ? 7.298   -8.794  -6.101  1.00 85.61  ? 2008 OLC B C9  1 
HETATM 5935 C  C8  . OLC FA 3 .   ? 8.173   -9.748  -6.920  1.00 85.78  ? 2008 OLC B C8  1 
HETATM 5936 C  C7  . OLC FA 3 .   ? 8.298   -9.210  -8.345  1.00 85.25  ? 2008 OLC B C7  1 
HETATM 5937 C  C6  . OLC FA 3 .   ? 8.467   -10.355 -9.342  1.00 84.87  ? 2008 OLC B C6  1 
HETATM 5938 C  C5  . OLC FA 3 .   ? 7.848   -9.931  -10.674 1.00 84.60  ? 2008 OLC B C5  1 
HETATM 5939 C  C4  . OLC FA 3 .   ? 7.638   -11.138 -11.590 1.00 83.84  ? 2008 OLC B C4  1 
HETATM 5940 C  C3  . OLC FA 3 .   ? 6.858   -10.681 -12.822 1.00 83.44  ? 2008 OLC B C3  1 
HETATM 5941 C  C10 . OLC GA 3 .   ? 0.156   -6.397  -10.261 1.00 81.66  ? 2009 OLC B C10 1 
HETATM 5942 C  C9  . OLC GA 3 .   ? -0.352  -6.040  -11.429 1.00 81.82  ? 2009 OLC B C9  1 
HETATM 5943 C  C11 . OLC GA 3 .   ? 1.321   -5.662  -9.607  1.00 82.52  ? 2009 OLC B C11 1 
HETATM 5944 C  C8  . OLC GA 3 .   ? 0.157   -4.860  -12.260 1.00 81.57  ? 2009 OLC B C8  1 
HETATM 5945 C  C24 . OLC GA 3 .   ? 2.845   -5.169  -23.443 1.00 101.62 ? 2009 OLC B C24 1 
HETATM 5946 C  C16 . OLC GA 3 .   ? 2.942   -3.402  -4.758  1.00 81.34  ? 2009 OLC B C16 1 
HETATM 5947 C  C12 . OLC GA 3 .   ? 1.518   -6.179  -8.189  1.00 83.13  ? 2009 OLC B C12 1 
HETATM 5948 C  C7  . OLC GA 3 .   ? 0.742   -5.374  -13.570 1.00 82.32  ? 2009 OLC B C7  1 
HETATM 5949 C  C15 . OLC GA 3 .   ? 1.873   -4.401  -5.212  1.00 81.05  ? 2009 OLC B C15 1 
HETATM 5950 C  C13 . OLC GA 3 .   ? 2.520   -5.263  -7.492  1.00 83.07  ? 2009 OLC B C13 1 
HETATM 5951 C  C6  . OLC GA 3 .   ? 1.827   -4.394  -14.011 1.00 84.35  ? 2009 OLC B C6  1 
HETATM 5952 C  C14 . OLC GA 3 .   ? 2.533   -5.537  -5.989  1.00 82.09  ? 2009 OLC B C14 1 
HETATM 5953 C  C5  . OLC GA 3 .   ? 1.714   -4.154  -15.511 1.00 85.24  ? 2009 OLC B C5  1 
HETATM 5954 C  C4  . OLC GA 3 .   ? 3.033   -4.559  -16.153 1.00 85.81  ? 2009 OLC B C4  1 
HETATM 5955 C  C3  . OLC GA 3 .   ? 2.776   -4.890  -17.613 1.00 86.47  ? 2009 OLC B C3  1 
HETATM 5956 C  C2  . OLC GA 3 .   ? 4.094   -4.744  -18.363 1.00 89.63  ? 2009 OLC B C2  1 
HETATM 5957 C  C21 . OLC GA 3 .   ? 1.834   -4.524  -21.216 1.00 99.44  ? 2009 OLC B C21 1 
HETATM 5958 C  C1  . OLC GA 3 .   ? 3.883   -4.586  -19.869 1.00 93.96  ? 2009 OLC B C1  1 
HETATM 5959 C  C22 . OLC GA 3 .   ? 2.003   -4.131  -22.691 1.00 101.09 ? 2009 OLC B C22 1 
HETATM 5960 O  O19 . OLC GA 3 .   ? 4.717   -5.057  -20.579 1.00 93.43  ? 2009 OLC B O19 1 
HETATM 5961 O  O25 . OLC GA 3 .   ? 4.084   -4.636  -23.844 1.00 101.07 ? 2009 OLC B O25 1 
HETATM 5962 O  O23 . OLC GA 3 .   ? 0.749   -4.059  -23.311 1.00 101.83 ? 2009 OLC B O23 1 
HETATM 5963 O  O20 . OLC GA 3 .   ? 2.800   -3.867  -20.374 1.00 98.00  ? 2009 OLC B O20 1 
HETATM 5964 C  C5  . OLC HA 3 .   ? -10.644 5.208   -13.364 1.00 102.64 ? 2010 OLC B C5  1 
HETATM 5965 C  C4  . OLC HA 3 .   ? -11.303 6.582   -13.323 1.00 103.19 ? 2010 OLC B C4  1 
HETATM 5966 C  C3  . OLC HA 3 .   ? -10.676 7.480   -14.387 1.00 106.14 ? 2010 OLC B C3  1 
HETATM 5967 C  C2  . OLC HA 3 .   ? -11.770 8.166   -15.207 1.00 109.39 ? 2010 OLC B C2  1 
HETATM 5968 C  C1  . OLC HA 3 .   ? -11.759 7.701   -16.669 1.00 112.56 ? 2010 OLC B C1  1 
HETATM 5969 O  O19 . OLC HA 3 .   ? -11.407 8.574   -17.666 1.00 114.70 ? 2010 OLC B O19 1 
HETATM 5970 O  O20 . OLC HA 3 .   ? -12.065 6.592   -16.960 1.00 112.51 ? 2010 OLC B O20 1 
HETATM 5971 C  C1  . OLA IA 4 .   ? 3.069   -13.352 -16.545 1.00 103.16 ? 2011 OLA B C1  1 
HETATM 5972 O  O1  . OLA IA 4 .   ? 3.727   -12.763 -17.437 1.00 104.90 ? 2011 OLA B O1  1 
HETATM 5973 O  O2  . OLA IA 4 .   ? 2.317   -14.318 -16.800 1.00 103.92 ? 2011 OLA B O2  1 
HETATM 5974 C  C2  . OLA IA 4 .   ? 3.165   -12.878 -15.108 1.00 98.98  ? 2011 OLA B C2  1 
HETATM 5975 C  C3  . OLA IA 4 .   ? 4.409   -13.450 -14.435 1.00 95.80  ? 2011 OLA B C3  1 
HETATM 5976 C  C4  . OLA IA 4 .   ? 4.280   -13.428 -12.915 1.00 94.66  ? 2011 OLA B C4  1 
HETATM 5977 C  C5  . OLA IA 4 .   ? 4.895   -14.682 -12.303 1.00 94.67  ? 2011 OLA B C5  1 
HETATM 5978 C  C6  . OLA IA 4 .   ? 5.731   -14.419 -11.051 1.00 93.38  ? 2011 OLA B C6  1 
HETATM 5979 C  C7  . OLA IA 4 .   ? 6.025   -15.746 -10.355 1.00 92.32  ? 2011 OLA B C7  1 
HETATM 5980 C  C8  . OLA IA 4 .   ? 6.551   -15.557 -8.935  1.00 92.00  ? 2011 OLA B C8  1 
HETATM 5981 C  C9  . OLA IA 4 .   ? 6.709   -16.914 -8.283  1.00 91.32  ? 2011 OLA B C9  1 
HETATM 5982 C  C10 . OLA IA 4 .   ? 7.715   -17.165 -7.442  1.00 90.44  ? 2011 OLA B C10 1 
HETATM 5983 C  C1  . OLA JA 4 .   ? 11.874  -14.175 14.002  1.00 104.64 ? 2012 OLA B C1  1 
HETATM 5984 O  O1  . OLA JA 4 .   ? 11.168  -15.185 13.762  1.00 105.15 ? 2012 OLA B O1  1 
HETATM 5985 O  O2  . OLA JA 4 .   ? 12.620  -14.114 15.010  1.00 105.17 ? 2012 OLA B O2  1 
HETATM 5986 C  C2  . OLA JA 4 .   ? 11.816  -12.977 13.062  1.00 101.46 ? 2012 OLA B C2  1 
HETATM 5987 C  C3  . OLA JA 4 .   ? 12.429  -13.279 11.694  1.00 98.40  ? 2012 OLA B C3  1 
HETATM 5988 C  C4  . OLA JA 4 .   ? 11.399  -13.895 10.747  1.00 96.78  ? 2012 OLA B C4  1 
HETATM 5989 C  C5  . OLA JA 4 .   ? 11.935  -14.038 9.326   1.00 94.74  ? 2012 OLA B C5  1 
HETATM 5990 C  C6  . OLA JA 4 .   ? 11.210  -15.154 8.580   1.00 92.25  ? 2012 OLA B C6  1 
HETATM 5991 C  C7  . OLA JA 4 .   ? 11.027  -14.818 7.103   1.00 89.67  ? 2012 OLA B C7  1 
HETATM 5992 C  C8  . OLA JA 4 .   ? 9.562   -14.901 6.695   1.00 87.62  ? 2012 OLA B C8  1 
HETATM 5993 C  C1  . OLA KA 4 .   ? 4.549   -28.461 10.855  1.00 120.54 ? 2013 OLA B C1  1 
HETATM 5994 O  O1  . OLA KA 4 .   ? 5.387   -29.389 10.775  1.00 119.78 ? 2013 OLA B O1  1 
HETATM 5995 O  O2  . OLA KA 4 .   ? 4.869   -27.297 11.190  1.00 121.70 ? 2013 OLA B O2  1 
HETATM 5996 C  C2  . OLA KA 4 .   ? 3.088   -28.745 10.562  1.00 119.59 ? 2013 OLA B C2  1 
HETATM 5997 C  C3  . OLA KA 4 .   ? 2.858   -29.223 9.124   1.00 118.16 ? 2013 OLA B C3  1 
HETATM 5998 C  C4  . OLA KA 4 .   ? 1.637   -30.135 9.012   1.00 116.15 ? 2013 OLA B C4  1 
HETATM 5999 C  C5  . OLA KA 4 .   ? 1.807   -31.182 7.918   1.00 115.61 ? 2013 OLA B C5  1 
HETATM 6000 C  C6  . OLA KA 4 .   ? 0.962   -30.847 6.691   1.00 115.95 ? 2013 OLA B C6  1 
HETATM 6001 C  C7  . OLA KA 4 .   ? 0.887   -32.009 5.696   1.00 114.75 ? 2013 OLA B C7  1 
HETATM 6002 C  C8  . OLA KA 4 .   ? 0.408   -31.550 4.319   1.00 112.68 ? 2013 OLA B C8  1 
HETATM 6003 C  C9  . OLA KA 4 .   ? -1.100  -31.675 4.243   1.00 111.89 ? 2013 OLA B C9  1 
HETATM 6004 C  C10 . OLA KA 4 .   ? -1.864  -31.186 3.259   1.00 111.82 ? 2013 OLA B C10 1 
HETATM 6005 C  C11 . OLA KA 4 .   ? -1.353  -30.430 2.051   1.00 111.27 ? 2013 OLA B C11 1 
HETATM 6006 C  C12 . OLA KA 4 .   ? -2.485  -29.602 1.448   1.00 110.64 ? 2013 OLA B C12 1 
HETATM 6007 C  C13 . OLA KA 4 .   ? -2.793  -30.027 0.016   1.00 109.72 ? 2013 OLA B C13 1 
HETATM 6008 C  C14 . OLA KA 4 .   ? -2.167  -29.062 -0.988  1.00 109.05 ? 2013 OLA B C14 1 
HETATM 6009 C  C1  . OLA LA 4 .   ? 3.497   -17.562 -17.531 1.00 96.33  ? 2014 OLA B C1  1 
HETATM 6010 O  O1  . OLA LA 4 .   ? 3.298   -16.637 -18.350 1.00 97.40  ? 2014 OLA B O1  1 
HETATM 6011 O  O2  . OLA LA 4 .   ? 4.190   -18.565 -17.818 1.00 96.64  ? 2014 OLA B O2  1 
HETATM 6012 C  C2  . OLA LA 4 .   ? 2.870   -17.469 -16.153 1.00 93.83  ? 2014 OLA B C2  1 
HETATM 6013 C  C3  . OLA LA 4 .   ? 3.910   -17.171 -15.072 1.00 91.84  ? 2014 OLA B C3  1 
HETATM 6014 C  C4  . OLA LA 4 .   ? 3.579   -17.968 -13.812 1.00 90.39  ? 2014 OLA B C4  1 
HETATM 6015 C  C5  . OLA LA 4 .   ? 4.788   -18.301 -12.943 1.00 87.99  ? 2014 OLA B C5  1 
HETATM 6016 C  C6  . OLA LA 4 .   ? 4.517   -19.572 -12.147 1.00 87.82  ? 2014 OLA B C6  1 
HETATM 6017 C  C7  . OLA LA 4 .   ? 5.629   -19.862 -11.143 1.00 88.09  ? 2014 OLA B C7  1 
HETATM 6018 C  C1  . OLA MA 4 .   ? 7.650   -14.492 -19.198 1.00 110.82 ? 2015 OLA B C1  1 
HETATM 6019 O  O1  . OLA MA 4 .   ? 8.574   -14.758 -20.001 1.00 112.62 ? 2015 OLA B O1  1 
HETATM 6020 O  O2  . OLA MA 4 .   ? 6.440   -14.693 -19.478 1.00 110.33 ? 2015 OLA B O2  1 
HETATM 6021 C  C2  . OLA MA 4 .   ? 8.034   -13.890 -17.855 1.00 108.73 ? 2015 OLA B C2  1 
HETATM 6022 C  C3  . OLA MA 4 .   ? 7.394   -14.638 -16.681 1.00 106.09 ? 2015 OLA B C3  1 
HETATM 6023 C  C4  . OLA MA 4 .   ? 8.384   -14.969 -15.559 1.00 103.43 ? 2015 OLA B C4  1 
HETATM 6024 C  C5  . OLA MA 4 .   ? 9.194   -16.248 -15.808 1.00 101.66 ? 2015 OLA B C5  1 
HETATM 6025 C  C6  . OLA MA 4 .   ? 8.348   -17.521 -15.770 1.00 98.96  ? 2015 OLA B C6  1 
HETATM 6026 C  C7  . OLA MA 4 .   ? 9.197   -18.785 -15.778 1.00 96.15  ? 2015 OLA B C7  1 
HETATM 6027 C  C8  . OLA MA 4 .   ? 8.391   -19.974 -15.272 1.00 95.44  ? 2015 OLA B C8  1 
HETATM 6028 C  C9  . OLA MA 4 .   ? 8.619   -20.149 -13.787 1.00 95.58  ? 2015 OLA B C9  1 
HETATM 6029 C  C1  . OLA NA 4 .   ? -4.018  2.323   -23.346 1.00 106.15 ? 2016 OLA B C1  1 
HETATM 6030 O  O1  . OLA NA 4 .   ? -3.109  2.851   -24.040 1.00 106.94 ? 2016 OLA B O1  1 
HETATM 6031 O  O2  . OLA NA 4 .   ? -4.606  1.259   -23.683 1.00 106.66 ? 2016 OLA B O2  1 
HETATM 6032 C  C2  . OLA NA 4 .   ? -4.440  3.005   -22.053 1.00 102.44 ? 2016 OLA B C2  1 
HETATM 6033 C  C3  . OLA NA 4 .   ? -3.252  3.364   -21.156 1.00 97.60  ? 2016 OLA B C3  1 
HETATM 6034 C  C4  . OLA NA 4 .   ? -3.643  3.357   -19.682 1.00 93.55  ? 2016 OLA B C4  1 
HETATM 6035 C  C5  . OLA NA 4 .   ? -2.515  3.880   -18.797 1.00 89.90  ? 2016 OLA B C5  1 
HETATM 6036 C  C6  . OLA NA 4 .   ? -2.907  3.829   -17.326 1.00 87.38  ? 2016 OLA B C6  1 
HETATM 6037 C  C7  . OLA NA 4 .   ? -1.745  4.276   -16.453 1.00 87.34  ? 2016 OLA B C7  1 
HETATM 6038 C  C8  . OLA NA 4 .   ? -1.548  3.331   -15.274 1.00 87.16  ? 2016 OLA B C8  1 
HETATM 6039 C  C9  . OLA NA 4 .   ? -0.358  3.773   -14.445 1.00 87.23  ? 2016 OLA B C9  1 
HETATM 6040 C  C10 . OLA NA 4 .   ? -0.456  4.355   -13.240 1.00 88.13  ? 2016 OLA B C10 1 
HETATM 6041 C  C11 . OLA NA 4 .   ? -1.782  4.629   -12.547 1.00 88.60  ? 2016 OLA B C11 1 
HETATM 6042 C  C12 . OLA NA 4 .   ? -1.599  5.507   -11.310 1.00 85.81  ? 2016 OLA B C12 1 
HETATM 6043 C  C13 . OLA NA 4 .   ? -2.907  5.609   -10.532 1.00 81.95  ? 2016 OLA B C13 1 
HETATM 6044 C  C14 . OLA NA 4 .   ? -2.627  5.483   -9.046  1.00 80.00  ? 2016 OLA B C14 1 
HETATM 6045 C  C15 . OLA NA 4 .   ? -3.883  5.061   -8.309  1.00 80.60  ? 2016 OLA B C15 1 
HETATM 6046 C  C16 . OLA NA 4 .   ? -3.551  4.673   -6.870  1.00 81.70  ? 2016 OLA B C16 1 
HETATM 6047 C  C17 . OLA NA 4 .   ? -4.774  4.114   -6.142  1.00 82.48  ? 2016 OLA B C17 1 
HETATM 6048 C  C18 . OLA NA 4 .   ? -5.445  5.165   -5.283  1.00 82.12  ? 2016 OLA B C18 1 
HETATM 6049 C  C1  . OLA OA 4 .   ? -7.574  4.147   -20.482 1.00 112.24 ? 2017 OLA B C1  1 
HETATM 6050 O  O1  . OLA OA 4 .   ? -6.574  4.884   -20.335 1.00 114.92 ? 2017 OLA B O1  1 
HETATM 6051 O  O2  . OLA OA 4 .   ? -7.748  3.446   -21.502 1.00 112.42 ? 2017 OLA B O2  1 
HETATM 6052 C  C2  . OLA OA 4 .   ? -8.629  4.132   -19.399 1.00 108.82 ? 2017 OLA B C2  1 
HETATM 6053 C  C3  . OLA OA 4 .   ? -8.089  3.522   -18.112 1.00 106.17 ? 2017 OLA B C3  1 
HETATM 6054 C  C4  . OLA OA 4 .   ? -8.387  4.435   -16.932 1.00 104.66 ? 2017 OLA B C4  1 
HETATM 6055 C  C5  . OLA OA 4 .   ? -7.099  4.740   -16.183 1.00 103.92 ? 2017 OLA B C5  1 
HETATM 6056 C  C6  . OLA OA 4 .   ? -7.263  4.549   -14.680 1.00 102.59 ? 2017 OLA B C6  1 
HETATM 6057 C  C7  . OLA OA 4 .   ? -5.914  4.407   -13.973 1.00 100.34 ? 2017 OLA B C7  1 
HETATM 6058 C  C8  . OLA OA 4 .   ? -6.078  4.576   -12.464 1.00 98.58  ? 2017 OLA B C8  1 
HETATM 6059 C  C9  . OLA OA 4 .   ? -6.385  3.235   -11.821 1.00 96.25  ? 2017 OLA B C9  1 
HETATM 6060 C  C10 . OLA OA 4 .   ? -7.387  2.964   -10.967 1.00 92.77  ? 2017 OLA B C10 1 
HETATM 6061 C  C11 . OLA OA 4 .   ? -8.424  3.930   -10.436 1.00 89.34  ? 2017 OLA B C11 1 
HETATM 6062 C  C12 . OLA OA 4 .   ? -9.061  3.322   -9.189  1.00 86.46  ? 2017 OLA B C12 1 
HETATM 6063 C  C13 . OLA OA 4 .   ? -8.612  4.044   -7.920  1.00 84.25  ? 2017 OLA B C13 1 
HETATM 6064 C  C14 . OLA OA 4 .   ? -8.834  3.225   -6.649  1.00 82.91  ? 2017 OLA B C14 1 
HETATM 6065 C  C15 . OLA OA 4 .   ? -10.212 3.463   -6.025  1.00 81.33  ? 2017 OLA B C15 1 
HETATM 6066 C  C16 . OLA OA 4 .   ? -10.106 3.855   -4.554  1.00 79.70  ? 2017 OLA B C16 1 
HETATM 6067 C  C1  . OLA PA 4 .   ? -15.232 -35.303 -14.568 1.00 130.50 ? 2018 OLA B C1  1 
HETATM 6068 O  O1  . OLA PA 4 .   ? -15.016 -35.251 -15.800 1.00 131.01 ? 2018 OLA B O1  1 
HETATM 6069 O  O2  . OLA PA 4 .   ? -15.989 -36.163 -14.060 1.00 131.36 ? 2018 OLA B O2  1 
HETATM 6070 C  C2  . OLA PA 4 .   ? -14.574 -34.268 -13.674 1.00 128.58 ? 2018 OLA B C2  1 
HETATM 6071 C  C3  . OLA PA 4 .   ? -13.704 -34.895 -12.583 1.00 126.51 ? 2018 OLA B C3  1 
HETATM 6072 C  C4  . OLA PA 4 .   ? -13.812 -34.099 -11.286 1.00 124.87 ? 2018 OLA B C4  1 
HETATM 6073 C  C5  . OLA PA 4 .   ? -13.308 -34.887 -10.082 1.00 123.63 ? 2018 OLA B C5  1 
HETATM 6074 C  C6  . OLA PA 4 .   ? -14.338 -34.935 -8.953  1.00 123.28 ? 2018 OLA B C6  1 
HETATM 6075 C  C7  . OLA PA 4 .   ? -14.043 -33.916 -7.852  1.00 123.59 ? 2018 OLA B C7  1 
HETATM 6076 C  C8  . OLA PA 4 .   ? -15.227 -33.745 -6.901  1.00 123.59 ? 2018 OLA B C8  1 
HETATM 6077 C  C9  . OLA PA 4 .   ? -15.429 -32.275 -6.569  1.00 122.81 ? 2018 OLA B C9  1 
HETATM 6078 C  C10 . OLA PA 4 .   ? -16.558 -31.731 -6.092  1.00 121.30 ? 2018 OLA B C10 1 
HETATM 6079 C  C11 . OLA PA 4 .   ? -17.837 -32.498 -5.809  1.00 120.89 ? 2018 OLA B C11 1 
HETATM 6080 C  C12 . OLA PA 4 .   ? -19.048 -31.791 -6.413  1.00 120.60 ? 2018 OLA B C12 1 
HETATM 6081 C  C13 . OLA PA 4 .   ? -19.317 -32.267 -7.839  1.00 121.38 ? 2018 OLA B C13 1 
HETATM 6082 C  C14 . OLA PA 4 .   ? -20.611 -31.683 -8.407  1.00 122.26 ? 2018 OLA B C14 1 
HETATM 6083 C  C15 . OLA PA 4 .   ? -20.558 -31.543 -9.928  1.00 122.18 ? 2018 OLA B C15 1 
HETATM 6084 C  C16 . OLA PA 4 .   ? -21.199 -32.737 -10.633 1.00 122.61 ? 2018 OLA B C16 1 
HETATM 6085 C  C17 . OLA PA 4 .   ? -20.188 -33.489 -11.493 1.00 122.71 ? 2018 OLA B C17 1 
HETATM 6086 C  C18 . OLA PA 4 .   ? -20.794 -33.855 -12.832 1.00 122.46 ? 2018 OLA B C18 1 
HETATM 6087 C  C11 . ZLK QA 2 .   ? -21.900 -2.943  -13.100 0.75 58.63  ? 2019 ZLK B C11 1 
HETATM 6088 C  C01 . ZLK QA 2 .   ? -18.821 -0.728  -18.639 0.75 70.64  ? 2019 ZLK B C01 1 
HETATM 6089 C  C03 . ZLK QA 2 .   ? -20.163 -2.331  -17.522 0.75 65.69  ? 2019 ZLK B C03 1 
HETATM 6090 C  C04 . ZLK QA 2 .   ? -21.047 -2.774  -16.493 0.75 65.32  ? 2019 ZLK B C04 1 
HETATM 6091 C  C05 . ZLK QA 2 .   ? -21.514 -1.745  -15.393 0.75 65.03  ? 2019 ZLK B C05 1 
HETATM 6092 C  C06 . ZLK QA 2 .   ? -22.374 -2.401  -14.327 0.75 62.19  ? 2019 ZLK B C06 1 
HETATM 6093 C  C07 . ZLK QA 2 .   ? -23.747 -2.628  -14.407 0.75 63.43  ? 2019 ZLK B C07 1 
HETATM 6094 C  C09 . ZLK QA 2 .   ? -25.523 -3.643  -12.963 0.75 61.97  ? 2019 ZLK B C09 1 
HETATM 6095 C  C10 . ZLK QA 2 .   ? -23.020 -3.483  -12.465 0.75 59.55  ? 2019 ZLK B C10 1 
HETATM 6096 C  C12 . ZLK QA 2 .   ? -20.612 -2.990  -12.470 0.75 56.36  ? 2019 ZLK B C12 1 
HETATM 6097 C  C13 . ZLK QA 2 .   ? -20.500 -3.533  -11.190 0.75 55.83  ? 2019 ZLK B C13 1 
HETATM 6098 C  C15 . ZLK QA 2 .   ? -18.136 -2.709  -10.627 0.75 53.41  ? 2019 ZLK B C15 1 
HETATM 6099 C  C18 . ZLK QA 2 .   ? -15.882 -2.373  -9.654  0.75 57.77  ? 2019 ZLK B C18 1 
HETATM 6100 C  C19 . ZLK QA 2 .   ? -16.458 -2.057  -8.125  0.75 56.24  ? 2019 ZLK B C19 1 
HETATM 6101 C  C20 . ZLK QA 2 .   ? -15.348 -2.073  -7.326  0.75 55.82  ? 2019 ZLK B C20 1 
HETATM 6102 C  C21 . ZLK QA 2 .   ? -14.460 -3.235  -7.947  0.75 56.79  ? 2019 ZLK B C21 1 
HETATM 6103 C  C22 . ZLK QA 2 .   ? -14.717 -3.095  -9.516  0.75 57.69  ? 2019 ZLK B C22 1 
HETATM 6104 C  C23 . ZLK QA 2 .   ? -21.652 -4.049  -10.531 0.75 56.76  ? 2019 ZLK B C23 1 
HETATM 6105 C  C24 . ZLK QA 2 .   ? -22.898 -4.046  -11.163 0.75 56.43  ? 2019 ZLK B C24 1 
HETATM 6106 C  C25 . ZLK QA 2 .   ? -21.524 -4.117  -16.493 0.75 64.98  ? 2019 ZLK B C25 1 
HETATM 6107 C  C26 . ZLK QA 2 .   ? -21.090 -5.043  -17.494 0.75 63.25  ? 2019 ZLK B C26 1 
HETATM 6108 C  C27 . ZLK QA 2 .   ? -20.268 -4.560  -18.551 0.75 66.27  ? 2019 ZLK B C27 1 
HETATM 6109 C  C28 . ZLK QA 2 .   ? -19.750 -3.251  -18.528 0.75 66.48  ? 2019 ZLK B C28 1 
HETATM 6110 C  C29 . ZLK QA 2 .   ? -19.704 -5.518  -19.644 0.75 69.09  ? 2019 ZLK B C29 1 
HETATM 6111 C  C35 . ZLK QA 2 .   ? -17.693 -8.288  -20.095 0.75 71.10  ? 2019 ZLK B C35 1 
HETATM 6112 C  C36 . ZLK QA 2 .   ? -16.582 -8.050  -20.912 0.75 69.46  ? 2019 ZLK B C36 1 
HETATM 6113 C  C37 . ZLK QA 2 .   ? -15.292 -8.345  -20.449 0.75 68.86  ? 2019 ZLK B C37 1 
HETATM 6114 C  C38 . ZLK QA 2 .   ? -15.107 -8.838  -19.163 0.75 69.34  ? 2019 ZLK B C38 1 
HETATM 6115 C  C39 . ZLK QA 2 .   ? -16.203 -9.048  -18.340 0.75 70.44  ? 2019 ZLK B C39 1 
HETATM 6116 C  C40 . ZLK QA 2 .   ? -17.516 -8.774  -18.806 0.75 71.25  ? 2019 ZLK B C40 1 
HETATM 6117 C  C41 . ZLK QA 2 .   ? -18.720 -9.043  -17.838 0.75 71.12  ? 2019 ZLK B C41 1 
HETATM 6118 N  N08 . ZLK QA 2 .   ? -24.122 -3.284  -13.289 0.75 63.36  ? 2019 ZLK B N08 1 
HETATM 6119 N  N14 . ZLK QA 2 .   ? -19.202 -3.693  -10.524 0.75 53.07  ? 2019 ZLK B N14 1 
HETATM 6120 N  N31 . ZLK QA 2 .   ? -20.063 -6.910  -19.594 0.75 72.70  ? 2019 ZLK B N31 1 
HETATM 6121 O  O02 . ZLK QA 2 .   ? -19.684 -1.022  -17.560 0.75 68.12  ? 2019 ZLK B O02 1 
HETATM 6122 O  O16 . ZLK QA 2 .   ? -18.404 -1.597  -10.887 0.75 55.52  ? 2019 ZLK B O16 1 
HETATM 6123 O  O17 . ZLK QA 2 .   ? -16.798 -3.130  -10.453 0.75 56.89  ? 2019 ZLK B O17 1 
HETATM 6124 O  O30 . ZLK QA 2 .   ? -18.953 -5.127  -20.460 0.75 69.84  ? 2019 ZLK B O30 1 
HETATM 6125 O  O33 . ZLK QA 2 .   ? -19.289 -7.253  -22.052 0.75 73.69  ? 2019 ZLK B O33 1 
HETATM 6126 O  O34 . ZLK QA 2 .   ? -20.136 -9.104  -20.957 0.75 77.86  ? 2019 ZLK B O34 1 
HETATM 6127 S  S32 . ZLK QA 2 .   ? -19.331 -7.911  -20.740 0.75 74.52  ? 2019 ZLK B S32 1 
HETATM 6128 NA NA  . NA  RA 6 .   ? -9.146  -19.685 -1.388  1.00 53.10  1 2020 NA  B NA  1 
HETATM 6129 O  O   . HOH SA 7 .   ? 12.942  20.553  -17.109 1.00 78.95  ? 2101 HOH A O   1 
HETATM 6130 O  O   . HOH SA 7 .   ? 16.964  21.248  -11.164 1.00 73.82  ? 2102 HOH A O   1 
HETATM 6131 O  O   . HOH SA 7 .   ? 29.314  21.391  -14.351 1.00 80.08  ? 2103 HOH A O   1 
HETATM 6132 O  O   . HOH SA 7 .   ? 15.583  19.827  -22.574 1.00 76.95  ? 2104 HOH A O   1 
HETATM 6133 O  O   . HOH SA 7 .   ? 5.710   17.807  -1.587  1.00 61.06  ? 2105 HOH A O   1 
HETATM 6134 O  O   . HOH TA 7 .   ? -2.448  -16.395 -11.409 1.00 53.65  ? 2101 HOH B O   1 
HETATM 6135 O  O   . HOH TA 7 .   ? -16.122 -22.727 -12.058 1.00 70.09  ? 2102 HOH B O   1 
HETATM 6136 O  O   . HOH TA 7 .   ? 4.235   -19.165 -20.485 1.00 80.89  ? 2103 HOH B O   1 
HETATM 6137 O  O   . HOH TA 7 .   ? -10.969 -21.827 -18.256 1.00 64.28  ? 2104 HOH B O   1 
HETATM 6138 O  O   . HOH TA 7 .   ? -6.875  -18.824 -1.247  1.00 59.01  ? 2105 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . CYS A  17  ? 1.5702 1.8886 1.6447 -0.0339 -0.0045 0.0702  14   CYS A N   
2    C  CA  . CYS A  17  ? 1.5772 1.8645 1.6502 -0.0317 -0.0038 0.0617  14   CYS A CA  
3    C  C   . CYS A  17  ? 1.6359 1.9086 1.7117 -0.0314 -0.0050 0.0645  14   CYS A C   
4    O  O   . CYS A  17  ? 1.6240 1.9107 1.6998 -0.0356 -0.0036 0.0647  14   CYS A O   
5    C  CB  . CYS A  17  ? 1.5796 1.8660 1.6460 -0.0357 0.0014  0.0454  14   CYS A CB  
6    S  SG  . CYS A  17  ? 1.6352 1.8938 1.6995 -0.0358 0.0043  0.0344  14   CYS A SG  
7    N  N   . HIS A  18  ? 1.6056 1.8513 1.6838 -0.0267 -0.0075 0.0668  15   HIS A N   
8    C  CA  . HIS A  18  ? 1.6094 1.8392 1.6902 -0.0262 -0.0090 0.0696  15   HIS A CA  
9    C  C   . HIS A  18  ? 1.6640 1.8644 1.7448 -0.0222 -0.0098 0.0650  15   HIS A C   
10   O  O   . HIS A  18  ? 1.6593 1.8521 1.7370 -0.0207 -0.0082 0.0569  15   HIS A O   
11   C  CB  . HIS A  18  ? 1.6164 1.8523 1.7030 -0.0254 -0.0131 0.0850  15   HIS A CB  
12   N  N   . ASP A  19  ? 1.6204 1.8052 1.7045 -0.0211 -0.0122 0.0700  16   ASP A N   
13   C  CA  . ASP A  19  ? 1.6211 1.7797 1.7057 -0.0177 -0.0133 0.0666  16   ASP A CA  
14   C  C   . ASP A  19  ? 1.6564 1.8048 1.7449 -0.0133 -0.0171 0.0753  16   ASP A C   
15   O  O   . ASP A  19  ? 1.6528 1.7871 1.7450 -0.0122 -0.0198 0.0815  16   ASP A O   
16   C  CB  . ASP A  19  ? 1.6467 1.7959 1.7325 -0.0195 -0.0135 0.0666  16   ASP A CB  
17   N  N   . THR A  20  ? 1.5963 1.7530 1.6839 -0.0109 -0.0170 0.0755  17   THR A N   
18   C  CA  . THR A  20  ? 1.5869 1.7366 1.6779 -0.0057 -0.0197 0.0829  17   THR A CA  
19   C  C   . THR A  20  ? 1.6269 1.7501 1.7181 -0.0022 -0.0207 0.0779  17   THR A C   
20   O  O   . THR A  20  ? 1.6311 1.7406 1.7264 0.0012  -0.0233 0.0847  17   THR A O   
21   C  CB  . THR A  20  ? 1.6683 1.8371 1.7575 -0.0044 -0.0187 0.0829  17   THR A CB  
22   O  OG1 . THR A  20  ? 1.6464 1.8398 1.7371 -0.0069 -0.0189 0.0913  17   THR A OG1 
23   C  CG2 . THR A  20  ? 1.6430 1.8028 1.7347 0.0022  -0.0208 0.0875  17   THR A CG2 
24   N  N   . ILE A  21  ? 1.5672 1.6833 1.6541 -0.0034 -0.0183 0.0659  18   ILE A N   
25   C  CA  . ILE A  21  ? 1.5655 1.6593 1.6522 -0.0009 -0.0188 0.0600  18   ILE A CA  
26   C  C   . ILE A  21  ? 1.6025 1.6798 1.6929 -0.0011 -0.0210 0.0644  18   ILE A C   
27   O  O   . ILE A  21  ? 1.6074 1.6674 1.6994 0.0019  -0.0226 0.0635  18   ILE A O   
28   C  CB  . ILE A  21  ? 1.6065 1.6982 1.6880 -0.0029 -0.0153 0.0475  18   ILE A CB  
29   N  N   . ASP A  22  ? 1.5306 1.6143 1.6222 -0.0049 -0.0212 0.0690  19   ASP A N   
30   C  CA  . ASP A  22  ? 1.5152 1.5866 1.6099 -0.0065 -0.0231 0.0733  19   ASP A CA  
31   C  C   . ASP A  22  ? 1.5277 1.5835 1.6268 -0.0036 -0.0261 0.0801  19   ASP A C   
32   O  O   . ASP A  22  ? 1.5237 1.5625 1.6237 -0.0039 -0.0269 0.0775  19   ASP A O   
33   C  CB  . ASP A  22  ? 1.5340 1.6197 1.6297 -0.0109 -0.0231 0.0793  19   ASP A CB  
34   C  CG  . ASP A  22  ? 1.6781 1.7746 1.7700 -0.0140 -0.0199 0.0717  19   ASP A CG  
35   O  OD1 . ASP A  22  ? 1.6908 1.7866 1.7790 -0.0128 -0.0172 0.0621  19   ASP A OD1 
36   O  OD2 . ASP A  22  ? 1.7520 1.8576 1.8448 -0.0175 -0.0198 0.0753  19   ASP A OD2 
37   N  N   . ASP A  23  ? 1.4557 1.5172 1.5576 -0.0009 -0.0273 0.0886  20   ASP A N   
38   C  CA  . ASP A  23  ? 1.4430 1.4883 1.5493 0.0026  -0.0294 0.0951  20   ASP A CA  
39   C  C   . ASP A  23  ? 1.4364 1.4685 1.5417 0.0076  -0.0293 0.0881  20   ASP A C   
40   O  O   . ASP A  23  ? 1.4416 1.4548 1.5495 0.0093  -0.0304 0.0883  20   ASP A O   
41   C  CB  . ASP A  23  ? 1.4690 1.5242 1.5794 0.0044  -0.0306 0.1083  20   ASP A CB  
42   C  CG  . ASP A  23  ? 1.6631 1.7381 1.7721 0.0075  -0.0296 0.1096  20   ASP A CG  
43   O  OD1 . ASP A  23  ? 1.6734 1.7684 1.7795 0.0040  -0.0282 0.1077  20   ASP A OD1 
44   O  OD2 . ASP A  23  ? 1.7584 1.8294 1.8692 0.0133  -0.0300 0.1124  20   ASP A OD2 
45   N  N   . PHE A  24  ? 1.3366 1.3791 1.4382 0.0094  -0.0277 0.0814  21   PHE A N   
46   C  CA  . PHE A  24  ? 1.3122 1.3456 1.4123 0.0137  -0.0274 0.0742  21   PHE A CA  
47   C  C   . PHE A  24  ? 1.3151 1.3324 1.4135 0.0120  -0.0271 0.0650  21   PHE A C   
48   O  O   . PHE A  24  ? 1.3106 1.3125 1.4104 0.0149  -0.0280 0.0623  21   PHE A O   
49   C  CB  . PHE A  24  ? 1.3258 1.3766 1.4217 0.0144  -0.0255 0.0692  21   PHE A CB  
50   C  CG  . PHE A  24  ? 1.3404 1.3838 1.4332 0.0168  -0.0246 0.0591  21   PHE A CG  
51   C  CD1 . PHE A  24  ? 1.3740 1.4129 1.4684 0.0225  -0.0256 0.0602  21   PHE A CD1 
52   C  CD2 . PHE A  24  ? 1.3611 1.4025 1.4496 0.0135  -0.0226 0.0491  21   PHE A CD2 
53   C  CE1 . PHE A  24  ? 1.3859 1.4195 1.4773 0.0243  -0.0249 0.0510  21   PHE A CE1 
54   C  CE2 . PHE A  24  ? 1.3993 1.4342 1.4851 0.0154  -0.0219 0.0405  21   PHE A CE2 
55   C  CZ  . PHE A  24  ? 1.3761 1.4077 1.4632 0.0205  -0.0231 0.0414  21   PHE A CZ  
56   N  N   . ARG A  25  ? 1.2264 1.2488 1.3219 0.0074  -0.0256 0.0604  22   ARG A N   
57   C  CA  . ARG A  25  ? 1.2087 1.2207 1.3025 0.0052  -0.0249 0.0526  22   ARG A CA  
58   C  C   . ARG A  25  ? 1.2203 1.2160 1.3177 0.0045  -0.0270 0.0556  22   ARG A C   
59   O  O   . ARG A  25  ? 1.2102 1.1929 1.3075 0.0059  -0.0273 0.0499  22   ARG A O   
60   C  CB  . ARG A  25  ? 1.1978 1.2211 1.2891 0.0009  -0.0228 0.0507  22   ARG A CB  
61   C  CG  . ARG A  25  ? 1.2579 1.2746 1.3468 -0.0005 -0.0211 0.0426  22   ARG A CG  
62   C  CD  . ARG A  25  ? 1.2708 1.2987 1.3579 -0.0039 -0.0188 0.0416  22   ARG A CD  
63   N  NE  . ARG A  25  ? 1.3637 1.3920 1.4537 -0.0069 -0.0204 0.0483  22   ARG A NE  
64   C  CZ  . ARG A  25  ? 1.6060 1.6369 1.6954 -0.0095 -0.0192 0.0470  22   ARG A CZ  
65   N  NH1 . ARG A  25  ? 1.3949 1.4274 1.4868 -0.0126 -0.0209 0.0534  22   ARG A NH1 
66   N  NH2 . ARG A  25  ? 1.5466 1.5787 1.6329 -0.0088 -0.0160 0.0394  22   ARG A NH2 
67   N  N   . ASN A  26  ? 1.1468 1.1438 1.2474 0.0020  -0.0283 0.0646  23   ASN A N   
68   C  CA  . ASN A  26  ? 1.1308 1.1132 1.2349 0.0000  -0.0300 0.0683  23   ASN A CA  
69   C  C   . ASN A  26  ? 1.1582 1.1256 1.2654 0.0042  -0.0312 0.0700  23   ASN A C   
70   O  O   . ASN A  26  ? 1.1656 1.1176 1.2747 0.0026  -0.0320 0.0688  23   ASN A O   
71   C  CB  . ASN A  26  ? 1.1041 1.0935 1.2104 -0.0042 -0.0309 0.0778  23   ASN A CB  
72   C  CG  . ASN A  26  ? 1.3652 1.3689 1.4691 -0.0085 -0.0297 0.0766  23   ASN A CG  
73   O  OD1 . ASN A  26  ? 1.2975 1.3037 1.3980 -0.0089 -0.0280 0.0684  23   ASN A OD1 
74   N  ND2 . ASN A  26  ? 1.2389 1.2525 1.3446 -0.0116 -0.0304 0.0852  23   ASN A ND2 
75   N  N   . GLN A  27  ? 1.0846 1.0570 1.1924 0.0094  -0.0311 0.0728  24   GLN A N   
76   C  CA  . GLN A  27  ? 1.0836 1.0428 1.1947 0.0145  -0.0317 0.0748  24   GLN A CA  
77   C  C   . GLN A  27  ? 1.1271 1.0777 1.2361 0.0176  -0.0313 0.0643  24   GLN A C   
78   O  O   . GLN A  27  ? 1.1258 1.0598 1.2370 0.0187  -0.0318 0.0619  24   GLN A O   
79   C  CB  . GLN A  27  ? 1.0984 1.0682 1.2115 0.0195  -0.0318 0.0835  24   GLN A CB  
80   N  N   . VAL A  28  ? 1.0699 1.0322 1.1747 0.0186  -0.0302 0.0579  25   VAL A N   
81   C  CA  . VAL A  28  ? 1.0523 1.0098 1.1547 0.0212  -0.0297 0.0482  25   VAL A CA  
82   C  C   . VAL A  28  ? 1.0587 1.0060 1.1599 0.0173  -0.0297 0.0411  25   VAL A C   
83   O  O   . VAL A  28  ? 1.0629 0.9981 1.1651 0.0190  -0.0302 0.0361  25   VAL A O   
84   C  CB  . VAL A  28  ? 1.0943 1.0676 1.1924 0.0226  -0.0283 0.0441  25   VAL A CB  
85   C  CG1 . VAL A  28  ? 1.0943 1.0628 1.1897 0.0244  -0.0278 0.0343  25   VAL A CG1 
86   C  CG2 . VAL A  28  ? 1.0833 1.0679 1.1827 0.0268  -0.0284 0.0512  25   VAL A CG2 
87   N  N   . TYR A  29  ? 0.9676 0.9205 1.0673 0.0122  -0.0291 0.0411  26   TYR A N   
88   C  CA  . TYR A  29  ? 0.9505 0.8963 1.0494 0.0086  -0.0291 0.0355  26   TYR A CA  
89   C  C   . TYR A  29  ? 0.9597 0.8905 1.0622 0.0069  -0.0305 0.0369  26   TYR A C   
90   O  O   . TYR A  29  ? 0.9628 0.8851 1.0651 0.0067  -0.0307 0.0302  26   TYR A O   
91   C  CB  . TYR A  29  ? 0.9648 0.9204 1.0618 0.0041  -0.0279 0.0360  26   TYR A CB  
92   C  CG  . TYR A  29  ? 0.9933 0.9591 1.0862 0.0047  -0.0256 0.0304  26   TYR A CG  
93   C  CD1 . TYR A  29  ? 1.0240 0.9861 1.1147 0.0069  -0.0247 0.0226  26   TYR A CD1 
94   C  CD2 . TYR A  29  ? 0.9988 0.9774 1.0900 0.0027  -0.0240 0.0325  26   TYR A CD2 
95   C  CE1 . TYR A  29  ? 1.0260 0.9957 1.1128 0.0070  -0.0221 0.0176  26   TYR A CE1 
96   C  CE2 . TYR A  29  ? 1.0050 0.9910 1.0924 0.0029  -0.0212 0.0267  26   TYR A CE2 
97   C  CZ  . TYR A  29  ? 1.0761 1.0570 1.1613 0.0050  -0.0202 0.0195  26   TYR A CZ  
98   O  OH  . TYR A  29  ? 1.0653 1.0523 1.1468 0.0049  -0.0170 0.0142  26   TYR A OH  
99   N  N   . SER A  30  ? 0.8852 0.8131 0.9909 0.0053  -0.0314 0.0453  27   SER A N   
100  C  CA  . SER A  30  ? 0.8763 0.7886 0.9854 0.0028  -0.0323 0.0468  27   SER A CA  
101  C  C   . SER A  30  ? 0.9258 0.8246 1.0365 0.0073  -0.0323 0.0422  27   SER A C   
102  O  O   . SER A  30  ? 0.9218 0.8095 1.0331 0.0046  -0.0325 0.0368  27   SER A O   
103  C  CB  . SER A  30  ? 0.9190 0.8304 1.0314 0.0011  -0.0329 0.0576  27   SER A CB  
104  O  OG  . SER A  30  ? 1.0637 0.9847 1.1751 -0.0047 -0.0331 0.0609  27   SER A OG  
105  N  N   . THR A  31  ? 0.8783 0.7795 0.9895 0.0139  -0.0321 0.0440  28   THR A N   
106  C  CA  . THR A  31  ? 0.8693 0.7597 0.9821 0.0193  -0.0320 0.0400  28   THR A CA  
107  C  C   . THR A  31  ? 0.8959 0.7857 1.0058 0.0193  -0.0318 0.0288  28   THR A C   
108  O  O   . THR A  31  ? 0.8824 0.7599 0.9937 0.0181  -0.0318 0.0233  28   THR A O   
109  C  CB  . THR A  31  ? 0.9627 0.8601 1.0766 0.0265  -0.0317 0.0456  28   THR A CB  
110  O  OG1 . THR A  31  ? 1.0157 0.9134 1.1328 0.0263  -0.0319 0.0568  28   THR A OG1 
111  C  CG2 . THR A  31  ? 0.9397 0.8272 1.0554 0.0331  -0.0314 0.0419  28   THR A CG2 
112  N  N   . LEU A  32  ? 0.8283 0.7319 0.9343 0.0203  -0.0313 0.0255  29   LEU A N   
113  C  CA  . LEU A  32  ? 0.8171 0.7223 0.9202 0.0207  -0.0310 0.0160  29   LEU A CA  
114  C  C   . LEU A  32  ? 0.8570 0.7578 0.9596 0.0151  -0.0311 0.0110  29   LEU A C   
115  O  O   . LEU A  32  ? 0.8594 0.7538 0.9622 0.0154  -0.0312 0.0041  29   LEU A O   
116  C  CB  . LEU A  32  ? 0.8120 0.7320 0.9111 0.0221  -0.0300 0.0143  29   LEU A CB  
117  C  CG  . LEU A  32  ? 0.8571 0.7844 0.9560 0.0275  -0.0298 0.0178  29   LEU A CG  
118  C  CD1 . LEU A  32  ? 0.8604 0.8019 0.9547 0.0272  -0.0285 0.0148  29   LEU A CD1 
119  C  CD2 . LEU A  32  ? 0.8409 0.7604 0.9416 0.0331  -0.0303 0.0148  29   LEU A CD2 
120  N  N   . TYR A  33  ? 0.7895 0.6948 0.8916 0.0100  -0.0310 0.0145  30   TYR A N   
121  C  CA  . TYR A  33  ? 0.7818 0.6851 0.8835 0.0047  -0.0310 0.0105  30   TYR A CA  
122  C  C   . TYR A  33  ? 0.8586 0.7480 0.9635 0.0022  -0.0318 0.0089  30   TYR A C   
123  O  O   . TYR A  33  ? 0.8619 0.7485 0.9664 0.0001  -0.0318 0.0021  30   TYR A O   
124  C  CB  . TYR A  33  ? 0.7779 0.6905 0.8785 0.0002  -0.0306 0.0146  30   TYR A CB  
125  C  CG  . TYR A  33  ? 0.7685 0.6939 0.8657 0.0016  -0.0290 0.0133  30   TYR A CG  
126  C  CD1 . TYR A  33  ? 0.7844 0.7121 0.8792 0.0041  -0.0281 0.0066  30   TYR A CD1 
127  C  CD2 . TYR A  33  ? 0.7645 0.6994 0.8608 0.0001  -0.0282 0.0185  30   TYR A CD2 
128  C  CE1 . TYR A  33  ? 0.7664 0.7038 0.8580 0.0051  -0.0261 0.0053  30   TYR A CE1 
129  C  CE2 . TYR A  33  ? 0.7644 0.7097 0.8576 0.0012  -0.0261 0.0165  30   TYR A CE2 
130  C  CZ  . TYR A  33  ? 0.7689 0.7145 0.8597 0.0037  -0.0249 0.0100  30   TYR A CZ  
131  O  OH  . TYR A  33  ? 0.6391 0.5930 0.7267 0.0045  -0.0224 0.0079  30   TYR A OH  
132  N  N   . SER A  34  ? 0.8324 0.7128 0.9404 0.0027  -0.0321 0.0149  31   SER A N   
133  C  CA  . SER A  34  ? 0.8354 0.7000 0.9466 0.0004  -0.0322 0.0135  31   SER A CA  
134  C  C   . SER A  34  ? 0.8756 0.7330 0.9871 0.0046  -0.0319 0.0053  31   SER A C   
135  O  O   . SER A  34  ? 0.8760 0.7267 0.9880 0.0009  -0.0317 -0.0014 31   SER A O   
136  C  CB  . SER A  34  ? 0.8898 0.7461 1.0044 0.0015  -0.0322 0.0225  31   SER A CB  
137  O  OG  . SER A  34  ? 1.0530 0.9131 1.1679 -0.0044 -0.0325 0.0291  31   SER A OG  
138  N  N   . MET A  35  ? 0.8241 0.6850 0.9351 0.0118  -0.0317 0.0054  32   MET A N   
139  C  CA  . MET A  35  ? 0.8373 0.6940 0.9484 0.0166  -0.0315 -0.0021 32   MET A CA  
140  C  C   . MET A  35  ? 0.8693 0.7327 0.9775 0.0141  -0.0316 -0.0110 32   MET A C   
141  O  O   . MET A  35  ? 0.8604 0.7167 0.9695 0.0133  -0.0315 -0.0182 32   MET A O   
142  C  CB  . MET A  35  ? 0.8791 0.7424 0.9896 0.0243  -0.0314 0.0007  32   MET A CB  
143  C  CG  . MET A  35  ? 0.9496 0.8046 1.0639 0.0291  -0.0309 0.0079  32   MET A CG  
144  S  SD  . MET A  35  ? 1.0267 0.8935 1.1400 0.0381  -0.0308 0.0103  32   MET A SD  
145  C  CE  . MET A  35  ? 0.9904 0.8546 1.1025 0.0412  -0.0307 -0.0018 32   MET A CE  
146  N  N   . ILE A  36  ? 0.8051 0.6823 0.9099 0.0129  -0.0317 -0.0104 33   ILE A N   
147  C  CA  . ILE A  36  ? 0.7729 0.6580 0.8751 0.0108  -0.0316 -0.0171 33   ILE A CA  
148  C  C   . ILE A  36  ? 0.7994 0.6809 0.9027 0.0041  -0.0318 -0.0203 33   ILE A C   
149  O  O   . ILE A  36  ? 0.7892 0.6714 0.8921 0.0030  -0.0318 -0.0276 33   ILE A O   
150  C  CB  . ILE A  36  ? 0.7927 0.6912 0.8914 0.0112  -0.0309 -0.0148 33   ILE A CB  
151  C  CG1 . ILE A  36  ? 0.7783 0.6816 0.8756 0.0169  -0.0305 -0.0132 33   ILE A CG1 
152  C  CG2 . ILE A  36  ? 0.7948 0.7004 0.8913 0.0094  -0.0304 -0.0206 33   ILE A CG2 
153  C  CD1 . ILE A  36  ? 0.6676 0.5820 0.7622 0.0165  -0.0294 -0.0088 33   ILE A CD1 
154  N  N   . SER A  37  ? 0.7333 0.6121 0.8378 -0.0008 -0.0319 -0.0151 34   SER A N   
155  C  CA  . SER A  37  ? 0.7407 0.6176 0.8461 -0.0081 -0.0320 -0.0177 34   SER A CA  
156  C  C   . SER A  37  ? 0.7975 0.6618 0.9052 -0.0095 -0.0319 -0.0244 34   SER A C   
157  O  O   . SER A  37  ? 0.7908 0.6580 0.8981 -0.0137 -0.0318 -0.0309 34   SER A O   
158  C  CB  . SER A  37  ? 0.8171 0.6928 0.9235 -0.0130 -0.0322 -0.0103 34   SER A CB  
159  O  OG  . SER A  37  ? 1.0051 0.8924 1.1096 -0.0118 -0.0320 -0.0045 34   SER A OG  
160  N  N   . VAL A  38  ? 0.7484 0.5994 0.8585 -0.0058 -0.0315 -0.0228 35   VAL A N   
161  C  CA  . VAL A  38  ? 0.7398 0.5769 0.8524 -0.0065 -0.0307 -0.0292 35   VAL A CA  
162  C  C   . VAL A  38  ? 0.7686 0.6094 0.8802 -0.0023 -0.0307 -0.0381 35   VAL A C   
163  O  O   . VAL A  38  ? 0.7737 0.6142 0.8854 -0.0067 -0.0304 -0.0462 35   VAL A O   
164  C  CB  . VAL A  38  ? 0.7982 0.6188 0.9142 -0.0035 -0.0298 -0.0240 35   VAL A CB  
165  C  CG1 . VAL A  38  ? 0.8030 0.6075 0.9216 -0.0045 -0.0283 -0.0317 35   VAL A CG1 
166  C  CG2 . VAL A  38  ? 0.7929 0.6110 0.9098 -0.0087 -0.0300 -0.0150 35   VAL A CG2 
167  N  N   . VAL A  39  ? 0.7182 0.5641 0.8287 0.0053  -0.0310 -0.0368 36   VAL A N   
168  C  CA  . VAL A  39  ? 0.7188 0.5698 0.8282 0.0096  -0.0310 -0.0444 36   VAL A CA  
169  C  C   . VAL A  39  ? 0.8210 0.6856 0.9277 0.0053  -0.0316 -0.0494 36   VAL A C   
170  O  O   . VAL A  39  ? 0.8363 0.7025 0.9431 0.0045  -0.0315 -0.0577 36   VAL A O   
171  C  CB  . VAL A  39  ? 0.7547 0.6103 0.8631 0.0180  -0.0312 -0.0408 36   VAL A CB  
172  C  CG1 . VAL A  39  ? 0.7499 0.6127 0.8567 0.0218  -0.0314 -0.0483 36   VAL A CG1 
173  C  CG2 . VAL A  39  ? 0.7544 0.5977 0.8660 0.0231  -0.0305 -0.0360 36   VAL A CG2 
174  N  N   . GLY A  40  ? 0.7712 0.6458 0.8759 0.0028  -0.0319 -0.0440 37   GLY A N   
175  C  CA  . GLY A  40  ? 0.7642 0.6521 0.8668 -0.0005 -0.0320 -0.0464 37   GLY A CA  
176  C  C   . GLY A  40  ? 0.8280 0.7166 0.9316 -0.0078 -0.0320 -0.0508 37   GLY A C   
177  O  O   . GLY A  40  ? 0.8244 0.7212 0.9273 -0.0092 -0.0321 -0.0568 37   GLY A O   
178  N  N   . PHE A  41  ? 0.7923 0.6734 0.8975 -0.0130 -0.0319 -0.0479 38   PHE A N   
179  C  CA  . PHE A  41  ? 0.7952 0.6771 0.9012 -0.0212 -0.0317 -0.0521 38   PHE A CA  
180  C  C   . PHE A  41  ? 0.8421 0.7175 0.9495 -0.0223 -0.0313 -0.0620 38   PHE A C   
181  O  O   . PHE A  41  ? 0.8410 0.7267 0.9478 -0.0263 -0.0313 -0.0679 38   PHE A O   
182  C  CB  . PHE A  41  ? 0.8282 0.7025 0.9355 -0.0269 -0.0316 -0.0467 38   PHE A CB  
183  C  CG  . PHE A  41  ? 0.8555 0.7308 0.9634 -0.0363 -0.0312 -0.0514 38   PHE A CG  
184  C  CD1 . PHE A  41  ? 0.9012 0.7930 1.0077 -0.0413 -0.0316 -0.0509 38   PHE A CD1 
185  C  CD2 . PHE A  41  ? 0.8996 0.7597 1.0096 -0.0403 -0.0303 -0.0567 38   PHE A CD2 
186  C  CE1 . PHE A  41  ? 0.9197 0.8150 1.0266 -0.0506 -0.0312 -0.0557 38   PHE A CE1 
187  C  CE2 . PHE A  41  ? 0.9440 0.8058 1.0542 -0.0500 -0.0297 -0.0624 38   PHE A CE2 
188  C  CZ  . PHE A  41  ? 0.9156 0.7961 1.0241 -0.0553 -0.0303 -0.0618 38   PHE A CZ  
189  N  N   . PHE A  42  ? 0.7937 0.6532 0.9030 -0.0185 -0.0306 -0.0638 39   PHE A N   
190  C  CA  . PHE A  42  ? 0.8104 0.6624 0.9213 -0.0190 -0.0297 -0.0738 39   PHE A CA  
191  C  C   . PHE A  42  ? 0.8324 0.6951 0.9421 -0.0143 -0.0301 -0.0801 39   PHE A C   
192  O  O   . PHE A  42  ? 0.8272 0.6937 0.9371 -0.0181 -0.0298 -0.0890 39   PHE A O   
193  C  CB  . PHE A  42  ? 0.8645 0.6959 0.9782 -0.0153 -0.0283 -0.0733 39   PHE A CB  
194  C  CG  . PHE A  42  ? 0.9162 0.7353 1.0316 -0.0222 -0.0273 -0.0699 39   PHE A CG  
195  C  CD1 . PHE A  42  ? 0.9844 0.7993 1.1004 -0.0313 -0.0261 -0.0775 39   PHE A CD1 
196  C  CD2 . PHE A  42  ? 0.9651 0.7779 1.0813 -0.0203 -0.0275 -0.0593 39   PHE A CD2 
197  C  CE1 . PHE A  42  ? 1.0158 0.8195 1.1332 -0.0387 -0.0251 -0.0744 39   PHE A CE1 
198  C  CE2 . PHE A  42  ? 1.0190 0.8211 1.1367 -0.0272 -0.0267 -0.0557 39   PHE A CE2 
199  C  CZ  . PHE A  42  ? 1.0064 0.8033 1.1246 -0.0364 -0.0254 -0.0632 39   PHE A CZ  
200  N  N   . GLY A  43  ? 0.7630 0.6314 0.8711 -0.0070 -0.0309 -0.0755 40   GLY A N   
201  C  CA  . GLY A  43  ? 0.7419 0.6211 0.8486 -0.0026 -0.0314 -0.0803 40   GLY A CA  
202  C  C   . GLY A  43  ? 0.7808 0.6770 0.8857 -0.0073 -0.0320 -0.0826 40   GLY A C   
203  O  O   . GLY A  43  ? 0.7599 0.6630 0.8648 -0.0081 -0.0320 -0.0903 40   GLY A O   
204  N  N   . ASN A  44  ? 0.7475 0.6513 0.8511 -0.0102 -0.0322 -0.0757 41   ASN A N   
205  C  CA  . ASN A  44  ? 0.7470 0.6676 0.8492 -0.0137 -0.0324 -0.0762 41   ASN A CA  
206  C  C   . ASN A  44  ? 0.8208 0.7453 0.9243 -0.0220 -0.0322 -0.0806 41   ASN A C   
207  O  O   . ASN A  44  ? 0.8149 0.7538 0.9179 -0.0246 -0.0324 -0.0842 41   ASN A O   
208  C  CB  . ASN A  44  ? 0.7316 0.6599 0.8321 -0.0122 -0.0323 -0.0674 41   ASN A CB  
209  C  CG  . ASN A  44  ? 0.7720 0.6990 0.8708 -0.0050 -0.0321 -0.0644 41   ASN A CG  
210  O  OD1 . ASN A  44  ? 0.6781 0.6108 0.7759 -0.0017 -0.0323 -0.0680 41   ASN A OD1 
211  N  ND2 . ASN A  44  ? 0.6214 0.5416 0.7199 -0.0028 -0.0319 -0.0579 41   ASN A ND2 
212  N  N   . GLY A  45  ? 0.7924 0.7047 0.8973 -0.0263 -0.0318 -0.0803 42   GLY A N   
213  C  CA  . GLY A  45  ? 0.7794 0.6928 0.8854 -0.0354 -0.0313 -0.0857 42   GLY A CA  
214  C  C   . GLY A  45  ? 0.8204 0.7338 0.9273 -0.0366 -0.0309 -0.0969 42   GLY A C   
215  O  O   . GLY A  45  ? 0.8020 0.7290 0.9086 -0.0425 -0.0309 -0.1022 42   GLY A O   
216  N  N   . PHE A  46  ? 0.8047 0.7049 0.9125 -0.0304 -0.0305 -0.1004 43   PHE A N   
217  C  CA  . PHE A  46  ? 0.8157 0.7150 0.9245 -0.0300 -0.0298 -0.1114 43   PHE A CA  
218  C  C   . PHE A  46  ? 0.8666 0.7862 0.9739 -0.0285 -0.0308 -0.1143 43   PHE A C   
219  O  O   . PHE A  46  ? 0.8562 0.7850 0.9639 -0.0334 -0.0305 -0.1228 43   PHE A O   
220  C  CB  . PHE A  46  ? 0.8487 0.7303 0.9590 -0.0221 -0.0290 -0.1129 43   PHE A CB  
221  C  CG  . PHE A  46  ? 0.8780 0.7591 0.9893 -0.0206 -0.0281 -0.1243 43   PHE A CG  
222  C  CD1 . PHE A  46  ? 0.9169 0.7905 1.0299 -0.0271 -0.0263 -0.1341 43   PHE A CD1 
223  C  CD2 . PHE A  46  ? 0.8987 0.7880 1.0092 -0.0132 -0.0290 -0.1258 43   PHE A CD2 
224  C  CE1 . PHE A  46  ? 0.9266 0.8006 1.0406 -0.0258 -0.0252 -0.1454 43   PHE A CE1 
225  C  CE2 . PHE A  46  ? 0.9295 0.8203 1.0409 -0.0118 -0.0282 -0.1366 43   PHE A CE2 
226  C  CZ  . PHE A  46  ? 0.9127 0.7956 1.0260 -0.0177 -0.0263 -0.1464 43   PHE A CZ  
227  N  N   . VAL A  47  ? 0.8359 0.7626 0.9415 -0.0221 -0.0318 -0.1072 44   VAL A N   
228  C  CA  . VAL A  47  ? 0.8205 0.7652 0.9247 -0.0199 -0.0326 -0.1078 44   VAL A CA  
229  C  C   . VAL A  47  ? 0.8936 0.8562 0.9975 -0.0268 -0.0328 -0.1071 44   VAL A C   
230  O  O   . VAL A  47  ? 0.8921 0.8694 0.9960 -0.0288 -0.0330 -0.1124 44   VAL A O   
231  C  CB  . VAL A  47  ? 0.8444 0.7896 0.9468 -0.0122 -0.0331 -0.0999 44   VAL A CB  
232  C  CG1 . VAL A  47  ? 0.8276 0.7910 0.9283 -0.0110 -0.0336 -0.0985 44   VAL A CG1 
233  C  CG2 . VAL A  47  ? 0.8425 0.7753 0.9451 -0.0052 -0.0331 -0.1020 44   VAL A CG2 
234  N  N   . LEU A  48  ? 0.8648 0.8270 0.9686 -0.0307 -0.0326 -0.1006 45   LEU A N   
235  C  CA  . LEU A  48  ? 0.8695 0.8491 0.9732 -0.0372 -0.0326 -0.0989 45   LEU A CA  
236  C  C   . LEU A  48  ? 0.9406 0.9250 1.0456 -0.0455 -0.0322 -0.1089 45   LEU A C   
237  O  O   . LEU A  48  ? 0.9287 0.9326 1.0336 -0.0489 -0.0324 -0.1115 45   LEU A O   
238  C  CB  . LEU A  48  ? 0.8708 0.8481 0.9742 -0.0391 -0.0324 -0.0898 45   LEU A CB  
239  C  CG  . LEU A  48  ? 0.9254 0.9227 1.0283 -0.0412 -0.0322 -0.0835 45   LEU A CG  
240  C  CD1 . LEU A  48  ? 0.9199 0.9310 1.0221 -0.0358 -0.0323 -0.0815 45   LEU A CD1 
241  C  CD2 . LEU A  48  ? 0.9699 0.9629 1.0722 -0.0400 -0.0319 -0.0740 45   LEU A CD2 
242  N  N   . TYR A  49  ? 0.9090 0.8755 1.0150 -0.0486 -0.0314 -0.1146 46   TYR A N   
243  C  CA  . TYR A  49  ? 0.9058 0.8724 1.0130 -0.0569 -0.0303 -0.1256 46   TYR A CA  
244  C  C   . TYR A  49  ? 0.9819 0.9595 1.0893 -0.0556 -0.0304 -0.1347 46   TYR A C   
245  O  O   . TYR A  49  ? 0.9776 0.9736 1.0850 -0.0623 -0.0304 -0.1398 46   TYR A O   
246  C  CB  . TYR A  49  ? 0.9302 0.8710 1.0386 -0.0583 -0.0289 -0.1292 46   TYR A CB  
247  C  CG  . TYR A  49  ? 0.9601 0.8971 1.0697 -0.0661 -0.0271 -0.1421 46   TYR A CG  
248  C  CD1 . TYR A  49  ? 0.9869 0.9315 1.0962 -0.0777 -0.0263 -0.1455 46   TYR A CD1 
249  C  CD2 . TYR A  49  ? 0.9733 0.9002 1.0840 -0.0622 -0.0260 -0.1515 46   TYR A CD2 
250  C  CE1 . TYR A  49  ? 1.0112 0.9535 1.1213 -0.0858 -0.0243 -0.1585 46   TYR A CE1 
251  C  CE2 . TYR A  49  ? 0.9892 0.9131 1.1009 -0.0695 -0.0239 -0.1645 46   TYR A CE2 
252  C  CZ  . TYR A  49  ? 1.1245 1.0560 1.2359 -0.0817 -0.0230 -0.1682 46   TYR A CZ  
253  O  OH  . TYR A  49  ? 1.1922 1.1205 1.3042 -0.0899 -0.0205 -0.1820 46   TYR A OH  
254  N  N   . VAL A  50  ? 0.9649 0.9332 1.0724 -0.0471 -0.0306 -0.1363 47   VAL A N   
255  C  CA  . VAL A  50  ? 0.9675 0.9452 1.0752 -0.0445 -0.0308 -0.1445 47   VAL A CA  
256  C  C   . VAL A  50  ? 1.0310 1.0353 1.1377 -0.0449 -0.0321 -0.1413 47   VAL A C   
257  O  O   . VAL A  50  ? 1.0007 1.0200 1.1078 -0.0485 -0.0321 -0.1492 47   VAL A O   
258  C  CB  . VAL A  50  ? 1.0210 0.9835 1.1289 -0.0344 -0.0309 -0.1448 47   VAL A CB  
259  C  CG1 . VAL A  50  ? 1.0152 0.9905 1.1229 -0.0308 -0.0314 -0.1511 47   VAL A CG1 
260  C  CG2 . VAL A  50  ? 1.0261 0.9647 1.1358 -0.0343 -0.0291 -0.1500 47   VAL A CG2 
261  N  N   . LEU A  51  ? 1.0335 1.0436 1.1390 -0.0415 -0.0329 -0.1297 48   LEU A N   
262  C  CA  . LEU A  51  ? 1.0375 1.0707 1.1423 -0.0410 -0.0336 -0.1246 48   LEU A CA  
263  C  C   . LEU A  51  ? 1.1079 1.1605 1.2133 -0.0495 -0.0334 -0.1243 48   LEU A C   
264  O  O   . LEU A  51  ? 1.0933 1.1678 1.1990 -0.0508 -0.0338 -0.1247 48   LEU A O   
265  C  CB  . LEU A  51  ? 1.0369 1.0679 1.1403 -0.0339 -0.0339 -0.1129 48   LEU A CB  
266  C  CG  . LEU A  51  ? 1.0943 1.1168 1.1966 -0.0256 -0.0343 -0.1123 48   LEU A CG  
267  C  CD1 . LEU A  51  ? 1.0997 1.1137 1.2005 -0.0204 -0.0340 -0.1020 48   LEU A CD1 
268  C  CD2 . LEU A  51  ? 1.1121 1.1521 1.2141 -0.0239 -0.0348 -0.1143 48   LEU A CD2 
269  N  N   . ILE A  52  ? 1.0916 1.1377 1.1973 -0.0552 -0.0328 -0.1230 49   ILE A N   
270  C  CA  . ILE A  52  ? 1.0993 1.1639 1.2054 -0.0639 -0.0325 -0.1226 49   ILE A CA  
271  C  C   . ILE A  52  ? 1.2139 1.2885 1.3209 -0.0718 -0.0321 -0.1356 49   ILE A C   
272  O  O   . ILE A  52  ? 1.2139 1.3138 1.3212 -0.0761 -0.0323 -0.1363 49   ILE A O   
273  C  CB  . ILE A  52  ? 1.1372 1.1911 1.2431 -0.0678 -0.0321 -0.1174 49   ILE A CB  
274  C  CG1 . ILE A  52  ? 1.1418 1.1975 1.2470 -0.0617 -0.0323 -0.1038 49   ILE A CG1 
275  C  CG2 . ILE A  52  ? 1.1348 1.2012 1.2411 -0.0795 -0.0314 -0.1220 49   ILE A CG2 
276  C  CD1 . ILE A  52  ? 1.2573 1.3390 1.3627 -0.0599 -0.0324 -0.0962 49   ILE A CD1 
277  N  N   . LYS A  53  ? 1.2161 1.2714 1.3235 -0.0730 -0.0312 -0.1457 50   LYS A N   
278  C  CA  . LYS A  53  ? 1.2273 1.2876 1.3354 -0.0804 -0.0302 -0.1598 50   LYS A CA  
279  C  C   . LYS A  53  ? 1.3094 1.3805 1.4179 -0.0759 -0.0307 -0.1661 50   LYS A C   
280  O  O   . LYS A  53  ? 1.3121 1.3785 1.4213 -0.0786 -0.0296 -0.1786 50   LYS A O   
281  C  CB  . LYS A  53  ? 1.2718 1.3049 1.3805 -0.0835 -0.0284 -0.1676 50   LYS A CB  
282  N  N   . THR A  54  ? 1.2860 1.3723 1.3940 -0.0696 -0.0322 -0.1575 51   THR A N   
283  C  CA  . THR A  54  ? 1.2957 1.3944 1.4039 -0.0654 -0.0330 -0.1615 51   THR A CA  
284  C  C   . THR A  54  ? 1.3725 1.5012 1.4815 -0.0733 -0.0330 -0.1674 51   THR A C   
285  O  O   . THR A  54  ? 1.3596 1.5065 1.4687 -0.0784 -0.0331 -0.1614 51   THR A O   
286  C  CB  . THR A  54  ? 1.3816 1.4806 1.4888 -0.0554 -0.0342 -0.1500 51   THR A CB  
287  O  OG1 . THR A  54  ? 1.3538 1.4541 1.4610 -0.0501 -0.0347 -0.1553 51   THR A OG1 
288  C  CG2 . THR A  54  ? 1.3474 1.4693 1.4546 -0.0558 -0.0347 -0.1391 51   THR A CG2 
289  N  N   . TYR A  55  ? 1.3475 1.4821 1.4570 -0.0743 -0.0328 -0.1791 52   TYR A N   
290  C  CA  . TYR A  55  ? 1.3415 1.5055 1.4518 -0.0818 -0.0327 -0.1862 52   TYR A CA  
291  C  C   . TYR A  55  ? 1.3601 1.5464 1.4705 -0.0763 -0.0344 -0.1792 52   TYR A C   
292  O  O   . TYR A  55  ? 1.3474 1.5602 1.4584 -0.0799 -0.0349 -0.1732 52   TYR A O   
293  C  CB  . TYR A  55  ? 1.3699 1.5289 1.4809 -0.0866 -0.0312 -0.2037 52   TYR A CB  
294  C  CG  . TYR A  55  ? 1.4125 1.5483 1.5235 -0.0925 -0.0290 -0.2111 52   TYR A CG  
295  C  CD1 . TYR A  55  ? 1.4365 1.5821 1.5474 -0.1038 -0.0279 -0.2134 52   TYR A CD1 
296  C  CD2 . TYR A  55  ? 1.4362 1.5407 1.5475 -0.0870 -0.0278 -0.2156 52   TYR A CD2 
297  C  CE1 . TYR A  55  ? 1.4594 1.5829 1.5702 -0.1100 -0.0257 -0.2200 52   TYR A CE1 
298  C  CE2 . TYR A  55  ? 1.4570 1.5389 1.5685 -0.0923 -0.0254 -0.2217 52   TYR A CE2 
299  C  CZ  . TYR A  55  ? 1.5527 1.6436 1.6639 -0.1042 -0.0244 -0.2240 52   TYR A CZ  
300  O  OH  . TYR A  55  ? 1.5790 1.6469 1.6903 -0.1101 -0.0218 -0.2299 52   TYR A OH  
301  N  N   . HIS A  56  ? 1.2988 1.4745 1.4088 -0.0676 -0.0351 -0.1791 53   HIS A N   
302  C  CA  . HIS A  56  ? 1.2828 1.4755 1.3926 -0.0619 -0.0365 -0.1723 53   HIS A CA  
303  C  C   . HIS A  56  ? 1.3157 1.5094 1.4248 -0.0573 -0.0370 -0.1556 53   HIS A C   
304  O  O   . HIS A  56  ? 1.3224 1.4979 1.4309 -0.0560 -0.0364 -0.1499 53   HIS A O   
305  C  CB  . HIS A  56  ? 1.2958 1.4750 1.4049 -0.0544 -0.0370 -0.1773 53   HIS A CB  
306  N  N   . LYS A  57  ? 1.2370 1.4525 1.3464 -0.0549 -0.0377 -0.1479 54   LYS A N   
307  C  CA  . LYS A  57  ? 1.2105 1.4300 1.3198 -0.0502 -0.0375 -0.1322 54   LYS A CA  
308  C  C   . LYS A  57  ? 1.2276 1.4193 1.3350 -0.0425 -0.0372 -0.1257 54   LYS A C   
309  O  O   . LYS A  57  ? 1.2327 1.4091 1.3390 -0.0381 -0.0377 -0.1306 54   LYS A O   
310  C  CB  . LYS A  57  ? 1.2210 1.4653 1.3309 -0.0483 -0.0381 -0.1265 54   LYS A CB  
311  C  CG  . LYS A  57  ? 1.2394 1.4956 1.3502 -0.0460 -0.0372 -0.1111 54   LYS A CG  
312  C  CD  . LYS A  57  ? 1.2677 1.5352 1.3785 -0.0408 -0.0373 -0.1034 54   LYS A CD  
313  C  CE  . LYS A  57  ? 1.3785 1.6650 1.4912 -0.0399 -0.0361 -0.0895 54   LYS A CE  
314  N  NZ  . LYS A  57  ? 1.5329 1.8333 1.6461 -0.0360 -0.0360 -0.0823 54   LYS A NZ  
315  N  N   . LYS A  58  ? 1.1375 1.3248 1.2448 -0.0410 -0.0364 -0.1148 55   LYS A N   
316  C  CA  . LYS A  58  ? 1.1159 1.2803 1.2216 -0.0346 -0.0357 -0.1072 55   LYS A CA  
317  C  C   . LYS A  58  ? 1.1036 1.2690 1.2082 -0.0278 -0.0355 -0.0999 55   LYS A C   
318  O  O   . LYS A  58  ? 1.0961 1.2812 1.2017 -0.0276 -0.0351 -0.0933 55   LYS A O   
319  C  CB  . LYS A  58  ? 1.1423 1.3061 1.2486 -0.0361 -0.0346 -0.0985 55   LYS A CB  
320  C  CG  . LYS A  58  ? 1.3000 1.4436 1.4058 -0.0389 -0.0346 -0.1029 55   LYS A CG  
321  C  CD  . LYS A  58  ? 1.4495 1.6057 1.5566 -0.0473 -0.0344 -0.1053 55   LYS A CD  
322  C  CE  . LYS A  58  ? 1.6188 1.7828 1.7264 -0.0471 -0.0334 -0.0936 55   LYS A CE  
323  N  NZ  . LYS A  58  ? 1.7152 1.8947 1.8240 -0.0560 -0.0333 -0.0962 55   LYS A NZ  
324  N  N   . SER A  59  ? 1.0136 1.1587 1.1162 -0.0226 -0.0356 -0.1009 56   SER A N   
325  C  CA  . SER A  59  ? 0.9855 1.1284 1.0864 -0.0167 -0.0352 -0.0949 56   SER A CA  
326  C  C   . SER A  59  ? 0.9855 1.1182 1.0855 -0.0131 -0.0333 -0.0835 56   SER A C   
327  O  O   . SER A  59  ? 0.9815 1.1061 1.0819 -0.0144 -0.0327 -0.0814 56   SER A O   
328  C  CB  . SER A  59  ? 1.0380 1.1647 1.1370 -0.0133 -0.0360 -0.1019 56   SER A CB  
329  O  OG  . SER A  59  ? 1.2054 1.3398 1.3054 -0.0158 -0.0374 -0.1132 56   SER A OG  
330  N  N   . ALA A  60  ? 0.9039 1.0361 1.0023 -0.0087 -0.0321 -0.0765 57   ALA A N   
331  C  CA  . ALA A  60  ? 0.8818 1.0027 0.9791 -0.0049 -0.0297 -0.0667 57   ALA A CA  
332  C  C   . ALA A  60  ? 0.8846 0.9827 0.9801 -0.0031 -0.0300 -0.0699 57   ALA A C   
333  O  O   . ALA A  60  ? 0.8884 0.9771 0.9838 -0.0024 -0.0287 -0.0651 57   ALA A O   
334  C  CB  . ALA A  60  ? 0.8902 1.0135 0.9860 -0.0014 -0.0282 -0.0607 57   ALA A CB  
335  N  N   . PHE A  61  ? 0.7941 0.8848 0.8882 -0.0024 -0.0316 -0.0782 58   PHE A N   
336  C  CA  . PHE A  61  ? 0.7848 0.8559 0.8776 -0.0004 -0.0320 -0.0815 58   PHE A CA  
337  C  C   . PHE A  61  ? 0.8538 0.9184 0.9484 -0.0035 -0.0325 -0.0835 58   PHE A C   
338  O  O   . PHE A  61  ? 0.8757 0.9258 0.9696 -0.0020 -0.0318 -0.0805 58   PHE A O   
339  C  CB  . PHE A  61  ? 0.8009 0.8690 0.8927 0.0014  -0.0336 -0.0898 58   PHE A CB  
340  C  CG  . PHE A  61  ? 0.8227 0.8730 0.9140 0.0033  -0.0342 -0.0941 58   PHE A CG  
341  C  CD1 . PHE A  61  ? 0.8688 0.9064 0.9579 0.0071  -0.0334 -0.0900 58   PHE A CD1 
342  C  CD2 . PHE A  61  ? 0.8439 0.8904 0.9373 0.0012  -0.0353 -0.1018 58   PHE A CD2 
343  C  CE1 . PHE A  61  ? 0.8825 0.9052 0.9716 0.0092  -0.0339 -0.0927 58   PHE A CE1 
344  C  CE2 . PHE A  61  ? 0.8823 0.9117 0.9758 0.0034  -0.0355 -0.1045 58   PHE A CE2 
345  C  CZ  . PHE A  61  ? 0.8645 0.8828 0.9560 0.0077  -0.0349 -0.0994 58   PHE A CZ  
346  N  N   . GLN A  62  ? 0.7893 0.8653 0.8861 -0.0082 -0.0334 -0.0887 59   GLN A N   
347  C  CA  . GLN A  62  ? 0.7780 0.8496 0.8764 -0.0127 -0.0337 -0.0915 59   GLN A CA  
348  C  C   . GLN A  62  ? 0.7867 0.8600 0.8855 -0.0136 -0.0324 -0.0822 59   GLN A C   
349  O  O   . GLN A  62  ? 0.7670 0.8287 0.8660 -0.0151 -0.0322 -0.0817 59   GLN A O   
350  C  CB  . GLN A  62  ? 0.7937 0.8792 0.8940 -0.0184 -0.0347 -0.1001 59   GLN A CB  
351  C  CG  . GLN A  62  ? 0.9564 1.0370 1.0565 -0.0172 -0.0358 -0.1105 59   GLN A CG  
352  C  CD  . GLN A  62  ? 1.1708 1.2639 1.2727 -0.0231 -0.0363 -0.1205 59   GLN A CD  
353  O  OE1 . GLN A  62  ? 1.0673 1.1763 1.1705 -0.0287 -0.0362 -0.1199 59   GLN A OE1 
354  N  NE2 . GLN A  62  ? 1.1467 1.2338 1.2488 -0.0219 -0.0368 -0.1302 59   GLN A NE2 
355  N  N   . VAL A  63  ? 0.7299 0.8173 0.8289 -0.0123 -0.0311 -0.0745 60   VAL A N   
356  C  CA  . VAL A  63  ? 0.7121 0.8028 0.8116 -0.0118 -0.0293 -0.0648 60   VAL A CA  
357  C  C   . VAL A  63  ? 0.7702 0.8412 0.8679 -0.0077 -0.0282 -0.0607 60   VAL A C   
358  O  O   . VAL A  63  ? 0.7799 0.8442 0.8779 -0.0091 -0.0279 -0.0584 60   VAL A O   
359  C  CB  . VAL A  63  ? 0.7429 0.8511 0.8433 -0.0099 -0.0278 -0.0570 60   VAL A CB  
360  C  CG1 . VAL A  63  ? 0.7377 0.8470 0.8388 -0.0077 -0.0253 -0.0467 60   VAL A CG1 
361  C  CG2 . VAL A  63  ? 0.7312 0.8621 0.8338 -0.0145 -0.0289 -0.0605 60   VAL A CG2 
362  N  N   . TYR A  64  ? 0.6967 0.7592 0.7923 -0.0033 -0.0277 -0.0604 61   TYR A N   
363  C  CA  . TYR A  64  ? 0.6911 0.7366 0.7845 0.0003  -0.0266 -0.0576 61   TYR A CA  
364  C  C   . TYR A  64  ? 0.7873 0.8192 0.8808 -0.0012 -0.0282 -0.0626 61   TYR A C   
365  O  O   . TYR A  64  ? 0.8046 0.8267 0.8976 -0.0004 -0.0274 -0.0587 61   TYR A O   
366  C  CB  . TYR A  64  ? 0.6912 0.7331 0.7821 0.0040  -0.0259 -0.0579 61   TYR A CB  
367  C  CG  . TYR A  64  ? 0.6641 0.7158 0.7548 0.0057  -0.0236 -0.0514 61   TYR A CG  
368  C  CD1 . TYR A  64  ? 0.6772 0.7286 0.7682 0.0074  -0.0207 -0.0431 61   TYR A CD1 
369  C  CD2 . TYR A  64  ? 0.6546 0.7150 0.7447 0.0061  -0.0240 -0.0534 61   TYR A CD2 
370  C  CE1 . TYR A  64  ? 0.6541 0.7128 0.7452 0.0095  -0.0180 -0.0366 61   TYR A CE1 
371  C  CE2 . TYR A  64  ? 0.6566 0.7250 0.7467 0.0077  -0.0216 -0.0467 61   TYR A CE2 
372  C  CZ  . TYR A  64  ? 0.7313 0.7980 0.8219 0.0096  -0.0184 -0.0381 61   TYR A CZ  
373  O  OH  . TYR A  64  ? 0.7740 0.8470 0.8649 0.0117  -0.0155 -0.0310 61   TYR A OH  
374  N  N   . MET A  65  ? 0.7583 0.7898 0.8526 -0.0032 -0.0302 -0.0710 62   MET A N   
375  C  CA  . MET A  65  ? 0.7569 0.7750 0.8518 -0.0045 -0.0314 -0.0760 62   MET A CA  
376  C  C   . MET A  65  ? 0.7488 0.7655 0.8452 -0.0090 -0.0312 -0.0738 62   MET A C   
377  O  O   . MET A  65  ? 0.7498 0.7533 0.8460 -0.0084 -0.0311 -0.0718 62   MET A O   
378  C  CB  . MET A  65  ? 0.7974 0.8164 0.8933 -0.0058 -0.0329 -0.0859 62   MET A CB  
379  C  CG  . MET A  65  ? 0.8656 0.8750 0.9601 -0.0008 -0.0334 -0.0895 62   MET A CG  
380  S  SD  . MET A  65  ? 0.9481 0.9406 1.0407 0.0041  -0.0328 -0.0839 62   MET A SD  
381  C  CE  . MET A  65  ? 0.9068 0.8863 1.0015 0.0010  -0.0329 -0.0835 62   MET A CE  
382  N  N   . ILE A  66  ? 0.6675 0.6993 0.7655 -0.0136 -0.0312 -0.0739 63   ILE A N   
383  C  CA  . ILE A  66  ? 0.6624 0.6964 0.7617 -0.0188 -0.0311 -0.0719 63   ILE A CA  
384  C  C   . ILE A  66  ? 0.6936 0.7232 0.7921 -0.0161 -0.0297 -0.0624 63   ILE A C   
385  O  O   . ILE A  66  ? 0.6785 0.6992 0.7772 -0.0182 -0.0298 -0.0608 63   ILE A O   
386  C  CB  . ILE A  66  ? 0.6987 0.7540 0.7996 -0.0241 -0.0312 -0.0731 63   ILE A CB  
387  C  CG1 . ILE A  66  ? 0.7037 0.7639 0.8054 -0.0278 -0.0324 -0.0837 63   ILE A CG1 
388  C  CG2 . ILE A  66  ? 0.7003 0.7604 0.8022 -0.0296 -0.0309 -0.0700 63   ILE A CG2 
389  C  CD1 . ILE A  66  ? 0.8013 0.8858 0.9041 -0.0305 -0.0324 -0.0842 63   ILE A CD1 
390  N  N   . ASN A  67  ? 0.6321 0.6676 0.7297 -0.0115 -0.0281 -0.0562 64   ASN A N   
391  C  CA  . ASN A  67  ? 0.6148 0.6469 0.7116 -0.0082 -0.0261 -0.0478 64   ASN A CA  
392  C  C   . ASN A  67  ? 0.6507 0.6650 0.7458 -0.0055 -0.0260 -0.0474 64   ASN A C   
393  O  O   . ASN A  67  ? 0.6443 0.6543 0.7394 -0.0057 -0.0252 -0.0426 64   ASN A O   
394  C  CB  . ASN A  67  ? 0.5625 0.6037 0.6588 -0.0041 -0.0240 -0.0424 64   ASN A CB  
395  C  CG  . ASN A  67  ? 0.7923 0.8520 0.8908 -0.0064 -0.0234 -0.0387 64   ASN A CG  
396  O  OD1 . ASN A  67  ? 0.8065 0.8705 0.9058 -0.0062 -0.0219 -0.0324 64   ASN A OD1 
397  N  ND2 . ASN A  67  ? 0.6174 0.6900 0.7170 -0.0088 -0.0246 -0.0427 64   ASN A ND2 
398  N  N   . LEU A  68  ? 0.5878 0.5934 0.6817 -0.0032 -0.0269 -0.0522 65   LEU A N   
399  C  CA  . LEU A  68  ? 0.5888 0.5795 0.6813 -0.0006 -0.0271 -0.0522 65   LEU A CA  
400  C  C   . LEU A  68  ? 0.6574 0.6397 0.7514 -0.0041 -0.0285 -0.0539 65   LEU A C   
401  O  O   . LEU A  68  ? 0.6784 0.6534 0.7721 -0.0035 -0.0280 -0.0495 65   LEU A O   
402  C  CB  . LEU A  68  ? 0.5896 0.5760 0.6808 0.0024  -0.0279 -0.0574 65   LEU A CB  
403  C  CG  . LEU A  68  ? 0.6471 0.6363 0.7359 0.0062  -0.0263 -0.0550 65   LEU A CG  
404  C  CD1 . LEU A  68  ? 0.6413 0.6312 0.7293 0.0079  -0.0275 -0.0608 65   LEU A CD1 
405  C  CD2 . LEU A  68  ? 0.7013 0.6819 0.7882 0.0087  -0.0247 -0.0504 65   LEU A CD2 
406  N  N   . ALA A  69  ? 0.5967 0.5806 0.6924 -0.0080 -0.0299 -0.0602 66   ALA A N   
407  C  CA  . ALA A  69  ? 0.6133 0.5888 0.7106 -0.0123 -0.0309 -0.0626 66   ALA A CA  
408  C  C   . ALA A  69  ? 0.6913 0.6695 0.7890 -0.0159 -0.0303 -0.0564 66   ALA A C   
409  O  O   . ALA A  69  ? 0.6970 0.6644 0.7950 -0.0164 -0.0304 -0.0538 66   ALA A O   
410  C  CB  . ALA A  69  ? 0.6244 0.6046 0.7232 -0.0169 -0.0318 -0.0709 66   ALA A CB  
411  N  N   . VAL A  70  ? 0.6366 0.6302 0.7345 -0.0177 -0.0295 -0.0532 67   VAL A N   
412  C  CA  . VAL A  70  ? 0.6207 0.6210 0.7192 -0.0206 -0.0287 -0.0470 67   VAL A CA  
413  C  C   . VAL A  70  ? 0.6988 0.6929 0.7960 -0.0161 -0.0274 -0.0399 67   VAL A C   
414  O  O   . VAL A  70  ? 0.6993 0.6895 0.7968 -0.0185 -0.0275 -0.0365 67   VAL A O   
415  C  CB  . VAL A  70  ? 0.6497 0.6699 0.7490 -0.0225 -0.0280 -0.0452 67   VAL A CB  
416  C  CG1 . VAL A  70  ? 0.6411 0.6696 0.7409 -0.0242 -0.0269 -0.0379 67   VAL A CG1 
417  C  CG2 . VAL A  70  ? 0.6479 0.6756 0.7485 -0.0286 -0.0293 -0.0527 67   VAL A CG2 
418  N  N   . ALA A  71  ? 0.6669 0.6602 0.7626 -0.0102 -0.0260 -0.0380 68   ALA A N   
419  C  CA  . ALA A  71  ? 0.6777 0.6654 0.7719 -0.0061 -0.0243 -0.0326 68   ALA A CA  
420  C  C   . ALA A  71  ? 0.7542 0.7280 0.8480 -0.0060 -0.0255 -0.0334 68   ALA A C   
421  O  O   . ALA A  71  ? 0.7788 0.7495 0.8722 -0.0056 -0.0247 -0.0286 68   ALA A O   
422  C  CB  . ALA A  71  ? 0.6851 0.6742 0.7775 -0.0009 -0.0225 -0.0320 68   ALA A CB  
423  N  N   . ASP A  72  ? 0.6958 0.6620 0.7900 -0.0063 -0.0272 -0.0392 69   ASP A N   
424  C  CA  . ASP A  72  ? 0.6910 0.6442 0.7854 -0.0058 -0.0283 -0.0397 69   ASP A CA  
425  C  C   . ASP A  72  ? 0.7550 0.7045 0.8512 -0.0111 -0.0291 -0.0380 69   ASP A C   
426  O  O   . ASP A  72  ? 0.7671 0.7105 0.8633 -0.0106 -0.0291 -0.0335 69   ASP A O   
427  C  CB  . ASP A  72  ? 0.7015 0.6484 0.7963 -0.0042 -0.0295 -0.0464 69   ASP A CB  
428  C  CG  . ASP A  72  ? 0.6723 0.6210 0.7651 0.0011  -0.0289 -0.0478 69   ASP A CG  
429  O  OD1 . ASP A  72  ? 0.6406 0.5934 0.7315 0.0033  -0.0273 -0.0437 69   ASP A OD1 
430  O  OD2 . ASP A  72  ? 0.7241 0.6699 0.8171 0.0027  -0.0299 -0.0532 69   ASP A OD2 
431  N  N   . LEU A  73  ? 0.7071 0.6615 0.8048 -0.0166 -0.0298 -0.0415 70   LEU A N   
432  C  CA  . LEU A  73  ? 0.7108 0.6623 0.8100 -0.0231 -0.0305 -0.0407 70   LEU A CA  
433  C  C   . LEU A  73  ? 0.8164 0.7747 0.9152 -0.0246 -0.0297 -0.0331 70   LEU A C   
434  O  O   . LEU A  73  ? 0.8170 0.7686 0.9164 -0.0272 -0.0301 -0.0298 70   LEU A O   
435  C  CB  . LEU A  73  ? 0.6955 0.6518 0.7958 -0.0295 -0.0310 -0.0471 70   LEU A CB  
436  C  CG  . LEU A  73  ? 0.7405 0.6877 0.8416 -0.0289 -0.0316 -0.0555 70   LEU A CG  
437  C  CD1 . LEU A  73  ? 0.7367 0.6893 0.8389 -0.0362 -0.0318 -0.0625 70   LEU A CD1 
438  C  CD2 . LEU A  73  ? 0.7584 0.6872 0.8604 -0.0269 -0.0319 -0.0553 70   LEU A CD2 
439  N  N   . LEU A  74  ? 0.8055 0.7769 0.9035 -0.0224 -0.0284 -0.0300 71   LEU A N   
440  C  CA  . LEU A  74  ? 0.8130 0.7923 0.9106 -0.0220 -0.0271 -0.0229 71   LEU A CA  
441  C  C   . LEU A  74  ? 0.8721 0.8419 0.9689 -0.0192 -0.0268 -0.0185 71   LEU A C   
442  O  O   . LEU A  74  ? 0.8894 0.8609 0.9865 -0.0218 -0.0267 -0.0138 71   LEU A O   
443  C  CB  . LEU A  74  ? 0.8149 0.8060 0.9118 -0.0174 -0.0250 -0.0209 71   LEU A CB  
444  C  CG  . LEU A  74  ? 0.8868 0.8815 0.9826 -0.0129 -0.0226 -0.0144 71   LEU A CG  
445  C  CD1 . LEU A  74  ? 0.8918 0.8970 0.9887 -0.0161 -0.0221 -0.0093 71   LEU A CD1 
446  C  CD2 . LEU A  74  ? 0.9169 0.9175 1.0120 -0.0075 -0.0202 -0.0137 71   LEU A CD2 
447  N  N   . CYS A  75  ? 0.8106 0.7722 0.9063 -0.0143 -0.0266 -0.0201 72   CYS A N   
448  C  CA  . CYS A  75  ? 0.8103 0.7652 0.9052 -0.0114 -0.0262 -0.0165 72   CYS A CA  
449  C  C   . CYS A  75  ? 0.8888 0.8320 0.9850 -0.0138 -0.0281 -0.0165 72   CYS A C   
450  O  O   . CYS A  75  ? 0.8782 0.8196 0.9746 -0.0144 -0.0280 -0.0113 72   CYS A O   
451  C  CB  . CYS A  75  ? 0.8115 0.7649 0.9044 -0.0056 -0.0250 -0.0182 72   CYS A CB  
452  S  SG  . CYS A  75  ? 0.8620 0.8079 0.9537 -0.0024 -0.0248 -0.0155 72   CYS A SG  
453  N  N   . VAL A  76  ? 0.8626 0.7980 0.9600 -0.0149 -0.0294 -0.0220 73   VAL A N   
454  C  CA  . VAL A  76  ? 0.8674 0.7899 0.9666 -0.0166 -0.0306 -0.0218 73   VAL A CA  
455  C  C   . VAL A  76  ? 0.9319 0.8543 1.0324 -0.0233 -0.0310 -0.0181 73   VAL A C   
456  O  O   . VAL A  76  ? 0.9370 0.8511 1.0386 -0.0242 -0.0314 -0.0140 73   VAL A O   
457  C  CB  . VAL A  76  ? 0.9141 0.8266 1.0145 -0.0158 -0.0313 -0.0286 73   VAL A CB  
458  C  CG1 . VAL A  76  ? 0.9112 0.8306 1.0111 -0.0164 -0.0312 -0.0354 73   VAL A CG1 
459  C  CG2 . VAL A  76  ? 0.9147 0.8159 1.0175 -0.0208 -0.0319 -0.0292 73   VAL A CG2 
460  N  N   . CYS A  77  ? 0.8827 0.8155 0.9831 -0.0281 -0.0308 -0.0188 74   CYS A N   
461  C  CA  . CYS A  77  ? 0.8769 0.8121 0.9782 -0.0351 -0.0312 -0.0155 74   CYS A CA  
462  C  C   . CYS A  77  ? 0.8776 0.8186 0.9783 -0.0343 -0.0307 -0.0074 74   CYS A C   
463  O  O   . CYS A  77  ? 0.8548 0.7961 0.9563 -0.0399 -0.0312 -0.0036 74   CYS A O   
464  C  CB  . CYS A  77  ? 0.8935 0.8405 0.9948 -0.0404 -0.0311 -0.0190 74   CYS A CB  
465  S  SG  . CYS A  77  ? 0.9603 0.9002 1.0626 -0.0441 -0.0316 -0.0291 74   CYS A SG  
466  N  N   . THR A  78  ? 0.8134 0.7585 0.9126 -0.0278 -0.0296 -0.0050 75   THR A N   
467  C  CA  . THR A  78  ? 0.7979 0.7488 0.8964 -0.0264 -0.0288 0.0018  75   THR A CA  
468  C  C   . THR A  78  ? 0.8429 0.7847 0.9416 -0.0234 -0.0292 0.0048  75   THR A C   
469  O  O   . THR A  78  ? 0.8398 0.7845 0.9387 -0.0246 -0.0292 0.0107  75   THR A O   
470  C  CB  . THR A  78  ? 0.7648 0.7275 0.8616 -0.0221 -0.0266 0.0026  75   THR A CB  
471  O  OG1 . THR A  78  ? 0.7205 0.6797 0.8160 -0.0164 -0.0257 -0.0012 75   THR A OG1 
472  C  CG2 . THR A  78  ? 0.7169 0.6914 0.8140 -0.0249 -0.0261 0.0020  75   THR A CG2 
473  N  N   . LEU A  79  ? 0.7902 0.7228 0.8889 -0.0196 -0.0296 0.0011  76   LEU A N   
474  C  CA  . LEU A  79  ? 0.7782 0.7035 0.8773 -0.0161 -0.0299 0.0040  76   LEU A CA  
475  C  C   . LEU A  79  ? 0.8146 0.7329 0.9160 -0.0200 -0.0311 0.0094  76   LEU A C   
476  O  O   . LEU A  79  ? 0.7842 0.7043 0.8857 -0.0182 -0.0310 0.0152  76   LEU A O   
477  C  CB  . LEU A  79  ? 0.7739 0.6916 0.8729 -0.0113 -0.0302 -0.0011 76   LEU A CB  
478  C  CG  . LEU A  79  ? 0.8228 0.7467 0.9193 -0.0067 -0.0289 -0.0052 76   LEU A CG  
479  C  CD1 . LEU A  79  ? 0.8231 0.7399 0.9198 -0.0026 -0.0295 -0.0095 76   LEU A CD1 
480  C  CD2 . LEU A  79  ? 0.8223 0.7544 0.9168 -0.0040 -0.0274 -0.0014 76   LEU A CD2 
481  N  N   . PRO A  80  ? 0.7978 0.7089 0.9010 -0.0259 -0.0320 0.0081  77   PRO A N   
482  C  CA  . PRO A  80  ? 0.7970 0.7011 0.9024 -0.0301 -0.0327 0.0141  77   PRO A CA  
483  C  C   . PRO A  80  ? 0.8395 0.7548 0.9443 -0.0326 -0.0326 0.0216  77   PRO A C   
484  O  O   . PRO A  80  ? 0.8387 0.7503 0.9450 -0.0333 -0.0331 0.0282  77   PRO A O   
485  C  CB  . PRO A  80  ? 0.8196 0.7167 0.9262 -0.0371 -0.0330 0.0097  77   PRO A CB  
486  C  CG  . PRO A  80  ? 0.8742 0.7704 0.9800 -0.0346 -0.0327 0.0010  77   PRO A CG  
487  C  CD  . PRO A  80  ? 0.8193 0.7290 0.9227 -0.0296 -0.0321 0.0011  77   PRO A CD  
488  N  N   . LEU A  81  ? 0.7910 0.7204 0.8939 -0.0332 -0.0319 0.0209  78   LEU A N   
489  C  CA  . LEU A  81  ? 0.7905 0.7322 0.8927 -0.0345 -0.0314 0.0272  78   LEU A CA  
490  C  C   . LEU A  81  ? 0.8595 0.8040 0.9609 -0.0288 -0.0308 0.0307  78   LEU A C   
491  O  O   . LEU A  81  ? 0.8566 0.8052 0.9587 -0.0304 -0.0311 0.0373  78   LEU A O   
492  C  CB  . LEU A  81  ? 0.7882 0.7441 0.8888 -0.0351 -0.0302 0.0255  78   LEU A CB  
493  C  CG  . LEU A  81  ? 0.8522 0.8114 0.9532 -0.0413 -0.0307 0.0229  78   LEU A CG  
494  C  CD1 . LEU A  81  ? 0.8497 0.8253 0.9495 -0.0402 -0.0292 0.0232  78   LEU A CD1 
495  C  CD2 . LEU A  81  ? 0.8906 0.8468 0.9931 -0.0493 -0.0321 0.0271  78   LEU A CD2 
496  N  N   . ARG A  82  ? 0.8362 0.7794 0.9362 -0.0227 -0.0298 0.0262  79   ARG A N   
497  C  CA  . ARG A  82  ? 0.8399 0.7863 0.9389 -0.0177 -0.0290 0.0282  79   ARG A CA  
498  C  C   . ARG A  82  ? 0.9099 0.8486 1.0112 -0.0178 -0.0304 0.0337  79   ARG A C   
499  O  O   . ARG A  82  ? 0.8893 0.8347 0.9907 -0.0172 -0.0303 0.0394  79   ARG A O   
500  C  CB  . ARG A  82  ? 0.8184 0.7630 0.9156 -0.0123 -0.0279 0.0218  79   ARG A CB  
501  C  CG  . ARG A  82  ? 0.8620 0.8165 0.9564 -0.0102 -0.0255 0.0190  79   ARG A CG  
502  C  CD  . ARG A  82  ? 0.9054 0.8568 0.9982 -0.0062 -0.0246 0.0125  79   ARG A CD  
503  N  NE  . ARG A  82  ? 0.8501 0.8076 0.9414 -0.0056 -0.0226 0.0093  79   ARG A NE  
504  C  CZ  . ARG A  82  ? 0.9358 0.8994 1.0247 -0.0029 -0.0197 0.0083  79   ARG A CZ  
505  N  NH1 . ARG A  82  ? 0.6766 0.6423 0.7641 -0.0011 -0.0188 0.0093  79   ARG A NH1 
506  N  NH2 . ARG A  82  ? 0.8069 0.7748 0.8949 -0.0019 -0.0176 0.0063  79   ARG A NH2 
507  N  N   . VAL A  83  ? 0.9022 0.8272 1.0056 -0.0187 -0.0316 0.0320  80   VAL A N   
508  C  CA  . VAL A  83  ? 0.9171 0.8320 1.0234 -0.0183 -0.0326 0.0374  80   VAL A CA  
509  C  C   . VAL A  83  ? 0.9675 0.8859 1.0753 -0.0235 -0.0332 0.0460  80   VAL A C   
510  O  O   . VAL A  83  ? 0.9680 0.8895 1.0770 -0.0216 -0.0334 0.0530  80   VAL A O   
511  C  CB  . VAL A  83  ? 0.9749 0.8733 1.0832 -0.0187 -0.0330 0.0330  80   VAL A CB  
512  C  CG1 . VAL A  83  ? 0.9720 0.8587 1.0837 -0.0171 -0.0334 0.0392  80   VAL A CG1 
513  C  CG2 . VAL A  83  ? 0.9736 0.8706 1.0804 -0.0137 -0.0325 0.0246  80   VAL A CG2 
514  N  N   . VAL A  84  ? 0.9171 0.8373 1.0249 -0.0301 -0.0335 0.0457  81   VAL A N   
515  C  CA  . VAL A  84  ? 0.9153 0.8401 1.0242 -0.0363 -0.0342 0.0532  81   VAL A CA  
516  C  C   . VAL A  84  ? 0.9676 0.9090 1.0752 -0.0346 -0.0337 0.0585  81   VAL A C   
517  O  O   . VAL A  84  ? 0.9674 0.9121 1.0766 -0.0371 -0.0344 0.0666  81   VAL A O   
518  C  CB  . VAL A  84  ? 0.9652 0.8913 1.0737 -0.0437 -0.0344 0.0503  81   VAL A CB  
519  C  CG1 . VAL A  84  ? 0.9608 0.8958 1.0697 -0.0501 -0.0351 0.0578  81   VAL A CG1 
520  C  CG2 . VAL A  84  ? 0.9636 0.8729 1.0737 -0.0470 -0.0347 0.0457  81   VAL A CG2 
521  N  N   . TYR A  85  ? 0.9187 0.8703 1.0236 -0.0305 -0.0324 0.0537  82   TYR A N   
522  C  CA  . TYR A  85  ? 0.9158 0.8830 1.0191 -0.0286 -0.0312 0.0564  82   TYR A CA  
523  C  C   . TYR A  85  ? 0.9837 0.9527 1.0877 -0.0249 -0.0313 0.0611  82   TYR A C   
524  O  O   . TYR A  85  ? 0.9896 0.9696 1.0938 -0.0263 -0.0313 0.0673  82   TYR A O   
525  C  CB  . TYR A  85  ? 0.9265 0.9006 1.0267 -0.0252 -0.0290 0.0491  82   TYR A CB  
526  C  CG  . TYR A  85  ? 0.9410 0.9288 1.0392 -0.0224 -0.0270 0.0497  82   TYR A CG  
527  C  CD1 . TYR A  85  ? 0.9658 0.9666 1.0636 -0.0251 -0.0261 0.0530  82   TYR A CD1 
528  C  CD2 . TYR A  85  ? 0.9455 0.9338 1.0419 -0.0175 -0.0256 0.0463  82   TYR A CD2 
529  C  CE1 . TYR A  85  ? 0.9704 0.9836 1.0663 -0.0228 -0.0237 0.0526  82   TYR A CE1 
530  C  CE2 . TYR A  85  ? 0.9518 0.9525 1.0461 -0.0158 -0.0233 0.0459  82   TYR A CE2 
531  C  CZ  . TYR A  85  ? 1.0332 1.0459 1.1273 -0.0184 -0.0222 0.0488  82   TYR A CZ  
532  O  OH  . TYR A  85  ? 1.0368 1.0615 1.1288 -0.0170 -0.0195 0.0475  82   TYR A OH  
533  N  N   . TYR A  86  ? 0.9492 0.9093 1.0533 -0.0200 -0.0313 0.0581  83   TYR A N   
534  C  CA  . TYR A  86  ? 0.9543 0.9173 1.0590 -0.0158 -0.0313 0.0622  83   TYR A CA  
535  C  C   . TYR A  86  ? 1.0520 1.0074 1.1606 -0.0170 -0.0329 0.0712  83   TYR A C   
536  O  O   . TYR A  86  ? 1.0588 1.0216 1.1686 -0.0147 -0.0330 0.0778  83   TYR A O   
537  C  CB  . TYR A  86  ? 0.9619 0.9209 1.0651 -0.0100 -0.0305 0.0554  83   TYR A CB  
538  C  CG  . TYR A  86  ? 0.9716 0.9396 1.0709 -0.0088 -0.0284 0.0482  83   TYR A CG  
539  C  CD1 . TYR A  86  ? 0.9885 0.9713 1.0857 -0.0085 -0.0268 0.0494  83   TYR A CD1 
540  C  CD2 . TYR A  86  ? 0.9863 0.9481 1.0842 -0.0080 -0.0278 0.0404  83   TYR A CD2 
541  C  CE1 . TYR A  86  ? 0.9917 0.9809 1.0855 -0.0074 -0.0242 0.0426  83   TYR A CE1 
542  C  CE2 . TYR A  86  ? 0.9962 0.9650 1.0908 -0.0067 -0.0255 0.0346  83   TYR A CE2 
543  C  CZ  . TYR A  86  ? 1.0521 1.0337 1.1447 -0.0063 -0.0236 0.0357  83   TYR A CZ  
544  O  OH  . TYR A  86  ? 1.0172 1.0040 1.1067 -0.0050 -0.0207 0.0298  83   TYR A OH  
545  N  N   . VAL A  87  ? 1.0285 0.9701 1.1393 -0.0208 -0.0339 0.0717  84   VAL A N   
546  C  CA  . VAL A  87  ? 1.0338 0.9655 1.1485 -0.0231 -0.0349 0.0801  84   VAL A CA  
547  C  C   . VAL A  87  ? 1.1134 1.0577 1.2285 -0.0285 -0.0354 0.0885  84   VAL A C   
548  O  O   . VAL A  87  ? 1.1134 1.0583 1.2313 -0.0287 -0.0360 0.0981  84   VAL A O   
549  C  CB  . VAL A  87  ? 1.0795 0.9920 1.1957 -0.0264 -0.0351 0.0758  84   VAL A CB  
550  C  CG1 . VAL A  87  ? 1.0783 0.9828 1.1974 -0.0330 -0.0358 0.0835  84   VAL A CG1 
551  C  CG2 . VAL A  87  ? 1.0770 0.9756 1.1944 -0.0202 -0.0346 0.0717  84   VAL A CG2 
552  N  N   . HIS A  88  ? 1.0946 1.0508 1.2071 -0.0320 -0.0351 0.0851  85   HIS A N   
553  C  CA  . HIS A  88  ? 1.1060 1.0767 1.2184 -0.0369 -0.0354 0.0914  85   HIS A CA  
554  C  C   . HIS A  88  ? 1.1665 1.1563 1.2773 -0.0338 -0.0345 0.0934  85   HIS A C   
555  O  O   . HIS A  88  ? 1.1608 1.1654 1.2705 -0.0371 -0.0342 0.0955  85   HIS A O   
556  C  CB  . HIS A  88  ? 1.1231 1.0971 1.2338 -0.0422 -0.0353 0.0868  85   HIS A CB  
557  C  CG  . HIS A  88  ? 1.1795 1.1427 1.2923 -0.0492 -0.0365 0.0901  85   HIS A CG  
558  N  ND1 . HIS A  88  ? 1.2029 1.1755 1.3161 -0.0561 -0.0372 0.0962  85   HIS A ND1 
559  C  CD2 . HIS A  88  ? 1.2142 1.1581 1.3288 -0.0506 -0.0369 0.0885  85   HIS A CD2 
560  C  CE1 . HIS A  88  ? 1.2030 1.1615 1.3180 -0.0619 -0.0380 0.0978  85   HIS A CE1 
561  N  NE2 . HIS A  88  ? 1.2134 1.1539 1.3294 -0.0589 -0.0377 0.0930  85   HIS A NE2 
562  N  N   . LYS A  89  ? 1.1299 1.1200 1.2406 -0.0277 -0.0339 0.0927  86   LYS A N   
563  C  CA  . LYS A  89  ? 1.1310 1.1389 1.2399 -0.0249 -0.0327 0.0936  86   LYS A CA  
564  C  C   . LYS A  89  ? 1.1742 1.1943 1.2793 -0.0253 -0.0307 0.0859  86   LYS A C   
565  O  O   . LYS A  89  ? 1.1689 1.2060 1.2728 -0.0265 -0.0296 0.0879  86   LYS A O   
566  C  CB  . LYS A  89  ? 1.1666 1.1860 1.2781 -0.0273 -0.0338 0.1053  86   LYS A CB  
567  N  N   . GLY A  90  ? 1.1164 1.1276 1.2197 -0.0242 -0.0298 0.0772  87   GLY A N   
568  C  CA  . GLY A  90  ? 1.0998 1.1190 1.1998 -0.0235 -0.0274 0.0698  87   GLY A CA  
569  C  C   . GLY A  90  ? 1.1102 1.1382 1.2100 -0.0279 -0.0270 0.0713  87   GLY A C   
570  O  O   . GLY A  90  ? 1.1073 1.1486 1.2052 -0.0274 -0.0248 0.0692  87   GLY A O   
571  N  N   . ILE A  91  ? 1.0409 1.0617 1.1426 -0.0322 -0.0290 0.0743  88   ILE A N   
572  C  CA  . ILE A  91  ? 1.0254 1.0553 1.1270 -0.0367 -0.0288 0.0758  88   ILE A CA  
573  C  C   . ILE A  91  ? 1.0414 1.0619 1.1427 -0.0377 -0.0289 0.0704  88   ILE A C   
574  O  O   . ILE A  91  ? 1.0391 1.0457 1.1420 -0.0398 -0.0307 0.0707  88   ILE A O   
575  C  CB  . ILE A  91  ? 1.0675 1.1020 1.1715 -0.0426 -0.0310 0.0857  88   ILE A CB  
576  C  CG1 . ILE A  91  ? 1.0720 1.1184 1.1767 -0.0417 -0.0310 0.0921  88   ILE A CG1 
577  C  CG2 . ILE A  91  ? 1.0811 1.1255 1.1849 -0.0477 -0.0310 0.0871  88   ILE A CG2 
578  C  CD1 . ILE A  91  ? 1.2046 1.2697 1.3068 -0.0392 -0.0283 0.0890  88   ILE A CD1 
579  N  N   . TRP A  92  ? 0.9645 0.9927 1.0638 -0.0360 -0.0267 0.0653  89   TRP A N   
580  C  CA  . TRP A  92  ? 0.9405 0.9633 1.0396 -0.0370 -0.0267 0.0608  89   TRP A CA  
581  C  C   . TRP A  92  ? 1.0118 1.0409 1.1121 -0.0438 -0.0282 0.0654  89   TRP A C   
582  O  O   . TRP A  92  ? 1.0110 1.0545 1.1111 -0.0453 -0.0275 0.0693  89   TRP A O   
583  C  CB  . TRP A  92  ? 0.8941 0.9218 0.9911 -0.0318 -0.0236 0.0543  89   TRP A CB  
584  C  CG  . TRP A  92  ? 0.8852 0.9075 0.9822 -0.0320 -0.0237 0.0499  89   TRP A CG  
585  C  CD1 . TRP A  92  ? 0.9137 0.9448 1.0107 -0.0337 -0.0230 0.0499  89   TRP A CD1 
586  C  CD2 . TRP A  92  ? 0.8807 0.8892 0.9778 -0.0307 -0.0246 0.0452  89   TRP A CD2 
587  N  NE1 . TRP A  92  ? 0.9010 0.9255 0.9982 -0.0338 -0.0234 0.0456  89   TRP A NE1 
588  C  CE2 . TRP A  92  ? 0.9244 0.9349 1.0216 -0.0320 -0.0244 0.0423  89   TRP A CE2 
589  C  CE3 . TRP A  92  ? 0.8931 0.8894 0.9904 -0.0283 -0.0255 0.0431  89   TRP A CE3 
590  C  CZ2 . TRP A  92  ? 0.9174 0.9179 1.0147 -0.0315 -0.0251 0.0371  89   TRP A CZ2 
591  C  CZ3 . TRP A  92  ? 0.9096 0.8953 1.0071 -0.0275 -0.0262 0.0379  89   TRP A CZ3 
592  C  CH2 . TRP A  92  ? 0.9175 0.9053 1.0150 -0.0293 -0.0260 0.0348  89   TRP A CH2 
593  N  N   . LEU A  93  ? 0.9720 0.9910 1.0734 -0.0483 -0.0300 0.0647  90   LEU A N   
594  C  CA  . LEU A  93  ? 0.9736 0.9983 1.0759 -0.0560 -0.0314 0.0688  90   LEU A CA  
595  C  C   . LEU A  93  ? 1.0476 1.0724 1.1495 -0.0588 -0.0313 0.0640  90   LEU A C   
596  O  O   . LEU A  93  ? 1.0551 1.0804 1.1577 -0.0665 -0.0328 0.0663  90   LEU A O   
597  C  CB  . LEU A  93  ? 0.9778 0.9923 1.0821 -0.0618 -0.0337 0.0748  90   LEU A CB  
598  C  CG  . LEU A  93  ? 1.0536 1.0479 1.1593 -0.0604 -0.0345 0.0724  90   LEU A CG  
599  C  CD1 . LEU A  93  ? 1.0640 1.0474 1.1704 -0.0667 -0.0354 0.0692  90   LEU A CD1 
600  C  CD2 . LEU A  93  ? 1.0889 1.0774 1.1966 -0.0606 -0.0356 0.0798  90   LEU A CD2 
601  N  N   . PHE A  94  ? 0.9987 1.0244 1.0993 -0.0531 -0.0295 0.0578  91   PHE A N   
602  C  CA  . PHE A  94  ? 0.9871 1.0150 1.0875 -0.0550 -0.0293 0.0535  91   PHE A CA  
603  C  C   . PHE A  94  ? 1.0419 1.0867 1.1413 -0.0513 -0.0269 0.0530  91   PHE A C   
604  O  O   . PHE A  94  ? 1.0464 1.0957 1.1458 -0.0522 -0.0266 0.0502  91   PHE A O   
605  C  CB  . PHE A  94  ? 1.0137 1.0270 1.1141 -0.0521 -0.0294 0.0469  91   PHE A CB  
606  C  CG  . PHE A  94  ? 1.0423 1.0380 1.1439 -0.0544 -0.0313 0.0469  91   PHE A CG  
607  C  CD1 . PHE A  94  ? 1.0862 1.0747 1.1890 -0.0625 -0.0330 0.0479  91   PHE A CD1 
608  C  CD2 . PHE A  94  ? 1.0783 1.0645 1.1798 -0.0483 -0.0310 0.0458  91   PHE A CD2 
609  C  CE1 . PHE A  94  ? 1.1065 1.0774 1.2109 -0.0638 -0.0341 0.0480  91   PHE A CE1 
610  C  CE2 . PHE A  94  ? 1.1215 1.0920 1.2246 -0.0494 -0.0324 0.0464  91   PHE A CE2 
611  C  CZ  . PHE A  94  ? 1.0968 1.0590 1.2014 -0.0567 -0.0338 0.0476  91   PHE A CZ  
612  N  N   . GLY A  95  ? 0.9949 1.0494 1.0937 -0.0473 -0.0251 0.0559  92   GLY A N   
613  C  CA  . GLY A  95  ? 0.9884 1.0581 1.0866 -0.0426 -0.0221 0.0558  92   GLY A CA  
614  C  C   . GLY A  95  ? 1.0464 1.1123 1.1436 -0.0339 -0.0189 0.0510  92   GLY A C   
615  O  O   . GLY A  95  ? 1.0537 1.1059 1.1504 -0.0316 -0.0193 0.0472  92   GLY A O   
616  N  N   . ASP A  96  ? 0.9963 1.0743 1.0931 -0.0288 -0.0155 0.0513  93   ASP A N   
617  C  CA  . ASP A  96  ? 0.9909 1.0661 1.0868 -0.0205 -0.0116 0.0472  93   ASP A CA  
618  C  C   . ASP A  96  ? 0.9998 1.0672 1.0957 -0.0187 -0.0117 0.0432  93   ASP A C   
619  O  O   . ASP A  96  ? 1.0140 1.0699 1.1090 -0.0151 -0.0108 0.0390  93   ASP A O   
620  C  CB  . ASP A  96  ? 1.0243 1.1141 1.1202 -0.0156 -0.0075 0.0490  93   ASP A CB  
621  C  CG  . ASP A  96  ? 1.2838 1.3791 1.3790 -0.0137 -0.0053 0.0500  93   ASP A CG  
622  O  OD1 . ASP A  96  ? 1.2958 1.3848 1.3903 -0.0165 -0.0072 0.0500  93   ASP A OD1 
623  O  OD2 . ASP A  96  ? 1.4211 1.5278 1.5164 -0.0093 -0.0015 0.0510  93   ASP A OD2 
624  N  N   . PHE A  97  ? 0.9006 0.9760 0.9977 -0.0214 -0.0127 0.0444  94   PHE A N   
625  C  CA  . PHE A  97  ? 0.8740 0.9456 0.9714 -0.0201 -0.0127 0.0410  94   PHE A CA  
626  C  C   . PHE A  97  ? 0.9073 0.9621 1.0042 -0.0219 -0.0151 0.0364  94   PHE A C   
627  O  O   . PHE A  97  ? 0.8979 0.9457 0.9942 -0.0169 -0.0136 0.0326  94   PHE A O   
628  C  CB  . PHE A  97  ? 0.8732 0.9577 0.9718 -0.0248 -0.0141 0.0431  94   PHE A CB  
629  C  CG  . PHE A  97  ? 0.8727 0.9566 0.9718 -0.0230 -0.0138 0.0398  94   PHE A CG  
630  C  CD1 . PHE A  97  ? 0.8954 0.9840 0.9948 -0.0149 -0.0100 0.0400  94   PHE A CD1 
631  C  CD2 . PHE A  97  ? 0.8877 0.9661 0.9871 -0.0295 -0.0170 0.0365  94   PHE A CD2 
632  C  CE1 . PHE A  97  ? 0.8957 0.9849 0.9958 -0.0133 -0.0098 0.0377  94   PHE A CE1 
633  C  CE2 . PHE A  97  ? 0.9137 0.9933 1.0136 -0.0281 -0.0167 0.0332  94   PHE A CE2 
634  C  CZ  . PHE A  97  ? 0.8825 0.9682 0.9827 -0.0200 -0.0133 0.0342  94   PHE A CZ  
635  N  N   . LEU A  98  ? 0.8412 0.8892 0.9384 -0.0286 -0.0186 0.0370  95   LEU A N   
636  C  CA  . LEU A  98  ? 0.8379 0.8699 0.9350 -0.0300 -0.0207 0.0331  95   LEU A CA  
637  C  C   . LEU A  98  ? 0.8880 0.9106 0.9839 -0.0246 -0.0196 0.0314  95   LEU A C   
638  O  O   . LEU A  98  ? 0.9032 0.9145 0.9989 -0.0232 -0.0204 0.0273  95   LEU A O   
639  C  CB  . LEU A  98  ? 0.8411 0.8673 0.9393 -0.0382 -0.0241 0.0345  95   LEU A CB  
640  C  CG  . LEU A  98  ? 0.9008 0.9313 0.9997 -0.0445 -0.0255 0.0329  95   LEU A CG  
641  C  CD1 . LEU A  98  ? 0.8962 0.9209 0.9960 -0.0534 -0.0281 0.0347  95   LEU A CD1 
642  C  CD2 . LEU A  98  ? 0.9486 0.9725 1.0475 -0.0425 -0.0255 0.0265  95   LEU A CD2 
643  N  N   . CYS A  99  ? 0.8256 0.8542 0.9208 -0.0217 -0.0175 0.0341  96   CYS A N   
644  C  CA  . CYS A  99  ? 0.8334 0.8554 0.9272 -0.0173 -0.0160 0.0320  96   CYS A CA  
645  C  C   . CYS A  99  ? 0.8749 0.8948 0.9675 -0.0112 -0.0129 0.0274  96   CYS A C   
646  O  O   . CYS A  99  ? 0.8823 0.8925 0.9738 -0.0090 -0.0129 0.0235  96   CYS A O   
647  C  CB  . CYS A  99  ? 0.8445 0.8744 0.9377 -0.0167 -0.0144 0.0354  96   CYS A CB  
648  S  SG  . CYS A  99  ? 0.9034 0.9286 0.9943 -0.0115 -0.0116 0.0318  96   CYS A SG  
649  N  N   . ARG A  100 ? 0.8051 0.8347 0.8980 -0.0085 -0.0100 0.0284  97   ARG A N   
650  C  CA  . ARG A  100 ? 0.7790 0.8079 0.8711 -0.0026 -0.0065 0.0256  97   ARG A CA  
651  C  C   . ARG A  100 ? 0.7665 0.7898 0.8591 -0.0032 -0.0083 0.0225  97   ARG A C   
652  O  O   . ARG A  100 ? 0.7479 0.7649 0.8395 0.0007  -0.0066 0.0189  97   ARG A O   
653  C  CB  . ARG A  100 ? 0.7847 0.8264 0.8777 0.0007  -0.0029 0.0288  97   ARG A CB  
654  C  CG  . ARG A  100 ? 0.8878 0.9343 0.9799 0.0026  0.0000  0.0303  97   ARG A CG  
655  C  CD  . ARG A  100 ? 1.0373 1.0970 1.1306 0.0061  0.0035  0.0337  97   ARG A CD  
656  N  NE  . ARG A  100 ? 1.3039 1.3756 1.3988 0.0015  0.0007  0.0385  97   ARG A NE  
657  C  CZ  . ARG A  100 ? 1.5892 1.6754 1.6854 0.0037  0.0029  0.0425  97   ARG A CZ  
658  N  NH1 . ARG A  100 ? 1.4238 1.5129 1.5199 0.0110  0.0084  0.0423  97   ARG A NH1 
659  N  NH2 . ARG A  100 ? 1.4716 1.5694 1.5690 -0.0016 0.0000  0.0466  97   ARG A NH2 
660  N  N   . LEU A  101 ? 0.7188 0.7440 0.8129 -0.0086 -0.0118 0.0233  98   LEU A N   
661  C  CA  . LEU A  101 ? 0.7083 0.7293 0.8030 -0.0104 -0.0138 0.0198  98   LEU A CA  
662  C  C   . LEU A  101 ? 0.7140 0.7208 0.8080 -0.0109 -0.0159 0.0156  98   LEU A C   
663  O  O   . LEU A  101 ? 0.6959 0.6981 0.7895 -0.0091 -0.0160 0.0115  98   LEU A O   
664  C  CB  . LEU A  101 ? 0.7101 0.7386 0.8064 -0.0169 -0.0164 0.0214  98   LEU A CB  
665  C  CG  . LEU A  101 ? 0.7733 0.8027 0.8703 -0.0185 -0.0176 0.0177  98   LEU A CG  
666  C  CD1 . LEU A  101 ? 0.7688 0.8096 0.8663 -0.0135 -0.0146 0.0191  98   LEU A CD1 
667  C  CD2 . LEU A  101 ? 0.7788 0.8109 0.8769 -0.0269 -0.0206 0.0173  98   LEU A CD2 
668  N  N   . SER A  102 ? 0.6762 0.6769 0.7699 -0.0130 -0.0174 0.0169  99   SER A N   
669  C  CA  . SER A  102 ? 0.6808 0.6692 0.7741 -0.0127 -0.0192 0.0139  99   SER A CA  
670  C  C   . SER A  102 ? 0.7522 0.7374 0.8434 -0.0070 -0.0167 0.0112  99   SER A C   
671  O  O   . SER A  102 ? 0.7701 0.7476 0.8607 -0.0055 -0.0175 0.0073  99   SER A O   
672  C  CB  . SER A  102 ? 0.7372 0.7216 0.8312 -0.0161 -0.0212 0.0175  99   SER A CB  
673  O  OG  . SER A  102 ? 0.9073 0.8894 1.0030 -0.0220 -0.0238 0.0183  99   SER A OG  
674  N  N   . THR A  103 ? 0.6955 0.6869 0.7854 -0.0041 -0.0134 0.0129  100  THR A N   
675  C  CA  . THR A  103 ? 0.6877 0.6765 0.7754 0.0004  -0.0103 0.0099  100  THR A CA  
676  C  C   . THR A  103 ? 0.7396 0.7270 0.8269 0.0034  -0.0087 0.0066  100  THR A C   
677  O  O   . THR A  103 ? 0.7553 0.7364 0.8413 0.0051  -0.0086 0.0028  100  THR A O   
678  C  CB  . THR A  103 ? 0.7647 0.7602 0.8514 0.0022  -0.0067 0.0120  100  THR A CB  
679  O  OG1 . THR A  103 ? 0.8179 0.8161 0.9050 -0.0009 -0.0085 0.0154  100  THR A OG1 
680  C  CG2 . THR A  103 ? 0.7519 0.7440 0.8359 0.0059  -0.0030 0.0081  100  THR A CG2 
681  N  N   . TYR A  104 ? 0.6834 0.6782 0.7720 0.0039  -0.0075 0.0087  101  TYR A N   
682  C  CA  . TYR A  104 ? 0.6681 0.6646 0.7570 0.0068  -0.0058 0.0073  101  TYR A CA  
683  C  C   . TYR A  104 ? 0.7173 0.7085 0.8066 0.0050  -0.0090 0.0034  101  TYR A C   
684  O  O   . TYR A  104 ? 0.7163 0.7037 0.8043 0.0077  -0.0077 0.0004  101  TYR A O   
685  C  CB  . TYR A  104 ? 0.6644 0.6727 0.7554 0.0066  -0.0049 0.0116  101  TYR A CB  
686  C  CG  . TYR A  104 ? 0.6595 0.6729 0.7515 0.0095  -0.0033 0.0118  101  TYR A CG  
687  C  CD1 . TYR A  104 ? 0.6793 0.6919 0.7706 0.0152  0.0014  0.0123  101  TYR A CD1 
688  C  CD2 . TYR A  104 ? 0.6556 0.6756 0.7494 0.0062  -0.0060 0.0120  101  TYR A CD2 
689  C  CE1 . TYR A  104 ? 0.6755 0.6937 0.7681 0.0182  0.0031  0.0139  101  TYR A CE1 
690  C  CE2 . TYR A  104 ? 0.6592 0.6867 0.7542 0.0088  -0.0045 0.0131  101  TYR A CE2 
691  C  CZ  . TYR A  104 ? 0.7126 0.7394 0.8072 0.0151  0.0000  0.0146  101  TYR A CZ  
692  O  OH  . TYR A  104 ? 0.7107 0.7451 0.8067 0.0180  0.0017  0.0167  101  TYR A OH  
693  N  N   . ALA A  105 ? 0.6626 0.6530 0.7533 0.0002  -0.0128 0.0033  102  ALA A N   
694  C  CA  . ALA A  105 ? 0.6490 0.6342 0.7403 -0.0020 -0.0158 -0.0009 102  ALA A CA  
695  C  C   . ALA A  105 ? 0.6773 0.6531 0.7670 0.0003  -0.0162 -0.0049 102  ALA A C   
696  O  O   . ALA A  105 ? 0.6784 0.6524 0.7681 0.0009  -0.0170 -0.0089 102  ALA A O   
697  C  CB  . ALA A  105 ? 0.6609 0.6444 0.7538 -0.0077 -0.0191 -0.0002 102  ALA A CB  
698  N  N   . LEU A  106 ? 0.6204 0.5917 0.7087 0.0016  -0.0156 -0.0040 103  LEU A N   
699  C  CA  . LEU A  106 ? 0.6186 0.5830 0.7052 0.0038  -0.0158 -0.0076 103  LEU A CA  
700  C  C   . LEU A  106 ? 0.6483 0.6138 0.7328 0.0073  -0.0127 -0.0100 103  LEU A C   
701  O  O   . LEU A  106 ? 0.6231 0.5854 0.7069 0.0084  -0.0136 -0.0139 103  LEU A O   
702  C  CB  . LEU A  106 ? 0.6217 0.5831 0.7075 0.0038  -0.0161 -0.0057 103  LEU A CB  
703  C  CG  . LEU A  106 ? 0.6885 0.6453 0.7724 0.0061  -0.0163 -0.0089 103  LEU A CG  
704  C  CD1 . LEU A  106 ? 0.6976 0.6484 0.7827 0.0061  -0.0192 -0.0122 103  LEU A CD1 
705  C  CD2 . LEU A  106 ? 0.7264 0.6837 0.8097 0.0060  -0.0163 -0.0061 103  LEU A CD2 
706  N  N   . TYR A  107 ? 0.6003 0.5702 0.6840 0.0091  -0.0090 -0.0077 104  TYR A N   
707  C  CA  . TYR A  107 ? 0.5932 0.5628 0.6750 0.0123  -0.0053 -0.0095 104  TYR A CA  
708  C  C   . TYR A  107 ? 0.6145 0.5871 0.6976 0.0131  -0.0055 -0.0102 104  TYR A C   
709  O  O   . TYR A  107 ? 0.6136 0.5838 0.6952 0.0148  -0.0044 -0.0130 104  TYR A O   
710  C  CB  . TYR A  107 ? 0.6096 0.5818 0.6905 0.0142  -0.0007 -0.0070 104  TYR A CB  
711  C  CG  . TYR A  107 ? 0.6275 0.5983 0.7067 0.0132  -0.0002 -0.0072 104  TYR A CG  
712  C  CD1 . TYR A  107 ? 0.6576 0.6241 0.7346 0.0126  -0.0010 -0.0106 104  TYR A CD1 
713  C  CD2 . TYR A  107 ? 0.6239 0.5995 0.7037 0.0126  0.0010  -0.0038 104  TYR A CD2 
714  C  CE1 . TYR A  107 ? 0.6749 0.6426 0.7505 0.0114  -0.0007 -0.0104 104  TYR A CE1 
715  C  CE2 . TYR A  107 ? 0.6254 0.6017 0.7038 0.0113  0.0014  -0.0038 104  TYR A CE2 
716  C  CZ  . TYR A  107 ? 0.7385 0.7112 0.8149 0.0106  0.0005  -0.0070 104  TYR A CZ  
717  O  OH  . TYR A  107 ? 0.7994 0.7751 0.8746 0.0092  0.0007  -0.0065 104  TYR A OH  
718  N  N   . VAL A  108 ? 0.5493 0.5280 0.6350 0.0115  -0.0072 -0.0078 105  VAL A N   
719  C  CA  . VAL A  108 ? 0.5623 0.5468 0.6495 0.0116  -0.0077 -0.0081 105  VAL A CA  
720  C  C   . VAL A  108 ? 0.6510 0.6313 0.7380 0.0100  -0.0109 -0.0134 105  VAL A C   
721  O  O   . VAL A  108 ? 0.6475 0.6287 0.7338 0.0118  -0.0101 -0.0154 105  VAL A O   
722  C  CB  . VAL A  108 ? 0.6051 0.5996 0.6950 0.0094  -0.0086 -0.0044 105  VAL A CB  
723  C  CG1 . VAL A  108 ? 0.5932 0.5954 0.6848 0.0083  -0.0099 -0.0055 105  VAL A CG1 
724  C  CG2 . VAL A  108 ? 0.6019 0.6023 0.6922 0.0125  -0.0047 0.0009  105  VAL A CG2 
725  N  N   . ASN A  109 ? 0.6134 0.5886 0.7008 0.0072  -0.0143 -0.0155 106  ASN A N   
726  C  CA  . ASN A  109 ? 0.6066 0.5768 0.6940 0.0063  -0.0171 -0.0206 106  ASN A CA  
727  C  C   . ASN A  109 ? 0.6760 0.6418 0.7609 0.0094  -0.0159 -0.0234 106  ASN A C   
728  O  O   . ASN A  109 ? 0.6861 0.6527 0.7707 0.0100  -0.0168 -0.0272 106  ASN A O   
729  C  CB  . ASN A  109 ? 0.5812 0.5449 0.6697 0.0036  -0.0199 -0.0210 106  ASN A CB  
730  C  CG  . ASN A  109 ? 0.6653 0.6215 0.7535 0.0044  -0.0219 -0.0256 106  ASN A CG  
731  O  OD1 . ASN A  109 ? 0.5520 0.5027 0.6391 0.0061  -0.0220 -0.0250 106  ASN A OD1 
732  N  ND2 . ASN A  109 ? 0.5938 0.5508 0.6829 0.0035  -0.0234 -0.0301 106  ASN A ND2 
733  N  N   . LEU A  110 ? 0.6222 0.5847 0.7050 0.0109  -0.0140 -0.0218 107  LEU A N   
734  C  CA  . LEU A  110 ? 0.6255 0.5849 0.7054 0.0129  -0.0126 -0.0244 107  LEU A CA  
735  C  C   . LEU A  110 ? 0.6586 0.6207 0.7372 0.0145  -0.0098 -0.0253 107  LEU A C   
736  O  O   . LEU A  110 ? 0.6620 0.6235 0.7393 0.0151  -0.0105 -0.0289 107  LEU A O   
737  C  CB  . LEU A  110 ? 0.6317 0.5890 0.7097 0.0132  -0.0107 -0.0226 107  LEU A CB  
738  C  CG  . LEU A  110 ? 0.7041 0.6595 0.7788 0.0142  -0.0093 -0.0255 107  LEU A CG  
739  C  CD1 . LEU A  110 ? 0.7148 0.6680 0.7898 0.0143  -0.0128 -0.0275 107  LEU A CD1 
740  C  CD2 . LEU A  110 ? 0.7360 0.6922 0.8088 0.0140  -0.0060 -0.0238 107  LEU A CD2 
741  N  N   . TYR A  111 ? 0.5926 0.5580 0.6717 0.0155  -0.0065 -0.0217 108  TYR A N   
742  C  CA  . TYR A  111 ? 0.5757 0.5427 0.6538 0.0175  -0.0033 -0.0214 108  TYR A CA  
743  C  C   . TYR A  111 ? 0.6601 0.6338 0.7405 0.0173  -0.0051 -0.0215 108  TYR A C   
744  O  O   . TYR A  111 ? 0.6532 0.6279 0.7326 0.0184  -0.0038 -0.0226 108  TYR A O   
745  C  CB  . TYR A  111 ? 0.5608 0.5278 0.6386 0.0195  0.0016  -0.0174 108  TYR A CB  
746  C  CG  . TYR A  111 ? 0.5520 0.5130 0.6267 0.0193  0.0042  -0.0191 108  TYR A CG  
747  C  CD1 . TYR A  111 ? 0.5682 0.5249 0.6396 0.0191  0.0061  -0.0228 108  TYR A CD1 
748  C  CD2 . TYR A  111 ? 0.5422 0.5033 0.6172 0.0186  0.0044  -0.0174 108  TYR A CD2 
749  C  CE1 . TYR A  111 ? 0.5235 0.4767 0.5918 0.0180  0.0083  -0.0250 108  TYR A CE1 
750  C  CE2 . TYR A  111 ? 0.5457 0.5035 0.6178 0.0179  0.0066  -0.0193 108  TYR A CE2 
751  C  CZ  . TYR A  111 ? 0.6176 0.5716 0.6863 0.0175  0.0086  -0.0233 108  TYR A CZ  
752  O  OH  . TYR A  111 ? 0.6610 0.6135 0.7268 0.0161  0.0111  -0.0256 108  TYR A OH  
753  N  N   . CYS A  112 ? 0.6335 0.6121 0.7167 0.0154  -0.0081 -0.0209 109  CYS A N   
754  C  CA  . CYS A  112 ? 0.6425 0.6288 0.7276 0.0142  -0.0102 -0.0221 109  CYS A CA  
755  C  C   . CYS A  112 ? 0.6953 0.6786 0.7793 0.0135  -0.0128 -0.0282 109  CYS A C   
756  O  O   . CYS A  112 ? 0.6945 0.6828 0.7784 0.0141  -0.0127 -0.0295 109  CYS A O   
757  C  CB  . CYS A  112 ? 0.6587 0.6505 0.7466 0.0111  -0.0127 -0.0211 109  CYS A CB  
758  S  SG  . CYS A  112 ? 0.7139 0.7178 0.8042 0.0120  -0.0101 -0.0141 109  CYS A SG  
759  N  N   . SER A  113 ? 0.6402 0.6161 0.7235 0.0126  -0.0151 -0.0314 110  SER A N   
760  C  CA  . SER A  113 ? 0.6316 0.6046 0.7139 0.0127  -0.0175 -0.0369 110  SER A CA  
761  C  C   . SER A  113 ? 0.6662 0.6390 0.7456 0.0147  -0.0156 -0.0383 110  SER A C   
762  O  O   . SER A  113 ? 0.6603 0.6367 0.7396 0.0148  -0.0169 -0.0420 110  SER A O   
763  C  CB  . SER A  113 ? 0.6608 0.6260 0.7433 0.0124  -0.0195 -0.0384 110  SER A CB  
764  O  OG  . SER A  113 ? 0.6901 0.6546 0.7752 0.0098  -0.0214 -0.0378 110  SER A OG  
765  N  N   . ILE A  114 ? 0.6221 0.5915 0.6992 0.0158  -0.0123 -0.0356 111  ILE A N   
766  C  CA  . ILE A  114 ? 0.6138 0.5824 0.6878 0.0167  -0.0097 -0.0368 111  ILE A CA  
767  C  C   . ILE A  114 ? 0.6515 0.6262 0.7262 0.0171  -0.0083 -0.0354 111  ILE A C   
768  O  O   . ILE A  114 ? 0.6451 0.6223 0.7184 0.0170  -0.0087 -0.0383 111  ILE A O   
769  C  CB  . ILE A  114 ? 0.6430 0.6065 0.7144 0.0170  -0.0058 -0.0347 111  ILE A CB  
770  C  CG1 . ILE A  114 ? 0.6416 0.6014 0.7118 0.0165  -0.0074 -0.0362 111  ILE A CG1 
771  C  CG2 . ILE A  114 ? 0.6448 0.6071 0.7128 0.0171  -0.0022 -0.0358 111  ILE A CG2 
772  C  CD1 . ILE A  114 ? 0.6566 0.6135 0.7250 0.0162  -0.0041 -0.0342 111  ILE A CD1 
773  N  N   . PHE A  115 ? 0.5899 0.5686 0.6670 0.0177  -0.0068 -0.0308 112  PHE A N   
774  C  CA  . PHE A  115 ? 0.5827 0.5688 0.6611 0.0185  -0.0052 -0.0280 112  PHE A CA  
775  C  C   . PHE A  115 ? 0.6471 0.6422 0.7274 0.0171  -0.0089 -0.0310 112  PHE A C   
776  O  O   . PHE A  115 ? 0.6495 0.6497 0.7294 0.0174  -0.0083 -0.0311 112  PHE A O   
777  C  CB  . PHE A  115 ? 0.6014 0.5906 0.6821 0.0202  -0.0022 -0.0215 112  PHE A CB  
778  C  CG  . PHE A  115 ? 0.6391 0.6204 0.7179 0.0223  0.0028  -0.0185 112  PHE A CG  
779  C  CD1 . PHE A  115 ? 0.6916 0.6656 0.7669 0.0223  0.0055  -0.0208 112  PHE A CD1 
780  C  CD2 . PHE A  115 ? 0.6838 0.6656 0.7642 0.0241  0.0053  -0.0136 112  PHE A CD2 
781  C  CE1 . PHE A  115 ? 0.7065 0.6729 0.7799 0.0236  0.0107  -0.0189 112  PHE A CE1 
782  C  CE2 . PHE A  115 ? 0.7297 0.7041 0.8085 0.0262  0.0105  -0.0115 112  PHE A CE2 
783  C  CZ  . PHE A  115 ? 0.7057 0.6720 0.7810 0.0258  0.0133  -0.0145 112  PHE A CZ  
784  N  N   . PHE A  116 ? 0.5956 0.5925 0.6779 0.0152  -0.0126 -0.0339 113  PHE A N   
785  C  CA  . PHE A  116 ? 0.5840 0.5890 0.6680 0.0133  -0.0159 -0.0382 113  PHE A CA  
786  C  C   . PHE A  116 ? 0.6377 0.6407 0.7197 0.0136  -0.0175 -0.0440 113  PHE A C   
787  O  O   . PHE A  116 ? 0.6285 0.6402 0.7110 0.0131  -0.0185 -0.0462 113  PHE A O   
788  C  CB  . PHE A  116 ? 0.6071 0.6124 0.6935 0.0107  -0.0188 -0.0405 113  PHE A CB  
789  C  CG  . PHE A  116 ? 0.6154 0.6267 0.7042 0.0094  -0.0179 -0.0356 113  PHE A CG  
790  C  CD1 . PHE A  116 ? 0.6428 0.6659 0.7330 0.0101  -0.0161 -0.0308 113  PHE A CD1 
791  C  CD2 . PHE A  116 ? 0.6212 0.6274 0.7108 0.0075  -0.0190 -0.0352 113  PHE A CD2 
792  C  CE1 . PHE A  116 ? 0.6411 0.6717 0.7335 0.0092  -0.0153 -0.0259 113  PHE A CE1 
793  C  CE2 . PHE A  116 ? 0.6414 0.6547 0.7330 0.0060  -0.0182 -0.0306 113  PHE A CE2 
794  C  CZ  . PHE A  116 ? 0.6150 0.6408 0.7079 0.0070  -0.0164 -0.0260 113  PHE A CZ  
795  N  N   . MET A  117 ? 0.6000 0.5932 0.6797 0.0145  -0.0177 -0.0461 114  MET A N   
796  C  CA  . MET A  117 ? 0.5984 0.5905 0.6758 0.0152  -0.0190 -0.0511 114  MET A CA  
797  C  C   . MET A  117 ? 0.6459 0.6421 0.7210 0.0156  -0.0166 -0.0498 114  MET A C   
798  O  O   . MET A  117 ? 0.6341 0.6363 0.7087 0.0154  -0.0181 -0.0535 114  MET A O   
799  C  CB  . MET A  117 ? 0.6284 0.6113 0.7041 0.0163  -0.0194 -0.0524 114  MET A CB  
800  C  CG  . MET A  117 ? 0.6787 0.6574 0.7567 0.0162  -0.0223 -0.0549 114  MET A CG  
801  S  SD  . MET A  117 ? 0.7460 0.7159 0.8224 0.0181  -0.0226 -0.0550 114  MET A SD  
802  C  CE  . MET A  117 ? 0.7132 0.6789 0.7929 0.0185  -0.0259 -0.0587 114  MET A CE  
803  N  N   . THR A  118 ? 0.6077 0.6009 0.6817 0.0161  -0.0127 -0.0445 115  THR A N   
804  C  CA  . THR A  118 ? 0.6054 0.6002 0.6772 0.0161  -0.0094 -0.0423 115  THR A CA  
805  C  C   . THR A  118 ? 0.6808 0.6870 0.7550 0.0159  -0.0100 -0.0406 115  THR A C   
806  O  O   . THR A  118 ? 0.6781 0.6894 0.7509 0.0152  -0.0102 -0.0421 115  THR A O   
807  C  CB  . THR A  118 ? 0.6218 0.6089 0.6922 0.0169  -0.0045 -0.0373 115  THR A CB  
808  O  OG1 . THR A  118 ? 0.5362 0.5151 0.6047 0.0167  -0.0042 -0.0390 115  THR A OG1 
809  C  CG2 . THR A  118 ? 0.5423 0.5281 0.6102 0.0166  -0.0005 -0.0355 115  THR A CG2 
810  N  N   . ALA A  119 ? 0.6557 0.6674 0.7334 0.0161  -0.0104 -0.0373 116  ALA A N   
811  C  CA  . ALA A  119 ? 0.6479 0.6730 0.7284 0.0157  -0.0110 -0.0349 116  ALA A CA  
812  C  C   . ALA A  119 ? 0.7180 0.7518 0.7990 0.0139  -0.0151 -0.0415 116  ALA A C   
813  O  O   . ALA A  119 ? 0.7135 0.7580 0.7952 0.0134  -0.0152 -0.0409 116  ALA A O   
814  C  CB  . ALA A  119 ? 0.6506 0.6806 0.7345 0.0159  -0.0108 -0.0306 116  ALA A CB  
815  N  N   . MET A  120 ? 0.6983 0.7274 0.7793 0.0132  -0.0181 -0.0478 117  MET A N   
816  C  CA  . MET A  120 ? 0.7046 0.7395 0.7862 0.0120  -0.0217 -0.0552 117  MET A CA  
817  C  C   . MET A  120 ? 0.7349 0.7708 0.8135 0.0127  -0.0216 -0.0578 117  MET A C   
818  O  O   . MET A  120 ? 0.7224 0.7697 0.8016 0.0118  -0.0231 -0.0605 117  MET A O   
819  C  CB  . MET A  120 ? 0.7524 0.7781 0.8346 0.0119  -0.0239 -0.0600 117  MET A CB  
820  C  CG  . MET A  120 ? 0.8104 0.8394 0.8934 0.0113  -0.0270 -0.0682 117  MET A CG  
821  S  SD  . MET A  120 ? 0.8776 0.8921 0.9611 0.0123  -0.0286 -0.0721 117  MET A SD  
822  C  CE  . MET A  120 ? 0.8344 0.8495 0.9212 0.0090  -0.0288 -0.0704 117  MET A CE  
823  N  N   . SER A  121 ? 0.6834 0.7088 0.7587 0.0138  -0.0199 -0.0570 118  SER A N   
824  C  CA  . SER A  121 ? 0.6728 0.6990 0.7447 0.0139  -0.0195 -0.0592 118  SER A CA  
825  C  C   . SER A  121 ? 0.7457 0.7798 0.8170 0.0128  -0.0173 -0.0552 118  SER A C   
826  O  O   . SER A  121 ? 0.7529 0.7954 0.8231 0.0120  -0.0186 -0.0581 118  SER A O   
827  C  CB  . SER A  121 ? 0.6837 0.6985 0.7523 0.0145  -0.0175 -0.0584 118  SER A CB  
828  O  OG  . SER A  121 ? 0.7387 0.7468 0.8081 0.0157  -0.0194 -0.0610 118  SER A OG  
829  N  N   . PHE A  122 ? 0.7160 0.7478 0.7882 0.0131  -0.0139 -0.0481 119  PHE A N   
830  C  CA  . PHE A  122 ? 0.7220 0.7598 0.7941 0.0126  -0.0111 -0.0425 119  PHE A CA  
831  C  C   . PHE A  122 ? 0.7664 0.8210 0.8415 0.0118  -0.0137 -0.0430 119  PHE A C   
832  O  O   . PHE A  122 ? 0.7559 0.8182 0.8299 0.0107  -0.0133 -0.0423 119  PHE A O   
833  C  CB  . PHE A  122 ? 0.7501 0.7819 0.8235 0.0142  -0.0067 -0.0345 119  PHE A CB  
834  C  CG  . PHE A  122 ? 0.7766 0.8104 0.8496 0.0143  -0.0027 -0.0281 119  PHE A CG  
835  C  CD1 . PHE A  122 ? 0.8350 0.8586 0.9040 0.0133  0.0009  -0.0276 119  PHE A CD1 
836  C  CD2 . PHE A  122 ? 0.8118 0.8583 0.8884 0.0151  -0.0024 -0.0224 119  PHE A CD2 
837  C  CE1 . PHE A  122 ? 0.8535 0.8774 0.9221 0.0131  0.0051  -0.0215 119  PHE A CE1 
838  C  CE2 . PHE A  122 ? 0.8572 0.9053 0.9338 0.0156  0.0015  -0.0154 119  PHE A CE2 
839  C  CZ  . PHE A  122 ? 0.8397 0.8753 0.9123 0.0146  0.0054  -0.0150 119  PHE A CZ  
840  N  N   . PHE A  123 ? 0.7213 0.7822 0.7998 0.0117  -0.0162 -0.0446 120  PHE A N   
841  C  CA  . PHE A  123 ? 0.7084 0.7866 0.7899 0.0102  -0.0187 -0.0462 120  PHE A CA  
842  C  C   . PHE A  123 ? 0.7890 0.8736 0.8692 0.0090  -0.0220 -0.0544 120  PHE A C   
843  O  O   . PHE A  123 ? 0.7845 0.8829 0.8651 0.0078  -0.0225 -0.0540 120  PHE A O   
844  C  CB  . PHE A  123 ? 0.7124 0.7945 0.7974 0.0095  -0.0203 -0.0470 120  PHE A CB  
845  C  CG  . PHE A  123 ? 0.7187 0.8075 0.8064 0.0102  -0.0178 -0.0381 120  PHE A CG  
846  C  CD1 . PHE A  123 ? 0.7647 0.8453 0.8515 0.0128  -0.0135 -0.0299 120  PHE A CD1 
847  C  CD2 . PHE A  123 ? 0.7277 0.8310 0.8189 0.0083  -0.0194 -0.0380 120  PHE A CD2 
848  C  CE1 . PHE A  123 ? 0.7718 0.8590 0.8614 0.0144  -0.0109 -0.0212 120  PHE A CE1 
849  C  CE2 . PHE A  123 ? 0.7600 0.8716 0.8539 0.0094  -0.0170 -0.0292 120  PHE A CE2 
850  C  CZ  . PHE A  123 ? 0.7486 0.8520 0.8418 0.0129  -0.0128 -0.0205 120  PHE A CZ  
851  N  N   . ARG A  124 ? 0.7584 0.8335 0.8371 0.0097  -0.0239 -0.0613 121  ARG A N   
852  C  CA  . ARG A  124 ? 0.7705 0.8503 0.8479 0.0096  -0.0266 -0.0692 121  ARG A CA  
853  C  C   . ARG A  124 ? 0.8276 0.9106 0.9017 0.0093  -0.0254 -0.0679 121  ARG A C   
854  O  O   . ARG A  124 ? 0.8217 0.9164 0.8955 0.0085  -0.0274 -0.0722 121  ARG A O   
855  C  CB  . ARG A  124 ? 0.7827 0.8503 0.8596 0.0113  -0.0282 -0.0751 121  ARG A CB  
856  C  CG  . ARG A  124 ? 0.8622 0.9356 0.9394 0.0121  -0.0312 -0.0841 121  ARG A CG  
857  C  CD  . ARG A  124 ? 0.9793 1.0631 1.0601 0.0103  -0.0331 -0.0889 121  ARG A CD  
858  N  NE  . ARG A  124 ? 1.0562 1.1306 1.1394 0.0102  -0.0337 -0.0912 121  ARG A NE  
859  C  CZ  . ARG A  124 ? 1.2765 1.3424 1.3603 0.0119  -0.0350 -0.0977 121  ARG A CZ  
860  N  NH1 . ARG A  124 ? 1.2374 1.3035 1.3196 0.0146  -0.0360 -0.1026 121  ARG A NH1 
861  N  NH2 . ARG A  124 ? 1.0470 1.1041 1.1329 0.0111  -0.0352 -0.0990 121  ARG A NH2 
862  N  N   . CYS A  125 ? 0.7943 0.8674 0.8657 0.0094  -0.0220 -0.0621 122  CYS A N   
863  C  CA  . CYS A  125 ? 0.8073 0.8816 0.8752 0.0081  -0.0201 -0.0602 122  CYS A CA  
864  C  C   . CYS A  125 ? 0.8715 0.9604 0.9407 0.0064  -0.0197 -0.0561 122  CYS A C   
865  O  O   . CYS A  125 ? 0.8608 0.9600 0.9286 0.0050  -0.0212 -0.0592 122  CYS A O   
866  C  CB  . CYS A  125 ? 0.8221 0.8815 0.8871 0.0080  -0.0159 -0.0552 122  CYS A CB  
867  S  SG  . CYS A  125 ? 0.8754 0.9344 0.9355 0.0051  -0.0127 -0.0530 122  CYS A SG  
868  N  N   . ILE A  126 ? 0.8459 0.9375 0.9183 0.0068  -0.0178 -0.0490 123  ILE A N   
869  C  CA  . ILE A  126 ? 0.8399 0.9464 0.9143 0.0057  -0.0170 -0.0433 123  ILE A CA  
870  C  C   . ILE A  126 ? 0.9108 1.0361 0.9873 0.0043  -0.0214 -0.0494 123  ILE A C   
871  O  O   . ILE A  126 ? 0.9157 1.0548 0.9922 0.0027  -0.0218 -0.0481 123  ILE A O   
872  C  CB  . ILE A  126 ? 0.8738 0.9789 0.9514 0.0073  -0.0138 -0.0338 123  ILE A CB  
873  C  CG1 . ILE A  126 ? 0.8849 0.9768 0.9602 0.0080  -0.0084 -0.0263 123  ILE A CG1 
874  C  CG2 . ILE A  126 ? 0.8953 1.0209 0.9770 0.0067  -0.0147 -0.0293 123  ILE A CG2 
875  C  CD1 . ILE A  126 ? 1.0428 1.1142 1.1147 0.0087  -0.0062 -0.0285 123  ILE A CD1 
876  N  N   . ALA A  127 ? 0.8739 0.9992 0.9521 0.0049  -0.0244 -0.0569 124  ALA A N   
877  C  CA  . ALA A  127 ? 0.8641 1.0049 0.9441 0.0036  -0.0281 -0.0647 124  ALA A CA  
878  C  C   . ALA A  127 ? 0.9267 1.0713 1.0036 0.0033  -0.0298 -0.0709 124  ALA A C   
879  O  O   . ALA A  127 ? 0.9266 1.0887 1.0042 0.0016  -0.0312 -0.0721 124  ALA A O   
880  C  CB  . ALA A  127 ? 0.8715 1.0067 0.9535 0.0041  -0.0301 -0.0713 124  ALA A CB  
881  N  N   . ILE A  128 ? 0.8956 1.0258 0.9693 0.0049  -0.0297 -0.0743 125  ILE A N   
882  C  CA  . ILE A  128 ? 0.8955 1.0290 0.9660 0.0051  -0.0311 -0.0801 125  ILE A CA  
883  C  C   . ILE A  128 ? 1.0083 1.1483 1.0758 0.0027  -0.0293 -0.0748 125  ILE A C   
884  O  O   . ILE A  128 ? 1.0097 1.1651 1.0768 0.0013  -0.0311 -0.0778 125  ILE A O   
885  C  CB  . ILE A  128 ? 0.9240 1.0417 0.9921 0.0077  -0.0313 -0.0843 125  ILE A CB  
886  C  CG1 . ILE A  128 ? 0.9290 1.0393 1.0001 0.0101  -0.0330 -0.0895 125  ILE A CG1 
887  C  CG2 . ILE A  128 ? 0.9063 1.0293 0.9711 0.0082  -0.0326 -0.0894 125  ILE A CG2 
888  C  CD1 . ILE A  128 ? 1.0514 1.1721 1.1252 0.0109  -0.0361 -0.0986 125  ILE A CD1 
889  N  N   . VAL A  129 ? 1.0117 1.1396 1.0772 0.0019  -0.0256 -0.0674 126  VAL A N   
890  C  CA  . VAL A  129 ? 1.0373 1.1668 1.0996 -0.0009 -0.0229 -0.0620 126  VAL A CA  
891  C  C   . VAL A  129 ? 1.1762 1.3217 1.2409 -0.0028 -0.0226 -0.0561 126  VAL A C   
892  O  O   . VAL A  129 ? 1.1856 1.3412 1.2483 -0.0054 -0.0227 -0.0555 126  VAL A O   
893  C  CB  . VAL A  129 ? 1.0921 1.2026 1.1518 -0.0012 -0.0184 -0.0564 126  VAL A CB  
894  C  CG1 . VAL A  129 ? 1.0891 1.1995 1.1456 -0.0047 -0.0149 -0.0508 126  VAL A CG1 
895  C  CG2 . VAL A  129 ? 1.0962 1.1943 1.1530 0.0001  -0.0189 -0.0622 126  VAL A CG2 
896  N  N   . PHE A  130 ? 1.1905 1.3395 1.2596 -0.0016 -0.0221 -0.0513 127  PHE A N   
897  C  CA  . PHE A  130 ? 1.2064 1.3722 1.2785 -0.0030 -0.0216 -0.0445 127  PHE A CA  
898  C  C   . PHE A  130 ? 1.3026 1.4867 1.3790 -0.0029 -0.0254 -0.0491 127  PHE A C   
899  O  O   . PHE A  130 ? 1.2888 1.4751 1.3688 -0.0019 -0.0247 -0.0450 127  PHE A O   
900  C  CB  . PHE A  130 ? 1.2310 1.3879 1.3046 -0.0019 -0.0168 -0.0328 127  PHE A CB  
901  C  CG  . PHE A  130 ? 1.2586 1.3954 1.3283 -0.0022 -0.0124 -0.0291 127  PHE A CG  
902  C  CD1 . PHE A  130 ? 1.3026 1.4399 1.3694 -0.0051 -0.0098 -0.0248 127  PHE A CD1 
903  C  CD2 . PHE A  130 ? 1.2892 1.4068 1.3578 -0.0001 -0.0105 -0.0300 127  PHE A CD2 
904  C  CE1 . PHE A  130 ? 1.3222 1.4405 1.3851 -0.0062 -0.0052 -0.0223 127  PHE A CE1 
905  C  CE2 . PHE A  130 ? 1.3323 1.4322 1.3971 -0.0010 -0.0061 -0.0275 127  PHE A CE2 
906  C  CZ  . PHE A  130 ? 1.3111 1.4110 1.3730 -0.0042 -0.0034 -0.0240 127  PHE A CZ  
907  N  N   . PRO A  131 ? 1.3095 1.5078 1.3856 -0.0041 -0.0291 -0.0579 128  PRO A N   
908  C  CA  . PRO A  131 ? 1.3242 1.5396 1.4043 -0.0046 -0.0321 -0.0634 128  PRO A CA  
909  C  C   . PRO A  131 ? 1.4375 1.6751 1.5210 -0.0067 -0.0318 -0.0562 128  PRO A C   
910  O  O   . PRO A  131 ? 1.4373 1.6906 1.5243 -0.0078 -0.0339 -0.0599 128  PRO A O   
911  C  CB  . PRO A  131 ? 1.3392 1.5613 1.4176 -0.0047 -0.0355 -0.0751 128  PRO A CB  
912  C  CG  . PRO A  131 ? 1.3922 1.5996 1.4658 -0.0038 -0.0344 -0.0754 128  PRO A CG  
913  C  CD  . PRO A  131 ? 1.3335 1.5335 1.4057 -0.0050 -0.0305 -0.0639 128  PRO A CD  
914  N  N   . VAL A  132 ? 1.4245 1.6639 1.5072 -0.0075 -0.0291 -0.0456 129  VAL A N   
915  C  CA  . VAL A  132 ? 1.4250 1.6842 1.5111 -0.0088 -0.0281 -0.0360 129  VAL A CA  
916  C  C   . VAL A  132 ? 1.4975 1.7493 1.5867 -0.0064 -0.0251 -0.0270 129  VAL A C   
917  O  O   . VAL A  132 ? 1.4995 1.7316 1.5871 -0.0044 -0.0213 -0.0203 129  VAL A O   
918  C  CB  . VAL A  132 ? 1.4746 1.7375 1.5586 -0.0106 -0.0261 -0.0284 129  VAL A CB  
919  N  N   . GLN A  133 ? 1.4624 1.7302 1.5558 -0.0069 -0.0267 -0.0278 130  GLN A N   
920  C  CA  . GLN A  133 ? 1.4659 1.7322 1.5627 -0.0048 -0.0246 -0.0204 130  GLN A CA  
921  C  C   . GLN A  133 ? 1.5245 1.7668 1.6198 -0.0027 -0.0241 -0.0253 130  GLN A C   
922  O  O   . GLN A  133 ? 1.5228 1.7590 1.6201 -0.0005 -0.0217 -0.0183 130  GLN A O   
923  C  CB  . GLN A  133 ? 1.4849 1.7520 1.5834 -0.0026 -0.0201 -0.0044 130  GLN A CB  
924  N  N   . ASN A  134 ? 1.4810 1.7118 1.5733 -0.0033 -0.0266 -0.0371 131  ASN A N   
925  C  CA  . ASN A  134 ? 1.4850 1.6943 1.5758 -0.0017 -0.0267 -0.0429 131  ASN A CA  
926  C  C   . ASN A  134 ? 1.5334 1.7469 1.6275 -0.0022 -0.0276 -0.0444 131  ASN A C   
927  O  O   . ASN A  134 ? 1.5381 1.7362 1.6322 -0.0003 -0.0258 -0.0416 131  ASN A O   
928  C  CB  . ASN A  134 ? 1.5007 1.7038 1.5885 -0.0022 -0.0296 -0.0550 131  ASN A CB  
929  N  N   . ILE A  135 ? 1.4752 1.7106 1.5719 -0.0052 -0.0301 -0.0493 132  ILE A N   
930  C  CA  . ILE A  135 ? 1.4639 1.7075 1.5638 -0.0072 -0.0311 -0.0521 132  ILE A CA  
931  C  C   . ILE A  135 ? 1.5009 1.7514 1.6036 -0.0060 -0.0284 -0.0395 132  ILE A C   
932  O  O   . ILE A  135 ? 1.5049 1.7530 1.6092 -0.0066 -0.0283 -0.0399 132  ILE A O   
933  C  CB  . ILE A  135 ? 1.4936 1.7605 1.5952 -0.0115 -0.0342 -0.0614 132  ILE A CB  
934  N  N   . ASN A  136 ? 1.4316 1.6906 1.5353 -0.0042 -0.0261 -0.0281 133  ASN A N   
935  C  CA  . ASN A  136 ? 1.4115 1.6781 1.5183 -0.0019 -0.0229 -0.0145 133  ASN A CA  
936  C  C   . ASN A  136 ? 1.4295 1.6708 1.5349 0.0028  -0.0189 -0.0070 133  ASN A C   
937  O  O   . ASN A  136 ? 1.4218 1.6655 1.5297 0.0053  -0.0164 0.0020  133  ASN A O   
938  C  CB  . ASN A  136 ? 1.4187 1.7070 1.5277 -0.0019 -0.0219 -0.0052 133  ASN A CB  
939  N  N   . LEU A  137 ? 1.3592 1.5779 1.4603 0.0040  -0.0182 -0.0107 134  LEU A N   
940  C  CA  . LEU A  137 ? 1.3439 1.5382 1.4431 0.0078  -0.0143 -0.0053 134  LEU A CA  
941  C  C   . LEU A  137 ? 1.3451 1.5227 1.4430 0.0080  -0.0153 -0.0122 134  LEU A C   
942  O  O   . LEU A  137 ? 1.3482 1.5148 1.4467 0.0108  -0.0124 -0.0064 134  LEU A O   
943  C  CB  . LEU A  137 ? 1.3498 1.5305 1.4452 0.0081  -0.0126 -0.0051 134  LEU A CB  
944  N  N   . VAL A  138 ? 1.2486 1.4245 1.3451 0.0052  -0.0192 -0.0243 135  VAL A N   
945  C  CA  . VAL A  138 ? 1.2230 1.3834 1.3182 0.0051  -0.0205 -0.0313 135  VAL A CA  
946  C  C   . VAL A  138 ? 1.1946 1.3687 1.2926 0.0017  -0.0236 -0.0376 135  VAL A C   
947  O  O   . VAL A  138 ? 1.1812 1.3558 1.2785 -0.0008 -0.0267 -0.0482 135  VAL A O   
948  C  CB  . VAL A  138 ? 1.2805 1.4246 1.3717 0.0052  -0.0218 -0.0394 135  VAL A CB  
949  N  N   . THR A  139 ? 1.0929 1.2785 1.1941 0.0015  -0.0224 -0.0309 136  THR A N   
950  C  CA  . THR A  139 ? 1.0504 1.2515 1.1543 -0.0026 -0.0247 -0.0355 136  THR A CA  
951  C  C   . THR A  139 ? 1.0173 1.2044 1.1210 -0.0031 -0.0247 -0.0379 136  THR A C   
952  O  O   . THR A  139 ? 1.0001 1.1695 1.1024 0.0004  -0.0225 -0.0330 136  THR A O   
953  C  CB  . THR A  139 ? 1.1417 1.3687 1.2493 -0.0031 -0.0236 -0.0264 136  THR A CB  
954  O  OG1 . THR A  139 ? 1.1456 1.3693 1.2547 -0.0002 -0.0207 -0.0167 136  THR A OG1 
955  C  CG2 . THR A  139 ? 1.1080 1.3459 1.2159 -0.0013 -0.0224 -0.0197 136  THR A CG2 
956  N  N   . GLN A  140 ? 0.9302 1.1264 1.0353 -0.0080 -0.0270 -0.0452 137  GLN A N   
957  C  CA  . GLN A  140 ? 0.9160 1.1026 1.0213 -0.0099 -0.0273 -0.0477 137  GLN A CA  
958  C  C   . GLN A  140 ? 0.9327 1.1253 1.0399 -0.0080 -0.0247 -0.0364 137  GLN A C   
959  O  O   . GLN A  140 ? 0.9379 1.1175 1.0446 -0.0076 -0.0241 -0.0353 137  GLN A O   
960  C  CB  . GLN A  140 ? 0.9264 1.1243 1.0329 -0.0166 -0.0298 -0.0582 137  GLN A CB  
961  C  CG  . GLN A  140 ? 1.1801 1.3767 1.2855 -0.0183 -0.0321 -0.0697 137  GLN A CG  
962  C  CD  . GLN A  140 ? 1.4966 1.7185 1.6035 -0.0205 -0.0329 -0.0709 137  GLN A CD  
963  O  OE1 . GLN A  140 ? 1.4603 1.6826 1.5662 -0.0201 -0.0342 -0.0773 137  GLN A OE1 
964  N  NE2 . GLN A  140 ? 1.3868 1.6320 1.4963 -0.0228 -0.0323 -0.0645 137  GLN A NE2 
965  N  N   . LYS A  141 ? 0.8452 1.0584 0.9548 -0.0067 -0.0232 -0.0275 138  LYS A N   
966  C  CA  . LYS A  141 ? 0.8244 1.0462 0.9364 -0.0037 -0.0204 -0.0153 138  LYS A CA  
967  C  C   . LYS A  141 ? 0.8607 1.0604 0.9710 0.0029  -0.0170 -0.0081 138  LYS A C   
968  O  O   . LYS A  141 ? 0.8590 1.0530 0.9699 0.0053  -0.0149 -0.0024 138  LYS A O   
969  C  CB  . LYS A  141 ? 0.8348 1.0842 0.9499 -0.0032 -0.0195 -0.0074 138  LYS A CB  
970  C  CG  . LYS A  141 ? 0.8895 1.1529 1.0078 -0.0002 -0.0166 0.0052  138  LYS A CG  
971  C  CD  . LYS A  141 ? 1.0042 1.2811 1.1249 0.0049  -0.0138 0.0177  138  LYS A CD  
972  C  CE  . LYS A  141 ? 1.0968 1.4078 1.2209 0.0013  -0.0152 0.0198  138  LYS A CE  
973  N  NZ  . LYS A  141 ? 1.1778 1.5029 1.3052 0.0073  -0.0116 0.0353  138  LYS A NZ  
974  N  N   . LYS A  142 ? 0.7955 0.9833 0.9035 0.0054  -0.0164 -0.0090 139  LYS A N   
975  C  CA  . LYS A  142 ? 0.7858 0.9527 0.8917 0.0106  -0.0130 -0.0038 139  LYS A CA  
976  C  C   . LYS A  142 ? 0.8268 0.9718 0.9301 0.0103  -0.0136 -0.0098 139  LYS A C   
977  O  O   . LYS A  142 ? 0.8291 0.9617 0.9319 0.0138  -0.0106 -0.0044 139  LYS A O   
978  C  CB  . LYS A  142 ? 0.8042 0.9670 0.9081 0.0117  -0.0124 -0.0042 139  LYS A CB  
979  C  CG  . LYS A  142 ? 0.9127 1.0941 1.0194 0.0135  -0.0104 0.0053  139  LYS A CG  
980  C  CD  . LYS A  142 ? 1.0536 1.2216 1.1584 0.0173  -0.0066 0.0113  139  LYS A CD  
981  C  CE  . LYS A  142 ? 1.1295 1.3146 1.2368 0.0187  -0.0048 0.0206  139  LYS A CE  
982  N  NZ  . LYS A  142 ? 1.2193 1.4207 1.3264 0.0143  -0.0086 0.0143  139  LYS A NZ  
983  N  N   . ALA A  143 ? 0.7494 0.8905 0.8514 0.0061  -0.0174 -0.0209 140  ALA A N   
984  C  CA  . ALA A  143 ? 0.7382 0.8598 0.8380 0.0056  -0.0183 -0.0266 140  ALA A CA  
985  C  C   . ALA A  143 ? 0.7954 0.9174 0.8968 0.0051  -0.0176 -0.0228 140  ALA A C   
986  O  O   . ALA A  143 ? 0.7990 0.9049 0.8990 0.0072  -0.0162 -0.0213 140  ALA A O   
987  C  CB  . ALA A  143 ? 0.7406 0.8609 0.8396 0.0016  -0.0221 -0.0383 140  ALA A CB  
988  N  N   . ARG A  144 ? 0.7365 0.8786 0.8409 0.0021  -0.0183 -0.0211 141  ARG A N   
989  C  CA  . ARG A  144 ? 0.7264 0.8735 0.8324 0.0007  -0.0178 -0.0174 141  ARG A CA  
990  C  C   . ARG A  144 ? 0.8209 0.9654 0.9276 0.0065  -0.0138 -0.0062 141  ARG A C   
991  O  O   . ARG A  144 ? 0.8284 0.9643 0.9348 0.0071  -0.0130 -0.0045 141  ARG A O   
992  C  CB  . ARG A  144 ? 0.6747 0.8466 0.7834 -0.0045 -0.0195 -0.0186 141  ARG A CB  
993  C  CG  . ARG A  144 ? 0.8058 0.9763 0.9139 -0.0115 -0.0230 -0.0307 141  ARG A CG  
994  C  CD  . ARG A  144 ? 0.9054 1.1008 1.0159 -0.0179 -0.0243 -0.0326 141  ARG A CD  
995  N  NE  . ARG A  144 ? 1.0219 1.2380 1.1338 -0.0183 -0.0246 -0.0321 141  ARG A NE  
996  C  CZ  . ARG A  144 ? 1.1735 1.3940 1.2850 -0.0222 -0.0269 -0.0419 141  ARG A CZ  
997  N  NH1 . ARG A  144 ? 1.0357 1.2404 1.1455 -0.0256 -0.0288 -0.0532 141  ARG A NH1 
998  N  NH2 . ARG A  144 ? 0.9399 1.1809 1.0529 -0.0224 -0.0271 -0.0404 141  ARG A NH2 
999  N  N   . PHE A  145 ? 0.7989 0.9503 0.9067 0.0110  -0.0110 0.0015  142  PHE A N   
1000 C  CA  . PHE A  145 ? 0.8052 0.9531 0.9140 0.0173  -0.0063 0.0124  142  PHE A CA  
1001 C  C   . PHE A  145 ? 0.8088 0.9309 0.9145 0.0205  -0.0042 0.0111  142  PHE A C   
1002 O  O   . PHE A  145 ? 0.7990 0.9147 0.9050 0.0239  -0.0012 0.0164  142  PHE A O   
1003 C  CB  . PHE A  145 ? 0.8429 1.0034 0.9538 0.0211  -0.0037 0.0207  142  PHE A CB  
1004 C  CG  . PHE A  145 ? 0.8862 1.0416 0.9985 0.0283  0.0019  0.0321  142  PHE A CG  
1005 C  CD1 . PHE A  145 ? 0.9341 1.1023 1.0496 0.0312  0.0040  0.0404  142  PHE A CD1 
1006 C  CD2 . PHE A  145 ? 0.9358 1.0737 1.0461 0.0323  0.0054  0.0342  142  PHE A CD2 
1007 C  CE1 . PHE A  145 ? 0.9510 1.1137 1.0680 0.0387  0.0096  0.0508  142  PHE A CE1 
1008 C  CE2 . PHE A  145 ? 0.9846 1.1161 1.0962 0.0390  0.0113  0.0441  142  PHE A CE2 
1009 C  CZ  . PHE A  145 ? 0.9573 1.1009 1.0724 0.0426  0.0134  0.0524  142  PHE A CZ  
1010 N  N   . VAL A  146 ? 0.7310 0.8400 0.8336 0.0192  -0.0055 0.0041  143  VAL A N   
1011 C  CA  . VAL A  146 ? 0.7075 0.7941 0.8066 0.0211  -0.0039 0.0016  143  VAL A CA  
1012 C  C   . VAL A  146 ? 0.7357 0.8127 0.8340 0.0193  -0.0054 -0.0022 143  VAL A C   
1013 O  O   . VAL A  146 ? 0.7332 0.7988 0.8305 0.0222  -0.0024 0.0009  143  VAL A O   
1014 C  CB  . VAL A  146 ? 0.7496 0.8292 0.8459 0.0195  -0.0056 -0.0052 143  VAL A CB  
1015 C  CG1 . VAL A  146 ? 0.7519 0.8108 0.8444 0.0201  -0.0047 -0.0093 143  VAL A CG1 
1016 C  CG2 . VAL A  146 ? 0.7455 0.8322 0.8423 0.0216  -0.0032 0.0001  143  VAL A CG2 
1017 N  N   . CYS A  147 ? 0.6676 0.7497 0.7664 0.0144  -0.0097 -0.0089 144  CYS A N   
1018 C  CA  . CYS A  147 ? 0.6535 0.7271 0.7517 0.0120  -0.0114 -0.0124 144  CYS A CA  
1019 C  C   . CYS A  147 ? 0.6908 0.7691 0.7908 0.0134  -0.0093 -0.0054 144  CYS A C   
1020 O  O   . CYS A  147 ? 0.6946 0.7609 0.7933 0.0143  -0.0084 -0.0050 144  CYS A O   
1021 C  CB  . CYS A  147 ? 0.6559 0.7339 0.7546 0.0063  -0.0157 -0.0207 144  CYS A CB  
1022 S  SG  . CYS A  147 ? 0.7113 0.7782 0.8074 0.0054  -0.0183 -0.0302 144  CYS A SG  
1023 N  N   . VAL A  148 ? 0.6441 0.7410 0.7470 0.0139  -0.0083 0.0006  145  VAL A N   
1024 C  CA  . VAL A  148 ? 0.6297 0.7345 0.7347 0.0161  -0.0059 0.0085  145  VAL A CA  
1025 C  C   . VAL A  148 ? 0.6790 0.7705 0.7830 0.0226  -0.0011 0.0142  145  VAL A C   
1026 O  O   . VAL A  148 ? 0.6556 0.7404 0.7591 0.0237  0.0001  0.0158  145  VAL A O   
1027 C  CB  . VAL A  148 ? 0.6488 0.7786 0.7574 0.0161  -0.0054 0.0147  145  VAL A CB  
1028 C  CG1 . VAL A  148 ? 0.6411 0.7789 0.7518 0.0202  -0.0021 0.0241  145  VAL A CG1 
1029 C  CG2 . VAL A  148 ? 0.6372 0.7806 0.7465 0.0085  -0.0097 0.0081  145  VAL A CG2 
1030 N  N   . GLY A  149 ? 0.6446 0.7319 0.7480 0.0263  0.0015  0.0163  146  GLY A N   
1031 C  CA  . GLY A  149 ? 0.6540 0.7271 0.7561 0.0319  0.0066  0.0204  146  GLY A CA  
1032 C  C   . GLY A  149 ? 0.7188 0.7730 0.8175 0.0307  0.0063  0.0147  146  GLY A C   
1033 O  O   . GLY A  149 ? 0.7284 0.7749 0.8267 0.0340  0.0099  0.0179  146  GLY A O   
1034 N  N   . ILE A  150 ? 0.6472 0.6951 0.7436 0.0261  0.0021  0.0061  147  ILE A N   
1035 C  CA  . ILE A  150 ? 0.6314 0.6638 0.7248 0.0246  0.0011  0.0006  147  ILE A CA  
1036 C  C   . ILE A  150 ? 0.7080 0.7407 0.8023 0.0233  0.0003  0.0016  147  ILE A C   
1037 O  O   . ILE A  150 ? 0.7217 0.7444 0.8145 0.0250  0.0025  0.0023  147  ILE A O   
1038 C  CB  . ILE A  150 ? 0.6496 0.6775 0.7410 0.0208  -0.0031 -0.0078 147  ILE A CB  
1039 C  CG1 . ILE A  150 ? 0.6358 0.6597 0.7252 0.0224  -0.0013 -0.0088 147  ILE A CG1 
1040 C  CG2 . ILE A  150 ? 0.6452 0.6609 0.7346 0.0189  -0.0049 -0.0125 147  ILE A CG2 
1041 C  CD1 . ILE A  150 ? 0.5773 0.6016 0.6654 0.0195  -0.0051 -0.0160 147  ILE A CD1 
1042 N  N   . TRP A  151 ? 0.6492 0.6943 0.7458 0.0200  -0.0028 0.0016  148  TRP A N   
1043 C  CA  . TRP A  151 ? 0.6255 0.6731 0.7230 0.0179  -0.0038 0.0030  148  TRP A CA  
1044 C  C   . TRP A  151 ? 0.7175 0.7680 0.8162 0.0228  0.0007  0.0108  148  TRP A C   
1045 O  O   . TRP A  151 ? 0.7407 0.7839 0.8384 0.0231  0.0016  0.0111  148  TRP A O   
1046 C  CB  . TRP A  151 ? 0.5759 0.6382 0.6756 0.0127  -0.0073 0.0016  148  TRP A CB  
1047 C  CG  . TRP A  151 ? 0.5682 0.6250 0.6671 0.0072  -0.0117 -0.0068 148  TRP A CG  
1048 C  CD1 . TRP A  151 ? 0.5969 0.6591 0.6961 0.0044  -0.0140 -0.0120 148  TRP A CD1 
1049 C  CD2 . TRP A  151 ? 0.5624 0.6083 0.6602 0.0036  -0.0140 -0.0108 148  TRP A CD2 
1050 N  NE1 . TRP A  151 ? 0.5845 0.6383 0.6829 -0.0001 -0.0173 -0.0193 148  TRP A NE1 
1051 C  CE2 . TRP A  151 ? 0.6019 0.6451 0.6995 -0.0005 -0.0173 -0.0183 148  TRP A CE2 
1052 C  CE3 . TRP A  151 ? 0.5733 0.6108 0.6703 0.0040  -0.0133 -0.0086 148  TRP A CE3 
1053 C  CZ2 . TRP A  151 ? 0.5874 0.6191 0.6843 -0.0040 -0.0197 -0.0231 148  TRP A CZ2 
1054 C  CZ3 . TRP A  151 ? 0.5849 0.6123 0.6811 0.0001  -0.0160 -0.0130 148  TRP A CZ3 
1055 C  CH2 . TRP A  151 ? 0.5918 0.6157 0.6880 -0.0036 -0.0191 -0.0199 148  TRP A CH2 
1056 N  N   . ILE A  152 ? 0.6651 0.7263 0.7659 0.0269  0.0038  0.0173  149  ILE A N   
1057 C  CA  . ILE A  152 ? 0.6665 0.7309 0.7690 0.0327  0.0087  0.0252  149  ILE A CA  
1058 C  C   . ILE A  152 ? 0.7125 0.7589 0.8124 0.0365  0.0128  0.0244  149  ILE A C   
1059 O  O   . ILE A  152 ? 0.7236 0.7667 0.8233 0.0380  0.0147  0.0260  149  ILE A O   
1060 C  CB  . ILE A  152 ? 0.6993 0.7794 0.8051 0.0372  0.0115  0.0332  149  ILE A CB  
1061 C  CG1 . ILE A  152 ? 0.6971 0.7986 0.8054 0.0326  0.0075  0.0338  149  ILE A CG1 
1062 C  CG2 . ILE A  152 ? 0.6805 0.7624 0.7881 0.0445  0.0174  0.0418  149  ILE A CG2 
1063 C  CD1 . ILE A  152 ? 0.8479 0.9639 0.9579 0.0303  0.0063  0.0367  149  ILE A CD1 
1064 N  N   . PHE A  153 ? 0.6572 0.6929 0.7550 0.0372  0.0140  0.0213  150  PHE A N   
1065 C  CA  . PHE A  153 ? 0.6653 0.6844 0.7602 0.0395  0.0180  0.0194  150  PHE A CA  
1066 C  C   . PHE A  153 ? 0.7181 0.7281 0.8105 0.0364  0.0162  0.0142  150  PHE A C   
1067 O  O   . PHE A  153 ? 0.7390 0.7442 0.8310 0.0390  0.0199  0.0160  150  PHE A O   
1068 C  CB  . PHE A  153 ? 0.6926 0.7040 0.7854 0.0391  0.0187  0.0162  150  PHE A CB  
1069 C  CG  . PHE A  153 ? 0.7386 0.7338 0.8282 0.0407  0.0233  0.0139  150  PHE A CG  
1070 C  CD1 . PHE A  153 ? 0.7795 0.7698 0.8697 0.0460  0.0301  0.0190  150  PHE A CD1 
1071 C  CD2 . PHE A  153 ? 0.7914 0.7767 0.8771 0.0367  0.0212  0.0064  150  PHE A CD2 
1072 C  CE1 . PHE A  153 ? 0.7981 0.7731 0.8850 0.0464  0.0348  0.0158  150  PHE A CE1 
1073 C  CE2 . PHE A  153 ? 0.8283 0.8005 0.9107 0.0372  0.0256  0.0037  150  PHE A CE2 
1074 C  CZ  . PHE A  153 ? 0.7961 0.7629 0.8790 0.0416  0.0324  0.0080  150  PHE A CZ  
1075 N  N   . VAL A  154 ? 0.6458 0.6549 0.7371 0.0311  0.0107  0.0084  151  VAL A N   
1076 C  CA  . VAL A  154 ? 0.6255 0.6271 0.7149 0.0279  0.0083  0.0042  151  VAL A CA  
1077 C  C   . VAL A  154 ? 0.6613 0.6691 0.7524 0.0275  0.0081  0.0078  151  VAL A C   
1078 O  O   . VAL A  154 ? 0.6500 0.6519 0.7398 0.0281  0.0099  0.0076  151  VAL A O   
1079 C  CB  . VAL A  154 ? 0.6584 0.6573 0.7467 0.0232  0.0029  -0.0021 151  VAL A CB  
1080 C  CG1 . VAL A  154 ? 0.6465 0.6385 0.7334 0.0205  0.0007  -0.0050 151  VAL A CG1 
1081 C  CG2 . VAL A  154 ? 0.6534 0.6466 0.7396 0.0238  0.0034  -0.0058 151  VAL A CG2 
1082 N  N   . ILE A  155 ? 0.6212 0.6422 0.7151 0.0260  0.0059  0.0109  152  ILE A N   
1083 C  CA  . ILE A  155 ? 0.6202 0.6499 0.7159 0.0251  0.0055  0.0147  152  ILE A CA  
1084 C  C   . ILE A  155 ? 0.6621 0.6920 0.7582 0.0309  0.0111  0.0199  152  ILE A C   
1085 O  O   . ILE A  155 ? 0.6581 0.6877 0.7540 0.0302  0.0114  0.0206  152  ILE A O   
1086 C  CB  . ILE A  155 ? 0.6564 0.7025 0.7549 0.0222  0.0027  0.0171  152  ILE A CB  
1087 C  CG1 . ILE A  155 ? 0.6511 0.6955 0.7491 0.0151  -0.0028 0.0112  152  ILE A CG1 
1088 C  CG2 . ILE A  155 ? 0.6618 0.7213 0.7625 0.0236  0.0044  0.0236  152  ILE A CG2 
1089 C  CD1 . ILE A  155 ? 0.7221 0.7797 0.8220 0.0117  -0.0053 0.0104  152  ILE A CD1 
1090 N  N   . LEU A  156 ? 0.6059 0.6357 0.7028 0.0365  0.0158  0.0232  153  LEU A N   
1091 C  CA  . LEU A  156 ? 0.6094 0.6378 0.7069 0.0428  0.0220  0.0279  153  LEU A CA  
1092 C  C   . LEU A  156 ? 0.6822 0.6950 0.7765 0.0437  0.0253  0.0237  153  LEU A C   
1093 O  O   . LEU A  156 ? 0.6662 0.6787 0.7604 0.0453  0.0277  0.0248  153  LEU A O   
1094 C  CB  . LEU A  156 ? 0.6062 0.6399 0.7061 0.0488  0.0262  0.0339  153  LEU A CB  
1095 C  CG  . LEU A  156 ? 0.6642 0.7176 0.7678 0.0492  0.0244  0.0399  153  LEU A CG  
1096 C  CD1 . LEU A  156 ? 0.6699 0.7280 0.7759 0.0550  0.0283  0.0460  153  LEU A CD1 
1097 C  CD2 . LEU A  156 ? 0.6782 0.7434 0.7837 0.0503  0.0248  0.0444  153  LEU A CD2 
1098 N  N   . THR A  157 ? 0.6486 0.6499 0.7403 0.0424  0.0254  0.0188  154  THR A N   
1099 C  CA  . THR A  157 ? 0.6462 0.6339 0.7345 0.0424  0.0288  0.0142  154  THR A CA  
1100 C  C   . THR A  157 ? 0.7023 0.6880 0.7887 0.0379  0.0255  0.0100  154  THR A C   
1101 O  O   . THR A  157 ? 0.7040 0.6827 0.7882 0.0382  0.0288  0.0074  154  THR A O   
1102 C  CB  . THR A  157 ? 0.6951 0.6735 0.7810 0.0417  0.0297  0.0104  154  THR A CB  
1103 O  OG1 . THR A  157 ? 0.8381 0.8202 0.9240 0.0374  0.0234  0.0077  154  THR A OG1 
1104 C  CG2 . THR A  157 ? 0.5794 0.5569 0.6669 0.0468  0.0349  0.0150  154  THR A CG2 
1105 N  N   . SER A  158 ? 0.6499 0.6420 0.7373 0.0336  0.0193  0.0097  155  SER A N   
1106 C  CA  . SER A  158 ? 0.6415 0.6324 0.7277 0.0294  0.0159  0.0071  155  SER A CA  
1107 C  C   . SER A  158 ? 0.7260 0.7257 0.8141 0.0295  0.0160  0.0114  155  SER A C   
1108 O  O   . SER A  158 ? 0.7306 0.7295 0.8178 0.0266  0.0143  0.0102  155  SER A O   
1109 C  CB  . SER A  158 ? 0.6623 0.6534 0.7486 0.0246  0.0096  0.0043  155  SER A CB  
1110 O  OG  . SER A  158 ? 0.8001 0.7832 0.8842 0.0241  0.0092  -0.0003 155  SER A OG  
1111 N  N   . SER A  159 ? 0.7027 0.7120 0.7935 0.0330  0.0182  0.0168  156  SER A N   
1112 C  CA  . SER A  159 ? 0.7024 0.7228 0.7952 0.0335  0.0185  0.0215  156  SER A CA  
1113 C  C   . SER A  159 ? 0.7682 0.7858 0.8597 0.0344  0.0214  0.0207  156  SER A C   
1114 O  O   . SER A  159 ? 0.7695 0.7945 0.8617 0.0314  0.0188  0.0225  156  SER A O   
1115 C  CB  . SER A  159 ? 0.7257 0.7571 0.8216 0.0386  0.0215  0.0277  156  SER A CB  
1116 O  OG  . SER A  159 ? 0.8764 0.9017 0.9722 0.0453  0.0281  0.0289  156  SER A OG  
1117 N  N   . PRO A  160 ? 0.7235 0.7312 0.8127 0.0373  0.0264  0.0176  157  PRO A N   
1118 C  CA  . PRO A  160 ? 0.7250 0.7326 0.8130 0.0371  0.0287  0.0162  157  PRO A CA  
1119 C  C   . PRO A  160 ? 0.7995 0.8090 0.8864 0.0308  0.0234  0.0147  157  PRO A C   
1120 O  O   . PRO A  160 ? 0.7998 0.8143 0.8866 0.0303  0.0244  0.0155  157  PRO A O   
1121 C  CB  . PRO A  160 ? 0.7528 0.7481 0.8380 0.0392  0.0341  0.0113  157  PRO A CB  
1122 C  CG  . PRO A  160 ? 0.8021 0.7934 0.8883 0.0433  0.0368  0.0128  157  PRO A CG  
1123 C  CD  . PRO A  160 ? 0.7423 0.7397 0.8302 0.0406  0.0306  0.0151  157  PRO A CD  
1124 N  N   . PHE A  161 ? 0.7758 0.7820 0.8623 0.0264  0.0179  0.0128  158  PHE A N   
1125 C  CA  . PHE A  161 ? 0.7841 0.7907 0.8701 0.0208  0.0129  0.0122  158  PHE A CA  
1126 C  C   . PHE A  161 ? 0.8999 0.9172 0.9884 0.0180  0.0095  0.0170  158  PHE A C   
1127 O  O   . PHE A  161 ? 0.9122 0.9313 1.0006 0.0138  0.0065  0.0179  158  PHE A O   
1128 C  CB  . PHE A  161 ? 0.7992 0.7974 0.8841 0.0179  0.0090  0.0084  158  PHE A CB  
1129 C  CG  . PHE A  161 ? 0.8024 0.7920 0.8842 0.0192  0.0118  0.0035  158  PHE A CG  
1130 C  CD1 . PHE A  161 ? 0.8250 0.8135 0.9048 0.0171  0.0120  0.0016  158  PHE A CD1 
1131 C  CD2 . PHE A  161 ? 0.8103 0.7944 0.8911 0.0222  0.0149  0.0013  158  PHE A CD2 
1132 C  CE1 . PHE A  161 ? 0.8274 0.8099 0.9041 0.0176  0.0151  -0.0031 158  PHE A CE1 
1133 C  CE2 . PHE A  161 ? 0.8366 0.8133 0.9143 0.0226  0.0181  -0.0033 158  PHE A CE2 
1134 C  CZ  . PHE A  161 ? 0.8087 0.7850 0.8842 0.0201  0.0182  -0.0058 158  PHE A CZ  
1135 N  N   . LEU A  162 ? 0.8913 0.9165 0.9820 0.0201  0.0103  0.0205  159  LEU A N   
1136 C  CA  . LEU A  162 ? 0.9049 0.9427 0.9979 0.0174  0.0078  0.0252  159  LEU A CA  
1137 C  C   . LEU A  162 ? 1.0089 1.0563 1.1025 0.0202  0.0114  0.0289  159  LEU A C   
1138 O  O   . LEU A  162 ? 1.0028 1.0605 1.0976 0.0168  0.0090  0.0324  159  LEU A O   
1139 C  CB  . LEU A  162 ? 0.8968 0.9414 0.9918 0.0184  0.0073  0.0273  159  LEU A CB  
1140 C  CG  . LEU A  162 ? 0.9397 0.9819 1.0351 0.0130  0.0023  0.0249  159  LEU A CG  
1141 C  CD1 . LEU A  162 ? 0.9307 0.9828 1.0280 0.0144  0.0025  0.0271  159  LEU A CD1 
1142 C  CD2 . LEU A  162 ? 0.9444 0.9892 1.0401 0.0059  -0.0023 0.0255  159  LEU A CD2 
1143 N  N   . MET A  163 ? 1.0094 1.0537 1.1023 0.0264  0.0172  0.0279  160  MET A N   
1144 C  CA  . MET A  163 ? 1.0273 1.0802 1.1210 0.0303  0.0216  0.0307  160  MET A CA  
1145 C  C   . MET A  163 ? 1.0689 1.1162 1.1602 0.0302  0.0241  0.0268  160  MET A C   
1146 O  O   . MET A  163 ? 1.0618 1.1108 1.1531 0.0351  0.0298  0.0266  160  MET A O   
1147 C  CB  . MET A  163 ? 1.0745 1.1305 1.1701 0.0382  0.0271  0.0335  160  MET A CB  
1148 C  CG  . MET A  163 ? 1.1595 1.2015 1.2536 0.0425  0.0315  0.0298  160  MET A CG  
1149 S  SD  . MET A  163 ? 1.2520 1.2982 1.3492 0.0513  0.0369  0.0351  160  MET A SD  
1150 C  CE  . MET A  163 ? 1.2096 1.2607 1.3081 0.0470  0.0305  0.0370  160  MET A CE  
1151 N  N   . ALA A  164 ? 1.0346 1.0764 1.1242 0.0245  0.0201  0.0240  161  ALA A N   
1152 C  CA  . ALA A  164 ? 1.0411 1.0801 1.1284 0.0231  0.0217  0.0205  161  ALA A CA  
1153 C  C   . ALA A  164 ? 1.1198 1.1704 1.2079 0.0197  0.0196  0.0239  161  ALA A C   
1154 O  O   . ALA A  164 ? 1.1097 1.1666 1.1994 0.0157  0.0149  0.0280  161  ALA A O   
1155 C  CB  . ALA A  164 ? 1.0539 1.0823 1.1391 0.0195  0.0187  0.0164  161  ALA A CB  
1156 N  N   . LYS A  165 ? 1.1125 1.1664 1.1993 0.0208  0.0234  0.0218  162  LYS A N   
1157 C  CA  . LYS A  165 ? 1.1186 1.1849 1.2059 0.0179  0.0223  0.0246  162  LYS A CA  
1158 C  C   . LYS A  165 ? 1.1824 1.2493 1.2696 0.0107  0.0158  0.0267  162  LYS A C   
1159 O  O   . LYS A  165 ? 1.1789 1.2364 1.2646 0.0088  0.0141  0.0237  162  LYS A O   
1160 C  CB  . LYS A  165 ? 1.1522 1.2203 1.2377 0.0201  0.0281  0.0201  162  LYS A CB  
1161 N  N   . PRO A  166 ? 1.1475 1.2256 1.2364 0.0068  0.0123  0.0323  163  PRO A N   
1162 C  CA  . PRO A  166 ? 1.1534 1.2307 1.2425 0.0001  0.0065  0.0351  163  PRO A CA  
1163 C  C   . PRO A  166 ? 1.2203 1.2985 1.3078 -0.0017 0.0069  0.0334  163  PRO A C   
1164 O  O   . PRO A  166 ? 1.2204 1.3054 1.3068 0.0006  0.0113  0.0310  163  PRO A O   
1165 C  CB  . PRO A  166 ? 1.1692 1.2594 1.2603 -0.0035 0.0039  0.0414  163  PRO A CB  
1166 C  CG  . PRO A  166 ? 1.2178 1.3190 1.3093 0.0015  0.0089  0.0415  163  PRO A CG  
1167 C  CD  . PRO A  166 ? 1.1633 1.2551 1.2540 0.0082  0.0135  0.0367  163  PRO A CD  
1168 N  N   . GLN A  167 ? 1.1756 1.2476 1.2630 -0.0057 0.0027  0.0345  164  GLN A N   
1169 C  CA  . GLN A  167 ? 1.1721 1.2463 1.2582 -0.0076 0.0025  0.0338  164  GLN A CA  
1170 C  C   . GLN A  167 ? 1.2443 1.3284 1.3321 -0.0129 -0.0014 0.0408  164  GLN A C   
1171 O  O   . GLN A  167 ? 1.2413 1.3216 1.3309 -0.0164 -0.0057 0.0453  164  GLN A O   
1172 C  CB  . GLN A  167 ? 1.1881 1.2495 1.2732 -0.0076 0.0006  0.0310  164  GLN A CB  
1173 C  CG  . GLN A  167 ? 1.1508 1.2016 1.2343 -0.0031 0.0038  0.0246  164  GLN A CG  
1174 C  CD  . GLN A  167 ? 1.2337 1.2722 1.3171 -0.0034 0.0007  0.0233  164  GLN A CD  
1175 O  OE1 . GLN A  167 ? 1.1488 1.1853 1.2329 -0.0062 -0.0032 0.0261  164  GLN A OE1 
1176 N  NE2 . GLN A  167 ? 1.1576 1.1878 1.2403 -0.0002 0.0024  0.0193  164  GLN A NE2 
1177 N  N   . LYS A  168 ? 1.2170 1.3142 1.3042 -0.0139 0.0005  0.0415  165  LYS A N   
1178 C  CA  . LYS A  168 ? 1.2209 1.3296 1.3097 -0.0190 -0.0028 0.0487  165  LYS A CA  
1179 C  C   . LYS A  168 ? 1.3131 1.4288 1.4008 -0.0203 -0.0022 0.0482  165  LYS A C   
1180 O  O   . LYS A  168 ? 1.3222 1.4420 1.4077 -0.0176 0.0025  0.0421  165  LYS A O   
1181 C  CB  . LYS A  168 ? 1.2381 1.3614 1.3278 -0.0193 -0.0013 0.0512  165  LYS A CB  
1182 C  CG  . LYS A  168 ? 1.3517 1.4728 1.4429 -0.0196 -0.0028 0.0537  165  LYS A CG  
1183 C  CD  . LYS A  168 ? 1.4485 1.5729 1.5417 -0.0263 -0.0080 0.0616  165  LYS A CD  
1184 N  N   . ASP A  169 ? 1.2814 1.3985 1.3705 -0.0244 -0.0065 0.0547  166  ASP A N   
1185 C  CA  . ASP A  169 ? 1.2825 1.4090 1.3710 -0.0258 -0.0063 0.0558  166  ASP A CA  
1186 C  C   . ASP A  169 ? 1.3449 1.4920 1.4337 -0.0286 -0.0053 0.0590  166  ASP A C   
1187 O  O   . ASP A  169 ? 1.3359 1.4894 1.4256 -0.0295 -0.0051 0.0611  166  ASP A O   
1188 C  CB  . ASP A  169 ? 1.3052 1.4245 1.3953 -0.0279 -0.0108 0.0618  166  ASP A CB  
1189 C  CG  . ASP A  169 ? 1.3941 1.5151 1.4875 -0.0325 -0.0154 0.0719  166  ASP A CG  
1190 O  OD1 . ASP A  169 ? 1.3846 1.5180 1.4788 -0.0354 -0.0155 0.0757  166  ASP A OD1 
1191 O  OD2 . ASP A  169 ? 1.4562 1.5660 1.5513 -0.0332 -0.0186 0.0761  166  ASP A OD2 
1192 N  N   . GLU A  170 ? 1.3059 1.4650 1.3940 -0.0302 -0.0047 0.0596  167  GLU A N   
1193 C  CA  . GLU A  170 ? 1.2954 1.4764 1.3837 -0.0333 -0.0037 0.0625  167  GLU A CA  
1194 C  C   . GLU A  170 ? 1.3347 1.5227 1.4260 -0.0373 -0.0076 0.0722  167  GLU A C   
1195 O  O   . GLU A  170 ? 1.3192 1.5222 1.4106 -0.0386 -0.0061 0.0727  167  GLU A O   
1196 C  CB  . GLU A  170 ? 1.3086 1.5003 1.3964 -0.0352 -0.0041 0.0640  167  GLU A CB  
1197 N  N   . LYS A  171 ? 1.2883 1.4647 1.3819 -0.0394 -0.0123 0.0795  168  LYS A N   
1198 C  CA  . LYS A  171 ? 1.2785 1.4577 1.3748 -0.0443 -0.0163 0.0890  168  LYS A CA  
1199 C  C   . LYS A  171 ? 1.3155 1.4855 1.4121 -0.0441 -0.0166 0.0875  168  LYS A C   
1200 O  O   . LYS A  171 ? 1.3184 1.4842 1.4169 -0.0484 -0.0201 0.0943  168  LYS A O   
1201 C  CB  . LYS A  171 ? 1.3122 1.4828 1.4109 -0.0467 -0.0205 0.0974  168  LYS A CB  
1202 N  N   . ASN A  172 ? 1.2495 1.4170 1.3440 -0.0394 -0.0126 0.0788  169  ASN A N   
1203 C  CA  . ASN A  172 ? 1.2387 1.4006 1.3333 -0.0380 -0.0120 0.0767  169  ASN A CA  
1204 C  C   . ASN A  172 ? 1.2660 1.4091 1.3617 -0.0395 -0.0155 0.0785  169  ASN A C   
1205 O  O   . ASN A  172 ? 1.2622 1.4042 1.3586 -0.0408 -0.0162 0.0793  169  ASN A O   
1206 C  CB  . ASN A  172 ? 1.2397 1.4193 1.3352 -0.0412 -0.0122 0.0813  169  ASN A CB  
1207 N  N   . ASN A  173 ? 1.1934 1.3229 1.2894 -0.0390 -0.0172 0.0784  170  ASN A N   
1208 C  CA  . ASN A  173 ? 1.1725 1.2835 1.2696 -0.0399 -0.0200 0.0788  170  ASN A CA  
1209 C  C   . ASN A  173 ? 1.1842 1.2842 1.2795 -0.0345 -0.0175 0.0701  170  ASN A C   
1210 O  O   . ASN A  173 ? 1.1768 1.2777 1.2702 -0.0300 -0.0142 0.0644  170  ASN A O   
1211 C  CB  . ASN A  173 ? 1.1266 1.2285 1.2249 -0.0407 -0.0225 0.0825  170  ASN A CB  
1212 C  CG  . ASN A  173 ? 1.2791 1.3871 1.3797 -0.0463 -0.0256 0.0925  170  ASN A CG  
1213 O  OD1 . ASN A  173 ? 1.2475 1.3711 1.3483 -0.0475 -0.0252 0.0964  170  ASN A OD1 
1214 N  ND2 . ASN A  173 ? 1.1302 1.2259 1.2328 -0.0502 -0.0285 0.0969  170  ASN A ND2 
1215 N  N   . THR A  174 ? 1.1073 1.1974 1.2033 -0.0355 -0.0189 0.0693  171  THR A N   
1216 C  CA  . THR A  174 ? 1.0901 1.1704 1.1850 -0.0308 -0.0169 0.0621  171  THR A CA  
1217 C  C   . THR A  174 ? 1.1039 1.1695 1.1983 -0.0285 -0.0177 0.0590  171  THR A C   
1218 O  O   . THR A  174 ? 1.1063 1.1629 1.2022 -0.0313 -0.0210 0.0624  171  THR A O   
1219 C  CB  . THR A  174 ? 1.1700 1.2484 1.2657 -0.0329 -0.0180 0.0623  171  THR A CB  
1220 O  OG1 . THR A  174 ? 1.2100 1.3043 1.3060 -0.0349 -0.0172 0.0657  171  THR A OG1 
1221 C  CG2 . THR A  174 ? 1.1047 1.1758 1.1993 -0.0278 -0.0157 0.0556  171  THR A CG2 
1222 N  N   . LYS A  175 ? 1.0182 1.0815 1.1106 -0.0232 -0.0145 0.0524  172  LYS A N   
1223 C  CA  . LYS A  175 ? 0.9939 1.0456 1.0853 -0.0204 -0.0146 0.0484  172  LYS A CA  
1224 C  C   . LYS A  175 ? 0.9885 1.0302 1.0791 -0.0172 -0.0134 0.0426  172  LYS A C   
1225 O  O   . LYS A  175 ? 0.9793 1.0247 1.0699 -0.0163 -0.0117 0.0414  172  LYS A O   
1226 C  CB  . LYS A  175 ? 1.0168 1.0754 1.1060 -0.0180 -0.0116 0.0455  172  LYS A CB  
1227 C  CG  . LYS A  175 ? 1.1254 1.1977 1.2153 -0.0212 -0.0123 0.0513  172  LYS A CG  
1228 C  CD  . LYS A  175 ? 1.2008 1.2753 1.2899 -0.0206 -0.0123 0.0513  172  LYS A CD  
1229 C  CE  . LYS A  175 ? 1.2344 1.3044 1.3261 -0.0229 -0.0167 0.0586  172  LYS A CE  
1230 N  NZ  . LYS A  175 ? 1.3877 1.4414 1.4796 -0.0205 -0.0181 0.0559  172  LYS A NZ  
1231 N  N   . CYS A  176 ? 0.9010 0.9314 0.9912 -0.0154 -0.0143 0.0394  173  CYS A N   
1232 C  CA  . CYS A  176 ? 0.8804 0.9015 0.9698 -0.0126 -0.0135 0.0340  173  CYS A CA  
1233 C  C   . CYS A  176 ? 0.9707 0.9847 1.0585 -0.0098 -0.0131 0.0299  173  CYS A C   
1234 O  O   . CYS A  176 ? 0.9867 1.0009 1.0749 -0.0107 -0.0147 0.0325  173  CYS A O   
1235 C  CB  . CYS A  176 ? 0.8698 0.8838 0.9614 -0.0156 -0.0168 0.0355  173  CYS A CB  
1236 S  SG  . CYS A  176 ? 0.9116 0.9213 1.0028 -0.0131 -0.0155 0.0302  173  CYS A SG  
1237 N  N   . PHE A  177 ? 0.9417 0.9504 1.0278 -0.0063 -0.0108 0.0240  174  PHE A N   
1238 C  CA  . PHE A  177 ? 0.9503 0.9526 1.0346 -0.0038 -0.0102 0.0194  174  PHE A CA  
1239 C  C   . PHE A  177 ? 1.0904 1.0993 1.1724 -0.0033 -0.0079 0.0183  174  PHE A C   
1240 O  O   . PHE A  177 ? 1.0897 1.0961 1.1708 -0.0026 -0.0087 0.0168  174  PHE A O   
1241 C  CB  . PHE A  177 ? 0.9547 0.9475 1.0407 -0.0044 -0.0142 0.0201  174  PHE A CB  
1242 C  CG  . PHE A  177 ? 0.9547 0.9426 1.0432 -0.0068 -0.0168 0.0221  174  PHE A CG  
1243 C  CD1 . PHE A  177 ? 0.9733 0.9590 1.0618 -0.0060 -0.0161 0.0187  174  PHE A CD1 
1244 C  CD2 . PHE A  177 ? 0.9690 0.9553 1.0599 -0.0104 -0.0199 0.0274  174  PHE A CD2 
1245 C  CE1 . PHE A  177 ? 0.9778 0.9610 1.0684 -0.0091 -0.0184 0.0200  174  PHE A CE1 
1246 C  CE2 . PHE A  177 ? 0.9980 0.9799 1.0910 -0.0137 -0.0220 0.0285  174  PHE A CE2 
1247 C  CZ  . PHE A  177 ? 0.9691 0.9501 1.0618 -0.0133 -0.0212 0.0244  174  PHE A CZ  
1248 N  N   . GLU A  178 ? 1.1160 1.1346 1.1971 -0.0037 -0.0047 0.0185  175  GLU A N   
1249 C  CA  . GLU A  178 ? 1.1462 1.1731 1.2251 -0.0041 -0.0021 0.0167  175  GLU A CA  
1250 C  C   . GLU A  178 ? 1.2863 1.3098 1.3618 -0.0019 0.0022  0.0091  175  GLU A C   
1251 O  O   . GLU A  178 ? 1.2788 1.2983 1.3535 0.0002  0.0055  0.0058  175  GLU A O   
1252 C  CB  . GLU A  178 ? 1.1591 1.1985 1.2384 -0.0058 -0.0003 0.0193  175  GLU A CB  
1253 C  CG  . GLU A  178 ? 1.2975 1.3439 1.3792 -0.0092 -0.0043 0.0271  175  GLU A CG  
1254 C  CD  . GLU A  178 ? 1.5418 1.5904 1.6236 -0.0103 -0.0066 0.0298  175  GLU A CD  
1255 O  OE1 . GLU A  178 ? 1.2349 1.2895 1.3142 -0.0100 -0.0041 0.0260  175  GLU A OE1 
1256 O  OE2 . GLU A  178 ? 1.5376 1.5824 1.6221 -0.0116 -0.0108 0.0358  175  GLU A OE2 
1257 N  N   . PRO A  179 ? 1.3203 1.3457 1.3936 -0.0026 0.0025  0.0066  176  PRO A N   
1258 C  CA  . PRO A  179 ? 1.3500 1.3726 1.4196 -0.0016 0.0069  -0.0009 176  PRO A CA  
1259 C  C   . PRO A  179 ? 1.4853 1.5171 1.5525 -0.0031 0.0121  -0.0045 176  PRO A C   
1260 O  O   . PRO A  179 ? 1.4838 1.5269 1.5519 -0.0052 0.0113  -0.0009 176  PRO A O   
1261 C  CB  . PRO A  179 ? 1.3673 1.3901 1.4358 -0.0022 0.0045  -0.0015 176  PRO A CB  
1262 C  CG  . PRO A  179 ? 1.4102 1.4408 1.4813 -0.0037 0.0005  0.0057  176  PRO A CG  
1263 C  CD  . PRO A  179 ? 1.3483 1.3797 1.4225 -0.0043 -0.0008 0.0109  176  PRO A CD  
1264 N  N   . PRO A  180 ? 1.4975 1.5253 1.5616 -0.0024 0.0176  -0.0118 177  PRO A N   
1265 C  CA  . PRO A  180 ? 1.5123 1.5488 1.5738 -0.0045 0.0230  -0.0164 177  PRO A CA  
1266 C  C   . PRO A  180 ? 1.6022 1.6497 1.6617 -0.0083 0.0218  -0.0172 177  PRO A C   
1267 O  O   . PRO A  180 ? 1.6034 1.6483 1.6601 -0.0094 0.0228  -0.0218 177  PRO A O   
1268 C  CB  . PRO A  180 ? 1.5352 1.5613 1.5941 -0.0028 0.0290  -0.0236 177  PRO A CB  
1269 C  CG  . PRO A  180 ? 1.5850 1.5986 1.6456 0.0006  0.0263  -0.0214 177  PRO A CG  
1270 C  CD  . PRO A  180 ? 1.5216 1.5372 1.5842 -0.0003 0.0194  -0.0163 177  PRO A CD  
1271 N  N   . GLN A  181 ? 1.5769 1.6374 1.6382 -0.0103 0.0191  -0.0116 178  GLN A N   
1272 C  CA  . GLN A  181 ? 1.5817 1.6552 1.6422 -0.0134 0.0170  -0.0098 178  GLN A CA  
1273 C  C   . GLN A  181 ? 1.6529 1.7369 1.7090 -0.0172 0.0222  -0.0175 178  GLN A C   
1274 O  O   . GLN A  181 ? 1.6491 1.7349 1.7028 -0.0187 0.0222  -0.0204 178  GLN A O   
1275 C  CB  . GLN A  181 ? 1.5948 1.6795 1.6589 -0.0144 0.0129  -0.0008 178  GLN A CB  
1276 N  N   . ASP A  182 ? 1.6197 1.7119 1.6749 -0.0191 0.0267  -0.0208 179  ASP A N   
1277 C  CA  . ASP A  182 ? 1.6197 1.7226 1.6707 -0.0235 0.0324  -0.0291 179  ASP A CA  
1278 C  C   . ASP A  182 ? 1.6861 1.7877 1.7363 -0.0232 0.0386  -0.0347 179  ASP A C   
1279 O  O   . ASP A  182 ? 1.6878 1.7928 1.7412 -0.0213 0.0374  -0.0297 179  ASP A O   
1280 C  CB  . ASP A  182 ? 1.6334 1.7583 1.6846 -0.0275 0.0300  -0.0253 179  ASP A CB  
1281 N  N   . ASN A  183 ? 1.6453 1.7416 1.6915 -0.0249 0.0456  -0.0450 180  ASN A N   
1282 C  CA  . ASN A  183 ? 1.6437 1.7362 1.6887 -0.0243 0.0531  -0.0521 180  ASN A CA  
1283 C  C   . ASN A  183 ? 1.6833 1.7598 1.7313 -0.0177 0.0536  -0.0490 180  ASN A C   
1284 O  O   . ASN A  183 ? 1.6805 1.7523 1.7282 -0.0157 0.0600  -0.0539 180  ASN A O   
1285 C  CB  . ASN A  183 ? 1.6575 1.7697 1.7026 -0.0276 0.0550  -0.0531 180  ASN A CB  
1286 N  N   . GLN A  184 ? 1.6276 1.6963 1.6787 -0.0142 0.0473  -0.0411 181  GLN A N   
1287 C  CA  . GLN A  184 ? 1.6212 1.6769 1.6753 -0.0085 0.0471  -0.0375 181  GLN A CA  
1288 C  C   . GLN A  184 ? 1.6578 1.6965 1.7096 -0.0068 0.0504  -0.0427 181  GLN A C   
1289 O  O   . GLN A  184 ? 1.6597 1.6896 1.7127 -0.0048 0.0462  -0.0391 181  GLN A O   
1290 C  CB  . GLN A  184 ? 1.6363 1.6932 1.6944 -0.0068 0.0390  -0.0273 181  GLN A CB  
1291 N  N   . THR A  185 ? 1.5884 1.6230 1.6369 -0.0081 0.0583  -0.0517 182  THR A N   
1292 C  CA  . THR A  185 ? 1.5737 1.5929 1.6194 -0.0077 0.0630  -0.0577 182  THR A CA  
1293 C  C   . THR A  185 ? 1.5632 1.5697 1.6101 -0.0023 0.0695  -0.0592 182  THR A C   
1294 O  O   . THR A  185 ? 1.5652 1.5759 1.6125 -0.0014 0.0745  -0.0620 182  THR A O   
1295 C  CB  . THR A  185 ? 1.7102 1.7337 1.7506 -0.0146 0.0673  -0.0670 182  THR A CB  
1296 O  OG1 . THR A  185 ? 1.7151 1.7234 1.7527 -0.0144 0.0750  -0.0745 182  THR A OG1 
1297 C  CG2 . THR A  185 ? 1.6921 1.7326 1.7312 -0.0189 0.0698  -0.0707 182  THR A CG2 
1298 N  N   . LYS A  186 ? 1.4642 1.4563 1.5121 0.0016  0.0694  -0.0571 183  LYS A N   
1299 C  CA  . LYS A  186 ? 1.4379 1.4173 1.4874 0.0076  0.0755  -0.0572 183  LYS A CA  
1300 C  C   . LYS A  186 ? 1.4338 1.3977 1.4809 0.0074  0.0788  -0.0609 183  LYS A C   
1301 O  O   . LYS A  186 ? 1.4228 1.3855 1.4690 0.0052  0.0735  -0.0593 183  LYS A O   
1302 C  CB  . LYS A  186 ? 1.4636 1.4442 1.5183 0.0139  0.0711  -0.0476 183  LYS A CB  
1303 C  CG  . LYS A  186 ? 1.5600 1.5563 1.6174 0.0136  0.0659  -0.0420 183  LYS A CG  
1304 C  CD  . LYS A  186 ? 1.6401 1.6445 1.6977 0.0143  0.0713  -0.0449 183  LYS A CD  
1305 C  CE  . LYS A  186 ? 1.7236 1.7228 1.7841 0.0217  0.0764  -0.0426 183  LYS A CE  
1306 N  NZ  . LYS A  186 ? 1.8088 1.8025 1.8671 0.0226  0.0864  -0.0510 183  LYS A NZ  
1307 N  N   . ASN A  187 ? 1.3587 1.3104 1.4047 0.0096  0.0877  -0.0657 184  ASN A N   
1308 C  CA  . ASN A  187 ? 1.3446 1.2807 1.3883 0.0091  0.0917  -0.0691 184  ASN A CA  
1309 C  C   . ASN A  187 ? 1.3332 1.2609 1.3805 0.0154  0.0890  -0.0610 184  ASN A C   
1310 O  O   . ASN A  187 ? 1.3475 1.2675 1.3932 0.0137  0.0880  -0.0616 184  ASN A O   
1311 C  CB  . ASN A  187 ? 1.3814 1.3061 1.4224 0.0084  0.1029  -0.0776 184  ASN A CB  
1312 C  CG  . ASN A  187 ? 1.7571 1.6636 1.7963 0.0086  0.1081  -0.0799 184  ASN A CG  
1313 O  OD1 . ASN A  187 ? 1.6953 1.5901 1.7375 0.0156  0.1122  -0.0758 184  ASN A OD1 
1314 N  ND2 . ASN A  187 ? 1.6691 1.5739 1.7036 0.0012  0.1078  -0.0857 184  ASN A ND2 
1315 N  N   A HIS A  188 ? 1.2530 1.1838 1.3052 0.0222  0.0878  -0.0537 185  HIS A N   
1316 N  N   B HIS A  188 ? 1.2423 1.1732 1.2945 0.0221  0.0877  -0.0537 185  HIS A N   
1317 C  CA  A HIS A  188 ? 1.2367 1.1624 1.2925 0.0279  0.0852  -0.0459 185  HIS A CA  
1318 C  CA  B HIS A  188 ? 1.2192 1.1445 1.2748 0.0277  0.0854  -0.0461 185  HIS A CA  
1319 C  C   A HIS A  188 ? 1.2202 1.1546 1.2774 0.0262  0.0750  -0.0405 185  HIS A C   
1320 C  C   B HIS A  188 ? 1.2056 1.1402 1.2629 0.0263  0.0750  -0.0403 185  HIS A C   
1321 O  O   A HIS A  188 ? 1.2246 1.1553 1.2838 0.0290  0.0723  -0.0356 185  HIS A O   
1322 O  O   B HIS A  188 ? 1.2034 1.1347 1.2630 0.0294  0.0723  -0.0352 185  HIS A O   
1323 C  CB  A HIS A  188 ? 1.2527 1.1785 1.3129 0.0361  0.0890  -0.0403 185  HIS A CB  
1324 C  CB  B HIS A  188 ? 1.2295 1.1530 1.2893 0.0360  0.0901  -0.0411 185  HIS A CB  
1325 C  CG  A HIS A  188 ? 1.3066 1.2185 1.3663 0.0399  0.0996  -0.0438 185  HIS A CG  
1326 C  CG  B HIS A  188 ? 1.2773 1.1898 1.3356 0.0380  0.1009  -0.0470 185  HIS A CG  
1327 N  ND1 A HIS A  188 ? 1.3307 1.2430 1.3901 0.0414  0.1065  -0.0483 185  HIS A ND1 
1328 N  ND1 B HIS A  188 ? 1.3056 1.2039 1.3600 0.0344  0.1067  -0.0539 185  HIS A ND1 
1329 C  CD2 A HIS A  188 ? 1.3380 1.2351 1.3976 0.0426  0.1045  -0.0433 185  HIS A CD2 
1330 C  CD2 B HIS A  188 ? 1.2984 1.2121 1.3586 0.0428  0.1069  -0.0474 185  HIS A CD2 
1331 C  CE1 A HIS A  188 ? 1.3310 1.2275 1.3901 0.0451  0.1156  -0.0507 185  HIS A CE1 
1332 C  CE1 B HIS A  188 ? 1.3009 1.1911 1.3550 0.0371  0.1163  -0.0584 185  HIS A CE1 
1333 N  NE2 A HIS A  188 ? 1.3393 1.2261 1.3986 0.0459  0.1148  -0.0474 185  HIS A NE2 
1334 N  NE2 B HIS A  188 ? 1.3010 1.2001 1.3586 0.0426  0.1168  -0.0547 185  HIS A NE2 
1335 N  N   . VAL A  189 ? 1.1060 1.0517 1.1621 0.0214  0.0696  -0.0415 186  VAL A N   
1336 C  CA  . VAL A  189 ? 1.0439 0.9965 1.1013 0.0194  0.0604  -0.0371 186  VAL A CA  
1337 C  C   . VAL A  189 ? 1.0015 0.9480 1.0553 0.0154  0.0595  -0.0416 186  VAL A C   
1338 O  O   . VAL A  189 ? 0.9913 0.9368 1.0461 0.0157  0.0543  -0.0386 186  VAL A O   
1339 C  CB  . VAL A  189 ? 1.0692 1.0354 1.1271 0.0163  0.0555  -0.0357 186  VAL A CB  
1340 C  CG1 . VAL A  189 ? 1.0545 1.0252 1.1130 0.0137  0.0470  -0.0325 186  VAL A CG1 
1341 C  CG2 . VAL A  189 ? 1.0625 1.0355 1.1242 0.0203  0.0556  -0.0304 186  VAL A CG2 
1342 N  N   . LEU A  190 ? 0.8889 0.8313 0.9384 0.0115  0.0653  -0.0492 187  LEU A N   
1343 C  CA  . LEU A  190 ? 0.8530 0.7905 0.8985 0.0070  0.0660  -0.0544 187  LEU A CA  
1344 C  C   . LEU A  190 ? 0.8591 0.7834 0.9050 0.0100  0.0690  -0.0533 187  LEU A C   
1345 O  O   . LEU A  190 ? 0.8566 0.7785 0.9008 0.0077  0.0663  -0.0541 187  LEU A O   
1346 C  CB  . LEU A  190 ? 0.8465 0.7850 0.8873 0.0013  0.0720  -0.0632 187  LEU A CB  
1347 C  CG  . LEU A  190 ? 0.9051 0.8462 0.9411 -0.0056 0.0710  -0.0689 187  LEU A CG  
1348 C  CD1 . LEU A  190 ? 0.9047 0.8580 0.9417 -0.0069 0.0618  -0.0648 187  LEU A CD1 
1349 C  CD2 . LEU A  190 ? 0.9261 0.8709 0.9578 -0.0116 0.0772  -0.0776 187  LEU A CD2 
1350 N  N   . VAL A  191 ? 0.7754 0.6921 0.8237 0.0154  0.0745  -0.0509 188  VAL A N   
1351 C  CA  . VAL A  191 ? 0.7603 0.6653 0.8097 0.0191  0.0778  -0.0483 188  VAL A CA  
1352 C  C   . VAL A  191 ? 0.7960 0.7061 0.8493 0.0227  0.0705  -0.0404 188  VAL A C   
1353 O  O   . VAL A  191 ? 0.7975 0.7029 0.8506 0.0227  0.0693  -0.0392 188  VAL A O   
1354 C  CB  . VAL A  191 ? 0.7990 0.6940 0.8498 0.0243  0.0871  -0.0481 188  VAL A CB  
1355 C  CG1 . VAL A  191 ? 0.7955 0.6796 0.8482 0.0289  0.0902  -0.0435 188  VAL A CG1 
1356 C  CG2 . VAL A  191 ? 0.7954 0.6841 0.8417 0.0196  0.0949  -0.0576 188  VAL A CG2 
1357 N  N   . LEU A  192 ? 0.7342 0.6547 0.7909 0.0250  0.0654  -0.0355 189  LEU A N   
1358 C  CA  . LEU A  192 ? 0.7080 0.6346 0.7684 0.0273  0.0583  -0.0289 189  LEU A CA  
1359 C  C   . LEU A  192 ? 0.7226 0.6527 0.7812 0.0226  0.0514  -0.0308 189  LEU A C   
1360 O  O   . LEU A  192 ? 0.7132 0.6438 0.7734 0.0236  0.0474  -0.0279 189  LEU A O   
1361 C  CB  . LEU A  192 ? 0.6999 0.6365 0.7640 0.0300  0.0553  -0.0237 189  LEU A CB  
1362 C  CG  . LEU A  192 ? 0.7513 0.6872 0.8185 0.0363  0.0606  -0.0193 189  LEU A CG  
1363 C  CD1 . LEU A  192 ? 0.7397 0.6869 0.8095 0.0373  0.0577  -0.0157 189  LEU A CD1 
1364 C  CD2 . LEU A  192 ? 0.8038 0.7378 0.8741 0.0409  0.0603  -0.0134 189  LEU A CD2 
1365 N  N   . HIS A  193 ? 0.6613 0.5949 0.7167 0.0177  0.0503  -0.0358 190  HIS A N   
1366 C  CA  . HIS A  193 ? 0.6486 0.5861 0.7021 0.0136  0.0448  -0.0379 190  HIS A CA  
1367 C  C   . HIS A  193 ? 0.7185 0.6487 0.7695 0.0124  0.0464  -0.0408 190  HIS A C   
1368 O  O   . HIS A  193 ? 0.7571 0.6895 0.8088 0.0121  0.0411  -0.0395 190  HIS A O   
1369 C  CB  . HIS A  193 ? 0.6478 0.5913 0.6981 0.0088  0.0450  -0.0426 190  HIS A CB  
1370 C  CG  . HIS A  193 ? 0.6870 0.6330 0.7341 0.0047  0.0419  -0.0461 190  HIS A CG  
1371 N  ND1 . HIS A  193 ? 0.7077 0.6588 0.7566 0.0050  0.0347  -0.0431 190  HIS A ND1 
1372 C  CD2 . HIS A  193 ? 0.7170 0.6611 0.7594 0.0003  0.0454  -0.0524 190  HIS A CD2 
1373 C  CE1 . HIS A  193 ? 0.7004 0.6533 0.7459 0.0016  0.0339  -0.0472 190  HIS A CE1 
1374 N  NE2 . HIS A  193 ? 0.7080 0.6576 0.7494 -0.0017 0.0401  -0.0528 190  HIS A NE2 
1375 N  N   . TYR A  194 ? 0.6511 0.5728 0.6993 0.0114  0.0538  -0.0448 191  TYR A N   
1376 C  CA  . TYR A  194 ? 0.6541 0.5687 0.6995 0.0093  0.0560  -0.0476 191  TYR A CA  
1377 C  C   . TYR A  194 ? 0.7275 0.6380 0.7762 0.0138  0.0552  -0.0420 191  TYR A C   
1378 O  O   . TYR A  194 ? 0.7456 0.6564 0.7933 0.0122  0.0523  -0.0425 191  TYR A O   
1379 C  CB  . TYR A  194 ? 0.6724 0.5783 0.7136 0.0059  0.0646  -0.0540 191  TYR A CB  
1380 C  CG  . TYR A  194 ? 0.6938 0.6060 0.7302 -0.0010 0.0641  -0.0609 191  TYR A CG  
1381 C  CD1 . TYR A  194 ? 0.7130 0.6302 0.7468 -0.0050 0.0597  -0.0630 191  TYR A CD1 
1382 C  CD2 . TYR A  194 ? 0.7023 0.6180 0.7372 -0.0034 0.0675  -0.0649 191  TYR A CD2 
1383 C  CE1 . TYR A  194 ? 0.7098 0.6357 0.7397 -0.0109 0.0588  -0.0684 191  TYR A CE1 
1384 C  CE2 . TYR A  194 ? 0.7087 0.6334 0.7396 -0.0098 0.0667  -0.0706 191  TYR A CE2 
1385 C  CZ  . TYR A  194 ? 0.7646 0.6945 0.7929 -0.0134 0.0624  -0.0721 191  TYR A CZ  
1386 O  OH  . TYR A  194 ? 0.7288 0.6692 0.7532 -0.0196 0.0618  -0.0772 191  TYR A OH  
1387 N  N   . VAL A  195 ? 0.6761 0.5847 0.7287 0.0194  0.0576  -0.0366 192  VAL A N   
1388 C  CA  . VAL A  195 ? 0.6741 0.5817 0.7303 0.0239  0.0568  -0.0304 192  VAL A CA  
1389 C  C   . VAL A  195 ? 0.7183 0.6357 0.7765 0.0235  0.0479  -0.0279 192  VAL A C   
1390 O  O   . VAL A  195 ? 0.6909 0.6086 0.7494 0.0234  0.0458  -0.0268 192  VAL A O   
1391 C  CB  . VAL A  195 ? 0.7222 0.6282 0.7825 0.0305  0.0612  -0.0244 192  VAL A CB  
1392 C  CG1 . VAL A  195 ? 0.7147 0.6208 0.7783 0.0348  0.0611  -0.0177 192  VAL A CG1 
1393 C  CG2 . VAL A  195 ? 0.7259 0.6214 0.7842 0.0311  0.0704  -0.0277 192  VAL A CG2 
1394 N  N   . SER A  196 ? 0.6645 0.5897 0.7240 0.0229  0.0431  -0.0274 193  SER A N   
1395 C  CA  . SER A  196 ? 0.6440 0.5774 0.7056 0.0222  0.0352  -0.0257 193  SER A CA  
1396 C  C   . SER A  196 ? 0.6944 0.6280 0.7529 0.0183  0.0317  -0.0303 193  SER A C   
1397 O  O   . SER A  196 ? 0.6761 0.6130 0.7361 0.0186  0.0272  -0.0292 193  SER A O   
1398 C  CB  . SER A  196 ? 0.6393 0.5787 0.7023 0.0217  0.0323  -0.0245 193  SER A CB  
1399 O  OG  . SER A  196 ? 0.7086 0.6535 0.7727 0.0200  0.0253  -0.0242 193  SER A OG  
1400 N  N   . LEU A  197 ? 0.6353 0.5669 0.6897 0.0146  0.0340  -0.0355 194  LEU A N   
1401 C  CA  . LEU A  197 ? 0.6212 0.5546 0.6723 0.0109  0.0315  -0.0400 194  LEU A CA  
1402 C  C   . LEU A  197 ? 0.6736 0.6032 0.7237 0.0108  0.0326  -0.0405 194  LEU A C   
1403 O  O   . LEU A  197 ? 0.6904 0.6242 0.7404 0.0099  0.0280  -0.0415 194  LEU A O   
1404 C  CB  . LEU A  197 ? 0.6189 0.5519 0.6655 0.0066  0.0353  -0.0454 194  LEU A CB  
1405 C  CG  . LEU A  197 ? 0.6563 0.5935 0.6990 0.0024  0.0333  -0.0501 194  LEU A CG  
1406 C  CD1 . LEU A  197 ? 0.6512 0.5966 0.6957 0.0031  0.0261  -0.0485 194  LEU A CD1 
1407 C  CD2 . LEU A  197 ? 0.6424 0.5799 0.6805 -0.0024 0.0382  -0.0556 194  LEU A CD2 
1408 N  N   . PHE A  198 ? 0.6107 0.5327 0.6604 0.0119  0.0389  -0.0396 195  PHE A N   
1409 C  CA  . PHE A  198 ? 0.6182 0.5362 0.6669 0.0115  0.0407  -0.0394 195  PHE A CA  
1410 C  C   . PHE A  198 ? 0.6360 0.5583 0.6892 0.0155  0.0371  -0.0338 195  PHE A C   
1411 O  O   . PHE A  198 ? 0.6190 0.5454 0.6719 0.0143  0.0333  -0.0345 195  PHE A O   
1412 C  CB  . PHE A  198 ? 0.6596 0.5666 0.7061 0.0109  0.0494  -0.0406 195  PHE A CB  
1413 C  CG  . PHE A  198 ? 0.7136 0.6178 0.7543 0.0046  0.0525  -0.0480 195  PHE A CG  
1414 C  CD1 . PHE A  198 ? 0.7825 0.6870 0.8198 0.0004  0.0519  -0.0510 195  PHE A CD1 
1415 C  CD2 . PHE A  198 ? 0.7638 0.6676 0.8024 0.0023  0.0553  -0.0520 195  PHE A CD2 
1416 C  CE1 . PHE A  198 ? 0.8078 0.7120 0.8396 -0.0061 0.0545  -0.0580 195  PHE A CE1 
1417 C  CE2 . PHE A  198 ? 0.8098 0.7137 0.8429 -0.0043 0.0579  -0.0592 195  PHE A CE2 
1418 C  CZ  . PHE A  198 ? 0.7920 0.6961 0.8216 -0.0086 0.0575  -0.0621 195  PHE A CZ  
1419 N  N   . VAL A  199 ? 0.5833 0.5061 0.6405 0.0199  0.0381  -0.0283 196  VAL A N   
1420 C  CA  . VAL A  199 ? 0.5656 0.4944 0.6272 0.0235  0.0354  -0.0226 196  VAL A CA  
1421 C  C   . VAL A  199 ? 0.6212 0.5594 0.6847 0.0226  0.0275  -0.0232 196  VAL A C   
1422 O  O   . VAL A  199 ? 0.6249 0.5687 0.6901 0.0230  0.0243  -0.0218 196  VAL A O   
1423 C  CB  . VAL A  199 ? 0.6099 0.5379 0.6751 0.0284  0.0394  -0.0166 196  VAL A CB  
1424 C  CG1 . VAL A  199 ? 0.6044 0.5420 0.6743 0.0317  0.0361  -0.0104 196  VAL A CG1 
1425 C  CG2 . VAL A  199 ? 0.6101 0.5274 0.6741 0.0302  0.0479  -0.0156 196  VAL A CG2 
1426 N  N   . GLY A  200 ? 0.5600 0.4997 0.6231 0.0212  0.0248  -0.0253 197  GLY A N   
1427 C  CA  . GLY A  200 ? 0.5619 0.5082 0.6269 0.0205  0.0181  -0.0257 197  GLY A CA  
1428 C  C   . GLY A  200 ? 0.6287 0.5763 0.6914 0.0177  0.0140  -0.0307 197  GLY A C   
1429 O  O   . GLY A  200 ? 0.6244 0.5765 0.6892 0.0176  0.0088  -0.0309 197  GLY A O   
1430 N  N   . PHE A  201 ? 0.5893 0.5335 0.6478 0.0153  0.0165  -0.0347 198  PHE A N   
1431 C  CA  . PHE A  201 ? 0.5922 0.5394 0.6484 0.0131  0.0130  -0.0390 198  PHE A CA  
1432 C  C   . PHE A  201 ? 0.6566 0.6029 0.7090 0.0107  0.0151  -0.0426 198  PHE A C   
1433 O  O   . PHE A  201 ? 0.6458 0.5967 0.6981 0.0104  0.0114  -0.0443 198  PHE A O   
1434 C  CB  . PHE A  201 ? 0.6144 0.5627 0.6692 0.0116  0.0121  -0.0406 198  PHE A CB  
1435 C  CG  . PHE A  201 ? 0.6219 0.5747 0.6748 0.0102  0.0085  -0.0442 198  PHE A CG  
1436 C  CD1 . PHE A  201 ? 0.6351 0.5912 0.6906 0.0118  0.0032  -0.0441 198  PHE A CD1 
1437 C  CD2 . PHE A  201 ? 0.6320 0.5863 0.6805 0.0071  0.0108  -0.0478 198  PHE A CD2 
1438 C  CE1 . PHE A  201 ? 0.6333 0.5937 0.6872 0.0115  0.0002  -0.0470 198  PHE A CE1 
1439 C  CE2 . PHE A  201 ? 0.6528 0.6131 0.6996 0.0063  0.0076  -0.0505 198  PHE A CE2 
1440 C  CZ  . PHE A  201 ? 0.6206 0.5837 0.6703 0.0089  0.0024  -0.0498 198  PHE A CZ  
1441 N  N   . ILE A  202 ? 0.6250 0.5658 0.6740 0.0086  0.0209  -0.0441 199  ILE A N   
1442 C  CA  . ILE A  202 ? 0.6243 0.5640 0.6691 0.0052  0.0234  -0.0477 199  ILE A CA  
1443 C  C   . ILE A  202 ? 0.6768 0.6163 0.7230 0.0064  0.0235  -0.0453 199  ILE A C   
1444 O  O   . ILE A  202 ? 0.6994 0.6437 0.7440 0.0046  0.0211  -0.0477 199  ILE A O   
1445 C  CB  . ILE A  202 ? 0.6690 0.6024 0.7095 0.0015  0.0300  -0.0509 199  ILE A CB  
1446 C  CG1 . ILE A  202 ? 0.6699 0.6072 0.7088 -0.0003 0.0291  -0.0536 199  ILE A CG1 
1447 C  CG2 . ILE A  202 ? 0.6979 0.6305 0.7338 -0.0030 0.0324  -0.0548 199  ILE A CG2 
1448 C  CD1 . ILE A  202 ? 0.7506 0.6831 0.7860 -0.0038 0.0356  -0.0570 199  ILE A CD1 
1449 N  N   . ILE A  203 ? 0.6068 0.5425 0.6561 0.0095  0.0263  -0.0402 200  ILE A N   
1450 C  CA  . ILE A  203 ? 0.5993 0.5368 0.6503 0.0107  0.0264  -0.0370 200  ILE A CA  
1451 C  C   . ILE A  203 ? 0.6567 0.6044 0.7102 0.0118  0.0193  -0.0372 200  ILE A C   
1452 O  O   . ILE A  203 ? 0.6438 0.5958 0.6959 0.0100  0.0178  -0.0392 200  ILE A O   
1453 C  CB  . ILE A  203 ? 0.6333 0.5659 0.6873 0.0143  0.0313  -0.0306 200  ILE A CB  
1454 C  CG1 . ILE A  203 ? 0.6248 0.5453 0.6756 0.0127  0.0393  -0.0315 200  ILE A CG1 
1455 C  CG2 . ILE A  203 ? 0.6534 0.5919 0.7100 0.0159  0.0300  -0.0263 200  ILE A CG2 
1456 C  CD1 . ILE A  203 ? 0.6230 0.5368 0.6769 0.0174  0.0452  -0.0252 200  ILE A CD1 
1457 N  N   . PRO A  204 ? 0.6357 0.5876 0.6928 0.0140  0.0152  -0.0361 201  PRO A N   
1458 C  CA  . PRO A  204 ? 0.6203 0.5807 0.6795 0.0145  0.0090  -0.0375 201  PRO A CA  
1459 C  C   . PRO A  204 ? 0.6610 0.6244 0.7172 0.0123  0.0060  -0.0432 201  PRO A C   
1460 O  O   . PRO A  204 ? 0.6628 0.6326 0.7194 0.0121  0.0033  -0.0447 201  PRO A O   
1461 C  CB  . PRO A  204 ? 0.6419 0.6031 0.7044 0.0162  0.0063  -0.0359 201  PRO A CB  
1462 C  CG  . PRO A  204 ? 0.6963 0.6525 0.7596 0.0177  0.0110  -0.0316 201  PRO A CG  
1463 C  CD  . PRO A  204 ? 0.6479 0.5971 0.7070 0.0159  0.0160  -0.0335 201  PRO A CD  
1464 N  N   . PHE A  205 ? 0.6212 0.5815 0.6743 0.0106  0.0067  -0.0461 202  PHE A N   
1465 C  CA  . PHE A  205 ? 0.6264 0.5911 0.6766 0.0089  0.0043  -0.0508 202  PHE A CA  
1466 C  C   . PHE A  205 ? 0.6888 0.6558 0.7355 0.0061  0.0063  -0.0529 202  PHE A C   
1467 O  O   . PHE A  205 ? 0.6840 0.6582 0.7301 0.0059  0.0029  -0.0558 202  PHE A O   
1468 C  CB  . PHE A  205 ? 0.6593 0.6223 0.7069 0.0075  0.0052  -0.0527 202  PHE A CB  
1469 C  CG  . PHE A  205 ? 0.6939 0.6637 0.7400 0.0073  0.0015  -0.0563 202  PHE A CG  
1470 C  CD1 . PHE A  205 ? 0.7347 0.7100 0.7828 0.0094  -0.0031 -0.0576 202  PHE A CD1 
1471 C  CD2 . PHE A  205 ? 0.7244 0.6959 0.7675 0.0054  0.0026  -0.0580 202  PHE A CD2 
1472 C  CE1 . PHE A  205 ? 0.7453 0.7268 0.7926 0.0103  -0.0062 -0.0604 202  PHE A CE1 
1473 C  CE2 . PHE A  205 ? 0.7566 0.7358 0.7988 0.0060  -0.0007 -0.0603 202  PHE A CE2 
1474 C  CZ  . PHE A  205 ? 0.7341 0.7176 0.7785 0.0089  -0.0050 -0.0612 202  PHE A CZ  
1475 N  N   . VAL A  206 ? 0.6390 0.5999 0.6836 0.0040  0.0119  -0.0514 203  VAL A N   
1476 C  CA  . VAL A  206 ? 0.6425 0.6043 0.6837 0.0007  0.0143  -0.0527 203  VAL A CA  
1477 C  C   . VAL A  206 ? 0.7210 0.6896 0.7650 0.0023  0.0115  -0.0507 203  VAL A C   
1478 O  O   . VAL A  206 ? 0.7260 0.7017 0.7680 0.0004  0.0095  -0.0535 203  VAL A O   
1479 C  CB  . VAL A  206 ? 0.6916 0.6433 0.7300 -0.0021 0.0217  -0.0517 203  VAL A CB  
1480 C  CG1 . VAL A  206 ? 0.6900 0.6420 0.7256 -0.0055 0.0242  -0.0519 203  VAL A CG1 
1481 C  CG2 . VAL A  206 ? 0.6848 0.6330 0.7192 -0.0054 0.0243  -0.0558 203  VAL A CG2 
1482 N  N   . ILE A  207 ? 0.6867 0.6552 0.7354 0.0058  0.0110  -0.0459 204  ILE A N   
1483 C  CA  . ILE A  207 ? 0.6821 0.6591 0.7341 0.0074  0.0082  -0.0436 204  ILE A CA  
1484 C  C   . ILE A  207 ? 0.7493 0.7359 0.8019 0.0077  0.0020  -0.0486 204  ILE A C   
1485 O  O   . ILE A  207 ? 0.7627 0.7576 0.8149 0.0068  0.0002  -0.0499 204  ILE A O   
1486 C  CB  . ILE A  207 ? 0.7163 0.6932 0.7732 0.0109  0.0087  -0.0378 204  ILE A CB  
1487 C  CG1 . ILE A  207 ? 0.7185 0.6865 0.7752 0.0115  0.0154  -0.0324 204  ILE A CG1 
1488 C  CG2 . ILE A  207 ? 0.7151 0.7039 0.7757 0.0121  0.0050  -0.0363 204  ILE A CG2 
1489 C  CD1 . ILE A  207 ? 0.7842 0.7515 0.8453 0.0154  0.0166  -0.0266 204  ILE A CD1 
1490 N  N   . ILE A  208 ? 0.6883 0.6735 0.7416 0.0091  -0.0008 -0.0512 205  ILE A N   
1491 C  CA  . ILE A  208 ? 0.6627 0.6546 0.7167 0.0101  -0.0060 -0.0558 205  ILE A CA  
1492 C  C   . ILE A  208 ? 0.7079 0.7041 0.7574 0.0079  -0.0061 -0.0600 205  ILE A C   
1493 O  O   . ILE A  208 ? 0.7336 0.7385 0.7835 0.0083  -0.0092 -0.0628 205  ILE A O   
1494 C  CB  . ILE A  208 ? 0.6838 0.6717 0.7400 0.0124  -0.0083 -0.0564 205  ILE A CB  
1495 C  CG1 . ILE A  208 ? 0.6748 0.6644 0.7358 0.0141  -0.0103 -0.0543 205  ILE A CG1 
1496 C  CG2 . ILE A  208 ? 0.6534 0.6445 0.7088 0.0135  -0.0118 -0.0609 205  ILE A CG2 
1497 C  CD1 . ILE A  208 ? 0.7227 0.7058 0.7853 0.0148  -0.0088 -0.0507 205  ILE A CD1 
1498 N  N   . ILE A  209 ? 0.6430 0.6348 0.6883 0.0053  -0.0028 -0.0607 206  ILE A N   
1499 C  CA  . ILE A  209 ? 0.6456 0.6431 0.6862 0.0023  -0.0026 -0.0645 206  ILE A CA  
1500 C  C   . ILE A  209 ? 0.7082 0.7119 0.7479 0.0002  -0.0022 -0.0644 206  ILE A C   
1501 O  O   . ILE A  209 ? 0.7089 0.7226 0.7479 0.0003  -0.0054 -0.0677 206  ILE A O   
1502 C  CB  . ILE A  209 ? 0.6950 0.6871 0.7309 -0.0017 0.0019  -0.0654 206  ILE A CB  
1503 C  CG1 . ILE A  209 ? 0.7030 0.6902 0.7398 -0.0001 0.0020  -0.0648 206  ILE A CG1 
1504 C  CG2 . ILE A  209 ? 0.7062 0.7069 0.7371 -0.0054 0.0018  -0.0696 206  ILE A CG2 
1505 C  CD1 . ILE A  209 ? 0.8595 0.8532 0.8967 0.0023  -0.0021 -0.0671 206  ILE A CD1 
1506 N  N   . VAL A  210 ? 0.6760 0.6743 0.7160 -0.0013 0.0017  -0.0603 207  VAL A N   
1507 C  CA  . VAL A  210 ? 0.6763 0.6797 0.7157 -0.0034 0.0027  -0.0586 207  VAL A CA  
1508 C  C   . VAL A  210 ? 0.7410 0.7558 0.7843 -0.0006 -0.0022 -0.0590 207  VAL A C   
1509 O  O   . VAL A  210 ? 0.7272 0.7521 0.7689 -0.0022 -0.0042 -0.0617 207  VAL A O   
1510 C  CB  . VAL A  210 ? 0.7179 0.7118 0.7576 -0.0046 0.0085  -0.0528 207  VAL A CB  
1511 C  CG1 . VAL A  210 ? 0.7136 0.7136 0.7533 -0.0064 0.0093  -0.0499 207  VAL A CG1 
1512 C  CG2 . VAL A  210 ? 0.7122 0.6952 0.7473 -0.0083 0.0139  -0.0541 207  VAL A CG2 
1513 N  N   . CYS A  211 ? 0.7264 0.7406 0.7746 0.0031  -0.0041 -0.0568 208  CYS A N   
1514 C  CA  . CYS A  211 ? 0.7289 0.7540 0.7810 0.0052  -0.0085 -0.0580 208  CYS A CA  
1515 C  C   . CYS A  211 ? 0.7660 0.7987 0.8172 0.0061  -0.0129 -0.0647 208  CYS A C   
1516 O  O   . CYS A  211 ? 0.7762 0.8204 0.8280 0.0058  -0.0153 -0.0670 208  CYS A O   
1517 C  CB  . CYS A  211 ? 0.7376 0.7601 0.7944 0.0081  -0.0094 -0.0554 208  CYS A CB  
1518 S  SG  . CYS A  211 ? 0.7937 0.8138 0.8530 0.0083  -0.0052 -0.0467 208  CYS A SG  
1519 N  N   . TYR A  212 ? 0.6885 0.7158 0.7386 0.0074  -0.0137 -0.0675 209  TYR A N   
1520 C  CA  . TYR A  212 ? 0.6808 0.7147 0.7306 0.0093  -0.0174 -0.0731 209  TYR A CA  
1521 C  C   . TYR A  212 ? 0.7931 0.8356 0.8384 0.0068  -0.0171 -0.0757 209  TYR A C   
1522 O  O   . TYR A  212 ? 0.8145 0.8668 0.8602 0.0085  -0.0203 -0.0799 209  TYR A O   
1523 C  CB  . TYR A  212 ? 0.6666 0.6932 0.7169 0.0119  -0.0182 -0.0741 209  TYR A CB  
1524 C  CG  . TYR A  212 ? 0.6481 0.6687 0.7031 0.0146  -0.0197 -0.0728 209  TYR A CG  
1525 C  CD1 . TYR A  212 ? 0.6524 0.6764 0.7109 0.0146  -0.0206 -0.0719 209  TYR A CD1 
1526 C  CD2 . TYR A  212 ? 0.6529 0.6659 0.7090 0.0166  -0.0202 -0.0724 209  TYR A CD2 
1527 C  CE1 . TYR A  212 ? 0.6360 0.6556 0.6985 0.0161  -0.0218 -0.0711 209  TYR A CE1 
1528 C  CE2 . TYR A  212 ? 0.6606 0.6682 0.7208 0.0183  -0.0214 -0.0712 209  TYR A CE2 
1529 C  CZ  . TYR A  212 ? 0.7113 0.7221 0.7746 0.0178  -0.0222 -0.0708 209  TYR A CZ  
1530 O  OH  . TYR A  212 ? 0.7394 0.7459 0.8064 0.0185  -0.0233 -0.0700 209  TYR A OH  
1531 N  N   . THR A  213 ? 0.7565 0.7955 0.7977 0.0025  -0.0131 -0.0733 210  THR A N   
1532 C  CA  . THR A  213 ? 0.7507 0.7980 0.7873 -0.0013 -0.0124 -0.0755 210  THR A CA  
1533 C  C   . THR A  213 ? 0.8158 0.8740 0.8536 -0.0021 -0.0140 -0.0754 210  THR A C   
1534 O  O   . THR A  213 ? 0.8115 0.8820 0.8482 -0.0020 -0.0167 -0.0793 210  THR A O   
1535 C  CB  . THR A  213 ? 0.8091 0.8484 0.8410 -0.0065 -0.0072 -0.0735 210  THR A CB  
1536 O  OG1 . THR A  213 ? 0.7261 0.7586 0.7569 -0.0057 -0.0063 -0.0745 210  THR A OG1 
1537 C  CG2 . THR A  213 ? 0.8013 0.8496 0.8279 -0.0117 -0.0061 -0.0759 210  THR A CG2 
1538 N  N   . MET A  214 ? 0.7833 0.8383 0.8240 -0.0023 -0.0124 -0.0706 211  MET A N   
1539 C  CA  . MET A  214 ? 0.7814 0.8474 0.8240 -0.0031 -0.0136 -0.0691 211  MET A CA  
1540 C  C   . MET A  214 ? 0.8125 0.8905 0.8586 0.0004  -0.0187 -0.0740 211  MET A C   
1541 O  O   . MET A  214 ? 0.7940 0.8856 0.8395 -0.0008 -0.0206 -0.0761 211  MET A O   
1542 C  CB  . MET A  214 ? 0.8205 0.8809 0.8661 -0.0030 -0.0108 -0.0622 211  MET A CB  
1543 C  CG  . MET A  214 ? 0.8885 0.9411 0.9310 -0.0070 -0.0054 -0.0572 211  MET A CG  
1544 S  SD  . MET A  214 ? 0.9601 1.0066 1.0070 -0.0052 -0.0020 -0.0482 211  MET A SD  
1545 C  CE  . MET A  214 ? 0.9282 0.9584 0.9710 -0.0086 0.0049  -0.0448 211  MET A CE  
1546 N  N   . ILE A  215 ? 0.7586 0.8314 0.8081 0.0044  -0.0208 -0.0760 212  ILE A N   
1547 C  CA  . ILE A  215 ? 0.7351 0.8161 0.7880 0.0078  -0.0250 -0.0814 212  ILE A CA  
1548 C  C   . ILE A  215 ? 0.7948 0.8832 0.8452 0.0091  -0.0271 -0.0873 212  ILE A C   
1549 O  O   . ILE A  215 ? 0.7995 0.9011 0.8509 0.0097  -0.0296 -0.0913 212  ILE A O   
1550 C  CB  . ILE A  215 ? 0.7604 0.8320 0.8174 0.0110  -0.0260 -0.0818 212  ILE A CB  
1551 C  CG1 . ILE A  215 ? 0.7598 0.8287 0.8197 0.0099  -0.0243 -0.0761 212  ILE A CG1 
1552 C  CG2 . ILE A  215 ? 0.7331 0.8104 0.7930 0.0143  -0.0297 -0.0886 212  ILE A CG2 
1553 C  CD1 . ILE A  215 ? 0.8318 0.8891 0.8945 0.0119  -0.0243 -0.0750 212  ILE A CD1 
1554 N  N   . ILE A  216 ? 0.7524 0.8342 0.7998 0.0096  -0.0261 -0.0878 213  ILE A N   
1555 C  CA  . ILE A  216 ? 0.7639 0.8538 0.8090 0.0115  -0.0280 -0.0926 213  ILE A CA  
1556 C  C   . ILE A  216 ? 0.8437 0.9480 0.8853 0.0079  -0.0280 -0.0938 213  ILE A C   
1557 O  O   . ILE A  216 ? 0.8463 0.9629 0.8882 0.0102  -0.0307 -0.0986 213  ILE A O   
1558 C  CB  . ILE A  216 ? 0.8084 0.8899 0.8510 0.0123  -0.0266 -0.0917 213  ILE A CB  
1559 C  CG1 . ILE A  216 ? 0.8197 0.8906 0.8665 0.0171  -0.0278 -0.0918 213  ILE A CG1 
1560 C  CG2 . ILE A  216 ? 0.8064 0.8991 0.8455 0.0131  -0.0277 -0.0953 213  ILE A CG2 
1561 C  CD1 . ILE A  216 ? 0.9383 0.9984 0.9837 0.0169  -0.0257 -0.0886 213  ILE A CD1 
1562 N  N   . LEU A  217 ? 0.8136 0.9163 0.8522 0.0023  -0.0249 -0.0894 214  LEU A N   
1563 C  CA  . LEU A  217 ? 0.8013 0.9168 0.8364 -0.0022 -0.0245 -0.0895 214  LEU A CA  
1564 C  C   . LEU A  217 ? 0.8402 0.9686 0.8784 -0.0015 -0.0271 -0.0907 214  LEU A C   
1565 O  O   . LEU A  217 ? 0.8260 0.9697 0.8628 -0.0022 -0.0290 -0.0941 214  LEU A O   
1566 C  CB  . LEU A  217 ? 0.8011 0.9087 0.8323 -0.0085 -0.0198 -0.0842 214  LEU A CB  
1567 C  CG  . LEU A  217 ? 0.8604 0.9583 0.8873 -0.0109 -0.0168 -0.0842 214  LEU A CG  
1568 C  CD1 . LEU A  217 ? 0.8606 0.9475 0.8847 -0.0167 -0.0115 -0.0793 214  LEU A CD1 
1569 C  CD2 . LEU A  217 ? 0.8875 0.9976 0.9100 -0.0121 -0.0182 -0.0889 214  LEU A CD2 
1570 N  N   . THR A  218 ? 0.8046 0.9285 0.8474 -0.0001 -0.0271 -0.0881 215  THR A N   
1571 C  CA  . THR A  218 ? 0.8013 0.9382 0.8478 0.0004  -0.0295 -0.0891 215  THR A CA  
1572 C  C   . THR A  218 ? 0.8604 1.0061 0.9090 0.0050  -0.0333 -0.0972 215  THR A C   
1573 O  O   . THR A  218 ? 0.8623 1.0245 0.9114 0.0046  -0.0354 -0.1007 215  THR A O   
1574 C  CB  . THR A  218 ? 0.8573 0.9873 0.9081 0.0009  -0.0284 -0.0843 215  THR A CB  
1575 O  OG1 . THR A  218 ? 0.8789 1.0006 0.9278 -0.0026 -0.0243 -0.0766 215  THR A OG1 
1576 C  CG2 . THR A  218 ? 0.7934 0.9387 0.8481 0.0010  -0.0307 -0.0856 215  THR A CG2 
1577 N  N   . LEU A  219 ? 0.8131 0.9480 0.8633 0.0094  -0.0341 -0.1001 216  LEU A N   
1578 C  CA  . LEU A  219 ? 0.8034 0.9430 0.8561 0.0146  -0.0370 -0.1076 216  LEU A CA  
1579 C  C   . LEU A  219 ? 0.8657 1.0178 0.9152 0.0158  -0.0383 -0.1119 216  LEU A C   
1580 O  O   . LEU A  219 ? 0.8569 1.0189 0.9086 0.0194  -0.0407 -0.1182 216  LEU A O   
1581 C  CB  . LEU A  219 ? 0.8000 0.9236 0.8549 0.0188  -0.0369 -0.1083 216  LEU A CB  
1582 C  CG  . LEU A  219 ? 0.8429 0.9576 0.9021 0.0187  -0.0367 -0.1066 216  LEU A CG  
1583 C  CD1 . LEU A  219 ? 0.8471 0.9473 0.9082 0.0227  -0.0368 -0.1077 216  LEU A CD1 
1584 C  CD2 . LEU A  219 ? 0.8580 0.9844 0.9207 0.0187  -0.0386 -0.1113 216  LEU A CD2 
1585 N  N   . LEU A  220 ? 0.8386 0.9910 0.8831 0.0127  -0.0366 -0.1088 217  LEU A N   
1586 C  CA  . LEU A  220 ? 0.8347 1.0010 0.8755 0.0130  -0.0376 -0.1121 217  LEU A CA  
1587 C  C   . LEU A  220 ? 0.8912 1.0754 0.9312 0.0093  -0.0387 -0.1131 217  LEU A C   
1588 O  O   . LEU A  220 ? 0.8715 1.0708 0.9118 0.0121  -0.0410 -0.1186 217  LEU A O   
1589 C  CB  . LEU A  220 ? 0.8333 0.9951 0.8688 0.0094  -0.0351 -0.1086 217  LEU A CB  
1590 C  CG  . LEU A  220 ? 0.8875 1.0390 0.9230 0.0136  -0.0347 -0.1088 217  LEU A CG  
1591 C  CD1 . LEU A  220 ? 0.8875 1.0325 0.9180 0.0083  -0.0315 -0.1047 217  LEU A CD1 
1592 C  CD2 . LEU A  220 ? 0.9167 1.0797 0.9525 0.0196  -0.0371 -0.1139 217  LEU A CD2 
1593 N  N   . LYS A  221 ? 0.8552 1.0381 0.8944 0.0034  -0.0368 -0.1074 218  LYS A N   
1594 C  CA  . LYS A  221 ? 0.8498 1.0491 0.8885 -0.0008 -0.0374 -0.1064 218  LYS A CA  
1595 C  C   . LYS A  221 ? 0.9114 1.1234 0.9548 0.0029  -0.0406 -0.1120 218  LYS A C   
1596 O  O   . LYS A  221 ? 0.8994 1.1300 0.9421 0.0023  -0.0425 -0.1157 218  LYS A O   
1597 C  CB  . LYS A  221 ? 0.8782 1.0700 0.9168 -0.0061 -0.0344 -0.0982 218  LYS A CB  
1598 C  CG  . LYS A  221 ? 0.9843 1.1905 1.0204 -0.0120 -0.0338 -0.0948 218  LYS A CG  
1599 C  CD  . LYS A  221 ? 1.0984 1.3013 1.1371 -0.0150 -0.0316 -0.0870 218  LYS A CD  
1600 C  CE  . LYS A  221 ? 1.2778 1.4599 1.3150 -0.0171 -0.0271 -0.0802 218  LYS A CE  
1601 N  NZ  . LYS A  221 ? 1.4199 1.5955 1.4618 -0.0157 -0.0259 -0.0745 218  LYS A NZ  
1602 N  N   . LYS A  222 ? 0.8882 1.0906 0.9364 0.0063  -0.0410 -0.1133 219  LYS A N   
1603 C  CA  . LYS A  222 ? 0.8855 1.0974 0.9384 0.0093  -0.0435 -0.1194 219  LYS A CA  
1604 C  C   . LYS A  222 ? 0.9565 1.1727 1.0101 0.0153  -0.0455 -0.1282 219  LYS A C   
1605 O  O   . LYS A  222 ? 0.9682 1.1992 1.0240 0.0168  -0.0475 -0.1346 219  LYS A O   
1606 C  CB  . LYS A  222 ? 0.9142 1.1140 0.9714 0.0099  -0.0428 -0.1176 219  LYS A CB  
1607 C  CG  . LYS A  222 ? 1.0763 1.2778 1.1340 0.0048  -0.0411 -0.1094 219  LYS A CG  
1608 N  N   . SER A  223 ? 0.9044 1.1085 0.9563 0.0189  -0.0449 -0.1284 220  SER A N   
1609 C  CA  . SER A  223 ? 0.8913 1.0976 0.9440 0.0257  -0.0462 -0.1352 220  SER A CA  
1610 C  C   . SER A  223 ? 0.9237 1.1503 0.9733 0.0257  -0.0475 -0.1382 220  SER A C   
1611 O  O   . SER A  223 ? 0.9093 1.1455 0.9607 0.0310  -0.0491 -0.1453 220  SER A O   
1612 C  CB  . SER A  223 ? 0.9467 1.1362 0.9984 0.0290  -0.0449 -0.1324 220  SER A CB  
1613 O  OG  . SER A  223 ? 1.1236 1.3155 1.1764 0.0362  -0.0459 -0.1379 220  SER A OG  
1614 N  N   . MET A  224 ? 0.8788 1.1113 0.9233 0.0197  -0.0465 -0.1328 221  MET A N   
1615 C  CA  . MET A  224 ? 0.8703 1.1229 0.9111 0.0180  -0.0475 -0.1346 221  MET A CA  
1616 C  C   . MET A  224 ? 0.9170 1.1888 0.9594 0.0157  -0.0492 -0.1376 221  MET A C   
1617 O  O   . MET A  224 ? 0.9216 1.2112 0.9635 0.0182  -0.0510 -0.1432 221  MET A O   
1618 C  CB  . MET A  224 ? 0.9049 1.1559 0.9397 0.0111  -0.0453 -0.1280 221  MET A CB  
1619 C  CG  . MET A  224 ? 0.9626 1.2055 0.9946 0.0135  -0.0442 -0.1272 221  MET A CG  
1620 S  SD  . MET A  224 ? 1.0273 1.2683 1.0521 0.0038  -0.0410 -0.1206 221  MET A SD  
1621 C  CE  . MET A  224 ? 0.9960 1.2103 1.0226 0.0023  -0.0381 -0.1149 221  MET A CE  
1622 N  N   . LYS A  225 ? 0.8648 1.1344 0.9091 0.0111  -0.0487 -0.1337 222  LYS A N   
1623 C  CA  . LYS A  225 ? 0.8619 1.1502 0.9082 0.0084  -0.0503 -0.1356 222  LYS A CA  
1624 C  C   . LYS A  225 ? 0.9521 1.2479 1.0031 0.0144  -0.0524 -0.1454 222  LYS A C   
1625 O  O   . LYS A  225 ? 0.9563 1.2733 1.0079 0.0143  -0.0542 -0.1504 222  LYS A O   
1626 C  CB  . LYS A  225 ? 0.8899 1.1730 0.9378 0.0030  -0.0488 -0.1281 222  LYS A CB  
1627 C  CG  . LYS A  225 ? 1.0702 1.3545 1.1135 -0.0041 -0.0468 -0.1193 222  LYS A CG  
1628 C  CD  . LYS A  225 ? 1.2218 1.5027 1.2674 -0.0084 -0.0451 -0.1113 222  LYS A CD  
1629 C  CE  . LYS A  225 ? 1.3984 1.6551 1.4431 -0.0092 -0.0418 -0.1045 222  LYS A CE  
1630 N  NZ  . LYS A  225 ? 1.5112 1.7629 1.5601 -0.0102 -0.0406 -0.0986 222  LYS A NZ  
1631 N  N   . SER A  226 ? 0.9220 1.2003 0.9763 0.0197  -0.0519 -0.1485 1000 SER A N   
1632 C  CA  . SER A  226 ? 0.9162 1.1972 0.9751 0.0253  -0.0531 -0.1582 1000 SER A CA  
1633 C  C   . SER A  226 ? 0.9888 1.2764 1.0468 0.0322  -0.0539 -0.1648 1000 SER A C   
1634 O  O   . SER A  226 ? 0.9953 1.2886 1.0568 0.0371  -0.0547 -0.1738 1000 SER A O   
1635 C  CB  . SER A  226 ? 0.9582 1.2172 1.0207 0.0277  -0.0519 -0.1585 1000 SER A CB  
1636 O  OG  . SER A  226 ? 1.0836 1.3259 1.1456 0.0334  -0.0510 -0.1585 1000 SER A OG  
1637 N  N   . ALA A  227 ? 0.9598 1.2469 1.0135 0.0326  -0.0534 -0.1606 1001 ALA A N   
1638 C  CA  . ALA A  227 ? 0.9642 1.2602 1.0167 0.0391  -0.0541 -0.1654 1001 ALA A CA  
1639 C  C   . ALA A  227 ? 1.0136 1.3369 1.0641 0.0367  -0.0558 -0.1686 1001 ALA A C   
1640 O  O   . ALA A  227 ? 1.0002 1.3360 1.0519 0.0429  -0.0568 -0.1759 1001 ALA A O   
1641 C  CB  . ALA A  227 ? 0.9789 1.2663 1.0273 0.0396  -0.0529 -0.1594 1001 ALA A CB  
1642 N  N   . ASP A  228 ? 0.9741 1.3067 1.0217 0.0279  -0.0560 -0.1628 1002 ASP A N   
1643 C  CA  . ASP A  228 ? 0.9639 1.3229 1.0095 0.0239  -0.0576 -0.1643 1002 ASP A CA  
1644 C  C   . ASP A  228 ? 1.0250 1.3966 1.0755 0.0256  -0.0590 -0.1723 1002 ASP A C   
1645 O  O   . ASP A  228 ? 1.0145 1.4074 1.0651 0.0279  -0.0606 -0.1788 1002 ASP A O   
1646 C  CB  . ASP A  228 ? 0.9822 1.3435 1.0241 0.0139  -0.0568 -0.1548 1002 ASP A CB  
1647 C  CG  . ASP A  228 ? 1.1105 1.4589 1.1473 0.0108  -0.0547 -0.1477 1002 ASP A CG  
1648 O  OD1 . ASP A  228 ? 1.1101 1.4522 1.1458 0.0162  -0.0544 -0.1498 1002 ASP A OD1 
1649 O  OD2 . ASP A  228 ? 1.2061 1.5508 1.2402 0.0030  -0.0532 -0.1399 1002 ASP A OD2 
1650 N  N   . LEU A  229 ? 0.9930 1.3520 1.0475 0.0246  -0.0584 -0.1721 1003 LEU A N   
1651 C  CA  . LEU A  229 ? 0.9839 1.3524 1.0432 0.0253  -0.0593 -0.1799 1003 LEU A CA  
1652 C  C   . LEU A  229 ? 1.0435 1.4105 1.1059 0.0345  -0.0594 -0.1912 1003 LEU A C   
1653 O  O   . LEU A  229 ? 1.0432 1.4268 1.1082 0.0360  -0.0603 -0.2002 1003 LEU A O   
1654 C  CB  . LEU A  229 ? 0.9875 1.3403 1.0498 0.0221  -0.0582 -0.1762 1003 LEU A CB  
1655 C  CG  . LEU A  229 ? 1.0476 1.4112 1.1146 0.0206  -0.0589 -0.1829 1003 LEU A CG  
1656 C  CD1 . LEU A  229 ? 1.0468 1.4217 1.1137 0.0124  -0.0591 -0.1750 1003 LEU A CD1 
1657 C  CD2 . LEU A  229 ? 1.0980 1.4404 1.1689 0.0241  -0.0576 -0.1873 1003 LEU A CD2 
1658 N  N   . GLU A  230 ? 1.0119 1.3594 1.0739 0.0407  -0.0581 -0.1905 1004 GLU A N   
1659 C  CA  . GLU A  230 ? 1.0150 1.3572 1.0798 0.0505  -0.0576 -0.1992 1004 GLU A CA  
1660 C  C   . GLU A  230 ? 1.0311 1.3943 1.0933 0.0546  -0.0586 -0.2022 1004 GLU A C   
1661 O  O   . GLU A  230 ? 1.0108 1.3795 1.0757 0.0623  -0.0584 -0.2113 1004 GLU A O   
1662 C  CB  . GLU A  230 ? 1.0497 1.3649 1.1148 0.0550  -0.0558 -0.1947 1004 GLU A CB  
1663 C  CG  . GLU A  230 ? 1.2620 1.5643 1.3313 0.0648  -0.0545 -0.2023 1004 GLU A CG  
1664 C  CD  . GLU A  230 ? 1.6965 1.9742 1.7659 0.0688  -0.0530 -0.1963 1004 GLU A CD  
1665 O  OE1 . GLU A  230 ? 1.6282 1.9055 1.6970 0.0763  -0.0525 -0.1960 1004 GLU A OE1 
1666 O  OE2 . GLU A  230 ? 1.6873 1.9477 1.7573 0.0644  -0.0522 -0.1913 1004 GLU A OE2 
1667 N  N   . ASP A  231 ? 0.9818 1.3564 1.0387 0.0492  -0.0595 -0.1947 1005 ASP A N   
1668 C  CA  . ASP A  231 ? 0.9751 1.3718 1.0286 0.0513  -0.0606 -0.1961 1005 ASP A CA  
1669 C  C   . ASP A  231 ? 1.0276 1.4520 1.0817 0.0484  -0.0624 -0.2020 1005 ASP A C   
1670 O  O   . ASP A  231 ? 1.0146 1.4569 1.0687 0.0540  -0.0632 -0.2085 1005 ASP A O   
1671 C  CB  . ASP A  231 ? 1.0007 1.3980 1.0479 0.0451  -0.0604 -0.1860 1005 ASP A CB  
1672 C  CG  . ASP A  231 ? 1.1491 1.5383 1.1942 0.0510  -0.0594 -0.1835 1005 ASP A CG  
1673 O  OD1 . ASP A  231 ? 1.1663 1.5409 1.2152 0.0599  -0.0584 -0.1870 1005 ASP A OD1 
1674 O  OD2 . ASP A  231 ? 1.2253 1.6231 1.2649 0.0464  -0.0595 -0.1779 1005 ASP A OD2 
1675 N  N   . ASN A  232 ? 0.9946 1.4241 1.0491 0.0400  -0.0630 -0.1994 1006 ASN A N   
1676 C  CA  . ASN A  232 ? 0.9845 1.4413 1.0399 0.0363  -0.0648 -0.2042 1006 ASN A CA  
1677 C  C   . ASN A  232 ? 1.0674 1.5268 1.1285 0.0425  -0.0646 -0.2168 1006 ASN A C   
1678 O  O   . ASN A  232 ? 1.0542 1.5374 1.1161 0.0442  -0.0657 -0.2246 1006 ASN A O   
1679 C  CB  . ASN A  232 ? 0.9524 1.4135 1.0070 0.0258  -0.0652 -0.1962 1006 ASN A CB  
1680 C  CG  . ASN A  232 ? 1.1831 1.6445 1.2320 0.0188  -0.0650 -0.1847 1006 ASN A CG  
1681 O  OD1 . ASN A  232 ? 1.0605 1.5303 1.1053 0.0197  -0.0654 -0.1837 1006 ASN A OD1 
1682 N  ND2 . ASN A  232 ? 1.1047 1.5575 1.1533 0.0116  -0.0642 -0.1759 1006 ASN A ND2 
1683 N  N   . TRP A  233 ? 1.0648 1.4999 1.1297 0.0457  -0.0629 -0.2193 1007 TRP A N   
1684 C  CA  . TRP A  233 ? 1.0837 1.5166 1.1539 0.0511  -0.0619 -0.2316 1007 TRP A CA  
1685 C  C   . TRP A  233 ? 1.1567 1.5900 1.2279 0.0623  -0.0611 -0.2394 1007 TRP A C   
1686 O  O   . TRP A  233 ? 1.1471 1.5901 1.2217 0.0670  -0.0605 -0.2511 1007 TRP A O   
1687 C  CB  . TRP A  233 ? 1.0882 1.4934 1.1616 0.0507  -0.0601 -0.2309 1007 TRP A CB  
1688 C  CG  . TRP A  233 ? 1.1130 1.5151 1.1916 0.0542  -0.0588 -0.2436 1007 TRP A CG  
1689 C  CD1 . TRP A  233 ? 1.1567 1.5440 1.2384 0.0635  -0.0567 -0.2520 1007 TRP A CD1 
1690 C  CD2 . TRP A  233 ? 1.1119 1.5262 1.1934 0.0479  -0.0591 -0.2495 1007 TRP A CD2 
1691 N  NE1 . TRP A  233 ? 1.1516 1.5396 1.2377 0.0630  -0.0554 -0.2635 1007 TRP A NE1 
1692 C  CE2 . TRP A  233 ? 1.1667 1.5719 1.2526 0.0533  -0.0570 -0.2624 1007 TRP A CE2 
1693 C  CE3 . TRP A  233 ? 1.1278 1.5603 1.2086 0.0382  -0.0607 -0.2448 1007 TRP A CE3 
1694 C  CZ2 . TRP A  233 ? 1.1572 1.5718 1.2464 0.0484  -0.0565 -0.2716 1007 TRP A CZ2 
1695 C  CZ3 . TRP A  233 ? 1.1450 1.5883 1.2294 0.0341  -0.0605 -0.2530 1007 TRP A CZ3 
1696 C  CH2 . TRP A  233 ? 1.1540 1.5888 1.2424 0.0387  -0.0584 -0.2666 1007 TRP A CH2 
1697 N  N   . GLU A  234 ? 1.1370 1.5601 1.2053 0.0667  -0.0606 -0.2328 1008 GLU A N   
1698 C  CA  . GLU A  234 ? 1.1400 1.5641 1.2089 0.0779  -0.0597 -0.2376 1008 GLU A CA  
1699 C  C   . GLU A  234 ? 1.1939 1.6505 1.2608 0.0790  -0.0614 -0.2419 1008 GLU A C   
1700 O  O   . GLU A  234 ? 1.1931 1.6570 1.2628 0.0881  -0.0605 -0.2514 1008 GLU A O   
1701 C  CB  . GLU A  234 ? 1.1618 1.5689 1.2280 0.0810  -0.0589 -0.2281 1008 GLU A CB  
1702 N  N   . THR A  235 ? 1.1448 1.6205 1.2070 0.0698  -0.0636 -0.2351 1009 THR A N   
1703 C  CA  . THR A  235 ? 1.1361 1.6445 1.1958 0.0691  -0.0654 -0.2381 1009 THR A CA  
1704 C  C   . THR A  235 ? 1.2069 1.7342 1.2703 0.0687  -0.0660 -0.2492 1009 THR A C   
1705 O  O   . THR A  235 ? 1.1892 1.7371 1.2533 0.0746  -0.0664 -0.2572 1009 THR A O   
1706 C  CB  . THR A  235 ? 1.2045 1.7260 1.2580 0.0587  -0.0672 -0.2273 1009 THR A CB  
1707 O  OG1 . THR A  235 ? 1.2267 1.7289 1.2793 0.0507  -0.0667 -0.2185 1009 THR A OG1 
1708 C  CG2 . THR A  235 ? 1.1735 1.6999 1.2224 0.0619  -0.0673 -0.2224 1009 THR A CG2 
1709 N  N   . LEU A  236 ? 1.1945 1.7161 1.2604 0.0619  -0.0660 -0.2500 1010 LEU A N   
1710 C  CA  . LEU A  236 ? 1.1967 1.7363 1.2663 0.0603  -0.0664 -0.2607 1010 LEU A CA  
1711 C  C   . LEU A  236 ? 1.2797 1.8142 1.3540 0.0715  -0.0642 -0.2747 1010 LEU A C   
1712 O  O   . LEU A  236 ? 1.2676 1.8259 1.3432 0.0743  -0.0645 -0.2845 1010 LEU A O   
1713 C  CB  . LEU A  236 ? 1.1967 1.7278 1.2684 0.0517  -0.0663 -0.2583 1010 LEU A CB  
1714 C  CG  . LEU A  236 ? 1.2506 1.7976 1.3193 0.0401  -0.0685 -0.2477 1010 LEU A CG  
1715 C  CD1 . LEU A  236 ? 1.2541 1.7883 1.3252 0.0335  -0.0679 -0.2441 1010 LEU A CD1 
1716 C  CD2 . LEU A  236 ? 1.2678 1.8519 1.3361 0.0366  -0.0706 -0.2525 1010 LEU A CD2 
1717 N  N   . ASN A  237 ? 1.2745 1.7780 1.3513 0.0781  -0.0616 -0.2754 1011 ASN A N   
1718 C  CA  . ASN A  237 ? 1.2892 1.7816 1.3707 0.0893  -0.0587 -0.2874 1011 ASN A CA  
1719 C  C   . ASN A  237 ? 1.3808 1.8849 1.4615 0.1001  -0.0583 -0.2899 1011 ASN A C   
1720 O  O   . ASN A  237 ? 1.3790 1.8914 1.4630 0.1080  -0.0566 -0.3021 1011 ASN A O   
1721 C  CB  . ASN A  237 ? 1.2961 1.7514 1.3802 0.0924  -0.0561 -0.2852 1011 ASN A CB  
1722 C  CG  . ASN A  237 ? 1.4728 1.9156 1.5583 0.0828  -0.0560 -0.2837 1011 ASN A CG  
1723 O  OD1 . ASN A  237 ? 1.3456 1.8071 1.4309 0.0740  -0.0576 -0.2854 1011 ASN A OD1 
1724 N  ND2 . ASN A  237 ? 1.3505 1.7625 1.4375 0.0844  -0.0541 -0.2801 1011 ASN A ND2 
1725 N  N   . ASP A  238 ? 1.3648 1.8703 1.4408 0.1004  -0.0596 -0.2785 1012 ASP A N   
1726 C  CA  . ASP A  238 ? 1.3724 1.8910 1.4470 0.1101  -0.0595 -0.2789 1012 ASP A CA  
1727 C  C   . ASP A  238 ? 1.4471 2.0031 1.5201 0.1089  -0.0615 -0.2846 1012 ASP A C   
1728 O  O   . ASP A  238 ? 1.4440 2.0112 1.5191 0.1195  -0.0602 -0.2928 1012 ASP A O   
1729 C  CB  . ASP A  238 ? 1.3994 1.9107 1.4691 0.1092  -0.0603 -0.2653 1012 ASP A CB  
1730 C  CG  . ASP A  238 ? 1.5129 1.9899 1.5845 0.1138  -0.0580 -0.2599 1012 ASP A CG  
1731 O  OD1 . ASP A  238 ? 1.5244 1.9830 1.6013 0.1218  -0.0553 -0.2672 1012 ASP A OD1 
1732 O  OD2 . ASP A  238 ? 1.5757 2.0442 1.6433 0.1090  -0.0588 -0.2485 1012 ASP A OD2 
1733 N  N   . ASN A  239 ? 1.4173 1.9929 1.4869 0.0965  -0.0644 -0.2802 1013 ASN A N   
1734 C  CA  . ASN A  239 ? 1.4111 2.0238 1.4789 0.0938  -0.0666 -0.2849 1013 ASN A CA  
1735 C  C   . ASN A  239 ? 1.4720 2.0961 1.5450 0.0966  -0.0655 -0.2999 1013 ASN A C   
1736 O  O   . ASN A  239 ? 1.4604 2.1136 1.5333 0.0993  -0.0664 -0.3071 1013 ASN A O   
1737 C  CB  . ASN A  239 ? 1.4131 2.0427 1.4760 0.0799  -0.0697 -0.2749 1013 ASN A CB  
1738 C  CG  . ASN A  239 ? 1.6407 2.2643 1.6978 0.0759  -0.0706 -0.2612 1013 ASN A CG  
1739 O  OD1 . ASN A  239 ? 1.4932 2.1273 1.5472 0.0809  -0.0708 -0.2593 1013 ASN A OD1 
1740 N  ND2 . ASN A  239 ? 1.5718 2.1790 1.6271 0.0665  -0.0709 -0.2517 1013 ASN A ND2 
1741 N  N   . LEU A  240 ? 1.4439 2.0456 1.5212 0.0957  -0.0635 -0.3052 1014 LEU A N   
1742 C  CA  . LEU A  240 ? 1.4441 2.0521 1.5265 0.0979  -0.0617 -0.3206 1014 LEU A CA  
1743 C  C   . LEU A  240 ? 1.5096 2.1138 1.5954 0.1131  -0.0585 -0.3312 1014 LEU A C   
1744 O  O   . LEU A  240 ? 1.4974 2.1211 1.5859 0.1168  -0.0576 -0.3442 1014 LEU A O   
1745 C  CB  . LEU A  240 ? 1.4517 2.0338 1.5373 0.0929  -0.0600 -0.3223 1014 LEU A CB  
1746 N  N   . LYS A  241 ? 1.4854 2.0656 1.5712 0.1219  -0.0568 -0.3252 1015 LYS A N   
1747 C  CA  . LYS A  241 ? 1.4906 2.0647 1.5795 0.1375  -0.0535 -0.3320 1015 LYS A CA  
1748 C  C   . LYS A  241 ? 1.5474 2.1530 1.6330 0.1424  -0.0554 -0.3299 1015 LYS A C   
1749 O  O   . LYS A  241 ? 1.5384 2.1515 1.6269 0.1549  -0.0530 -0.3384 1015 LYS A O   
1750 C  CB  . LYS A  241 ? 1.5326 2.0705 1.6228 0.1443  -0.0511 -0.3245 1015 LYS A CB  
1751 N  N   . VAL A  242 ? 1.5120 2.1362 1.5915 0.1325  -0.0594 -0.3187 1016 VAL A N   
1752 C  CA  . VAL A  242 ? 1.5058 2.1622 1.5811 0.1343  -0.0617 -0.3156 1016 VAL A CA  
1753 C  C   . VAL A  242 ? 1.5559 2.2465 1.6324 0.1328  -0.0627 -0.3273 1016 VAL A C   
1754 O  O   . VAL A  242 ? 1.5472 2.2638 1.6226 0.1393  -0.0632 -0.3303 1016 VAL A O   
1755 C  CB  . VAL A  242 ? 1.5550 2.2173 1.6234 0.1232  -0.0650 -0.3000 1016 VAL A CB  
1756 C  CG1 . VAL A  242 ? 1.5407 2.2397 1.6044 0.1224  -0.0676 -0.2977 1016 VAL A CG1 
1757 C  CG2 . VAL A  242 ? 1.5632 2.1957 1.6305 0.1267  -0.0637 -0.2897 1016 VAL A CG2 
1758 N  N   . ILE A  243 ? 1.5153 2.2069 1.5942 0.1246  -0.0629 -0.3340 1017 ILE A N   
1759 C  CA  . ILE A  243 ? 1.5034 2.2266 1.5838 0.1222  -0.0637 -0.3459 1017 ILE A CA  
1760 C  C   . ILE A  243 ? 1.5634 2.2865 1.6493 0.1369  -0.0596 -0.3617 1017 ILE A C   
1761 O  O   . ILE A  243 ? 1.5503 2.3035 1.6360 0.1419  -0.0601 -0.3683 1017 ILE A O   
1762 C  CB  . ILE A  243 ? 1.5381 2.2621 1.6196 0.1088  -0.0649 -0.3473 1017 ILE A CB  
1763 C  CG1 . ILE A  243 ? 1.5368 2.2772 1.6126 0.0948  -0.0692 -0.3331 1017 ILE A CG1 
1764 C  CG2 . ILE A  243 ? 1.5326 2.2789 1.6181 0.1091  -0.0638 -0.3641 1017 ILE A CG2 
1765 C  CD1 . ILE A  243 ? 1.5978 2.3323 1.6742 0.0818  -0.0703 -0.3293 1017 ILE A CD1 
1766 N  N   . GLU A  244 ? 1.5308 2.2197 1.6216 0.1437  -0.0555 -0.3676 1018 GLU A N   
1767 C  CA  . GLU A  244 ? 1.8056 2.4871 1.9021 0.1577  -0.0506 -0.3825 1018 GLU A CA  
1768 C  C   . GLU A  244 ? 1.8612 2.5406 1.9577 0.1728  -0.0490 -0.3787 1018 GLU A C   
1769 O  O   . GLU A  244 ? 1.2825 1.9931 1.3767 0.1763  -0.0507 -0.3785 1018 GLU A O   
1770 C  CB  . GLU A  244 ? 1.8342 2.4780 1.9355 0.1584  -0.0466 -0.3886 1018 GLU A CB  
1771 N  N   . VAL A  252 ? 1.5440 2.4146 1.6011 0.0977  -0.0788 -0.3184 1026 VAL A N   
1772 C  CA  . VAL A  252 ? 1.5438 2.4008 1.6041 0.0899  -0.0785 -0.3207 1026 VAL A CA  
1773 C  C   . VAL A  252 ? 1.5837 2.4463 1.6395 0.0735  -0.0816 -0.3075 1026 VAL A C   
1774 O  O   . VAL A  252 ? 1.5773 2.4205 1.6348 0.0667  -0.0813 -0.3043 1026 VAL A O   
1775 C  CB  . VAL A  252 ? 1.5835 2.4582 1.6492 0.0928  -0.0776 -0.3369 1026 VAL A CB  
1776 C  CG1 . VAL A  252 ? 1.5864 2.4366 1.6581 0.1070  -0.0731 -0.3493 1026 VAL A CG1 
1777 C  CG2 . VAL A  252 ? 1.5658 2.4855 1.6298 0.0927  -0.0798 -0.3421 1026 VAL A CG2 
1778 N  N   . LYS A  253 ? 1.5298 2.4189 1.5799 0.0672  -0.0844 -0.2997 1027 LYS A N   
1779 C  CA  . LYS A  253 ? 1.5248 2.4203 1.5702 0.0519  -0.0869 -0.2863 1027 LYS A CA  
1780 C  C   . LYS A  253 ? 1.5851 2.4476 1.6270 0.0490  -0.0859 -0.2737 1027 LYS A C   
1781 O  O   . LYS A  253 ? 1.5887 2.4390 1.6292 0.0382  -0.0864 -0.2639 1027 LYS A O   
1782 C  CB  . LYS A  253 ? 1.5424 2.4779 1.5829 0.0463  -0.0898 -0.2834 1027 LYS A CB  
1783 N  N   . ASP A  254 ? 1.5362 2.3851 1.5771 0.0589  -0.0843 -0.2738 1028 ASP A N   
1784 C  CA  . ASP A  254 ? 1.5366 2.3557 1.5744 0.0576  -0.0831 -0.2631 1028 ASP A CA  
1785 C  C   . ASP A  254 ? 1.5661 2.3472 1.6082 0.0588  -0.0809 -0.2628 1028 ASP A C   
1786 O  O   . ASP A  254 ? 1.5704 2.3315 1.6100 0.0506  -0.0808 -0.2522 1028 ASP A O   
1787 C  CB  . ASP A  254 ? 1.5614 2.3808 1.5976 0.0689  -0.0819 -0.2642 1028 ASP A CB  
1788 N  N   . ALA A  255 ? 1.4959 2.2678 1.5444 0.0688  -0.0791 -0.2747 1029 ALA A N   
1789 C  CA  . ALA A  255 ? 1.4910 2.2292 1.5440 0.0704  -0.0769 -0.2763 1029 ALA A CA  
1790 C  C   . ALA A  255 ? 1.5281 2.2660 1.5816 0.0579  -0.0781 -0.2722 1029 ALA A C   
1791 O  O   . ALA A  255 ? 1.5312 2.2408 1.5857 0.0547  -0.0770 -0.2666 1029 ALA A O   
1792 C  CB  . ALA A  255 ? 1.4962 2.2292 1.5555 0.0829  -0.0744 -0.2911 1029 ALA A CB  
1793 N  N   . LEU A  256 ? 1.4667 2.2372 1.5196 0.0509  -0.0804 -0.2742 1030 LEU A N   
1794 C  CA  . LEU A  256 ? 1.4572 2.2331 1.5108 0.0392  -0.0816 -0.2695 1030 LEU A CA  
1795 C  C   . LEU A  256 ? 1.4935 2.2602 1.5419 0.0286  -0.0825 -0.2530 1030 LEU A C   
1796 O  O   . LEU A  256 ? 1.4931 2.2375 1.5428 0.0238  -0.0816 -0.2467 1030 LEU A O   
1797 C  CB  . LEU A  256 ? 1.4433 2.2591 1.4979 0.0352  -0.0838 -0.2760 1030 LEU A CB  
1798 N  N   . THR A  257 ? 1.4356 2.2185 1.4783 0.0252  -0.0839 -0.2464 1031 THR A N   
1799 C  CA  . THR A  257 ? 1.4363 2.2110 1.4736 0.0147  -0.0842 -0.2314 1031 THR A CA  
1800 C  C   . THR A  257 ? 1.4917 2.2266 1.5286 0.0165  -0.0818 -0.2251 1031 THR A C   
1801 O  O   . THR A  257 ? 1.4986 2.2195 1.5331 0.0077  -0.0813 -0.2140 1031 THR A O   
1802 C  CB  . THR A  257 ? 1.5550 2.3541 1.5861 0.0112  -0.0857 -0.2274 1031 THR A CB  
1803 O  OG1 . THR A  257 ? 1.5567 2.3622 1.5879 0.0227  -0.0854 -0.2360 1031 THR A OG1 
1804 C  CG2 . THR A  257 ? 1.5316 2.3673 1.5616 0.0026  -0.0883 -0.2265 1031 THR A CG2 
1805 N  N   . LYS A  258 ? 1.4355 2.1525 1.4748 0.0282  -0.0802 -0.2322 1032 LYS A N   
1806 C  CA  . LYS A  258 ? 1.4297 2.1102 1.4693 0.0317  -0.0779 -0.2278 1032 LYS A CA  
1807 C  C   . LYS A  258 ? 1.4385 2.0960 1.4830 0.0304  -0.0767 -0.2283 1032 LYS A C   
1808 O  O   . LYS A  258 ? 1.4377 2.0709 1.4809 0.0259  -0.0755 -0.2192 1032 LYS A O   
1809 C  CB  . LYS A  258 ? 1.4634 2.1365 1.5043 0.0450  -0.0766 -0.2348 1032 LYS A CB  
1810 N  N   . MET A  259 ? 1.3590 2.0249 1.4088 0.0339  -0.0768 -0.2389 1033 MET A N   
1811 C  CA  . MET A  259 ? 1.3467 1.9949 1.4013 0.0323  -0.0757 -0.2407 1033 MET A CA  
1812 C  C   . MET A  259 ? 1.3726 2.0267 1.4262 0.0202  -0.0767 -0.2310 1033 MET A C   
1813 O  O   . MET A  259 ? 1.3634 1.9966 1.4193 0.0176  -0.0755 -0.2271 1033 MET A O   
1814 C  CB  . MET A  259 ? 1.3696 2.0288 1.4297 0.0383  -0.0753 -0.2557 1033 MET A CB  
1815 C  CG  . MET A  259 ? 1.4191 2.0590 1.4820 0.0508  -0.0729 -0.2648 1033 MET A CG  
1816 S  SD  . MET A  259 ? 1.4638 2.1130 1.5334 0.0571  -0.0715 -0.2834 1033 MET A SD  
1817 C  CE  . MET A  259 ? 1.4092 2.1025 1.4770 0.0578  -0.0738 -0.2895 1033 MET A CE  
1818 N  N   . ARG A  260 ? 1.3167 2.0004 1.3675 0.0132  -0.0788 -0.2271 1034 ARG A N   
1819 C  CA  . ARG A  260 ? 1.3076 2.0005 1.3578 0.0019  -0.0797 -0.2169 1034 ARG A CA  
1820 C  C   . ARG A  260 ? 1.3437 2.0134 1.3900 -0.0039 -0.0784 -0.2025 1034 ARG A C   
1821 O  O   . ARG A  260 ? 1.3445 2.0042 1.3924 -0.0095 -0.0776 -0.1949 1034 ARG A O   
1822 C  CB  . ARG A  260 ? 1.3012 2.0329 1.3495 -0.0037 -0.0822 -0.2168 1034 ARG A CB  
1823 N  N   . ALA A  261 ? 1.2772 1.9394 1.3185 -0.0026 -0.0779 -0.1989 1035 ALA A N   
1824 C  CA  . ALA A  261 ? 1.2722 1.9119 1.3093 -0.0081 -0.0762 -0.1865 1035 ALA A CA  
1825 C  C   . ALA A  261 ? 1.2904 1.8948 1.3303 -0.0037 -0.0740 -0.1858 1035 ALA A C   
1826 O  O   . ALA A  261 ? 1.2768 1.8624 1.3156 -0.0091 -0.0724 -0.1757 1035 ALA A O   
1827 C  CB  . ALA A  261 ? 1.2840 1.9275 1.3153 -0.0076 -0.0762 -0.1849 1035 ALA A CB  
1828 N  N   . ALA A  262 ? 1.2331 1.8290 1.2769 0.0063  -0.0737 -0.1965 1036 ALA A N   
1829 C  CA  . ALA A  262 ? 1.2351 1.7994 1.2820 0.0113  -0.0717 -0.1974 1036 ALA A CA  
1830 C  C   . ALA A  262 ? 1.2705 1.8303 1.3223 0.0084  -0.0714 -0.1977 1036 ALA A C   
1831 O  O   . ALA A  262 ? 1.2631 1.7980 1.3157 0.0072  -0.0698 -0.1919 1036 ALA A O   
1832 C  CB  . ALA A  262 ? 1.2470 1.8050 1.2961 0.0228  -0.0712 -0.2082 1036 ALA A CB  
1833 N  N   . ALA A  263 ? 1.2266 1.8114 1.2814 0.0071  -0.0729 -0.2046 1037 ALA A N   
1834 C  CA  . ALA A  263 ? 1.2257 1.8122 1.2852 0.0036  -0.0728 -0.2056 1037 ALA A CA  
1835 C  C   . ALA A  263 ? 1.2692 1.8541 1.3275 -0.0057 -0.0725 -0.1913 1037 ALA A C   
1836 O  O   . ALA A  263 ? 1.2594 1.8318 1.3208 -0.0075 -0.0715 -0.1883 1037 ALA A O   
1837 C  CB  . ALA A  263 ? 1.2247 1.8424 1.2872 0.0036  -0.0745 -0.2162 1037 ALA A CB  
1838 N  N   . LEU A  264 ? 1.2248 1.8220 1.2785 -0.0115 -0.0732 -0.1823 1038 LEU A N   
1839 C  CA  . LEU A  264 ? 1.2225 1.8167 1.2747 -0.0200 -0.0723 -0.1677 1038 LEU A CA  
1840 C  C   . LEU A  264 ? 1.2896 1.8488 1.3397 -0.0193 -0.0697 -0.1602 1038 LEU A C   
1841 O  O   . LEU A  264 ? 1.2803 1.8272 1.3317 -0.0232 -0.0681 -0.1508 1038 LEU A O   
1842 C  CB  . LEU A  264 ? 1.2151 1.8312 1.2626 -0.0265 -0.0734 -0.1613 1038 LEU A CB  
1843 C  CG  . LEU A  264 ? 1.2629 1.9168 1.3119 -0.0292 -0.0761 -0.1659 1038 LEU A CG  
1844 C  CD1 . LEU A  264 ? 1.2614 1.9338 1.3050 -0.0331 -0.0772 -0.1632 1038 LEU A CD1 
1845 C  CD2 . LEU A  264 ? 1.2931 1.9597 1.3455 -0.0358 -0.0762 -0.1581 1038 LEU A CD2 
1846 N  N   . ASP A  265 ? 1.2665 1.8114 1.3137 -0.0140 -0.0692 -0.1640 1039 ASP A N   
1847 C  CA  . ASP A  265 ? 1.2817 1.7952 1.3267 -0.0125 -0.0668 -0.1587 1039 ASP A CA  
1848 C  C   . ASP A  265 ? 1.3416 1.8333 1.3913 -0.0082 -0.0656 -0.1612 1039 ASP A C   
1849 O  O   . ASP A  265 ? 1.3461 1.8172 1.3957 -0.0107 -0.0636 -0.1527 1039 ASP A O   
1850 C  CB  . ASP A  265 ? 1.3107 1.8210 1.3520 -0.0072 -0.0669 -0.1637 1039 ASP A CB  
1851 C  CG  . ASP A  265 ? 1.4631 1.9482 1.5004 -0.0081 -0.0646 -0.1567 1039 ASP A CG  
1852 O  OD1 . ASP A  265 ? 1.4840 1.9440 1.5235 -0.0050 -0.0630 -0.1556 1039 ASP A OD1 
1853 O  OD2 . ASP A  265 ? 1.5326 2.0240 1.5644 -0.0121 -0.0643 -0.1528 1039 ASP A OD2 
1854 N  N   . ALA A  266 ? 1.2990 1.7955 1.3528 -0.0019 -0.0667 -0.1730 1040 ALA A N   
1855 C  CA  . ALA A  266 ? 1.3038 1.7819 1.3622 0.0019  -0.0656 -0.1773 1040 ALA A CA  
1856 C  C   . ALA A  266 ? 1.3600 1.8419 1.4214 -0.0041 -0.0653 -0.1712 1040 ALA A C   
1857 O  O   . ALA A  266 ? 1.3565 1.8176 1.4199 -0.0037 -0.0638 -0.1681 1040 ALA A O   
1858 C  CB  . ALA A  266 ? 1.3071 1.7930 1.3690 0.0088  -0.0665 -0.1918 1040 ALA A CB  
1859 N  N   . GLN A  267 ? 1.3226 1.8324 1.3843 -0.0098 -0.0668 -0.1689 1041 GLN A N   
1860 C  CA  . GLN A  267 ? 1.3220 1.8409 1.3865 -0.0158 -0.0666 -0.1614 1041 GLN A CA  
1861 C  C   . GLN A  267 ? 1.3968 1.8951 1.4594 -0.0194 -0.0643 -0.1469 1041 GLN A C   
1862 O  O   . GLN A  267 ? 1.3977 1.8876 1.4634 -0.0207 -0.0631 -0.1421 1041 GLN A O   
1863 C  CB  . GLN A  267 ? 1.3257 1.8796 1.3903 -0.0209 -0.0686 -0.1607 1041 GLN A CB  
1864 N  N   . LYS A  268 ? 1.3697 1.8594 1.4271 -0.0208 -0.0634 -0.1407 1042 LYS A N   
1865 C  CA  . LYS A  268 ? 1.3828 1.8517 1.4379 -0.0242 -0.0606 -0.1279 1042 LYS A CA  
1866 C  C   . LYS A  268 ? 1.4556 1.8936 1.5117 -0.0197 -0.0587 -0.1284 1042 LYS A C   
1867 O  O   . LYS A  268 ? 1.4522 1.8749 1.5091 -0.0217 -0.0564 -0.1192 1042 LYS A O   
1868 C  CB  . LYS A  268 ? 1.4183 1.8871 1.4673 -0.0275 -0.0600 -0.1233 1042 LYS A CB  
1869 N  N   . ALA A  269 ? 1.4295 1.8590 1.4858 -0.0133 -0.0595 -0.1389 1043 ALA A N   
1870 C  CA  . ALA A  269 ? 1.4439 1.8456 1.5012 -0.0085 -0.0580 -0.1406 1043 ALA A CA  
1871 C  C   . ALA A  269 ? 1.5101 1.9076 1.5728 -0.0076 -0.0579 -0.1426 1043 ALA A C   
1872 O  O   . ALA A  269 ? 1.4982 1.9157 1.5641 -0.0086 -0.0594 -0.1480 1043 ALA A O   
1873 C  CB  . ALA A  269 ? 1.4561 1.8530 1.5124 -0.0018 -0.0589 -0.1506 1043 ALA A CB  
1874 N  N   . THR A  270 ? 1.4921 1.8644 1.5554 -0.0062 -0.0559 -0.1384 1044 THR A N   
1875 C  CA  . THR A  270 ? 1.4964 1.8611 1.5643 -0.0056 -0.0553 -0.1393 1044 THR A CA  
1876 C  C   . THR A  270 ? 1.5722 1.9209 1.6417 0.0006  -0.0555 -0.1495 1044 THR A C   
1877 O  O   . THR A  270 ? 1.5769 1.9064 1.6440 0.0040  -0.0545 -0.1487 1044 THR A O   
1878 C  CB  . THR A  270 ? 1.5801 1.9290 1.6478 -0.0084 -0.0528 -0.1269 1044 THR A CB  
1879 O  OG1 . THR A  270 ? 1.5698 1.9324 1.6361 -0.0136 -0.0523 -0.1173 1044 THR A OG1 
1880 C  CG2 . THR A  270 ? 1.5488 1.8929 1.6211 -0.0084 -0.0523 -0.1267 1044 THR A CG2 
1881 N  N   . PRO A  271 ? 1.5381 1.8947 1.6116 0.0017  -0.0564 -0.1589 1045 PRO A N   
1882 C  CA  . PRO A  271 ? 1.5462 1.8862 1.6215 0.0074  -0.0561 -0.1685 1045 PRO A CA  
1883 C  C   . PRO A  271 ? 1.6157 1.9304 1.6922 0.0080  -0.0543 -0.1640 1045 PRO A C   
1884 O  O   . PRO A  271 ? 1.6009 1.9151 1.6781 0.0037  -0.0535 -0.1554 1045 PRO A O   
1885 C  CB  . PRO A  271 ? 1.5591 1.9174 1.6381 0.0071  -0.0572 -0.1801 1045 PRO A CB  
1886 C  CG  . PRO A  271 ? 1.6059 1.9848 1.6862 0.0003  -0.0578 -0.1744 1045 PRO A CG  
1887 C  CD  . PRO A  271 ? 1.5488 1.9301 1.6255 -0.0025 -0.0576 -0.1615 1045 PRO A CD  
1888 N  N   . PRO A  272 ? 1.6003 1.8944 1.6773 0.0135  -0.0536 -0.1689 1046 PRO A N   
1889 C  CA  . PRO A  272 ? 1.6144 1.8852 1.6925 0.0137  -0.0520 -0.1644 1046 PRO A CA  
1890 C  C   . PRO A  272 ? 1.6874 1.9606 1.7694 0.0100  -0.0517 -0.1664 1046 PRO A C   
1891 O  O   . PRO A  272 ? 1.6873 1.9495 1.7697 0.0077  -0.0506 -0.1586 1046 PRO A O   
1892 C  CB  . PRO A  272 ? 1.6417 1.8943 1.7199 0.0205  -0.0515 -0.1705 1046 PRO A CB  
1893 C  CG  . PRO A  272 ? 1.6899 1.9573 1.7689 0.0238  -0.0526 -0.1812 1046 PRO A CG  
1894 C  CD  . PRO A  272 ? 1.6233 1.9145 1.6999 0.0200  -0.0540 -0.1780 1046 PRO A CD  
1895 N  N   . LYS A  273 ? 1.6560 1.9441 1.7408 0.0092  -0.0526 -0.1771 1047 LYS A N   
1896 C  CA  . LYS A  273 ? 1.6580 1.9523 1.7465 0.0049  -0.0523 -0.1810 1047 LYS A CA  
1897 C  C   . LYS A  273 ? 1.7239 2.0326 1.8127 -0.0011 -0.0524 -0.1705 1047 LYS A C   
1898 O  O   . LYS A  273 ? 1.7191 2.0219 1.8097 -0.0039 -0.0514 -0.1669 1047 LYS A O   
1899 C  CB  . LYS A  273 ? 1.6813 1.9925 1.7721 0.0048  -0.0530 -0.1951 1047 LYS A CB  
1900 N  N   . LEU A  274 ? 1.6922 2.0192 1.7792 -0.0029 -0.0533 -0.1649 1048 LEU A N   
1901 C  CA  . LEU A  274 ? 1.6927 2.0343 1.7801 -0.0078 -0.0531 -0.1537 1048 LEU A CA  
1902 C  C   . LEU A  274 ? 1.7729 2.1024 1.8568 -0.0070 -0.0520 -0.1408 1048 LEU A C   
1903 O  O   . LEU A  274 ? 1.7640 2.1077 1.8463 -0.0092 -0.0523 -0.1345 1048 LEU A O   
1904 C  CB  . LEU A  274 ? 1.6813 2.0552 1.7698 -0.0113 -0.0548 -0.1571 1048 LEU A CB  
1905 N  N   . GLU A  275 ? 1.7584 2.0614 1.8412 -0.0043 -0.0504 -0.1372 1049 GLU A N   
1906 C  CA  . GLU A  275 ? 1.7710 2.0593 1.8504 -0.0037 -0.0487 -0.1265 1049 GLU A CA  
1907 C  C   . GLU A  275 ? 1.8434 2.1282 1.9240 -0.0063 -0.0467 -0.1145 1049 GLU A C   
1908 O  O   . GLU A  275 ? 1.8371 2.1207 1.9156 -0.0075 -0.0452 -0.1046 1049 GLU A O   
1909 C  CB  . GLU A  275 ? 1.7967 2.0601 1.8740 0.0009  -0.0480 -0.1293 1049 GLU A CB  
1910 N  N   . ASP A  276 ? 1.8187 2.1017 1.9028 -0.0070 -0.0464 -0.1153 1050 ASP A N   
1911 C  CA  . ASP A  276 ? 1.8245 2.1052 1.9103 -0.0087 -0.0444 -0.1044 1050 ASP A CA  
1912 C  C   . ASP A  276 ? 1.8761 2.1831 1.9643 -0.0125 -0.0446 -0.0982 1050 ASP A C   
1913 O  O   . ASP A  276 ? 1.8682 2.1749 1.9572 -0.0131 -0.0425 -0.0862 1050 ASP A O   
1914 C  CB  . ASP A  276 ? 1.8514 2.1207 1.9397 -0.0083 -0.0441 -0.1079 1050 ASP A CB  
1915 N  N   . LYS A  277 ? 1.8366 2.1668 1.9263 -0.0147 -0.0469 -0.1063 1051 LYS A N   
1916 C  CA  . LYS A  277 ? 1.8298 2.1890 1.9220 -0.0185 -0.0475 -0.1015 1051 LYS A CA  
1917 C  C   . LYS A  277 ? 1.8990 2.2655 1.9892 -0.0193 -0.0467 -0.0910 1051 LYS A C   
1918 O  O   . LYS A  277 ? 1.9000 2.2534 1.9863 -0.0176 -0.0464 -0.0912 1051 LYS A O   
1919 C  CB  . LYS A  277 ? 1.8507 2.2323 1.9448 -0.0208 -0.0501 -0.1145 1051 LYS A CB  
1920 N  N   . SER A  278 ? 1.8635 2.2516 1.9564 -0.0222 -0.0462 -0.0815 1052 SER A N   
1921 C  CA  . SER A  278 ? 1.8649 2.2625 1.9568 -0.0236 -0.0450 -0.0699 1052 SER A CA  
1922 C  C   . SER A  278 ? 1.9228 2.3360 2.0123 -0.0253 -0.0474 -0.0762 1052 SER A C   
1923 O  O   . SER A  278 ? 1.9155 2.3423 2.0059 -0.0260 -0.0500 -0.0888 1052 SER A O   
1924 C  CB  . SER A  278 ? 1.9025 2.3226 1.9987 -0.0258 -0.0442 -0.0590 1052 SER A CB  
1925 N  N   . PRO A  279 ? 1.8871 2.2998 1.9737 -0.0264 -0.0463 -0.0681 1053 PRO A N   
1926 C  CA  . PRO A  279 ? 1.8818 2.3117 1.9662 -0.0285 -0.0486 -0.0741 1053 PRO A CA  
1927 C  C   . PRO A  279 ? 1.9227 2.3886 2.0105 -0.0321 -0.0508 -0.0747 1053 PRO A C   
1928 O  O   . PRO A  279 ? 1.9122 2.3950 1.9991 -0.0332 -0.0535 -0.0846 1053 PRO A O   
1929 C  CB  . PRO A  279 ? 1.9093 2.3280 1.9897 -0.0296 -0.0463 -0.0638 1053 PRO A CB  
1930 C  CG  . PRO A  279 ? 1.9755 2.3661 2.0556 -0.0273 -0.0426 -0.0553 1053 PRO A CG  
1931 C  CD  . PRO A  279 ? 1.9142 2.3105 1.9994 -0.0261 -0.0425 -0.0538 1053 PRO A CD  
1932 N  N   . ASP A  280 ? 1.8761 2.3550 1.9679 -0.0337 -0.0496 -0.0641 1054 ASP A N   
1933 C  CA  . ASP A  280 ? 1.8597 2.3750 1.9553 -0.0374 -0.0514 -0.0626 1054 ASP A CA  
1934 C  C   . ASP A  280 ? 1.8990 2.4273 1.9984 -0.0380 -0.0529 -0.0727 1054 ASP A C   
1935 O  O   . ASP A  280 ? 1.8822 2.4420 1.9851 -0.0415 -0.0542 -0.0719 1054 ASP A O   
1936 C  CB  . ASP A  280 ? 1.8791 2.4040 1.9772 -0.0388 -0.0489 -0.0439 1054 ASP A CB  
1937 C  CG  . ASP A  280 ? 2.0128 2.5472 2.1086 -0.0414 -0.0486 -0.0360 1054 ASP A CG  
1938 O  OD1 . ASP A  280 ? 2.0057 2.5719 2.1030 -0.0450 -0.0510 -0.0375 1054 ASP A OD1 
1939 O  OD2 . ASP A  280 ? 2.1028 2.6136 2.1953 -0.0404 -0.0459 -0.0283 1054 ASP A OD2 
1940 N  N   . SER A  281 ? 1.8629 2.3679 1.9615 -0.0352 -0.0528 -0.0824 1055 SER A N   
1941 C  CA  . SER A  281 ? 1.8595 2.3712 1.9611 -0.0362 -0.0538 -0.0932 1055 SER A CA  
1942 C  C   . SER A  281 ? 1.9060 2.4442 2.0085 -0.0390 -0.0566 -0.1077 1055 SER A C   
1943 O  O   . SER A  281 ? 1.9012 2.4400 2.0009 -0.0381 -0.0579 -0.1137 1055 SER A O   
1944 C  CB  . SER A  281 ? 1.9151 2.3935 2.0149 -0.0324 -0.0529 -0.1008 1055 SER A CB  
1945 N  N   . PRO A  282 ? 1.8593 2.4197 1.9655 -0.0427 -0.0574 -0.1143 1056 PRO A N   
1946 C  CA  . PRO A  282 ? 1.8473 2.4327 1.9543 -0.0456 -0.0596 -0.1293 1056 PRO A CA  
1947 C  C   . PRO A  282 ? 1.8940 2.4593 1.9987 -0.0423 -0.0602 -0.1462 1056 PRO A C   
1948 O  O   . PRO A  282 ? 1.8835 2.4652 1.9880 -0.0432 -0.0617 -0.1583 1056 PRO A O   
1949 C  CB  . PRO A  282 ? 1.8616 2.4704 1.9728 -0.0506 -0.0596 -0.1320 1056 PRO A CB  
1950 C  CG  . PRO A  282 ? 1.9214 2.5254 2.0343 -0.0503 -0.0577 -0.1146 1056 PRO A CG  
1951 C  CD  . PRO A  282 ? 1.8789 2.4441 1.9886 -0.0447 -0.0561 -0.1085 1056 PRO A CD  
1952 N  N   . GLU A  283 ? 1.8533 2.3837 1.9563 -0.0382 -0.0587 -0.1466 1057 GLU A N   
1953 C  CA  . GLU A  283 ? 1.8554 2.3616 1.9564 -0.0339 -0.0587 -0.1597 1057 GLU A CA  
1954 C  C   . GLU A  283 ? 1.9016 2.4009 1.9988 -0.0302 -0.0594 -0.1580 1057 GLU A C   
1955 O  O   . GLU A  283 ? 1.8988 2.3982 1.9949 -0.0277 -0.0604 -0.1702 1057 GLU A O   
1956 C  CB  . GLU A  283 ? 1.8823 2.3556 1.9830 -0.0311 -0.0568 -0.1573 1057 GLU A CB  
1957 C  CG  . GLU A  283 ? 1.9896 2.4632 2.0932 -0.0340 -0.0562 -0.1664 1057 GLU A CG  
1958 C  CD  . GLU A  283 ? 2.2101 2.6533 2.3134 -0.0318 -0.0545 -0.1625 1057 GLU A CD  
1959 O  OE1 . GLU A  283 ? 2.0741 2.4914 2.1757 -0.0276 -0.0540 -0.1694 1057 GLU A OE1 
1960 O  OE2 . GLU A  283 ? 2.1378 2.5838 2.2427 -0.0341 -0.0535 -0.1520 1057 GLU A OE2 
1961 N  N   . MET A  284 ? 1.8513 2.3443 1.9466 -0.0298 -0.0587 -0.1427 1058 MET A N   
1962 C  CA  . MET A  284 ? 1.8474 2.3353 1.9387 -0.0277 -0.0590 -0.1388 1058 MET A CA  
1963 C  C   . MET A  284 ? 1.8739 2.3949 1.9653 -0.0308 -0.0611 -0.1413 1058 MET A C   
1964 O  O   . MET A  284 ? 1.8703 2.3926 1.9588 -0.0288 -0.0622 -0.1469 1058 MET A O   
1965 C  CB  . MET A  284 ? 1.8823 2.3548 1.9717 -0.0276 -0.0570 -0.1219 1058 MET A CB  
1966 N  N   . LYS A  285 ? 1.8043 2.3537 1.8991 -0.0357 -0.0617 -0.1369 1059 LYS A N   
1967 C  CA  . LYS A  285 ? 1.7783 2.3632 1.8739 -0.0394 -0.0637 -0.1382 1059 LYS A CA  
1968 C  C   . LYS A  285 ? 1.7925 2.3898 1.8883 -0.0385 -0.0654 -0.1570 1059 LYS A C   
1969 O  O   . LYS A  285 ? 1.7784 2.3917 1.8724 -0.0387 -0.0670 -0.1602 1059 LYS A O   
1970 C  CB  . LYS A  285 ? 1.7998 2.4119 1.8995 -0.0446 -0.0636 -0.1295 1059 LYS A CB  
1971 N  N   . ASP A  286 ? 1.7315 2.3206 1.8294 -0.0375 -0.0648 -0.1693 1060 ASP A N   
1972 C  CA  . ASP A  286 ? 1.7162 2.3126 1.8149 -0.0362 -0.0656 -0.1882 1060 ASP A CA  
1973 C  C   . ASP A  286 ? 1.7428 2.3217 1.8380 -0.0299 -0.0659 -0.1946 1060 ASP A C   
1974 O  O   . ASP A  286 ? 1.7287 2.3248 1.8237 -0.0290 -0.0671 -0.2053 1060 ASP A O   
1975 C  CB  . ASP A  286 ? 1.7430 2.3275 1.8444 -0.0367 -0.0641 -0.1982 1060 ASP A CB  
1976 C  CG  . ASP A  286 ? 1.8720 2.4546 1.9741 -0.0342 -0.0639 -0.2181 1060 ASP A CG  
1977 O  OD1 . ASP A  286 ? 1.8725 2.4827 1.9754 -0.0360 -0.0651 -0.2272 1060 ASP A OD1 
1978 O  OD2 . ASP A  286 ? 1.9453 2.4989 2.0473 -0.0304 -0.0623 -0.2245 1060 ASP A OD2 
1979 N  N   . PHE A  287 ? 1.6919 2.2380 1.7846 -0.0256 -0.0646 -0.1882 1061 PHE A N   
1980 C  CA  . PHE A  287 ? 1.6872 2.2159 1.7764 -0.0195 -0.0647 -0.1923 1061 PHE A CA  
1981 C  C   . PHE A  287 ? 1.7045 2.2511 1.7907 -0.0208 -0.0662 -0.1859 1061 PHE A C   
1982 O  O   . PHE A  287 ? 1.6980 2.2522 1.7827 -0.0176 -0.0673 -0.1947 1061 PHE A O   
1983 C  CB  . PHE A  287 ? 1.7234 2.2156 1.8107 -0.0157 -0.0629 -0.1857 1061 PHE A CB  
1984 N  N   . ARG A  288 ? 1.6407 2.1952 1.7262 -0.0255 -0.0662 -0.1708 1062 ARG A N   
1985 C  CA  . ARG A  288 ? 1.6271 2.1985 1.7097 -0.0281 -0.0673 -0.1628 1062 ARG A CA  
1986 C  C   . ARG A  288 ? 1.6529 2.2623 1.7371 -0.0313 -0.0695 -0.1699 1062 ARG A C   
1987 O  O   . ARG A  288 ? 1.6369 2.2604 1.7184 -0.0317 -0.0709 -0.1698 1062 ARG A O   
1988 C  CB  . ARG A  288 ? 1.6296 2.1974 1.7117 -0.0323 -0.0660 -0.1445 1062 ARG A CB  
1989 C  CG  . ARG A  288 ? 1.7641 2.2966 1.8433 -0.0295 -0.0637 -0.1367 1062 ARG A CG  
1990 C  CD  . ARG A  288 ? 1.8974 2.4245 1.9774 -0.0329 -0.0616 -0.1201 1062 ARG A CD  
1991 N  NE  . ARG A  288 ? 2.0313 2.5685 2.1085 -0.0367 -0.0613 -0.1091 1062 ARG A NE  
1992 C  CZ  . ARG A  288 ? 2.2448 2.7761 2.3221 -0.0394 -0.0590 -0.0936 1062 ARG A CZ  
1993 N  NH1 . ARG A  288 ? 2.0957 2.6123 2.1757 -0.0383 -0.0569 -0.0872 1062 ARG A NH1 
1994 N  NH2 . ARG A  288 ? 2.0970 2.6367 2.1716 -0.0432 -0.0585 -0.0844 1062 ARG A NH2 
1995 N  N   . HIS A  289 ? 1.6005 2.2275 1.6890 -0.0339 -0.0699 -0.1761 1063 HIS A N   
1996 C  CA  . HIS A  289 ? 1.5822 2.2468 1.6729 -0.0373 -0.0718 -0.1844 1063 HIS A CA  
1997 C  C   . HIS A  289 ? 1.6269 2.2922 1.7172 -0.0324 -0.0723 -0.2030 1063 HIS A C   
1998 O  O   . HIS A  289 ? 1.6053 2.2976 1.6953 -0.0333 -0.0740 -0.2092 1063 HIS A O   
1999 C  CB  . HIS A  289 ? 1.5835 2.2662 1.6789 -0.0423 -0.0715 -0.1848 1063 HIS A CB  
2000 N  N   . GLY A  290 ? 1.5995 2.2356 1.6902 -0.0271 -0.0706 -0.2112 1064 GLY A N   
2001 C  CA  . GLY A  290 ? 1.6007 2.2306 1.6914 -0.0210 -0.0703 -0.2280 1064 GLY A CA  
2002 C  C   . GLY A  290 ? 1.6511 2.2818 1.7379 -0.0165 -0.0713 -0.2279 1064 GLY A C   
2003 O  O   . GLY A  290 ? 1.6428 2.2887 1.7298 -0.0134 -0.0720 -0.2403 1064 GLY A O   
2004 N  N   . PHE A  291 ? 1.6126 2.2281 1.6958 -0.0165 -0.0713 -0.2139 1065 PHE A N   
2005 C  CA  . PHE A  291 ? 1.6123 2.2293 1.6911 -0.0138 -0.0723 -0.2115 1065 PHE A CA  
2006 C  C   . PHE A  291 ? 1.6544 2.3075 1.7323 -0.0196 -0.0744 -0.2071 1065 PHE A C   
2007 O  O   . PHE A  291 ? 1.6456 2.3114 1.7207 -0.0177 -0.0757 -0.2104 1065 PHE A O   
2008 C  CB  . PHE A  291 ? 1.6451 2.2330 1.7202 -0.0129 -0.0710 -0.1987 1065 PHE A CB  
2009 N  N   . ASP A  292 ? 1.6068 2.2775 1.6870 -0.0267 -0.0749 -0.1995 1066 ASP A N   
2010 C  CA  . ASP A  292 ? 1.5924 2.2990 1.6725 -0.0329 -0.0769 -0.1941 1066 ASP A CA  
2011 C  C   . ASP A  292 ? 1.6316 2.3685 1.7140 -0.0321 -0.0784 -0.2100 1066 ASP A C   
2012 O  O   . ASP A  292 ? 1.6225 2.3844 1.7030 -0.0336 -0.0802 -0.2109 1066 ASP A O   
2013 C  CB  . ASP A  292 ? 1.6098 2.3255 1.6924 -0.0397 -0.0765 -0.1807 1066 ASP A CB  
2014 C  CG  . ASP A  292 ? 1.7238 2.4546 1.8041 -0.0454 -0.0772 -0.1650 1066 ASP A CG  
2015 O  OD1 . ASP A  292 ? 1.7409 2.4511 1.8170 -0.0447 -0.0763 -0.1562 1066 ASP A OD1 
2016 O  OD2 . ASP A  292 ? 1.7783 2.5414 1.8610 -0.0508 -0.0785 -0.1612 1066 ASP A OD2 
2017 N  N   . ILE A  293 ? 1.5787 2.3129 1.6649 -0.0301 -0.0774 -0.2231 1067 ILE A N   
2018 C  CA  . ILE A  293 ? 1.5603 2.3195 1.6490 -0.0291 -0.0780 -0.2404 1067 ILE A CA  
2019 C  C   . ILE A  293 ? 1.6043 2.3559 1.6907 -0.0209 -0.0779 -0.2515 1067 ILE A C   
2020 O  O   . ILE A  293 ? 1.5914 2.3704 1.6780 -0.0203 -0.0791 -0.2610 1067 ILE A O   
2021 C  CB  . ILE A  293 ? 1.5984 2.3524 1.6915 -0.0298 -0.0763 -0.2510 1067 ILE A CB  
2022 N  N   . LEU A  294 ? 1.5660 2.2817 1.6504 -0.0146 -0.0764 -0.2497 1068 LEU A N   
2023 C  CA  . LEU A  294 ? 1.5651 2.2697 1.6474 -0.0059 -0.0759 -0.2578 1068 LEU A CA  
2024 C  C   . LEU A  294 ? 1.6200 2.3415 1.6978 -0.0069 -0.0780 -0.2502 1068 LEU A C   
2025 O  O   . LEU A  294 ? 1.6135 2.3470 1.6903 -0.0016 -0.0785 -0.2594 1068 LEU A O   
2026 C  CB  . LEU A  294 ? 1.5763 2.2388 1.6579 0.0001  -0.0737 -0.2557 1068 LEU A CB  
2027 C  CG  . LEU A  294 ? 1.6330 2.2796 1.7135 0.0104  -0.0726 -0.2647 1068 LEU A CG  
2028 C  CD1 . LEU A  294 ? 1.6299 2.2822 1.7145 0.0155  -0.0711 -0.2832 1068 LEU A CD1 
2029 C  CD2 . LEU A  294 ? 1.6660 2.2739 1.7455 0.0146  -0.0708 -0.2584 1068 LEU A CD2 
2030 N  N   . VAL A  295 ? 1.5795 2.3027 1.6547 -0.0137 -0.0789 -0.2335 1069 VAL A N   
2031 C  CA  . VAL A  295 ? 1.5733 2.3125 1.6439 -0.0167 -0.0806 -0.2250 1069 VAL A CA  
2032 C  C   . VAL A  295 ? 1.6153 2.3972 1.6869 -0.0203 -0.0829 -0.2306 1069 VAL A C   
2033 O  O   . VAL A  295 ? 1.5983 2.3965 1.6669 -0.0187 -0.0843 -0.2332 1069 VAL A O   
2034 C  CB  . VAL A  295 ? 1.6247 2.3524 1.6926 -0.0234 -0.0803 -0.2061 1069 VAL A CB  
2035 N  N   . GLY A  296 ? 1.5790 2.3795 1.6547 -0.0252 -0.0833 -0.2328 1070 GLY A N   
2036 C  CA  . GLY A  296 ? 1.5663 2.4088 1.6439 -0.0292 -0.0853 -0.2391 1070 GLY A CA  
2037 C  C   . GLY A  296 ? 1.6146 2.4676 1.6934 -0.0219 -0.0851 -0.2584 1070 GLY A C   
2038 O  O   . GLY A  296 ? 1.5983 2.4815 1.6760 -0.0224 -0.0870 -0.2628 1070 GLY A O   
2039 N  N   . GLN A  297 ? 1.5767 2.4036 1.6579 -0.0149 -0.0827 -0.2699 1071 GLN A N   
2040 C  CA  . GLN A  297 ? 1.5697 2.3985 1.6526 -0.0064 -0.0815 -0.2886 1071 GLN A CA  
2041 C  C   . GLN A  297 ? 1.6240 2.4472 1.7030 0.0010  -0.0819 -0.2886 1071 GLN A C   
2042 O  O   . GLN A  297 ? 1.6164 2.4553 1.6961 0.0069  -0.0817 -0.3016 1071 GLN A O   
2043 C  CB  . GLN A  297 ? 1.5936 2.3909 1.6799 -0.0014 -0.0784 -0.2980 1071 GLN A CB  
2044 C  CG  . GLN A  297 ? 1.7563 2.5665 1.8470 -0.0074 -0.0776 -0.3055 1071 GLN A CG  
2045 C  CD  . GLN A  297 ? 2.0207 2.7959 2.1138 -0.0047 -0.0747 -0.3098 1071 GLN A CD  
2046 O  OE1 . GLN A  297 ? 1.9648 2.7217 2.0577 -0.0087 -0.0745 -0.2979 1071 GLN A OE1 
2047 N  NE2 . GLN A  297 ? 1.9337 2.6984 2.0291 0.0022  -0.0721 -0.3269 1071 GLN A NE2 
2048 N  N   . ILE A  298 ? 1.5858 2.3875 1.6608 0.0006  -0.0821 -0.2743 1072 ILE A N   
2049 C  CA  . ILE A  298 ? 1.5855 2.3821 1.6561 0.0063  -0.0824 -0.2722 1072 ILE A CA  
2050 C  C   . ILE A  298 ? 1.6171 2.4518 1.6848 0.0019  -0.0852 -0.2698 1072 ILE A C   
2051 O  O   . ILE A  298 ? 1.6093 2.4579 1.6761 0.0083  -0.0855 -0.2786 1072 ILE A O   
2052 C  CB  . ILE A  298 ? 1.6375 2.4012 1.7046 0.0056  -0.0816 -0.2580 1072 ILE A CB  
2053 N  N   . ASP A  299 ? 1.5605 2.4130 1.6271 -0.0088 -0.0870 -0.2578 1073 ASP A N   
2054 C  CA  . ASP A  299 ? 1.5434 2.4329 1.6073 -0.0149 -0.0897 -0.2534 1073 ASP A CA  
2055 C  C   . ASP A  299 ? 1.5738 2.4993 1.6408 -0.0131 -0.0908 -0.2684 1073 ASP A C   
2056 O  O   . ASP A  299 ? 1.5566 2.5099 1.6211 -0.0134 -0.0927 -0.2701 1073 ASP A O   
2057 C  CB  . ASP A  299 ? 1.5623 2.4597 1.6255 -0.0264 -0.0908 -0.2368 1073 ASP A CB  
2058 C  CG  . ASP A  299 ? 1.6723 2.5456 1.7306 -0.0298 -0.0901 -0.2209 1073 ASP A CG  
2059 O  OD1 . ASP A  299 ? 1.6694 2.5544 1.7229 -0.0320 -0.0913 -0.2159 1073 ASP A OD1 
2060 O  OD2 . ASP A  299 ? 1.7541 2.5978 1.8133 -0.0306 -0.0883 -0.2135 1073 ASP A OD2 
2061 N  N   . ASP A  300 ? 1.5247 2.4502 1.5970 -0.0116 -0.0895 -0.2797 1074 ASP A N   
2062 C  CA  . ASP A  300 ? 1.5064 2.4633 1.5822 -0.0098 -0.0898 -0.2961 1074 ASP A CA  
2063 C  C   . ASP A  300 ? 1.5422 2.4966 1.6175 0.0018  -0.0886 -0.3102 1074 ASP A C   
2064 O  O   . ASP A  300 ? 1.5245 2.5118 1.6000 0.0032  -0.0898 -0.3189 1074 ASP A O   
2065 C  CB  . ASP A  300 ? 1.5280 2.4798 1.6091 -0.0115 -0.0880 -0.3047 1074 ASP A CB  
2066 N  N   . ALA A  301 ? 1.4993 2.4157 1.5743 0.0104  -0.0862 -0.3116 1075 ALA A N   
2067 C  CA  . ALA A  301 ? 1.6996 2.6085 1.7746 0.0227  -0.0845 -0.3229 1075 ALA A CA  
2068 C  C   . ALA A  301 ? 1.6315 2.5535 1.7011 0.0238  -0.0866 -0.3148 1075 ALA A C   
2069 O  O   . ALA A  301 ? 0.9770 1.9104 1.0463 0.0325  -0.0861 -0.3240 1075 ALA A O   
2070 C  CB  . ALA A  301 ? 1.7240 2.5882 1.8003 0.0305  -0.0813 -0.3244 1075 ALA A CB  
2071 N  N   . ALA A  317 ? 1.8385 2.6198 1.9318 0.0630  -0.0663 -0.3796 1091 ALA A N   
2072 C  CA  . ALA A  317 ? 1.8477 2.5872 1.9406 0.0683  -0.0645 -0.3719 1091 ALA A CA  
2073 C  C   . ALA A  317 ? 1.8993 2.6112 1.9963 0.0669  -0.0612 -0.3790 1091 ALA A C   
2074 O  O   . ALA A  317 ? 1.9052 2.5889 2.0014 0.0643  -0.0610 -0.3687 1091 ALA A O   
2075 C  CB  . ALA A  317 ? 1.8621 2.5905 1.9549 0.0825  -0.0625 -0.3752 1091 ALA A CB  
2076 N  N   . GLU A  318 ? 1.8476 2.5681 1.9488 0.0681  -0.0584 -0.3970 1092 GLU A N   
2077 C  CA  . GLU A  318 ? 1.8523 2.5499 1.9573 0.0657  -0.0549 -0.4061 1092 GLU A CA  
2078 C  C   . GLU A  318 ? 1.8907 2.6005 1.9955 0.0511  -0.0571 -0.4005 1092 GLU A C   
2079 O  O   . GLU A  318 ? 1.8927 2.5814 1.9997 0.0472  -0.0549 -0.4034 1092 GLU A O   
2080 C  CB  . GLU A  318 ? 1.8684 2.5703 1.9779 0.0721  -0.0505 -0.4282 1092 GLU A CB  
2081 N  N   . GLN A  319 ? 1.8257 2.5698 1.9279 0.0430  -0.0613 -0.3920 1093 GLN A N   
2082 C  CA  . GLN A  319 ? 1.8088 2.5689 1.9109 0.0297  -0.0637 -0.3841 1093 GLN A CA  
2083 C  C   . GLN A  319 ? 1.8414 2.5778 1.9407 0.0263  -0.0654 -0.3643 1093 GLN A C   
2084 O  O   . GLN A  319 ? 1.8351 2.5632 1.9356 0.0188  -0.0652 -0.3598 1093 GLN A O   
2085 C  CB  . GLN A  319 ? 1.8107 2.6172 1.9115 0.0233  -0.0672 -0.3826 1093 GLN A CB  
2086 N  N   . LEU A  320 ? 1.7854 2.5118 1.8809 0.0316  -0.0669 -0.3527 1094 LEU A N   
2087 C  CA  . LEU A  320 ? 1.7801 2.4830 1.8727 0.0292  -0.0681 -0.3346 1094 LEU A CA  
2088 C  C   . LEU A  320 ? 1.8168 2.4770 1.9108 0.0353  -0.0649 -0.3357 1094 LEU A C   
2089 O  O   . LEU A  320 ? 1.8218 2.4609 1.9145 0.0318  -0.0653 -0.3233 1094 LEU A O   
2090 C  CB  . LEU A  320 ? 1.7791 2.4903 1.8668 0.0309  -0.0706 -0.3226 1094 LEU A CB  
2091 N  N   . LYS A  321 ? 1.7555 2.4029 1.8523 0.0445  -0.0617 -0.3504 1095 LYS A N   
2092 C  CA  . LYS A  321 ? 1.7572 2.3649 1.8560 0.0508  -0.0583 -0.3530 1095 LYS A CA  
2093 C  C   . LYS A  321 ? 1.7916 2.3889 1.8933 0.0431  -0.0566 -0.3572 1095 LYS A C   
2094 O  O   . LYS A  321 ? 1.7962 2.3609 1.8987 0.0445  -0.0547 -0.3541 1095 LYS A O   
2095 C  CB  . LYS A  321 ? 1.7913 2.3907 1.8925 0.0632  -0.0549 -0.3673 1095 LYS A CB  
2096 N  N   . THR A  322 ? 1.7248 2.3517 1.8281 0.0346  -0.0574 -0.3642 1096 THR A N   
2097 C  CA  . THR A  322 ? 1.7175 2.3425 1.8233 0.0258  -0.0562 -0.3686 1096 THR A CA  
2098 C  C   . THR A  322 ? 1.7601 2.3804 1.8640 0.0176  -0.0586 -0.3504 1096 THR A C   
2099 O  O   . THR A  322 ? 1.7567 2.3578 1.8620 0.0138  -0.0571 -0.3495 1096 THR A O   
2100 C  CB  . THR A  322 ? 1.8003 2.4626 1.9082 0.0196  -0.0563 -0.3818 1096 THR A CB  
2101 N  N   . THR A  323 ? 1.7090 2.3466 1.8096 0.0150  -0.0621 -0.3361 1097 THR A N   
2102 C  CA  . THR A  323 ? 1.7062 2.3405 1.8048 0.0080  -0.0642 -0.3179 1097 THR A CA  
2103 C  C   . THR A  323 ? 1.7755 2.3701 1.8724 0.0130  -0.0631 -0.3083 1097 THR A C   
2104 O  O   . THR A  323 ? 1.7737 2.3532 1.8709 0.0084  -0.0628 -0.2997 1097 THR A O   
2105 C  CB  . THR A  323 ? 1.7593 2.4238 1.8550 0.0039  -0.0677 -0.3071 1097 THR A CB  
2106 O  OG1 . THR A  323 ? 1.7342 2.4357 1.8318 -0.0002 -0.0685 -0.3174 1097 THR A OG1 
2107 C  CG2 . THR A  323 ? 1.7276 2.3915 1.8218 -0.0037 -0.0693 -0.2887 1097 THR A CG2 
2108 N  N   . ARG A  324 ? 1.7422 2.3215 1.8376 0.0226  -0.0624 -0.3098 1098 ARG A N   
2109 C  CA  . ARG A  324 ? 1.7527 2.2965 1.8465 0.0282  -0.0613 -0.3015 1098 ARG A CA  
2110 C  C   . ARG A  324 ? 1.8127 2.3268 1.9097 0.0308  -0.0580 -0.3091 1098 ARG A C   
2111 O  O   . ARG A  324 ? 1.8210 2.3054 1.9172 0.0341  -0.0571 -0.3016 1098 ARG A O   
2112 C  CB  . ARG A  324 ? 1.7525 2.2937 1.8439 0.0377  -0.0615 -0.3015 1098 ARG A CB  
2113 N  N   . ASN A  325 ? 1.7616 2.2843 1.8622 0.0287  -0.0562 -0.3240 1099 ASN A N   
2114 C  CA  . ASN A  325 ? 1.7642 2.2617 1.8681 0.0298  -0.0527 -0.3335 1099 ASN A CA  
2115 C  C   . ASN A  325 ? 1.8008 2.3051 1.9064 0.0187  -0.0526 -0.3338 1099 ASN A C   
2116 O  O   . ASN A  325 ? 1.7993 2.2841 1.9073 0.0177  -0.0498 -0.3415 1099 ASN A O   
2117 C  CB  . ASN A  325 ? 1.7707 2.2696 1.8774 0.0366  -0.0497 -0.3522 1099 ASN A CB  
2118 N  N   . ALA A  326 ? 1.7391 2.2708 1.8434 0.0104  -0.0556 -0.3249 1100 ALA A N   
2119 C  CA  . ALA A  326 ? 1.7231 2.2680 1.8292 0.0000  -0.0558 -0.3241 1100 ALA A CA  
2120 C  C   . ALA A  326 ? 1.7458 2.2983 1.8499 -0.0060 -0.0585 -0.3051 1100 ALA A C   
2121 O  O   . ALA A  326 ? 1.7371 2.2872 1.8425 -0.0125 -0.0580 -0.3008 1100 ALA A O   
2122 C  CB  . ALA A  326 ? 1.7203 2.3002 1.8284 -0.0049 -0.0558 -0.3379 1100 ALA A CB  
2123 N  N   . TYR A  327 ? 1.6854 2.2475 1.7864 -0.0041 -0.0609 -0.2939 1101 TYR A N   
2124 C  CA  . TYR A  327 ? 1.6743 2.2429 1.7734 -0.0092 -0.0630 -0.2754 1101 TYR A CA  
2125 C  C   . TYR A  327 ? 1.7188 2.2576 1.8147 -0.0045 -0.0629 -0.2623 1101 TYR A C   
2126 O  O   . TYR A  327 ? 1.7085 2.2459 1.8031 -0.0085 -0.0637 -0.2473 1101 TYR A O   
2127 C  CB  . TYR A  327 ? 1.6762 2.2812 1.7741 -0.0127 -0.0656 -0.2716 1101 TYR A CB  
2128 N  N   . ILE A  328 ? 1.6778 2.1937 1.7727 0.0040  -0.0617 -0.2676 1102 ILE A N   
2129 C  CA  . ILE A  328 ? 1.6808 2.1705 1.7727 0.0085  -0.0616 -0.2563 1102 ILE A CA  
2130 C  C   . ILE A  328 ? 1.7331 2.1881 1.8259 0.0153  -0.0591 -0.2612 1102 ILE A C   
2131 O  O   . ILE A  328 ? 1.7377 2.1698 1.8286 0.0173  -0.0588 -0.2509 1102 ILE A O   
2132 C  CB  . ILE A  328 ? 1.7161 2.2182 1.8044 0.0119  -0.0633 -0.2526 1102 ILE A CB  
2133 N  N   . GLN A  329 ? 1.6828 2.1339 1.7787 0.0188  -0.0572 -0.2766 1103 GLN A N   
2134 C  CA  . GLN A  329 ? 1.6884 2.1072 1.7857 0.0255  -0.0546 -0.2818 1103 GLN A CA  
2135 C  C   . GLN A  329 ? 1.7473 2.1422 1.8454 0.0219  -0.0534 -0.2750 1103 GLN A C   
2136 O  O   . GLN A  329 ? 1.7526 2.1193 1.8503 0.0272  -0.0521 -0.2713 1103 GLN A O   
2137 C  CB  . GLN A  329 ? 1.7028 2.1237 1.8036 0.0291  -0.0522 -0.3001 1103 GLN A CB  
2138 N  N   . LYS A  330 ? 1.7004 2.1078 1.7996 0.0129  -0.0539 -0.2729 1104 LYS A N   
2139 C  CA  . LYS A  330 ? 1.7045 2.0939 1.8046 0.0086  -0.0530 -0.2664 1104 LYS A CA  
2140 C  C   . LYS A  330 ? 1.7627 2.1376 1.8598 0.0094  -0.0540 -0.2493 1104 LYS A C   
2141 O  O   . LYS A  330 ? 1.7679 2.1162 1.8651 0.0112  -0.0526 -0.2452 1104 LYS A O   
2142 C  CB  . LYS A  330 ? 1.7251 2.1364 1.8273 -0.0011 -0.0533 -0.2684 1104 LYS A CB  
2143 N  N   . TYR A  331 ? 1.7125 2.1047 1.8069 0.0079  -0.0560 -0.2397 1105 TYR A N   
2144 C  CA  . TYR A  331 ? 1.7133 2.0947 1.8046 0.0079  -0.0566 -0.2240 1105 TYR A CA  
2145 C  C   . TYR A  331 ? 1.7649 2.1242 1.8538 0.0156  -0.0561 -0.2221 1105 TYR A C   
2146 O  O   . TYR A  331 ? 1.7666 2.1083 1.8534 0.0160  -0.0557 -0.2112 1105 TYR A O   
2147 C  CB  . TYR A  331 ? 1.7222 2.1297 1.8115 0.0033  -0.0585 -0.2153 1105 TYR A CB  
2148 C  CG  . TYR A  331 ? 1.7404 2.1689 1.8321 -0.0045 -0.0590 -0.2127 1105 TYR A CG  
2149 C  CD1 . TYR A  331 ? 1.7688 2.1913 1.8605 -0.0085 -0.0585 -0.1999 1105 TYR A CD1 
2150 C  CD2 . TYR A  331 ? 1.7421 2.1976 1.8361 -0.0077 -0.0598 -0.2231 1105 TYR A CD2 
2151 C  CE1 . TYR A  331 ? 1.7765 2.2196 1.8707 -0.0150 -0.0588 -0.1969 1105 TYR A CE1 
2152 C  CE2 . TYR A  331 ? 1.7468 2.2240 1.8432 -0.0150 -0.0602 -0.2205 1105 TYR A CE2 
2153 C  CZ  . TYR A  331 ? 1.8512 2.3223 1.9477 -0.0185 -0.0597 -0.2070 1105 TYR A CZ  
2154 O  OH  . TYR A  331 ? 1.8616 2.3555 1.9607 -0.0251 -0.0600 -0.2035 1105 TYR A OH  
2155 N  N   . LEU A  332 ? 1.7147 2.0761 1.8039 0.0219  -0.0559 -0.2324 1106 LEU A N   
2156 C  CA  . LEU A  332 ? 1.9207 2.2652 2.0080 0.0300  -0.0553 -0.2313 1106 LEU A CA  
2157 C  C   . LEU A  332 ? 1.9979 2.3295 2.0882 0.0370  -0.0534 -0.2440 1106 LEU A C   
2158 O  O   . LEU A  332 ? 1.3969 1.7060 1.4871 0.0434  -0.0521 -0.2424 1106 LEU A O   
2159 C  CB  . LEU A  332 ? 1.9150 2.2788 1.9989 0.0315  -0.0571 -0.2285 1106 LEU A CB  
2160 N  N   . LEU A  337 ? 1.4845 1.6525 1.5678 0.0355  -0.0470 -0.1740 225  LEU A N   
2161 C  CA  . LEU A  337 ? 1.4789 1.6448 1.5626 0.0291  -0.0467 -0.1679 225  LEU A CA  
2162 C  C   . LEU A  337 ? 1.5202 1.6628 1.6047 0.0300  -0.0453 -0.1629 225  LEU A C   
2163 O  O   . LEU A  337 ? 1.5195 1.6507 1.6020 0.0337  -0.0448 -0.1579 225  LEU A O   
2164 C  CB  . LEU A  337 ? 1.4762 1.6545 1.5567 0.0250  -0.0471 -0.1590 225  LEU A CB  
2165 N  N   . SER A  338 ? 1.4607 1.5980 1.5480 0.0263  -0.0448 -0.1645 226  SER A N   
2166 C  CA  . SER A  338 ? 1.4528 1.5696 1.5412 0.0262  -0.0436 -0.1606 226  SER A CA  
2167 C  C   . SER A  338 ? 1.4592 1.5721 1.5455 0.0232  -0.0431 -0.1490 226  SER A C   
2168 O  O   . SER A  338 ? 1.4513 1.5475 1.5371 0.0251  -0.0422 -0.1440 226  SER A O   
2169 C  CB  . SER A  338 ? 1.5066 1.6207 1.5986 0.0227  -0.0430 -0.1675 226  SER A CB  
2170 O  OG  . SER A  338 ? 1.6304 1.7621 1.7230 0.0163  -0.0436 -0.1672 226  SER A OG  
2171 N  N   . SER A  339 ? 1.3880 1.5164 1.4733 0.0188  -0.0434 -0.1446 227  SER A N   
2172 C  CA  . SER A  339 ? 1.3790 1.5053 1.4625 0.0161  -0.0424 -0.1336 227  SER A CA  
2173 C  C   . SER A  339 ? 1.3866 1.5024 1.4666 0.0193  -0.0416 -0.1278 227  SER A C   
2174 O  O   . SER A  339 ? 1.3807 1.4876 1.4594 0.0182  -0.0402 -0.1198 227  SER A O   
2175 C  CB  . SER A  339 ? 1.4318 1.5781 1.5149 0.0121  -0.0427 -0.1304 227  SER A CB  
2176 O  OG  . SER A  339 ? 1.5592 1.7177 1.6456 0.0084  -0.0433 -0.1348 227  SER A OG  
2177 N  N   . HIS A  340 ? 1.3058 1.4239 1.3843 0.0232  -0.0424 -0.1323 228  HIS A N   
2178 C  CA  . HIS A  340 ? 1.2881 1.4005 1.3632 0.0263  -0.0419 -0.1291 228  HIS A CA  
2179 C  C   . HIS A  340 ? 1.2543 1.3483 1.3303 0.0305  -0.0414 -0.1291 228  HIS A C   
2180 O  O   . HIS A  340 ? 1.2414 1.3274 1.3149 0.0315  -0.0404 -0.1234 228  HIS A O   
2181 C  CB  . HIS A  340 ? 1.3043 1.4303 1.3782 0.0290  -0.0432 -0.1351 228  HIS A CB  
2182 C  CG  . HIS A  340 ? 1.3491 1.4929 1.4204 0.0255  -0.0437 -0.1331 228  HIS A CG  
2183 N  ND1 . HIS A  340 ? 1.3699 1.5225 1.4418 0.0202  -0.0434 -0.1291 228  HIS A ND1 
2184 C  CD2 . HIS A  340 ? 1.3737 1.5289 1.4421 0.0267  -0.0444 -0.1347 228  HIS A CD2 
2185 C  CE1 . HIS A  340 ? 1.3617 1.5293 1.4310 0.0183  -0.0438 -0.1280 228  HIS A CE1 
2186 N  NE2 . HIS A  340 ? 1.3671 1.5370 1.4341 0.0218  -0.0445 -0.1317 228  HIS A NE2 
2187 N  N   . LYS A  341 ? 1.1602 1.2483 1.2398 0.0329  -0.0418 -0.1357 229  LYS A N   
2188 C  CA  . LYS A  341 ? 1.1393 1.2099 1.2206 0.0370  -0.0412 -0.1358 229  LYS A CA  
2189 C  C   . LYS A  341 ? 1.1275 1.1850 1.2096 0.0339  -0.0401 -0.1296 229  LYS A C   
2190 O  O   . LYS A  341 ? 1.1175 1.1619 1.1993 0.0364  -0.0394 -0.1255 229  LYS A O   
2191 C  CB  . LYS A  341 ? 1.1758 1.2438 1.2608 0.0401  -0.0414 -0.1453 229  LYS A CB  
2192 N  N   . LYS A  342 ? 1.0414 1.1040 1.1245 0.0285  -0.0401 -0.1288 230  LYS A N   
2193 C  CA  . LYS A  342 ? 1.0229 1.0762 1.1069 0.0252  -0.0391 -0.1229 230  LYS A CA  
2194 C  C   . LYS A  342 ? 1.0204 1.0719 1.1012 0.0243  -0.0379 -0.1136 230  LYS A C   
2195 O  O   . LYS A  342 ? 1.0264 1.0665 1.1072 0.0239  -0.0368 -0.1083 230  LYS A O   
2196 C  CB  . LYS A  342 ? 1.0573 1.1198 1.1436 0.0200  -0.0393 -0.1250 230  LYS A CB  
2197 N  N   . ALA A  343 ? 0.9159 0.9785 0.9938 0.0239  -0.0378 -0.1120 231  ALA A N   
2198 C  CA  . ALA A  343 ? 0.8797 0.9405 0.9541 0.0228  -0.0362 -0.1045 231  ALA A CA  
2199 C  C   . ALA A  343 ? 0.8919 0.9430 0.9642 0.0262  -0.0357 -0.1032 231  ALA A C   
2200 O  O   . ALA A  343 ? 0.9066 0.9488 0.9775 0.0254  -0.0341 -0.0974 231  ALA A O   
2201 C  CB  . ALA A  343 ? 0.8813 0.9566 0.9533 0.0208  -0.0361 -0.1039 231  ALA A CB  
2202 N  N   . ILE A  344 ? 0.8093 0.8627 0.8815 0.0303  -0.0370 -0.1085 232  ILE A N   
2203 C  CA  . ILE A  344 ? 0.8001 0.8470 0.8708 0.0342  -0.0367 -0.1072 232  ILE A CA  
2204 C  C   . ILE A  344 ? 0.8238 0.8554 0.8971 0.0359  -0.0363 -0.1050 232  ILE A C   
2205 O  O   . ILE A  344 ? 0.8155 0.8405 0.8871 0.0367  -0.0353 -0.1002 232  ILE A O   
2206 C  CB  . ILE A  344 ? 0.8467 0.9019 0.9172 0.0388  -0.0381 -0.1130 232  ILE A CB  
2207 C  CG1 . ILE A  344 ? 0.8666 0.9378 0.9335 0.0366  -0.0383 -0.1138 232  ILE A CG1 
2208 C  CG2 . ILE A  344 ? 0.8488 0.8972 0.9191 0.0441  -0.0379 -0.1115 232  ILE A CG2 
2209 C  CD1 . ILE A  344 ? 0.9856 1.0616 1.0474 0.0362  -0.0373 -0.1101 232  ILE A CD1 
2210 N  N   . GLY A  345 ? 0.7628 0.7896 0.8399 0.0358  -0.0370 -0.1086 233  GLY A N   
2211 C  CA  . GLY A  345 ? 0.7543 0.7666 0.8342 0.0365  -0.0366 -0.1068 233  GLY A CA  
2212 C  C   . GLY A  345 ? 0.7810 0.7875 0.8598 0.0330  -0.0353 -0.0994 233  GLY A C   
2213 O  O   . GLY A  345 ? 0.7888 0.7858 0.8675 0.0346  -0.0347 -0.0952 233  GLY A O   
2214 N  N   . MET A  346 ? 0.6943 0.7076 0.7722 0.0286  -0.0347 -0.0975 234  MET A N   
2215 C  CA  . MET A  346 ? 0.6839 0.6938 0.7608 0.0255  -0.0330 -0.0907 234  MET A CA  
2216 C  C   . MET A  346 ? 0.7617 0.7692 0.8349 0.0263  -0.0315 -0.0861 234  MET A C   
2217 O  O   . MET A  346 ? 0.7506 0.7496 0.8237 0.0262  -0.0304 -0.0816 234  MET A O   
2218 C  CB  . MET A  346 ? 0.7073 0.7274 0.7843 0.0218  -0.0326 -0.0897 234  MET A CB  
2219 C  CG  . MET A  346 ? 0.7542 0.7713 0.8305 0.0195  -0.0304 -0.0824 234  MET A CG  
2220 S  SD  . MET A  346 ? 0.8024 0.8326 0.8785 0.0164  -0.0292 -0.0795 234  MET A SD  
2221 C  CE  . MET A  346 ? 0.7584 0.7940 0.8303 0.0170  -0.0285 -0.0799 234  MET A CE  
2222 N  N   . ILE A  347 ? 0.7242 0.7403 0.7943 0.0268  -0.0314 -0.0876 235  ILE A N   
2223 C  CA  . ILE A  347 ? 0.7120 0.7282 0.7780 0.0266  -0.0297 -0.0846 235  ILE A CA  
2224 C  C   . ILE A  347 ? 0.7931 0.8017 0.8594 0.0297  -0.0299 -0.0832 235  ILE A C   
2225 O  O   . ILE A  347 ? 0.7997 0.8034 0.8642 0.0284  -0.0281 -0.0788 235  ILE A O   
2226 C  CB  . ILE A  347 ? 0.7401 0.7682 0.8030 0.0263  -0.0300 -0.0874 235  ILE A CB  
2227 C  CG1 . ILE A  347 ? 0.7416 0.7764 0.8036 0.0224  -0.0289 -0.0861 235  ILE A CG1 
2228 C  CG2 . ILE A  347 ? 0.7311 0.7603 0.7897 0.0262  -0.0286 -0.0858 235  ILE A CG2 
2229 C  CD1 . ILE A  347 ? 0.7932 0.8408 0.8526 0.0213  -0.0294 -0.0889 235  ILE A CD1 
2230 N  N   . MET A  348 ? 0.7750 0.7826 0.8437 0.0339  -0.0318 -0.0867 236  MET A N   
2231 C  CA  . MET A  348 ? 0.8028 0.8043 0.8722 0.0376  -0.0320 -0.0847 236  MET A CA  
2232 C  C   . MET A  348 ? 0.8087 0.7985 0.8803 0.0368  -0.0314 -0.0803 236  MET A C   
2233 O  O   . MET A  348 ? 0.8130 0.8000 0.8834 0.0374  -0.0305 -0.0760 236  MET A O   
2234 C  CB  . MET A  348 ? 0.8586 0.8610 0.9307 0.0431  -0.0338 -0.0893 236  MET A CB  
2235 C  CG  . MET A  348 ? 0.9395 0.9547 1.0097 0.0445  -0.0345 -0.0940 236  MET A CG  
2236 S  SD  . MET A  348 ? 1.0360 1.0598 1.1030 0.0485  -0.0344 -0.0925 236  MET A SD  
2237 C  CE  . MET A  348 ? 1.0012 1.0190 1.0732 0.0566  -0.0355 -0.0946 236  MET A CE  
2238 N  N   . VAL A  349 ? 0.7092 0.6937 0.7841 0.0351  -0.0320 -0.0815 237  VAL A N   
2239 C  CA  . VAL A  349 ? 0.6797 0.6540 0.7568 0.0337  -0.0316 -0.0775 237  VAL A CA  
2240 C  C   . VAL A  349 ? 0.6853 0.6596 0.7600 0.0301  -0.0295 -0.0721 237  VAL A C   
2241 O  O   . VAL A  349 ? 0.6702 0.6393 0.7447 0.0302  -0.0287 -0.0677 237  VAL A O   
2242 C  CB  . VAL A  349 ? 0.7155 0.6851 0.7964 0.0324  -0.0326 -0.0808 237  VAL A CB  
2243 C  CG1 . VAL A  349 ? 0.7105 0.6704 0.7934 0.0304  -0.0322 -0.0763 237  VAL A CG1 
2244 C  CG2 . VAL A  349 ? 0.7114 0.6793 0.7947 0.0363  -0.0339 -0.0866 237  VAL A CG2 
2245 N  N   . VAL A  350 ? 0.6074 0.5878 0.6804 0.0271  -0.0285 -0.0724 238  VAL A N   
2246 C  CA  . VAL A  350 ? 0.5822 0.5623 0.6532 0.0242  -0.0259 -0.0677 238  VAL A CA  
2247 C  C   . VAL A  350 ? 0.6285 0.6089 0.6956 0.0243  -0.0240 -0.0655 238  VAL A C   
2248 O  O   . VAL A  350 ? 0.6368 0.6129 0.7032 0.0230  -0.0221 -0.0615 238  VAL A O   
2249 C  CB  . VAL A  350 ? 0.6154 0.6022 0.6859 0.0218  -0.0251 -0.0681 238  VAL A CB  
2250 C  CG1 . VAL A  350 ? 0.6136 0.5992 0.6819 0.0197  -0.0217 -0.0633 238  VAL A CG1 
2251 C  CG2 . VAL A  350 ? 0.6125 0.6005 0.6869 0.0208  -0.0266 -0.0696 238  VAL A CG2 
2252 N  N   . THR A  351 ? 0.5588 0.5454 0.6235 0.0256  -0.0245 -0.0684 239  THR A N   
2253 C  CA  . THR A  351 ? 0.5592 0.5487 0.6200 0.0250  -0.0228 -0.0673 239  THR A CA  
2254 C  C   . THR A  351 ? 0.6365 0.6217 0.6983 0.0270  -0.0232 -0.0644 239  THR A C   
2255 O  O   . THR A  351 ? 0.6472 0.6321 0.7066 0.0250  -0.0210 -0.0617 239  THR A O   
2256 C  CB  . THR A  351 ? 0.6747 0.6738 0.7328 0.0257  -0.0235 -0.0712 239  THR A CB  
2257 O  OG1 . THR A  351 ? 0.6854 0.6883 0.7424 0.0230  -0.0227 -0.0726 239  THR A OG1 
2258 C  CG2 . THR A  351 ? 0.6549 0.6590 0.7086 0.0244  -0.0218 -0.0705 239  THR A CG2 
2259 N  N   . ALA A  352 ? 0.5769 0.5588 0.6425 0.0308  -0.0257 -0.0650 240  ALA A N   
2260 C  CA  . ALA A  352 ? 0.5750 0.5522 0.6425 0.0332  -0.0263 -0.0614 240  ALA A CA  
2261 C  C   . ALA A  352 ? 0.6432 0.6132 0.7120 0.0305  -0.0252 -0.0572 240  ALA A C   
2262 O  O   . ALA A  352 ? 0.6501 0.6197 0.7180 0.0300  -0.0241 -0.0533 240  ALA A O   
2263 C  CB  . ALA A  352 ? 0.5860 0.5595 0.6574 0.0378  -0.0287 -0.0632 240  ALA A CB  
2264 N  N   . ALA A  353 ? 0.6025 0.5686 0.6732 0.0286  -0.0254 -0.0580 241  ALA A N   
2265 C  CA  . ALA A  353 ? 0.6063 0.5672 0.6782 0.0260  -0.0243 -0.0541 241  ALA A CA  
2266 C  C   . ALA A  353 ? 0.6619 0.6256 0.7303 0.0236  -0.0212 -0.0517 241  ALA A C   
2267 O  O   . ALA A  353 ? 0.6921 0.6532 0.7607 0.0228  -0.0202 -0.0479 241  ALA A O   
2268 C  CB  . ALA A  353 ? 0.6155 0.5756 0.6895 0.0242  -0.0248 -0.0558 241  ALA A CB  
2269 N  N   . PHE A  354 ? 0.5677 0.5364 0.6326 0.0223  -0.0195 -0.0540 242  PHE A N   
2270 C  CA  . PHE A  354 ? 0.5582 0.5280 0.6195 0.0197  -0.0158 -0.0526 242  PHE A CA  
2271 C  C   . PHE A  354 ? 0.6525 0.6256 0.7113 0.0195  -0.0150 -0.0519 242  PHE A C   
2272 O  O   . PHE A  354 ? 0.6728 0.6448 0.7303 0.0176  -0.0125 -0.0497 242  PHE A O   
2273 C  CB  . PHE A  354 ? 0.5667 0.5397 0.6253 0.0178  -0.0138 -0.0550 242  PHE A CB  
2274 C  CG  . PHE A  354 ? 0.5865 0.5567 0.6466 0.0168  -0.0122 -0.0531 242  PHE A CG  
2275 C  CD1 . PHE A  354 ? 0.6292 0.6006 0.6926 0.0178  -0.0146 -0.0537 242  PHE A CD1 
2276 C  CD2 . PHE A  354 ? 0.6110 0.5784 0.6693 0.0149  -0.0080 -0.0509 242  PHE A CD2 
2277 C  CE1 . PHE A  354 ? 0.6300 0.6015 0.6950 0.0170  -0.0131 -0.0513 242  PHE A CE1 
2278 C  CE2 . PHE A  354 ? 0.6381 0.6040 0.6982 0.0149  -0.0063 -0.0483 242  PHE A CE2 
2279 C  CZ  . PHE A  354 ? 0.6000 0.5689 0.6634 0.0160  -0.0090 -0.0481 242  PHE A CZ  
2280 N  N   . LEU A  355 ? 0.6028 0.5813 0.6610 0.0217  -0.0169 -0.0538 243  LEU A N   
2281 C  CA  . LEU A  355 ? 0.5906 0.5753 0.6463 0.0216  -0.0163 -0.0529 243  LEU A CA  
2282 C  C   . LEU A  355 ? 0.6414 0.6237 0.7000 0.0234  -0.0174 -0.0483 243  LEU A C   
2283 O  O   . LEU A  355 ? 0.6231 0.6089 0.6798 0.0215  -0.0155 -0.0461 243  LEU A O   
2284 C  CB  . LEU A  355 ? 0.5915 0.5847 0.6457 0.0237  -0.0178 -0.0558 243  LEU A CB  
2285 C  CG  . LEU A  355 ? 0.6569 0.6548 0.7074 0.0210  -0.0165 -0.0602 243  LEU A CG  
2286 C  CD1 . LEU A  355 ? 0.6570 0.6627 0.7075 0.0241  -0.0189 -0.0630 243  LEU A CD1 
2287 C  CD2 . LEU A  355 ? 0.6764 0.6786 0.7217 0.0159  -0.0127 -0.0611 243  LEU A CD2 
2288 N  N   . VAL A  356 ? 0.6291 0.6054 0.6922 0.0266  -0.0202 -0.0468 244  VAL A N   
2289 C  CA  . VAL A  356 ? 0.6230 0.5957 0.6894 0.0286  -0.0215 -0.0420 244  VAL A CA  
2290 C  C   . VAL A  356 ? 0.6713 0.6379 0.7393 0.0259  -0.0206 -0.0387 244  VAL A C   
2291 O  O   . VAL A  356 ? 0.6831 0.6511 0.7515 0.0254  -0.0202 -0.0344 244  VAL A O   
2292 C  CB  . VAL A  356 ? 0.6599 0.6281 0.7304 0.0331  -0.0245 -0.0424 244  VAL A CB  
2293 C  CG1 . VAL A  356 ? 0.6528 0.6160 0.7270 0.0352  -0.0256 -0.0368 244  VAL A CG1 
2294 C  CG2 . VAL A  356 ? 0.6538 0.6296 0.7228 0.0365  -0.0253 -0.0454 244  VAL A CG2 
2295 N  N   . SER A  357 ? 0.6161 0.5777 0.6851 0.0243  -0.0204 -0.0403 245  SER A N   
2296 C  CA  . SER A  357 ? 0.6140 0.5708 0.6849 0.0223  -0.0199 -0.0370 245  SER A CA  
2297 C  C   . SER A  357 ? 0.6896 0.6484 0.7577 0.0193  -0.0163 -0.0366 245  SER A C   
2298 O  O   . SER A  357 ? 0.6959 0.6559 0.7637 0.0180  -0.0149 -0.0333 245  SER A O   
2299 C  CB  . SER A  357 ? 0.6368 0.5879 0.7110 0.0223  -0.0218 -0.0383 245  SER A CB  
2300 O  OG  . SER A  357 ? 0.7682 0.7161 0.8445 0.0201  -0.0215 -0.0349 245  SER A OG  
2301 N  N   . PHE A  358 ? 0.6364 0.5957 0.7028 0.0184  -0.0147 -0.0397 246  PHE A N   
2302 C  CA  . PHE A  358 ? 0.6225 0.5818 0.6867 0.0163  -0.0108 -0.0393 246  PHE A CA  
2303 C  C   . PHE A  358 ? 0.6950 0.6579 0.7551 0.0145  -0.0075 -0.0405 246  PHE A C   
2304 O  O   . PHE A  358 ? 0.7095 0.6716 0.7686 0.0130  -0.0043 -0.0390 246  PHE A O   
2305 C  CB  . PHE A  358 ? 0.6303 0.5892 0.6945 0.0162  -0.0099 -0.0414 246  PHE A CB  
2306 C  CG  . PHE A  358 ? 0.6343 0.5920 0.7021 0.0172  -0.0130 -0.0414 246  PHE A CG  
2307 C  CD1 . PHE A  358 ? 0.6479 0.6032 0.7190 0.0169  -0.0144 -0.0384 246  PHE A CD1 
2308 C  CD2 . PHE A  358 ? 0.6477 0.6078 0.7156 0.0178  -0.0144 -0.0448 246  PHE A CD2 
2309 C  CE1 . PHE A  358 ? 0.6458 0.6007 0.7201 0.0169  -0.0169 -0.0392 246  PHE A CE1 
2310 C  CE2 . PHE A  358 ? 0.6784 0.6386 0.7497 0.0181  -0.0170 -0.0457 246  PHE A CE2 
2311 C  CZ  . PHE A  358 ? 0.6449 0.6024 0.7192 0.0174  -0.0181 -0.0431 246  PHE A CZ  
2312 N  N   . MET A  359 ? 0.6320 0.5995 0.6894 0.0144  -0.0078 -0.0435 247  MET A N   
2313 C  CA  . MET A  359 ? 0.6289 0.6009 0.6817 0.0116  -0.0043 -0.0456 247  MET A CA  
2314 C  C   . MET A  359 ? 0.6589 0.6355 0.7112 0.0105  -0.0037 -0.0433 247  MET A C   
2315 O  O   . MET A  359 ? 0.6612 0.6386 0.7107 0.0075  0.0003  -0.0444 247  MET A O   
2316 C  CB  . MET A  359 ? 0.6647 0.6423 0.7145 0.0111  -0.0048 -0.0495 247  MET A CB  
2317 C  CG  . MET A  359 ? 0.7335 0.7140 0.7781 0.0068  -0.0003 -0.0527 247  MET A CG  
2318 S  SD  . MET A  359 ? 0.8171 0.8080 0.8578 0.0053  -0.0010 -0.0567 247  MET A SD  
2319 C  CE  . MET A  359 ? 0.7809 0.7686 0.8225 0.0068  -0.0026 -0.0585 247  MET A CE  
2320 N  N   . PRO A  360 ? 0.5983 0.5785 0.6529 0.0127  -0.0070 -0.0403 248  PRO A N   
2321 C  CA  . PRO A  360 ? 0.5916 0.5781 0.6456 0.0113  -0.0061 -0.0375 248  PRO A CA  
2322 C  C   . PRO A  360 ? 0.6511 0.6342 0.7059 0.0096  -0.0037 -0.0354 248  PRO A C   
2323 O  O   . PRO A  360 ? 0.6428 0.6313 0.6949 0.0066  -0.0005 -0.0363 248  PRO A O   
2324 C  CB  . PRO A  360 ? 0.6129 0.6012 0.6706 0.0150  -0.0103 -0.0333 248  PRO A CB  
2325 C  CG  . PRO A  360 ? 0.6692 0.6552 0.7276 0.0179  -0.0127 -0.0360 248  PRO A CG  
2326 C  CD  . PRO A  360 ? 0.6192 0.5981 0.6772 0.0166  -0.0114 -0.0390 248  PRO A CD  
2327 N  N   . TYR A  361 ? 0.6116 0.5869 0.6699 0.0111  -0.0050 -0.0331 249  TYR A N   
2328 C  CA  . TYR A  361 ? 0.5991 0.5720 0.6585 0.0099  -0.0029 -0.0307 249  TYR A CA  
2329 C  C   . TYR A  361 ? 0.6662 0.6384 0.7222 0.0077  0.0025  -0.0343 249  TYR A C   
2330 O  O   . TYR A  361 ? 0.6918 0.6668 0.7467 0.0059  0.0054  -0.0339 249  TYR A O   
2331 C  CB  . TYR A  361 ? 0.6079 0.5744 0.6714 0.0117  -0.0053 -0.0280 249  TYR A CB  
2332 C  CG  . TYR A  361 ? 0.6214 0.5859 0.6857 0.0110  -0.0025 -0.0264 249  TYR A CG  
2333 C  CD1 . TYR A  361 ? 0.6420 0.6099 0.7072 0.0099  -0.0018 -0.0229 249  TYR A CD1 
2334 C  CD2 . TYR A  361 ? 0.6174 0.5779 0.6820 0.0117  -0.0008 -0.0276 249  TYR A CD2 
2335 C  CE1 . TYR A  361 ? 0.6429 0.6102 0.7091 0.0097  0.0007  -0.0213 249  TYR A CE1 
2336 C  CE2 . TYR A  361 ? 0.6172 0.5769 0.6828 0.0119  0.0019  -0.0254 249  TYR A CE2 
2337 C  CZ  . TYR A  361 ? 0.6665 0.6296 0.7329 0.0111  0.0026  -0.0224 249  TYR A CZ  
2338 O  OH  . TYR A  361 ? 0.6057 0.5691 0.6734 0.0118  0.0053  -0.0202 249  TYR A OH  
2339 N  N   . HIS A  362 ? 0.5899 0.5581 0.6441 0.0077  0.0040  -0.0378 250  HIS A N   
2340 C  CA  . HIS A  362 ? 0.5757 0.5408 0.6268 0.0058  0.0096  -0.0411 250  HIS A CA  
2341 C  C   . HIS A  362 ? 0.6496 0.6200 0.6961 0.0020  0.0131  -0.0453 250  HIS A C   
2342 O  O   . HIS A  362 ? 0.6734 0.6412 0.7176 -0.0002 0.0184  -0.0477 250  HIS A O   
2343 C  CB  . HIS A  362 ? 0.5738 0.5337 0.6249 0.0069  0.0100  -0.0427 250  HIS A CB  
2344 C  CG  . HIS A  362 ? 0.5987 0.5544 0.6538 0.0097  0.0087  -0.0390 250  HIS A CG  
2345 N  ND1 . HIS A  362 ? 0.6112 0.5675 0.6696 0.0116  0.0037  -0.0372 250  HIS A ND1 
2346 C  CD2 . HIS A  362 ? 0.6011 0.5530 0.6573 0.0107  0.0122  -0.0371 250  HIS A CD2 
2347 C  CE1 . HIS A  362 ? 0.5927 0.5466 0.6539 0.0131  0.0040  -0.0344 250  HIS A CE1 
2348 N  NE2 . HIS A  362 ? 0.5969 0.5486 0.6570 0.0130  0.0090  -0.0338 250  HIS A NE2 
2349 N  N   . ILE A  363 ? 0.5810 0.5590 0.6259 0.0010  0.0105  -0.0463 251  ILE A N   
2350 C  CA  . ILE A  363 ? 0.5676 0.5538 0.6081 -0.0032 0.0135  -0.0501 251  ILE A CA  
2351 C  C   . ILE A  363 ? 0.6515 0.6439 0.6927 -0.0043 0.0142  -0.0477 251  ILE A C   
2352 O  O   . ILE A  363 ? 0.6711 0.6657 0.7093 -0.0080 0.0191  -0.0512 251  ILE A O   
2353 C  CB  . ILE A  363 ? 0.5969 0.5915 0.6357 -0.0034 0.0104  -0.0514 251  ILE A CB  
2354 C  CG1 . ILE A  363 ? 0.6020 0.5919 0.6394 -0.0031 0.0102  -0.0544 251  ILE A CG1 
2355 C  CG2 . ILE A  363 ? 0.5898 0.5961 0.6242 -0.0083 0.0132  -0.0546 251  ILE A CG2 
2356 C  CD1 . ILE A  363 ? 0.5773 0.5762 0.6135 -0.0025 0.0069  -0.0555 251  ILE A CD1 
2357 N  N   . GLN A  364 ? 0.6104 0.6051 0.6559 -0.0012 0.0096  -0.0420 252  GLN A N   
2358 C  CA  . GLN A  364 ? 0.6174 0.6189 0.6643 -0.0018 0.0093  -0.0383 252  GLN A CA  
2359 C  C   . GLN A  364 ? 0.6869 0.6842 0.7341 -0.0029 0.0133  -0.0387 252  GLN A C   
2360 O  O   . GLN A  364 ? 0.6703 0.6752 0.7159 -0.0057 0.0161  -0.0397 252  GLN A O   
2361 C  CB  . GLN A  364 ? 0.6316 0.6338 0.6832 0.0018  0.0036  -0.0316 252  GLN A CB  
2362 C  CG  . GLN A  364 ? 0.8154 0.8281 0.8685 0.0009  0.0026  -0.0269 252  GLN A CG  
2363 C  CD  . GLN A  364 ? 1.0438 1.0703 1.0929 -0.0028 0.0051  -0.0296 252  GLN A CD  
2364 O  OE1 . GLN A  364 ? 0.9608 0.9927 1.0073 -0.0034 0.0049  -0.0324 252  GLN A OE1 
2365 N  NE2 . GLN A  364 ? 0.9651 0.9991 1.0136 -0.0056 0.0076  -0.0290 252  GLN A NE2 
2366 N  N   . ARG A  365 ? 0.6553 0.6419 0.7045 -0.0004 0.0139  -0.0381 253  ARG A N   
2367 C  CA  . ARG A  365 ? 0.6427 0.6249 0.6926 -0.0001 0.0178  -0.0380 253  ARG A CA  
2368 C  C   . ARG A  365 ? 0.7208 0.7020 0.7662 -0.0034 0.0246  -0.0443 253  ARG A C   
2369 O  O   . ARG A  365 ? 0.7412 0.7237 0.7864 -0.0043 0.0285  -0.0451 253  ARG A O   
2370 C  CB  . ARG A  365 ? 0.5906 0.5633 0.6434 0.0034  0.0168  -0.0357 253  ARG A CB  
2371 C  CG  . ARG A  365 ? 0.5808 0.5516 0.6361 0.0051  0.0187  -0.0327 253  ARG A CG  
2372 C  CD  . ARG A  365 ? 0.6058 0.5702 0.6641 0.0083  0.0171  -0.0299 253  ARG A CD  
2373 N  NE  . ARG A  365 ? 0.6630 0.6206 0.7196 0.0092  0.0215  -0.0329 253  ARG A NE  
2374 C  CZ  . ARG A  365 ? 0.7538 0.7072 0.8127 0.0119  0.0209  -0.0308 253  ARG A CZ  
2375 N  NH1 . ARG A  365 ? 0.5534 0.5087 0.6159 0.0134  0.0160  -0.0268 253  ARG A NH1 
2376 N  NH2 . ARG A  365 ? 0.5302 0.4777 0.5877 0.0129  0.0253  -0.0326 253  ARG A NH2 
2377 N  N   . THR A  366 ? 0.6891 0.6679 0.7309 -0.0054 0.0263  -0.0490 254  THR A N   
2378 C  CA  . THR A  366 ? 0.6969 0.6739 0.7341 -0.0096 0.0331  -0.0558 254  THR A CA  
2379 C  C   . THR A  366 ? 0.7812 0.7708 0.8157 -0.0141 0.0345  -0.0585 254  THR A C   
2380 O  O   . THR A  366 ? 0.7887 0.7785 0.8217 -0.0163 0.0398  -0.0617 254  THR A O   
2381 C  CB  . THR A  366 ? 0.7220 0.6944 0.7560 -0.0113 0.0340  -0.0597 254  THR A CB  
2382 O  OG1 . THR A  366 ? 0.7207 0.6836 0.7576 -0.0070 0.0323  -0.0565 254  THR A OG1 
2383 C  CG2 . THR A  366 ? 0.6930 0.6615 0.7222 -0.0162 0.0415  -0.0668 254  THR A CG2 
2384 N  N   . ILE A  367 ? 0.7510 0.7518 0.7853 -0.0151 0.0299  -0.0568 255  ILE A N   
2385 C  CA  . ILE A  367 ? 0.7558 0.7720 0.7880 -0.0191 0.0303  -0.0580 255  ILE A CA  
2386 C  C   . ILE A  367 ? 0.8475 0.8682 0.8824 -0.0184 0.0307  -0.0547 255  ILE A C   
2387 O  O   . ILE A  367 ? 0.8462 0.8732 0.8783 -0.0226 0.0354  -0.0591 255  ILE A O   
2388 C  CB  . ILE A  367 ? 0.7855 0.8128 0.8182 -0.0183 0.0246  -0.0546 255  ILE A CB  
2389 C  CG1 . ILE A  367 ? 0.7846 0.8114 0.8136 -0.0204 0.0251  -0.0593 255  ILE A CG1 
2390 C  CG2 . ILE A  367 ? 0.7987 0.8439 0.8307 -0.0212 0.0241  -0.0532 255  ILE A CG2 
2391 C  CD1 . ILE A  367 ? 0.8584 0.8898 0.8895 -0.0165 0.0189  -0.0548 255  ILE A CD1 
2392 N  N   . HIS A  368 ? 0.8280 0.8456 0.8678 -0.0136 0.0260  -0.0474 256  HIS A N   
2393 C  CA  . HIS A  368 ? 0.8255 0.8479 0.8684 -0.0127 0.0254  -0.0430 256  HIS A CA  
2394 C  C   . HIS A  368 ? 0.8467 0.8647 0.8885 -0.0136 0.0316  -0.0469 256  HIS A C   
2395 O  O   . HIS A  368 ? 0.8381 0.8661 0.8792 -0.0163 0.0339  -0.0480 256  HIS A O   
2396 C  CB  . HIS A  368 ? 0.8447 0.8617 0.8928 -0.0080 0.0197  -0.0352 256  HIS A CB  
2397 C  CG  . HIS A  368 ? 0.8933 0.9176 0.9444 -0.0078 0.0182  -0.0297 256  HIS A CG  
2398 N  ND1 . HIS A  368 ? 0.9174 0.9526 0.9703 -0.0083 0.0140  -0.0243 256  HIS A ND1 
2399 C  CD2 . HIS A  368 ? 0.9201 0.9430 0.9728 -0.0072 0.0204  -0.0287 256  HIS A CD2 
2400 C  CE1 . HIS A  368 ? 0.9104 0.9501 0.9657 -0.0085 0.0137  -0.0201 256  HIS A CE1 
2401 N  NE2 . HIS A  368 ? 0.9155 0.9487 0.9707 -0.0078 0.0175  -0.0228 256  HIS A NE2 
2402 N  N   . LEU A  369 ? 0.7839 0.7879 0.8260 -0.0111 0.0344  -0.0487 257  LEU A N   
2403 C  CA  . LEU A  369 ? 0.7771 0.7752 0.8188 -0.0106 0.0408  -0.0519 257  LEU A CA  
2404 C  C   . LEU A  369 ? 0.8747 0.8757 0.9114 -0.0159 0.0478  -0.0605 257  LEU A C   
2405 O  O   . LEU A  369 ? 0.8871 0.8900 0.9236 -0.0165 0.0525  -0.0630 257  LEU A O   
2406 C  CB  . LEU A  369 ? 0.7748 0.7579 0.8181 -0.0062 0.0422  -0.0508 257  LEU A CB  
2407 C  CG  . LEU A  369 ? 0.8195 0.8004 0.8679 -0.0014 0.0368  -0.0430 257  LEU A CG  
2408 C  CD1 . LEU A  369 ? 0.8243 0.7933 0.8740 0.0025  0.0389  -0.0423 257  LEU A CD1 
2409 C  CD2 . LEU A  369 ? 0.8090 0.7970 0.8603 -0.0002 0.0361  -0.0388 257  LEU A CD2 
2410 N  N   . HIS A  370 ? 0.8389 0.8411 0.8715 -0.0201 0.0486  -0.0655 258  HIS A N   
2411 C  CA  . HIS A  370 ? 0.8413 0.8473 0.8686 -0.0265 0.0552  -0.0745 258  HIS A CA  
2412 C  C   . HIS A  370 ? 0.9763 1.0019 1.0026 -0.0308 0.0541  -0.0750 258  HIS A C   
2413 O  O   . HIS A  370 ? 0.9778 1.0083 1.0009 -0.0355 0.0601  -0.0819 258  HIS A O   
2414 C  CB  . HIS A  370 ? 0.8347 0.8367 0.8578 -0.0301 0.0564  -0.0794 258  HIS A CB  
2415 C  CG  . HIS A  370 ? 0.8612 0.8448 0.8838 -0.0283 0.0609  -0.0818 258  HIS A CG  
2416 N  ND1 . HIS A  370 ? 0.8717 0.8461 0.8919 -0.0304 0.0694  -0.0882 258  HIS A ND1 
2417 C  CD2 . HIS A  370 ? 0.8675 0.8410 0.8917 -0.0245 0.0581  -0.0783 258  HIS A CD2 
2418 C  CE1 . HIS A  370 ? 0.8626 0.8212 0.8833 -0.0275 0.0715  -0.0876 258  HIS A CE1 
2419 N  NE2 . HIS A  370 ? 0.8641 0.8226 0.8871 -0.0242 0.0647  -0.0817 258  HIS A NE2 
2420 N  N   . PHE A  371 ? 0.9989 1.0357 1.0279 -0.0292 0.0468  -0.0678 259  PHE A N   
2421 C  CA  . PHE A  371 ? 1.0267 1.0837 1.0556 -0.0324 0.0447  -0.0659 259  PHE A CA  
2422 C  C   . PHE A  371 ? 1.1554 1.2171 1.1861 -0.0322 0.0473  -0.0653 259  PHE A C   
2423 O  O   . PHE A  371 ? 1.1530 1.2306 1.1819 -0.0369 0.0493  -0.0680 259  PHE A O   
2424 C  CB  . PHE A  371 ? 1.0555 1.1190 1.0882 -0.0288 0.0364  -0.0564 259  PHE A CB  
2425 C  CG  . PHE A  371 ? 1.0837 1.1683 1.1171 -0.0311 0.0337  -0.0523 259  PHE A CG  
2426 C  CD1 . PHE A  371 ? 1.1308 1.2305 1.1610 -0.0353 0.0334  -0.0544 259  PHE A CD1 
2427 C  CD2 . PHE A  371 ? 1.1194 1.2100 1.1568 -0.0291 0.0312  -0.0455 259  PHE A CD2 
2428 C  CE1 . PHE A  371 ? 1.1394 1.2603 1.1707 -0.0370 0.0309  -0.0494 259  PHE A CE1 
2429 C  CE2 . PHE A  371 ? 1.1499 1.2607 1.1884 -0.0312 0.0286  -0.0406 259  PHE A CE2 
2430 C  CZ  . PHE A  371 ? 1.1225 1.2484 1.1580 -0.0348 0.0285  -0.0424 259  PHE A CZ  
2431 N  N   . LEU A  372 ? 1.1779 1.2271 1.2122 -0.0269 0.0471  -0.0617 260  LEU A N   
2432 C  CA  . LEU A  372 ? 1.2040 1.2563 1.2405 -0.0255 0.0493  -0.0604 260  LEU A CA  
2433 C  C   . LEU A  372 ? 1.3465 1.3978 1.3794 -0.0291 0.0583  -0.0704 260  LEU A C   
2434 O  O   . LEU A  372 ? 1.3436 1.4053 1.3769 -0.0306 0.0606  -0.0715 260  LEU A O   
2435 C  CB  . LEU A  372 ? 1.2042 1.2430 1.2452 -0.0189 0.0470  -0.0543 260  LEU A CB  
2436 C  CG  . LEU A  372 ? 1.2533 1.2964 1.2992 -0.0157 0.0392  -0.0439 260  LEU A CG  
2437 C  CD1 . LEU A  372 ? 1.2575 1.3109 1.3058 -0.0155 0.0391  -0.0402 260  LEU A CD1 
2438 C  CD2 . LEU A  372 ? 1.2501 1.3012 1.2960 -0.0173 0.0334  -0.0402 260  LEU A CD2 
2439 N  N   . HIS A  373 ? 1.3743 1.4129 1.4036 -0.0308 0.0634  -0.0777 261  HIS A N   
2440 C  CA  . HIS A  373 ? 1.4060 1.4394 1.4314 -0.0344 0.0728  -0.0881 261  HIS A CA  
2441 C  C   . HIS A  373 ? 1.4893 1.5389 1.5097 -0.0432 0.0757  -0.0960 261  HIS A C   
2442 O  O   . HIS A  373 ? 1.4921 1.5415 1.5094 -0.0474 0.0835  -0.1051 261  HIS A O   
2443 C  CB  . HIS A  373 ? 1.4308 1.4432 1.4546 -0.0328 0.0770  -0.0918 261  HIS A CB  
2444 C  CG  . HIS A  373 ? 1.4826 1.4800 1.5108 -0.0247 0.0768  -0.0860 261  HIS A CG  
2445 N  ND1 . HIS A  373 ? 1.5147 1.4966 1.5425 -0.0223 0.0847  -0.0903 261  HIS A ND1 
2446 C  CD2 . HIS A  373 ? 1.5088 1.5052 1.5418 -0.0188 0.0699  -0.0763 261  HIS A CD2 
2447 C  CE1 . HIS A  373 ? 1.5119 1.4857 1.5443 -0.0148 0.0822  -0.0826 261  HIS A CE1 
2448 N  NE2 . HIS A  373 ? 1.5125 1.4949 1.5480 -0.0129 0.0733  -0.0744 261  HIS A NE2 
2449 N  N   . ASN A  374 ? 1.4598 1.5237 1.4795 -0.0460 0.0696  -0.0924 262  ASN A N   
2450 C  CA  . ASN A  374 ? 1.4622 1.5455 1.4775 -0.0543 0.0712  -0.0983 262  ASN A CA  
2451 C  C   . ASN A  374 ? 1.5412 1.6439 1.5576 -0.0566 0.0718  -0.0979 262  ASN A C   
2452 O  O   . ASN A  374 ? 1.5354 1.6439 1.5566 -0.0519 0.0663  -0.0886 262  ASN A O   
2453 C  CB  . ASN A  374 ? 1.4399 1.5333 1.4550 -0.0549 0.0642  -0.0928 262  ASN A CB  
2454 N  N   . GLU A  375 ? 1.5197 1.6328 1.5315 -0.0643 0.0786  -0.1085 263  GLU A N   
2455 C  CA  . GLU A  375 ? 1.5227 1.6561 1.5346 -0.0680 0.0806  -0.1105 263  GLU A CA  
2456 C  C   . GLU A  375 ? 1.5952 1.7538 1.6095 -0.0686 0.0729  -0.1010 263  GLU A C   
2457 O  O   . GLU A  375 ? 1.5927 1.7601 1.6111 -0.0656 0.0700  -0.0943 263  GLU A O   
2458 C  CB  . GLU A  375 ? 1.5395 1.6788 1.5453 -0.0773 0.0897  -0.1250 263  GLU A CB  
2459 N  N   . THR A  376 ? 1.5592 1.7297 1.5712 -0.0723 0.0697  -0.0999 264  THR A N   
2460 C  CA  . THR A  376 ? 1.5487 1.7430 1.5630 -0.0725 0.0628  -0.0903 264  THR A CA  
2461 C  C   . THR A  376 ? 1.5953 1.7795 1.6150 -0.0639 0.0544  -0.0774 264  THR A C   
2462 O  O   . THR A  376 ? 1.5951 1.7608 1.6144 -0.0607 0.0533  -0.0775 264  THR A O   
2463 C  CB  . THR A  376 ? 1.6514 1.8650 1.6609 -0.0800 0.0636  -0.0950 264  THR A CB  
2464 O  OG1 . THR A  376 ? 1.6475 1.8542 1.6508 -0.0871 0.0718  -0.1092 264  THR A OG1 
2465 C  CG2 . THR A  376 ? 1.6249 1.8710 1.6349 -0.0842 0.0617  -0.0912 264  THR A CG2 
2466 N  N   . LYS A  377 ? 1.5387 1.7352 1.5633 -0.0607 0.0488  -0.0664 265  LYS A N   
2467 C  CA  . LYS A  377 ? 1.5287 1.7164 1.5585 -0.0532 0.0411  -0.0541 265  LYS A CA  
2468 C  C   . LYS A  377 ? 1.5742 1.7843 1.6072 -0.0527 0.0353  -0.0430 265  LYS A C   
2469 O  O   . LYS A  377 ? 1.5664 1.7826 1.6035 -0.0509 0.0328  -0.0356 265  LYS A O   
2470 C  CB  . LYS A  377 ? 1.5474 1.7156 1.5812 -0.0473 0.0403  -0.0506 265  LYS A CB  
2471 C  CG  . LYS A  377 ? 1.4484 1.5915 1.4805 -0.0450 0.0441  -0.0574 265  LYS A CG  
2472 C  CD  . LYS A  377 ? 1.4051 1.5316 1.4417 -0.0384 0.0417  -0.0514 265  LYS A CD  
2473 C  CE  . LYS A  377 ? 1.3977 1.5051 1.4327 -0.0369 0.0477  -0.0590 265  LYS A CE  
2474 N  NZ  . LYS A  377 ? 1.4554 1.5680 1.4894 -0.0391 0.0538  -0.0648 265  LYS A NZ  
2475 N  N   . PRO A  378 ? 1.5310 1.7542 1.5626 -0.0542 0.0331  -0.0412 266  PRO A N   
2476 C  CA  . PRO A  378 ? 1.5270 1.7713 1.5622 -0.0528 0.0278  -0.0294 266  PRO A CA  
2477 C  C   . PRO A  378 ? 1.5979 1.8281 1.6391 -0.0446 0.0212  -0.0172 266  PRO A C   
2478 O  O   . PRO A  378 ? 1.6037 1.8112 1.6454 -0.0404 0.0200  -0.0183 266  PRO A O   
2479 C  CB  . PRO A  378 ? 1.5444 1.8054 1.5759 -0.0565 0.0283  -0.0321 266  PRO A CB  
2480 C  CG  . PRO A  378 ? 1.6048 1.8455 1.6324 -0.0567 0.0310  -0.0414 266  PRO A CG  
2481 C  CD  . PRO A  378 ? 1.5530 1.7731 1.5797 -0.0570 0.0355  -0.0490 266  PRO A CD  
2482 N  N   . CYS A  379 ? 1.5607 1.8047 1.6066 -0.0428 0.0170  -0.0056 267  CYS A N   
2483 C  CA  . CYS A  379 ? 1.5688 1.8002 1.6206 -0.0358 0.0111  0.0064  267  CYS A CA  
2484 C  C   . CYS A  379 ? 1.5900 1.8130 1.6428 -0.0309 0.0077  0.0100  267  CYS A C   
2485 O  O   . CYS A  379 ? 1.5835 1.7857 1.6396 -0.0254 0.0045  0.0142  267  CYS A O   
2486 C  CB  . CYS A  379 ? 1.5798 1.8294 1.6359 -0.0358 0.0081  0.0180  267  CYS A CB  
2487 S  SG  . CYS A  379 ? 1.6358 1.8923 1.6919 -0.0403 0.0112  0.0151  267  CYS A SG  
2488 N  N   . ASP A  380 ? 1.5300 1.7696 1.5797 -0.0330 0.0087  0.0077  268  ASP A N   
2489 C  CA  . ASP A  380 ? 1.5225 1.7577 1.5726 -0.0285 0.0060  0.0103  268  ASP A CA  
2490 C  C   . ASP A  380 ? 1.5584 1.7692 1.6057 -0.0273 0.0074  0.0011  268  ASP A C   
2491 O  O   . ASP A  380 ? 1.5609 1.7622 1.6095 -0.0223 0.0046  0.0036  268  ASP A O   
2492 C  CB  . ASP A  380 ? 1.5389 1.8020 1.5861 -0.0319 0.0071  0.0099  268  ASP A CB  
2493 C  CG  . ASP A  380 ? 1.6855 1.9732 1.7365 -0.0317 0.0048  0.0214  268  ASP A CG  
2494 O  OD1 . ASP A  380 ? 1.6991 1.9891 1.7547 -0.0253 0.0006  0.0330  268  ASP A OD1 
2495 O  OD2 . ASP A  380 ? 1.7551 2.0595 1.8045 -0.0377 0.0075  0.0190  268  ASP A OD2 
2496 N  N   . SER A  381 ? 1.4864 1.6876 1.5301 -0.0316 0.0120  -0.0092 269  SER A N   
2497 C  CA  . SER A  381 ? 1.4723 1.6507 1.5135 -0.0308 0.0140  -0.0175 269  SER A CA  
2498 C  C   . SER A  381 ? 1.4673 1.6237 1.5125 -0.0263 0.0122  -0.0143 269  SER A C   
2499 O  O   . SER A  381 ? 1.4614 1.5995 1.5078 -0.0222 0.0103  -0.0144 269  SER A O   
2500 C  CB  . SER A  381 ? 1.5243 1.7051 1.5594 -0.0379 0.0207  -0.0303 269  SER A CB  
2501 O  OG  . SER A  381 ? 1.6404 1.8179 1.6756 -0.0402 0.0240  -0.0334 269  SER A OG  
2502 N  N   . VAL A  382 ? 1.3861 1.5463 1.4335 -0.0275 0.0128  -0.0114 270  VAL A N   
2503 C  CA  . VAL A  382 ? 1.3756 1.5189 1.4267 -0.0240 0.0112  -0.0079 270  VAL A CA  
2504 C  C   . VAL A  382 ? 1.4093 1.5439 1.4657 -0.0182 0.0050  0.0026  270  VAL A C   
2505 O  O   . VAL A  382 ? 1.4102 1.5260 1.4687 -0.0149 0.0035  0.0033  270  VAL A O   
2506 C  CB  . VAL A  382 ? 1.4158 1.5687 1.4676 -0.0271 0.0134  -0.0073 270  VAL A CB  
2507 C  CG1 . VAL A  382 ? 1.4151 1.5534 1.4709 -0.0237 0.0113  -0.0025 270  VAL A CG1 
2508 C  CG2 . VAL A  382 ? 1.4135 1.5702 1.4602 -0.0323 0.0202  -0.0191 270  VAL A CG2 
2509 N  N   . LEU A  383 ? 1.3459 1.4942 1.4044 -0.0168 0.0019  0.0104  271  LEU A N   
2510 C  CA  . LEU A  383 ? 1.3351 1.4752 1.3987 -0.0112 -0.0033 0.0202  271  LEU A CA  
2511 C  C   . LEU A  383 ? 1.3575 1.4814 1.4204 -0.0073 -0.0044 0.0164  271  LEU A C   
2512 O  O   . LEU A  383 ? 1.3585 1.4639 1.4242 -0.0039 -0.0067 0.0182  271  LEU A O   
2513 C  CB  . LEU A  383 ? 1.3278 1.4878 1.3938 -0.0103 -0.0056 0.0298  271  LEU A CB  
2514 N  N   . ARG A  384 ? 1.2823 1.4142 1.3412 -0.0085 -0.0026 0.0106  272  ARG A N   
2515 C  CA  . ARG A  384 ? 1.2699 1.3902 1.3275 -0.0056 -0.0033 0.0063  272  ARG A CA  
2516 C  C   . ARG A  384 ? 1.2960 1.3961 1.3520 -0.0060 -0.0014 -0.0013 272  ARG A C   
2517 O  O   . ARG A  384 ? 1.2995 1.3859 1.3563 -0.0024 -0.0032 -0.0024 272  ARG A O   
2518 C  CB  . ARG A  384 ? 1.2642 1.4007 1.3171 -0.0083 -0.0012 0.0014  272  ARG A CB  
2519 N  N   . MET A  385 ? 1.2209 1.3201 1.2748 -0.0101 0.0023  -0.0062 273  MET A N   
2520 C  CA  . MET A  385 ? 1.2068 1.2886 1.2596 -0.0101 0.0046  -0.0123 273  MET A CA  
2521 C  C   . MET A  385 ? 1.2238 1.2922 1.2816 -0.0063 0.0012  -0.0062 273  MET A C   
2522 O  O   . MET A  385 ? 1.2255 1.2786 1.2839 -0.0039 0.0004  -0.0083 273  MET A O   
2523 C  CB  . MET A  385 ? 1.2340 1.3200 1.2836 -0.0150 0.0101  -0.0185 273  MET A CB  
2524 C  CG  . MET A  385 ? 1.2790 1.3711 1.3228 -0.0196 0.0149  -0.0279 273  MET A CG  
2525 S  SD  . MET A  385 ? 1.3399 1.4135 1.3809 -0.0187 0.0171  -0.0354 273  MET A SD  
2526 C  CE  . MET A  385 ? 1.2942 1.3775 1.3335 -0.0183 0.0141  -0.0349 273  MET A CE  
2527 N  N   . GLN A  386 ? 1.1480 1.2232 1.2092 -0.0064 -0.0008 0.0013  274  GLN A N   
2528 C  CA  . GLN A  386 ? 1.1311 1.1956 1.1968 -0.0040 -0.0040 0.0076  274  GLN A CA  
2529 C  C   . GLN A  386 ? 1.1158 1.1710 1.1850 0.0004  -0.0084 0.0125  274  GLN A C   
2530 O  O   . GLN A  386 ? 1.1098 1.1510 1.1816 0.0021  -0.0103 0.0137  274  GLN A O   
2531 C  CB  . GLN A  386 ? 1.1468 1.2224 1.2147 -0.0061 -0.0045 0.0140  274  GLN A CB  
2532 C  CG  . GLN A  386 ? 1.3994 1.4783 1.4652 -0.0094 -0.0003 0.0092  274  GLN A CG  
2533 C  CD  . GLN A  386 ? 1.7186 1.7824 1.7856 -0.0080 0.0001  0.0076  274  GLN A CD  
2534 O  OE1 . GLN A  386 ? 1.6626 1.7151 1.7328 -0.0056 -0.0034 0.0117  274  GLN A OE1 
2535 N  NE2 . GLN A  386 ? 1.6431 1.7070 1.7077 -0.0095 0.0047  0.0014  274  GLN A NE2 
2536 N  N   . LYS A  387 ? 1.0287 1.0921 1.0979 0.0021  -0.0098 0.0150  275  LYS A N   
2537 C  CA  . LYS A  387 ? 1.0153 1.0701 1.0877 0.0070  -0.0134 0.0190  275  LYS A CA  
2538 C  C   . LYS A  387 ? 1.0405 1.0821 1.1110 0.0086  -0.0129 0.0114  275  LYS A C   
2539 O  O   . LYS A  387 ? 1.0403 1.0684 1.1138 0.0116  -0.0154 0.0127  275  LYS A O   
2540 C  CB  . LYS A  387 ? 1.0350 1.1042 1.1077 0.0090  -0.0144 0.0236  275  LYS A CB  
2541 N  N   . SER A  388 ? 0.9605 1.0061 1.0261 0.0060  -0.0096 0.0034  276  SER A N   
2542 C  CA  . SER A  388 ? 0.9426 0.9776 1.0061 0.0068  -0.0087 -0.0037 276  SER A CA  
2543 C  C   . SER A  388 ? 0.9605 0.9808 1.0254 0.0069  -0.0086 -0.0054 276  SER A C   
2544 O  O   . SER A  388 ? 0.9647 0.9745 1.0304 0.0092  -0.0099 -0.0077 276  SER A O   
2545 C  CB  . SER A  388 ? 0.9740 1.0171 1.0319 0.0033  -0.0048 -0.0111 276  SER A CB  
2546 O  OG  . SER A  388 ? 1.0664 1.1208 1.1232 0.0044  -0.0058 -0.0104 276  SER A OG  
2547 N  N   . VAL A  389 ? 0.8757 0.8968 0.9412 0.0045  -0.0070 -0.0039 277  VAL A N   
2548 C  CA  . VAL A  389 ? 0.8660 0.8763 0.9332 0.0046  -0.0068 -0.0043 277  VAL A CA  
2549 C  C   . VAL A  389 ? 0.9472 0.9485 1.0189 0.0071  -0.0112 0.0007  277  VAL A C   
2550 O  O   . VAL A  389 ? 0.9720 0.9631 1.0446 0.0082  -0.0119 -0.0016 277  VAL A O   
2551 C  CB  . VAL A  389 ? 0.9020 0.9177 0.9691 0.0019  -0.0044 -0.0029 277  VAL A CB  
2552 C  CG1 . VAL A  389 ? 0.8939 0.9004 0.9633 0.0024  -0.0047 -0.0019 277  VAL A CG1 
2553 C  CG2 . VAL A  389 ? 0.8990 0.9214 0.9615 -0.0007 0.0007  -0.0092 277  VAL A CG2 
2554 N  N   . VAL A  390 ? 0.8863 0.8917 0.9607 0.0079  -0.0138 0.0075  278  VAL A N   
2555 C  CA  . VAL A  390 ? 0.8741 0.8704 0.9529 0.0100  -0.0175 0.0126  278  VAL A CA  
2556 C  C   . VAL A  390 ? 0.9193 0.9070 0.9984 0.0134  -0.0190 0.0090  278  VAL A C   
2557 O  O   . VAL A  390 ? 0.9437 0.9203 1.0250 0.0140  -0.0205 0.0079  278  VAL A O   
2558 C  CB  . VAL A  390 ? 0.9201 0.9232 1.0018 0.0102  -0.0193 0.0213  278  VAL A CB  
2559 C  CG1 . VAL A  390 ? 0.9233 0.9147 1.0096 0.0125  -0.0225 0.0263  278  VAL A CG1 
2560 C  CG2 . VAL A  390 ? 0.9110 0.9225 0.9928 0.0065  -0.0182 0.0249  278  VAL A CG2 
2561 N  N   . ILE A  391 ? 0.8324 0.8267 0.9093 0.0153  -0.0184 0.0067  279  ILE A N   
2562 C  CA  . ILE A  391 ? 0.8159 0.8049 0.8929 0.0188  -0.0197 0.0033  279  ILE A CA  
2563 C  C   . ILE A  391 ? 0.8414 0.8239 0.9161 0.0180  -0.0184 -0.0043 279  ILE A C   
2564 O  O   . ILE A  391 ? 0.8154 0.7885 0.8920 0.0200  -0.0202 -0.0061 279  ILE A O   
2565 C  CB  . ILE A  391 ? 0.8571 0.8582 0.9324 0.0209  -0.0194 0.0040  279  ILE A CB  
2566 C  CG1 . ILE A  391 ? 0.8676 0.8751 0.9462 0.0227  -0.0210 0.0131  279  ILE A CG1 
2567 C  CG2 . ILE A  391 ? 0.8778 0.8752 0.9528 0.0247  -0.0205 0.0000  279  ILE A CG2 
2568 C  CD1 . ILE A  391 ? 1.0362 1.0616 1.1128 0.0235  -0.0202 0.0152  279  ILE A CD1 
2569 N  N   . THR A  392 ? 0.8086 0.7959 0.8793 0.0150  -0.0152 -0.0086 280  THR A N   
2570 C  CA  . THR A  392 ? 0.7952 0.7771 0.8637 0.0144  -0.0135 -0.0149 280  THR A CA  
2571 C  C   . THR A  392 ? 0.8271 0.7998 0.8982 0.0140  -0.0142 -0.0145 280  THR A C   
2572 O  O   . THR A  392 ? 0.8308 0.7977 0.9019 0.0149  -0.0146 -0.0181 280  THR A O   
2573 C  CB  . THR A  392 ? 0.7981 0.7863 0.8618 0.0116  -0.0093 -0.0195 280  THR A CB  
2574 O  OG1 . THR A  392 ? 0.8294 0.8203 0.8927 0.0090  -0.0069 -0.0180 280  THR A OG1 
2575 C  CG2 . THR A  392 ? 0.6996 0.6985 0.7604 0.0113  -0.0088 -0.0210 280  THR A CG2 
2576 N  N   . LEU A  393 ? 0.7562 0.7287 0.8295 0.0126  -0.0145 -0.0098 281  LEU A N   
2577 C  CA  . LEU A  393 ? 0.7345 0.7004 0.8102 0.0117  -0.0153 -0.0087 281  LEU A CA  
2578 C  C   . LEU A  393 ? 0.7961 0.7541 0.8754 0.0130  -0.0189 -0.0076 281  LEU A C   
2579 O  O   . LEU A  393 ? 0.8182 0.7709 0.8987 0.0125  -0.0195 -0.0096 281  LEU A O   
2580 C  CB  . LEU A  393 ? 0.7179 0.6879 0.7947 0.0093  -0.0145 -0.0041 281  LEU A CB  
2581 C  CG  . LEU A  393 ? 0.7543 0.7212 0.8328 0.0079  -0.0143 -0.0033 281  LEU A CG  
2582 C  CD1 . LEU A  393 ? 0.7526 0.7189 0.8288 0.0085  -0.0112 -0.0079 281  LEU A CD1 
2583 C  CD2 . LEU A  393 ? 0.7675 0.7399 0.8470 0.0057  -0.0139 0.0018  281  LEU A CD2 
2584 N  N   . SER A  394 ? 0.7242 0.6817 0.8053 0.0147  -0.0209 -0.0042 282  SER A N   
2585 C  CA  . SER A  394 ? 0.7050 0.6536 0.7895 0.0165  -0.0237 -0.0033 282  SER A CA  
2586 C  C   . SER A  394 ? 0.7278 0.6734 0.8113 0.0189  -0.0240 -0.0097 282  SER A C   
2587 O  O   . SER A  394 ? 0.7250 0.6630 0.8106 0.0189  -0.0254 -0.0121 282  SER A O   
2588 C  CB  . SER A  394 ? 0.7240 0.6739 0.8105 0.0188  -0.0250 0.0022  282  SER A CB  
2589 O  OG  . SER A  394 ? 0.8331 0.7869 0.9208 0.0165  -0.0249 0.0088  282  SER A OG  
2590 N  N   . LEU A  395 ? 0.6485 0.6010 0.7286 0.0203  -0.0226 -0.0127 283  LEU A N   
2591 C  CA  . LEU A  395 ? 0.6332 0.5852 0.7118 0.0222  -0.0226 -0.0186 283  LEU A CA  
2592 C  C   . LEU A  395 ? 0.6625 0.6119 0.7403 0.0201  -0.0217 -0.0227 283  LEU A C   
2593 O  O   . LEU A  395 ? 0.6531 0.5986 0.7319 0.0211  -0.0230 -0.0263 283  LEU A O   
2594 C  CB  . LEU A  395 ? 0.6271 0.5883 0.7019 0.0231  -0.0211 -0.0205 283  LEU A CB  
2595 C  CG  . LEU A  395 ? 0.6825 0.6484 0.7579 0.0265  -0.0223 -0.0178 283  LEU A CG  
2596 C  CD1 . LEU A  395 ? 0.6805 0.6573 0.7516 0.0263  -0.0206 -0.0208 283  LEU A CD1 
2597 C  CD2 . LEU A  395 ? 0.6818 0.6405 0.7605 0.0307  -0.0248 -0.0188 283  LEU A CD2 
2598 N  N   . ALA A  396 ? 0.6095 0.5616 0.6858 0.0175  -0.0194 -0.0216 284  ALA A N   
2599 C  CA  . ALA A  396 ? 0.5994 0.5503 0.6754 0.0159  -0.0180 -0.0237 284  ALA A CA  
2600 C  C   . ALA A  396 ? 0.6538 0.5995 0.7334 0.0150  -0.0203 -0.0229 284  ALA A C   
2601 O  O   . ALA A  396 ? 0.6470 0.5913 0.7272 0.0151  -0.0210 -0.0264 284  ALA A O   
2602 C  CB  . ALA A  396 ? 0.6042 0.5587 0.6785 0.0141  -0.0148 -0.0218 284  ALA A CB  
2603 N  N   . ALA A  397 ? 0.6117 0.5550 0.6937 0.0137  -0.0216 -0.0184 285  ALA A N   
2604 C  CA  . ALA A  397 ? 0.6174 0.5555 0.7028 0.0117  -0.0236 -0.0176 285  ALA A CA  
2605 C  C   . ALA A  397 ? 0.6961 0.6275 0.7833 0.0131  -0.0258 -0.0214 285  ALA A C   
2606 O  O   . ALA A  397 ? 0.6998 0.6281 0.7889 0.0110  -0.0268 -0.0236 285  ALA A O   
2607 C  CB  . ALA A  397 ? 0.6257 0.5627 0.7129 0.0097  -0.0243 -0.0117 285  ALA A CB  
2608 N  N   . SER A  398 ? 0.6732 0.6038 0.7599 0.0167  -0.0263 -0.0224 286  SER A N   
2609 C  CA  . SER A  398 ? 0.6724 0.5972 0.7608 0.0192  -0.0280 -0.0262 286  SER A CA  
2610 C  C   . SER A  398 ? 0.7479 0.6753 0.8351 0.0195  -0.0279 -0.0329 286  SER A C   
2611 O  O   . SER A  398 ? 0.7561 0.6800 0.8445 0.0217  -0.0290 -0.0371 286  SER A O   
2612 C  CB  . SER A  398 ? 0.6857 0.6108 0.7740 0.0236  -0.0283 -0.0243 286  SER A CB  
2613 O  OG  . SER A  398 ? 0.7468 0.6798 0.8318 0.0257  -0.0273 -0.0271 286  SER A OG  
2614 N  N   . ASN A  399 ? 0.6987 0.6323 0.7838 0.0177  -0.0264 -0.0337 287  ASN A N   
2615 C  CA  . ASN A  399 ? 0.6948 0.6323 0.7788 0.0177  -0.0261 -0.0388 287  ASN A CA  
2616 C  C   . ASN A  399 ? 0.7598 0.6944 0.8466 0.0160  -0.0278 -0.0426 287  ASN A C   
2617 O  O   . ASN A  399 ? 0.7571 0.6941 0.8437 0.0169  -0.0283 -0.0477 287  ASN A O   
2618 C  CB  . ASN A  399 ? 0.6142 0.5579 0.6960 0.0162  -0.0237 -0.0374 287  ASN A CB  
2619 C  CG  . ASN A  399 ? 0.7752 0.7199 0.8586 0.0132  -0.0233 -0.0347 287  ASN A CG  
2620 O  OD1 . ASN A  399 ? 0.6282 0.5749 0.7133 0.0115  -0.0240 -0.0369 287  ASN A OD1 
2621 N  ND2 . ASN A  399 ? 0.6994 0.6445 0.7826 0.0122  -0.0220 -0.0300 287  ASN A ND2 
2622 N  N   . CYS A  400 ? 0.7267 0.6570 0.8159 0.0129  -0.0284 -0.0404 288  CYS A N   
2623 C  CA  . CYS A  400 ? 0.7309 0.6585 0.8227 0.0098  -0.0296 -0.0441 288  CYS A CA  
2624 C  C   . CYS A  400 ? 0.7894 0.7093 0.8829 0.0120  -0.0308 -0.0489 288  CYS A C   
2625 O  O   . CYS A  400 ? 0.7936 0.7130 0.8886 0.0100  -0.0315 -0.0545 288  CYS A O   
2626 C  CB  . CYS A  400 ? 0.7351 0.6603 0.8285 0.0053  -0.0297 -0.0402 288  CYS A CB  
2627 S  SG  . CYS A  400 ? 0.7886 0.7028 0.8838 0.0059  -0.0303 -0.0352 288  CYS A SG  
2628 N  N   . CYS A  401 ? 0.7228 0.6380 0.8162 0.0164  -0.0310 -0.0468 289  CYS A N   
2629 C  CA  . CYS A  401 ? 0.7089 0.6170 0.8041 0.0201  -0.0317 -0.0503 289  CYS A CA  
2630 C  C   . CYS A  401 ? 0.7384 0.6527 0.8322 0.0231  -0.0319 -0.0565 289  CYS A C   
2631 O  O   . CYS A  401 ? 0.7446 0.6544 0.8402 0.0253  -0.0324 -0.0616 289  CYS A O   
2632 C  CB  . CYS A  401 ? 0.7155 0.6187 0.8114 0.0240  -0.0316 -0.0445 289  CYS A CB  
2633 S  SG  . CYS A  401 ? 0.7725 0.6677 0.8706 0.0203  -0.0316 -0.0372 289  CYS A SG  
2634 N  N   . PHE A  402 ? 0.6725 0.5969 0.7632 0.0231  -0.0313 -0.0562 290  PHE A N   
2635 C  CA  . PHE A  402 ? 0.6517 0.5835 0.7406 0.0252  -0.0314 -0.0613 290  PHE A CA  
2636 C  C   . PHE A  402 ? 0.7123 0.6486 0.8020 0.0221  -0.0319 -0.0670 290  PHE A C   
2637 O  O   . PHE A  402 ? 0.7100 0.6509 0.7995 0.0239  -0.0324 -0.0724 290  PHE A O   
2638 C  CB  . PHE A  402 ? 0.6633 0.6034 0.7484 0.0257  -0.0302 -0.0585 290  PHE A CB  
2639 C  CG  . PHE A  402 ? 0.6736 0.6138 0.7571 0.0289  -0.0297 -0.0549 290  PHE A CG  
2640 C  CD1 . PHE A  402 ? 0.6962 0.6334 0.7797 0.0281  -0.0290 -0.0488 290  PHE A CD1 
2641 C  CD2 . PHE A  402 ? 0.6968 0.6421 0.7784 0.0324  -0.0299 -0.0574 290  PHE A CD2 
2642 C  CE1 . PHE A  402 ? 0.6966 0.6364 0.7786 0.0306  -0.0285 -0.0454 290  PHE A CE1 
2643 C  CE2 . PHE A  402 ? 0.7289 0.6768 0.8090 0.0350  -0.0294 -0.0538 290  PHE A CE2 
2644 C  CZ  . PHE A  402 ? 0.6922 0.6375 0.7725 0.0340  -0.0286 -0.0479 290  PHE A CZ  
2645 N  N   . ASP A  403 ? 0.6753 0.6125 0.7659 0.0174  -0.0316 -0.0655 291  ASP A N   
2646 C  CA  . ASP A  403 ? 0.6819 0.6268 0.7732 0.0140  -0.0319 -0.0700 291  ASP A CA  
2647 C  C   . ASP A  403 ? 0.7536 0.6946 0.8475 0.0130  -0.0329 -0.0774 291  ASP A C   
2648 O  O   . ASP A  403 ? 0.7419 0.6911 0.8356 0.0128  -0.0333 -0.0828 291  ASP A O   
2649 C  CB  . ASP A  403 ? 0.7115 0.6610 0.8030 0.0096  -0.0311 -0.0657 291  ASP A CB  
2650 C  CG  . ASP A  403 ? 0.8176 0.7717 0.9065 0.0111  -0.0295 -0.0598 291  ASP A CG  
2651 O  OD1 . ASP A  403 ? 0.8138 0.7732 0.9006 0.0133  -0.0289 -0.0608 291  ASP A OD1 
2652 O  OD2 . ASP A  403 ? 0.8964 0.8483 0.9853 0.0098  -0.0286 -0.0544 291  ASP A OD2 
2653 N  N   . PRO A  404 ? 0.7512 0.6799 0.8475 0.0128  -0.0331 -0.0781 292  PRO A N   
2654 C  CA  . PRO A  404 ? 0.7544 0.6782 0.8530 0.0125  -0.0333 -0.0863 292  PRO A CA  
2655 C  C   . PRO A  404 ? 0.7947 0.7210 0.8926 0.0184  -0.0337 -0.0908 292  PRO A C   
2656 O  O   . PRO A  404 ? 0.7873 0.7188 0.8860 0.0177  -0.0339 -0.0984 292  PRO A O   
2657 C  CB  . PRO A  404 ? 0.7802 0.6883 0.8813 0.0122  -0.0329 -0.0843 292  PRO A CB  
2658 C  CG  . PRO A  404 ? 0.8362 0.7445 0.9364 0.0097  -0.0328 -0.0758 292  PRO A CG  
2659 C  CD  . PRO A  404 ? 0.7760 0.6944 0.8731 0.0128  -0.0327 -0.0718 292  PRO A CD  
2660 N  N   . LEU A  405 ? 0.7499 0.6756 0.8463 0.0238  -0.0336 -0.0861 293  LEU A N   
2661 C  CA  . LEU A  405 ? 0.7489 0.6793 0.8442 0.0294  -0.0339 -0.0894 293  LEU A CA  
2662 C  C   . LEU A  405 ? 0.7873 0.7323 0.8802 0.0280  -0.0343 -0.0925 293  LEU A C   
2663 O  O   . LEU A  405 ? 0.7749 0.7252 0.8678 0.0307  -0.0348 -0.0982 293  LEU A O   
2664 C  CB  . LEU A  405 ? 0.7508 0.6798 0.8444 0.0343  -0.0337 -0.0830 293  LEU A CB  
2665 C  CG  . LEU A  405 ? 0.8052 0.7227 0.9014 0.0392  -0.0334 -0.0806 293  LEU A CG  
2666 C  CD1 . LEU A  405 ? 0.7920 0.6965 0.8920 0.0378  -0.0330 -0.0843 293  LEU A CD1 
2667 C  CD2 . LEU A  405 ? 0.8473 0.7631 0.9424 0.0397  -0.0330 -0.0716 293  LEU A CD2 
2668 N  N   . LEU A  406 ? 0.7558 0.7078 0.8471 0.0240  -0.0340 -0.0886 294  LEU A N   
2669 C  CA  . LEU A  406 ? 0.7603 0.7260 0.8497 0.0223  -0.0341 -0.0902 294  LEU A CA  
2670 C  C   . LEU A  406 ? 0.8692 0.8404 0.9608 0.0193  -0.0347 -0.0975 294  LEU A C   
2671 O  O   . LEU A  406 ? 0.8643 0.8458 0.9551 0.0199  -0.0353 -0.1019 294  LEU A O   
2672 C  CB  . LEU A  406 ? 0.7540 0.7236 0.8418 0.0192  -0.0329 -0.0833 294  LEU A CB  
2673 C  CG  . LEU A  406 ? 0.7980 0.7806 0.8843 0.0173  -0.0324 -0.0827 294  LEU A CG  
2674 C  CD1 . LEU A  406 ? 0.7831 0.7713 0.8664 0.0202  -0.0322 -0.0834 294  LEU A CD1 
2675 C  CD2 . LEU A  406 ? 0.8470 0.8304 0.9325 0.0151  -0.0308 -0.0756 294  LEU A CD2 
2676 N  N   . TYR A  407 ? 0.8898 0.8545 0.9839 0.0157  -0.0347 -0.0994 295  TYR A N   
2677 C  CA  . TYR A  407 ? 0.9125 0.8823 1.0087 0.0118  -0.0350 -0.1073 295  TYR A CA  
2678 C  C   . TYR A  407 ? 0.9412 0.9072 1.0387 0.0154  -0.0353 -0.1159 295  TYR A C   
2679 O  O   . TYR A  407 ? 0.9192 0.8958 1.0172 0.0137  -0.0356 -0.1229 295  TYR A O   
2680 C  CB  . TYR A  407 ? 0.9583 0.9224 1.0564 0.0061  -0.0346 -0.1069 295  TYR A CB  
2681 C  CG  . TYR A  407 ? 1.0221 0.9941 1.1219 0.0007  -0.0347 -0.1153 295  TYR A CG  
2682 C  CD1 . TYR A  407 ? 1.0579 1.0479 1.1573 -0.0033 -0.0350 -0.1150 295  TYR A CD1 
2683 C  CD2 . TYR A  407 ? 1.0473 1.0097 1.1493 -0.0003 -0.0342 -0.1236 295  TYR A CD2 
2684 C  CE1 . TYR A  407 ? 1.0849 1.0850 1.1858 -0.0086 -0.0351 -0.1229 295  TYR A CE1 
2685 C  CE2 . TYR A  407 ? 1.0663 1.0372 1.1697 -0.0058 -0.0340 -0.1325 295  TYR A CE2 
2686 C  CZ  . TYR A  407 ? 1.2011 1.1918 1.3038 -0.0102 -0.0346 -0.1322 295  TYR A CZ  
2687 O  OH  . TYR A  407 ? 1.2678 1.2694 1.3718 -0.0163 -0.0344 -0.1409 295  TYR A OH  
2688 N  N   . PHE A  408 ? 0.9125 0.8647 1.0109 0.0205  -0.0349 -0.1152 296  PHE A N   
2689 C  CA  . PHE A  408 ? 0.9282 0.8764 1.0282 0.0252  -0.0347 -0.1228 296  PHE A CA  
2690 C  C   . PHE A  408 ? 0.9583 0.9201 1.0561 0.0292  -0.0355 -0.1249 296  PHE A C   
2691 O  O   . PHE A  408 ? 0.9417 0.9093 1.0406 0.0300  -0.0356 -0.1333 296  PHE A O   
2692 C  CB  . PHE A  408 ? 0.9726 0.9041 1.0742 0.0311  -0.0338 -0.1198 296  PHE A CB  
2693 C  CG  . PHE A  408 ? 1.0293 0.9444 1.1330 0.0288  -0.0328 -0.1161 296  PHE A CG  
2694 C  CD1 . PHE A  408 ? 1.0962 1.0084 1.2014 0.0214  -0.0324 -0.1195 296  PHE A CD1 
2695 C  CD2 . PHE A  408 ? 1.0773 0.9809 1.1819 0.0340  -0.0323 -0.1095 296  PHE A CD2 
2696 C  CE1 . PHE A  408 ? 1.1150 1.0123 1.2220 0.0187  -0.0314 -0.1159 296  PHE A CE1 
2697 C  CE2 . PHE A  408 ? 1.1221 1.0109 1.2289 0.0318  -0.0314 -0.1056 296  PHE A CE2 
2698 C  CZ  . PHE A  408 ? 1.1028 0.9880 1.2106 0.0240  -0.0310 -0.1089 296  PHE A CZ  
2699 N  N   . PHE A  409 ? 0.9089 0.8763 1.0037 0.0312  -0.0359 -0.1176 297  PHE A N   
2700 C  CA  . PHE A  409 ? 0.9014 0.8806 0.9937 0.0347  -0.0365 -0.1186 297  PHE A CA  
2701 C  C   . PHE A  409 ? 0.9528 0.9484 1.0432 0.0307  -0.0371 -0.1193 297  PHE A C   
2702 O  O   . PHE A  409 ? 0.9457 0.9523 1.0348 0.0327  -0.0377 -0.1226 297  PHE A O   
2703 C  CB  . PHE A  409 ? 0.9236 0.9002 1.0136 0.0389  -0.0363 -0.1113 297  PHE A CB  
2704 C  CG  . PHE A  409 ? 0.9493 0.9129 1.0413 0.0444  -0.0358 -0.1101 297  PHE A CG  
2705 C  CD1 . PHE A  409 ? 1.0027 0.9651 1.0966 0.0500  -0.0357 -0.1160 297  PHE A CD1 
2706 C  CD2 . PHE A  409 ? 0.9909 0.9439 1.0833 0.0442  -0.0352 -0.1029 297  PHE A CD2 
2707 C  CE1 . PHE A  409 ? 1.0276 0.9775 1.1240 0.0558  -0.0349 -0.1140 297  PHE A CE1 
2708 C  CE2 . PHE A  409 ? 1.0377 0.9792 1.1324 0.0494  -0.0346 -0.1008 297  PHE A CE2 
2709 C  CZ  . PHE A  409 ? 1.0139 0.9535 1.1108 0.0554  -0.0344 -0.1061 297  PHE A CZ  
2710 N  N   . SER A  410 ? 0.9179 0.9163 1.0084 0.0251  -0.0368 -0.1161 298  SER A N   
2711 C  CA  . SER A  410 ? 0.9150 0.9289 1.0040 0.0215  -0.0370 -0.1149 298  SER A CA  
2712 C  C   . SER A  410 ? 0.9944 1.0161 1.0858 0.0159  -0.0373 -0.1186 298  SER A C   
2713 O  O   . SER A  410 ? 0.9926 1.0283 1.0833 0.0130  -0.0373 -0.1167 298  SER A O   
2714 C  CB  . SER A  410 ? 0.9369 0.9505 1.0234 0.0208  -0.0360 -0.1055 298  SER A CB  
2715 O  OG  . SER A  410 ? 1.0088 1.0361 1.0937 0.0185  -0.0358 -0.1034 298  SER A OG  
2716 N  N   . GLY A  411 ? 0.9623 0.9754 1.0564 0.0144  -0.0371 -0.1239 299  GLY A N   
2717 C  CA  . GLY A  411 ? 1.2994 1.3197 1.3956 0.0083  -0.0371 -0.1283 299  GLY A CA  
2718 C  C   . GLY A  411 ? 1.6870 1.7160 1.7846 0.0075  -0.0376 -0.1392 299  GLY A C   
2719 O  O   . GLY A  411 ? 1.2420 1.2744 1.3416 0.0024  -0.0373 -0.1452 299  GLY A O   
2720 N  N   . CYS B  17  ? 1.8156 1.8618 1.9085 0.0110  -0.1222 -0.1834 14   CYS B N   
2721 C  CA  . CYS B  17  ? 1.8182 1.8753 1.8979 0.0168  -0.1218 -0.1918 14   CYS B CA  
2722 C  C   . CYS B  17  ? 1.8729 1.9241 1.9582 0.0292  -0.1212 -0.2003 14   CYS B C   
2723 O  O   . CYS B  17  ? 1.8770 1.9092 1.9679 0.0320  -0.1276 -0.2057 14   CYS B O   
2724 C  CB  . CYS B  17  ? 1.8190 1.9012 1.8870 0.0144  -0.1159 -0.1876 14   CYS B CB  
2725 S  SG  . CYS B  17  ? 1.8633 1.9581 1.9400 0.0167  -0.1074 -0.1795 14   CYS B SG  
2726 N  N   . HIS B  18  ? 1.8166 1.8833 1.9007 0.0365  -0.1144 -0.2013 15   HIS B N   
2727 C  CA  . HIS B  18  ? 1.8071 1.8692 1.8969 0.0486  -0.1136 -0.2089 15   HIS B CA  
2728 C  C   . HIS B  18  ? 1.8263 1.8837 1.9331 0.0496  -0.1103 -0.2026 15   HIS B C   
2729 O  O   . HIS B  18  ? 1.8150 1.8867 1.9230 0.0475  -0.1037 -0.1955 15   HIS B O   
2730 C  CB  . HIS B  18  ? 1.8149 1.8976 1.8926 0.0569  -0.1083 -0.2146 15   HIS B CB  
2731 C  CG  . HIS B  18  ? 1.8573 1.9344 1.9401 0.0701  -0.1084 -0.2234 15   HIS B CG  
2732 N  ND1 . HIS B  18  ? 1.8733 1.9574 1.9659 0.0754  -0.1026 -0.2206 15   HIS B ND1 
2733 C  CD2 . HIS B  18  ? 1.8841 1.9477 1.9634 0.0783  -0.1144 -0.2345 15   HIS B CD2 
2734 C  CE1 . HIS B  18  ? 1.8666 1.9420 1.9618 0.0868  -0.1052 -0.2302 15   HIS B CE1 
2735 N  NE2 . HIS B  18  ? 1.8772 1.9395 1.9643 0.0891  -0.1126 -0.2388 15   HIS B NE2 
2736 N  N   . ASP B  19  ? 1.7637 1.8007 1.8835 0.0524  -0.1155 -0.2047 16   ASP B N   
2737 C  CA  . ASP B  19  ? 1.7478 1.7789 1.8846 0.0534  -0.1131 -0.1988 16   ASP B CA  
2738 C  C   . ASP B  19  ? 1.7571 1.7862 1.9007 0.0649  -0.1126 -0.2051 16   ASP B C   
2739 O  O   . ASP B  19  ? 1.7536 1.7680 1.8999 0.0708  -0.1193 -0.2128 16   ASP B O   
2740 C  CB  . ASP B  19  ? 1.7758 1.7877 1.9250 0.0471  -0.1186 -0.1936 16   ASP B CB  
2741 C  CG  . ASP B  19  ? 1.9357 1.9297 2.0850 0.0484  -0.1279 -0.2005 16   ASP B CG  
2742 O  OD1 . ASP B  19  ? 1.9536 1.9475 2.0911 0.0437  -0.1313 -0.2029 16   ASP B OD1 
2743 O  OD2 . ASP B  19  ? 2.0191 1.9989 2.1802 0.0537  -0.1325 -0.2031 16   ASP B OD2 
2744 N  N   . THR B  20  ? 1.6763 1.7200 1.8222 0.0678  -0.1051 -0.2015 17   THR B N   
2745 C  CA  . THR B  20  ? 1.6550 1.6996 1.8087 0.0780  -0.1034 -0.2057 17   THR B CA  
2746 C  C   . THR B  20  ? 1.6676 1.7064 1.8386 0.0753  -0.1013 -0.1968 17   THR B C   
2747 O  O   . THR B  20  ? 1.6626 1.7007 1.8431 0.0822  -0.1001 -0.1981 17   THR B O   
2748 C  CB  . THR B  20  ? 1.7140 1.7811 1.8566 0.0843  -0.0965 -0.2090 17   THR B CB  
2749 O  OG1 . THR B  20  ? 1.6721 1.7485 1.8239 0.0861  -0.0902 -0.2030 17   THR B OG1 
2750 C  CG2 . THR B  20  ? 1.6828 1.7669 1.8093 0.0779  -0.0932 -0.2063 17   THR B CG2 
2751 N  N   . ILE B  21  ? 1.5933 1.6276 1.7679 0.0655  -0.1012 -0.1878 18   ILE B N   
2752 C  CA  . ILE B  21  ? 1.5747 1.6046 1.7635 0.0619  -0.0987 -0.1784 18   ILE B CA  
2753 C  C   . ILE B  21  ? 1.5964 1.6065 1.8011 0.0632  -0.1051 -0.1783 18   ILE B C   
2754 O  O   . ILE B  21  ? 1.5901 1.5976 1.8080 0.0646  -0.1033 -0.1733 18   ILE B O   
2755 C  CB  . ILE B  21  ? 1.6123 1.6477 1.7964 0.0517  -0.0953 -0.1688 18   ILE B CB  
2756 N  N   . ASP B  22  ? 1.5316 1.5282 1.7352 0.0623  -0.1129 -0.1830 19   ASP B N   
2757 C  CA  . ASP B  22  ? 1.5174 1.4949 1.7359 0.0625  -0.1204 -0.1820 19   ASP B CA  
2758 C  C   . ASP B  22  ? 1.5153 1.4868 1.7479 0.0700  -0.1224 -0.1834 19   ASP B C   
2759 O  O   . ASP B  22  ? 1.5075 1.4711 1.7558 0.0678  -0.1237 -0.1762 19   ASP B O   
2760 C  CB  . ASP B  22  ? 1.5517 1.5168 1.7641 0.0621  -0.1292 -0.1889 19   ASP B CB  
2761 C  CG  . ASP B  22  ? 1.7374 1.7029 1.9415 0.0530  -0.1296 -0.1852 19   ASP B CG  
2762 O  OD1 . ASP B  22  ? 1.7487 1.7268 1.9474 0.0477  -0.1227 -0.1791 19   ASP B OD1 
2763 O  OD2 . ASP B  22  ? 1.8405 1.7933 2.0435 0.0509  -0.1373 -0.1884 19   ASP B OD2 
2764 N  N   . ASP B  23  ? 1.4328 1.4087 1.6600 0.0788  -0.1226 -0.1923 20   ASP B N   
2765 C  CA  . ASP B  23  ? 1.4136 1.3839 1.6540 0.0861  -0.1250 -0.1940 20   ASP B CA  
2766 C  C   . ASP B  23  ? 1.3887 1.3712 1.6362 0.0856  -0.1165 -0.1864 20   ASP B C   
2767 O  O   . ASP B  23  ? 1.3701 1.3461 1.6333 0.0873  -0.1183 -0.1826 20   ASP B O   
2768 C  CB  . ASP B  23  ? 1.4530 1.4210 1.6857 0.0967  -0.1296 -0.2067 20   ASP B CB  
2769 C  CG  . ASP B  23  ? 1.6856 1.6728 1.9019 0.1009  -0.1221 -0.2121 20   ASP B CG  
2770 O  OD1 . ASP B  23  ? 1.7102 1.7033 1.9115 0.0976  -0.1210 -0.2145 20   ASP B OD1 
2771 O  OD2 . ASP B  23  ? 1.7941 1.7908 2.0129 0.1073  -0.1178 -0.2136 20   ASP B OD2 
2772 N  N   . PHE B  24  ? 1.3057 1.3056 1.5420 0.0828  -0.1078 -0.1837 21   PHE B N   
2773 C  CA  . PHE B  24  ? 1.2778 1.2898 1.5185 0.0813  -0.0996 -0.1759 21   PHE B CA  
2774 C  C   . PHE B  24  ? 1.2674 1.2725 1.5199 0.0739  -0.0988 -0.1647 21   PHE B C   
2775 O  O   . PHE B  24  ? 1.2640 1.2689 1.5286 0.0751  -0.0967 -0.1595 21   PHE B O   
2776 C  CB  . PHE B  24  ? 1.2981 1.3291 1.5228 0.0790  -0.0921 -0.1749 21   PHE B CB  
2777 C  CG  . PHE B  24  ? 1.3113 1.3527 1.5382 0.0741  -0.0846 -0.1646 21   PHE B CG  
2778 C  CD1 . PHE B  24  ? 1.3403 1.3909 1.5718 0.0787  -0.0801 -0.1634 21   PHE B CD1 
2779 C  CD2 . PHE B  24  ? 1.3391 1.3801 1.5632 0.0650  -0.0826 -0.1562 21   PHE B CD2 
2780 C  CE1 . PHE B  24  ? 1.3479 1.4068 1.5808 0.0739  -0.0738 -0.1537 21   PHE B CE1 
2781 C  CE2 . PHE B  24  ? 1.3686 1.4171 1.5937 0.0609  -0.0766 -0.1469 21   PHE B CE2 
2782 C  CZ  . PHE B  24  ? 1.3376 1.3949 1.5669 0.0652  -0.0723 -0.1456 21   PHE B CZ  
2783 N  N   . ARG B  25  ? 1.1636 1.1640 1.4121 0.0666  -0.1002 -0.1611 22   ARG B N   
2784 C  CA  . ARG B  25  ? 1.1346 1.1285 1.3925 0.0600  -0.0995 -0.1511 22   ARG B CA  
2785 C  C   . ARG B  25  ? 1.1409 1.1221 1.4177 0.0628  -0.1047 -0.1490 22   ARG B C   
2786 O  O   . ARG B  25  ? 1.1152 1.0975 1.4028 0.0619  -0.1014 -0.1413 22   ARG B O   
2787 C  CB  . ARG B  25  ? 1.1274 1.1155 1.3789 0.0537  -0.1028 -0.1504 22   ARG B CB  
2788 C  CG  . ARG B  25  ? 1.2341 1.2337 1.4689 0.0485  -0.0982 -0.1492 22   ARG B CG  
2789 C  CD  . ARG B  25  ? 1.3192 1.3122 1.5473 0.0433  -0.1030 -0.1507 22   ARG B CD  
2790 N  NE  . ARG B  25  ? 1.4843 1.4678 1.7220 0.0381  -0.1043 -0.1427 22   ARG B NE  
2791 C  CZ  . ARG B  25  ? 1.7089 1.6881 1.9417 0.0321  -0.1069 -0.1409 22   ARG B CZ  
2792 N  NH1 . ARG B  25  ? 1.5111 1.4826 1.7539 0.0285  -0.1076 -0.1334 22   ARG B NH1 
2793 N  NH2 . ARG B  25  ? 1.5987 1.5820 1.8169 0.0297  -0.1089 -0.1463 22   ARG B NH2 
2794 N  N   . ASN B  26  ? 1.0886 1.0580 1.3690 0.0663  -0.1135 -0.1559 23   ASN B N   
2795 C  CA  . ASN B  26  ? 1.0760 1.0318 1.3740 0.0688  -0.1209 -0.1544 23   ASN B CA  
2796 C  C   . ASN B  26  ? 1.0967 1.0550 1.4048 0.0747  -0.1200 -0.1545 23   ASN B C   
2797 O  O   . ASN B  26  ? 1.0749 1.0260 1.3999 0.0742  -0.1232 -0.1482 23   ASN B O   
2798 C  CB  . ASN B  26  ? 1.0959 1.0382 1.3921 0.0713  -0.1313 -0.1627 23   ASN B CB  
2799 C  CG  . ASN B  26  ? 1.4805 1.4166 1.7723 0.0647  -0.1343 -0.1607 23   ASN B CG  
2800 O  OD1 . ASN B  26  ? 1.4306 1.3657 1.7299 0.0586  -0.1324 -0.1513 23   ASN B OD1 
2801 N  ND2 . ASN B  26  ? 1.4279 1.3594 1.7074 0.0662  -0.1395 -0.1697 23   ASN B ND2 
2802 N  N   . GLN B  27  ? 1.0375 1.0068 1.3359 0.0800  -0.1155 -0.1608 24   GLN B N   
2803 C  CA  . GLN B  27  ? 1.0249 0.9976 1.3316 0.0860  -0.1144 -0.1617 24   GLN B CA  
2804 C  C   . GLN B  27  ? 1.0534 1.0360 1.3656 0.0822  -0.1059 -0.1515 24   GLN B C   
2805 O  O   . GLN B  27  ? 1.0458 1.0246 1.3731 0.0831  -0.1073 -0.1465 24   GLN B O   
2806 C  CB  . GLN B  27  ? 1.0425 1.0229 1.3372 0.0940  -0.1136 -0.1728 24   GLN B CB  
2807 N  N   . VAL B  28  ? 0.9886 0.9834 1.2880 0.0778  -0.0978 -0.1482 25   VAL B N   
2808 C  CA  . VAL B  28  ? 0.9658 0.9697 1.2665 0.0739  -0.0898 -0.1388 25   VAL B CA  
2809 C  C   . VAL B  28  ? 0.9661 0.9623 1.2778 0.0682  -0.0901 -0.1288 25   VAL B C   
2810 O  O   . VAL B  28  ? 0.9613 0.9582 1.2836 0.0678  -0.0876 -0.1218 25   VAL B O   
2811 C  CB  . VAL B  28  ? 1.0140 1.0320 1.2969 0.0708  -0.0827 -0.1383 25   VAL B CB  
2812 C  CG1 . VAL B  28  ? 1.0084 1.0335 1.2917 0.0661  -0.0755 -0.1281 25   VAL B CG1 
2813 C  CG2 . VAL B  28  ? 1.0087 1.0370 1.2828 0.0772  -0.0815 -0.1469 25   VAL B CG2 
2814 N  N   . TYR B  29  ? 0.8873 0.8764 1.1966 0.0641  -0.0933 -0.1281 26   TYR B N   
2815 C  CA  . TYR B  29  ? 0.8786 0.8610 1.1979 0.0592  -0.0936 -0.1189 26   TYR B CA  
2816 C  C   . TYR B  29  ? 0.9101 0.8841 1.2494 0.0614  -0.0988 -0.1152 26   TYR B C   
2817 O  O   . TYR B  29  ? 0.9038 0.8790 1.2523 0.0592  -0.0953 -0.1059 26   TYR B O   
2818 C  CB  . TYR B  29  ? 0.9020 0.8785 1.2155 0.0550  -0.0968 -0.1195 26   TYR B CB  
2819 C  CG  . TYR B  29  ? 0.9279 0.9117 1.2265 0.0497  -0.0909 -0.1166 26   TYR B CG  
2820 C  CD1 . TYR B  29  ? 0.9479 0.9378 1.2451 0.0470  -0.0839 -0.1084 26   TYR B CD1 
2821 C  CD2 . TYR B  29  ? 0.9457 0.9289 1.2315 0.0472  -0.0932 -0.1217 26   TYR B CD2 
2822 C  CE1 . TYR B  29  ? 0.9627 0.9575 1.2458 0.0422  -0.0798 -0.1056 26   TYR B CE1 
2823 C  CE2 . TYR B  29  ? 0.9602 0.9492 1.2329 0.0420  -0.0890 -0.1186 26   TYR B CE2 
2824 C  CZ  . TYR B  29  ? 1.0419 1.0362 1.3134 0.0396  -0.0826 -0.1106 26   TYR B CZ  
2825 O  OH  . TYR B  29  ? 1.0566 1.0549 1.3149 0.0345  -0.0797 -0.1075 26   TYR B OH  
2826 N  N   . SER B  30  ? 0.8652 0.8308 1.2106 0.0660  -0.1072 -0.1223 27   SER B N   
2827 C  CA  . SER B  30  ? 0.8530 0.8098 1.2177 0.0682  -0.1141 -0.1191 27   SER B CA  
2828 C  C   . SER B  30  ? 0.8557 0.8187 1.2287 0.0704  -0.1102 -0.1151 27   SER B C   
2829 O  O   . SER B  30  ? 0.8443 0.8049 1.2327 0.0684  -0.1110 -0.1061 27   SER B O   
2830 C  CB  . SER B  30  ? 0.9241 0.8700 1.2904 0.0732  -0.1247 -0.1289 27   SER B CB  
2831 O  OG  . SER B  30  ? 1.1062 1.0430 1.4709 0.0702  -0.1304 -0.1298 27   SER B OG  
2832 N  N   . THR B  31  ? 0.7781 0.7498 1.1412 0.0743  -0.1059 -0.1212 28   THR B N   
2833 C  CA  . THR B  31  ? 0.7652 0.7433 1.1350 0.0765  -0.1022 -0.1182 28   THR B CA  
2834 C  C   . THR B  31  ? 0.7942 0.7792 1.1651 0.0710  -0.0938 -0.1067 28   THR B C   
2835 O  O   . THR B  31  ? 0.7612 0.7442 1.1466 0.0699  -0.0944 -0.0988 28   THR B O   
2836 C  CB  . THR B  31  ? 0.8616 0.8480 1.2199 0.0822  -0.0997 -0.1275 28   THR B CB  
2837 O  OG1 . THR B  31  ? 0.8669 0.8453 1.2247 0.0882  -0.1081 -0.1381 28   THR B OG1 
2838 C  CG2 . THR B  31  ? 0.7889 0.7823 1.1541 0.0846  -0.0961 -0.1245 28   THR B CG2 
2839 N  N   . LEU B  32  ? 0.7603 0.7531 1.1154 0.0676  -0.0866 -0.1057 29   LEU B N   
2840 C  CA  . LEU B  32  ? 0.7542 0.7529 1.1064 0.0629  -0.0789 -0.0960 29   LEU B CA  
2841 C  C   . LEU B  32  ? 0.7640 0.7566 1.1268 0.0591  -0.0794 -0.0866 29   LEU B C   
2842 O  O   . LEU B  32  ? 0.7452 0.7400 1.1156 0.0579  -0.0758 -0.0783 29   LEU B O   
2843 C  CB  . LEU B  32  ? 0.7672 0.7739 1.0997 0.0601  -0.0730 -0.0974 29   LEU B CB  
2844 C  CG  . LEU B  32  ? 0.8383 0.8546 1.1600 0.0634  -0.0708 -0.1044 29   LEU B CG  
2845 C  CD1 . LEU B  32  ? 0.8543 0.8785 1.1577 0.0594  -0.0658 -0.1036 29   LEU B CD1 
2846 C  CD2 . LEU B  32  ? 0.8515 0.8733 1.1799 0.0659  -0.0679 -0.1016 29   LEU B CD2 
2847 N  N   . TYR B  33  ? 0.7025 0.6880 1.0668 0.0575  -0.0839 -0.0874 30   TYR B N   
2848 C  CA  . TYR B  33  ? 0.7067 0.6876 1.0824 0.0544  -0.0845 -0.0780 30   TYR B CA  
2849 C  C   . TYR B  33  ? 0.8111 0.7883 1.2073 0.0560  -0.0891 -0.0730 30   TYR B C   
2850 O  O   . TYR B  33  ? 0.8227 0.8019 1.2276 0.0540  -0.0858 -0.0629 30   TYR B O   
2851 C  CB  . TYR B  33  ? 0.7200 0.6941 1.0942 0.0523  -0.0890 -0.0796 30   TYR B CB  
2852 C  CG  . TYR B  33  ? 0.7315 0.7090 1.0877 0.0491  -0.0843 -0.0812 30   TYR B CG  
2853 C  CD1 . TYR B  33  ? 0.7538 0.7376 1.1014 0.0467  -0.0763 -0.0751 30   TYR B CD1 
2854 C  CD2 . TYR B  33  ? 0.7381 0.7116 1.0861 0.0483  -0.0886 -0.0883 30   TYR B CD2 
2855 C  CE1 . TYR B  33  ? 0.7424 0.7283 1.0735 0.0436  -0.0732 -0.0763 30   TYR B CE1 
2856 C  CE2 . TYR B  33  ? 0.7493 0.7257 1.0814 0.0448  -0.0852 -0.0892 30   TYR B CE2 
2857 C  CZ  . TYR B  33  ? 0.7565 0.7391 1.0805 0.0425  -0.0777 -0.0832 30   TYR B CZ  
2858 O  OH  . TYR B  33  ? 0.6934 0.6781 1.0019 0.0389  -0.0754 -0.0839 30   TYR B OH  
2859 N  N   . SER B  34  ? 0.7852 0.7573 1.1885 0.0600  -0.0969 -0.0800 31   SER B N   
2860 C  CA  . SER B  34  ? 0.7759 0.7439 1.1988 0.0616  -0.1029 -0.0759 31   SER B CA  
2861 C  C   . SER B  34  ? 0.8000 0.7758 1.2262 0.0615  -0.0966 -0.0698 31   SER B C   
2862 O  O   . SER B  34  ? 0.7857 0.7618 1.2259 0.0595  -0.0966 -0.0598 31   SER B O   
2863 C  CB  . SER B  34  ? 0.8281 0.7887 1.2540 0.0667  -0.1123 -0.0861 31   SER B CB  
2864 O  OG  . SER B  34  ? 0.9352 0.8858 1.3635 0.0663  -0.1206 -0.0892 31   SER B OG  
2865 N  N   . MET B  35  ? 0.7647 0.7474 1.1778 0.0632  -0.0909 -0.0749 32   MET B N   
2866 C  CA  . MET B  35  ? 0.7689 0.7591 1.1827 0.0628  -0.0846 -0.0696 32   MET B CA  
2867 C  C   . MET B  35  ? 0.7937 0.7880 1.2052 0.0582  -0.0771 -0.0586 32   MET B C   
2868 O  O   . MET B  35  ? 0.7820 0.7779 1.2046 0.0571  -0.0757 -0.0503 32   MET B O   
2869 C  CB  . MET B  35  ? 0.8073 0.8048 1.2058 0.0651  -0.0801 -0.0770 32   MET B CB  
2870 C  CG  . MET B  35  ? 0.8602 0.8563 1.2628 0.0709  -0.0858 -0.0860 32   MET B CG  
2871 S  SD  . MET B  35  ? 0.9298 0.9377 1.3152 0.0731  -0.0787 -0.0918 32   MET B SD  
2872 C  CE  . MET B  35  ? 0.8933 0.8980 1.2818 0.0807  -0.0861 -0.1038 32   MET B CE  
2873 N  N   . ILE B  36  ? 0.7238 0.7194 1.1206 0.0557  -0.0725 -0.0588 33   ILE B N   
2874 C  CA  . ILE B  36  ? 0.7091 0.7073 1.1007 0.0522  -0.0656 -0.0497 33   ILE B CA  
2875 C  C   . ILE B  36  ? 0.7772 0.7722 1.1861 0.0511  -0.0679 -0.0404 33   ILE B C   
2876 O  O   . ILE B  36  ? 0.7892 0.7877 1.2017 0.0498  -0.0630 -0.0312 33   ILE B O   
2877 C  CB  . ILE B  36  ? 0.7369 0.7361 1.1093 0.0502  -0.0619 -0.0528 33   ILE B CB  
2878 C  CG1 . ILE B  36  ? 0.7244 0.7291 1.0806 0.0507  -0.0592 -0.0597 33   ILE B CG1 
2879 C  CG2 . ILE B  36  ? 0.7317 0.7322 1.0987 0.0475  -0.0556 -0.0437 33   ILE B CG2 
2880 C  CD1 . ILE B  36  ? 0.6452 0.6500 0.9857 0.0492  -0.0595 -0.0658 33   ILE B CD1 
2881 N  N   . SER B  37  ? 0.7142 0.7029 1.1338 0.0515  -0.0755 -0.0423 34   SER B N   
2882 C  CA  . SER B  37  ? 0.7057 0.6921 1.1433 0.0503  -0.0788 -0.0329 34   SER B CA  
2883 C  C   . SER B  37  ? 0.7635 0.7522 1.2177 0.0506  -0.0804 -0.0259 34   SER B C   
2884 O  O   . SER B  37  ? 0.7673 0.7596 1.2301 0.0490  -0.0772 -0.0149 34   SER B O   
2885 C  CB  . SER B  37  ? 0.7426 0.7209 1.1889 0.0506  -0.0884 -0.0368 34   SER B CB  
2886 O  OG  . SER B  37  ? 0.8662 0.8421 1.2981 0.0499  -0.0878 -0.0433 34   SER B OG  
2887 N  N   . VAL B  38  ? 0.6911 0.6780 1.1494 0.0530  -0.0853 -0.0321 35   VAL B N   
2888 C  CA  . VAL B  38  ? 0.6764 0.6646 1.1513 0.0532  -0.0882 -0.0260 35   VAL B CA  
2889 C  C   . VAL B  38  ? 0.6814 0.6776 1.1502 0.0519  -0.0789 -0.0199 35   VAL B C   
2890 O  O   . VAL B  38  ? 0.6510 0.6505 1.1305 0.0500  -0.0770 -0.0089 35   VAL B O   
2891 C  CB  . VAL B  38  ? 0.7356 0.7181 1.2183 0.0566  -0.0977 -0.0344 35   VAL B CB  
2892 C  CG1 . VAL B  38  ? 0.7272 0.7106 1.2282 0.0561  -0.1016 -0.0271 35   VAL B CG1 
2893 C  CG2 . VAL B  38  ? 0.7298 0.7027 1.2178 0.0578  -0.1078 -0.0399 35   VAL B CG2 
2894 N  N   . VAL B  39  ? 0.6393 0.6386 1.0906 0.0528  -0.0732 -0.0262 36   VAL B N   
2895 C  CA  . VAL B  39  ? 0.6388 0.6443 1.0818 0.0515  -0.0649 -0.0210 36   VAL B CA  
2896 C  C   . VAL B  39  ? 0.7188 0.7270 1.1557 0.0490  -0.0577 -0.0118 36   VAL B C   
2897 O  O   . VAL B  39  ? 0.7153 0.7272 1.1553 0.0477  -0.0533 -0.0030 36   VAL B O   
2898 C  CB  . VAL B  39  ? 0.6858 0.6942 1.1115 0.0527  -0.0614 -0.0296 36   VAL B CB  
2899 C  CG1 . VAL B  39  ? 0.6819 0.6955 1.0979 0.0507  -0.0535 -0.0236 36   VAL B CG1 
2900 C  CG2 . VAL B  39  ? 0.6813 0.6883 1.1139 0.0562  -0.0678 -0.0379 36   VAL B CG2 
2901 N  N   . GLY B  40  ? 0.6759 0.6819 1.1040 0.0487  -0.0568 -0.0143 37   GLY B N   
2902 C  CA  . GLY B  40  ? 0.6855 0.6930 1.1066 0.0474  -0.0506 -0.0072 37   GLY B CA  
2903 C  C   . GLY B  40  ? 0.7547 0.7639 1.1932 0.0469  -0.0513 0.0038  37   GLY B C   
2904 O  O   . GLY B  40  ? 0.7494 0.7627 1.1857 0.0465  -0.0449 0.0123  37   GLY B O   
2905 N  N   . PHE B  41  ? 0.7260 0.7321 1.1816 0.0470  -0.0593 0.0039  38   PHE B N   
2906 C  CA  . PHE B  41  ? 0.7223 0.7309 1.1972 0.0461  -0.0614 0.0151  38   PHE B CA  
2907 C  C   . PHE B  41  ? 0.7582 0.7721 1.2442 0.0454  -0.0601 0.0236  38   PHE B C   
2908 O  O   . PHE B  41  ? 0.7525 0.7723 1.2412 0.0449  -0.0544 0.0341  38   PHE B O   
2909 C  CB  . PHE B  41  ? 0.7529 0.7560 1.2436 0.0459  -0.0719 0.0134  38   PHE B CB  
2910 C  CG  . PHE B  41  ? 0.7755 0.7819 1.2879 0.0444  -0.0752 0.0261  38   PHE B CG  
2911 C  CD1 . PHE B  41  ? 0.8097 0.8202 1.3240 0.0440  -0.0711 0.0342  38   PHE B CD1 
2912 C  CD2 . PHE B  41  ? 0.8046 0.8109 1.3361 0.0435  -0.0826 0.0305  38   PHE B CD2 
2913 C  CE1 . PHE B  41  ? 0.8120 0.8278 1.3470 0.0427  -0.0737 0.0472  38   PHE B CE1 
2914 C  CE2 . PHE B  41  ? 0.8358 0.8467 1.3879 0.0417  -0.0859 0.0437  38   PHE B CE2 
2915 C  CZ  . PHE B  41  ? 0.8042 0.8204 1.3580 0.0413  -0.0812 0.0522  38   PHE B CZ  
2916 N  N   . PHE B  42  ? 0.6955 0.7075 1.1871 0.0456  -0.0651 0.0191  39   PHE B N   
2917 C  CA  . PHE B  42  ? 0.6815 0.6978 1.1841 0.0445  -0.0649 0.0267  39   PHE B CA  
2918 C  C   . PHE B  42  ? 0.7190 0.7401 1.2069 0.0441  -0.0550 0.0298  39   PHE B C   
2919 O  O   . PHE B  42  ? 0.7006 0.7271 1.1957 0.0428  -0.0518 0.0405  39   PHE B O   
2920 C  CB  . PHE B  42  ? 0.7062 0.7183 1.2196 0.0451  -0.0738 0.0206  39   PHE B CB  
2921 C  CG  . PHE B  42  ? 0.7194 0.7263 1.2519 0.0451  -0.0853 0.0212  39   PHE B CG  
2922 C  CD1 . PHE B  42  ? 0.7483 0.7584 1.3013 0.0427  -0.0894 0.0335  39   PHE B CD1 
2923 C  CD2 . PHE B  42  ? 0.7480 0.7468 1.2775 0.0472  -0.0923 0.0098  39   PHE B CD2 
2924 C  CE1 . PHE B  42  ? 0.7554 0.7600 1.3262 0.0421  -0.1011 0.0349  39   PHE B CE1 
2925 C  CE2 . PHE B  42  ? 0.7829 0.7753 1.3289 0.0471  -0.1037 0.0104  39   PHE B CE2 
2926 C  CZ  . PHE B  42  ? 0.7518 0.7468 1.3187 0.0443  -0.1085 0.0231  39   PHE B CZ  
2927 N  N   . GLY B  43  ? 0.6778 0.6970 1.1455 0.0450  -0.0508 0.0212  40   GLY B N   
2928 C  CA  . GLY B  43  ? 0.6740 0.6960 1.1257 0.0444  -0.0425 0.0236  40   GLY B CA  
2929 C  C   . GLY B  43  ? 0.7348 0.7595 1.1780 0.0445  -0.0350 0.0315  40   GLY B C   
2930 O  O   . GLY B  43  ? 0.7280 0.7560 1.1681 0.0439  -0.0297 0.0392  40   GLY B O   
2931 N  N   . ASN B  44  ? 0.6984 0.7213 1.1374 0.0455  -0.0347 0.0297  41   ASN B N   
2932 C  CA  . ASN B  44  ? 0.6969 0.7221 1.1278 0.0465  -0.0279 0.0366  41   ASN B CA  
2933 C  C   . ASN B  44  ? 0.7768 0.8078 1.2267 0.0466  -0.0280 0.0484  41   ASN B C   
2934 O  O   . ASN B  44  ? 0.7773 0.8127 1.2232 0.0474  -0.0215 0.0566  41   ASN B O   
2935 C  CB  . ASN B  44  ? 0.6283 0.6495 1.0465 0.0475  -0.0273 0.0305  41   ASN B CB  
2936 C  CG  . ASN B  44  ? 0.7033 0.7209 1.0988 0.0471  -0.0247 0.0224  41   ASN B CG  
2937 O  OD1 . ASN B  44  ? 0.6746 0.6926 1.0566 0.0471  -0.0192 0.0252  41   ASN B OD1 
2938 N  ND2 . ASN B  44  ? 0.5189 0.5331 0.9099 0.0466  -0.0291 0.0126  41   ASN B ND2 
2939 N  N   . GLY B  45  ? 0.7543 0.7854 1.2248 0.0457  -0.0358 0.0493  42   GLY B N   
2940 C  CA  . GLY B  45  ? 0.7519 0.7893 1.2442 0.0450  -0.0381 0.0612  42   GLY B CA  
2941 C  C   . GLY B  45  ? 0.8280 0.8712 1.3256 0.0439  -0.0351 0.0697  42   GLY B C   
2942 O  O   . GLY B  45  ? 0.8264 0.8771 1.3291 0.0444  -0.0303 0.0810  42   GLY B O   
2943 N  N   . PHE B  46  ? 0.8138 0.8538 1.3082 0.0427  -0.0373 0.0641  43   PHE B N   
2944 C  CA  . PHE B  46  ? 0.8180 0.8622 1.3156 0.0411  -0.0349 0.0709  43   PHE B CA  
2945 C  C   . PHE B  46  ? 0.8971 0.9440 1.3756 0.0424  -0.0243 0.0753  43   PHE B C   
2946 O  O   . PHE B  46  ? 0.8861 0.9396 1.3702 0.0420  -0.0206 0.0861  43   PHE B O   
2947 C  CB  . PHE B  46  ? 0.8373 0.8770 1.3352 0.0399  -0.0398 0.0629  43   PHE B CB  
2948 C  CG  . PHE B  46  ? 0.8547 0.8981 1.3551 0.0379  -0.0376 0.0696  43   PHE B CG  
2949 C  CD1 . PHE B  46  ? 0.8856 0.9340 1.4076 0.0357  -0.0421 0.0796  43   PHE B CD1 
2950 C  CD2 . PHE B  46  ? 0.8872 0.9289 1.3683 0.0379  -0.0314 0.0669  43   PHE B CD2 
2951 C  CE1 . PHE B  46  ? 0.8952 0.9472 1.4196 0.0334  -0.0401 0.0861  43   PHE B CE1 
2952 C  CE2 . PHE B  46  ? 0.9249 0.9696 1.4081 0.0357  -0.0295 0.0736  43   PHE B CE2 
2953 C  CZ  . PHE B  46  ? 0.8928 0.9425 1.3976 0.0335  -0.0338 0.0829  43   PHE B CZ  
2954 N  N   . VAL B  47  ? 0.8773 0.9189 1.3329 0.0440  -0.0199 0.0670  44   VAL B N   
2955 C  CA  . VAL B  47  ? 0.8811 0.9223 1.3150 0.0456  -0.0111 0.0694  44   VAL B CA  
2956 C  C   . VAL B  47  ? 0.9039 0.9505 1.3391 0.0484  -0.0058 0.0784  44   VAL B C   
2957 O  O   . VAL B  47  ? 0.8909 0.9410 1.3192 0.0497  0.0006  0.0860  44   VAL B O   
2958 C  CB  . VAL B  47  ? 0.9442 0.9779 1.3549 0.0461  -0.0098 0.0585  44   VAL B CB  
2959 C  CG1 . VAL B  47  ? 0.9523 0.9838 1.3403 0.0483  -0.0021 0.0607  44   VAL B CG1 
2960 C  CG2 . VAL B  47  ? 0.9407 0.9716 1.3489 0.0438  -0.0130 0.0523  44   VAL B CG2 
2961 N  N   . LEU B  48  ? 0.8585 0.9063 1.3037 0.0495  -0.0087 0.0779  45   LEU B N   
2962 C  CA  . LEU B  48  ? 0.8589 0.9131 1.3084 0.0524  -0.0043 0.0867  45   LEU B CA  
2963 C  C   . LEU B  48  ? 0.9434 1.0079 1.4124 0.0515  -0.0038 0.1000  45   LEU B C   
2964 O  O   . LEU B  48  ? 0.9469 1.0178 1.4108 0.0544  0.0036  0.1085  45   LEU B O   
2965 C  CB  . LEU B  48  ? 0.8535 0.9060 1.3108 0.0529  -0.0088 0.0831  45   LEU B CB  
2966 C  CG  . LEU B  48  ? 0.9095 0.9653 1.3615 0.0568  -0.0032 0.0874  45   LEU B CG  
2967 C  CD1 . LEU B  48  ? 0.9158 0.9686 1.3416 0.0604  0.0053  0.0857  45   LEU B CD1 
2968 C  CD2 . LEU B  48  ? 0.9351 0.9860 1.3895 0.0565  -0.0082 0.0805  45   LEU B CD2 
2969 N  N   . TYR B  49  ? 0.9109 0.9769 1.4011 0.0478  -0.0120 0.1016  46   TYR B N   
2970 C  CA  . TYR B  49  ? 0.9017 0.9770 1.4126 0.0457  -0.0138 0.1142  46   TYR B CA  
2971 C  C   . TYR B  49  ? 0.9630 1.0416 1.4630 0.0459  -0.0067 0.1195  46   TYR B C   
2972 O  O   . TYR B  49  ? 0.9567 1.0449 1.4600 0.0475  -0.0011 0.1309  46   TYR B O   
2973 C  CB  . TYR B  49  ? 0.9152 0.9880 1.4472 0.0415  -0.0253 0.1122  46   TYR B CB  
2974 C  CG  . TYR B  49  ? 0.9294 1.0109 1.4819 0.0384  -0.0284 0.1246  46   TYR B CG  
2975 C  CD1 . TYR B  49  ? 0.9495 1.0411 1.5224 0.0378  -0.0304 0.1374  46   TYR B CD1 
2976 C  CD2 . TYR B  49  ? 0.9408 1.0211 1.4927 0.0359  -0.0294 0.1244  46   TYR B CD2 
2977 C  CE1 . TYR B  49  ? 0.9588 1.0595 1.5506 0.0345  -0.0333 0.1499  46   TYR B CE1 
2978 C  CE2 . TYR B  49  ? 0.9472 1.0356 1.5176 0.0327  -0.0323 0.1363  46   TYR B CE2 
2979 C  CZ  . TYR B  49  ? 1.0778 1.1766 1.6681 0.0318  -0.0344 0.1491  46   TYR B CZ  
2980 O  OH  . TYR B  49  ? 1.1503 1.2578 1.7594 0.0281  -0.0379 0.1617  46   TYR B OH  
2981 N  N   . VAL B  50  ? 0.9335 1.0044 1.4196 0.0444  -0.0069 0.1114  47   VAL B N   
2982 C  CA  . VAL B  50  ? 0.9433 1.0146 1.4168 0.0440  -0.0013 0.1149  47   VAL B CA  
2983 C  C   . VAL B  50  ? 1.0606 1.1330 1.5128 0.0486  0.0089  0.1183  47   VAL B C   
2984 O  O   . VAL B  50  ? 1.0643 1.1422 1.5141 0.0491  0.0140  0.1274  47   VAL B O   
2985 C  CB  . VAL B  50  ? 0.9854 1.0475 1.4486 0.0415  -0.0044 0.1048  47   VAL B CB  
2986 C  CG1 . VAL B  50  ? 0.9854 1.0460 1.4314 0.0412  0.0016  0.1076  47   VAL B CG1 
2987 C  CG2 . VAL B  50  ? 0.9753 1.0378 1.4607 0.0378  -0.0139 0.1037  47   VAL B CG2 
2988 N  N   . LEU B  51  ? 1.0517 1.1189 1.4888 0.0521  0.0115  0.1113  48   LEU B N   
2989 C  CA  . LEU B  51  ? 1.0679 1.1345 1.4838 0.0572  0.0202  0.1132  48   LEU B CA  
2990 C  C   . LEU B  51  ? 1.1685 1.2465 1.5947 0.0612  0.0249  0.1244  48   LEU B C   
2991 O  O   . LEU B  51  ? 1.1680 1.2489 1.5807 0.0655  0.0327  0.1299  48   LEU B O   
2992 C  CB  . LEU B  51  ? 1.0699 1.1264 1.4660 0.0593  0.0204  0.1018  48   LEU B CB  
2993 C  CG  . LEU B  51  ? 1.1145 1.1604 1.4909 0.0571  0.0192  0.0927  48   LEU B CG  
2994 C  CD1 . LEU B  51  ? 1.1126 1.1510 1.4790 0.0573  0.0162  0.0819  48   LEU B CD1 
2995 C  CD2 . LEU B  51  ? 1.1337 1.1758 1.4870 0.0597  0.0257  0.0957  48   LEU B CD2 
2996 N  N   . ILE B  52  ? 1.1576 1.2422 1.6072 0.0600  0.0201  0.1278  49   ILE B N   
2997 C  CA  . ILE B  52  ? 1.1661 1.2634 1.6296 0.0631  0.0236  0.1396  49   ILE B CA  
2998 C  C   . ILE B  52  ? 1.2685 1.3774 1.7439 0.0618  0.0259  0.1528  49   ILE B C   
2999 O  O   . ILE B  52  ? 1.2663 1.3841 1.7369 0.0665  0.0339  0.1617  49   ILE B O   
3000 C  CB  . ILE B  52  ? 1.1941 1.2936 1.6792 0.0613  0.0162  0.1393  49   ILE B CB  
3001 C  CG1 . ILE B  52  ? 1.2050 1.2965 1.6762 0.0645  0.0169  0.1296  49   ILE B CG1 
3002 C  CG2 . ILE B  52  ? 1.1921 1.3071 1.7021 0.0614  0.0160  0.1544  49   ILE B CG2 
3003 C  CD1 . ILE B  52  ? 1.2941 1.3882 1.7482 0.0716  0.0265  0.1321  49   ILE B CD1 
3004 N  N   . LYS B  53  ? 1.2642 1.3724 1.7535 0.0558  0.0190  0.1536  50   LYS B N   
3005 C  CA  . LYS B  53  ? 1.2744 1.3926 1.7767 0.0531  0.0193  0.1656  50   LYS B CA  
3006 C  C   . LYS B  53  ? 1.3826 1.4968 1.8639 0.0536  0.0254  0.1651  50   LYS B C   
3007 O  O   . LYS B  53  ? 1.3655 1.4840 1.8559 0.0496  0.0235  0.1718  50   LYS B O   
3008 C  CB  . LYS B  53  ? 1.2947 1.4134 1.8226 0.0464  0.0080  0.1668  50   LYS B CB  
3009 N  N   . THR B  54  ? 1.4022 1.5073 1.8552 0.0581  0.0317  0.1573  51   THR B N   
3010 C  CA  . THR B  54  ? 1.4338 1.5330 1.8622 0.0597  0.0377  0.1564  51   THR B CA  
3011 C  C   . THR B  54  ? 1.5360 1.6331 1.9411 0.0677  0.0463  0.1550  51   THR B C   
3012 O  O   . THR B  54  ? 1.5387 1.6240 1.9174 0.0698  0.0490  0.1478  51   THR B O   
3013 C  CB  . THR B  54  ? 1.5712 1.6567 1.9878 0.0554  0.0331  0.1456  51   THR B CB  
3014 O  OG1 . THR B  54  ? 1.5916 1.6677 1.9998 0.0563  0.0302  0.1335  51   THR B OG1 
3015 C  CG2 . THR B  54  ? 1.5421 1.6297 1.9793 0.0486  0.0256  0.1478  51   THR B CG2 
3016 N  N   . TYR B  55  ? 1.5220 1.6306 1.9377 0.0721  0.0499  0.1625  52   TYR B N   
3017 C  CA  . TYR B  55  ? 1.5424 1.6515 1.9406 0.0806  0.0578  0.1625  52   TYR B CA  
3018 C  C   . TYR B  55  ? 1.6245 1.7354 2.0027 0.0859  0.0666  0.1684  52   TYR B C   
3019 O  O   . TYR B  55  ? 1.6229 1.7289 1.9790 0.0933  0.0725  0.1652  52   TYR B O   
3020 C  CB  . TYR B  55  ? 1.5481 1.6709 1.9677 0.0832  0.0585  0.1701  52   TYR B CB  
3021 N  N   . HIS B  56  ? 1.5935 1.7108 1.9794 0.0822  0.0668  0.1769  53   HIS B N   
3022 C  CA  . HIS B  56  ? 1.5988 1.7186 1.9684 0.0858  0.0741  0.1837  53   HIS B CA  
3023 C  C   . HIS B  56  ? 1.6353 1.7381 1.9689 0.0906  0.0777  0.1744  53   HIS B C   
3024 O  O   . HIS B  56  ? 1.6357 1.7399 1.9511 0.0984  0.0855  0.1780  53   HIS B O   
3025 C  CB  . HIS B  56  ? 1.6110 1.7348 1.9937 0.0781  0.0704  0.1904  53   HIS B CB  
3026 C  CG  . HIS B  56  ? 1.6672 1.7927 2.0335 0.0808  0.0770  0.1974  53   HIS B CG  
3027 N  ND1 . HIS B  56  ? 1.7070 1.8171 2.0497 0.0791  0.0765  0.1910  53   HIS B ND1 
3028 C  CD2 . HIS B  56  ? 1.6880 1.8289 2.0582 0.0848  0.0840  0.2103  53   HIS B CD2 
3029 C  CE1 . HIS B  56  ? 1.7038 1.8192 2.0362 0.0821  0.0828  0.1998  53   HIS B CE1 
3030 N  NE2 . HIS B  56  ? 1.6960 1.8303 2.0440 0.0859  0.0878  0.2115  53   HIS B NE2 
3031 N  N   . LYS B  57  ? 1.5698 1.6568 1.8933 0.0860  0.0715  0.1627  54   LYS B N   
3032 C  CA  . LYS B  57  ? 1.5649 1.6343 1.8558 0.0887  0.0724  0.1534  54   LYS B CA  
3033 C  C   . LYS B  57  ? 1.5660 1.6243 1.8531 0.0867  0.0665  0.1409  54   LYS B C   
3034 O  O   . LYS B  57  ? 1.5674 1.6214 1.8635 0.0795  0.0596  0.1357  54   LYS B O   
3035 C  CB  . LYS B  57  ? 1.5967 1.6584 1.8770 0.0837  0.0707  0.1544  54   LYS B CB  
3036 C  CG  . LYS B  57  ? 1.6834 1.7258 1.9320 0.0843  0.0693  0.1454  54   LYS B CG  
3037 C  CD  . LYS B  57  ? 1.7172 1.7535 1.9373 0.0937  0.0760  0.1462  54   LYS B CD  
3038 C  CE  . LYS B  57  ? 1.7599 1.7756 1.9495 0.0937  0.0727  0.1371  54   LYS B CE  
3039 N  NZ  . LYS B  57  ? 1.8321 1.8408 2.0194 0.0934  0.0681  0.1269  54   LYS B NZ  
3040 N  N   . LYS B  58  ? 1.4661 1.5211 1.7410 0.0935  0.0692  0.1365  55   LYS B N   
3041 C  CA  . LYS B  58  ? 1.4399 1.4851 1.7104 0.0918  0.0638  0.1253  55   LYS B CA  
3042 C  C   . LYS B  58  ? 1.4448 1.4724 1.6826 0.0939  0.0631  0.1168  55   LYS B C   
3043 O  O   . LYS B  58  ? 1.4518 1.4750 1.6689 0.1015  0.0681  0.1179  55   LYS B O   
3044 C  CB  . LYS B  58  ? 1.4596 1.5127 1.7430 0.0959  0.0650  0.1256  55   LYS B CB  
3045 N  N   . SER B  59  ? 1.3457 1.3632 1.5789 0.0873  0.0563  0.1088  56   SER B N   
3046 C  CA  . SER B  59  ? 1.3217 1.3225 1.5264 0.0873  0.0535  0.1010  56   SER B CA  
3047 C  C   . SER B  59  ? 1.2861 1.2818 1.4857 0.0891  0.0508  0.0928  56   SER B C   
3048 O  O   . SER B  59  ? 1.2678 1.2725 1.4879 0.0887  0.0501  0.0924  56   SER B O   
3049 C  CB  . SER B  59  ? 1.3685 1.3638 1.5742 0.0788  0.0476  0.0976  56   SER B CB  
3050 O  OG  . SER B  59  ? 1.5015 1.5001 1.7115 0.0763  0.0492  0.1048  56   SER B OG  
3051 N  N   . ALA B  60  ? 1.1890 1.1697 1.3615 0.0904  0.0482  0.0863  57   ALA B N   
3052 C  CA  . ALA B  60  ? 1.1533 1.1278 1.3190 0.0910  0.0443  0.0782  57   ALA B CA  
3053 C  C   . ALA B  60  ? 1.1107 1.0883 1.2933 0.0828  0.0382  0.0729  57   ALA B C   
3054 O  O   . ALA B  60  ? 1.0843 1.0657 1.2784 0.0826  0.0363  0.0692  57   ALA B O   
3055 C  CB  . ALA B  60  ? 1.1765 1.1341 1.3102 0.0929  0.0415  0.0735  57   ALA B CB  
3056 N  N   . PHE B  61  ? 1.0258 1.0024 1.2110 0.0764  0.0352  0.0732  58   PHE B N   
3057 C  CA  . PHE B  61  ? 0.9987 0.9790 1.2000 0.0693  0.0298  0.0686  58   PHE B CA  
3058 C  C   . PHE B  61  ? 0.9851 0.9784 1.2158 0.0690  0.0305  0.0709  58   PHE B C   
3059 O  O   . PHE B  61  ? 0.9738 0.9690 1.2152 0.0662  0.0263  0.0651  58   PHE B O   
3060 C  CB  . PHE B  61  ? 1.0205 0.9984 1.2198 0.0636  0.0275  0.0699  58   PHE B CB  
3061 C  CG  . PHE B  61  ? 1.0294 1.0136 1.2489 0.0576  0.0230  0.0665  58   PHE B CG  
3062 C  CD1 . PHE B  61  ? 1.0749 1.0554 1.2894 0.0539  0.0178  0.0587  58   PHE B CD1 
3063 C  CD2 . PHE B  61  ? 1.0416 1.0357 1.2849 0.0559  0.0237  0.0713  58   PHE B CD2 
3064 C  CE1 . PHE B  61  ? 1.0837 1.0703 1.3161 0.0495  0.0140  0.0551  58   PHE B CE1 
3065 C  CE2 . PHE B  61  ? 1.0693 1.0683 1.3306 0.0513  0.0191  0.0675  58   PHE B CE2 
3066 C  CZ  . PHE B  61  ? 1.0539 1.0491 1.3091 0.0485  0.0145  0.0591  58   PHE B CZ  
3067 N  N   . GLN B  62  ? 0.9067 0.9089 1.1501 0.0717  0.0353  0.0796  59   GLN B N   
3068 C  CA  . GLN B  62  ? 0.8784 0.8932 1.1504 0.0713  0.0354  0.0838  59   GLN B CA  
3069 C  C   . GLN B  62  ? 0.9089 0.9263 1.1858 0.0751  0.0359  0.0817  59   GLN B C   
3070 O  O   . GLN B  62  ? 0.8879 0.9108 1.1851 0.0726  0.0322  0.0802  59   GLN B O   
3071 C  CB  . GLN B  62  ? 0.8858 0.9099 1.1682 0.0731  0.0404  0.0949  59   GLN B CB  
3072 N  N   . VAL B  63  ? 0.8620 0.8741 1.1192 0.0813  0.0398  0.0813  60   VAL B N   
3073 C  CA  . VAL B  63  ? 0.8460 0.8591 1.1045 0.0856  0.0404  0.0792  60   VAL B CA  
3074 C  C   . VAL B  63  ? 0.8747 0.8820 1.1337 0.0807  0.0334  0.0693  60   VAL B C   
3075 O  O   . VAL B  63  ? 0.8559 0.8688 1.1333 0.0794  0.0309  0.0683  60   VAL B O   
3076 C  CB  . VAL B  63  ? 0.9018 0.9084 1.1361 0.0935  0.0453  0.0796  60   VAL B CB  
3077 C  CG1 . VAL B  63  ? 0.9005 0.9069 1.1356 0.0973  0.0449  0.0763  60   VAL B CG1 
3078 C  CG2 . VAL B  63  ? 0.8959 0.9099 1.1304 0.0993  0.0528  0.0896  60   VAL B CG2 
3079 N  N   . TYR B  64  ? 0.8245 0.8209 1.0637 0.0775  0.0300  0.0626  61   TYR B N   
3080 C  CA  . TYR B  64  ? 0.8041 0.7956 1.0414 0.0725  0.0235  0.0535  61   TYR B CA  
3081 C  C   . TYR B  64  ? 0.8242 0.8230 1.0853 0.0673  0.0197  0.0524  61   TYR B C   
3082 O  O   . TYR B  64  ? 0.8225 0.8223 1.0925 0.0653  0.0156  0.0471  61   TYR B O   
3083 C  CB  . TYR B  64  ? 0.8134 0.7939 1.0263 0.0699  0.0207  0.0490  61   TYR B CB  
3084 C  CG  . TYR B  64  ? 0.8258 0.7962 1.0134 0.0748  0.0222  0.0484  61   TYR B CG  
3085 C  CD1 . TYR B  64  ? 0.8512 0.8190 1.0344 0.0781  0.0213  0.0449  61   TYR B CD1 
3086 C  CD2 . TYR B  64  ? 0.8435 0.8057 1.0105 0.0760  0.0233  0.0508  61   TYR B CD2 
3087 C  CE1 . TYR B  64  ? 0.8674 0.8249 1.0268 0.0830  0.0218  0.0439  61   TYR B CE1 
3088 C  CE2 . TYR B  64  ? 0.8655 0.8166 1.0077 0.0809  0.0235  0.0497  61   TYR B CE2 
3089 C  CZ  . TYR B  64  ? 0.9533 0.9021 1.0918 0.0846  0.0227  0.0460  61   TYR B CZ  
3090 O  OH  . TYR B  64  ? 0.9513 0.8882 1.0652 0.0898  0.0221  0.0445  61   TYR B OH  
3091 N  N   . MET B  65  ? 0.7644 0.7683 1.0362 0.0654  0.0208  0.0575  62   MET B N   
3092 C  CA  . MET B  65  ? 0.7519 0.7622 1.0467 0.0612  0.0168  0.0570  62   MET B CA  
3093 C  C   . MET B  65  ? 0.7975 0.8155 1.1153 0.0623  0.0157  0.0596  62   MET B C   
3094 O  O   . MET B  65  ? 0.8080 0.8264 1.1374 0.0595  0.0102  0.0542  62   MET B O   
3095 C  CB  . MET B  65  ? 0.7743 0.7881 1.0758 0.0592  0.0181  0.0631  62   MET B CB  
3096 C  CG  . MET B  65  ? 0.8157 0.8249 1.1096 0.0545  0.0146  0.0582  62   MET B CG  
3097 S  SD  . MET B  65  ? 0.8602 0.8661 1.1526 0.0508  0.0080  0.0465  62   MET B SD  
3098 C  CE  . MET B  65  ? 0.7973 0.8109 1.1197 0.0502  0.0038  0.0455  62   MET B CE  
3099 N  N   . ILE B  66  ? 0.7336 0.7578 1.0578 0.0667  0.0206  0.0682  63   ILE B N   
3100 C  CA  . ILE B  66  ? 0.7215 0.7539 1.0680 0.0679  0.0197  0.0728  63   ILE B CA  
3101 C  C   . ILE B  66  ? 0.7787 0.8066 1.1223 0.0681  0.0163  0.0653  63   ILE B C   
3102 O  O   . ILE B  66  ? 0.7620 0.7921 1.1231 0.0656  0.0111  0.0636  63   ILE B O   
3103 C  CB  . ILE B  66  ? 0.7556 0.7967 1.1066 0.0732  0.0267  0.0842  63   ILE B CB  
3104 C  CG1 . ILE B  66  ? 0.7643 0.8111 1.1209 0.0722  0.0294  0.0924  63   ILE B CG1 
3105 C  CG2 . ILE B  66  ? 0.7406 0.7906 1.1139 0.0745  0.0257  0.0898  63   ILE B CG2 
3106 C  CD1 . ILE B  66  ? 0.8973 0.9487 1.2443 0.0782  0.0377  0.1009  63   ILE B CD1 
3107 N  N   . ASN B  67  ? 0.7466 0.7670 1.0672 0.0708  0.0186  0.0608  64   ASN B N   
3108 C  CA  . ASN B  67  ? 0.7374 0.7526 1.0520 0.0709  0.0155  0.0539  64   ASN B CA  
3109 C  C   . ASN B  67  ? 0.7590 0.7696 1.0744 0.0653  0.0085  0.0444  64   ASN B C   
3110 O  O   . ASN B  67  ? 0.7555 0.7660 1.0796 0.0641  0.0044  0.0406  64   ASN B O   
3111 C  CB  . ASN B  67  ? 0.7188 0.7267 1.0082 0.0751  0.0190  0.0519  64   ASN B CB  
3112 C  CG  . ASN B  67  ? 0.8353 0.8488 1.1282 0.0817  0.0248  0.0598  64   ASN B CG  
3113 O  OD1 . ASN B  67  ? 0.8417 0.8572 1.1420 0.0836  0.0242  0.0599  64   ASN B OD1 
3114 N  ND2 . ASN B  67  ? 0.6550 0.6720 0.9440 0.0853  0.0307  0.0669  64   ASN B ND2 
3115 N  N   . LEU B  68  ? 0.6857 0.6933 0.9928 0.0621  0.0071  0.0409  65   LEU B N   
3116 C  CA  . LEU B  68  ? 0.6719 0.6771 0.9801 0.0574  0.0011  0.0325  65   LEU B CA  
3117 C  C   . LEU B  68  ? 0.7039 0.7147 1.0377 0.0556  -0.0031 0.0331  65   LEU B C   
3118 O  O   . LEU B  68  ? 0.6881 0.6973 1.0269 0.0538  -0.0082 0.0267  65   LEU B O   
3119 C  CB  . LEU B  68  ? 0.6677 0.6702 0.9637 0.0549  0.0013  0.0307  65   LEU B CB  
3120 C  CG  . LEU B  68  ? 0.7242 0.7189 0.9939 0.0545  0.0016  0.0268  65   LEU B CG  
3121 C  CD1 . LEU B  68  ? 0.7244 0.7173 0.9842 0.0527  0.0028  0.0286  65   LEU B CD1 
3122 C  CD2 . LEU B  68  ? 0.7276 0.7195 0.9914 0.0514  -0.0036 0.0178  65   LEU B CD2 
3123 N  N   . ALA B  69  ? 0.6498 0.6668 0.9995 0.0561  -0.0015 0.0410  66   ALA B N   
3124 C  CA  . ALA B  69  ? 0.6415 0.6632 1.0162 0.0544  -0.0065 0.0429  66   ALA B CA  
3125 C  C   . ALA B  69  ? 0.7105 0.7335 1.0977 0.0553  -0.0093 0.0438  66   ALA B C   
3126 O  O   . ALA B  69  ? 0.7163 0.7378 1.1152 0.0532  -0.0161 0.0390  66   ALA B O   
3127 C  CB  . ALA B  69  ? 0.6415 0.6699 1.0296 0.0548  -0.0041 0.0530  66   ALA B CB  
3128 N  N   . VAL B  70  ? 0.6482 0.6735 1.0319 0.0588  -0.0043 0.0496  67   VAL B N   
3129 C  CA  . VAL B  70  ? 0.6304 0.6574 1.0253 0.0600  -0.0063 0.0517  67   VAL B CA  
3130 C  C   . VAL B  70  ? 0.7238 0.7431 1.1089 0.0582  -0.0109 0.0411  67   VAL B C   
3131 O  O   . VAL B  70  ? 0.7103 0.7289 1.1090 0.0564  -0.0168 0.0392  67   VAL B O   
3132 C  CB  . VAL B  70  ? 0.6610 0.6934 1.0540 0.0649  0.0009  0.0608  67   VAL B CB  
3133 C  CG1 . VAL B  70  ? 0.6499 0.6839 1.0531 0.0661  -0.0010 0.0627  67   VAL B CG1 
3134 C  CG2 . VAL B  70  ? 0.6516 0.6936 1.0583 0.0662  0.0045  0.0722  67   VAL B CG2 
3135 N  N   . ALA B  71  ? 0.7226 0.7358 1.0839 0.0584  -0.0087 0.0344  68   ALA B N   
3136 C  CA  . ALA B  71  ? 0.7394 0.7459 1.0892 0.0562  -0.0130 0.0246  68   ALA B CA  
3137 C  C   . ALA B  71  ? 0.7902 0.7953 1.1472 0.0524  -0.0196 0.0173  68   ALA B C   
3138 O  O   . ALA B  71  ? 0.7928 0.7946 1.1517 0.0506  -0.0248 0.0113  68   ALA B O   
3139 C  CB  . ALA B  71  ? 0.7612 0.7622 1.0848 0.0567  -0.0099 0.0206  68   ALA B CB  
3140 N  N   . ASP B  72  ? 0.7275 0.7349 1.0887 0.0515  -0.0196 0.0180  69   ASP B N   
3141 C  CA  . ASP B  72  ? 0.7136 0.7202 1.0823 0.0491  -0.0255 0.0116  69   ASP B CA  
3142 C  C   . ASP B  72  ? 0.7573 0.7650 1.1491 0.0488  -0.0313 0.0137  69   ASP B C   
3143 O  O   . ASP B  72  ? 0.7549 0.7590 1.1496 0.0474  -0.0375 0.0063  69   ASP B O   
3144 C  CB  . ASP B  72  ? 0.7290 0.7380 1.0970 0.0486  -0.0237 0.0129  69   ASP B CB  
3145 C  CG  . ASP B  72  ? 0.7563 0.7632 1.1019 0.0479  -0.0201 0.0096  69   ASP B CG  
3146 O  OD1 . ASP B  72  ? 0.7411 0.7442 1.0703 0.0475  -0.0196 0.0053  69   ASP B OD1 
3147 O  OD2 . ASP B  72  ? 0.7577 0.7664 1.1023 0.0473  -0.0183 0.0116  69   ASP B OD2 
3148 N  N   . LEU B  73  ? 0.7173 0.7302 1.1250 0.0500  -0.0297 0.0241  70   LEU B N   
3149 C  CA  . LEU B  73  ? 0.7200 0.7345 1.1514 0.0493  -0.0357 0.0286  70   LEU B CA  
3150 C  C   . LEU B  73  ? 0.8023 0.8135 1.2376 0.0489  -0.0398 0.0267  70   LEU B C   
3151 O  O   . LEU B  73  ? 0.8036 0.8113 1.2513 0.0473  -0.0480 0.0235  70   LEU B O   
3152 C  CB  . LEU B  73  ? 0.7114 0.7338 1.1581 0.0504  -0.0325 0.0416  70   LEU B CB  
3153 C  CG  . LEU B  73  ? 0.7651 0.7900 1.2188 0.0494  -0.0334 0.0438  70   LEU B CG  
3154 C  CD1 . LEU B  73  ? 0.7561 0.7897 1.2209 0.0503  -0.0289 0.0569  70   LEU B CD1 
3155 C  CD2 . LEU B  73  ? 0.7842 0.8055 1.2534 0.0473  -0.0434 0.0393  70   LEU B CD2 
3156 N  N   . LEU B  74  ? 0.7765 0.7878 1.2006 0.0505  -0.0349 0.0280  71   LEU B N   
3157 C  CA  . LEU B  74  ? 0.7856 0.7936 1.2121 0.0500  -0.0384 0.0265  71   LEU B CA  
3158 C  C   . LEU B  74  ? 0.8180 0.8181 1.2357 0.0474  -0.0447 0.0141  71   LEU B C   
3159 O  O   . LEU B  74  ? 0.8044 0.8009 1.2311 0.0460  -0.0511 0.0124  71   LEU B O   
3160 C  CB  . LEU B  74  ? 0.8027 0.8122 1.2175 0.0527  -0.0315 0.0301  71   LEU B CB  
3161 C  CG  . LEU B  74  ? 0.8694 0.8877 1.2944 0.0562  -0.0253 0.0430  71   LEU B CG  
3162 C  CD1 . LEU B  74  ? 0.8837 0.9023 1.2894 0.0600  -0.0172 0.0440  71   LEU B CD1 
3163 C  CD2 . LEU B  74  ? 0.8976 0.9195 1.3438 0.0561  -0.0289 0.0506  71   LEU B CD2 
3164 N  N   . CYS B  75  ? 0.7782 0.7763 1.1787 0.0468  -0.0431 0.0061  72   CYS B N   
3165 C  CA  . CYS B  75  ? 0.7788 0.7715 1.1700 0.0448  -0.0483 -0.0053 72   CYS B CA  
3166 C  C   . CYS B  75  ? 0.8441 0.8353 1.2484 0.0443  -0.0552 -0.0092 72   CYS B C   
3167 O  O   . CYS B  75  ? 0.8304 0.8164 1.2361 0.0432  -0.0620 -0.0162 72   CYS B O   
3168 C  CB  . CYS B  75  ? 0.7806 0.7731 1.1489 0.0444  -0.0439 -0.0110 72   CYS B CB  
3169 S  SG  . CYS B  75  ? 0.8307 0.8202 1.1883 0.0423  -0.0493 -0.0240 72   CYS B SG  
3170 N  N   . VAL B  76  ? 0.8097 0.8047 1.2227 0.0452  -0.0540 -0.0050 73   VAL B N   
3171 C  CA  . VAL B  76  ? 0.8119 0.8048 1.2373 0.0453  -0.0610 -0.0086 73   VAL B CA  
3172 C  C   . VAL B  76  ? 0.8560 0.8452 1.3011 0.0447  -0.0692 -0.0055 73   VAL B C   
3173 O  O   . VAL B  76  ? 0.8701 0.8538 1.3203 0.0447  -0.0772 -0.0122 73   VAL B O   
3174 C  CB  . VAL B  76  ? 0.8575 0.8547 1.2884 0.0461  -0.0589 -0.0053 73   VAL B CB  
3175 C  CG1 . VAL B  76  ? 0.8567 0.8571 1.2684 0.0463  -0.0511 -0.0070 73   VAL B CG1 
3176 C  CG2 . VAL B  76  ? 0.8500 0.8516 1.2991 0.0461  -0.0582 0.0072  73   VAL B CG2 
3177 N  N   . CYS B  77  ? 0.7947 0.7867 1.2497 0.0443  -0.0676 0.0045  74   CYS B N   
3178 C  CA  . CYS B  77  ? 0.7979 0.7870 1.2721 0.0432  -0.0756 0.0093  74   CYS B CA  
3179 C  C   . CYS B  77  ? 0.8285 0.8097 1.2969 0.0419  -0.0813 0.0014  74   CYS B C   
3180 O  O   . CYS B  77  ? 0.8247 0.8009 1.3076 0.0407  -0.0900 0.0031  74   CYS B O   
3181 C  CB  . CYS B  77  ? 0.8090 0.8055 1.2962 0.0434  -0.0715 0.0234  74   CYS B CB  
3182 S  SG  . CYS B  77  ? 0.8598 0.8656 1.3573 0.0444  -0.0666 0.0339  74   CYS B SG  
3183 N  N   . THR B  78  ? 0.7653 0.7449 1.2126 0.0419  -0.0772 -0.0070 75   THR B N   
3184 C  CA  . THR B  78  ? 0.7532 0.7257 1.1926 0.0403  -0.0822 -0.0150 75   THR B CA  
3185 C  C   . THR B  78  ? 0.7936 0.7613 1.2228 0.0406  -0.0867 -0.0276 75   THR B C   
3186 O  O   . THR B  78  ? 0.7829 0.7435 1.2113 0.0397  -0.0939 -0.0340 75   THR B O   
3187 C  CB  . THR B  78  ? 0.7934 0.7675 1.2179 0.0396  -0.0760 -0.0148 75   THR B CB  
3188 O  OG1 . THR B  78  ? 0.8443 0.8221 1.2504 0.0405  -0.0686 -0.0182 75   THR B OG1 
3189 C  CG2 . THR B  78  ? 0.6635 0.6416 1.0991 0.0401  -0.0727 -0.0029 75   THR B CG2 
3190 N  N   . LEU B  79  ? 0.7602 0.7319 1.1817 0.0422  -0.0827 -0.0309 76   LEU B N   
3191 C  CA  . LEU B  79  ? 0.7622 0.7316 1.1744 0.0435  -0.0858 -0.0423 76   LEU B CA  
3192 C  C   . LEU B  79  ? 0.8299 0.7918 1.2551 0.0447  -0.0966 -0.0466 76   LEU B C   
3193 O  O   . LEU B  79  ? 0.8319 0.7892 1.2473 0.0454  -0.1007 -0.0570 76   LEU B O   
3194 C  CB  . LEU B  79  ? 0.7541 0.7300 1.1590 0.0451  -0.0797 -0.0432 76   LEU B CB  
3195 C  CG  . LEU B  79  ? 0.7834 0.7649 1.1701 0.0441  -0.0706 -0.0423 76   LEU B CG  
3196 C  CD1 . LEU B  79  ? 0.7772 0.7640 1.1590 0.0454  -0.0664 -0.0431 76   LEU B CD1 
3197 C  CD2 . LEU B  79  ? 0.7652 0.7451 1.1342 0.0425  -0.0710 -0.0503 76   LEU B CD2 
3198 N  N   . PRO B  80  ? 0.7932 0.7530 1.2394 0.0449  -0.1019 -0.0390 77   PRO B N   
3199 C  CA  . PRO B  80  ? 0.7874 0.7377 1.2448 0.0459  -0.1138 -0.0434 77   PRO B CA  
3200 C  C   . PRO B  80  ? 0.8375 0.7793 1.2907 0.0444  -0.1203 -0.0485 77   PRO B C   
3201 O  O   . PRO B  80  ? 0.8416 0.7751 1.2933 0.0462  -0.1287 -0.0574 77   PRO B O   
3202 C  CB  . PRO B  80  ? 0.8001 0.7510 1.2807 0.0449  -0.1177 -0.0311 77   PRO B CB  
3203 C  CG  . PRO B  80  ? 0.8554 0.8171 1.3352 0.0450  -0.1073 -0.0236 77   PRO B CG  
3204 C  CD  . PRO B  80  ? 0.8062 0.7720 1.2669 0.0442  -0.0982 -0.0259 77   PRO B CD  
3205 N  N   . LEU B  81  ? 0.7867 0.7303 1.2369 0.0415  -0.1164 -0.0434 78   LEU B N   
3206 C  CA  . LEU B  81  ? 0.7811 0.7171 1.2266 0.0394  -0.1220 -0.0478 78   LEU B CA  
3207 C  C   . LEU B  81  ? 0.8569 0.7915 1.2806 0.0404  -0.1209 -0.0611 78   LEU B C   
3208 O  O   . LEU B  81  ? 0.8470 0.7729 1.2675 0.0405  -0.1290 -0.0688 78   LEU B O   
3209 C  CB  . LEU B  81  ? 0.7749 0.7140 1.2222 0.0364  -0.1176 -0.0392 78   LEU B CB  
3210 C  CG  . LEU B  81  ? 0.8145 0.7563 1.2834 0.0353  -0.1185 -0.0249 78   LEU B CG  
3211 C  CD1 . LEU B  81  ? 0.8074 0.7522 1.2750 0.0333  -0.1140 -0.0186 78   LEU B CD1 
3212 C  CD2 . LEU B  81  ? 0.7988 0.7317 1.2861 0.0345  -0.1313 -0.0226 78   LEU B CD2 
3213 N  N   . ARG B  82  ? 0.8330 0.7764 1.2418 0.0410  -0.1113 -0.0633 79   ARG B N   
3214 C  CA  . ARG B  82  ? 0.8402 0.7856 1.2287 0.0418  -0.1091 -0.0743 79   ARG B CA  
3215 C  C   . ARG B  82  ? 0.9134 0.8547 1.3026 0.0458  -0.1154 -0.0834 79   ARG B C   
3216 O  O   . ARG B  82  ? 0.9211 0.8588 1.2987 0.0466  -0.1191 -0.0932 79   ARG B O   
3217 C  CB  . ARG B  82  ? 0.8191 0.7748 1.1948 0.0417  -0.0985 -0.0728 79   ARG B CB  
3218 C  CG  . ARG B  82  ? 0.8340 0.7929 1.2033 0.0384  -0.0924 -0.0664 79   ARG B CG  
3219 C  CD  . ARG B  82  ? 0.8415 0.8087 1.1952 0.0383  -0.0838 -0.0665 79   ARG B CD  
3220 N  NE  . ARG B  82  ? 0.7877 0.7564 1.1337 0.0357  -0.0789 -0.0611 79   ARG B NE  
3221 C  CZ  . ARG B  82  ? 0.8691 0.8385 1.1981 0.0332  -0.0777 -0.0652 79   ARG B CZ  
3222 N  NH1 . ARG B  82  ? 0.6025 0.5726 0.9202 0.0326  -0.0805 -0.0743 79   ARG B NH1 
3223 N  NH2 . ARG B  82  ? 0.7877 0.7573 1.1108 0.0314  -0.0741 -0.0601 79   ARG B NH2 
3224 N  N   . VAL B  83  ? 0.8803 0.8217 1.2832 0.0485  -0.1171 -0.0801 80   VAL B N   
3225 C  CA  . VAL B  83  ? 0.8892 0.8259 1.2954 0.0531  -0.1240 -0.0879 80   VAL B CA  
3226 C  C   . VAL B  83  ? 0.9556 0.8790 1.3663 0.0536  -0.1361 -0.0931 80   VAL B C   
3227 O  O   . VAL B  83  ? 0.9514 0.8707 1.3510 0.0570  -0.1400 -0.1044 80   VAL B O   
3228 C  CB  . VAL B  83  ? 0.9268 0.8657 1.3488 0.0550  -0.1241 -0.0816 80   VAL B CB  
3229 C  CG1 . VAL B  83  ? 0.9257 0.8592 1.3502 0.0603  -0.1315 -0.0904 80   VAL B CG1 
3230 C  CG2 . VAL B  83  ? 0.9201 0.8710 1.3368 0.0543  -0.1127 -0.0765 80   VAL B CG2 
3231 N  N   . VAL B  84  ? 0.9214 0.8384 1.3475 0.0504  -0.1417 -0.0843 81   VAL B N   
3232 C  CA  . VAL B  84  ? 0.9222 0.8256 1.3549 0.0498  -0.1541 -0.0866 81   VAL B CA  
3233 C  C   . VAL B  84  ? 0.9864 0.8859 1.4012 0.0488  -0.1552 -0.0958 81   VAL B C   
3234 O  O   . VAL B  84  ? 0.9916 0.8798 1.4036 0.0507  -0.1649 -0.1037 81   VAL B O   
3235 C  CB  . VAL B  84  ? 0.9626 0.8632 1.4159 0.0457  -0.1581 -0.0729 81   VAL B CB  
3236 C  CG1 . VAL B  84  ? 0.9639 0.8504 1.4226 0.0439  -0.1707 -0.0742 81   VAL B CG1 
3237 C  CG2 . VAL B  84  ? 0.9512 0.8541 1.4232 0.0468  -0.1600 -0.0645 81   VAL B CG2 
3238 N  N   . TYR B  85  ? 0.9468 0.8550 1.3492 0.0458  -0.1456 -0.0946 82   TYR B N   
3239 C  CA  . TYR B  85  ? 0.9518 0.8588 1.3369 0.0438  -0.1453 -0.1019 82   TYR B CA  
3240 C  C   . TYR B  85  ? 1.0283 0.9366 1.3961 0.0482  -0.1454 -0.1153 82   TYR B C   
3241 O  O   . TYR B  85  ? 1.0267 0.9275 1.3853 0.0484  -0.1517 -0.1233 82   TYR B O   
3242 C  CB  . TYR B  85  ? 0.9573 0.8739 1.3348 0.0396  -0.1353 -0.0960 82   TYR B CB  
3243 C  CG  . TYR B  85  ? 0.9679 0.8857 1.3260 0.0371  -0.1337 -0.1031 82   TYR B CG  
3244 C  CD1 . TYR B  85  ? 0.9866 0.8958 1.3442 0.0335  -0.1401 -0.1036 82   TYR B CD1 
3245 C  CD2 . TYR B  85  ? 0.9785 0.9064 1.3193 0.0378  -0.1261 -0.1081 82   TYR B CD2 
3246 C  CE1 . TYR B  85  ? 0.9947 0.9053 1.3347 0.0307  -0.1391 -0.1097 82   TYR B CE1 
3247 C  CE2 . TYR B  85  ? 0.9952 0.9251 1.3187 0.0350  -0.1252 -0.1138 82   TYR B CE2 
3248 C  CZ  . TYR B  85  ? 1.0807 1.0019 1.4037 0.0314  -0.1318 -0.1148 82   TYR B CZ  
3249 O  OH  . TYR B  85  ? 1.0685 0.9919 1.3746 0.0281  -0.1313 -0.1199 82   TYR B OH  
3250 N  N   . TYR B  86  ? 0.9920 0.9101 1.3550 0.0517  -0.1384 -0.1174 83   TYR B N   
3251 C  CA  . TYR B  86  ? 0.9871 0.9097 1.3345 0.0564  -0.1370 -0.1289 83   TYR B CA  
3252 C  C   . TYR B  86  ? 1.0516 0.9650 1.4045 0.0628  -0.1461 -0.1363 83   TYR B C   
3253 O  O   . TYR B  86  ? 1.0462 0.9596 1.3860 0.0674  -0.1478 -0.1473 83   TYR B O   
3254 C  CB  . TYR B  86  ? 0.9840 0.9215 1.3237 0.0570  -0.1257 -0.1271 83   TYR B CB  
3255 C  CG  . TYR B  86  ? 0.9921 0.9373 1.3221 0.0513  -0.1181 -0.1219 83   TYR B CG  
3256 C  CD1 . TYR B  86  ? 1.0221 0.9698 1.3351 0.0490  -0.1173 -0.1277 83   TYR B CD1 
3257 C  CD2 . TYR B  86  ? 0.9958 0.9452 1.3334 0.0481  -0.1121 -0.1111 83   TYR B CD2 
3258 C  CE1 . TYR B  86  ? 1.0428 0.9965 1.3469 0.0436  -0.1115 -0.1228 83   TYR B CE1 
3259 C  CE2 . TYR B  86  ? 1.0070 0.9618 1.3349 0.0434  -0.1059 -0.1067 83   TYR B CE2 
3260 C  CZ  . TYR B  86  ? 1.0994 1.0561 1.4109 0.0410  -0.1061 -0.1126 83   TYR B CZ  
3261 O  OH  . TYR B  86  ? 1.0908 1.0519 1.3927 0.0363  -0.1012 -0.1084 83   TYR B OH  
3262 N  N   . VAL B  87  ? 1.0248 0.9304 1.3971 0.0632  -0.1523 -0.1301 84   VAL B N   
3263 C  CA  . VAL B  87  ? 1.0339 0.9277 1.4141 0.0687  -0.1634 -0.1357 84   VAL B CA  
3264 C  C   . VAL B  87  ? 1.1164 0.9956 1.4921 0.0681  -0.1742 -0.1414 84   VAL B C   
3265 O  O   . VAL B  87  ? 1.1208 0.9910 1.4905 0.0738  -0.1822 -0.1519 84   VAL B O   
3266 C  CB  . VAL B  87  ? 1.0700 0.9609 1.4730 0.0679  -0.1670 -0.1252 84   VAL B CB  
3267 C  CG1 . VAL B  87  ? 1.0676 0.9414 1.4832 0.0699  -0.1822 -0.1265 84   VAL B CG1 
3268 C  CG2 . VAL B  87  ? 1.0605 0.9617 1.4653 0.0716  -0.1601 -0.1249 84   VAL B CG2 
3269 N  N   . HIS B  88  ? 1.0823 0.9599 1.4593 0.0614  -0.1740 -0.1350 85   HIS B N   
3270 C  CA  . HIS B  88  ? 1.0924 0.9569 1.4655 0.0592  -0.1834 -0.1385 85   HIS B CA  
3271 C  C   . HIS B  88  ? 1.1461 1.0144 1.4966 0.0589  -0.1797 -0.1480 85   HIS B C   
3272 O  O   . HIS B  88  ? 1.1355 0.9960 1.4817 0.0550  -0.1848 -0.1488 85   HIS B O   
3273 C  CB  . HIS B  88  ? 1.1077 0.9685 1.4963 0.0521  -0.1857 -0.1257 85   HIS B CB  
3274 C  CG  . HIS B  88  ? 1.1590 1.0075 1.5677 0.0525  -0.1974 -0.1200 85   HIS B CG  
3275 N  ND1 . HIS B  88  ? 1.1908 1.0239 1.6049 0.0501  -0.2099 -0.1192 85   HIS B ND1 
3276 C  CD2 . HIS B  88  ? 1.1846 1.0337 1.6082 0.0552  -0.1994 -0.1153 85   HIS B CD2 
3277 C  CE1 . HIS B  88  ? 1.1849 1.0100 1.6175 0.0510  -0.2192 -0.1134 85   HIS B CE1 
3278 N  NE2 . HIS B  88  ? 1.1829 1.0172 1.6218 0.0541  -0.2133 -0.1110 85   HIS B NE2 
3279 N  N   . LYS B  89  ? 1.1156 0.9963 1.4520 0.0629  -0.1712 -0.1548 86   LYS B N   
3280 C  CA  . LYS B  89  ? 1.1170 1.0049 1.4314 0.0631  -0.1666 -0.1634 86   LYS B CA  
3281 C  C   . LYS B  89  ? 1.1446 1.0370 1.4537 0.0548  -0.1619 -0.1574 86   LYS B C   
3282 O  O   . LYS B  89  ? 1.1510 1.0408 1.4468 0.0528  -0.1645 -0.1630 86   LYS B O   
3283 C  CB  . LYS B  89  ? 1.1563 1.0328 1.4601 0.0685  -0.1762 -0.1759 86   LYS B CB  
3284 C  CG  . LYS B  89  ? 1.2773 1.1535 1.5799 0.0782  -0.1782 -0.1844 86   LYS B CG  
3285 N  N   . GLY B  90  ? 1.0645 0.9635 1.3836 0.0505  -0.1553 -0.1463 87   GLY B N   
3286 C  CA  . GLY B  90  ? 1.0493 0.9530 1.3648 0.0434  -0.1504 -0.1398 87   GLY B CA  
3287 C  C   . GLY B  90  ? 1.0784 0.9704 1.4018 0.0383  -0.1579 -0.1353 87   GLY B C   
3288 O  O   . GLY B  90  ? 1.0807 0.9729 1.3939 0.0337  -0.1576 -0.1363 87   GLY B O   
3289 N  N   . ILE B  91  ? 1.0137 0.8958 1.3561 0.0387  -0.1649 -0.1293 88   ILE B N   
3290 C  CA  . ILE B  91  ? 1.0033 0.8746 1.3563 0.0337  -0.1724 -0.1230 88   ILE B CA  
3291 C  C   . ILE B  91  ? 0.9942 0.8695 1.3669 0.0315  -0.1687 -0.1091 88   ILE B C   
3292 O  O   . ILE B  91  ? 0.9679 0.8432 1.3535 0.0347  -0.1699 -0.1055 88   ILE B O   
3293 C  CB  . ILE B  91  ? 1.0531 0.9071 1.4105 0.0356  -0.1866 -0.1283 88   ILE B CB  
3294 C  CG1 . ILE B  91  ? 1.0728 0.9230 1.4091 0.0389  -0.1900 -0.1428 88   ILE B CG1 
3295 C  CG2 . ILE B  91  ? 1.0520 0.8954 1.4228 0.0299  -0.1947 -0.1199 88   ILE B CG2 
3296 C  CD1 . ILE B  91  ? 1.1573 1.0120 1.4755 0.0343  -0.1865 -0.1469 88   ILE B CD1 
3297 N  N   . TRP B  92  ? 0.9190 0.7985 1.2932 0.0264  -0.1641 -0.1014 89   TRP B N   
3298 C  CA  . TRP B  92  ? 0.8947 0.7791 1.2866 0.0249  -0.1600 -0.0880 89   TRP B CA  
3299 C  C   . TRP B  92  ? 0.9788 0.8521 1.3897 0.0227  -0.1705 -0.0808 89   TRP B C   
3300 O  O   . TRP B  92  ? 0.9983 0.8625 1.4065 0.0194  -0.1776 -0.0829 89   TRP B O   
3301 C  CB  . TRP B  92  ? 0.8584 0.7523 1.2437 0.0216  -0.1504 -0.0828 89   TRP B CB  
3302 C  CG  . TRP B  92  ? 0.8482 0.7491 1.2488 0.0218  -0.1443 -0.0701 89   TRP B CG  
3303 C  CD1 . TRP B  92  ? 0.8782 0.7783 1.2927 0.0191  -0.1453 -0.0595 89   TRP B CD1 
3304 C  CD2 . TRP B  92  ? 0.8327 0.7429 1.2365 0.0251  -0.1366 -0.0664 89   TRP B CD2 
3305 N  NE1 . TRP B  92  ? 0.8608 0.7697 1.2864 0.0209  -0.1382 -0.0495 89   TRP B NE1 
3306 C  CE2 . TRP B  92  ? 0.8772 0.7920 1.2960 0.0243  -0.1328 -0.0536 89   TRP B CE2 
3307 C  CE3 . TRP B  92  ? 0.8389 0.7545 1.2342 0.0287  -0.1323 -0.0723 89   TRP B CE3 
3308 C  CZ2 . TRP B  92  ? 0.8571 0.7811 1.2819 0.0269  -0.1252 -0.0469 89   TRP B CZ2 
3309 C  CZ3 . TRP B  92  ? 0.8452 0.7692 1.2474 0.0309  -0.1252 -0.0655 89   TRP B CZ3 
3310 C  CH2 . TRP B  92  ? 0.8451 0.7729 1.2614 0.0299  -0.1218 -0.0531 89   TRP B CH2 
3311 N  N   . LEU B  93  ? 0.9332 0.8072 1.3635 0.0242  -0.1723 -0.0719 90   LEU B N   
3312 C  CA  . LEU B  93  ? 0.9311 0.7951 1.3812 0.0219  -0.1833 -0.0637 90   LEU B CA  
3313 C  C   . LEU B  93  ? 0.9603 0.8325 1.4311 0.0203  -0.1793 -0.0477 90   LEU B C   
3314 O  O   . LEU B  93  ? 0.9669 0.8333 1.4570 0.0191  -0.1882 -0.0394 90   LEU B O   
3315 C  CB  . LEU B  93  ? 0.9366 0.7891 1.3918 0.0252  -0.1949 -0.0692 90   LEU B CB  
3316 C  CG  . LEU B  93  ? 1.0072 0.8654 1.4627 0.0304  -0.1911 -0.0722 90   LEU B CG  
3317 C  CD1 . LEU B  93  ? 1.0061 0.8661 1.4854 0.0302  -0.1940 -0.0594 90   LEU B CD1 
3318 C  CD2 . LEU B  93  ? 1.0533 0.9009 1.4977 0.0349  -0.1992 -0.0860 90   LEU B CD2 
3319 N  N   . PHE B  94  ? 0.8900 0.7750 1.3564 0.0201  -0.1668 -0.0431 91   PHE B N   
3320 C  CA  . PHE B  94  ? 0.8665 0.7609 1.3505 0.0196  -0.1615 -0.0282 91   PHE B CA  
3321 C  C   . PHE B  94  ? 0.9030 0.8018 1.3872 0.0167  -0.1566 -0.0216 91   PHE B C   
3322 O  O   . PHE B  94  ? 0.8854 0.7932 1.3826 0.0170  -0.1511 -0.0094 91   PHE B O   
3323 C  CB  . PHE B  94  ? 0.8813 0.7876 1.3632 0.0232  -0.1509 -0.0264 91   PHE B CB  
3324 C  CG  . PHE B  94  ? 0.8903 0.7938 1.3726 0.0264  -0.1547 -0.0323 91   PHE B CG  
3325 C  CD1 . PHE B  94  ? 0.9190 0.8183 1.4213 0.0266  -0.1635 -0.0257 91   PHE B CD1 
3326 C  CD2 . PHE B  94  ? 0.9041 0.8100 1.3676 0.0292  -0.1496 -0.0439 91   PHE B CD2 
3327 C  CE1 . PHE B  94  ? 0.9261 0.8223 1.4290 0.0298  -0.1675 -0.0314 91   PHE B CE1 
3328 C  CE2 . PHE B  94  ? 0.9351 0.8389 1.3995 0.0326  -0.1529 -0.0492 91   PHE B CE2 
3329 C  CZ  . PHE B  94  ? 0.9114 0.8099 1.3953 0.0331  -0.1619 -0.0434 91   PHE B CZ  
3330 N  N   . GLY B  95  ? 0.8665 0.7589 1.3367 0.0141  -0.1590 -0.0294 92   GLY B N   
3331 C  CA  . GLY B  95  ? 0.8734 0.7685 1.3423 0.0114  -0.1555 -0.0245 92   GLY B CA  
3332 C  C   . GLY B  95  ? 0.9681 0.8717 1.4180 0.0124  -0.1440 -0.0289 92   GLY B C   
3333 O  O   . GLY B  95  ? 0.9787 0.8877 1.4174 0.0153  -0.1377 -0.0342 92   GLY B O   
3334 N  N   . ASP B  96  ? 0.9400 0.8443 1.3863 0.0100  -0.1419 -0.0263 93   ASP B N   
3335 C  CA  . ASP B  96  ? 0.9534 0.8640 1.3820 0.0104  -0.1327 -0.0296 93   ASP B CA  
3336 C  C   . ASP B  96  ? 0.9862 0.9081 1.4171 0.0147  -0.1220 -0.0227 93   ASP B C   
3337 O  O   . ASP B  96  ? 0.9916 0.9179 1.4065 0.0164  -0.1156 -0.0284 93   ASP B O   
3338 C  CB  . ASP B  96  ? 0.9910 0.8989 1.4188 0.0070  -0.1343 -0.0269 93   ASP B CB  
3339 C  CG  . ASP B  96  ? 1.2141 1.1124 1.6291 0.0023  -0.1419 -0.0367 93   ASP B CG  
3340 O  OD1 . ASP B  96  ? 1.2237 1.1174 1.6288 0.0021  -0.1459 -0.0464 93   ASP B OD1 
3341 O  OD2 . ASP B  96  ? 1.3333 1.2289 1.7477 -0.0009 -0.1438 -0.0347 93   ASP B OD2 
3342 N  N   . PHE B  97  ? 0.9122 0.8393 1.3627 0.0164  -0.1202 -0.0099 94   PHE B N   
3343 C  CA  . PHE B  97  ? 0.8811 0.8193 1.3346 0.0208  -0.1099 -0.0021 94   PHE B CA  
3344 C  C   . PHE B  97  ? 0.9009 0.8428 1.3481 0.0234  -0.1059 -0.0062 94   PHE B C   
3345 O  O   . PHE B  97  ? 0.8936 0.8408 1.3265 0.0257  -0.0975 -0.0082 94   PHE B O   
3346 C  CB  . PHE B  97  ? 0.8846 0.8287 1.3621 0.0222  -0.1096 0.0126  94   PHE B CB  
3347 C  CG  . PHE B  97  ? 0.8917 0.8478 1.3703 0.0272  -0.0984 0.0205  94   PHE B CG  
3348 C  CD1 . PHE B  97  ? 0.9291 0.8891 1.3953 0.0296  -0.0904 0.0208  94   PHE B CD1 
3349 C  CD2 . PHE B  97  ? 0.9029 0.8657 1.3942 0.0295  -0.0962 0.0274  94   PHE B CD2 
3350 C  CE1 . PHE B  97  ? 0.9325 0.9025 1.3979 0.0348  -0.0803 0.0276  94   PHE B CE1 
3351 C  CE2 . PHE B  97  ? 0.9362 0.9100 1.4275 0.0342  -0.0859 0.0347  94   PHE B CE2 
3352 C  CZ  . PHE B  97  ? 0.9142 0.8913 1.3921 0.0370  -0.0778 0.0346  94   PHE B CZ  
3353 N  N   . LEU B  98  ? 0.8412 0.7792 1.2983 0.0229  -0.1128 -0.0076 95   LEU B N   
3354 C  CA  . LEU B  98  ? 0.8379 0.7788 1.2912 0.0254  -0.1101 -0.0113 95   LEU B CA  
3355 C  C   . LEU B  98  ? 0.8901 0.8292 1.3200 0.0253  -0.1080 -0.0243 95   LEU B C   
3356 O  O   . LEU B  98  ? 0.8821 0.8264 1.3051 0.0277  -0.1024 -0.0264 95   LEU B O   
3357 C  CB  . LEU B  98  ? 0.8334 0.7703 1.3040 0.0254  -0.1186 -0.0092 95   LEU B CB  
3358 C  CG  . LEU B  98  ? 0.8888 0.8323 1.3826 0.0263  -0.1181 0.0056  95   LEU B CG  
3359 C  CD1 . LEU B  98  ? 0.8908 0.8278 1.4019 0.0252  -0.1293 0.0077  95   LEU B CD1 
3360 C  CD2 . LEU B  98  ? 0.9080 0.8632 1.3998 0.0299  -0.1069 0.0109  95   LEU B CD2 
3361 N  N   . CYS B  99  ? 0.8564 0.7891 1.2742 0.0224  -0.1121 -0.0322 96   CYS B N   
3362 C  CA  . CYS B  99  ? 0.8697 0.8026 1.2652 0.0220  -0.1098 -0.0433 96   CYS B CA  
3363 C  C   . CYS B  99  ? 0.8910 0.8311 1.2734 0.0227  -0.1001 -0.0412 96   CYS B C   
3364 O  O   . CYS B  99  ? 0.8751 0.8199 1.2454 0.0243  -0.0950 -0.0449 96   CYS B O   
3365 C  CB  . CYS B  99  ? 0.8873 0.8121 1.2734 0.0183  -0.1172 -0.0518 96   CYS B CB  
3366 S  SG  . CYS B  99  ? 0.9478 0.8754 1.3063 0.0171  -0.1138 -0.0636 96   CYS B SG  
3367 N  N   A ARG B  100 ? 0.8472 0.7876 1.2323 0.0219  -0.0983 -0.0349 97   ARG B N   
3368 N  N   B ARG B  100 ? 0.8476 0.7881 1.2327 0.0219  -0.0983 -0.0349 97   ARG B N   
3369 C  CA  A ARG B  100 ? 0.8477 0.7930 1.2211 0.0232  -0.0904 -0.0322 97   ARG B CA  
3370 C  CA  B ARG B  100 ? 0.8486 0.7938 1.2216 0.0232  -0.0904 -0.0324 97   ARG B CA  
3371 C  C   A ARG B  100 ? 0.8822 0.8349 1.2594 0.0275  -0.0826 -0.0257 97   ARG B C   
3372 C  C   B ARG B  100 ? 0.8829 0.8357 1.2602 0.0275  -0.0825 -0.0256 97   ARG B C   
3373 O  O   A ARG B  100 ? 0.8856 0.8416 1.2475 0.0287  -0.0767 -0.0279 97   ARG B O   
3374 O  O   B ARG B  100 ? 0.8867 0.8428 1.2488 0.0288  -0.0765 -0.0274 97   ARG B O   
3375 C  CB  A ARG B  100 ? 0.8545 0.7980 1.2339 0.0224  -0.0910 -0.0260 97   ARG B CB  
3376 C  CB  B ARG B  100 ? 0.8569 0.8001 1.2341 0.0220  -0.0913 -0.0272 97   ARG B CB  
3377 C  CG  A ARG B  100 ? 1.0283 0.9646 1.3998 0.0176  -0.0979 -0.0326 97   ARG B CG  
3378 C  CG  B ARG B  100 ? 1.0317 0.9669 1.4047 0.0171  -0.0995 -0.0336 97   ARG B CG  
3379 C  CD  A ARG B  100 ? 1.1910 1.1245 1.5767 0.0165  -0.1012 -0.0255 97   ARG B CD  
3380 C  CD  B ARG B  100 ? 1.2100 1.1434 1.5809 0.0157  -0.0994 -0.0303 97   ARG B CD  
3381 N  NE  A ARG B  100 ? 1.3008 1.2264 1.6806 0.0113  -0.1090 -0.0316 97   ARG B NE  
3382 N  NE  B ARG B  100 ? 1.3275 1.2538 1.7076 0.0117  -0.1080 -0.0305 97   ARG B NE  
3383 C  CZ  A ARG B  100 ? 1.4716 1.3928 1.8631 0.0090  -0.1142 -0.0271 97   ARG B CZ  
3384 C  CZ  B ARG B  100 ? 1.5130 1.4388 1.9115 0.0120  -0.1100 -0.0215 97   ARG B CZ  
3385 N  NH1 A ARG B  100 ? 1.3651 1.2899 1.7758 0.0116  -0.1125 -0.0160 97   ARG B NH1 
3386 N  NH1 B ARG B  100 ? 1.3018 1.2350 1.7117 0.0167  -0.1034 -0.0115 97   ARG B NH1 
3387 N  NH2 A ARG B  100 ? 1.2568 1.1704 1.6415 0.0039  -0.1214 -0.0332 97   ARG B NH2 
3388 N  NH2 B ARG B  100 ? 1.4057 1.3241 1.8114 0.0078  -0.1186 -0.0220 97   ARG B NH2 
3389 N  N   . LEU B  101 ? 0.8140 0.7693 1.2117 0.0294  -0.0831 -0.0176 98   LEU B N   
3390 C  CA  . LEU B  101 ? 0.7950 0.7578 1.1989 0.0333  -0.0763 -0.0103 98   LEU B CA  
3391 C  C   . LEU B  101 ? 0.8318 0.7960 1.2275 0.0339  -0.0749 -0.0164 98   LEU B C   
3392 O  O   . LEU B  101 ? 0.8325 0.8021 1.2219 0.0364  -0.0677 -0.0136 98   LEU B O   
3393 C  CB  . LEU B  101 ? 0.7828 0.7486 1.2119 0.0344  -0.0786 0.0005  98   LEU B CB  
3394 C  CG  . LEU B  101 ? 0.8436 0.8189 1.2798 0.0384  -0.0705 0.0104  98   LEU B CG  
3395 C  CD1 . LEU B  101 ? 0.8464 0.8262 1.2762 0.0414  -0.0629 0.0159  98   LEU B CD1 
3396 C  CD2 . LEU B  101 ? 0.8821 0.8608 1.3433 0.0385  -0.0744 0.0200  98   LEU B CD2 
3397 N  N   . SER B  102 ? 0.7634 0.7227 1.1586 0.0320  -0.0817 -0.0246 99   SER B N   
3398 C  CA  . SER B  102 ? 0.7515 0.7125 1.1393 0.0330  -0.0808 -0.0308 99   SER B CA  
3399 C  C   . SER B  102 ? 0.8015 0.7643 1.1661 0.0323  -0.0761 -0.0373 99   SER B C   
3400 O  O   . SER B  102 ? 0.8106 0.7779 1.1684 0.0339  -0.0713 -0.0380 99   SER B O   
3401 C  CB  . SER B  102 ? 0.7899 0.7449 1.1832 0.0322  -0.0896 -0.0379 99   SER B CB  
3402 O  OG  . SER B  102 ? 0.8817 0.8359 1.2962 0.0333  -0.0936 -0.0313 99   SER B OG  
3403 N  N   . THR B  103 ? 0.7404 0.6998 1.0932 0.0296  -0.0778 -0.0413 100  THR B N   
3404 C  CA  . THR B  103 ? 0.7311 0.6921 1.0622 0.0281  -0.0746 -0.0465 100  THR B CA  
3405 C  C   . THR B  103 ? 0.7814 0.7461 1.1062 0.0302  -0.0669 -0.0398 100  THR B C   
3406 O  O   . THR B  103 ? 0.8123 0.7803 1.1251 0.0308  -0.0628 -0.0412 100  THR B O   
3407 C  CB  . THR B  103 ? 0.7395 0.6957 1.0615 0.0243  -0.0795 -0.0516 100  THR B CB  
3408 O  OG1 . THR B  103 ? 0.6839 0.6361 1.0105 0.0228  -0.0866 -0.0580 100  THR B OG1 
3409 C  CG2 . THR B  103 ? 0.6948 0.6529 0.9947 0.0221  -0.0773 -0.0563 100  THR B CG2 
3410 N  N   . TYR B  104 ? 0.6837 0.6478 1.0168 0.0317  -0.0652 -0.0324 101  TYR B N   
3411 C  CA  . TYR B  104 ? 0.6609 0.6277 0.9890 0.0348  -0.0582 -0.0256 101  TYR B CA  
3412 C  C   . TYR B  104 ? 0.7025 0.6745 1.0332 0.0378  -0.0527 -0.0215 101  TYR B C   
3413 O  O   . TYR B  104 ? 0.7181 0.6911 1.0338 0.0389  -0.0480 -0.0214 101  TYR B O   
3414 C  CB  . TYR B  104 ? 0.6526 0.6192 0.9947 0.0366  -0.0580 -0.0179 101  TYR B CB  
3415 C  CG  . TYR B  104 ? 0.6536 0.6232 0.9921 0.0411  -0.0507 -0.0106 101  TYR B CG  
3416 C  CD1 . TYR B  104 ? 0.6771 0.6434 0.9969 0.0415  -0.0490 -0.0128 101  TYR B CD1 
3417 C  CD2 . TYR B  104 ? 0.6464 0.6220 1.0005 0.0451  -0.0463 -0.0010 101  TYR B CD2 
3418 C  CE1 . TYR B  104 ? 0.6570 0.6249 0.9725 0.0465  -0.0428 -0.0066 101  TYR B CE1 
3419 C  CE2 . TYR B  104 ? 0.6520 0.6309 1.0024 0.0501  -0.0394 0.0057  101  TYR B CE2 
3420 C  CZ  . TYR B  104 ? 0.7211 0.6956 1.0518 0.0512  -0.0376 0.0025  101  TYR B CZ  
3421 O  OH  . TYR B  104 ? 0.7008 0.6775 1.0264 0.0570  -0.0311 0.0085  101  TYR B OH  
3422 N  N   . ALA B  105 ? 0.6326 0.6072 0.9819 0.0389  -0.0540 -0.0181 102  ALA B N   
3423 C  CA  . ALA B  105 ? 0.6135 0.5931 0.9687 0.0413  -0.0498 -0.0136 102  ALA B CA  
3424 C  C   . ALA B  105 ? 0.6509 0.6313 0.9901 0.0405  -0.0479 -0.0195 102  ALA B C   
3425 O  O   . ALA B  105 ? 0.6523 0.6356 0.9857 0.0425  -0.0422 -0.0154 102  ALA B O   
3426 C  CB  . ALA B  105 ? 0.6104 0.5910 0.9873 0.0412  -0.0545 -0.0111 102  ALA B CB  
3427 N  N   . LEU B  106 ? 0.6022 0.5801 0.9330 0.0377  -0.0525 -0.0286 103  LEU B N   
3428 C  CA  . LEU B  106 ? 0.6019 0.5821 0.9187 0.0370  -0.0506 -0.0334 103  LEU B CA  
3429 C  C   . LEU B  106 ? 0.6417 0.6215 0.9387 0.0365  -0.0465 -0.0325 103  LEU B C   
3430 O  O   . LEU B  106 ? 0.6380 0.6204 0.9280 0.0373  -0.0424 -0.0305 103  LEU B O   
3431 C  CB  . LEU B  106 ? 0.6123 0.5919 0.9255 0.0349  -0.0561 -0.0429 103  LEU B CB  
3432 C  CG  . LEU B  106 ? 0.6835 0.6672 0.9828 0.0342  -0.0543 -0.0477 103  LEU B CG  
3433 C  CD1 . LEU B  106 ? 0.6859 0.6734 0.9926 0.0366  -0.0508 -0.0438 103  LEU B CD1 
3434 C  CD2 . LEU B  106 ? 0.7053 0.6894 1.0015 0.0329  -0.0594 -0.0569 103  LEU B CD2 
3435 N  N   . TYR B  107 ? 0.5959 0.5719 0.8843 0.0350  -0.0480 -0.0336 104  TYR B N   
3436 C  CA  . TYR B  107 ? 0.5897 0.5635 0.8584 0.0344  -0.0457 -0.0331 104  TYR B CA  
3437 C  C   . TYR B  107 ? 0.6408 0.6146 0.9089 0.0385  -0.0396 -0.0250 104  TYR B C   
3438 O  O   . TYR B  107 ? 0.6391 0.6119 0.8919 0.0389  -0.0369 -0.0239 104  TYR B O   
3439 C  CB  . TYR B  107 ? 0.6009 0.5702 0.8613 0.0315  -0.0501 -0.0368 104  TYR B CB  
3440 C  CG  . TYR B  107 ? 0.6228 0.5928 0.8796 0.0273  -0.0557 -0.0449 104  TYR B CG  
3441 C  CD1 . TYR B  107 ? 0.6402 0.6142 0.8869 0.0255  -0.0557 -0.0490 104  TYR B CD1 
3442 C  CD2 . TYR B  107 ? 0.6362 0.6033 0.8998 0.0253  -0.0609 -0.0483 104  TYR B CD2 
3443 C  CE1 . TYR B  107 ? 0.6371 0.6133 0.8806 0.0225  -0.0603 -0.0563 104  TYR B CE1 
3444 C  CE2 . TYR B  107 ? 0.6412 0.6090 0.9006 0.0219  -0.0659 -0.0559 104  TYR B CE2 
3445 C  CZ  . TYR B  107 ? 0.7168 0.6897 0.9660 0.0208  -0.0653 -0.0600 104  TYR B CZ  
3446 O  OH  . TYR B  107 ? 0.7237 0.6986 0.9682 0.0182  -0.0696 -0.0673 104  TYR B OH  
3447 N  N   . VAL B  108 ? 0.6063 0.5816 0.8913 0.0417  -0.0377 -0.0190 105  VAL B N   
3448 C  CA  . VAL B  108 ? 0.6079 0.5848 0.8944 0.0464  -0.0314 -0.0108 105  VAL B CA  
3449 C  C   . VAL B  108 ? 0.6538 0.6343 0.9398 0.0473  -0.0278 -0.0086 105  VAL B C   
3450 O  O   . VAL B  108 ? 0.6637 0.6428 0.9356 0.0490  -0.0238 -0.0062 105  VAL B O   
3451 C  CB  . VAL B  108 ? 0.6481 0.6280 0.9547 0.0494  -0.0303 -0.0039 105  VAL B CB  
3452 C  CG1 . VAL B  108 ? 0.6365 0.6205 0.9462 0.0547  -0.0232 0.0051  105  VAL B CG1 
3453 C  CG2 . VAL B  108 ? 0.6498 0.6255 0.9539 0.0490  -0.0331 -0.0053 105  VAL B CG2 
3454 N  N   . ASN B  109 ? 0.5806 0.5648 0.8806 0.0458  -0.0300 -0.0100 106  ASN B N   
3455 C  CA  . ASN B  109 ? 0.5770 0.5647 0.8787 0.0461  -0.0275 -0.0083 106  ASN B CA  
3456 C  C   . ASN B  109 ? 0.6499 0.6357 0.9307 0.0441  -0.0270 -0.0126 106  ASN B C   
3457 O  O   . ASN B  109 ? 0.6661 0.6526 0.9401 0.0453  -0.0229 -0.0086 106  ASN B O   
3458 C  CB  . ASN B  109 ? 0.5667 0.5571 0.8858 0.0448  -0.0318 -0.0110 106  ASN B CB  
3459 C  CG  . ASN B  109 ? 0.7602 0.7534 1.0782 0.0441  -0.0312 -0.0127 106  ASN B CG  
3460 O  OD1 . ASN B  109 ? 0.7694 0.7626 1.0824 0.0421  -0.0346 -0.0200 106  ASN B OD1 
3461 N  ND2 . ASN B  109 ? 0.5892 0.5852 0.9114 0.0460  -0.0269 -0.0058 106  ASN B ND2 
3462 N  N   . LEU B  110 ? 0.5842 0.5681 0.8552 0.0407  -0.0314 -0.0201 107  LEU B N   
3463 C  CA  . LEU B  110 ? 0.5815 0.5648 0.8338 0.0380  -0.0320 -0.0236 107  LEU B CA  
3464 C  C   . LEU B  110 ? 0.6323 0.6108 0.8663 0.0387  -0.0295 -0.0201 107  LEU B C   
3465 O  O   . LEU B  110 ? 0.6176 0.5960 0.8413 0.0383  -0.0275 -0.0180 107  LEU B O   
3466 C  CB  . LEU B  110 ? 0.5854 0.5690 0.8323 0.0343  -0.0374 -0.0316 107  LEU B CB  
3467 C  CG  . LEU B  110 ? 0.6552 0.6406 0.8850 0.0309  -0.0388 -0.0350 107  LEU B CG  
3468 C  CD1 . LEU B  110 ? 0.6531 0.6449 0.8895 0.0310  -0.0381 -0.0367 107  LEU B CD1 
3469 C  CD2 . LEU B  110 ? 0.6942 0.6789 0.9157 0.0273  -0.0438 -0.0410 107  LEU B CD2 
3470 N  N   . TYR B  111 ? 0.5998 0.5736 0.8293 0.0399  -0.0301 -0.0193 108  TYR B N   
3471 C  CA  . TYR B  111 ? 0.5908 0.5585 0.8018 0.0413  -0.0287 -0.0166 108  TYR B CA  
3472 C  C   . TYR B  111 ? 0.6576 0.6248 0.8707 0.0467  -0.0225 -0.0092 108  TYR B C   
3473 O  O   . TYR B  111 ? 0.6666 0.6289 0.8629 0.0479  -0.0211 -0.0070 108  TYR B O   
3474 C  CB  . TYR B  111 ? 0.5815 0.5438 0.7851 0.0406  -0.0323 -0.0193 108  TYR B CB  
3475 C  CG  . TYR B  111 ? 0.5611 0.5234 0.7555 0.0347  -0.0384 -0.0259 108  TYR B CG  
3476 C  CD1 . TYR B  111 ? 0.5709 0.5315 0.7470 0.0314  -0.0405 -0.0268 108  TYR B CD1 
3477 C  CD2 . TYR B  111 ? 0.5621 0.5269 0.7668 0.0321  -0.0421 -0.0306 108  TYR B CD2 
3478 C  CE1 . TYR B  111 ? 0.5370 0.4998 0.7056 0.0258  -0.0458 -0.0319 108  TYR B CE1 
3479 C  CE2 . TYR B  111 ? 0.5704 0.5363 0.7663 0.0269  -0.0474 -0.0364 108  TYR B CE2 
3480 C  CZ  . TYR B  111 ? 0.6199 0.5857 0.7982 0.0237  -0.0490 -0.0369 108  TYR B CZ  
3481 O  OH  . TYR B  111 ? 0.6375 0.6061 0.8076 0.0185  -0.0540 -0.0416 108  TYR B OH  
3482 N  N   . CYS B  112 ? 0.6325 0.6049 0.8656 0.0497  -0.0193 -0.0050 109  CYS B N   
3483 C  CA  . CYS B  112 ? 0.6474 0.6218 0.8847 0.0545  -0.0132 0.0027  109  CYS B CA  
3484 C  C   . CYS B  112 ? 0.7038 0.6793 0.9357 0.0530  -0.0116 0.0039  109  CYS B C   
3485 O  O   . CYS B  112 ? 0.7059 0.6780 0.9250 0.0554  -0.0082 0.0078  109  CYS B O   
3486 C  CB  . CYS B  112 ? 0.6459 0.6272 0.9076 0.0568  -0.0113 0.0075  109  CYS B CB  
3487 S  SG  . CYS B  112 ? 0.7028 0.6838 0.9694 0.0618  -0.0091 0.0118  109  CYS B SG  
3488 N  N   . SER B  113 ? 0.6419 0.6218 0.8832 0.0492  -0.0143 0.0004  110  SER B N   
3489 C  CA  . SER B  113 ? 0.6316 0.6136 0.8706 0.0474  -0.0134 0.0013  110  SER B CA  
3490 C  C   . SER B  113 ? 0.6620 0.6384 0.8774 0.0454  -0.0143 0.0001  110  SER B C   
3491 O  O   . SER B  113 ? 0.6483 0.6232 0.8567 0.0461  -0.0116 0.0044  110  SER B O   
3492 C  CB  . SER B  113 ? 0.6747 0.6622 0.9278 0.0445  -0.0167 -0.0033 110  SER B CB  
3493 O  OG  . SER B  113 ? 0.7645 0.7561 1.0398 0.0463  -0.0167 -0.0011 110  SER B OG  
3494 N  N   . ILE B  114 ? 0.6337 0.6065 0.8366 0.0426  -0.0187 -0.0052 111  ILE B N   
3495 C  CA  . ILE B  114 ? 0.6351 0.6021 0.8151 0.0400  -0.0213 -0.0059 111  ILE B CA  
3496 C  C   . ILE B  114 ? 0.7084 0.6673 0.8747 0.0441  -0.0184 -0.0008 111  ILE B C   
3497 O  O   . ILE B  114 ? 0.7413 0.6962 0.8943 0.0436  -0.0181 0.0022  111  ILE B O   
3498 C  CB  . ILE B  114 ? 0.6677 0.6331 0.8387 0.0360  -0.0272 -0.0120 111  ILE B CB  
3499 C  CG1 . ILE B  114 ? 0.6527 0.6263 0.8333 0.0322  -0.0298 -0.0171 111  ILE B CG1 
3500 C  CG2 . ILE B  114 ? 0.6920 0.6501 0.8390 0.0334  -0.0308 -0.0113 111  ILE B CG2 
3501 C  CD1 . ILE B  114 ? 0.6446 0.6187 0.8212 0.0288  -0.0349 -0.0230 111  ILE B CD1 
3502 N  N   . PHE B  115 ? 0.6545 0.6113 0.8245 0.0487  -0.0163 0.0006  112  PHE B N   
3503 C  CA  . PHE B  115 ? 0.6677 0.6172 0.8244 0.0540  -0.0134 0.0049  112  PHE B CA  
3504 C  C   . PHE B  115 ? 0.7251 0.6767 0.8859 0.0577  -0.0073 0.0115  112  PHE B C   
3505 O  O   . PHE B  115 ? 0.7291 0.6734 0.8723 0.0599  -0.0063 0.0143  112  PHE B O   
3506 C  CB  . PHE B  115 ? 0.6926 0.6404 0.8525 0.0582  -0.0127 0.0045  112  PHE B CB  
3507 C  CG  . PHE B  115 ? 0.7334 0.6755 0.8821 0.0552  -0.0191 -0.0012 112  PHE B CG  
3508 C  CD1 . PHE B  115 ? 0.7889 0.7245 0.9182 0.0507  -0.0246 -0.0038 112  PHE B CD1 
3509 C  CD2 . PHE B  115 ? 0.7829 0.7258 0.9403 0.0567  -0.0200 -0.0030 112  PHE B CD2 
3510 C  CE1 . PHE B  115 ? 0.8158 0.7465 0.9349 0.0475  -0.0311 -0.0083 112  PHE B CE1 
3511 C  CE2 . PHE B  115 ? 0.8255 0.7628 0.9724 0.0537  -0.0263 -0.0079 112  PHE B CE2 
3512 C  CZ  . PHE B  115 ? 0.8012 0.7326 0.9290 0.0490  -0.0319 -0.0105 112  PHE B CZ  
3513 N  N   . PHE B  116 ? 0.6807 0.6419 0.8640 0.0581  -0.0040 0.0141  113  PHE B N   
3514 C  CA  . PHE B  116 ? 0.6770 0.6418 0.8668 0.0608  0.0014  0.0208  113  PHE B CA  
3515 C  C   . PHE B  116 ? 0.7572 0.7195 0.9369 0.0570  0.0001  0.0213  113  PHE B C   
3516 O  O   . PHE B  116 ? 0.7596 0.7183 0.9296 0.0594  0.0033  0.0262  113  PHE B O   
3517 C  CB  . PHE B  116 ? 0.6843 0.6597 0.9015 0.0612  0.0036  0.0237  113  PHE B CB  
3518 C  CG  . PHE B  116 ? 0.6991 0.6785 0.9295 0.0652  0.0056  0.0259  113  PHE B CG  
3519 C  CD1 . PHE B  116 ? 0.7492 0.7256 0.9700 0.0713  0.0095  0.0296  113  PHE B CD1 
3520 C  CD2 . PHE B  116 ? 0.7126 0.6987 0.9651 0.0633  0.0033  0.0249  113  PHE B CD2 
3521 C  CE1 . PHE B  116 ? 0.7543 0.7356 0.9882 0.0751  0.0115  0.0324  113  PHE B CE1 
3522 C  CE2 . PHE B  116 ? 0.7445 0.7343 1.0098 0.0666  0.0045  0.0278  113  PHE B CE2 
3523 C  CZ  . PHE B  116 ? 0.7317 0.7198 0.9881 0.0724  0.0088  0.0319  113  PHE B CZ  
3524 N  N   . MET B  117 ? 0.7162 0.6806 0.8976 0.0513  -0.0045 0.0163  114  MET B N   
3525 C  CA  . MET B  117 ? 0.7075 0.6706 0.8801 0.0473  -0.0062 0.0169  114  MET B CA  
3526 C  C   . MET B  117 ? 0.7715 0.7234 0.9173 0.0470  -0.0084 0.0179  114  MET B C   
3527 O  O   . MET B  117 ? 0.7706 0.7189 0.9073 0.0465  -0.0075 0.0221  114  MET B O   
3528 C  CB  . MET B  117 ? 0.7271 0.6961 0.9071 0.0421  -0.0104 0.0113  114  MET B CB  
3529 C  CG  . MET B  117 ? 0.7557 0.7340 0.9601 0.0420  -0.0091 0.0110  114  MET B CG  
3530 S  SD  . MET B  117 ? 0.7972 0.7823 1.0082 0.0374  -0.0138 0.0038  114  MET B SD  
3531 C  CE  . MET B  117 ? 0.7442 0.7368 0.9800 0.0385  -0.0122 0.0054  114  MET B CE  
3532 N  N   . THR B  118 ? 0.7472 0.6929 0.8804 0.0475  -0.0117 0.0144  115  THR B N   
3533 C  CA  . THR B  118 ? 0.7635 0.6969 0.8706 0.0476  -0.0154 0.0150  115  THR B CA  
3534 C  C   . THR B  118 ? 0.8244 0.7508 0.9219 0.0541  -0.0108 0.0203  115  THR B C   
3535 O  O   . THR B  118 ? 0.8216 0.7395 0.9016 0.0537  -0.0123 0.0233  115  THR B O   
3536 C  CB  . THR B  118 ? 0.8444 0.7734 0.9430 0.0468  -0.0205 0.0100  115  THR B CB  
3537 O  OG1 . THR B  118 ? 0.7743 0.7111 0.8829 0.0413  -0.0239 0.0053  115  THR B OG1 
3538 C  CG2 . THR B  118 ? 0.8525 0.7682 0.9241 0.0458  -0.0263 0.0104  115  THR B CG2 
3539 N  N   . ALA B  119 ? 0.7792 0.7095 0.8881 0.0601  -0.0055 0.0217  116  ALA B N   
3540 C  CA  . ALA B  119 ? 0.7821 0.7085 0.8844 0.0674  0.0000  0.0268  116  ALA B CA  
3541 C  C   . ALA B  119 ? 0.8425 0.7716 0.9480 0.0671  0.0038  0.0325  116  ALA B C   
3542 O  O   . ALA B  119 ? 0.8370 0.7578 0.9256 0.0706  0.0053  0.0361  116  ALA B O   
3543 C  CB  . ALA B  119 ? 0.7817 0.7156 0.9005 0.0730  0.0049  0.0278  116  ALA B CB  
3544 N  N   . MET B  120 ? 0.8268 0.7663 0.9526 0.0626  0.0046  0.0330  117  MET B N   
3545 C  CA  . MET B  120 ? 0.8364 0.7797 0.9688 0.0610  0.0073  0.0382  117  MET B CA  
3546 C  C   . MET B  120 ? 0.9122 0.8461 1.0245 0.0569  0.0030  0.0386  117  MET B C   
3547 O  O   . MET B  120 ? 0.9199 0.8486 1.0219 0.0585  0.0051  0.0437  117  MET B O   
3548 C  CB  . MET B  120 ? 0.8589 0.8145 1.0175 0.0571  0.0073  0.0370  117  MET B CB  
3549 C  CG  . MET B  120 ? 0.9127 0.8731 1.0812 0.0549  0.0093  0.0420  117  MET B CG  
3550 S  SD  . MET B  120 ? 0.9562 0.9284 1.1524 0.0503  0.0070  0.0386  117  MET B SD  
3551 C  CE  . MET B  120 ? 0.9009 0.8814 1.1193 0.0548  0.0107  0.0412  117  MET B CE  
3552 N  N   . SER B  121 ? 0.8696 0.8016 0.9760 0.0514  -0.0032 0.0338  118  SER B N   
3553 C  CA  . SER B  121 ? 0.8680 0.7922 0.9563 0.0465  -0.0085 0.0346  118  SER B CA  
3554 C  C   . SER B  121 ? 0.9576 0.8665 1.0191 0.0499  -0.0105 0.0367  118  SER B C   
3555 O  O   . SER B  121 ? 0.9613 0.8629 1.0097 0.0485  -0.0118 0.0409  118  SER B O   
3556 C  CB  . SER B  121 ? 0.8916 0.8184 0.9795 0.0407  -0.0146 0.0294  118  SER B CB  
3557 O  OG  . SER B  121 ? 0.9619 0.9019 1.0730 0.0384  -0.0132 0.0267  118  SER B OG  
3558 N  N   . PHE B  122 ? 0.9417 0.8452 0.9949 0.0546  -0.0110 0.0337  119  PHE B N   
3559 C  CA  . PHE B  122 ? 0.9676 0.8555 0.9946 0.0592  -0.0134 0.0346  119  PHE B CA  
3560 C  C   . PHE B  122 ? 1.0367 0.9209 1.0581 0.0652  -0.0074 0.0402  119  PHE B C   
3561 O  O   . PHE B  122 ? 1.0363 0.9074 1.0356 0.0659  -0.0105 0.0427  119  PHE B O   
3562 C  CB  . PHE B  122 ? 0.9991 0.8836 1.0219 0.0639  -0.0144 0.0301  119  PHE B CB  
3563 C  CG  . PHE B  122 ? 1.0465 0.9134 1.0405 0.0678  -0.0194 0.0297  119  PHE B CG  
3564 C  CD1 . PHE B  122 ? 1.1177 0.9745 1.0943 0.0623  -0.0292 0.0276  119  PHE B CD1 
3565 C  CD2 . PHE B  122 ? 1.0868 0.9471 1.0706 0.0772  -0.0146 0.0318  119  PHE B CD2 
3566 C  CE1 . PHE B  122 ? 1.1497 0.9884 1.0990 0.0658  -0.0352 0.0273  119  PHE B CE1 
3567 C  CE2 . PHE B  122 ? 1.1503 0.9927 1.1060 0.0817  -0.0199 0.0308  119  PHE B CE2 
3568 C  CZ  . PHE B  122 ? 1.1401 0.9710 1.0786 0.0758  -0.0306 0.0285  119  PHE B CZ  
3569 N  N   . PHE B  123 ? 1.0078 0.9038 1.0495 0.0693  0.0006  0.0424  120  PHE B N   
3570 C  CA  . PHE B  123 ? 1.0122 0.9086 1.0528 0.0750  0.0073  0.0484  120  PHE B CA  
3571 C  C   . PHE B  123 ? 1.0986 0.9933 1.1367 0.0701  0.0066  0.0530  120  PHE B C   
3572 O  O   . PHE B  123 ? 1.1069 0.9909 1.1257 0.0730  0.0068  0.0566  120  PHE B O   
3573 C  CB  . PHE B  123 ? 1.0116 0.9231 1.0775 0.0792  0.0150  0.0504  120  PHE B CB  
3574 C  CG  . PHE B  123 ? 1.0243 0.9348 1.0859 0.0880  0.0185  0.0496  120  PHE B CG  
3575 C  CD1 . PHE B  123 ? 1.0627 0.9635 1.1092 0.0895  0.0135  0.0440  120  PHE B CD1 
3576 C  CD2 . PHE B  123 ? 1.0320 0.9522 1.1059 0.0945  0.0267  0.0549  120  PHE B CD2 
3577 C  CE1 . PHE B  123 ? 1.0702 0.9704 1.1136 0.0980  0.0167  0.0432  120  PHE B CE1 
3578 C  CE2 . PHE B  123 ? 1.0630 0.9837 1.1339 0.1031  0.0303  0.0546  120  PHE B CE2 
3579 C  CZ  . PHE B  123 ? 1.0493 0.9596 1.1048 0.1050  0.0253  0.0485  120  PHE B CZ  
3580 N  N   . ARG B  124 ? 1.0649 0.9691 1.1211 0.0627  0.0050  0.0526  121  ARG B N   
3581 C  CA  . ARG B  124 ? 1.0732 0.9772 1.1298 0.0573  0.0038  0.0568  121  ARG B CA  
3582 C  C   . ARG B  124 ? 1.1652 1.0536 1.1950 0.0539  -0.0035 0.0573  121  ARG B C   
3583 O  O   . ARG B  124 ? 1.1704 1.0529 1.1912 0.0524  -0.0038 0.0623  121  ARG B O   
3584 C  CB  . ARG B  124 ? 1.0712 0.9888 1.1528 0.0510  0.0031  0.0552  121  ARG B CB  
3585 C  CG  . ARG B  124 ? 1.2303 1.1514 1.3201 0.0467  0.0039  0.0603  121  ARG B CG  
3586 C  CD  . ARG B  124 ? 1.3782 1.3051 1.4797 0.0507  0.0108  0.0661  121  ARG B CD  
3587 N  NE  . ARG B  124 ? 1.4587 1.4002 1.5884 0.0514  0.0142  0.0651  121  ARG B NE  
3588 C  CZ  . ARG B  124 ? 1.6231 1.5742 1.7740 0.0469  0.0135  0.0656  121  ARG B CZ  
3589 N  NH1 . ARG B  124 ? 1.4012 1.3638 1.5764 0.0480  0.0156  0.0649  121  ARG B NH1 
3590 N  NH2 . ARG B  124 ? 1.5251 1.4740 1.6732 0.0415  0.0103  0.0670  121  ARG B NH2 
3591 N  N   . CYS B  125 ? 1.1423 1.0237 1.1591 0.0525  -0.0098 0.0526  122  CYS B N   
3592 C  CA  . CYS B  125 ? 1.1473 1.0136 1.1385 0.0491  -0.0182 0.0532  122  CYS B CA  
3593 C  C   . CYS B  125 ? 1.2401 1.0903 1.2067 0.0553  -0.0182 0.0563  122  CYS B C   
3594 O  O   . CYS B  125 ? 1.2357 1.0764 1.1884 0.0525  -0.0215 0.0608  122  CYS B O   
3595 C  CB  . CYS B  125 ? 1.1400 1.0038 1.1251 0.0467  -0.0248 0.0478  122  CYS B CB  
3596 S  SG  . CYS B  125 ? 1.1959 1.0406 1.1494 0.0420  -0.0369 0.0493  122  CYS B SG  
3597 N  N   . ILE B  126 ? 1.2338 1.0813 1.1955 0.0641  -0.0142 0.0540  123  ILE B N   
3598 C  CA  . ILE B  126 ? 1.2605 1.0935 1.1986 0.0721  -0.0132 0.0560  123  ILE B CA  
3599 C  C   . ILE B  126 ? 1.3508 1.1863 1.2919 0.0737  -0.0070 0.0624  123  ILE B C   
3600 O  O   . ILE B  126 ? 1.3581 1.1789 1.2763 0.0758  -0.0094 0.0654  123  ILE B O   
3601 C  CB  . ILE B  126 ? 1.3033 1.1359 1.2390 0.0816  -0.0096 0.0519  123  ILE B CB  
3602 C  CG1 . ILE B  126 ? 1.3205 1.1389 1.2360 0.0813  -0.0191 0.0469  123  ILE B CG1 
3603 C  CG2 . ILE B  126 ? 1.3216 1.1490 1.2454 0.0920  -0.0031 0.0549  123  ILE B CG2 
3604 C  CD1 . ILE B  126 ? 1.3844 1.2100 1.3122 0.0732  -0.0246 0.0428  123  ILE B CD1 
3605 N  N   . ALA B  127 ? 1.3359 1.1892 1.3050 0.0715  -0.0003 0.0646  124  ALA B N   
3606 C  CA  . ALA B  127 ? 1.3494 1.2073 1.3253 0.0714  0.0051  0.0711  124  ALA B CA  
3607 C  C   . ALA B  127 ? 1.4506 1.3001 1.4168 0.0634  -0.0012 0.0747  124  ALA B C   
3608 O  O   . ALA B  127 ? 1.4593 1.2982 1.4085 0.0653  -0.0012 0.0792  124  ALA B O   
3609 C  CB  . ALA B  127 ? 1.3389 1.2174 1.3482 0.0699  0.0117  0.0724  124  ALA B CB  
3610 N  N   . ILE B  128 ? 1.4275 1.2814 1.4032 0.0548  -0.0068 0.0728  125  ILE B N   
3611 C  CA  . ILE B  128 ? 1.4390 1.2874 1.4087 0.0465  -0.0130 0.0765  125  ILE B CA  
3612 C  C   . ILE B  128 ? 1.5310 1.3581 1.4680 0.0459  -0.0218 0.0775  125  ILE B C   
3613 O  O   . ILE B  128 ? 1.5360 1.3526 1.4592 0.0443  -0.0241 0.0828  125  ILE B O   
3614 C  CB  . ILE B  128 ? 1.4671 1.3288 1.4578 0.0384  -0.0158 0.0743  125  ILE B CB  
3615 C  CG1 . ILE B  128 ? 1.4584 1.3396 1.4813 0.0388  -0.0084 0.0734  125  ILE B CG1 
3616 C  CG2 . ILE B  128 ? 1.4763 1.3333 1.4609 0.0300  -0.0223 0.0789  125  ILE B CG2 
3617 C  CD1 . ILE B  128 ? 1.5703 1.4578 1.6069 0.0379  -0.0035 0.0794  125  ILE B CD1 
3618 N  N   . VAL B  129 ? 1.5120 1.3324 1.4372 0.0466  -0.0275 0.0726  126  VAL B N   
3619 C  CA  . VAL B  129 ? 1.5372 1.3372 1.4324 0.0455  -0.0378 0.0731  126  VAL B CA  
3620 C  C   . VAL B  129 ? 1.6473 1.4295 1.5166 0.0540  -0.0373 0.0745  126  VAL B C   
3621 O  O   . VAL B  129 ? 1.6530 1.4181 1.4995 0.0519  -0.0446 0.0783  126  VAL B O   
3622 C  CB  . VAL B  129 ? 1.5826 1.3818 1.4746 0.0439  -0.0440 0.0674  126  VAL B CB  
3623 C  CG1 . VAL B  129 ? 1.5987 1.3760 1.4595 0.0430  -0.0556 0.0681  126  VAL B CG1 
3624 C  CG2 . VAL B  129 ? 1.5667 1.3824 1.4808 0.0352  -0.0453 0.0665  126  VAL B CG2 
3625 N  N   . PHE B  130 ? 1.6349 1.4212 1.5074 0.0638  -0.0289 0.0717  127  PHE B N   
3626 C  CA  . PHE B  130 ? 1.6584 1.4301 1.5072 0.0737  -0.0270 0.0725  127  PHE B CA  
3627 C  C   . PHE B  130 ? 1.7461 1.5292 1.6080 0.0789  -0.0153 0.0765  127  PHE B C   
3628 O  O   . PHE B  130 ? 1.7322 1.5240 1.6022 0.0873  -0.0073 0.0745  127  PHE B O   
3629 C  CB  . PHE B  130 ? 1.6840 1.4484 1.5200 0.0821  -0.0284 0.0662  127  PHE B CB  
3630 C  CG  . PHE B  130 ? 1.7050 1.4610 1.5320 0.0768  -0.0395 0.0622  127  PHE B CG  
3631 C  CD1 . PHE B  130 ? 1.7606 1.4940 1.5579 0.0751  -0.0514 0.0630  127  PHE B CD1 
3632 C  CD2 . PHE B  130 ? 1.7163 1.4867 1.5640 0.0733  -0.0388 0.0580  127  PHE B CD2 
3633 C  CE1 . PHE B  130 ? 1.7772 1.5037 1.5668 0.0696  -0.0624 0.0603  127  PHE B CE1 
3634 C  CE2 . PHE B  130 ? 1.7567 1.5203 1.5961 0.0680  -0.0493 0.0548  127  PHE B CE2 
3635 C  CZ  . PHE B  130 ? 1.7507 1.4930 1.5616 0.0660  -0.0610 0.0563  127  PHE B CZ  
3636 N  N   . PRO B  131 ? 1.7403 1.5238 1.6046 0.0741  -0.0144 0.0828  128  PRO B N   
3637 C  CA  . PRO B  131 ? 1.7420 1.5370 1.6193 0.0784  -0.0039 0.0873  128  PRO B CA  
3638 C  C   . PRO B  131 ? 1.8398 1.6242 1.6943 0.0899  0.0003  0.0884  128  PRO B C   
3639 O  O   . PRO B  131 ? 1.8228 1.6186 1.6881 0.0945  0.0097  0.0923  128  PRO B O   
3640 C  CB  . PRO B  131 ? 1.7575 1.5544 1.6427 0.0689  -0.0060 0.0934  128  PRO B CB  
3641 C  CG  . PRO B  131 ? 1.8139 1.6039 1.6945 0.0597  -0.0166 0.0920  128  PRO B CG  
3642 C  CD  . PRO B  131 ? 1.7693 1.5439 1.6261 0.0642  -0.0231 0.0868  128  PRO B CD  
3643 N  N   . VAL B  132 ? 1.8451 1.6079 1.6677 0.0946  -0.0069 0.0852  129  VAL B N   
3644 C  CA  . VAL B  132 ? 1.8685 1.6185 1.6653 0.1068  -0.0041 0.0848  129  VAL B CA  
3645 C  C   . VAL B  132 ? 1.9445 1.7045 1.7494 0.1166  0.0026  0.0799  129  VAL B C   
3646 O  O   . VAL B  132 ? 1.9394 1.6944 1.7405 0.1167  -0.0031 0.0740  129  VAL B O   
3647 C  CB  . VAL B  132 ? 1.9398 1.6608 1.6989 0.1076  -0.0162 0.0833  129  VAL B CB  
3648 N  N   . GLN B  133 ? 1.9190 1.6947 1.7373 0.1239  0.0146  0.0831  130  GLN B N   
3649 C  CA  . GLN B  133 ? 1.9188 1.7079 1.7485 0.1338  0.0232  0.0807  130  GLN B CA  
3650 C  C   . GLN B  133 ? 1.9688 1.7753 1.8300 0.1274  0.0237  0.0777  130  GLN B C   
3651 O  O   . GLN B  133 ? 1.9596 1.7728 1.8278 0.1334  0.0267  0.0739  130  GLN B O   
3652 C  CB  . GLN B  133 ? 1.9546 1.7254 1.7525 0.1460  0.0206  0.0757  130  GLN B CB  
3653 C  CG  . GLN B  133 ? 2.1465 1.9228 1.9498 0.1538  0.0230  0.0700  130  GLN B CG  
3654 C  CD  . GLN B  133 ? 2.3896 2.1602 2.1955 0.1470  0.0133  0.0636  130  GLN B CD  
3655 O  OE1 . GLN B  133 ? 2.3368 2.1090 2.1441 0.1531  0.0138  0.0588  130  GLN B OE1 
3656 N  NE2 . GLN B  133 ? 2.2859 2.0514 2.0941 0.1342  0.0045  0.0638  130  GLN B NE2 
3657 N  N   . ASN B  134 ? 1.9238 1.7383 1.8046 0.1153  0.0209  0.0797  131  ASN B N   
3658 C  CA  . ASN B  134 ? 1.9062 1.7365 1.8160 0.1087  0.0209  0.0770  131  ASN B CA  
3659 C  C   . ASN B  134 ? 1.9282 1.7798 1.8644 0.1138  0.0314  0.0793  131  ASN B C   
3660 O  O   . ASN B  134 ? 1.9200 1.7797 1.8699 0.1150  0.0321  0.0753  131  ASN B O   
3661 C  CB  . ASN B  134 ? 1.9146 1.7493 1.8390 0.0961  0.0165  0.0791  131  ASN B CB  
3662 N  N   . ILE B  135 ? 1.8616 1.7223 1.8046 0.1168  0.0392  0.0865  132  ILE B N   
3663 C  CA  . ILE B  135 ? 1.8341 1.7158 1.8019 0.1215  0.0491  0.0909  132  ILE B CA  
3664 C  C   . ILE B  135 ? 1.8587 1.7421 1.8206 0.1331  0.0537  0.0883  132  ILE B C   
3665 O  O   . ILE B  135 ? 1.8390 1.7397 1.8253 0.1348  0.0589  0.0896  132  ILE B O   
3666 C  CB  . ILE B  135 ? 1.8691 1.7587 1.8415 0.1224  0.0557  0.0998  132  ILE B CB  
3667 N  N   . ASN B  136 ? 1.8094 1.6744 1.7391 0.1409  0.0509  0.0845  133  ASN B N   
3668 C  CA  . ASN B  136 ? 1.7989 1.6622 1.7183 0.1529  0.0542  0.0812  133  ASN B CA  
3669 C  C   . ASN B  136 ? 1.8228 1.6801 1.7425 0.1508  0.0472  0.0731  133  ASN B C   
3670 O  O   . ASN B  136 ? 1.8115 1.6740 1.7347 0.1587  0.0507  0.0708  133  ASN B O   
3671 C  CB  . ASN B  136 ? 1.8177 1.6632 1.7014 0.1633  0.0543  0.0808  133  ASN B CB  
3672 N  N   . LEU B  137 ? 1.7606 1.6081 1.6772 0.1401  0.0374  0.0692  134  LEU B N   
3673 C  CA  . LEU B  137 ? 1.7438 1.5856 1.6602 0.1365  0.0298  0.0620  134  LEU B CA  
3674 C  C   . LEU B  137 ? 1.7269 1.5872 1.6772 0.1287  0.0311  0.0615  134  LEU B C   
3675 O  O   . LEU B  137 ? 1.7182 1.5816 1.6757 0.1301  0.0299  0.0570  134  LEU B O   
3676 C  CB  . LEU B  137 ? 1.7592 1.5807 1.6526 0.1294  0.0181  0.0587  134  LEU B CB  
3677 N  N   . VAL B  138 ? 1.6319 1.5036 1.6024 0.1207  0.0329  0.0658  135  VAL B N   
3678 C  CA  . VAL B  138 ? 1.5925 1.4808 1.5946 0.1134  0.0336  0.0654  135  VAL B CA  
3679 C  C   . VAL B  138 ? 1.5780 1.4853 1.6048 0.1160  0.0430  0.0725  135  VAL B C   
3680 O  O   . VAL B  138 ? 1.5640 1.4789 1.6049 0.1101  0.0442  0.0770  135  VAL B O   
3681 C  CB  . VAL B  138 ? 1.6393 1.5248 1.6452 0.1015  0.0263  0.0638  135  VAL B CB  
3682 N  N   . THR B  139 ? 1.4903 1.4054 1.5224 0.1250  0.0492  0.0739  136  THR B N   
3683 C  CA  . THR B  139 ? 1.4547 1.3886 1.5094 0.1286  0.0581  0.0817  136  THR B CA  
3684 C  C   . THR B  139 ? 1.4365 1.3863 1.5234 0.1244  0.0585  0.0818  136  THR B C   
3685 O  O   . THR B  139 ? 1.4279 1.3741 1.5169 0.1214  0.0533  0.0752  136  THR B O   
3686 C  CB  . THR B  139 ? 1.5758 1.5104 1.6171 0.1418  0.0655  0.0849  136  THR B CB  
3687 O  OG1 . THR B  139 ? 1.5635 1.5037 1.6131 0.1471  0.0670  0.0823  136  THR B OG1 
3688 C  CG2 . THR B  139 ? 1.5897 1.5040 1.5943 0.1476  0.0631  0.0819  136  THR B CG2 
3689 N  N   . GLN B  140 ? 1.3438 1.3112 1.4552 0.1243  0.0644  0.0899  137  GLN B N   
3690 C  CA  . GLN B  140 ? 1.3082 1.2913 1.4514 0.1209  0.0648  0.0918  137  GLN B CA  
3691 C  C   . GLN B  140 ? 1.3221 1.3089 1.4677 0.1283  0.0673  0.0904  137  GLN B C   
3692 O  O   . GLN B  140 ? 1.3132 1.3069 1.4789 0.1247  0.0647  0.0885  137  GLN B O   
3693 C  CB  . GLN B  140 ? 1.3097 1.3096 1.4758 0.1198  0.0701  0.1021  137  GLN B CB  
3694 N  N   . LYS B  141 ? 1.2592 1.2414 1.3845 0.1388  0.0721  0.0913  138  LYS B N   
3695 C  CA  . LYS B  141 ? 1.2378 1.2224 1.3619 0.1475  0.0749  0.0900  138  LYS B CA  
3696 C  C   . LYS B  141 ? 1.2599 1.2302 1.3728 0.1444  0.0668  0.0795  138  LYS B C   
3697 O  O   . LYS B  141 ? 1.2444 1.2198 1.3702 0.1450  0.0658  0.0775  138  LYS B O   
3698 C  CB  . LYS B  141 ? 1.2698 1.2509 1.3711 0.1601  0.0816  0.0929  138  LYS B CB  
3699 C  CG  . LYS B  141 ? 1.3789 1.3662 1.4824 0.1704  0.0862  0.0935  138  LYS B CG  
3700 C  CD  . LYS B  141 ? 1.4706 1.4437 1.5411 0.1820  0.0878  0.0896  138  LYS B CD  
3701 N  N   . LYS B  142 ? 1.2105 1.1633 1.2992 0.1410  0.0606  0.0734  139  LYS B N   
3702 C  CA  . LYS B  142 ? 1.2057 1.1445 1.2817 0.1370  0.0520  0.0641  139  LYS B CA  
3703 C  C   . LYS B  142 ? 1.2328 1.1778 1.3311 0.1262  0.0468  0.0612  139  LYS B C   
3704 O  O   . LYS B  142 ? 1.2434 1.1851 1.3430 0.1245  0.0421  0.0554  139  LYS B O   
3705 C  CB  . LYS B  142 ? 1.2471 1.1665 1.2923 0.1358  0.0465  0.0602  139  LYS B CB  
3706 C  CG  . LYS B  142 ? 1.3911 1.2988 1.4089 0.1475  0.0485  0.0594  139  LYS B CG  
3707 C  CD  . LYS B  142 ? 1.5012 1.3909 1.4899 0.1469  0.0440  0.0581  139  LYS B CD  
3708 C  CE  . LYS B  142 ? 1.5928 1.4725 1.5555 0.1598  0.0474  0.0586  139  LYS B CE  
3709 N  NZ  . LYS B  142 ? 1.6608 1.5239 1.5968 0.1591  0.0437  0.0590  139  LYS B NZ  
3710 N  N   . ALA B  143 ? 1.1555 1.1095 1.2715 0.1193  0.0474  0.0651  140  ALA B N   
3711 C  CA  . ALA B  143 ? 1.1328 1.0932 1.2705 0.1099  0.0428  0.0624  140  ALA B CA  
3712 C  C   . ALA B  143 ? 1.1494 1.1219 1.3107 0.1116  0.0446  0.0637  140  ALA B C   
3713 O  O   . ALA B  143 ? 1.1377 1.1093 1.3068 0.1066  0.0392  0.0580  140  ALA B O   
3714 C  CB  . ALA B  143 ? 1.1354 1.1030 1.2869 0.1041  0.0437  0.0671  140  ALA B CB  
3715 N  N   . ARG B  144 ? 1.0953 1.0790 1.2671 0.1186  0.0520  0.0715  141  ARG B N   
3716 C  CA  . ARG B  144 ? 1.0824 1.0788 1.2775 0.1209  0.0542  0.0749  141  ARG B CA  
3717 C  C   . ARG B  144 ? 1.1259 1.1156 1.3119 0.1248  0.0519  0.0691  141  ARG B C   
3718 O  O   . ARG B  144 ? 1.1169 1.1114 1.3202 0.1216  0.0489  0.0674  141  ARG B O   
3719 C  CB  . ARG B  144 ? 1.0885 1.0993 1.2953 0.1278  0.0629  0.0860  141  ARG B CB  
3720 C  CG  . ARG B  144 ? 1.2166 1.2400 1.4473 0.1219  0.0637  0.0933  141  ARG B CG  
3721 C  CD  . ARG B  144 ? 1.3833 1.4232 1.6283 0.1281  0.0718  0.1053  141  ARG B CD  
3722 N  NE  . ARG B  144 ? 1.6203 1.6576 1.8439 0.1354  0.0782  0.1088  141  ARG B NE  
3723 C  CZ  . ARG B  144 ? 1.8920 1.9303 2.1126 0.1330  0.0799  0.1131  141  ARG B CZ  
3724 N  NH1 . ARG B  144 ? 1.7476 1.7899 1.9861 0.1236  0.0757  0.1146  141  ARG B NH1 
3725 N  NH2 . ARG B  144 ? 1.7742 1.8089 1.9734 0.1402  0.0855  0.1159  141  ARG B NH2 
3726 N  N   . PHE B  145 ? 1.0814 1.0588 1.2397 0.1315  0.0526  0.0657  142  PHE B N   
3727 C  CA  . PHE B  145 ? 1.0823 1.0522 1.2303 0.1358  0.0499  0.0601  142  PHE B CA  
3728 C  C   . PHE B  145 ? 1.1031 1.0610 1.2430 0.1275  0.0402  0.0506  142  PHE B C   
3729 O  O   . PHE B  145 ? 1.1158 1.0713 1.2573 0.1278  0.0368  0.0464  142  PHE B O   
3730 C  CB  . PHE B  145 ? 1.1217 1.0838 1.2450 0.1474  0.0541  0.0606  142  PHE B CB  
3731 C  CG  . PHE B  145 ? 1.1376 1.1155 1.2751 0.1566  0.0636  0.0695  142  PHE B CG  
3732 C  CD1 . PHE B  145 ? 1.1745 1.1624 1.3166 0.1595  0.0708  0.0780  142  PHE B CD1 
3733 C  CD2 . PHE B  145 ? 1.1640 1.1487 1.3133 0.1614  0.0651  0.0704  142  PHE B CD2 
3734 C  CE1 . PHE B  145 ? 1.1709 1.1759 1.3283 0.1674  0.0795  0.0874  142  PHE B CE1 
3735 C  CE2 . PHE B  145 ? 1.1887 1.1903 1.3536 0.1695  0.0739  0.0799  142  PHE B CE2 
3736 C  CZ  . PHE B  145 ? 1.1563 1.1684 1.3252 0.1724  0.0811  0.0885  142  PHE B CZ  
3737 N  N   . VAL B  146 ? 1.0083 0.9603 1.1416 0.1197  0.0358  0.0478  143  VAL B N   
3738 C  CA  . VAL B  146 ? 0.9858 0.9295 1.1137 0.1110  0.0271  0.0401  143  VAL B CA  
3739 C  C   . VAL B  146 ? 0.9839 0.9388 1.1396 0.1045  0.0252  0.0394  143  VAL B C   
3740 O  O   . VAL B  146 ? 0.9799 0.9317 1.1369 0.1013  0.0198  0.0338  143  VAL B O   
3741 C  CB  . VAL B  146 ? 1.0360 0.9713 1.1484 0.1057  0.0237  0.0387  143  VAL B CB  
3742 C  CG1 . VAL B  146 ? 1.0325 0.9642 1.1453 0.0959  0.0156  0.0323  143  VAL B CG1 
3743 C  CG2 . VAL B  146 ? 1.0483 0.9689 1.1303 0.1115  0.0230  0.0380  143  VAL B CG2 
3744 N  N   . CYS B  147 ? 0.8908 0.8581 1.0684 0.1027  0.0290  0.0452  144  CYS B N   
3745 C  CA  . CYS B  147 ? 0.8603 0.8371 1.0640 0.0969  0.0265  0.0450  144  CYS B CA  
3746 C  C   . CYS B  147 ? 0.8983 0.8800 1.1152 0.0996  0.0266  0.0455  144  CYS B C   
3747 O  O   . CYS B  147 ? 0.8886 0.8701 1.1147 0.0942  0.0211  0.0406  144  CYS B O   
3748 C  CB  . CYS B  147 ? 0.8492 0.8370 1.0720 0.0950  0.0299  0.0518  144  CYS B CB  
3749 S  SG  . CYS B  147 ? 0.8959 0.8787 1.1097 0.0885  0.0273  0.0497  144  CYS B SG  
3750 N  N   . VAL B  148 ? 0.8684 0.8545 1.0856 0.1081  0.0327  0.0513  145  VAL B N   
3751 C  CA  . VAL B  148 ? 0.8614 0.8524 1.0907 0.1116  0.0332  0.0527  145  VAL B CA  
3752 C  C   . VAL B  148 ? 0.8765 0.8554 1.0904 0.1100  0.0268  0.0437  145  VAL B C   
3753 O  O   . VAL B  148 ? 0.8596 0.8399 1.0861 0.1059  0.0223  0.0409  145  VAL B O   
3754 C  CB  . VAL B  148 ? 0.9215 0.9214 1.1547 0.1218  0.0416  0.0615  145  VAL B CB  
3755 C  CG1 . VAL B  148 ? 0.9047 0.9195 1.1592 0.1215  0.0467  0.0715  145  VAL B CG1 
3756 C  CG2 . VAL B  148 ? 0.9367 0.9271 1.1414 0.1298  0.0451  0.0601  145  VAL B CG2 
3757 N  N   . GLY B  149 ? 0.8284 0.7947 1.0149 0.1123  0.0255  0.0393  146  GLY B N   
3758 C  CA  . GLY B  149 ? 0.8273 0.7806 0.9956 0.1101  0.0185  0.0310  146  GLY B CA  
3759 C  C   . GLY B  149 ? 0.8586 0.8104 1.0330 0.0996  0.0110  0.0249  146  GLY B C   
3760 O  O   . GLY B  149 ? 0.8611 0.8098 1.0368 0.0969  0.0058  0.0203  146  GLY B O   
3761 N  N   . ILE B  150 ? 0.7787 0.7337 0.9582 0.0938  0.0105  0.0252  147  ILE B N   
3762 C  CA  . ILE B  150 ? 0.7476 0.7031 0.9338 0.0846  0.0044  0.0199  147  ILE B CA  
3763 C  C   . ILE B  150 ? 0.7682 0.7321 0.9791 0.0822  0.0031  0.0201  147  ILE B C   
3764 O  O   . ILE B  150 ? 0.7710 0.7318 0.9820 0.0772  -0.0030 0.0141  147  ILE B O   
3765 C  CB  . ILE B  150 ? 0.7757 0.7332 0.9619 0.0804  0.0049  0.0209  147  ILE B CB  
3766 C  CG1 . ILE B  150 ? 0.7878 0.7340 0.9467 0.0801  0.0028  0.0187  147  ILE B CG1 
3767 C  CG2 . ILE B  150 ? 0.7797 0.7417 0.9798 0.0726  0.0001  0.0166  147  ILE B CG2 
3768 C  CD1 . ILE B  150 ? 0.8668 0.8139 1.0228 0.0776  0.0045  0.0214  147  ILE B CD1 
3769 N  N   . TRP B  151 ? 0.6945 0.6688 0.9258 0.0857  0.0082  0.0275  148  TRP B N   
3770 C  CA  . TRP B  151 ? 0.6647 0.6467 0.9206 0.0837  0.0065  0.0292  148  TRP B CA  
3771 C  C   . TRP B  151 ? 0.7523 0.7306 1.0066 0.0853  0.0039  0.0267  148  TRP B C   
3772 O  O   . TRP B  151 ? 0.7492 0.7265 1.0117 0.0800  -0.0019 0.0222  148  TRP B O   
3773 C  CB  . TRP B  151 ? 0.6156 0.6095 0.8923 0.0875  0.0124  0.0392  148  TRP B CB  
3774 C  CG  . TRP B  151 ? 0.6010 0.6003 0.8893 0.0836  0.0125  0.0416  148  TRP B CG  
3775 C  CD1 . TRP B  151 ? 0.6314 0.6339 0.9166 0.0859  0.0175  0.0468  148  TRP B CD1 
3776 C  CD2 . TRP B  151 ? 0.5885 0.5908 0.8947 0.0773  0.0071  0.0395  148  TRP B CD2 
3777 N  NE1 . TRP B  151 ? 0.6153 0.6227 0.9157 0.0810  0.0154  0.0480  148  TRP B NE1 
3778 C  CE2 . TRP B  151 ? 0.6301 0.6371 0.9429 0.0760  0.0089  0.0432  148  TRP B CE2 
3779 C  CE3 . TRP B  151 ? 0.6023 0.6026 0.9175 0.0726  0.0004  0.0340  148  TRP B CE3 
3780 C  CZ2 . TRP B  151 ? 0.6170 0.6267 0.9461 0.0707  0.0041  0.0416  148  TRP B CZ2 
3781 C  CZ3 . TRP B  151 ? 0.6124 0.6151 0.9424 0.0676  -0.0042 0.0322  148  TRP B CZ3 
3782 C  CH2 . TRP B  151 ? 0.6142 0.6215 0.9513 0.0669  -0.0024 0.0359  148  TRP B CH2 
3783 N  N   . ILE B  152 ? 0.7245 0.7003 0.9674 0.0928  0.0079  0.0292  149  ILE B N   
3784 C  CA  . ILE B  152 ? 0.7221 0.6943 0.9632 0.0952  0.0056  0.0272  149  ILE B CA  
3785 C  C   . ILE B  152 ? 0.7396 0.7005 0.9650 0.0889  -0.0027 0.0176  149  ILE B C   
3786 O  O   . ILE B  152 ? 0.7283 0.6889 0.9626 0.0849  -0.0077 0.0146  149  ILE B O   
3787 C  CB  . ILE B  152 ? 0.7761 0.7478 1.0071 0.1058  0.0118  0.0317  149  ILE B CB  
3788 C  CG1 . ILE B  152 ? 0.7732 0.7587 1.0218 0.1119  0.0202  0.0423  149  ILE B CG1 
3789 C  CG2 . ILE B  152 ? 0.7876 0.7550 1.0165 0.1083  0.0088  0.0292  149  ILE B CG2 
3790 C  CD1 . ILE B  152 ? 0.8432 0.8275 1.0759 0.1211  0.0268  0.0456  149  ILE B CD1 
3791 N  N   . PHE B  153 ? 0.6770 0.6293 0.8799 0.0875  -0.0045 0.0133  150  PHE B N   
3792 C  CA  . PHE B  153 ? 0.6757 0.6185 0.8627 0.0812  -0.0125 0.0053  150  PHE B CA  
3793 C  C   . PHE B  153 ? 0.7115 0.6580 0.9113 0.0724  -0.0178 0.0011  150  PHE B C   
3794 O  O   . PHE B  153 ? 0.6862 0.6296 0.8862 0.0687  -0.0234 -0.0033 150  PHE B O   
3795 C  CB  . PHE B  153 ? 0.7153 0.6498 0.8784 0.0809  -0.0134 0.0035  150  PHE B CB  
3796 C  CG  . PHE B  153 ? 0.7504 0.6755 0.8958 0.0745  -0.0220 -0.0034 150  PHE B CG  
3797 C  CD1 . PHE B  153 ? 0.7962 0.7121 0.9281 0.0760  -0.0267 -0.0064 150  PHE B CD1 
3798 C  CD2 . PHE B  153 ? 0.7838 0.7098 0.9260 0.0669  -0.0255 -0.0063 150  PHE B CD2 
3799 C  CE1 . PHE B  153 ? 0.8189 0.7268 0.9350 0.0694  -0.0354 -0.0118 150  PHE B CE1 
3800 C  CE2 . PHE B  153 ? 0.8314 0.7504 0.9577 0.0607  -0.0335 -0.0115 150  PHE B CE2 
3801 C  CZ  . PHE B  153 ? 0.8122 0.7222 0.9256 0.0617  -0.0386 -0.0140 150  PHE B CZ  
3802 N  N   . VAL B  154 ? 0.6753 0.6285 0.8864 0.0695  -0.0159 0.0026  151  VAL B N   
3803 C  CA  . VAL B  154 ? 0.6707 0.6277 0.8935 0.0624  -0.0204 -0.0016 151  VAL B CA  
3804 C  C   . VAL B  154 ? 0.7074 0.6686 0.9511 0.0616  -0.0224 -0.0008 151  VAL B C   
3805 O  O   . VAL B  154 ? 0.6927 0.6514 0.9366 0.0563  -0.0285 -0.0066 151  VAL B O   
3806 C  CB  . VAL B  154 ? 0.6980 0.6604 0.9272 0.0606  -0.0180 -0.0001 151  VAL B CB  
3807 C  CG1 . VAL B  154 ? 0.6796 0.6456 0.9213 0.0546  -0.0228 -0.0048 151  VAL B CG1 
3808 C  CG2 . VAL B  154 ? 0.7055 0.6627 0.9133 0.0600  -0.0176 -0.0013 151  VAL B CG2 
3809 N  N   . ILE B  155 ? 0.6585 0.6261 0.9191 0.0667  -0.0175 0.0067  152  ILE B N   
3810 C  CA  . ILE B  155 ? 0.6566 0.6285 0.9383 0.0663  -0.0193 0.0094  152  ILE B CA  
3811 C  C   . ILE B  155 ? 0.7332 0.6987 1.0082 0.0653  -0.0239 0.0054  152  ILE B C   
3812 O  O   . ILE B  155 ? 0.7330 0.6981 1.0184 0.0606  -0.0294 0.0027  152  ILE B O   
3813 C  CB  . ILE B  155 ? 0.6803 0.6615 0.9799 0.0725  -0.0128 0.0200  152  ILE B CB  
3814 C  CG1 . ILE B  155 ? 0.6702 0.6585 0.9859 0.0705  -0.0118 0.0237  152  ILE B CG1 
3815 C  CG2 . ILE B  155 ? 0.6602 0.6445 0.9762 0.0740  -0.0140 0.0242  152  ILE B CG2 
3816 C  CD1 . ILE B  155 ? 0.7582 0.7553 1.0822 0.0765  -0.0040 0.0338  152  ILE B CD1 
3817 N  N   . LEU B  156 ? 0.7170 0.6767 0.9738 0.0694  -0.0224 0.0048  153  LEU B N   
3818 C  CA  . LEU B  156 ? 0.7279 0.6810 0.9772 0.0687  -0.0271 0.0012  153  LEU B CA  
3819 C  C   . LEU B  156 ? 0.7778 0.7236 1.0130 0.0610  -0.0349 -0.0076 153  LEU B C   
3820 O  O   . LEU B  156 ? 0.7995 0.7435 1.0406 0.0566  -0.0405 -0.0107 153  LEU B O   
3821 C  CB  . LEU B  156 ? 0.7378 0.6868 0.9731 0.0767  -0.0232 0.0037  153  LEU B CB  
3822 C  CG  . LEU B  156 ? 0.7973 0.7547 1.0472 0.0853  -0.0155 0.0127  153  LEU B CG  
3823 C  CD1 . LEU B  156 ? 0.8101 0.7629 1.0424 0.0941  -0.0113 0.0141  153  LEU B CD1 
3824 C  CD2 . LEU B  156 ? 0.8108 0.7732 1.0825 0.0844  -0.0175 0.0160  153  LEU B CD2 
3825 N  N   . THR B  157 ? 0.7061 0.6480 0.9231 0.0590  -0.0356 -0.0110 154  THR B N   
3826 C  CA  . THR B  157 ? 0.6968 0.6333 0.8994 0.0517  -0.0429 -0.0183 154  THR B CA  
3827 C  C   . THR B  157 ? 0.7438 0.6851 0.9582 0.0448  -0.0466 -0.0222 154  THR B C   
3828 O  O   . THR B  157 ? 0.7366 0.6749 0.9431 0.0388  -0.0530 -0.0278 154  THR B O   
3829 C  CB  . THR B  157 ? 0.7111 0.6431 0.8922 0.0516  -0.0426 -0.0194 154  THR B CB  
3830 O  OG1 . THR B  157 ? 0.7180 0.6559 0.9054 0.0537  -0.0368 -0.0158 154  THR B OG1 
3831 C  CG2 . THR B  157 ? 0.6378 0.5613 0.8019 0.0573  -0.0422 -0.0178 154  THR B CG2 
3832 N  N   . SER B  158 ? 0.6990 0.6475 0.9320 0.0460  -0.0431 -0.0191 155  SER B N   
3833 C  CA  . SER B  158 ? 0.6890 0.6413 0.9341 0.0409  -0.0467 -0.0228 155  SER B CA  
3834 C  C   . SER B  158 ? 0.7340 0.6867 0.9965 0.0398  -0.0500 -0.0222 155  SER B C   
3835 O  O   . SER B  158 ? 0.7160 0.6693 0.9853 0.0353  -0.0547 -0.0265 155  SER B O   
3836 C  CB  . SER B  158 ? 0.7159 0.6744 0.9713 0.0425  -0.0425 -0.0200 155  SER B CB  
3837 O  OG  . SER B  158 ? 0.8358 0.7939 1.0756 0.0419  -0.0408 -0.0216 155  SER B OG  
3838 N  N   . SER B  159 ? 0.6959 0.6479 0.9649 0.0441  -0.0479 -0.0168 156  SER B N   
3839 C  CA  . SER B  159 ? 0.6774 0.6300 0.9642 0.0435  -0.0509 -0.0144 156  SER B CA  
3840 C  C   . SER B  159 ? 0.7111 0.6586 0.9955 0.0366  -0.0592 -0.0214 156  SER B C   
3841 O  O   . SER B  159 ? 0.6578 0.6065 0.9588 0.0345  -0.0625 -0.0207 156  SER B O   
3842 C  CB  . SER B  159 ? 0.6967 0.6493 0.9865 0.0494  -0.0473 -0.0081 156  SER B CB  
3843 O  OG  . SER B  159 ? 0.7169 0.6625 0.9876 0.0496  -0.0494 -0.0118 156  SER B OG  
3844 N  N   . PRO B  160 ? 0.7059 0.6483 0.9708 0.0324  -0.0634 -0.0280 157  PRO B N   
3845 C  CA  . PRO B  160 ? 0.7156 0.6545 0.9797 0.0256  -0.0712 -0.0342 157  PRO B CA  
3846 C  C   . PRO B  160 ? 0.7883 0.7300 1.0635 0.0224  -0.0740 -0.0374 157  PRO B C   
3847 O  O   . PRO B  160 ? 0.7952 0.7340 1.0749 0.0180  -0.0802 -0.0409 157  PRO B O   
3848 C  CB  . PRO B  160 ? 0.7317 0.6670 0.9725 0.0219  -0.0743 -0.0396 157  PRO B CB  
3849 C  CG  . PRO B  160 ? 0.7768 0.7102 1.0078 0.0271  -0.0698 -0.0356 157  PRO B CG  
3850 C  CD  . PRO B  160 ? 0.7222 0.6611 0.9651 0.0334  -0.0622 -0.0297 157  PRO B CD  
3851 N  N   . PHE B  161 ? 0.7437 0.6904 1.0230 0.0248  -0.0699 -0.0363 158  PHE B N   
3852 C  CA  . PHE B  161 ? 0.7405 0.6893 1.0299 0.0229  -0.0725 -0.0396 158  PHE B CA  
3853 C  C   . PHE B  161 ? 0.8231 0.7718 1.1357 0.0242  -0.0743 -0.0346 158  PHE B C   
3854 O  O   . PHE B  161 ? 0.8240 0.7713 1.1450 0.0220  -0.0793 -0.0380 158  PHE B O   
3855 C  CB  . PHE B  161 ? 0.7495 0.7032 1.0345 0.0248  -0.0681 -0.0403 158  PHE B CB  
3856 C  CG  . PHE B  161 ? 0.7619 0.7158 1.0255 0.0217  -0.0688 -0.0461 158  PHE B CG  
3857 C  CD1 . PHE B  161 ? 0.7863 0.7408 1.0439 0.0173  -0.0737 -0.0536 158  PHE B CD1 
3858 C  CD2 . PHE B  161 ? 0.7779 0.7313 1.0267 0.0230  -0.0652 -0.0437 158  PHE B CD2 
3859 C  CE1 . PHE B  161 ? 0.7957 0.7519 1.0343 0.0141  -0.0746 -0.0577 158  PHE B CE1 
3860 C  CE2 . PHE B  161 ? 0.8063 0.7596 1.0358 0.0194  -0.0671 -0.0480 158  PHE B CE2 
3861 C  CZ  . PHE B  161 ? 0.7824 0.7380 1.0076 0.0148  -0.0717 -0.0546 158  PHE B CZ  
3862 N  N   . LEU B  162 ? 0.7879 0.7378 1.1102 0.0280  -0.0708 -0.0264 159  LEU B N   
3863 C  CA  . LEU B  162 ? 0.7886 0.7395 1.1334 0.0293  -0.0724 -0.0194 159  LEU B CA  
3864 C  C   . LEU B  162 ? 0.8849 0.8302 1.2335 0.0258  -0.0788 -0.0203 159  LEU B C   
3865 O  O   . LEU B  162 ? 0.8962 0.8406 1.2629 0.0247  -0.0830 -0.0164 159  LEU B O   
3866 C  CB  . LEU B  162 ? 0.7818 0.7387 1.1352 0.0355  -0.0649 -0.0092 159  LEU B CB  
3867 C  CG  . LEU B  162 ? 0.8318 0.7955 1.1946 0.0390  -0.0599 -0.0039 159  LEU B CG  
3868 C  CD1 . LEU B  162 ? 0.8246 0.7946 1.1936 0.0452  -0.0524 0.0061  159  LEU B CD1 
3869 C  CD2 . LEU B  162 ? 0.8343 0.7985 1.2171 0.0368  -0.0653 -0.0022 159  LEU B CD2 
3870 N  N   A MET B  163 ? 0.8503 0.7916 1.1825 0.0238  -0.0800 -0.0246 160  MET B N   
3871 N  N   B MET B  163 ? 0.8580 0.7993 1.1903 0.0237  -0.0802 -0.0247 160  MET B N   
3872 C  CA  A MET B  163 ? 0.8498 0.7855 1.1836 0.0201  -0.0862 -0.0256 160  MET B CA  
3873 C  CA  B MET B  163 ? 0.8610 0.7966 1.1952 0.0200  -0.0863 -0.0256 160  MET B CA  
3874 C  C   A MET B  163 ? 0.9399 0.8701 1.2602 0.0133  -0.0933 -0.0356 160  MET B C   
3875 C  C   B MET B  163 ? 0.9447 0.8747 1.2672 0.0131  -0.0939 -0.0353 160  MET B C   
3876 O  O   A MET B  163 ? 0.9333 0.8586 1.2470 0.0096  -0.0979 -0.0379 160  MET B O   
3877 O  O   B MET B  163 ? 0.9382 0.8631 1.2571 0.0093  -0.0991 -0.0373 160  MET B O   
3878 C  CB  A MET B  163 ? 0.8738 0.8090 1.2023 0.0234  -0.0828 -0.0215 160  MET B CB  
3879 C  CB  B MET B  163 ? 0.8893 0.8243 1.2154 0.0231  -0.0829 -0.0224 160  MET B CB  
3880 C  CG  A MET B  163 ? 0.9132 0.8488 1.2211 0.0260  -0.0780 -0.0238 160  MET B CG  
3881 C  CG  B MET B  163 ? 0.9364 0.8695 1.2385 0.0225  -0.0814 -0.0281 160  MET B CG  
3882 S  SD  A MET B  163 ? 0.9512 0.8882 1.2583 0.0340  -0.0715 -0.0163 160  MET B SD  
3883 S  SD  B MET B  163 ? 0.9857 0.9174 1.2780 0.0283  -0.0769 -0.0238 160  MET B SD  
3884 C  CE  A MET B  163 ? 0.8982 0.8447 1.2211 0.0407  -0.0629 -0.0076 160  MET B CE  
3885 C  CE  B MET B  163 ? 0.9530 0.8779 1.2191 0.0224  -0.0827 -0.0327 160  MET B CE  
3886 N  N   . ALA B  164 ? 0.9310 0.8625 1.2479 0.0117  -0.0945 -0.0411 161  ALA B N   
3887 C  CA  . ALA B  164 ? 0.9566 0.8848 1.2611 0.0061  -0.1005 -0.0503 161  ALA B CA  
3888 C  C   . ALA B  164 ? 1.0748 0.9977 1.3913 0.0028  -0.1083 -0.0521 161  ALA B C   
3889 O  O   . ALA B  164 ? 1.0603 0.9828 1.3947 0.0049  -0.1092 -0.0476 161  ALA B O   
3890 C  CB  . ALA B  164 ? 0.9629 0.8958 1.2573 0.0069  -0.0978 -0.0553 161  ALA B CB  
3891 N  N   . LYS B  165 ? 1.0889 1.0073 1.3948 -0.0028 -0.1146 -0.0585 162  LYS B N   
3892 C  CA  . LYS B  165 ? 1.1014 1.0130 1.4141 -0.0068 -0.1230 -0.0616 162  LYS B CA  
3893 C  C   . LYS B  165 ? 1.1693 1.0808 1.4868 -0.0053 -0.1250 -0.0658 162  LYS B C   
3894 O  O   . LYS B  165 ? 1.1622 1.0788 1.4692 -0.0037 -0.1216 -0.0706 162  LYS B O   
3895 C  CB  . LYS B  165 ? 1.1483 1.0566 1.4446 -0.0130 -0.1284 -0.0682 162  LYS B CB  
3896 N  N   . PRO B  166 ? 1.1453 1.0506 1.4788 -0.0057 -0.1311 -0.0639 163  PRO B N   
3897 C  CA  . PRO B  166 ? 1.1462 1.0498 1.4840 -0.0038 -0.1342 -0.0682 163  PRO B CA  
3898 C  C   . PRO B  166 ? 1.2069 1.1094 1.5270 -0.0059 -0.1376 -0.0796 163  PRO B C   
3899 O  O   . PRO B  166 ? 1.2032 1.1034 1.5115 -0.0106 -0.1410 -0.0837 163  PRO B O   
3900 C  CB  . PRO B  166 ? 1.1617 1.0570 1.5188 -0.0049 -0.1419 -0.0634 163  PRO B CB  
3901 C  CG  . PRO B  166 ? 1.2152 1.1069 1.5732 -0.0091 -0.1445 -0.0598 163  PRO B CG  
3902 C  CD  . PRO B  166 ? 1.1593 1.0587 1.5080 -0.0078 -0.1361 -0.0573 163  PRO B CD  
3903 N  N   . GLN B  167 ? 1.1738 1.0788 1.4922 -0.0023 -0.1365 -0.0843 164  GLN B N   
3904 C  CA  . GLN B  167 ? 1.1815 1.0872 1.4841 -0.0028 -0.1389 -0.0950 164  GLN B CA  
3905 C  C   . GLN B  167 ? 1.2619 1.1574 1.5705 -0.0026 -0.1484 -0.0998 164  GLN B C   
3906 O  O   . GLN B  167 ? 1.2494 1.1404 1.5738 0.0004  -0.1511 -0.0963 164  GLN B O   
3907 C  CB  . GLN B  167 ? 1.1917 1.1067 1.4880 0.0018  -0.1320 -0.0976 164  GLN B CB  
3908 C  CG  . GLN B  167 ? 1.3074 1.2317 1.5917 0.0010  -0.1241 -0.0952 164  GLN B CG  
3909 C  CD  . GLN B  167 ? 1.5623 1.4926 1.8537 0.0056  -0.1168 -0.0898 164  GLN B CD  
3910 O  OE1 . GLN B  167 ? 1.5073 1.4439 1.7925 0.0084  -0.1131 -0.0932 164  GLN B OE1 
3911 N  NE2 . GLN B  167 ? 1.4717 1.4006 1.7764 0.0067  -0.1144 -0.0809 164  GLN B NE2 
3912 N  N   . LYS B  168 ? 1.2587 1.1500 1.5545 -0.0061 -0.1540 -0.1073 165  LYS B N   
3913 C  CA  . LYS B  168 ? 1.2772 1.1576 1.5748 -0.0059 -0.1636 -0.1132 165  LYS B CA  
3914 C  C   . LYS B  168 ? 1.3748 1.2586 1.6517 -0.0058 -0.1644 -0.1244 165  LYS B C   
3915 O  O   . LYS B  168 ? 1.3794 1.2695 1.6420 -0.0098 -0.1617 -0.1262 165  LYS B O   
3916 C  CB  . LYS B  168 ? 1.3078 1.1771 1.6136 -0.0113 -0.1717 -0.1092 165  LYS B CB  
3917 C  CG  . LYS B  168 ? 1.4702 1.3356 1.7990 -0.0109 -0.1727 -0.0977 165  LYS B CG  
3918 C  CD  . LYS B  168 ? 1.6198 1.4743 1.9627 -0.0086 -0.1815 -0.0973 165  LYS B CD  
3919 C  CE  . LYS B  168 ? 1.7244 1.5685 2.0826 -0.0130 -0.1898 -0.0898 165  LYS B CE  
3920 N  NZ  . LYS B  168 ? 1.7711 1.6027 2.1408 -0.0115 -0.2004 -0.0900 165  LYS B NZ  
3921 N  N   . ASP B  169 ? 1.3606 1.2407 1.6354 -0.0009 -0.1680 -0.1318 166  ASP B N   
3922 C  CA  . ASP B  169 ? 1.3753 1.2601 1.6303 0.0004  -0.1682 -0.1425 166  ASP B CA  
3923 C  C   . ASP B  169 ? 1.4599 1.3347 1.7062 -0.0037 -0.1774 -0.1482 166  ASP B C   
3924 O  O   . ASP B  169 ? 1.4591 1.3229 1.7156 -0.0079 -0.1838 -0.1433 166  ASP B O   
3925 C  CB  . ASP B  169 ? 1.3957 1.2826 1.6503 0.0085  -0.1671 -0.1487 166  ASP B CB  
3926 C  CG  . ASP B  169 ? 1.4971 1.3691 1.7597 0.0125  -0.1770 -0.1529 166  ASP B CG  
3927 O  OD1 . ASP B  169 ? 1.4974 1.3568 1.7708 0.0090  -0.1847 -0.1486 166  ASP B OD1 
3928 O  OD2 . ASP B  169 ? 1.5650 1.4378 1.8231 0.0192  -0.1774 -0.1603 166  ASP B OD2 
3929 N  N   . GLU B  170 ? 1.4332 1.3124 1.6608 -0.0023 -0.1779 -0.1581 167  GLU B N   
3930 C  CA  . GLU B  170 ? 1.4376 1.3087 1.6532 -0.0052 -0.1861 -0.1651 167  GLU B CA  
3931 C  C   . GLU B  170 ? 1.4676 1.3195 1.6942 -0.0038 -0.1972 -0.1662 167  GLU B C   
3932 O  O   . GLU B  170 ? 1.4598 1.3010 1.6858 -0.0094 -0.2050 -0.1657 167  GLU B O   
3933 C  CB  . GLU B  170 ? 1.4607 1.3414 1.6564 -0.0010 -0.1837 -0.1756 167  GLU B CB  
3934 C  CG  . GLU B  170 ? 1.6333 1.5212 1.8109 -0.0072 -0.1837 -0.1784 167  GLU B CG  
3935 C  CD  . GLU B  170 ? 2.0030 1.8981 2.1612 -0.0029 -0.1836 -0.1891 167  GLU B CD  
3936 O  OE1 . GLU B  170 ? 1.9582 1.8661 2.1117 0.0032  -0.1766 -0.1920 167  GLU B OE1 
3937 O  OE2 . GLU B  170 ? 1.9507 1.8389 2.0983 -0.0057 -0.1906 -0.1945 167  GLU B OE2 
3938 N  N   . LYS B  171 ? 1.4074 1.2547 1.6449 0.0032  -0.1984 -0.1667 168  LYS B N   
3939 C  CA  . LYS B  171 ? 1.4011 1.2302 1.6504 0.0053  -0.2095 -0.1670 168  LYS B CA  
3940 C  C   . LYS B  171 ? 1.4394 1.2621 1.7122 0.0015  -0.2117 -0.1542 168  LYS B C   
3941 O  O   . LYS B  171 ? 1.4394 1.2499 1.7263 0.0038  -0.2195 -0.1519 168  LYS B O   
3942 C  CB  . LYS B  171 ? 1.4305 1.2579 1.6790 0.0148  -0.2105 -0.1742 168  LYS B CB  
3943 N  N   . ASN B  172 ? 1.3791 1.2101 1.6560 -0.0043 -0.2053 -0.1458 169  ASN B N   
3944 C  CA  . ASN B  172 ? 1.3608 1.1893 1.6585 -0.0079 -0.2055 -0.1331 169  ASN B CA  
3945 C  C   . ASN B  172 ? 1.3621 1.1925 1.6784 -0.0029 -0.2028 -0.1263 169  ASN B C   
3946 O  O   . ASN B  172 ? 1.3534 1.1790 1.6889 -0.0050 -0.2058 -0.1160 169  ASN B O   
3947 C  CB  . ASN B  172 ? 1.3936 1.2062 1.6987 -0.0133 -0.2172 -0.1302 169  ASN B CB  
3948 C  CG  . ASN B  172 ? 1.7865 1.5983 2.0779 -0.0201 -0.2190 -0.1329 169  ASN B CG  
3949 O  OD1 . ASN B  172 ? 1.7469 1.5711 2.0263 -0.0221 -0.2111 -0.1342 169  ASN B OD1 
3950 N  ND2 . ASN B  172 ? 1.6862 1.4829 1.9797 -0.0241 -0.2304 -0.1333 169  ASN B ND2 
3951 N  N   . ASN B  173 ? 1.2763 1.1148 1.5873 0.0034  -0.1969 -0.1312 170  ASN B N   
3952 C  CA  . ASN B  173 ? 1.2465 1.0882 1.5732 0.0080  -0.1938 -0.1254 170  ASN B CA  
3953 C  C   . ASN B  173 ? 1.2428 1.0986 1.5739 0.0069  -0.1821 -0.1169 170  ASN B C   
3954 O  O   . ASN B  173 ? 1.2319 1.0976 1.5480 0.0053  -0.1748 -0.1198 170  ASN B O   
3955 C  CB  . ASN B  173 ? 1.2662 1.1102 1.5848 0.0154  -0.1928 -0.1347 170  ASN B CB  
3956 C  CG  . ASN B  173 ? 1.5918 1.4204 1.9093 0.0187  -0.2050 -0.1424 170  ASN B CG  
3957 O  OD1 . ASN B  173 ? 1.4921 1.3150 1.7937 0.0184  -0.2098 -0.1516 170  ASN B OD1 
3958 N  ND2 . ASN B  173 ? 1.5095 1.3307 1.8433 0.0222  -0.2106 -0.1388 170  ASN B ND2 
3959 N  N   . THR B  174 ? 1.1708 1.0276 1.5219 0.0077  -0.1807 -0.1062 171  THR B N   
3960 C  CA  . THR B  174 ? 1.1500 1.0194 1.5055 0.0076  -0.1697 -0.0979 171  THR B CA  
3961 C  C   . THR B  174 ? 1.1527 1.0329 1.4991 0.0124  -0.1613 -0.1024 171  THR B C   
3962 O  O   . THR B  174 ? 1.1479 1.0264 1.4992 0.0171  -0.1634 -0.1051 171  THR B O   
3963 C  CB  . THR B  174 ? 1.2765 1.1446 1.6555 0.0070  -0.1706 -0.0846 171  THR B CB  
3964 O  OG1 . THR B  174 ? 1.2465 1.1047 1.6328 0.0022  -0.1789 -0.0809 171  THR B OG1 
3965 C  CG2 . THR B  174 ? 1.2774 1.1582 1.6591 0.0071  -0.1592 -0.0762 171  THR B CG2 
3966 N  N   . LYS B  175 ? 1.0645 0.9550 1.3971 0.0109  -0.1528 -0.1034 172  LYS B N   
3967 C  CA  . LYS B  175 ? 1.0331 0.9349 1.3550 0.0142  -0.1443 -0.1067 172  LYS B CA  
3968 C  C   . LYS B  175 ? 1.0198 0.9300 1.3482 0.0144  -0.1354 -0.0971 172  LYS B C   
3969 O  O   . LYS B  175 ? 1.0084 0.9168 1.3464 0.0119  -0.1352 -0.0888 172  LYS B O   
3970 C  CB  . LYS B  175 ? 1.0601 0.9670 1.3599 0.0121  -0.1426 -0.1151 172  LYS B CB  
3971 C  CG  . LYS B  175 ? 1.1521 1.0534 1.4426 0.0139  -0.1496 -0.1261 172  LYS B CG  
3972 C  CD  . LYS B  175 ? 1.2670 1.1753 1.5516 0.0201  -0.1460 -0.1324 172  LYS B CD  
3973 C  CE  . LYS B  175 ? 1.4107 1.3149 1.6838 0.0230  -0.1519 -0.1438 172  LYS B CE  
3974 N  NZ  . LYS B  175 ? 1.5634 1.4789 1.8258 0.0283  -0.1461 -0.1500 172  LYS B NZ  
3975 N  N   . CYS B  176 ? 0.9443 0.8636 1.2680 0.0178  -0.1283 -0.0979 173  CYS B N   
3976 C  CA  . CYS B  176 ? 0.9230 0.8502 1.2500 0.0186  -0.1197 -0.0897 173  CYS B CA  
3977 C  C   . CYS B  176 ? 0.9730 0.9099 1.2850 0.0203  -0.1131 -0.0942 173  CYS B C   
3978 O  O   . CYS B  176 ? 0.9781 0.9161 1.2838 0.0227  -0.1151 -0.1023 173  CYS B O   
3979 C  CB  . CYS B  176 ? 0.9091 0.8350 1.2568 0.0216  -0.1199 -0.0819 173  CYS B CB  
3980 S  SG  . CYS B  176 ? 0.9471 0.8801 1.3023 0.0219  -0.1109 -0.0694 173  CYS B SG  
3981 N  N   . PHE B  177 ? 0.9106 0.8544 1.2169 0.0195  -0.1055 -0.0889 174  PHE B N   
3982 C  CA  . PHE B  177 ? 0.8961 0.8493 1.1891 0.0205  -0.0991 -0.0908 174  PHE B CA  
3983 C  C   . PHE B  177 ? 0.9972 0.9543 1.2715 0.0182  -0.1005 -0.0993 174  PHE B C   
3984 O  O   . PHE B  177 ? 1.0007 0.9655 1.2665 0.0200  -0.0972 -0.1028 174  PHE B O   
3985 C  CB  . PHE B  177 ? 0.8958 0.8524 1.1973 0.0253  -0.0965 -0.0904 174  PHE B CB  
3986 C  CG  . PHE B  177 ? 0.8880 0.8401 1.2102 0.0275  -0.0978 -0.0833 174  PHE B CG  
3987 C  CD1 . PHE B  177 ? 0.9095 0.8633 1.2386 0.0272  -0.0930 -0.0736 174  PHE B CD1 
3988 C  CD2 . PHE B  177 ? 0.8998 0.8461 1.2343 0.0300  -0.1044 -0.0861 174  PHE B CD2 
3989 C  CE1 . PHE B  177 ? 0.9119 0.8634 1.2606 0.0291  -0.0941 -0.0661 174  PHE B CE1 
3990 C  CE2 . PHE B  177 ? 0.9246 0.8674 1.2789 0.0314  -0.1065 -0.0785 174  PHE B CE2 
3991 C  CZ  . PHE B  177 ? 0.8939 0.8401 1.2556 0.0307  -0.1011 -0.0682 174  PHE B CZ  
3992 N  N   . GLU B  178 ? 0.9911 0.9438 1.2591 0.0139  -0.1052 -0.1018 175  GLU B N   
3993 C  CA  . GLU B  178 ? 1.0087 0.9658 1.2591 0.0111  -0.1069 -0.1090 175  GLU B CA  
3994 C  C   . GLU B  178 ? 1.0994 1.0645 1.3348 0.0076  -0.1022 -0.1062 175  GLU B C   
3995 O  O   . GLU B  178 ? 1.0780 1.0404 1.3139 0.0051  -0.1009 -0.1001 175  GLU B O   
3996 C  CB  . GLU B  178 ? 1.0282 0.9774 1.2773 0.0075  -0.1145 -0.1129 175  GLU B CB  
3997 C  CG  . GLU B  178 ? 1.1721 1.1146 1.4276 0.0109  -0.1206 -0.1193 175  GLU B CG  
3998 C  CD  . GLU B  178 ? 1.4559 1.4051 1.7029 0.0152  -0.1196 -0.1273 175  GLU B CD  
3999 O  OE1 . GLU B  178 ? 1.3520 1.3104 1.5828 0.0134  -0.1173 -0.1310 175  GLU B OE1 
4000 O  OE2 . GLU B  178 ? 1.4188 1.3644 1.6757 0.0205  -0.1214 -0.1296 175  GLU B OE2 
4001 N  N   . PRO B  179 ? 1.1082 1.0832 1.3302 0.0076  -0.1000 -0.1103 176  PRO B N   
4002 C  CA  . PRO B  179 ? 1.1241 1.1064 1.3321 0.0038  -0.0966 -0.1068 176  PRO B CA  
4003 C  C   . PRO B  179 ? 1.2272 1.2075 1.4246 -0.0027 -0.1012 -0.1074 176  PRO B C   
4004 O  O   . PRO B  179 ? 1.2268 1.2036 1.4237 -0.0041 -0.1064 -0.1126 176  PRO B O   
4005 C  CB  . PRO B  179 ? 1.1409 1.1350 1.3401 0.0058  -0.0938 -0.1107 176  PRO B CB  
4006 C  CG  . PRO B  179 ? 1.1921 1.1845 1.4015 0.0118  -0.0947 -0.1161 176  PRO B CG  
4007 C  CD  . PRO B  179 ? 1.1353 1.1157 1.3544 0.0114  -0.1006 -0.1178 176  PRO B CD  
4008 N  N   . PRO B  180 ? 1.2139 1.1956 1.4023 -0.0066 -0.0999 -0.1021 177  PRO B N   
4009 C  CA  . PRO B  180 ? 1.2287 1.2082 1.4069 -0.0131 -0.1051 -0.1025 177  PRO B CA  
4010 C  C   . PRO B  180 ? 1.3278 1.3145 1.4949 -0.0162 -0.1087 -0.1089 177  PRO B C   
4011 O  O   . PRO B  180 ? 1.3192 1.3169 1.4786 -0.0152 -0.1061 -0.1107 177  PRO B O   
4012 C  CB  . PRO B  180 ? 1.2490 1.2300 1.4180 -0.0157 -0.1030 -0.0961 177  PRO B CB  
4013 C  CG  . PRO B  180 ? 1.2948 1.2739 1.4737 -0.0100 -0.0971 -0.0916 177  PRO B CG  
4014 C  CD  . PRO B  180 ? 1.2320 1.2162 1.4183 -0.0054 -0.0946 -0.0957 177  PRO B CD  
4015 N  N   . GLN B  181 ? 1.3311 1.3118 1.4986 -0.0194 -0.1147 -0.1125 178  GLN B N   
4016 C  CA  . GLN B  181 ? 1.3535 1.3388 1.5117 -0.0220 -0.1189 -0.1191 178  GLN B CA  
4017 C  C   . GLN B  181 ? 1.4594 1.4497 1.6024 -0.0300 -0.1227 -0.1176 178  GLN B C   
4018 O  O   . GLN B  181 ? 1.4583 1.4509 1.5960 -0.0327 -0.1213 -0.1118 178  GLN B O   
4019 C  CB  . GLN B  181 ? 1.3721 1.3464 1.5399 -0.0208 -0.1240 -0.1238 178  GLN B CB  
4020 C  CG  . GLN B  181 ? 1.4530 1.4149 1.6293 -0.0242 -0.1282 -0.1197 178  GLN B CG  
4021 C  CD  . GLN B  181 ? 1.5595 1.5150 1.7511 -0.0200 -0.1244 -0.1136 178  GLN B CD  
4022 O  OE1 . GLN B  181 ? 1.4218 1.3769 1.6131 -0.0212 -0.1219 -0.1074 178  GLN B OE1 
4023 N  NE2 . GLN B  181 ? 1.4891 1.4396 1.6945 -0.0148 -0.1244 -0.1149 178  GLN B NE2 
4024 N  N   . ASP B  182 ? 1.4536 1.4454 1.5892 -0.0339 -0.1280 -0.1227 179  ASP B N   
4025 C  CA  . ASP B  182 ? 1.4690 1.4656 1.5908 -0.0423 -0.1327 -0.1213 179  ASP B CA  
4026 C  C   . ASP B  182 ? 1.5378 1.5233 1.6630 -0.0467 -0.1362 -0.1157 179  ASP B C   
4027 O  O   . ASP B  182 ? 1.5388 1.5274 1.6558 -0.0509 -0.1368 -0.1106 179  ASP B O   
4028 C  CB  . ASP B  182 ? 1.4969 1.4953 1.6121 -0.0449 -0.1379 -0.1279 179  ASP B CB  
4029 N  N   . ASN B  183 ? 1.4935 1.4658 1.6314 -0.0452 -0.1385 -0.1164 180  ASN B N   
4030 C  CA  . ASN B  183 ? 1.4919 1.4535 1.6361 -0.0475 -0.1409 -0.1112 180  ASN B CA  
4031 C  C   . ASN B  183 ? 1.5379 1.4967 1.6928 -0.0409 -0.1343 -0.1064 180  ASN B C   
4032 O  O   . ASN B  183 ? 1.5307 1.4948 1.6889 -0.0354 -0.1289 -0.1077 180  ASN B O   
4033 C  CB  . ASN B  183 ? 1.4939 1.4443 1.6475 -0.0490 -0.1465 -0.1136 180  ASN B CB  
4034 N  N   . GLN B  184 ? 1.4878 1.4387 1.6475 -0.0413 -0.1345 -0.1008 181  GLN B N   
4035 C  CA  . GLN B  184 ? 1.4772 1.4255 1.6459 -0.0352 -0.1283 -0.0956 181  GLN B CA  
4036 C  C   . GLN B  184 ? 1.5032 1.4606 1.6633 -0.0328 -0.1227 -0.0940 181  GLN B C   
4037 O  O   . GLN B  184 ? 1.4884 1.4479 1.6565 -0.0268 -0.1169 -0.0931 181  GLN B O   
4038 C  CB  . GLN B  184 ? 1.4899 1.4328 1.6774 -0.0294 -0.1261 -0.0955 181  GLN B CB  
4039 N  N   . THR B  185 ? 1.4481 1.4108 1.5922 -0.0381 -0.1254 -0.0932 182  THR B N   
4040 C  CA  . THR B  185 ? 1.4354 1.4070 1.5686 -0.0380 -0.1221 -0.0909 182  THR B CA  
4041 C  C   . THR B  185 ? 1.4692 1.4393 1.5887 -0.0438 -0.1269 -0.0869 182  THR B C   
4042 O  O   . THR B  185 ? 1.4637 1.4416 1.5711 -0.0465 -0.1272 -0.0848 182  THR B O   
4043 C  CB  . THR B  185 ? 1.5302 1.5140 1.6574 -0.0392 -0.1217 -0.0954 182  THR B CB  
4044 O  OG1 . THR B  185 ? 1.4845 1.4683 1.6110 -0.0428 -0.1269 -0.1007 182  THR B OG1 
4045 C  CG2 . THR B  185 ? 1.5220 1.5102 1.6578 -0.0321 -0.1150 -0.0970 182  THR B CG2 
4046 N  N   . LYS B  186 ? 1.4104 1.3701 1.5323 -0.0457 -0.1312 -0.0855 183  LYS B N   
4047 C  CA  . LYS B  186 ? 1.4023 1.3569 1.5131 -0.0508 -0.1373 -0.0821 183  LYS B CA  
4048 C  C   . LYS B  186 ? 1.4100 1.3654 1.5097 -0.0499 -0.1359 -0.0771 183  LYS B C   
4049 O  O   . LYS B  186 ? 1.4062 1.3649 1.5086 -0.0446 -0.1292 -0.0757 183  LYS B O   
4050 C  CB  . LYS B  186 ? 1.4420 1.3842 1.5618 -0.0494 -0.1396 -0.0810 183  LYS B CB  
4051 C  CG  . LYS B  186 ? 1.6000 1.5360 1.7310 -0.0408 -0.1329 -0.0776 183  LYS B CG  
4052 C  CD  . LYS B  186 ? 1.7073 1.6338 1.8511 -0.0389 -0.1343 -0.0767 183  LYS B CD  
4053 C  CE  . LYS B  186 ? 1.8020 1.7204 1.9387 -0.0421 -0.1408 -0.0747 183  LYS B CE  
4054 N  NZ  . LYS B  186 ? 1.8995 1.8169 2.0334 -0.0503 -0.1492 -0.0778 183  LYS B NZ  
4055 N  N   . ASN B  187 ? 1.3326 1.2841 1.4198 -0.0555 -0.1431 -0.0744 184  ASN B N   
4056 C  CA  . ASN B  187 ? 1.3207 1.2703 1.3957 -0.0555 -0.1442 -0.0694 184  ASN B CA  
4057 C  C   . ASN B  187 ? 1.3109 1.2509 1.3914 -0.0470 -0.1385 -0.0669 184  ASN B C   
4058 O  O   . ASN B  187 ? 1.3145 1.2547 1.3884 -0.0443 -0.1357 -0.0635 184  ASN B O   
4059 C  CB  . ASN B  187 ? 1.3662 1.3119 1.4272 -0.0636 -0.1549 -0.0672 184  ASN B CB  
4060 C  CG  . ASN B  187 ? 1.6727 1.6114 1.7209 -0.0632 -0.1581 -0.0621 184  ASN B CG  
4061 O  OD1 . ASN B  187 ? 1.5378 1.4823 1.5782 -0.0636 -0.1567 -0.0589 184  ASN B OD1 
4062 N  ND2 . ASN B  187 ? 1.6118 1.5375 1.6574 -0.0624 -0.1631 -0.0611 184  ASN B ND2 
4063 N  N   . HIS B  188 ? 1.2055 1.1376 1.2981 -0.0429 -0.1370 -0.0680 185  HIS B N   
4064 C  CA  . HIS B  188 ? 1.1726 1.0970 1.2727 -0.0344 -0.1312 -0.0654 185  HIS B CA  
4065 C  C   . HIS B  188 ? 1.1150 1.0451 1.2250 -0.0278 -0.1216 -0.0649 185  HIS B C   
4066 O  O   . HIS B  188 ? 1.1054 1.0314 1.2154 -0.0215 -0.1167 -0.0615 185  HIS B O   
4067 C  CB  . HIS B  188 ? 1.1842 1.1011 1.2961 -0.0325 -0.1325 -0.0662 185  HIS B CB  
4068 N  N   . VAL B  189 ? 0.9931 0.9320 1.1110 -0.0290 -0.1192 -0.0683 186  VAL B N   
4069 C  CA  . VAL B  189 ? 0.9517 0.8965 1.0792 -0.0235 -0.1112 -0.0683 186  VAL B CA  
4070 C  C   . VAL B  189 ? 0.9684 0.9185 1.0837 -0.0239 -0.1093 -0.0658 186  VAL B C   
4071 O  O   . VAL B  189 ? 0.9779 0.9277 1.0964 -0.0183 -0.1032 -0.0630 186  VAL B O   
4072 C  CB  . VAL B  189 ? 0.9719 0.9225 1.1115 -0.0239 -0.1103 -0.0731 186  VAL B CB  
4073 C  CG1 . VAL B  189 ? 0.9592 0.9200 1.0986 -0.0226 -0.1061 -0.0747 186  VAL B CG1 
4074 C  CG2 . VAL B  189 ? 0.9608 0.9061 1.1185 -0.0187 -0.1073 -0.0725 186  VAL B CG2 
4075 N  N   . LEU B  190 ? 0.8724 0.8271 0.9736 -0.0308 -0.1152 -0.0662 187  LEU B N   
4076 C  CA  . LEU B  190 ? 0.8478 0.8079 0.9361 -0.0330 -0.1155 -0.0630 187  LEU B CA  
4077 C  C   . LEU B  190 ? 0.8879 0.8380 0.9671 -0.0302 -0.1158 -0.0579 187  LEU B C   
4078 O  O   . LEU B  190 ? 0.8999 0.8522 0.9737 -0.0286 -0.1129 -0.0546 187  LEU B O   
4079 C  CB  . LEU B  190 ? 0.8451 0.8120 0.9214 -0.0419 -0.1232 -0.0636 187  LEU B CB  
4080 C  CG  . LEU B  190 ? 0.8996 0.8781 0.9665 -0.0452 -0.1233 -0.0610 187  LEU B CG  
4081 C  CD1 . LEU B  190 ? 0.8836 0.8722 0.9607 -0.0404 -0.1151 -0.0634 187  LEU B CD1 
4082 C  CD2 . LEU B  190 ? 0.9389 0.9255 0.9963 -0.0539 -0.1308 -0.0614 187  LEU B CD2 
4083 N  N   . VAL B  191 ? 0.8247 0.7636 0.9023 -0.0292 -0.1193 -0.0573 188  VAL B N   
4084 C  CA  . VAL B  191 ? 0.8174 0.7454 0.8858 -0.0253 -0.1198 -0.0533 188  VAL B CA  
4085 C  C   . VAL B  191 ? 0.8361 0.7624 0.9158 -0.0161 -0.1101 -0.0519 188  VAL B C   
4086 O  O   . VAL B  191 ? 0.8406 0.7632 0.9127 -0.0126 -0.1078 -0.0484 188  VAL B O   
4087 C  CB  . VAL B  191 ? 0.8776 0.7944 0.9398 -0.0269 -0.1274 -0.0535 188  VAL B CB  
4088 C  CG1 . VAL B  191 ? 0.8817 0.7860 0.9348 -0.0209 -0.1273 -0.0502 188  VAL B CG1 
4089 C  CG2 . VAL B  191 ? 0.8782 0.7971 0.9279 -0.0368 -0.1377 -0.0537 188  VAL B CG2 
4090 N  N   . LEU B  192 ? 0.7615 0.6909 0.8592 -0.0126 -0.1050 -0.0542 189  LEU B N   
4091 C  CA  . LEU B  192 ? 0.7435 0.6731 0.8540 -0.0046 -0.0962 -0.0523 189  LEU B CA  
4092 C  C   . LEU B  192 ? 0.7261 0.6641 0.8384 -0.0039 -0.0911 -0.0516 189  LEU B C   
4093 O  O   . LEU B  192 ? 0.6891 0.6258 0.8035 0.0017  -0.0853 -0.0482 189  LEU B O   
4094 C  CB  . LEU B  192 ? 0.7446 0.6749 0.8742 -0.0021 -0.0938 -0.0540 189  LEU B CB  
4095 C  CG  . LEU B  192 ? 0.8255 0.7468 0.9566 0.0004  -0.0961 -0.0528 189  LEU B CG  
4096 C  CD1 . LEU B  192 ? 0.8374 0.7601 0.9858 0.0001  -0.0964 -0.0546 189  LEU B CD1 
4097 C  CD2 . LEU B  192 ? 0.8413 0.7577 0.9728 0.0088  -0.0902 -0.0481 189  LEU B CD2 
4098 N  N   . HIS B  193 ? 0.6733 0.6201 0.7839 -0.0094 -0.0935 -0.0545 190  HIS B N   
4099 C  CA  . HIS B  193 ? 0.6553 0.6112 0.7665 -0.0093 -0.0896 -0.0541 190  HIS B CA  
4100 C  C   . HIS B  193 ? 0.7094 0.6622 0.8058 -0.0095 -0.0901 -0.0493 190  HIS B C   
4101 O  O   . HIS B  193 ? 0.7084 0.6633 0.8080 -0.0057 -0.0845 -0.0469 190  HIS B O   
4102 C  CB  . HIS B  193 ? 0.6629 0.6290 0.7721 -0.0152 -0.0931 -0.0580 190  HIS B CB  
4103 C  CG  . HIS B  193 ? 0.6992 0.6746 0.8028 -0.0164 -0.0911 -0.0564 190  HIS B CG  
4104 N  ND1 . HIS B  193 ? 0.7113 0.6919 0.8257 -0.0117 -0.0844 -0.0565 190  HIS B ND1 
4105 C  CD2 . HIS B  193 ? 0.7102 0.6902 0.7993 -0.0219 -0.0954 -0.0538 190  HIS B CD2 
4106 C  CE1 . HIS B  193 ? 0.6979 0.6861 0.8040 -0.0141 -0.0845 -0.0544 190  HIS B CE1 
4107 N  NE2 . HIS B  193 ? 0.7013 0.6899 0.7924 -0.0204 -0.0909 -0.0524 190  HIS B NE2 
4108 N  N   . TYR B  194 ? 0.6686 0.6160 0.7486 -0.0142 -0.0975 -0.0477 191  TYR B N   
4109 C  CA  . TYR B  194 ? 0.6647 0.6077 0.7287 -0.0152 -0.0998 -0.0428 191  TYR B CA  
4110 C  C   . TYR B  194 ? 0.7227 0.6545 0.7844 -0.0080 -0.0962 -0.0397 191  TYR B C   
4111 O  O   . TYR B  194 ? 0.7527 0.6836 0.8086 -0.0062 -0.0936 -0.0360 191  TYR B O   
4112 C  CB  . TYR B  194 ? 0.6854 0.6257 0.7328 -0.0228 -0.1101 -0.0416 191  TYR B CB  
4113 C  CG  . TYR B  194 ? 0.6986 0.6526 0.7436 -0.0297 -0.1127 -0.0417 191  TYR B CG  
4114 C  CD1 . TYR B  194 ? 0.7245 0.6857 0.7666 -0.0302 -0.1100 -0.0382 191  TYR B CD1 
4115 C  CD2 . TYR B  194 ? 0.6909 0.6516 0.7373 -0.0354 -0.1173 -0.0451 191  TYR B CD2 
4116 C  CE1 . TYR B  194 ? 0.7349 0.7106 0.7762 -0.0356 -0.1114 -0.0380 191  TYR B CE1 
4117 C  CE2 . TYR B  194 ? 0.6794 0.6544 0.7240 -0.0409 -0.1187 -0.0451 191  TYR B CE2 
4118 C  CZ  . TYR B  194 ? 0.7857 0.7686 0.8278 -0.0408 -0.1156 -0.0415 191  TYR B CZ  
4119 O  OH  . TYR B  194 ? 0.8207 0.8190 0.8613 -0.0455 -0.1166 -0.0410 191  TYR B OH  
4120 N  N   . VAL B  195 ? 0.6539 0.5778 0.7205 -0.0036 -0.0954 -0.0408 192  VAL B N   
4121 C  CA  . VAL B  195 ? 0.6499 0.5645 0.7148 0.0044  -0.0911 -0.0379 192  VAL B CA  
4122 C  C   . VAL B  195 ? 0.6921 0.6131 0.7706 0.0097  -0.0815 -0.0363 192  VAL B C   
4123 O  O   . VAL B  195 ? 0.7023 0.6194 0.7740 0.0134  -0.0784 -0.0326 192  VAL B O   
4124 C  CB  . VAL B  195 ? 0.6948 0.6014 0.7633 0.0085  -0.0921 -0.0391 192  VAL B CB  
4125 C  CG1 . VAL B  195 ? 0.6943 0.5914 0.7570 0.0171  -0.0882 -0.0358 192  VAL B CG1 
4126 C  CG2 . VAL B  195 ? 0.6938 0.5947 0.7506 0.0024  -0.1024 -0.0410 192  VAL B CG2 
4127 N  N   . SER B  196 ? 0.6209 0.5513 0.7177 0.0094  -0.0778 -0.0391 193  SER B N   
4128 C  CA  . SER B  196 ? 0.5918 0.5293 0.7042 0.0134  -0.0699 -0.0381 193  SER B CA  
4129 C  C   . SER B  196 ? 0.6538 0.5965 0.7601 0.0113  -0.0687 -0.0363 193  SER B C   
4130 O  O   . SER B  196 ? 0.6521 0.5949 0.7619 0.0157  -0.0630 -0.0329 193  SER B O   
4131 C  CB  . SER B  196 ? 0.5816 0.5263 0.7120 0.0124  -0.0691 -0.0421 193  SER B CB  
4132 O  OG  . SER B  196 ? 0.5785 0.5307 0.7225 0.0146  -0.0637 -0.0418 193  SER B OG  
4133 N  N   . LEU B  197 ? 0.6108 0.5583 0.7082 0.0046  -0.0740 -0.0380 194  LEU B N   
4134 C  CA  . LEU B  197 ? 0.6116 0.5653 0.7027 0.0017  -0.0738 -0.0358 194  LEU B CA  
4135 C  C   . LEU B  197 ? 0.6699 0.6149 0.7463 0.0032  -0.0743 -0.0304 194  LEU B C   
4136 O  O   . LEU B  197 ? 0.6476 0.5953 0.7251 0.0047  -0.0703 -0.0274 194  LEU B O   
4137 C  CB  . LEU B  197 ? 0.6177 0.5780 0.7004 -0.0060 -0.0805 -0.0377 194  LEU B CB  
4138 C  CG  . LEU B  197 ? 0.6853 0.6544 0.7621 -0.0096 -0.0810 -0.0351 194  LEU B CG  
4139 C  CD1 . LEU B  197 ? 0.6810 0.6602 0.7733 -0.0065 -0.0742 -0.0369 194  LEU B CD1 
4140 C  CD2 . LEU B  197 ? 0.7276 0.7031 0.7945 -0.0173 -0.0882 -0.0357 194  LEU B CD2 
4141 N  N   . PHE B  198 ? 0.6508 0.5845 0.7130 0.0029  -0.0796 -0.0292 195  PHE B N   
4142 C  CA  . PHE B  198 ? 0.6565 0.5796 0.7021 0.0046  -0.0816 -0.0245 195  PHE B CA  
4143 C  C   . PHE B  198 ? 0.6969 0.6139 0.7471 0.0132  -0.0741 -0.0224 195  PHE B C   
4144 O  O   . PHE B  198 ? 0.6883 0.6042 0.7349 0.0151  -0.0709 -0.0186 195  PHE B O   
4145 C  CB  . PHE B  198 ? 0.6888 0.6014 0.7162 0.0010  -0.0914 -0.0243 195  PHE B CB  
4146 C  CG  . PHE B  198 ? 0.7129 0.6305 0.7298 -0.0079 -0.0991 -0.0226 195  PHE B CG  
4147 C  CD1 . PHE B  198 ? 0.7508 0.6655 0.7545 -0.0103 -0.1021 -0.0173 195  PHE B CD1 
4148 C  CD2 . PHE B  198 ? 0.7379 0.6647 0.7593 -0.0141 -0.1030 -0.0258 195  PHE B CD2 
4149 C  CE1 . PHE B  198 ? 0.7598 0.6813 0.7557 -0.0187 -0.1090 -0.0145 195  PHE B CE1 
4150 C  CE2 . PHE B  198 ? 0.7683 0.7026 0.7813 -0.0222 -0.1094 -0.0234 195  PHE B CE2 
4151 C  CZ  . PHE B  198 ? 0.7434 0.6755 0.7442 -0.0246 -0.1123 -0.0174 195  PHE B CZ  
4152 N  N   . VAL B  199 ? 0.6657 0.5796 0.7240 0.0182  -0.0715 -0.0243 196  VAL B N   
4153 C  CA  . VAL B  199 ? 0.6766 0.5862 0.7400 0.0268  -0.0645 -0.0219 196  VAL B CA  
4154 C  C   . VAL B  199 ? 0.7203 0.6399 0.8018 0.0294  -0.0562 -0.0204 196  VAL B C   
4155 O  O   . VAL B  199 ? 0.7243 0.6414 0.8046 0.0344  -0.0510 -0.0165 196  VAL B O   
4156 C  CB  . VAL B  199 ? 0.7322 0.6376 0.8008 0.0309  -0.0647 -0.0240 196  VAL B CB  
4157 C  CG1 . VAL B  199 ? 0.7271 0.6321 0.8056 0.0399  -0.0563 -0.0211 196  VAL B CG1 
4158 C  CG2 . VAL B  199 ? 0.7391 0.6323 0.7880 0.0295  -0.0732 -0.0249 196  VAL B CG2 
4159 N  N   . GLY B  200 ? 0.6416 0.5717 0.7389 0.0259  -0.0555 -0.0236 197  GLY B N   
4160 C  CA  . GLY B  200 ? 0.6182 0.5574 0.7345 0.0281  -0.0490 -0.0229 197  GLY B CA  
4161 C  C   . GLY B  200 ? 0.6581 0.6043 0.7755 0.0248  -0.0481 -0.0223 197  GLY B C   
4162 O  O   . GLY B  200 ? 0.6708 0.6230 0.8028 0.0273  -0.0429 -0.0211 197  GLY B O   
4163 N  N   . PHE B  201 ? 0.6150 0.5612 0.7181 0.0192  -0.0534 -0.0226 198  PHE B N   
4164 C  CA  . PHE B  201 ? 0.6050 0.5589 0.7087 0.0161  -0.0528 -0.0215 198  PHE B CA  
4165 C  C   . PHE B  201 ? 0.6839 0.6328 0.7676 0.0125  -0.0570 -0.0173 198  PHE B C   
4166 O  O   . PHE B  201 ? 0.6971 0.6466 0.7805 0.0135  -0.0539 -0.0135 198  PHE B O   
4167 C  CB  . PHE B  201 ? 0.6112 0.5764 0.7243 0.0120  -0.0545 -0.0265 198  PHE B CB  
4168 C  CG  . PHE B  201 ? 0.6226 0.5967 0.7374 0.0098  -0.0533 -0.0252 198  PHE B CG  
4169 C  CD1 . PHE B  201 ? 0.6448 0.6220 0.7715 0.0135  -0.0475 -0.0232 198  PHE B CD1 
4170 C  CD2 . PHE B  201 ? 0.6424 0.6222 0.7470 0.0040  -0.0581 -0.0253 198  PHE B CD2 
4171 C  CE1 . PHE B  201 ? 0.6433 0.6283 0.7716 0.0117  -0.0466 -0.0219 198  PHE B CE1 
4172 C  CE2 . PHE B  201 ? 0.6666 0.6555 0.7732 0.0024  -0.0567 -0.0235 198  PHE B CE2 
4173 C  CZ  . PHE B  201 ? 0.6340 0.6250 0.7523 0.0064  -0.0509 -0.0220 198  PHE B CZ  
4174 N  N   . ILE B  202 ? 0.6403 0.5845 0.7083 0.0078  -0.0646 -0.0176 199  ILE B N   
4175 C  CA  . ILE B  202 ? 0.6422 0.5812 0.6910 0.0035  -0.0705 -0.0130 199  ILE B CA  
4176 C  C   . ILE B  202 ? 0.6976 0.6233 0.7348 0.0082  -0.0693 -0.0086 199  ILE B C   
4177 O  O   . ILE B  202 ? 0.7059 0.6307 0.7373 0.0071  -0.0690 -0.0041 199  ILE B O   
4178 C  CB  . ILE B  202 ? 0.6853 0.6222 0.7203 -0.0030 -0.0801 -0.0137 199  ILE B CB  
4179 C  CG1 . ILE B  202 ? 0.6830 0.6336 0.7280 -0.0076 -0.0813 -0.0182 199  ILE B CG1 
4180 C  CG2 . ILE B  202 ? 0.6978 0.6293 0.7137 -0.0079 -0.0871 -0.0078 199  ILE B CG2 
4181 C  CD1 . ILE B  202 ? 0.7726 0.7375 0.8227 -0.0115 -0.0803 -0.0174 199  ILE B CD1 
4182 N  N   . ILE B  203 ? 0.6370 0.5525 0.6706 0.0135  -0.0688 -0.0097 200  ILE B N   
4183 C  CA  . ILE B  203 ? 0.6339 0.5365 0.6548 0.0189  -0.0676 -0.0059 200  ILE B CA  
4184 C  C   . ILE B  203 ? 0.6994 0.6068 0.7319 0.0231  -0.0588 -0.0032 200  ILE B C   
4185 O  O   . ILE B  203 ? 0.7034 0.6059 0.7252 0.0225  -0.0596 0.0013  200  ILE B O   
4186 C  CB  . ILE B  203 ? 0.6695 0.5603 0.6826 0.0247  -0.0688 -0.0076 200  ILE B CB  
4187 C  CG1 . ILE B  203 ? 0.6656 0.5482 0.6619 0.0197  -0.0798 -0.0090 200  ILE B CG1 
4188 C  CG2 . ILE B  203 ? 0.6808 0.5603 0.6831 0.0322  -0.0654 -0.0040 200  ILE B CG2 
4189 C  CD1 . ILE B  203 ? 0.6607 0.5335 0.6520 0.0246  -0.0820 -0.0119 200  ILE B CD1 
4190 N  N   . PRO B  204 ? 0.6610 0.5783 0.7153 0.0264  -0.0514 -0.0052 201  PRO B N   
4191 C  CA  . PRO B  204 ? 0.6494 0.5714 0.7147 0.0296  -0.0442 -0.0019 201  PRO B CA  
4192 C  C   . PRO B  204 ? 0.6939 0.6214 0.7584 0.0244  -0.0453 0.0006  201  PRO B C   
4193 O  O   . PRO B  204 ? 0.6931 0.6170 0.7530 0.0259  -0.0429 0.0052  201  PRO B O   
4194 C  CB  . PRO B  204 ? 0.6627 0.5947 0.7517 0.0321  -0.0389 -0.0049 201  PRO B CB  
4195 C  CG  . PRO B  204 ? 0.7113 0.6395 0.7986 0.0332  -0.0418 -0.0084 201  PRO B CG  
4196 C  CD  . PRO B  204 ? 0.6631 0.5865 0.7328 0.0273  -0.0500 -0.0099 201  PRO B CD  
4197 N  N   . PHE B  205 ? 0.6549 0.5912 0.7228 0.0184  -0.0491 -0.0021 202  PHE B N   
4198 C  CA  . PHE B  205 ? 0.6558 0.5987 0.7229 0.0135  -0.0504 0.0005  202  PHE B CA  
4199 C  C   . PHE B  205 ? 0.7191 0.6519 0.7645 0.0105  -0.0559 0.0063  202  PHE B C   
4200 O  O   . PHE B  205 ? 0.7046 0.6384 0.7497 0.0096  -0.0543 0.0107  202  PHE B O   
4201 C  CB  . PHE B  205 ? 0.6737 0.6288 0.7474 0.0083  -0.0534 -0.0034 202  PHE B CB  
4202 C  CG  . PHE B  205 ? 0.7063 0.6728 0.7875 0.0054  -0.0520 -0.0018 202  PHE B CG  
4203 C  CD1 . PHE B  205 ? 0.7608 0.7278 0.8489 0.0079  -0.0471 0.0018  202  PHE B CD1 
4204 C  CD2 . PHE B  205 ? 0.7465 0.7241 0.8290 0.0007  -0.0553 -0.0040 202  PHE B CD2 
4205 C  CE1 . PHE B  205 ? 0.7720 0.7497 0.8681 0.0057  -0.0458 0.0031  202  PHE B CE1 
4206 C  CE2 . PHE B  205 ? 0.7796 0.7688 0.8697 -0.0011 -0.0535 -0.0026 202  PHE B CE2 
4207 C  CZ  . PHE B  205 ? 0.7547 0.7435 0.8519 0.0015  -0.0489 0.0008  202  PHE B CZ  
4208 N  N   . VAL B  206 ? 0.6957 0.6179 0.7230 0.0089  -0.0629 0.0064  203  VAL B N   
4209 C  CA  . VAL B  206 ? 0.7167 0.6271 0.7222 0.0060  -0.0698 0.0118  203  VAL B CA  
4210 C  C   . VAL B  206 ? 0.7784 0.6778 0.7774 0.0118  -0.0657 0.0156  203  VAL B C   
4211 O  O   . VAL B  206 ? 0.7710 0.6669 0.7617 0.0093  -0.0677 0.0209  203  VAL B O   
4212 C  CB  . VAL B  206 ? 0.7770 0.6778 0.7649 0.0030  -0.0794 0.0110  203  VAL B CB  
4213 C  CG1 . VAL B  206 ? 0.7905 0.6753 0.7548 0.0015  -0.0870 0.0166  203  VAL B CG1 
4214 C  CG2 . VAL B  206 ? 0.7670 0.6798 0.7588 -0.0046 -0.0844 0.0095  203  VAL B CG2 
4215 N  N   . ILE B  207 ? 0.7394 0.6344 0.7430 0.0195  -0.0600 0.0132  204  ILE B N   
4216 C  CA  . ILE B  207 ? 0.7544 0.6413 0.7537 0.0260  -0.0547 0.0165  204  ILE B CA  
4217 C  C   . ILE B  207 ? 0.8324 0.7281 0.8443 0.0248  -0.0492 0.0201  204  ILE B C   
4218 O  O   . ILE B  207 ? 0.8322 0.7199 0.8329 0.0252  -0.0496 0.0250  204  ILE B O   
4219 C  CB  . ILE B  207 ? 0.7913 0.6769 0.7981 0.0344  -0.0485 0.0135  204  ILE B CB  
4220 C  CG1 . ILE B  207 ? 0.8063 0.6808 0.7978 0.0362  -0.0546 0.0105  204  ILE B CG1 
4221 C  CG2 . ILE B  207 ? 0.7958 0.6771 0.8018 0.0414  -0.0415 0.0175  204  ILE B CG2 
4222 C  CD1 . ILE B  207 ? 0.8876 0.7641 0.8898 0.0430  -0.0494 0.0072  204  ILE B CD1 
4223 N  N   . ILE B  208 ? 0.7853 0.6966 0.8194 0.0228  -0.0452 0.0174  205  ILE B N   
4224 C  CA  . ILE B  208 ? 0.7718 0.6929 0.8203 0.0213  -0.0408 0.0200  205  ILE B CA  
4225 C  C   . ILE B  208 ? 0.8247 0.7448 0.8620 0.0147  -0.0465 0.0243  205  ILE B C   
4226 O  O   . ILE B  208 ? 0.8313 0.7479 0.8655 0.0148  -0.0450 0.0294  205  ILE B O   
4227 C  CB  . ILE B  208 ? 0.7931 0.7295 0.8667 0.0215  -0.0364 0.0152  205  ILE B CB  
4228 C  CG1 . ILE B  208 ? 0.7872 0.7248 0.8750 0.0280  -0.0292 0.0151  205  ILE B CG1 
4229 C  CG2 . ILE B  208 ? 0.7880 0.7360 0.8734 0.0173  -0.0359 0.0160  205  ILE B CG2 
4230 C  CD1 . ILE B  208 ? 0.9007 0.8433 1.0005 0.0299  -0.0282 0.0101  205  ILE B CD1 
4231 N  N   . ILE B  209 ? 0.7793 0.7023 0.8100 0.0089  -0.0533 0.0231  206  ILE B N   
4232 C  CA  . ILE B  209 ? 0.7824 0.7056 0.8026 0.0021  -0.0595 0.0284  206  ILE B CA  
4233 C  C   . ILE B  209 ? 0.8392 0.7455 0.8387 0.0026  -0.0632 0.0346  206  ILE B C   
4234 O  O   . ILE B  209 ? 0.8373 0.7437 0.8366 0.0006  -0.0627 0.0399  206  ILE B O   
4235 C  CB  . ILE B  209 ? 0.8186 0.7467 0.8323 -0.0041 -0.0672 0.0272  206  ILE B CB  
4236 C  CG1 . ILE B  209 ? 0.8101 0.7537 0.8420 -0.0041 -0.0639 0.0205  206  ILE B CG1 
4237 C  CG2 . ILE B  209 ? 0.8343 0.7649 0.8395 -0.0113 -0.0733 0.0340  206  ILE B CG2 
4238 C  CD1 . ILE B  209 ? 0.9938 0.9535 1.0432 -0.0053 -0.0596 0.0199  206  ILE B CD1 
4239 N  N   . VAL B  210 ? 0.8127 0.7042 0.7954 0.0058  -0.0668 0.0336  207  VAL B N   
4240 C  CA  . VAL B  210 ? 0.8324 0.7052 0.7926 0.0073  -0.0713 0.0383  207  VAL B CA  
4241 C  C   . VAL B  210 ? 0.9109 0.7808 0.8751 0.0126  -0.0637 0.0410  207  VAL B C   
4242 O  O   . VAL B  210 ? 0.9181 0.7818 0.8730 0.0099  -0.0663 0.0469  207  VAL B O   
4243 C  CB  . VAL B  210 ? 0.8838 0.7415 0.8256 0.0107  -0.0769 0.0355  207  VAL B CB  
4244 C  CG1 . VAL B  210 ? 0.8911 0.7284 0.8087 0.0135  -0.0815 0.0398  207  VAL B CG1 
4245 C  CG2 . VAL B  210 ? 0.8824 0.7420 0.8182 0.0040  -0.0862 0.0344  207  VAL B CG2 
4246 N  N   . CYS B  211 ? 0.8756 0.7505 0.8540 0.0195  -0.0547 0.0373  208  CYS B N   
4247 C  CA  . CYS B  211 ? 0.8696 0.7442 0.8544 0.0244  -0.0469 0.0402  208  CYS B CA  
4248 C  C   . CYS B  211 ? 0.9020 0.7859 0.8988 0.0196  -0.0450 0.0444  208  CYS B C   
4249 O  O   . CYS B  211 ? 0.9040 0.7808 0.8934 0.0201  -0.0443 0.0496  208  CYS B O   
4250 C  CB  . CYS B  211 ? 0.8672 0.7495 0.8693 0.0312  -0.0383 0.0363  208  CYS B CB  
4251 S  SG  . CYS B  211 ? 0.9342 0.8036 0.9209 0.0396  -0.0383 0.0334  208  CYS B SG  
4252 N  N   . TYR B  212 ? 0.8282 0.7274 0.8427 0.0153  -0.0445 0.0420  209  TYR B N   
4253 C  CA  . TYR B  212 ? 0.8134 0.7224 0.8407 0.0113  -0.0428 0.0454  209  TYR B CA  
4254 C  C   . TYR B  212 ? 0.9118 0.8145 0.9235 0.0049  -0.0501 0.0516  209  TYR B C   
4255 O  O   . TYR B  212 ? 0.9104 0.8151 0.9267 0.0028  -0.0487 0.0565  209  TYR B O   
4256 C  CB  . TYR B  212 ? 0.7927 0.7196 0.8430 0.0097  -0.0400 0.0406  209  TYR B CB  
4257 C  CG  . TYR B  212 ? 0.7614 0.6953 0.8312 0.0154  -0.0326 0.0361  209  TYR B CG  
4258 C  CD1 . TYR B  212 ? 0.7715 0.6983 0.8400 0.0212  -0.0279 0.0377  209  TYR B CD1 
4259 C  CD2 . TYR B  212 ? 0.7464 0.6940 0.8356 0.0151  -0.0307 0.0307  209  TYR B CD2 
4260 C  CE1 . TYR B  212 ? 0.7405 0.6745 0.8277 0.0260  -0.0218 0.0348  209  TYR B CE1 
4261 C  CE2 . TYR B  212 ? 0.7407 0.6938 0.8480 0.0199  -0.0251 0.0273  209  TYR B CE2 
4262 C  CZ  . TYR B  212 ? 0.7954 0.7420 0.9021 0.0250  -0.0208 0.0298  209  TYR B CZ  
4263 O  OH  . TYR B  212 ? 0.8086 0.7613 0.9337 0.0292  -0.0160 0.0277  209  TYR B OH  
4264 N  N   . THR B  213 ? 0.9179 0.8125 0.9112 0.0016  -0.0585 0.0521  210  THR B N   
4265 C  CA  . THR B  213 ? 0.9429 0.8299 0.9196 -0.0049 -0.0671 0.0591  210  THR B CA  
4266 C  C   . THR B  213 ? 1.0595 0.9291 1.0198 -0.0022 -0.0677 0.0641  210  THR B C   
4267 O  O   . THR B  213 ? 1.0608 0.9291 1.0197 -0.0060 -0.0692 0.0705  210  THR B O   
4268 C  CB  . THR B  213 ? 0.9077 0.7906 0.8698 -0.0093 -0.0767 0.0586  210  THR B CB  
4269 O  OG1 . THR B  213 ? 0.7832 0.6842 0.7617 -0.0119 -0.0752 0.0545  210  THR B OG1 
4270 C  CG2 . THR B  213 ? 0.8891 0.7633 0.8335 -0.0164 -0.0869 0.0669  210  THR B CG2 
4271 N  N   . MET B  214 ? 1.0505 0.9078 1.0000 0.0048  -0.0659 0.0611  211  MET B N   
4272 C  CA  . MET B  214 ? 1.0797 0.9204 1.0124 0.0092  -0.0656 0.0648  211  MET B CA  
4273 C  C   . MET B  214 ? 1.1467 0.9934 1.0931 0.0108  -0.0576 0.0679  211  MET B C   
4274 O  O   . MET B  214 ? 1.1686 1.0045 1.1025 0.0094  -0.0601 0.0739  211  MET B O   
4275 C  CB  . MET B  214 ? 1.1260 0.9562 1.0477 0.0176  -0.0638 0.0600  211  MET B CB  
4276 C  CG  . MET B  214 ? 1.2013 1.0161 1.0991 0.0165  -0.0745 0.0593  211  MET B CG  
4277 S  SD  . MET B  214 ? 1.2837 1.0875 1.1706 0.0276  -0.0716 0.0531  211  MET B SD  
4278 C  CE  . MET B  214 ? 1.2679 1.0434 1.1185 0.0303  -0.0807 0.0575  211  MET B CE  
4279 N  N   . ILE B  215 ? 1.0910 0.9541 1.0629 0.0134  -0.0486 0.0641  212  ILE B N   
4280 C  CA  . ILE B  215 ? 1.0775 0.9485 1.0662 0.0146  -0.0412 0.0669  212  ILE B CA  
4281 C  C   . ILE B  215 ? 1.1280 1.0041 1.1220 0.0070  -0.0444 0.0723  212  ILE B C   
4282 O  O   . ILE B  215 ? 1.1276 0.9978 1.1174 0.0062  -0.0439 0.0780  212  ILE B O   
4283 C  CB  . ILE B  215 ? 1.0944 0.9813 1.1094 0.0187  -0.0326 0.0618  212  ILE B CB  
4284 C  CG1 . ILE B  215 ? 1.0947 0.9765 1.1051 0.0268  -0.0284 0.0582  212  ILE B CG1 
4285 C  CG2 . ILE B  215 ? 1.0921 0.9884 1.1266 0.0182  -0.0267 0.0651  212  ILE B CG2 
4286 C  CD1 . ILE B  215 ? 1.0970 0.9934 1.1314 0.0300  -0.0225 0.0527  212  ILE B CD1 
4287 N  N   . ILE B  216 ? 1.0852 0.9724 1.0878 0.0016  -0.0479 0.0708  213  ILE B N   
4288 C  CA  . ILE B  216 ? 1.0816 0.9763 1.0910 -0.0052 -0.0507 0.0759  213  ILE B CA  
4289 C  C   . ILE B  216 ? 1.1737 1.0528 1.1602 -0.0099 -0.0588 0.0839  213  ILE B C   
4290 O  O   . ILE B  216 ? 1.1714 1.0511 1.1618 -0.0131 -0.0588 0.0898  213  ILE B O   
4291 C  CB  . ILE B  216 ? 1.1032 1.0140 1.1255 -0.0089 -0.0523 0.0723  213  ILE B CB  
4292 C  CG1 . ILE B  216 ? 1.0892 1.0157 1.1375 -0.0047 -0.0442 0.0656  213  ILE B CG1 
4293 C  CG2 . ILE B  216 ? 1.1044 1.0216 1.1280 -0.0163 -0.0572 0.0787  213  ILE B CG2 
4294 C  CD1 . ILE B  216 ? 1.1755 1.1144 1.2325 -0.0055 -0.0450 0.0593  213  ILE B CD1 
4295 N  N   . LEU B  217 ? 1.1576 1.0217 1.1203 -0.0101 -0.0662 0.0842  214  LEU B N   
4296 C  CA  . LEU B  217 ? 1.1709 1.0175 1.1096 -0.0143 -0.0755 0.0918  214  LEU B CA  
4297 C  C   . LEU B  217 ? 1.2600 1.0926 1.1885 -0.0103 -0.0728 0.0951  214  LEU B C   
4298 O  O   . LEU B  217 ? 1.2747 1.0998 1.1951 -0.0149 -0.0773 0.1026  214  LEU B O   
4299 C  CB  . LEU B  217 ? 1.1836 1.0172 1.1000 -0.0152 -0.0850 0.0908  214  LEU B CB  
4300 C  CG  . LEU B  217 ? 1.2438 1.0899 1.1662 -0.0210 -0.0901 0.0897  214  LEU B CG  
4301 C  CD1 . LEU B  217 ? 1.2580 1.0907 1.1596 -0.0207 -0.0988 0.0876  214  LEU B CD1 
4302 C  CD2 . LEU B  217 ? 1.2687 1.1223 1.1947 -0.0299 -0.0957 0.0980  214  LEU B CD2 
4303 N  N   . THR B  218 ? 1.2266 1.0570 1.1568 -0.0019 -0.0652 0.0900  215  THR B N   
4304 C  CA  . THR B  218 ? 1.2358 1.0558 1.1583 0.0031  -0.0608 0.0926  215  THR B CA  
4305 C  C   . THR B  218 ? 1.3186 1.1500 1.2611 0.0000  -0.0555 0.0970  215  THR B C   
4306 O  O   . THR B  218 ? 1.3325 1.1538 1.2650 -0.0018 -0.0574 0.1033  215  THR B O   
4307 C  CB  . THR B  218 ? 1.2722 1.0924 1.1965 0.0128  -0.0531 0.0863  215  THR B CB  
4308 O  OG1 . THR B  218 ? 1.3012 1.1097 1.2062 0.0156  -0.0588 0.0825  215  THR B OG1 
4309 C  CG2 . THR B  218 ? 1.2119 1.0243 1.1298 0.0186  -0.0474 0.0892  215  THR B CG2 
4310 N  N   . LEU B  219 ? 1.2834 1.1351 1.2536 -0.0007 -0.0496 0.0934  216  LEU B N   
4311 C  CA  . LEU B  219 ? 1.2783 1.1424 1.2705 -0.0033 -0.0448 0.0965  216  LEU B CA  
4312 C  C   . LEU B  219 ? 1.3647 1.2277 1.3542 -0.0116 -0.0513 0.1038  216  LEU B C   
4313 O  O   . LEU B  219 ? 1.3645 1.2294 1.3627 -0.0136 -0.0491 0.1086  216  LEU B O   
4314 C  CB  . LEU B  219 ? 1.2585 1.1430 1.2792 -0.0017 -0.0385 0.0902  216  LEU B CB  
4315 C  CG  . LEU B  219 ? 1.3102 1.1988 1.3409 0.0059  -0.0306 0.0850  216  LEU B CG  
4316 C  CD1 . LEU B  219 ? 1.2989 1.2062 1.3577 0.0065  -0.0261 0.0797  216  LEU B CD1 
4317 C  CD2 . LEU B  219 ? 1.3442 1.2275 1.3742 0.0091  -0.0258 0.0895  216  LEU B CD2 
4318 N  N   . LEU B  220 ? 1.3421 1.2022 1.3201 -0.0166 -0.0597 0.1053  217  LEU B N   
4319 C  CA  . LEU B  220 ? 1.3539 1.2132 1.3283 -0.0249 -0.0669 0.1134  217  LEU B CA  
4320 C  C   . LEU B  220 ? 1.4325 1.2702 1.3826 -0.0265 -0.0729 0.1206  217  LEU B C   
4321 O  O   . LEU B  220 ? 1.4342 1.2712 1.3875 -0.0312 -0.0744 0.1278  217  LEU B O   
4322 C  CB  . LEU B  220 ? 1.3582 1.2224 1.3282 -0.0298 -0.0743 0.1135  217  LEU B CB  
4323 C  CG  . LEU B  220 ? 1.4122 1.2998 1.4068 -0.0308 -0.0702 0.1091  217  LEU B CG  
4324 C  CD1 . LEU B  220 ? 1.4226 1.3133 1.4093 -0.0339 -0.0766 0.1077  217  LEU B CD1 
4325 C  CD2 . LEU B  220 ? 1.4354 1.3352 1.4464 -0.0358 -0.0696 0.1148  217  LEU B CD2 
4326 N  N   . LYS B  221 ? 1.4019 1.2215 1.3274 -0.0224 -0.0764 0.1187  218  LYS B N   
4327 C  CA  . LYS B  221 ? 1.4169 1.2130 1.3153 -0.0223 -0.0826 0.1243  218  LYS B CA  
4328 C  C   . LYS B  221 ? 1.4801 1.2746 1.3842 -0.0198 -0.0757 0.1271  218  LYS B C   
4329 O  O   . LYS B  221 ? 1.4772 1.2605 1.3705 -0.0242 -0.0807 0.1348  218  LYS B O   
4330 C  CB  . LYS B  221 ? 1.4559 1.2357 1.3309 -0.0155 -0.0852 0.1191  218  LYS B CB  
4331 C  CG  . LYS B  221 ? 1.6082 1.3615 1.4504 -0.0168 -0.0961 0.1247  218  LYS B CG  
4332 C  CD  . LYS B  221 ? 1.7231 1.4596 1.5435 -0.0071 -0.0954 0.1192  218  LYS B CD  
4333 N  N   . LYS B  222 ? 1.4431 1.2494 1.3648 -0.0133 -0.0648 0.1214  219  LYS B N   
4334 C  CA  . LYS B  222 ? 1.4469 1.2549 1.3773 -0.0107 -0.0574 0.1238  219  LYS B CA  
4335 C  C   . LYS B  222 ? 1.5301 1.3518 1.4836 -0.0175 -0.0562 0.1287  219  LYS B C   
4336 O  O   . LYS B  222 ? 1.5349 1.3519 1.4881 -0.0191 -0.0552 0.1345  219  LYS B O   
4337 C  CB  . LYS B  222 ? 1.4658 1.2834 1.4090 -0.0021 -0.0472 0.1170  219  LYS B CB  
4338 C  CG  . LYS B  222 ? 1.6281 1.4312 1.5481 0.0060  -0.0469 0.1133  219  LYS B CG  
4339 N  N   . SER B  223 ? 1.5000 1.3386 1.4730 -0.0211 -0.0564 0.1264  220  SER B N   
4340 C  CA  . SER B  223 ? 1.4972 1.3505 1.4932 -0.0268 -0.0555 0.1300  220  SER B CA  
4341 C  C   . SER B  223 ? 1.5712 1.4150 1.5552 -0.0348 -0.0642 0.1396  220  SER B C   
4342 O  O   . SER B  223 ? 1.5687 1.4169 1.5650 -0.0386 -0.0633 0.1450  220  SER B O   
4343 C  CB  . SER B  223 ? 1.5432 1.4159 1.5596 -0.0272 -0.0537 0.1241  220  SER B CB  
4344 O  OG  . SER B  223 ? 1.6936 1.5756 1.7190 -0.0340 -0.0581 0.1286  220  SER B OG  
4345 N  N   . MET B  224 ? 1.5425 1.3738 1.5038 -0.0376 -0.0732 0.1420  221  MET B N   
4346 C  CA  . MET B  224 ? 1.5519 1.3726 1.4996 -0.0457 -0.0832 0.1518  221  MET B CA  
4347 C  C   . MET B  224 ? 1.6183 1.4181 1.5463 -0.0457 -0.0859 0.1577  221  MET B C   
4348 O  O   . MET B  224 ? 1.6140 1.4106 1.5427 -0.0522 -0.0901 0.1663  221  MET B O   
4349 C  CB  . MET B  224 ? 1.5908 1.4050 1.5211 -0.0488 -0.0928 0.1527  221  MET B CB  
4350 C  CG  . MET B  224 ? 1.6266 1.4620 1.5758 -0.0526 -0.0931 0.1516  221  MET B CG  
4351 S  SD  . MET B  224 ? 1.6945 1.5226 1.6230 -0.0570 -0.1051 0.1538  221  MET B SD  
4352 C  CE  . MET B  224 ? 1.6519 1.4818 1.5789 -0.0480 -0.0992 0.1409  221  MET B CE  
4353 N  N   . LYS B  225 ? 1.5891 1.3753 1.4998 -0.0383 -0.0833 0.1533  222  LYS B N   
4354 C  CA  . LYS B  225 ? 1.6052 1.3713 1.4952 -0.0366 -0.0848 0.1577  222  LYS B CA  
4355 C  C   . LYS B  225 ? 1.6680 1.4429 1.5770 -0.0372 -0.0773 0.1607  222  LYS B C   
4356 O  O   . LYS B  225 ? 1.6750 1.4373 1.5732 -0.0408 -0.0811 0.1682  222  LYS B O   
4357 C  CB  . LYS B  225 ? 1.6451 1.3985 1.5152 -0.0270 -0.0821 0.1512  222  LYS B CB  
4358 N  N   . SER B  226 ? 1.6202 1.4165 1.5579 -0.0342 -0.0676 0.1553  1000 SER B N   
4359 C  CA  . SER B  226 ? 1.6127 1.4197 1.5721 -0.0349 -0.0608 0.1577  1000 SER B CA  
4360 C  C   . SER B  226 ? 1.6752 1.4908 1.6509 -0.0436 -0.0647 0.1643  1000 SER B C   
4361 O  O   . SER B  226 ? 1.6634 1.4835 1.6530 -0.0458 -0.0616 0.1683  1000 SER B O   
4362 C  CB  . SER B  226 ? 1.6416 1.4668 1.6248 -0.0286 -0.0507 0.1498  1000 SER B CB  
4363 N  N   . ALA B  227 ? 1.6497 1.4685 1.6245 -0.0486 -0.0714 0.1657  1001 ALA B N   
4364 C  CA  . ALA B  227 ? 1.6503 1.4780 1.6395 -0.0566 -0.0755 0.1726  1001 ALA B CA  
4365 C  C   . ALA B  227 ? 1.7447 1.5526 1.7126 -0.0630 -0.0844 0.1833  1001 ALA B C   
4366 O  O   . ALA B  227 ? 1.7402 1.5513 1.7193 -0.0689 -0.0860 0.1904  1001 ALA B O   
4367 C  CB  . ALA B  227 ? 1.6529 1.4928 1.6485 -0.0590 -0.0789 0.1707  1001 ALA B CB  
4368 N  N   . ASP B  228 ? 1.7362 1.5226 1.6730 -0.0617 -0.0907 0.1841  1002 ASP B N   
4369 C  CA  . ASP B  228 ? 1.7573 1.5208 1.6690 -0.0669 -0.1004 0.1935  1002 ASP B CA  
4370 C  C   . ASP B  228 ? 1.8237 1.5792 1.7333 -0.0649 -0.0957 0.1958  1002 ASP B C   
4371 O  O   . ASP B  228 ? 1.8249 1.5719 1.7309 -0.0714 -0.1008 0.2049  1002 ASP B O   
4372 C  CB  . ASP B  228 ? 1.7985 1.5409 1.6774 -0.0643 -0.1082 0.1919  1002 ASP B CB  
4373 C  CG  . ASP B  228 ? 1.9136 1.6631 1.7927 -0.0663 -0.1135 0.1898  1002 ASP B CG  
4374 O  OD1 . ASP B  228 ? 1.9022 1.6725 1.8052 -0.0706 -0.1120 0.1909  1002 ASP B OD1 
4375 O  OD2 . ASP B  228 ? 1.9898 1.7241 1.8450 -0.0634 -0.1193 0.1871  1002 ASP B OD2 
4376 N  N   . LEU B  229 ? 1.7884 1.5478 1.7016 -0.0563 -0.0859 0.1882  1003 LEU B N   
4377 C  CA  . LEU B  229 ? 1.7964 1.5521 1.7103 -0.0533 -0.0798 0.1896  1003 LEU B CA  
4378 C  C   . LEU B  229 ? 1.8534 1.6259 1.7976 -0.0587 -0.0761 0.1937  1003 LEU B C   
4379 O  O   . LEU B  229 ? 1.8587 1.6245 1.8013 -0.0613 -0.0760 0.1998  1003 LEU B O   
4380 C  CB  . LEU B  229 ? 1.7946 1.5560 1.7105 -0.0430 -0.0698 0.1806  1003 LEU B CB  
4381 N  N   . GLU B  230 ? 1.8011 1.5947 1.7721 -0.0602 -0.0736 0.1904  1004 GLU B N   
4382 C  CA  . GLU B  230 ? 1.7865 1.5974 1.7880 -0.0647 -0.0709 0.1931  1004 GLU B CA  
4383 C  C   . GLU B  230 ? 1.8500 1.6551 1.8482 -0.0743 -0.0801 0.2034  1004 GLU B C   
4384 O  O   . GLU B  230 ? 1.8421 1.6533 1.8573 -0.0789 -0.0798 0.2088  1004 GLU B O   
4385 C  CB  . GLU B  230 ? 1.7884 1.6220 1.8153 -0.0616 -0.0658 0.1850  1004 GLU B CB  
4386 C  CG  . GLU B  230 ? 1.9067 1.7593 1.9669 -0.0628 -0.0608 0.1845  1004 GLU B CG  
4387 C  CD  . GLU B  230 ? 2.1536 2.0267 2.2361 -0.0592 -0.0566 0.1760  1004 GLU B CD  
4388 O  OE1 . GLU B  230 ? 2.1281 2.0097 2.2233 -0.0531 -0.0496 0.1687  1004 GLU B OE1 
4389 O  OE2 . GLU B  230 ? 2.0361 1.9167 2.1232 -0.0626 -0.0606 0.1769  1004 GLU B OE2 
4390 N  N   . ASP B  231 ? 1.8207 1.6142 1.7976 -0.0773 -0.0889 0.2065  1005 ASP B N   
4391 C  CA  . ASP B  231 ? 1.8243 1.6112 1.7955 -0.0867 -0.0991 0.2172  1005 ASP B CA  
4392 C  C   . ASP B  231 ? 1.8932 1.6567 1.8423 -0.0907 -0.1051 0.2259  1005 ASP B C   
4393 O  O   . ASP B  231 ? 1.8844 1.6464 1.8392 -0.0985 -0.1103 0.2354  1005 ASP B O   
4394 C  CB  . ASP B  231 ? 1.8534 1.6368 1.8100 -0.0886 -0.1070 0.2176  1005 ASP B CB  
4395 C  CG  . ASP B  231 ? 1.9649 1.7709 1.9447 -0.0921 -0.1072 0.2181  1005 ASP B CG  
4396 O  OD1 . ASP B  231 ? 1.9541 1.7809 1.9627 -0.0900 -0.0992 0.2140  1005 ASP B OD1 
4397 O  OD2 . ASP B  231 ? 2.0431 1.8462 2.0120 -0.0966 -0.1157 0.2227  1005 ASP B OD2 
4398 N  N   . ASN B  232 ? 1.8732 1.6185 1.7967 -0.0849 -0.1044 0.2226  1006 ASN B N   
4399 C  CA  . ASN B  232 ? 1.8905 1.6118 1.7891 -0.0867 -0.1095 0.2292  1006 ASN B CA  
4400 C  C   . ASN B  232 ? 1.9419 1.6686 1.8555 -0.0866 -0.1022 0.2310  1006 ASN B C   
4401 O  O   . ASN B  232 ? 1.9495 1.6614 1.8514 -0.0915 -0.1071 0.2393  1006 ASN B O   
4402 C  CB  . ASN B  232 ? 1.9168 1.6176 1.7822 -0.0795 -0.1113 0.2244  1006 ASN B CB  
4403 C  CG  . ASN B  232 ? 2.2295 1.9177 2.0736 -0.0815 -0.1222 0.2255  1006 ASN B CG  
4404 O  OD1 . ASN B  232 ? 2.1257 1.8077 1.9655 -0.0904 -0.1327 0.2344  1006 ASN B OD1 
4405 N  ND2 . ASN B  232 ? 2.1598 1.8438 1.9901 -0.0736 -0.1204 0.2169  1006 ASN B ND2 
4406 N  N   . TRP B  233 ? 1.8865 1.6342 1.8262 -0.0814 -0.0913 0.2238  1007 TRP B N   
4407 C  CA  . TRP B  233 ? 1.8781 1.6346 1.8370 -0.0815 -0.0844 0.2253  1007 TRP B CA  
4408 C  C   . TRP B  233 ? 1.9167 1.6861 1.9020 -0.0900 -0.0871 0.2317  1007 TRP B C   
4409 O  O   . TRP B  233 ? 1.9110 1.6797 1.9051 -0.0940 -0.0865 0.2375  1007 TRP B O   
4410 C  CB  . TRP B  233 ? 1.8520 1.6261 1.8295 -0.0731 -0.0732 0.2156  1007 TRP B CB  
4411 C  CG  . TRP B  233 ? 1.8557 1.6386 1.8520 -0.0729 -0.0666 0.2173  1007 TRP B CG  
4412 C  CD1 . TRP B  233 ? 1.8756 1.6766 1.9046 -0.0764 -0.0640 0.2184  1007 TRP B CD1 
4413 C  CD2 . TRP B  233 ? 1.8607 1.6353 1.8445 -0.0686 -0.0620 0.2183  1007 TRP B CD2 
4414 N  NE1 . TRP B  233 ? 1.8645 1.6686 1.9025 -0.0754 -0.0588 0.2204  1007 TRP B NE1 
4415 C  CE2 . TRP B  233 ? 1.8966 1.6856 1.9075 -0.0706 -0.0571 0.2205  1007 TRP B CE2 
4416 C  CE3 . TRP B  233 ? 1.8931 1.6501 1.8452 -0.0627 -0.0616 0.2173  1007 TRP B CE3 
4417 C  CZ2 . TRP B  233 ? 1.8897 1.6770 1.8976 -0.0676 -0.0517 0.2227  1007 TRP B CZ2 
4418 C  CZ3 . TRP B  233 ? 1.9131 1.6687 1.8617 -0.0589 -0.0556 0.2190  1007 TRP B CZ3 
4419 C  CH2 . TRP B  233 ? 1.9068 1.6782 1.8835 -0.0617 -0.0507 0.2220  1007 TRP B CH2 
4420 N  N   . GLU B  234 ? 1.8641 1.6456 1.8622 -0.0925 -0.0898 0.2307  1008 GLU B N   
4421 C  CA  . GLU B  234 ? 1.8482 1.6435 1.8712 -0.0996 -0.0923 0.2363  1008 GLU B CA  
4422 C  C   . GLU B  234 ? 1.9032 1.6819 1.9115 -0.1089 -0.1027 0.2489  1008 GLU B C   
4423 O  O   . GLU B  234 ? 1.8893 1.6732 1.9148 -0.1146 -0.1037 0.2555  1008 GLU B O   
4424 C  CB  . GLU B  234 ? 1.8553 1.6685 1.8932 -0.0985 -0.0920 0.2316  1008 GLU B CB  
4425 N  N   . THR B  235 ? 1.8747 1.6326 1.8513 -0.1105 -0.1110 0.2525  1009 THR B N   
4426 C  CA  . THR B  235 ? 1.8838 1.6228 1.8428 -0.1194 -0.1224 0.2648  1009 THR B CA  
4427 C  C   . THR B  235 ? 1.9447 1.6678 1.8930 -0.1211 -0.1225 0.2698  1009 THR B C   
4428 O  O   . THR B  235 ? 1.9335 1.6520 1.8862 -0.1294 -0.1282 0.2799  1009 THR B O   
4429 C  CB  . THR B  235 ? 1.9727 1.6935 1.9011 -0.1206 -0.1324 0.2671  1009 THR B CB  
4430 O  OG1 . THR B  235 ? 1.9619 1.6818 1.8785 -0.1114 -0.1276 0.2562  1009 THR B OG1 
4431 C  CG2 . THR B  235 ? 1.9413 1.6722 1.8798 -0.1275 -0.1397 0.2734  1009 THR B CG2 
4432 N  N   . LEU B  236 ? 1.9216 1.6376 1.8569 -0.1132 -0.1159 0.2630  1010 LEU B N   
4433 C  CA  . LEU B  236 ? 1.9380 1.6407 1.8624 -0.1135 -0.1147 0.2669  1010 LEU B CA  
4434 C  C   . LEU B  236 ? 1.9984 1.7171 1.9545 -0.1183 -0.1104 0.2709  1010 LEU B C   
4435 O  O   . LEU B  236 ? 2.0004 1.7078 1.9518 -0.1252 -0.1156 0.2801  1010 LEU B O   
4436 C  CB  . LEU B  236 ? 1.9455 1.6441 1.8556 -0.1029 -0.1065 0.2581  1010 LEU B CB  
4437 N  N   . ASN B  237 ? 1.9528 1.6968 1.9409 -0.1148 -0.1021 0.2639  1011 ASN B N   
4438 C  CA  . ASN B  237 ? 1.9399 1.7009 1.9609 -0.1183 -0.0982 0.2662  1011 ASN B CA  
4439 C  C   . ASN B  237 ? 1.9993 1.7644 2.0346 -0.1277 -0.1057 0.2751  1011 ASN B C   
4440 O  O   . ASN B  237 ? 1.9924 1.7588 2.0415 -0.1335 -0.1070 0.2819  1011 ASN B O   
4441 C  CB  . ASN B  237 ? 1.9188 1.7038 1.9677 -0.1112 -0.0884 0.2557  1011 ASN B CB  
4442 C  CG  . ASN B  237 ? 2.1751 1.9598 2.2155 -0.1021 -0.0803 0.2478  1011 ASN B CG  
4443 O  OD1 . ASN B  237 ? 2.0801 1.8475 2.0943 -0.1000 -0.0806 0.2496  1011 ASN B OD1 
4444 N  ND2 . ASN B  237 ? 2.0743 1.8783 2.1369 -0.0961 -0.0730 0.2388  1011 ASN B ND2 
4445 N  N   . ASP B  238 ? 1.9612 1.7291 1.9939 -0.1293 -0.1107 0.2756  1012 ASP B N   
4446 C  CA  . ASP B  238 ? 1.9559 1.7297 2.0020 -0.1377 -0.1177 0.2845  1012 ASP B CA  
4447 C  C   . ASP B  238 ? 2.0301 1.7813 2.0559 -0.1468 -0.1281 0.2975  1012 ASP B C   
4448 O  O   . ASP B  238 ? 2.0177 1.7734 2.0604 -0.1541 -0.1315 0.3059  1012 ASP B O   
4449 C  CB  . ASP B  238 ? 1.9751 1.7591 2.0229 -0.1366 -0.1199 0.2820  1012 ASP B CB  
4450 N  N   . ASN B  239 ? 2.0150 1.7414 2.0045 -0.1463 -0.1338 0.2992  1013 ASN B N   
4451 C  CA  . ASN B  239 ? 2.0299 1.7316 1.9963 -0.1546 -0.1447 0.3112  1013 ASN B CA  
4452 C  C   . ASN B  239 ? 2.0810 1.7752 2.0485 -0.1566 -0.1422 0.3147  1013 ASN B C   
4453 O  O   . ASN B  239 ? 2.0851 1.7654 2.0455 -0.1653 -0.1505 0.3259  1013 ASN B O   
4454 C  CB  . ASN B  239 ? 2.0576 1.7339 1.9843 -0.1530 -0.1524 0.3116  1013 ASN B CB  
4455 C  CG  . ASN B  239 ? 2.3545 2.0348 2.2768 -0.1531 -0.1576 0.3107  1013 ASN B CG  
4456 O  OD1 . ASN B  239 ? 2.2953 1.9745 2.2051 -0.1454 -0.1545 0.3015  1013 ASN B OD1 
4457 N  ND2 . ASN B  239 ? 2.2506 1.9345 2.1813 -0.1618 -0.1662 0.3209  1013 ASN B ND2 
4458 N  N   . LEU B  240 ? 2.0273 1.7316 2.0049 -0.1491 -0.1312 0.3058  1014 LEU B N   
4459 C  CA  . LEU B  240 ? 2.0236 1.7254 2.0064 -0.1505 -0.1276 0.3086  1014 LEU B CA  
4460 C  C   . LEU B  240 ? 2.0618 1.7793 2.0787 -0.1581 -0.1285 0.3149  1014 LEU B C   
4461 O  O   . LEU B  240 ? 2.0610 1.7698 2.0780 -0.1647 -0.1319 0.3232  1014 LEU B O   
4462 C  CB  . LEU B  240 ? 2.0174 1.7300 2.0063 -0.1405 -0.1157 0.2978  1014 LEU B CB  
4463 N  N   . LYS B  241 ? 2.0027 1.7427 2.0475 -0.1570 -0.1259 0.3110  1015 LYS B N   
4464 C  CA  . LYS B  241 ? 1.9820 1.7390 2.0604 -0.1628 -0.1268 0.3159  1015 LYS B CA  
4465 C  C   . LYS B  241 ? 2.0349 1.7825 2.1071 -0.1726 -0.1380 0.3283  1015 LYS B C   
4466 O  O   . LYS B  241 ? 2.0258 1.7799 2.1189 -0.1795 -0.1410 0.3359  1015 LYS B O   
4467 C  CB  . LYS B  241 ? 1.9935 1.7774 2.1012 -0.1565 -0.1195 0.3061  1015 LYS B CB  
4468 N  N   . VAL B  242 ? 1.9971 1.7294 2.0411 -0.1734 -0.1449 0.3308  1016 VAL B N   
4469 C  CA  . VAL B  242 ? 1.9969 1.7181 2.0312 -0.1829 -0.1569 0.3435  1016 VAL B CA  
4470 C  C   . VAL B  242 ? 2.0541 1.7510 2.0701 -0.1909 -0.1646 0.3543  1016 VAL B C   
4471 O  O   . VAL B  242 ? 2.0520 1.7437 2.0710 -0.2005 -0.1737 0.3666  1016 VAL B O   
4472 C  CB  . VAL B  242 ? 2.0548 1.7679 2.0657 -0.1815 -0.1626 0.3429  1016 VAL B CB  
4473 N  N   . ILE B  243 ? 2.0127 1.6958 2.0106 -0.1867 -0.1606 0.3501  1017 ILE B N   
4474 C  CA  . ILE B  243 ? 2.0203 1.6806 1.9994 -0.1929 -0.1665 0.3588  1017 ILE B CA  
4475 C  C   . ILE B  243 ? 2.0515 1.7234 2.0609 -0.1996 -0.1654 0.3651  1017 ILE B C   
4476 O  O   . ILE B  243 ? 2.0535 1.7133 2.0597 -0.2096 -0.1748 0.3774  1017 ILE B O   
4477 C  CB  . ILE B  243 ? 2.0730 1.7181 2.0245 -0.1852 -0.1615 0.3517  1017 ILE B CB  
4478 N  N   . GLU B  244 ? 1.9852 1.6802 2.0243 -0.1944 -0.1548 0.3570  1018 GLU B N   
4479 C  CA  . GLU B  244 ? 2.2301 1.9381 2.3007 -0.1995 -0.1533 0.3612  1018 GLU B CA  
4480 C  C   . GLU B  244 ? 2.4673 2.1913 2.5656 -0.2048 -0.1572 0.3666  1018 GLU B C   
4481 O  O   . GLU B  244 ? 1.9517 1.6645 2.0427 -0.2137 -0.1672 0.3783  1018 GLU B O   
4482 C  CB  . GLU B  244 ? 2.2335 1.9601 2.3255 -0.1916 -0.1416 0.3504  1018 GLU B CB  
4483 N  N   . ASP B  247 ? 1.9040 1.5554 1.9398 -0.2492 -0.2139 0.4285  1021 ASP B N   
4484 C  CA  . ASP B  247 ? 1.9046 1.5438 1.9425 -0.2617 -0.2247 0.4444  1021 ASP B CA  
4485 C  C   . ASP B  247 ? 1.9751 1.5808 1.9727 -0.2682 -0.2385 0.4543  1021 ASP B C   
4486 O  O   . ASP B  247 ? 1.9817 1.5655 1.9642 -0.2751 -0.2452 0.4623  1021 ASP B O   
4487 C  CB  . ASP B  247 ? 1.9080 1.5708 1.9805 -0.2668 -0.2268 0.4523  1021 ASP B CB  
4488 N  N   . ASN B  248 ? 1.9312 1.5325 1.9114 -0.2662 -0.2434 0.4540  1022 ASN B N   
4489 C  CA  . ASN B  248 ? 1.9479 1.5173 1.8895 -0.2717 -0.2579 0.4629  1022 ASN B CA  
4490 C  C   . ASN B  248 ? 2.0125 1.5584 1.9162 -0.2638 -0.2561 0.4528  1022 ASN B C   
4491 O  O   . ASN B  248 ? 2.0030 1.5615 1.9095 -0.2526 -0.2440 0.4381  1022 ASN B O   
4492 C  CB  . ASN B  248 ? 1.9437 1.5201 1.8861 -0.2741 -0.2653 0.4686  1022 ASN B CB  
4493 N  N   . ALA B  249 ? 1.9887 1.5003 1.8566 -0.2693 -0.2685 0.4609  1023 ALA B N   
4494 C  CA  . ALA B  249 ? 2.0046 1.4899 1.8321 -0.2620 -0.2689 0.4529  1023 ALA B CA  
4495 C  C   . ALA B  249 ? 2.0480 1.5287 1.8555 -0.2556 -0.2719 0.4468  1023 ALA B C   
4496 O  O   . ALA B  249 ? 2.0520 1.5241 1.8372 -0.2452 -0.2663 0.4348  1023 ALA B O   
4497 C  CB  . ALA B  249 ? 2.0360 1.4856 1.8318 -0.2702 -0.2826 0.4642  1023 ALA B CB  
4498 N  N   . ALA B  250 ? 1.9906 1.4777 1.8065 -0.2619 -0.2810 0.4555  1024 ALA B N   
4499 C  CA  . ALA B  250 ? 1.9900 1.4752 1.7909 -0.2577 -0.2854 0.4518  1024 ALA B CA  
4500 C  C   . ALA B  250 ? 2.0084 1.5268 1.8351 -0.2473 -0.2697 0.4375  1024 ALA B C   
4501 O  O   . ALA B  250 ? 2.0075 1.5235 1.8183 -0.2397 -0.2685 0.4285  1024 ALA B O   
4502 C  CB  . ALA B  250 ? 1.9992 1.4822 1.8032 -0.2691 -0.3007 0.4679  1024 ALA B CB  
4503 N  N   . GLN B  251 ? 1.9381 1.4864 1.8043 -0.2470 -0.2582 0.4353  1025 GLN B N   
4504 C  CA  . GLN B  251 ? 1.9138 1.4943 1.8076 -0.2376 -0.2431 0.4221  1025 GLN B CA  
4505 C  C   . GLN B  251 ? 1.9544 1.5322 1.8372 -0.2259 -0.2310 0.4065  1025 GLN B C   
4506 O  O   . GLN B  251 ? 1.9426 1.5337 1.8284 -0.2167 -0.2228 0.3945  1025 GLN B O   
4507 C  CB  . GLN B  251 ? 1.9073 1.5174 1.8449 -0.2413 -0.2366 0.4256  1025 GLN B CB  
4508 C  CG  . GLN B  251 ? 2.0501 1.6939 2.0171 -0.2334 -0.2248 0.4151  1025 GLN B CG  
4509 C  CD  . GLN B  251 ? 2.2884 1.9495 2.2783 -0.2262 -0.2102 0.4036  1025 GLN B CD  
4510 O  OE1 . GLN B  251 ? 2.2550 1.9057 2.2294 -0.2196 -0.2042 0.3943  1025 GLN B OE1 
4511 N  NE2 . GLN B  251 ? 2.1627 1.8507 2.1903 -0.2271 -0.2046 0.4043  1025 GLN B NE2 
4512 N  N   . VAL B  252 ? 1.9113 1.4718 1.7809 -0.2265 -0.2303 0.4073  1026 VAL B N   
4513 C  CA  . VAL B  252 ? 1.9086 1.4644 1.7647 -0.2161 -0.2199 0.3947  1026 VAL B CA  
4514 C  C   . VAL B  252 ? 1.9663 1.4978 1.7813 -0.2096 -0.2249 0.3893  1026 VAL B C   
4515 O  O   . VAL B  252 ? 1.9618 1.4949 1.7678 -0.1988 -0.2152 0.3769  1026 VAL B O   
4516 C  CB  . VAL B  252 ? 1.9618 1.5069 1.8155 -0.2195 -0.2185 0.3987  1026 VAL B CB  
4517 N  N   . LYS B  253 ? 1.9308 1.4398 1.7216 -0.2163 -0.2405 0.3990  1027 LYS B N   
4518 C  CA  . LYS B  253 ? 1.9454 1.4293 1.6969 -0.2113 -0.2483 0.3953  1027 LYS B CA  
4519 C  C   . LYS B  253 ? 1.9699 1.4720 1.7309 -0.2056 -0.2448 0.3875  1027 LYS B C   
4520 O  O   . LYS B  253 ? 1.9767 1.4686 1.7142 -0.1967 -0.2436 0.3779  1027 LYS B O   
4521 C  CB  . LYS B  253 ? 1.9992 1.4524 1.7236 -0.2217 -0.2679 0.4098  1027 LYS B CB  
4522 N  N   . ASP B  254 ? 1.8938 1.4236 1.6894 -0.2105 -0.2429 0.3915  1028 ASP B N   
4523 C  CA  . ASP B  254 ? 1.8750 1.4261 1.6842 -0.2062 -0.2392 0.3851  1028 ASP B CA  
4524 C  C   . ASP B  254 ? 1.8824 1.4533 1.7050 -0.1938 -0.2221 0.3684  1028 ASP B C   
4525 O  O   . ASP B  254 ? 1.8739 1.4457 1.6855 -0.1864 -0.2202 0.3594  1028 ASP B O   
4526 C  CB  . ASP B  254 ? 1.8810 1.4569 1.7239 -0.2146 -0.2413 0.3947  1028 ASP B CB  
4527 C  CG  . ASP B  254 ? 1.9971 1.5887 1.8464 -0.2130 -0.2428 0.3926  1028 ASP B CG  
4528 O  OD1 . ASP B  254 ? 2.0136 1.5860 1.8368 -0.2163 -0.2560 0.3983  1028 ASP B OD1 
4529 O  OD2 . ASP B  254 ? 2.0510 1.6736 1.9310 -0.2086 -0.2314 0.3857  1028 ASP B OD2 
4530 N  N   . ALA B  255 ? 1.8033 1.3894 1.6494 -0.1917 -0.2104 0.3646  1029 ALA B N   
4531 C  CA  . ALA B  255 ? 1.7813 1.3861 1.6422 -0.1808 -0.1946 0.3501  1029 ALA B CA  
4532 C  C   . ALA B  255 ? 1.8418 1.4261 1.6697 -0.1716 -0.1922 0.3414  1029 ALA B C   
4533 O  O   . ALA B  255 ? 1.8301 1.4259 1.6611 -0.1618 -0.1824 0.3292  1029 ALA B O   
4534 C  CB  . ALA B  255 ? 1.7741 1.3953 1.6646 -0.1824 -0.1858 0.3506  1029 ALA B CB  
4535 N  N   . LEU B  256 ? 1.8225 1.3761 1.6180 -0.1747 -0.2015 0.3479  1030 LEU B N   
4536 C  CA  . LEU B  256 ? 1.8425 1.3728 1.6020 -0.1661 -0.2009 0.3412  1030 LEU B CA  
4537 C  C   . LEU B  256 ? 1.8982 1.4172 1.6333 -0.1604 -0.2064 0.3355  1030 LEU B C   
4538 O  O   . LEU B  256 ? 1.8992 1.4204 1.6257 -0.1493 -0.1979 0.3237  1030 LEU B O   
4539 C  CB  . LEU B  256 ? 1.8636 1.3635 1.5952 -0.1718 -0.2109 0.3509  1030 LEU B CB  
4540 N  N   . THR B  257 ? 1.8523 1.3601 1.5774 -0.1683 -0.2209 0.3444  1031 THR B N   
4541 C  CA  . THR B  257 ? 1.8595 1.3558 1.5624 -0.1652 -0.2292 0.3413  1031 THR B CA  
4542 C  C   . THR B  257 ? 1.8962 1.4210 1.6223 -0.1587 -0.2189 0.3307  1031 THR B C   
4543 O  O   . THR B  257 ? 1.8966 1.4138 1.6039 -0.1516 -0.2202 0.3230  1031 THR B O   
4544 C  CB  . THR B  257 ? 1.9290 1.4087 1.6198 -0.1769 -0.2479 0.3556  1031 THR B CB  
4545 O  OG1 . THR B  257 ? 1.9022 1.4018 1.6257 -0.1872 -0.2481 0.3659  1031 THR B OG1 
4546 C  CG2 . THR B  257 ? 1.9141 1.3545 1.5648 -0.1796 -0.2613 0.3623  1031 THR B CG2 
4547 N  N   . LYS B  258 ? 1.8332 1.3899 1.5994 -0.1608 -0.2089 0.3302  1032 LYS B N   
4548 C  CA  . LYS B  258 ? 1.8126 1.3988 1.6049 -0.1551 -0.1983 0.3205  1032 LYS B CA  
4549 C  C   . LYS B  258 ? 1.8622 1.4558 1.6563 -0.1429 -0.1837 0.3064  1032 LYS B C   
4550 O  O   . LYS B  258 ? 1.8577 1.4597 1.6514 -0.1353 -0.1787 0.2965  1032 LYS B O   
4551 C  CB  . LYS B  258 ? 1.8168 1.4322 1.6497 -0.1615 -0.1938 0.3255  1032 LYS B CB  
4552 N  N   . MET B  259 ? 1.8119 1.4029 1.6085 -0.1415 -0.1771 0.3063  1033 MET B N   
4553 C  CA  . MET B  259 ? 1.8017 1.3996 1.6009 -0.1311 -0.1637 0.2956  1033 MET B CA  
4554 C  C   . MET B  259 ? 1.8752 1.4522 1.6387 -0.1216 -0.1647 0.2882  1033 MET B C   
4555 O  O   . MET B  259 ? 1.8641 1.4529 1.6327 -0.1119 -0.1544 0.2772  1033 MET B O   
4556 C  CB  . MET B  259 ? 1.8282 1.4229 1.6323 -0.1339 -0.1601 0.3006  1033 MET B CB  
4557 C  CG  . MET B  259 ? 1.8471 1.4707 1.6924 -0.1357 -0.1502 0.2997  1033 MET B CG  
4558 S  SD  . MET B  259 ? 1.8965 1.5158 1.7450 -0.1376 -0.1454 0.3042  1033 MET B SD  
4559 C  CE  . MET B  259 ? 1.8552 1.4782 1.6946 -0.1235 -0.1324 0.2915  1033 MET B CE  
4560 N  N   . ARG B  260 ? 1.8603 1.4060 1.5879 -0.1243 -0.1775 0.2944  1034 ARG B N   
4561 C  CA  . ARG B  260 ? 1.8798 1.4011 1.5692 -0.1153 -0.1809 0.2883  1034 ARG B CA  
4562 C  C   . ARG B  260 ? 1.9346 1.4594 1.6195 -0.1108 -0.1832 0.2812  1034 ARG B C   
4563 O  O   . ARG B  260 ? 1.9359 1.4538 1.6029 -0.1001 -0.1792 0.2716  1034 ARG B O   
4564 C  CB  . ARG B  260 ? 1.8963 1.3826 1.5498 -0.1204 -0.1959 0.2976  1034 ARG B CB  
4565 C  CG  . ARG B  260 ? 2.0039 1.4680 1.6232 -0.1099 -0.1936 0.2916  1034 ARG B CG  
4566 C  CD  . ARG B  260 ? 2.1094 1.5357 1.6884 -0.1134 -0.2102 0.2991  1034 ARG B CD  
4567 N  NE  . ARG B  260 ? 2.1939 1.5980 1.7357 -0.1009 -0.2103 0.2906  1034 ARG B NE  
4568 C  CZ  . ARG B  260 ? 2.3619 1.7545 1.8837 -0.0949 -0.2165 0.2845  1034 ARG B CZ  
4569 N  NH1 . ARG B  260 ? 2.1754 1.5767 1.7102 -0.1009 -0.2233 0.2863  1034 ARG B NH1 
4570 N  NH2 . ARG B  260 ? 2.2219 1.5944 1.7102 -0.0828 -0.2161 0.2766  1034 ARG B NH2 
4571 N  N   . ALA B  261 ? 1.8860 1.4230 1.5888 -0.1191 -0.1893 0.2864  1035 ALA B N   
4572 C  CA  . ALA B  261 ? 1.8822 1.4269 1.5865 -0.1171 -0.1920 0.2815  1035 ALA B CA  
4573 C  C   . ALA B  261 ? 1.9146 1.4877 1.6450 -0.1085 -0.1759 0.2693  1035 ALA B C   
4574 O  O   . ALA B  261 ? 1.9202 1.4916 1.6395 -0.1004 -0.1738 0.2602  1035 ALA B O   
4575 C  CB  . ALA B  261 ? 1.8832 1.4369 1.6031 -0.1289 -0.2017 0.2920  1035 ALA B CB  
4576 N  N   . ALA B  262 ? 1.8428 1.4405 1.6071 -0.1103 -0.1651 0.2693  1036 ALA B N   
4577 C  CA  . ALA B  262 ? 1.8174 1.4426 1.6096 -0.1031 -0.1502 0.2588  1036 ALA B CA  
4578 C  C   . ALA B  262 ? 1.8637 1.4841 1.6447 -0.0920 -0.1401 0.2501  1036 ALA B C   
4579 O  O   . ALA B  262 ? 1.8513 1.4838 1.6390 -0.0837 -0.1319 0.2400  1036 ALA B O   
4580 C  CB  . ALA B  262 ? 1.8051 1.4548 1.6349 -0.1088 -0.1439 0.2625  1036 ALA B CB  
4581 N  N   . ALA B  263 ? 1.8290 1.4326 1.5933 -0.0918 -0.1409 0.2543  1037 ALA B N   
4582 C  CA  . ALA B  263 ? 1.8343 1.4338 1.5872 -0.0815 -0.1314 0.2477  1037 ALA B CA  
4583 C  C   . ALA B  263 ? 1.9051 1.4875 1.6265 -0.0717 -0.1335 0.2402  1037 ALA B C   
4584 O  O   . ALA B  263 ? 1.8952 1.4859 1.6182 -0.0615 -0.1228 0.2314  1037 ALA B O   
4585 C  CB  . ALA B  263 ? 1.8532 1.4377 1.5935 -0.0846 -0.1331 0.2553  1037 ALA B CB  
4586 N  N   . LEU B  264 ? 1.8854 1.4439 1.5785 -0.0748 -0.1477 0.2439  1038 LEU B N   
4587 C  CA  . LEU B  264 ? 1.9046 1.4438 1.5657 -0.0661 -0.1522 0.2373  1038 LEU B CA  
4588 C  C   . LEU B  264 ? 1.9563 1.5134 1.6325 -0.0621 -0.1482 0.2287  1038 LEU B C   
4589 O  O   . LEU B  264 ? 1.9596 1.5112 1.6204 -0.0518 -0.1450 0.2199  1038 LEU B O   
4590 C  CB  . LEU B  264 ? 1.9264 1.4344 1.5547 -0.0720 -0.1704 0.2448  1038 LEU B CB  
4591 N  N   . ASP B  265 ? 1.9028 1.4816 1.6091 -0.0700 -0.1481 0.2312  1039 ASP B N   
4592 C  CA  . ASP B  265 ? 1.8910 1.4888 1.6145 -0.0678 -0.1446 0.2241  1039 ASP B CA  
4593 C  C   . ASP B  265 ? 1.9267 1.5482 1.6740 -0.0592 -0.1281 0.2144  1039 ASP B C   
4594 O  O   . ASP B  265 ? 1.9237 1.5513 1.6710 -0.0523 -0.1245 0.2057  1039 ASP B O   
4595 C  CB  . ASP B  265 ? 1.9015 1.5144 1.6479 -0.0789 -0.1501 0.2309  1039 ASP B CB  
4596 N  N   . ALA B  266 ? 1.8690 1.5031 1.6362 -0.0598 -0.1190 0.2163  1040 ALA B N   
4597 C  CA  . ALA B  266 ? 1.8548 1.5112 1.6459 -0.0526 -0.1042 0.2087  1040 ALA B CA  
4598 C  C   . ALA B  266 ? 1.9287 1.5754 1.6991 -0.0406 -0.0981 0.2018  1040 ALA B C   
4599 O  O   . ALA B  266 ? 1.9138 1.5777 1.7005 -0.0335 -0.0872 0.1945  1040 ALA B O   
4600 C  CB  . ALA B  266 ? 1.8519 1.5214 1.6673 -0.0574 -0.0983 0.2140  1040 ALA B CB  
4601 N  N   . GLN B  267 ? 1.9211 1.5404 1.6556 -0.0382 -0.1055 0.2043  1041 GLN B N   
4602 C  CA  . GLN B  267 ? 1.9394 1.5466 1.6497 -0.0263 -0.1007 0.1988  1041 GLN B CA  
4603 C  C   . GLN B  267 ? 2.0155 1.6207 1.7151 -0.0181 -0.1010 0.1895  1041 GLN B C   
4604 O  O   . GLN B  267 ? 2.0102 1.6205 1.7076 -0.0073 -0.0916 0.1826  1041 GLN B O   
4605 C  CB  . GLN B  267 ? 1.9769 1.5537 1.6509 -0.0266 -0.1098 0.2047  1041 GLN B CB  
4606 C  CG  . GLN B  267 ? 2.0895 1.6565 1.7412 -0.0143 -0.1026 0.2006  1041 GLN B CG  
4607 C  CD  . GLN B  267 ? 2.2646 1.8000 1.8780 -0.0140 -0.1123 0.2058  1041 GLN B CD  
4608 O  OE1 . GLN B  267 ? 2.2088 1.7383 1.8085 -0.0073 -0.1064 0.2061  1041 GLN B OE1 
4609 N  NE2 . GLN B  267 ? 2.1473 1.6616 1.7420 -0.0210 -0.1278 0.2102  1041 GLN B NE2 
4610 N  N   . LYS B  268 ? 1.9905 1.5876 1.6826 -0.0233 -0.1124 0.1901  1042 LYS B N   
4611 C  CA  . LYS B  268 ? 1.9972 1.5909 1.6789 -0.0175 -0.1152 0.1823  1042 LYS B CA  
4612 C  C   . LYS B  268 ? 2.0423 1.6653 1.7567 -0.0147 -0.1039 0.1751  1042 LYS B C   
4613 O  O   . LYS B  268 ? 2.0345 1.6588 1.7434 -0.0059 -0.1001 0.1670  1042 LYS B O   
4614 C  CB  . LYS B  268 ? 2.0349 1.6145 1.7034 -0.0261 -0.1312 0.1869  1042 LYS B CB  
4615 N  N   . ALA B  269 ? 1.9979 1.6438 1.7459 -0.0221 -0.0990 0.1782  1043 ALA B N   
4616 C  CA  . ALA B  269 ? 1.9842 1.6578 1.7648 -0.0203 -0.0891 0.1719  1043 ALA B CA  
4617 C  C   . ALA B  269 ? 2.0477 1.7334 1.8396 -0.0112 -0.0753 0.1670  1043 ALA B C   
4618 O  O   . ALA B  269 ? 2.0468 1.7261 1.8312 -0.0091 -0.0720 0.1708  1043 ALA B O   
4619 C  CB  . ALA B  269 ? 1.9768 1.6686 1.7872 -0.0305 -0.0893 0.1769  1043 ALA B CB  
4620 N  N   . THR B  270 ? 2.0084 1.7119 1.8185 -0.0059 -0.0677 0.1592  1044 THR B N   
4621 C  CA  . THR B  270 ? 2.0017 1.7193 1.8257 0.0025  -0.0549 0.1549  1044 THR B CA  
4622 C  C   . THR B  270 ? 2.0298 1.7734 1.8929 -0.0021 -0.0477 0.1556  1044 THR B C   
4623 O  O   . THR B  270 ? 2.0042 1.7602 1.8855 -0.0066 -0.0494 0.1531  1044 THR B O   
4624 C  CB  . THR B  270 ? 2.1198 1.8371 1.9353 0.0121  -0.0520 0.1462  1044 THR B CB  
4625 N  N   . PRO B  271 ? 1.9914 1.7434 1.8675 -0.0012 -0.0403 0.1591  1045 PRO B N   
4626 C  CA  . PRO B  271 ? 1.9748 1.7503 1.8880 -0.0055 -0.0347 0.1597  1045 PRO B CA  
4627 C  C   . PRO B  271 ? 2.0248 1.8191 1.9593 0.0005  -0.0266 0.1521  1045 PRO B C   
4628 O  O   . PRO B  271 ? 2.0283 1.8186 1.9495 0.0091  -0.0230 0.1477  1045 PRO B O   
4629 C  CB  . PRO B  271 ? 1.9936 1.7693 1.9102 -0.0066 -0.0307 0.1666  1045 PRO B CB  
4630 C  CG  . PRO B  271 ? 2.0628 1.8220 1.9491 0.0013  -0.0294 0.1668  1045 PRO B CG  
4631 C  CD  . PRO B  271 ? 2.0206 1.7615 1.8784 0.0038  -0.0370 0.1629  1045 PRO B CD  
4632 N  N   . PRO B  272 ? 1.9657 1.7799 1.9325 -0.0034 -0.0241 0.1503  1046 PRO B N   
4633 C  CA  . PRO B  272 ? 1.9507 1.7815 1.9372 0.0021  -0.0174 0.1432  1046 PRO B CA  
4634 C  C   . PRO B  272 ? 1.9983 1.8358 1.9905 0.0093  -0.0085 0.1437  1046 PRO B C   
4635 O  O   . PRO B  272 ? 1.9975 1.8406 1.9919 0.0162  -0.0039 0.1382  1046 PRO B O   
4636 C  CB  . PRO B  272 ? 1.9564 1.8044 1.9740 -0.0041 -0.0178 0.1424  1046 PRO B CB  
4637 C  CG  . PRO B  272 ? 2.0140 1.8583 2.0339 -0.0114 -0.0213 0.1504  1046 PRO B CG  
4638 C  CD  . PRO B  272 ? 1.9766 1.7986 1.9628 -0.0125 -0.0276 0.1546  1046 PRO B CD  
4639 N  N   . LYS B  273 ? 1.9489 1.7861 1.9434 0.0077  -0.0061 0.1507  1047 LYS B N   
4640 C  CA  . LYS B  273 ? 1.9406 1.7851 1.9399 0.0140  0.0022  0.1529  1047 LYS B CA  
4641 C  C   . LYS B  273 ? 2.0040 1.8347 1.9725 0.0230  0.0042  0.1513  1047 LYS B C   
4642 O  O   . LYS B  273 ? 1.9942 1.8332 1.9665 0.0310  0.0112  0.1489  1047 LYS B O   
4643 C  CB  . LYS B  273 ? 1.9678 1.8145 1.9754 0.0091  0.0031  0.1615  1047 LYS B CB  
4644 N  N   . LEU B  274 ? 1.9774 1.7866 1.9150 0.0220  -0.0026 0.1526  1048 LEU B N   
4645 C  CA  . LEU B  274 ? 1.9908 1.7831 1.8953 0.0307  -0.0028 0.1505  1048 LEU B CA  
4646 C  C   . LEU B  274 ? 2.0467 1.8309 1.9386 0.0330  -0.0080 0.1430  1048 LEU B C   
4647 O  O   . LEU B  274 ? 2.0563 1.8209 1.9169 0.0373  -0.0128 0.1414  1048 LEU B O   
4648 C  CB  . LEU B  274 ? 2.0070 1.7786 1.8834 0.0288  -0.0078 0.1568  1048 LEU B CB  
4649 N  N   . GLU B  275 ? 1.9921 1.7916 1.9085 0.0303  -0.0075 0.1382  1049 GLU B N   
4650 C  CA  . GLU B  275 ? 1.9943 1.7899 1.9036 0.0318  -0.0119 0.1311  1049 GLU B CA  
4651 C  C   . GLU B  275 ? 2.0473 1.8391 1.9420 0.0431  -0.0073 0.1262  1049 GLU B C   
4652 O  O   . GLU B  275 ? 2.0512 1.8280 1.9225 0.0462  -0.0130 0.1222  1049 GLU B O   
4653 C  CB  . GLU B  275 ? 1.9948 1.8093 1.9350 0.0269  -0.0112 0.1272  1049 GLU B CB  
4654 N  N   . ASP B  276 ? 1.9945 1.8001 1.9034 0.0494  0.0027  0.1270  1050 ASP B N   
4655 C  CA  . ASP B  276 ? 2.3513 2.1567 2.2497 0.0609  0.0087  0.1236  1050 ASP B CA  
4656 C  C   . ASP B  276 ? 2.5536 2.3449 2.4245 0.0675  0.0105  0.1277  1050 ASP B C   
4657 O  O   . ASP B  276 ? 1.9868 1.7562 1.8277 0.0676  0.0030  0.1276  1050 ASP B O   
4658 C  CB  . ASP B  276 ? 2.3557 2.1851 2.2853 0.0639  0.0183  0.1234  1050 ASP B CB  
4659 N  N   . ASP B  280 ? 2.1961 1.8290 1.8323 0.0984  -0.0270 0.1287  1054 ASP B N   
4660 C  CA  . ASP B  280 ? 2.2105 1.8293 1.8181 0.1076  -0.0245 0.1310  1054 ASP B CA  
4661 C  C   . ASP B  280 ? 2.2514 1.8938 1.8791 0.1113  -0.0095 0.1359  1054 ASP B C   
4662 O  O   . ASP B  280 ? 2.2557 1.8908 1.8622 0.1200  -0.0052 0.1381  1054 ASP B O   
4663 C  CB  . ASP B  280 ? 2.2509 1.8505 1.8249 0.1220  -0.0272 0.1235  1054 ASP B CB  
4664 C  CG  . ASP B  280 ? 2.3693 1.9420 1.9024 0.1293  -0.0319 0.1250  1054 ASP B CG  
4665 O  OD1 . ASP B  280 ? 2.3888 1.9348 1.8972 0.1240  -0.0464 0.1256  1054 ASP B OD1 
4666 O  OD2 . ASP B  280 ? 2.4300 2.0086 1.9559 0.1401  -0.0214 0.1260  1054 ASP B OD2 
4667 N  N   . SER B  281 ? 2.1902 1.8605 1.8583 0.1044  -0.0023 0.1380  1055 SER B N   
4668 C  CA  . SER B  281 ? 2.1743 1.8692 1.8661 0.1064  0.0107  0.1433  1055 SER B CA  
4669 C  C   . SER B  281 ? 2.2345 1.9253 1.9221 0.1001  0.0102  0.1520  1055 SER B C   
4670 O  O   . SER B  281 ? 2.2383 1.9152 1.9205 0.0895  0.0000  0.1546  1055 SER B O   
4671 C  CB  . SER B  281 ? 2.1912 1.9136 1.9262 0.0995  0.0158  0.1431  1055 SER B CB  
4672 O  OG  . SER B  281 ? 2.2785 2.0014 2.0295 0.0851  0.0088  0.1465  1055 SER B OG  
4673 N  N   . PRO B  282 ? 2.1872 1.8909 1.8787 0.1058  0.0209  0.1573  1056 PRO B N   
4674 C  CA  . PRO B  282 ? 2.1857 1.8857 1.8738 0.0991  0.0200  0.1660  1056 PRO B CA  
4675 C  C   . PRO B  282 ? 2.2143 1.9292 1.9377 0.0838  0.0181  0.1713  1056 PRO B C   
4676 O  O   . PRO B  282 ? 2.2162 1.9242 1.9366 0.0756  0.0140  0.1780  1056 PRO B O   
4677 C  CB  . PRO B  282 ? 2.2041 1.9180 1.8904 0.1098  0.0327  0.1700  1056 PRO B CB  
4678 C  CG  . PRO B  282 ? 2.2632 1.9807 1.9414 0.1240  0.0384  0.1627  1056 PRO B CG  
4679 C  CD  . PRO B  282 ? 2.1992 1.9218 1.8981 0.1183  0.0338  0.1565  1056 PRO B CD  
4680 N  N   . GLU B  283 ? 2.1446 1.8788 1.9004 0.0800  0.0203  0.1681  1057 GLU B N   
4681 C  CA  . GLU B  283 ? 2.1225 1.8703 1.9118 0.0666  0.0179  0.1715  1057 GLU B CA  
4682 C  C   . GLU B  283 ? 2.1640 1.8922 1.9416 0.0573  0.0048  0.1700  1057 GLU B C   
4683 O  O   . GLU B  283 ? 2.1475 1.8779 1.9400 0.0459  0.0004  0.1751  1057 GLU B O   
4684 C  CB  . GLU B  283 ? 2.1213 1.8937 1.9446 0.0675  0.0240  0.1674  1057 GLU B CB  
4685 C  CG  . GLU B  283 ? 2.2367 2.0312 2.0992 0.0579  0.0267  0.1725  1057 GLU B CG  
4686 C  CD  . GLU B  283 ? 2.4987 2.3186 2.3904 0.0625  0.0359  0.1712  1057 GLU B CD  
4687 O  OE1 . GLU B  283 ? 2.4305 2.2552 2.3315 0.0643  0.0354  0.1642  1057 GLU B OE1 
4688 O  OE2 . GLU B  283 ? 2.4418 2.2769 2.3468 0.0642  0.0434  0.1777  1057 GLU B OE2 
4689 N  N   . MET B  284 ? 2.1280 1.8368 1.8783 0.0625  -0.0017 0.1636  1058 MET B N   
4690 C  CA  . MET B  284 ? 2.1340 1.8229 1.8697 0.0548  -0.0150 0.1625  1058 MET B CA  
4691 C  C   . MET B  284 ? 2.1956 1.8586 1.8983 0.0532  -0.0227 0.1677  1058 MET B C   
4692 O  O   . MET B  284 ? 2.1931 1.8448 1.8930 0.0425  -0.0328 0.1716  1058 MET B O   
4693 C  CB  . MET B  284 ? 2.1704 1.8507 1.8923 0.0610  -0.0190 0.1539  1058 MET B CB  
4694 N  N   . LYS B  285 ? 2.1589 1.8124 1.8360 0.0639  -0.0181 0.1680  1059 LYS B N   
4695 C  CA  . LYS B  285 ? 2.1708 1.7993 1.8140 0.0643  -0.0245 0.1726  1059 LYS B CA  
4696 C  C   . LYS B  285 ? 2.1990 1.8359 1.8585 0.0547  -0.0224 0.1821  1059 LYS B C   
4697 O  O   . LYS B  285 ? 2.2062 1.8228 1.8445 0.0497  -0.0305 0.1873  1059 LYS B O   
4698 C  CB  . LYS B  285 ? 2.2143 1.8330 1.8270 0.0802  -0.0188 0.1693  1059 LYS B CB  
4699 N  N   . ASP B  286 ? 2.1240 1.7902 1.8211 0.0519  -0.0124 0.1846  1060 ASP B N   
4700 C  CA  . ASP B  286 ? 2.1073 1.7852 1.8259 0.0423  -0.0102 0.1933  1060 ASP B CA  
4701 C  C   . ASP B  286 ? 2.1472 1.8247 1.8843 0.0280  -0.0194 0.1958  1060 ASP B C   
4702 O  O   . ASP B  286 ? 2.1403 1.8122 1.8786 0.0189  -0.0239 0.2033  1060 ASP B O   
4703 C  CB  . ASP B  286 ? 2.1091 1.8182 1.8615 0.0450  0.0028  0.1947  1060 ASP B CB  
4704 N  N   . PHE B  287 ? 2.1008 1.7848 1.8524 0.0261  -0.0220 0.1898  1061 PHE B N   
4705 C  CA  . PHE B  287 ? 2.0937 1.7789 1.8624 0.0138  -0.0304 0.1914  1061 PHE B CA  
4706 C  C   . PHE B  287 ? 2.1792 1.8352 1.9158 0.0094  -0.0438 0.1937  1061 PHE B C   
4707 O  O   . PHE B  287 ? 2.1728 1.8251 1.9168 -0.0019 -0.0512 0.1996  1061 PHE B O   
4708 C  CB  . PHE B  287 ? 2.0990 1.8001 1.8903 0.0144  -0.0286 0.1840  1061 PHE B CB  
4709 C  CG  . PHE B  287 ? 2.1078 1.8104 1.9140 0.0034  -0.0370 0.1848  1061 PHE B CG  
4710 C  CD1 . PHE B  287 ? 2.1260 1.8450 1.9637 -0.0059 -0.0360 0.1894  1061 PHE B CD1 
4711 C  CD2 . PHE B  287 ? 2.1403 1.8288 1.9295 0.0025  -0.0462 0.1812  1061 PHE B CD2 
4712 C  CE1 . PHE B  287 ? 2.1299 1.8517 1.9815 -0.0152 -0.0432 0.1903  1061 PHE B CE1 
4713 C  CE2 . PHE B  287 ? 2.1675 1.8595 1.9710 -0.0076 -0.0536 0.1827  1061 PHE B CE2 
4714 C  CZ  . PHE B  287 ? 2.1270 1.8361 1.9615 -0.0159 -0.0516 0.1872  1061 PHE B CZ  
4715 N  N   . ARG B  288 ? 2.1624 1.7975 1.8635 0.0185  -0.0473 0.1893  1062 ARG B N   
4716 C  CA  . ARG B  288 ? 2.1836 1.7879 1.8496 0.0162  -0.0609 0.1910  1062 ARG B CA  
4717 C  C   . ARG B  288 ? 2.2418 1.8321 1.8936 0.0110  -0.0647 0.2000  1062 ARG B C   
4718 O  O   . ARG B  288 ? 2.2421 1.8166 1.8849 0.0013  -0.0764 0.2055  1062 ARG B O   
4719 C  CB  . ARG B  288 ? 2.2057 1.7920 1.8375 0.0291  -0.0625 0.1838  1062 ARG B CB  
4720 N  N   . HIS B  289 ? 2.1977 1.7955 1.8496 0.0168  -0.0547 0.2021  1063 HIS B N   
4721 C  CA  . HIS B  289 ? 2.2034 1.7909 1.8438 0.0125  -0.0564 0.2106  1063 HIS B CA  
4722 C  C   . HIS B  289 ? 2.2278 1.8300 1.9013 -0.0017 -0.0575 0.2183  1063 HIS B C   
4723 O  O   . HIS B  289 ? 2.2286 1.8164 1.8918 -0.0096 -0.0647 0.2260  1063 HIS B O   
4724 C  CB  . HIS B  289 ? 2.2142 1.8087 1.8468 0.0234  -0.0444 0.2105  1063 HIS B CB  
4725 N  N   . GLY B  290 ? 2.1554 1.7849 1.8675 -0.0046 -0.0509 0.2160  1064 GLY B N   
4726 C  CA  . GLY B  290 ? 2.1307 1.7768 1.8777 -0.0167 -0.0514 0.2217  1064 GLY B CA  
4727 C  C   . GLY B  290 ? 2.1664 1.7988 1.9103 -0.0282 -0.0644 0.2264  1064 GLY B C   
4728 O  O   . GLY B  290 ? 2.1527 1.7905 1.9148 -0.0384 -0.0669 0.2336  1064 GLY B O   
4729 N  N   . PHE B  291 ? 2.1198 1.7346 1.8408 -0.0265 -0.0731 0.2226  1065 PHE B N   
4730 C  CA  . PHE B  291 ? 2.1137 1.7134 1.8270 -0.0366 -0.0868 0.2273  1065 PHE B CA  
4731 C  C   . PHE B  291 ? 2.1522 1.7189 1.8236 -0.0362 -0.0969 0.2319  1065 PHE B C   
4732 O  O   . PHE B  291 ? 2.1558 1.7102 1.8229 -0.0466 -0.1068 0.2403  1065 PHE B O   
4733 C  CB  . PHE B  291 ? 2.1342 1.7369 1.8506 -0.0356 -0.0908 0.2209  1065 PHE B CB  
4734 N  N   . ASP B  292 ? 2.0881 1.6404 1.7288 -0.0241 -0.0946 0.2265  1066 ASP B N   
4735 C  CA  . ASP B  292 ? 2.0938 1.6131 1.6907 -0.0210 -0.1037 0.2289  1066 ASP B CA  
4736 C  C   . ASP B  292 ? 2.1232 1.6360 1.7163 -0.0269 -0.1042 0.2382  1066 ASP B C   
4737 O  O   . ASP B  292 ? 2.1376 1.6245 1.7056 -0.0325 -0.1165 0.2444  1066 ASP B O   
4738 C  CB  . ASP B  292 ? 2.1208 1.6324 1.6914 -0.0049 -0.0977 0.2203  1066 ASP B CB  
4739 C  CG  . ASP B  292 ? 2.2010 1.6795 1.7292 0.0000  -0.1105 0.2174  1066 ASP B CG  
4740 O  OD1 . ASP B  292 ? 2.1953 1.6688 1.7238 -0.0040 -0.1197 0.2155  1066 ASP B OD1 
4741 O  OD2 . ASP B  292 ? 2.2685 1.7263 1.7627 0.0082  -0.1116 0.2170  1066 ASP B OD2 
4742 N  N   . ILE B  293 ? 2.0407 1.5772 1.6597 -0.0263 -0.0916 0.2397  1067 ILE B N   
4743 C  CA  . ILE B  293 ? 2.0265 1.5619 1.6480 -0.0325 -0.0907 0.2486  1067 ILE B CA  
4744 C  C   . ILE B  293 ? 2.0418 1.5787 1.6841 -0.0482 -0.0994 0.2571  1067 ILE B C   
4745 O  O   . ILE B  293 ? 2.0476 1.5687 1.6773 -0.0553 -0.1063 0.2656  1067 ILE B O   
4746 C  CB  . ILE B  293 ? 2.0491 1.6112 1.6945 -0.0276 -0.0751 0.2480  1067 ILE B CB  
4747 N  N   . LEU B  294 ? 1.9586 1.5145 1.6322 -0.0534 -0.0992 0.2550  1068 LEU B N   
4748 C  CA  . LEU B  294 ? 1.9359 1.4964 1.6318 -0.0673 -0.1068 0.2625  1068 LEU B CA  
4749 C  C   . LEU B  294 ? 1.9870 1.5200 1.6563 -0.0736 -0.1229 0.2672  1068 LEU B C   
4750 O  O   . LEU B  294 ? 1.9796 1.5074 1.6555 -0.0852 -0.1311 0.2766  1068 LEU B O   
4751 C  CB  . LEU B  294 ? 1.9113 1.5012 1.6475 -0.0694 -0.1009 0.2581  1068 LEU B CB  
4752 C  CG  . LEU B  294 ? 1.9460 1.5556 1.7198 -0.0797 -0.0990 0.2645  1068 LEU B CG  
4753 C  CD1 . LEU B  294 ? 1.9224 1.5630 1.7330 -0.0761 -0.0876 0.2579  1068 LEU B CD1 
4754 C  CD2 . LEU B  294 ? 1.9716 1.5753 1.7511 -0.0913 -0.1108 0.2713  1068 LEU B CD2 
4755 N  N   . VAL B  295 ? 1.9492 1.4649 1.5893 -0.0661 -0.1281 0.2612  1069 VAL B N   
4756 C  CA  . VAL B  295 ? 1.9616 1.4491 1.5731 -0.0710 -0.1446 0.2654  1069 VAL B CA  
4757 C  C   . VAL B  295 ? 2.0302 1.4890 1.6092 -0.0730 -0.1524 0.2726  1069 VAL B C   
4758 O  O   . VAL B  295 ? 2.0373 1.4786 1.6067 -0.0833 -0.1659 0.2817  1069 VAL B O   
4759 C  CB  . VAL B  295 ? 2.0150 1.4927 1.6059 -0.0622 -0.1482 0.2565  1069 VAL B CB  
4760 C  CG1 . VAL B  295 ? 2.0324 1.4765 1.5878 -0.0662 -0.1665 0.2613  1069 VAL B CG1 
4761 C  CG2 . VAL B  295 ? 1.9934 1.4977 1.6169 -0.0634 -0.1435 0.2514  1069 VAL B CG2 
4762 N  N   . GLY B  296 ? 1.9816 1.4378 1.5461 -0.0634 -0.1435 0.2692  1070 GLY B N   
4763 C  CA  . GLY B  296 ? 1.9908 1.4225 1.5251 -0.0637 -0.1484 0.2753  1070 GLY B CA  
4764 C  C   . GLY B  296 ? 2.0145 1.4534 1.5707 -0.0768 -0.1496 0.2862  1070 GLY B C   
4765 O  O   . GLY B  296 ? 2.0274 1.4422 1.5633 -0.0844 -0.1616 0.2948  1070 GLY B O   
4766 N  N   . GLN B  297 ? 1.9297 1.4014 1.5281 -0.0797 -0.1380 0.2860  1071 GLN B N   
4767 C  CA  . GLN B  297 ? 1.9068 1.3901 1.5325 -0.0918 -0.1378 0.2955  1071 GLN B CA  
4768 C  C   . GLN B  297 ? 1.9427 1.4226 1.5811 -0.1049 -0.1502 0.3029  1071 GLN B C   
4769 O  O   . GLN B  297 ? 1.9370 1.4134 1.5837 -0.1159 -0.1558 0.3129  1071 GLN B O   
4770 C  CB  . GLN B  297 ? 1.8967 1.4156 1.5635 -0.0900 -0.1228 0.2921  1071 GLN B CB  
4771 N  N   . ILE B  298 ? 1.8893 1.3709 1.5293 -0.1038 -0.1545 0.2983  1072 ILE B N   
4772 C  CA  . ILE B  298 ? 1.8798 1.3596 1.5305 -0.1152 -0.1662 0.3052  1072 ILE B CA  
4773 C  C   . ILE B  298 ? 1.9367 1.3810 1.5512 -0.1213 -0.1830 0.3141  1072 ILE B C   
4774 O  O   . ILE B  298 ? 1.9229 1.3632 1.5464 -0.1335 -0.1914 0.3251  1072 ILE B O   
4775 C  CB  . ILE B  298 ? 1.9111 1.4041 1.5728 -0.1115 -0.1654 0.2977  1072 ILE B CB  
4776 N  N   . ASP B  299 ? 1.9118 1.3297 1.4851 -0.1125 -0.1881 0.3094  1073 ASP B N   
4777 C  CA  . ASP B  299 ? 1.9343 1.3145 1.4676 -0.1163 -0.2048 0.3163  1073 ASP B CA  
4778 C  C   . ASP B  299 ? 1.9984 1.3649 1.5218 -0.1221 -0.2072 0.3253  1073 ASP B C   
4779 O  O   . ASP B  299 ? 2.0097 1.3519 1.5153 -0.1314 -0.2223 0.3353  1073 ASP B O   
4780 C  CB  . ASP B  299 ? 1.9749 1.3319 1.4674 -0.1033 -0.2078 0.3073  1073 ASP B CB  
4781 C  CG  . ASP B  299 ? 2.0839 1.4399 1.5739 -0.1017 -0.2146 0.3028  1073 ASP B CG  
4782 O  OD1 . ASP B  299 ? 2.1033 1.4400 1.5799 -0.1102 -0.2312 0.3104  1073 ASP B OD1 
4783 O  OD2 . ASP B  299 ? 2.1462 1.5208 1.6477 -0.0923 -0.2038 0.2922  1073 ASP B OD2 
4784 N  N   . ASP B  300 ? 1.9447 1.3268 1.4797 -0.1169 -0.1929 0.3222  1074 ASP B N   
4785 C  CA  . ASP B  300 ? 1.9467 1.3205 1.4761 -0.1219 -0.1928 0.3301  1074 ASP B CA  
4786 C  C   . ASP B  300 ? 1.9823 1.3668 1.5432 -0.1378 -0.1979 0.3416  1074 ASP B C   
4787 O  O   . ASP B  300 ? 1.9895 1.3537 1.5363 -0.1465 -0.2081 0.3518  1074 ASP B O   
4788 C  CB  . ASP B  300 ? 1.9588 1.3527 1.4989 -0.1127 -0.1753 0.3240  1074 ASP B CB  
4789 C  CG  . ASP B  300 ? 2.0767 1.4576 1.5816 -0.0969 -0.1699 0.3147  1074 ASP B CG  
4790 O  OD1 . ASP B  300 ? 2.0954 1.4525 1.5680 -0.0914 -0.1790 0.3108  1074 ASP B OD1 
4791 O  OD2 . ASP B  300 ? 2.1415 1.5364 1.6514 -0.0899 -0.1568 0.3118  1074 ASP B OD2 
4792 N  N   . ALA B  301 ? 1.9101 1.3259 1.5132 -0.1412 -0.1913 0.3399  1075 ALA B N   
4793 C  CA  . ALA B  301 ? 1.8867 1.3168 1.5238 -0.1548 -0.1949 0.3496  1075 ALA B CA  
4794 C  C   . ALA B  301 ? 1.9387 1.3506 1.5648 -0.1643 -0.2120 0.3581  1075 ALA B C   
4795 O  O   . ALA B  301 ? 1.9482 1.3602 1.5894 -0.1767 -0.2193 0.3694  1075 ALA B O   
4796 C  CB  . ALA B  301 ? 1.8679 1.3358 1.5498 -0.1532 -0.1825 0.3436  1075 ALA B CB  
4797 N  N   . LEU B  302 ? 1.8749 1.2712 1.4750 -0.1587 -0.2189 0.3533  1076 LEU B N   
4798 C  CA  . LEU B  302 ? 1.8703 1.2477 1.4565 -0.1669 -0.2363 0.3614  1076 LEU B CA  
4799 C  C   . LEU B  302 ? 1.9096 1.2501 1.4600 -0.1730 -0.2509 0.3714  1076 LEU B C   
4800 O  O   . LEU B  302 ? 1.8999 1.2304 1.4525 -0.1855 -0.2643 0.3839  1076 LEU B O   
4801 C  CB  . LEU B  302 ? 1.8788 1.2506 1.4475 -0.1585 -0.2392 0.3527  1076 LEU B CB  
4802 N  N   . LYS B  303 ? 1.8636 1.1852 1.3821 -0.1639 -0.2477 0.3662  1077 LYS B N   
4803 C  CA  . LYS B  303 ? 1.8747 1.1607 1.3559 -0.1673 -0.2596 0.3737  1077 LYS B CA  
4804 C  C   . LYS B  303 ? 1.8742 1.1656 1.3766 -0.1802 -0.2608 0.3858  1077 LYS B C   
4805 O  O   . LYS B  303 ? 1.8738 1.1391 1.3573 -0.1897 -0.2759 0.3971  1077 LYS B O   
4806 C  CB  . LYS B  303 ? 1.9251 1.1974 1.3736 -0.1529 -0.2520 0.3640  1077 LYS B CB  
4807 N  N   . LEU B  304 ? 1.7900 1.1151 1.3322 -0.1806 -0.2457 0.3837  1078 LEU B N   
4808 C  CA  . LEU B  304 ? 1.7726 1.1079 1.3409 -0.1922 -0.2451 0.3940  1078 LEU B CA  
4809 C  C   . LEU B  304 ? 1.8014 1.1463 1.3978 -0.2057 -0.2543 0.4045  1078 LEU B C   
4810 O  O   . LEU B  304 ? 1.7977 1.1319 1.3963 -0.2176 -0.2636 0.4170  1078 LEU B O   
4811 C  CB  . LEU B  304 ? 1.7519 1.1190 1.3520 -0.1874 -0.2265 0.3877  1078 LEU B CB  
4812 C  CG  . LEU B  304 ? 1.8208 1.1838 1.3983 -0.1745 -0.2156 0.3787  1078 LEU B CG  
4813 C  CD1 . LEU B  304 ? 1.7975 1.1951 1.4117 -0.1710 -0.1984 0.3737  1078 LEU B CD1 
4814 C  CD2 . LEU B  304 ? 1.8855 1.2169 1.4261 -0.1768 -0.2236 0.3855  1078 LEU B CD2 
4815 N  N   . ALA B  305 ? 1.7380 1.1027 1.3550 -0.2037 -0.2519 0.3998  1079 ALA B N   
4816 C  CA  . ALA B  305 ? 1.7251 1.1016 1.3687 -0.2150 -0.2597 0.4092  1079 ALA B CA  
4817 C  C   . ALA B  305 ? 1.8130 1.1565 1.4268 -0.2241 -0.2804 0.4213  1079 ALA B C   
4818 O  O   . ALA B  305 ? 1.7978 1.1416 1.4271 -0.2369 -0.2895 0.4346  1079 ALA B O   
4819 C  CB  . ALA B  305 ? 1.7171 1.1194 1.3825 -0.2091 -0.2526 0.4004  1079 ALA B CB  
4820 N  N   . ASN B  306 ? 1.8030 1.1175 1.3740 -0.2171 -0.2882 0.4168  1080 ASN B N   
4821 C  CA  . ASN B  306 ? 1.8266 1.1050 1.3623 -0.2236 -0.3089 0.4265  1080 ASN B CA  
4822 C  C   . ASN B  306 ? 1.9042 1.1563 1.4217 -0.2326 -0.3189 0.4382  1080 ASN B C   
4823 O  O   . ASN B  306 ? 1.9031 1.1366 1.4123 -0.2442 -0.3360 0.4518  1080 ASN B O   
4824 C  CB  . ASN B  306 ? 1.8286 1.0833 1.3230 -0.2115 -0.3126 0.4163  1080 ASN B CB  
4825 C  CG  . ASN B  306 ? 2.0447 1.3153 1.5485 -0.2058 -0.3103 0.4085  1080 ASN B CG  
4826 O  OD1 . ASN B  306 ? 1.9374 1.2260 1.4679 -0.2136 -0.3139 0.4146  1080 ASN B OD1 
4827 N  ND2 . ASN B  306 ? 1.9527 1.2164 1.4335 -0.1919 -0.3046 0.3950  1080 ASN B ND2 
4828 N  N   . GLU B  307 ? 1.8701 1.1211 1.3816 -0.2273 -0.3086 0.4334  1081 GLU B N   
4829 C  CA  . GLU B  307 ? 1.8837 1.1116 1.3784 -0.2349 -0.3161 0.4433  1081 GLU B CA  
4830 C  C   . GLU B  307 ? 1.9326 1.1837 1.4696 -0.2473 -0.3125 0.4534  1081 GLU B C   
4831 O  O   . GLU B  307 ? 1.9391 1.1830 1.4732 -0.2513 -0.3114 0.4582  1081 GLU B O   
4832 C  CB  . GLU B  307 ? 1.9134 1.1281 1.3783 -0.2231 -0.3074 0.4338  1081 GLU B CB  
4833 N  N   . GLY B  308 ? 1.8739 1.1524 1.4492 -0.2528 -0.3109 0.4565  1082 GLY B N   
4834 C  CA  . GLY B  308 ? 1.8530 1.1556 1.4711 -0.2637 -0.3080 0.4657  1082 GLY B CA  
4835 C  C   . GLY B  308 ? 1.8935 1.2193 1.5377 -0.2609 -0.2918 0.4604  1082 GLY B C   
4836 O  O   . GLY B  308 ? 1.8776 1.2138 1.5486 -0.2709 -0.2923 0.4696  1082 GLY B O   
4837 N  N   . LYS B  309 ? 1.8554 1.1895 1.4926 -0.2473 -0.2778 0.4461  1083 LYS B N   
4838 C  CA  . LYS B  309 ? 1.8398 1.1976 1.5012 -0.2431 -0.2617 0.4400  1083 LYS B CA  
4839 C  C   . LYS B  309 ? 1.8833 1.2791 1.5856 -0.2383 -0.2494 0.4316  1083 LYS B C   
4840 O  O   . LYS B  309 ? 1.8797 1.2866 1.5796 -0.2261 -0.2386 0.4187  1083 LYS B O   
4841 C  CB  . LYS B  309 ? 1.8754 1.2199 1.5039 -0.2309 -0.2542 0.4302  1083 LYS B CB  
4842 C  CG  . LYS B  309 ? 1.9720 1.2767 1.5546 -0.2333 -0.2665 0.4368  1083 LYS B CG  
4843 C  CD  . LYS B  309 ? 2.0681 1.3543 1.6090 -0.2188 -0.2639 0.4256  1083 LYS B CD  
4844 N  N   . VAL B  310 ? 1.8234 1.2380 1.5620 -0.2479 -0.2519 0.4392  1084 VAL B N   
4845 C  CA  . VAL B  310 ? 1.7920 1.2418 1.5701 -0.2446 -0.2421 0.4327  1084 VAL B CA  
4846 C  C   . VAL B  310 ? 1.8014 1.2776 1.6058 -0.2374 -0.2253 0.4228  1084 VAL B C   
4847 O  O   . VAL B  310 ? 1.7867 1.2794 1.5978 -0.2268 -0.2149 0.4106  1084 V